2FMJA

220-loop mutant of streptomyces griseus trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
b'VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Conversion of trypsin into a Na(+)-activated enzyme.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA02
1DFPA 3EGKH 4OS4A 1SGIB 1O3PB 3B23B 4YT7H 1DSTA 4CRDA 4A1VA 1DXWA 3SJ8A 4B2CA 5DGJA 3RMOH 3M5OA 1C5MD 2Z6BD 2K1QA 2PKAB 1Y3VA 4RKOB 1SGCA 4UFGH 5C5OA 2VVUA 1BMNH 1C1NA 1V2MT 1CVWH 2WPHS 1KTSB 3UPEA 4F49A 3A8AA 3S0NA 3V7TA 1DDJA 2ZGCA 3TIUA 1C1UH 1ETSH 2ZEBA 4AFZA 2FLRH 5AF9H 1O32A 1M9UA 1SGFG 2HPPH 1DPOA 1GPZA 4GPGA 2XWAA 3SU1A 3TNSA 2BLVA 8GCHG 1HAPH 3RC6A 3L6PA 4O97A 1QQ4A 1TONA 1SPJA 1NROH 4AB9A 1PPHE 1AE5A 1QJ1B 3FAOA 2HNTE 1OWHA 3OU0A 1KLTA 1MUEB 1C1RA 5IYTA 2RG3A 2SGAA 2Y6TA 4AORA 1TRMA 1UO6A 1E36B 4OS5A 2DE8A 3K6ZA 1SLUB 1WSSH 2QV1A 1WQVH 3H7OA 1P2NA 3SNBA 5T6FA 3RU4T 3ZZ9A 2VB0A 3GCHB 1V2WT 1MTSA 1TAWA 3SU5A 1O2MA 5PTPA 1ZHMA 3DHKH 4X8UH 1HJ9A 2FESH 5AVDA 1KYNA 2BVRH 1K21H 3KQCA 1O3MA 3P8FA 2I6SA 1BITA 1QRZA 4HGCA 4BAQB 2A4OA 1C4U2 3SV8A 4NSVA 5F8TA 5E2PA 1PJPA 1OWJA 1TFXA 1P2MA 2AMPA 1EZUC 4WF8A 4RSPA 2PKSB 1C1TA 1S6FA 2R9PA 3DFJA 3SQHE 1GHAG 1QQUA 1F0TA 1HJ8A 3S9CA 3KIDU 4K8BA 5J4SA 1MTNB 2ZA5A 2SGDE 4FUIA 5FPYA 1YM0A 2ZPQA 2ILNA 4DG4A 4X2XA 3LGIA 2VIQA 1K1OA 1G2LA 1HYLA 1V2VT 1SGPE 4FU7A 1SQAA 5JBTA 3RXKA 2BDBA 3S9BA 3K6YA 6LPRA 1NFXA 3GDVA 1C2KA 1HXEH 1GBLA 1MAYA 1PYTC 1W0YH 2SGPE 4JZIA 1DLEA 3GICB 4CR5A 1QY6A 1TGBA 3DA9B 3S69A 2JETB 2Y5HA 1TRNA 2QYIA 2W5EA 1MZDA 4BAMB 2W3IA 2J2UA 5GXPA 1PQ8A 2FYQA 3A7VA 3BIUH 1TGCA 4WH8A 4VGCC 1NESE 5FX6A 3EA8A 2AMDA 2VIWA 1TYNA 4AOQA 4MVNA 3KNXA 2NU0E 1O3EA 4I8GA 2Q1JA 1CU1A 2ZTYA 1BJUA 3GY3A 2P94A 3BTEE 3D49H 3SJIA 2ZWLH 4X2WA 3MHWU 1C2IA 1CT4E 3ODFA 2OCVB 1K9OE 4E7NA 1SGEE 4Y0YE 2H5DA 5E8EH 1AWHB 1BRBE 1HRTH 1A61H 1PYTD 3OX7U 2RCEA 1D4PB 1BBRH 1BB0B 4FUEA 2KAIA 1V2ST 3ZZBA 2GDEH 1ESBA 3ZZCA 1F0SA 2FO9A 1DANH 4AFQA 2TIOA 3UTUH 2AH4X 2VWMA 5JDUB 4GHQA 4H42U 1O2TA 1HNEE 1GI4A 3RXFA 3A7YA 1BMMH 1P09A 2GMTB 2R3YA 1ELAA 3RXDA 3GCTG 2FODA 4IMQA 3QGJA 1WQSA 2XYAA 1ZR0A 4AFUA 2I6QA 3SNDA 3VEQB 2V0BA 3P8GA 3EDXB 3L3TA 3EE0B 4Z0KA 1WOFA 2GCTB 1YLCA 1DUAA 1KXAA 1D3DB 1P2KA 3TU7H 1V2UT 2PUQH 2FLBH 3RLWH 1ZPZA 3HKJB 1JOUB 3SV7A 1AUJA 3RMMH 1G9IE 3MWIU 3SU6A 1C1OA 1ANCA 1HB0B 2RA0A 2QXHA 3FFGA 1UVPA 1AY6H 3KQEA 3T62A 3S7HB 1UTOA 1YBWA 1CBWB 1FQ3A 2FZZA 3E6PH 1O2VA 1TA2A 2ZHQH 1Y8TA 1DVAH 4JZ1A 1UTMA 2OINA 2WV5A 1A3BH 1DM4B 5F8ZA 3GCHC 4E7RG 1AD8H 1CT2E 1TA6A 4X8VH 2A2XH 2NU4E 3Q3XA 4K5ZA 3P92A 1O34A 1O3HA 1THRH 1ZPCA 2OC7A 1XKBC 4ZUHA 1BTZA 1ANDA 1AWFH 3QK1A 4CHAB 3U1JB 4UFEH 2C8YB 2ZU1A 3QGNB 4FVDA 1O5GH 2FS9A 3SO3A 1UK3A 2ANWA 3MOCA 2PKSC 3A84A 5E0GA 3O8CA 1C5XB 1ZMLA 1HPGA 3TJNA 4CRCA 3AASA 1A1RA 1P9UA 2JH0D 2ALPA 2ZDAH 2P59A 3CS0A 3MH5A 3MH4A 2B0FA 1MTNC 1L1GA 1TRYA 2VVVA 1D3QB 3BG8A 1QIXB 1YPEH 1TMUH 4U01A 3A82A 1N8OB 2J4IA 1ID5H 1ZSKA 2SNVA 3FVFB 4X0WU 1QJ7B 1HCGA 2Y7XA 1BA8B 2STBE 2JH5D 1ZHRA 2CJIA 1J17T 4MPXA 1SVPA 1MU8B 1BBRK 1ZTJA 5LPFA 4ISLA 4Y11E 1FY8E 1QB6A 1ZZZA 3SJOA 3RM2H 2A32A 2JETC 4WWYA 3TJVA 1ACBE 2A31A 1AZZA 3NCLA 2FOHA 3F9EA 1HBTH 3M7QA 1NFWA 1UTLM 3UNSA 2Z94A 1C2LA 2GD4B 2OC1A 2ULLA 5ETXA 1KDQB 2Q6GA 5FXLA 3GCNA 4U30A 2XNIA 1EJNA 1Z1JA 4FXGH 4I33A 4Y7AA 1ZTLA 4UFFH 1FDPA 1Z6EA 1QL7A 1IHSH 2QXIA 5BPEA 1C2GA 2GTBA 3A89A 5DK1A 3PMJA 3I29A 7LPRA 1MCVA 1GL0E 1EXFA 4PROA 3ATLA 4DURA 1TBQH 2GV6A 2WUCA 2QCYA 1LKAA 4OS7A 2GZ8A 1TBRH 1V2NT 4CRFA 1O2QA 4YT6H 1BRAA 1T31A 2QN5T 3A83A 2G51A 4CH2B 2O8UA 2AERH 2ZHFH 1GMHF 3ZVAA 2D26C 2GMTC 1HAHH 2BD7A 1E0FD 2F9PA 3EA9A 3RDZA 4D76A 2BD8A 1BTPA 2A4GA 3TNTA 1EP5A 4XSKU 4X6NA 5EXMA 1J8AA 4BAKB 1GDUA 4Q7XA 1LHGH 1V2JT 4XBBA 1OP0A 4ZXXH 1HV7A 3BV9B 1ETTH 3LH1A 1QB1A 1THPB 1Q2WA 2GCTC 4DGJA 2BZ6H 1OYTH 4CBOA 3UWIA 2BVSH 2OC0A 4A1XA 1ZLRA 1O3OA 3U69H 4Y79A 1XUHA 2BYAX 1Z1IA 2A2QH 2Y80A 3QN7A 2H9EH 2UWPA 1EB2A 1GMHG 1QGFA 1MBQA 1PPCE 3HK6B 4NIWA 2ZDKA 3VPKA 1K28D 1CHOG 2CF9H 1NY22 1IQHA 3FP7E 1LVOA 2PSXA 1Y3YA 1Z6JH 4ZKRU 2HRVA 1SOZA 1JIMA 2VIPA 1EPTA 1MU6B 2C4FH 1GI6A 3TK9A 1LHCH 1DITH 3RU4D 3UQVA 1F5RA 2A0QB 1GI1A 2VH6A 1GHBG 4CREA 2XW9A 4UDWH 1HJAB 1W14U 3MFJA 4CHAC 3BEFB 2SGFE 1EJAA 4WXIA 3F9FA 4MNVA 2BMGB 2WPMS 2B9LA 4BTUB 4ZKSU 4MG3A 4FUBA 2BOHB 1GMDF 3RXAA 4QT8C 1C9PA 3ZV8A 2ZDNA 1MTUA 1L0ZA 1ELBA 2AIQA 4Y71A 3UUZA 2P93A 1B0FA 4LOYH 1EJMA 1O5CB 1YKTA 3E1XB 3ATKA 1ARBA 4E05H 1OWDA 1S0RA 1NS3A 1ORFA 2A5KA 3OY6U 2QXGA 3U1IB 4AB8A 1DSUA 1N8OC 3A86A 3OSYA 1O35A 2YOLA 1D3TB 2F83A 1O3AA 1E37B 1RXPA 2ODYB 2BQ7B 3TGKE 3P17H 3VXEH 4ASHA 3M36A 4Y7BA 1SBWA 1MBMA 1T8NA 3RXGA 4SGAE 1G3BA 4DIHH 1KXCA 1BUIA 2G4TA 1P8VC 4GHTA 1QL8A 1W12U 1BRUP 3ZV9A 1SL3A 4GAWA 1O5FH 1UTNA 4AFSA 1H4WA 3DD2H 1V6DA 5ABWA 3E8LA 1VJAU 1DUEA 3BTTE 2AIPA 3SQEE 1P2QA 4ZROA 3SOSA 2XBYA 4JCNA 1TX7A 4AYYB 5AFYH 3QTOH 1E34B 3KHVA 3PMBB 1X7AC 2ZFSA 1EOLA 3RXVA 2AYWA 2THFB 1FNIA 3AVZA 3PTBA 1B0EA 1OKXA 3W94A 1GVZA 2GT8A 3SGQE 1FZZA 2ZCLP 1C5ZB 1E38B 2CXVA 2PFEA 2ZC9H 5CHAB 4YLQH 1P2JA 4CH8B 4B76A 4X1QU 5T6GA 2B8OH 5K7RA 2BDGA 4NCYA 1GCDA 2H9TH 1LPKB 1D9IA 4DIIH 1OSSA 3PV4A 1W7XH 3WY8A 1YGCH 1FN8A 1T32A 2CGAA 1FY3A 1YPKH 1KLJH 1ELTA 6GCHG 4RKJB 1KIGH 1EP6A 3BEIB 1Z71A 3GCOA 1IQIA 1GDNA 1ZMNA 2B5TB 5A8XA 1T8OA 1YCPH 5LPRA 2VU8E 2WPLS 3GISB 4AYVB 4CBNA 4D7GA 2FTLE 1HAVA 1DX5M 1C2FA 1O2KA 2TRMA 1ELFA 6ESTA 4CRBA 3Q77A 1AFQB 3MU8A 1UCYE 2J34A 2ZFTA 4IN1A 3VB7A 1WU1A 1A4WH 2P8OB 4IC5A 1A7SA 2BY7X 1NFYA 1KY9A 1Z8JB 2G5NA 4FUDA 1P04A 4MNXA 7GCHG 2XTTB 3SU0A 1O5BB 4XFQA 4ABGA 2ZTXA 1IQKA 2G5VA 1TX8A 1ANBA 2BOKA 5EODA 3TH4H 3SHAH 1Z8GA 3PMAB 2PGQB 3GYMA 3LU9B 2F9NA 1B5GH 1GBIA 1VZQH 4D9QA 4K1EA 1A0LA 3QWCH 2IOTA 3FZDA 1GJAB 1HJAC 1O5DH 4IMZA 3HGPA 2FIRH 3TGIE 1ELVA 2EI8A 2ZCHP 1TGTA 3SGAE 4INHA 1DT2A 1YC0A 2FMJA 1Z8IB 3RXTA 2XC5A 4JYUH 4B73A 3F68H 3M3VA 1O2HA 1WUNH 1EAXA 1QA0A 4H6TA 1EASA 2BD2A 5EGMA 4GUXA 1LHDH 5T3HA 3UFAA 1WTHD 1O2YA 1O2ZA 4MLFB 2VH0A 5GDSH 4RN6A 3ZZ8A 2BVXH 1F2SE 3MMGA 1UVOA 3SN8A 2ZECA 2GP9B 1C5YB 1O2XA 1IQLA 5B6OA 2QIQA 5DP8A 1GJ6A 1SFQB 3RXEA 4YTAA 2EI7A 2WUBA 2BZAA 1FIWA 5GCHF 5A8ZA 2C3SA 1QFKH 1SGRE 2VNTA 1DXPA 1MH0A 3F1SB 5GJ4B 3I77A 5F03A 2J9NA 1AQ7A 2SFAA 1AO5A 4ZMAH 1YCPK 1O2UA 3GY8A 3SBKA 2OXSA 3C1KA 2A45B 4YESB 1PFXC 4ZKOU 4TWWA 5DP4A 1HDTH 2VVCA 1KXEA 5HM9A 1ABJH 3GOVB 4XBDA 2O8TA 3D62A 1HAXB 1ZOMA 3EYDA 1BZXE 1TWXB 1C5QA 2A7HA 3CS7A 2OUAA 2ZFFH 3RXQA 4H6SB 1EOJA 1RS0A 1TPOA 1Z8RA 2PSYA 1BT7A 2XBVA 1O3GA 1AE8H 3RM0H 2C90B 4GLYA 4IW4E 4FUHA 2Z3EA 5ESTE 1OYQA 1BRCE 1IQEA 1NM6A 4E06H 1SGFA 4X6OA 4XOJA 3Q76A 2O9QA 3E90B 1TPAE 1AKSA 2YNBA 3U8OH 3ZVBA 1OX1A 1CT0E 3FANA 1A5GH 3LPRA 1BHXB 3MO6A 2F9VA 3QZQA 5C20A 1P02A 1TNJA 2ASUB 2VINA 4JYVH 1O2JA 5A8YA 1AVWA 3BTHE 2IPHA 1JXPA 3AAUA 4WMEA 2WPJS 2OTVA 3PMHB 1EPTB 1FXYA 1AFQC 3SJKA 3M5LA 5IDKA 2P8OC 5A09A 1W7GH 1G3EA 4Q2KA 1E35B 3PLBA 1XUGA 3A8DA 3EAJA 1V2PT 1PQ5A 1SQOA 1O3JA 4NSYA 3GY7A 1SQTA 4BNRA 4K1TA 2CMYA 1NN6A 2V35A 1TLDA 2PGBB 3URCA 3V3MA 2LPRA 1JMOH 1LO6A 4NA7A 2EEKA 4KELA 1EZSC 3RUOA 1A3EH 1DS2E 1L4DA 1VGCB 3TH2H 1GHZA 2P3TB 2OD3B 4X6MA 4ABHA 5EW2H 1T8MA 1C1MA 1TQ0B 4K69A 1F5KU 2ZU4A 4FUCA 3UY9A 1QBVH 2ZHWH 5DP7A 3SV2H 2F3CE 1NRPH 5DP3A 4FVBA 1ZRKA 2FX4A 1Y5UT 6CHAB 2PV9B 1NRQH 3ESTA 4Y6DA 1GBHA 3GY6A 3BTGE 1FJSA 1V2TT 1OWIA 3SNCA 2GGVB 2C8WB 2PR3A 2QF3A 2ZZUH 1P10A 2NWNA 3F9HA 2BDIA 5C1XA 4THNH 3B8JA 1IOEA 4OS1A 2G52A 1ZJKA 2FI4E 1LPGB 3ITIA 4Q80A 3FP8E 1UTPA 3PWBA 1LVMA 5HMAA 5C1YA 2HPQH 3ZYDA 2BLWA 4LZ1H 1P12E 1GBDA 5EXNA 4I32A 1V2OT 2W3KA 3A8BA 4NFFA 1UVSH 3UOUA 1FIZA 1V3XA 1SMFE 4ISNA 1O39A 8LPRA 3T27A 3ZVFA 5L2ZH 1A0JA 1TGNA 1GJBB 2A7CA 3RXUA 3A87A 1GI9B 4NZLA 2XC0A 1WTGH 1XX9A 1CQQA 2HGTH 2ZKSA 3PYHA 4KTUA 4BXSA 1ZSLA 2WYGA 3ZZ5A 1KTTB 1FONA 1SG8B 2BM2A 1NO9H 3BF6H 1GBAA 4ABDA 1JRSA 3M35A 4YOJA 1C2JA 3HKIB 4ZH8A 4BOHA 5JBCS 5JPMH 5C3NA 1Q31A 4INKA 1O3DA 1G36A 3AW1A 1SGNE 1TNLA 2ZF0H 1C4V2 3QDZB 1HAVB 2AEIH 3A85A 2TBSA 4NG9H 3ZVEA 1BHXF 1PQAA 1BTHH 2BY5X 5JYIA 5HXFA 5E0JA 1VITH 1BJVA 1AHTH 1Q3XA 5EQSA 3TITA 3VB6A 2D2DA 3MH7A 3W95A 5C2ZA 3LGYA 1C9TA 2C8XB 5DO4H 1GBBA 1O3BA 5HM2A 1W3CA 2ANKH 4GSOA 1O3FA 4MNYA 1RFNA 1D3PB 1EPTC 2ZGXH 1PPZA 3BIVH 1EX3A 3M3TA 2HNTF 3BTQE 3K65B 3SV9A 1DWDH 3RLYH 1ELGA 3OTJE 1QRWA 1ELDE 9ESTA 5CE1A 4YZUA 1AVGH 2Y81A 1IQFA 4D8NA 3KEEA 2UWOA 1GL1A 1GCTB 2V6NA 2ANMH 3V12A 1SGDE 3F9GA 5E0HA 2VWLA 3DUXH 1TE0A 2ANYA 5FCKA 1KLIH 4IBLH 4BXWA 1O33A 4FUGA 2ZFPH 1DY8A 5FBEA 3U98H 3UOPA 4Q7ZA 1VGCC 1UTQA 1GBEA 1ELEE 3PWCA 1RRKA 3LC5A 2PW8H 3MU1A 1S6HA 2A4QA 1TNKA 5JB9S 1GI2A 1C2HA 3QZRA 3CENA 3SHCH 2ZU3A 3BEUA 3MNCA 1ZSJA 1OXGA 2Z9GA 5A2MH 1P0SH 4X2YA 2A7JA 2ZDMA 1PPBH 1GJDB 3TH3H 1Y3WA 6CHAC 1LKBA 3UR6A 1GG6B 1GJ9B 2BY6X 1JRTA 1A0HB 1C5OH 1SOTA 5I46H 1G37A 5DPAA 1TMBH 1O30A 1MAXA 1O37A 2BDHA 3IG6B 5SGAE 2OQUA 2ZTZA 3D23A 1CBWC 1F0UA 4WXVA 5FAHA 3GDSA 2UUJB 3LJOA 1GBMA 3L33A 3P95A 2BLOA 1H8IH 3NXPA 1RIWB 2A5AA 3QUMP 1W0ZU 3ZYEA 1GBTA 3RXBA 1AUTC 1TIOA 3G01A 4J1YA 4NIYA 4ABEA 1FLEE 4OGXA 4TYDA 3MU0A 1T8LA 3SUGA 4LXBH 4GVUA 3VGCB 2OQ5A 4BTTB 3LC3A 1H9IE 4Q7YA 2ESTE 3SU2A 5C67A 2R0LA 1BCUH 1TB6H 1MKXH 1S0QA 4ZKNU 1ARCA 4MTBA 2FOEA 4DCDA 1GI3A 1EUFA 1S84A 1O3IA 4NFEA 1BIOA 1G32B 1P05A 3GY2A 2P3UB 2FDAA 4XBCA 2HLCA 1QCPA 1YPMH 5FX5A 1EB1H 5H4IB 4Y76A 5BRRE 2OC8A 1OPHB 4I8JA 2ZDVH 1GHVH 1O5AB 5FPTA 1FY5A 3KGPA 1EAUA 2PUXB 1C2EA 2XBXA 3BTFE 1GMDG 3BTDE 1GJ4H 3NPSA 4DVAU 3A81A 1KXBA 1VR1H 3KL6A 3SGBE 4KP0A 5EPYA 5EPNA 5L30H 1NZQH 2OBQA 1O2RA 1XVOA 1GI5A 1NU7B 2VIOA 4F4OC 2R2WU 1RJXB 4OGYA 2BX3A 4B74A 3LOXA 3UWJH 1CGHA 3PB1E 3ZVCA 1O3KA 1HXFH 1N6YA 3P70B 1QTFA 2Q6DA 2PWXA 3S7KB 2KAIB 5DP9A 4A6LA 4MDSA 4TY7A 4XE4A 2XWBI 1XUJA 1MQ6A 4JK5A 2A4RA 2R0KA 1HAOH 2AGGX 4WVPE 1CHGA 2BXUH 3SORA 1GHYH 3A80A 5DP6A 4ISOA 1AZ8A 5FPSA 2UUFB 1VITF 3M37A 5A0AE 1L1JA 1GCTC 4D9RA 4NA9H 2F91A 1NRRH 2J95A 3ZZDA 1GI8B 1S81A 2XCFA 1SB1H 4TY6A 3VXFH 2Y5GA 4I31A 1AIXH 4ZAEA 1K1LA 3SUFA 2LNCA 2ZO3H 3UQOA 1Z7KA 4Y8XA 2F9BH 2VWOA 2AFQB 5F6MA 1GJCB 4JK6A 1UTKA 2FTMA 3RMNH 1BQYA 3TLOA 1C1SA 1W13U 2AGIX 1UK2A 1KXDA 4IS5A 2HALA 1XUIA 2ALVA 4J2YB 1W2KH 2PLXA 2FOCA 3KQBA 2XC4A 3MU4A 3LH3A 1O2SA 1SLWB 2ZI2H 1Y5BT 1GG6C 3A8CA 3RXIA 1LQDB 1MKXK 1MMJN 2H1UA 2Z9JA 1NTPA 2ODQA 1P9SA 3LDXH 1O2OA 1LHEH 2VGCB 2Q6FA 1MZAA 1JBUH 1DLKB 2QY0B 1J15A 3BTME 5EG4A 1RGQA 3M7UA 1AN1E 3URDA 1BOQA 7ESTE 1SHYA 5C1UA 1C4Y2 2ZCKP 5EXLA 2FEQH 1RIWC 5TCCA 1RTFB 1UHBA 4ESTE 1K1IA 2TGPZ 2O8LA 3BSQA 3Q3YA 1A5IA 5HGGA 5I25A 2HVXA 2TPIZ 1P3EA 3SI3H 3VGCC 4INLA 4WMDA 1KDQA 2TGAA 2P16A 1IQJA 4IN2A 1DWBH 1F7ZA 1O2GH 3K9XB 4ISIH 1PPEE 3KN2A 1C1PA 4O03A 8GCHF 3E3TA 1EQ9A 1LVYA 1ZGVA 4K2YA 4ABAA 1XUFA 2GDDA 2Z9IA 1H9HE 1YCPM 3DFLA 1P03A 4H4FA 1SFIA 3AAVA 3DT0H 4NIVA 1EAIA 4BANB 1K22H 1SGQE 1UCYH 1IQMA 3QX5H 3BTWE 4OS2A 1A2CH 2C8ZB 1V2RT 1ZTKA 2PHBA 2FOMB 4ABJA 4A1TA 2ZDLA 3JZ1B 4FU8A 1TNGA 1EAWA 1MKWH 1O3LA 2FM2A 2JH6D 3A88A 4O9VA 4AN7A 4KTSA 1DY9A 3LT3A 2IJOB 1GBFA 4HZHA 2FOBA 1C1QA 1FY4A 2ZPRA 1AB9B 2GKVE 1C1VH 2G81E 3RXLA 2BQWB 4JZFH 2GZ9A 1GHAF 2J92A 3OY5U 4K3JA 2W7SA 1UMAH 2BB4A 1FMGA 1BMAA 2ZU5A 3T25A 1A46H 1SGTA 2C93B 1C5VA 5TJXA 1SLXB 1GGDB 3MU5A 3LGTA 3T5FH 2BLQA 2ZG0H 1BMLA 5GCHG 1DE7H 5CHAC 1MD7A 1QA7A 3RU4E 1Y3XA 3C27B 4OS6A 4SGBE 5LGOA 4X1SU 1AFEH 1BTYA 1S85A 3SUDA 2ZGJA 4FU9A 3S9AA 4K60A 5F8XA 2M5TA 3R0FA 2ZFRH 2O8MA 5C5NA 3SU4A 1WCZA 3RC5A 1BBRE 4KTCA 4ABFA 1C5SA 1AI8H 1GBKA 1TOCB 1O38A 1P2OA 4WY3A 1EZXC 2Z3CA 3U8TH 1WV7H 2EA3A 1OWKA 1GVLA 2H6MA 2VIDA 1YPHC 2XRCA 4MPWA 1H8DH 4D7FA 2DE9A 3M5MA 5J4QA 1QRXA 1F92A 3LGWA 2TGTA 1DICA 2VGCC 1O2LA 4ZHLU 2SGQE 3U9AH 1NRSH 5LH8A 1J16A 1NFUA 1ELCA 2WPIS 1O31A 4NA8A 3MNSA 3SW2B 1O2IA 4TWYA 1Y5AT 4ZXYH 2PTNA 4DW2U 1YYY1 1AU8A 3H5CB 1DWCH 1O3CA 1UVTH 2FI5E 4UD9H 1UCYK 5K0HA 1MTWA 1CE5A 3GCTF 9LPRA 1GWAA 5EU8A 1TBZH 3N7OA 3TPIZ 1P11E 1QL9A 5HYOA 2W26A 3RXJA 3T28A 1MKWK 4MNWA 2SGEE 2ODPA 4JZEH 4Y8YA 3T26A 1Y3UA 4YO9A 1XXDA 2A1DB 4LZ4B 1SLVB 1BDAA 1C5NH 1TABE 3PLPA 2GZ7A 4DJZB 1C5PA 1XVMA 3UREA 2QA9E 4AZ2B 1GHWH 1NT1A 1LDTT 4FUJA 5FBIA 1EATA 1HAIH 4B71A 5DP5A 1GHXH 1LTOA 1VCQA 2ZFQH 4YLUA 1T4UH 7KMEH 1RTLA 2TGDA 1AMHA 2Y7ZA 4I8KA 3TK6A 1CGIE 4HFPB 4ZHMU 2GV7A 1OP8A 1JIRA 4B2AA 5E2OA 2BXTH 3TK5A 3RXSA 3STJA 4AG1A 2HWLB 2CN0H 1UJ1A 3PO1B 1WYKA 4GCHF 2D8WA 2NU3E 2BD3A 2VIVA 2BDAA 4NGAH 1ZJDA 4R8TB 1G2MA 1TX6A 1XMNB 1S83A 2F9UA 3A7TA 3VB4A 5EW1H 1AB9C 5A0BA 3E0NB 2W7UA 1YPLH 5JB8S 1C2DA 4LK4A 5ESBA 5EOKA 4UFDH 1GDQA 1G3DA 1K1NA 4IC6A 1HAZB 1HIAA 2STAE 4B2BA 2G4UA 1V2KT 3MO9A 3E0PB 4KGAA 1GGDC 3PROA 2Z3DA 1T7CA 2OBOA 1LVBA 1GJ7B 4GCHG 1VJ9U 3KF2A 2BD5A 2CHAB 2ZHEH 4B75A 1CA8B 3ZZ6A 3LGUA 1O0DH 3MI4A 1ESAA 1XKAC 2JKHA 5T6DA 2QXJA 4X1NU 1DWEH 4X1PU 1QURH 4AGKA 3Q00A 3R3GB 1O2NA 2ZGHA 4MQAA 3LKWA 3M7TA 1N1LA 2BD4A 1GBCA 1ZMJA 1VCPA 2RA3A 1ZGIA 4HTCH 2ZHDA 3T2NA 4O3UA 3GDUA 2QF0A 1SGYE 2G00A 3RXPA 3V13A 2IN2A 3UNRA 3PTNA 3SJ9A 1F5LA 2VWNA 4JMYA 2PKAA 1GMCF 2FOGA 3TJOA 4I8HA 3LJJA 3BG4B 3F6UH 1V2LT 5EQRA 1NU9A 3A7WA 1GJ5H 1BTWA 1WAYB 5G4BA 3AW0A 3UR9A 3OYPA 1UHBB 2BY8X 3ODDA 2V3OH 4TPYA 1SR5C 1FPHH 1TNHA 3LIWA 3NUMA 1IAUA 1K1MA 2FS8A 2CF8H 1NRNH 2HNTC 3RP2A 1C5WB 3ATMA 3FZZA 3PM3A 4TPIZ 3RXHA 1CA0B 1YP9A 3SNAA 4BTIB 1H9LB 5FCRA 1F0RA 4U2WA 1OWEA 3TJUA 1GMCG 5GPIB 1UTJA 3PLKA 2XXLA 2J94A 4JYTA 2J38A 2VJ1A 3P6ZB 3KQDA 2ZPSA 2A5IA 1SSXA 3NK8A 1QHRB 2FYRA 1J14A 1TQ7B 3ENSB 3LONA 3RXRA 3RXCA 2ZQ1A 2ZNKH 2B7DH 4X2VA 1GI0A 2GT7A 1N6XA 3VB5A 3ZZ4A 2DUCA 3VFEA 1QBNA 4K1SA 1FAXA 1G3CA 4NWKA 3T29A 1O2WA 1IHTH 1UVUH 1ZRBA 3M5NA 1GJ8B 1SI5H 1H1BA 1D6WA 4R0IA 1TPSA 1KXFA 1AGJA 1MD8A 2WYJA 3UNQA 1GVKB 4X1RU 3A7XA 1MCTA 3HATH 3MTYA 5GWZA 1K1JA 1A5HA 1O3NA 4I7YH 1HGTH 2GCHF 2WINI 1CHOF 2FPZA 3O8RA 1ZYOA 1OS8A 1PQ7A 1ZHPA 2V3HH 3TGJE 1CGJE 1YPJH 1YF4A 2FX6A 1JWTA 1S5SA 1ESTA 3ZZAA 3Q3KA 5CMXH 2Z7FE 4A92A 4MPVA 2BQ6B 3QLPH 5JBBS 1O5EH 4HI3A 5L2YH 1IQGA 1XM1A 1GHBF 3PO1C 3ZZ3A 3B9FH 2R2MB 1PPFE 3P8OA 1FV9A 5L6NH 1QNJA 2AGEX 3M3SA 1HFDA 3ZVGA 1B7XB 3BN9A 8KME2 5AHGH 2GCHG 3RXMA 3NWUA 5LPEA 1ETRH 2D1JA 1L4ZA 1C5TA 2SNWA 2H2ZA 4K8YA 1RD3B 2RDLA 3UIRA 1P01A 3P8NA 3QO6A 1VCWA 2OP9A 2BDYA 1K2I1 3A7ZA 2GVFA 1QJ6B 4BAHB 1MTVA 3D65E 4I8LA 2ZP0H 2ZGBH 1NPMA 1PPGE 5EQQA 1AKSB 3GY4A 2EC9H 1DOJA 1HAGE 4X6PA 1HLTH 2CHAC 1XUKA 4U32A 4CRAA 1O2PA 4CRGA 2WV4A 1YPHE 4YOGA 4CR9A 1K1PA 3GYLB 1HAYB 2FWWA 2F9OA 4YM9A 2QGRA 1LQEA 1BTXA 1THSH 2HOBA 4NIXA 1MQ5A 1EZQA 1U6QA 3ZZ7A 2NU2E 1ANEA 3H7TA 3ATWA 2FOFA 4O3TA 1C5RA 4UEHH 3STIA 1SHHB 1GI7B 2R3UA 3MYWA 3BG4C 3M61U 4X8SH 1GBJA 2G55A 4JZDH 3KCGH 1TALA 1O36A 1CSOE 2WPKS 2GX4A 3RMLH 4DY7B 1C2MA 3NZIA 2PTCE 1FPCH 1L2EA 2P3FH 3SU3A 2XCNA 1W10U 2FI3E 1FN6A 3RC4A 1NC6A 3SNEA 2QC2A 4FUFA 2BHGA 8ESTE 3IITA 3CP7A 3E91A 2ZU2A 1RTKA 4Z6AH 3K2UA 1CA0C 1EKBB 1FY1A 1WBGB 4WMFA 2O8WA 3EQ0H 3SI4H 1LPZB 1P06A 1W11U 2BX4A 4ABIA 1Y59T 2Y82A 2Z9KA 2H5CA 4Y10E 2UWLA 3EA7A 1ABIH 2ZQ2A 4AX9H 2CV3A 2FXRA 1FUJA 3GY5A 3FP6E 6GCHF 4ZHAA 4XDEA 4WJG2 1LMWB 3QTVH 5AFZH 2P95A 1D6RA 2UUYA 4B1TA 4UONA 4M7GA 2H9HA 1C1WH 5FHTA 1KSNA 4BAOB 1SC8U 1LCYA 1TPPA 3RXOA 2AS9A 3VB3A 3SZNA 2QAAA 3O8BA 1TGSZ 5A0CA 4ABBA 2G8TA 4A5TS 3SUEA 1HUTH 1G30B 1QR3E 1QBOA 4Y8ZA 1VITG 1TNIA 1YLDA 2BY9X 1OP2A 3LGVA 2FP7B 4DOQA 4KKDA 3HGNA 1J9CH 3U8RH 3MH6A 3MNXA 1AVXA 2Z9LA 2FOAA 3ELAH 3ATIA 2OLGA 1FAKH 3ZVDA 2ZIQH 5GIBA 7GCHF 1CO7E 2UUKB 1C5LH 1XXFA 1P57B 3TVJB 2YNAA 4A7IB 4VGCB 4YOIA 3BTKE 4NZQA 1TOMH 4WH6A 3HK3B 3E16B 2EI6A 4AGJA 1QB9A 3JZ2B 1TMTH 2Y5FA 1BTUA 1V2QT 5JBAS 3V0XA 4AG2A 1FI8A 4ISHH 1HIAB 1L1NA 1YPGH 3HPTB 1C5UA 3IWMA 1S82A 3SV6A 4IGDA 5DKMA 2BTCE 3O8DA 3NKKA 4NWLA 4Y0ZE 4DT7B 4X8TH 2BDCA 1LHFH 2NU1E 1OOKB 1W8BH 3MO3A 2AMQA 2XBWA 1IQNA 4MPUA 2BD9A 1INCA 5TCAA 1UK4A 1T4VH 4UE7H 1ZPBA 3MNBA 5DG6A 3I78A 1P2IA 5DJ7A 1P3CA
chains in the Genus database with same CATH superfamily
1DFPA 3EGKH 4OS4A 1SGIB 1O3PB 3B23B 4YT7H 1DSTA 4CRDA 4A1VA 1DXWA 3SJ8A 4B2CA 5DGJA 3RMOH 3M5OA 1C5MD 2Z6BD 2K1QA 2PKAB 1Y3VA 4RKOB 1SGCA 4UFGH 1E79D 5C5OA 2VVUA 1BMNH 1C1NA 1V2MT 1CVWH 2WPHS 1KTSB 2WV9A 3UPEA 4F49A 3A8AA 3S0NA 3V7TA 1DDJA 2ZGCA 3CNRA 3F2HA 3TIUA 1C1UH 1ETSH 2ZEBA 4AFZA 2FLRH 5AF9H 1O32A 1M9UA 1SGFG 2HPPH 1DPOA 1GPZA 4GPGA 2XWAA 3SU1A 3TNSA 2BLVA 8GCHG 1HAPH 3RC6A 3L6PA 4O97A 1QQ4A 1TONA 1SPJA 1NROH 3U28C 4AB9A 1PPHE 1AE5A 1QJ1B 3FAOA 2HNTE 1OWHA 3OU0A 1KLTA 5HIYA 1MUEB 1C1RA 5IYTA 2RG3A 2SGAA 2Y6TA 4AORA 1TRMA 1UO6A 1E36B 4OS5A 2DE8A 3K6ZA 1SLUB 1WSSH 2QV1A 1WQVH 3H7OA 1P2NA 3SNBA 5T6FA 3RU4T 3ZZ9A 2VB0A 3GCHB 1V2WT 1MTSA 1TAWA 3SU5A 1O2MA 5PTPA 1ZHMA 3DHKH 2LELA 4X8UH 1HJ9A 1FX0B 2FESH 5AVDA 1KYNA 2BVRH 1K21H 3KQCA 1O3MA 3P8FA 2I6SA 1BITA 1QRZA 4HGCA 4BAQB 2A4OA 1C4U2 3SV8A 4NSVA 5F8TA 5E2PA 2VBCA 2GJGA 1PJPA 1OWJA 1TFXA 1P2MA 2AMPA 1EZUC 4WF8A 4RSPA 2PKSB 1C1TA 1S6FA 2R9PA 3DFJA 3SQHE 1GHAG 1QQUA 1F0TA 1HJ8A 3S9CA 3KIDU 4K8BA 5J4SA 1MTNB 2ZA5A 2SGDE 4FUIA 4HG6A 5FPYA 1YM0A 2ZPQA 2ILNA 4DG4A 4X2XA 3LGIA 2VIQA 1K1OA 1G2LA 1HYLA 1V2VT 1SGPE 4FU7A 1SQAA 5JBTA 3RXKA 2BDBA 3S9BA 3K6YA 6LPRA 1NFXA 3GDVA 1C2KA 1HXEH 1GBLA 1MAYA 1PYTC 1W0YH 2SGPE 4JZIA 1DLEA 3GICB 4CR5A 1QY6A 1TGBA 3DA9B 3S69A 2JETB 2Y5HA 1TRNA 2QYIA 2W5EA 1MZDA 4BAMB 2W3IA 2J2UA 5GXPA 1PQ8A 2FYQA 3A7VA 3BIUH 1TGCA 4WH8A 4VGCC 1NESE 3F2FA 5FX6A 3EA8A 2AMDA 2VIWA 1TYNA 4AOQA 4MVNA 3KNXA 2NU0E 1O3EA 4I8GA 2Q1JA 1CU1A 2ZTYA 1BJUA 3GY3A 2P94A 3BTEE 3D49H 3SJIA 3FN8A 2ZWLH 4X2WA 3MHWU 1C2IA 1CT4E 3ODFA 2OCVB 1K9OE 4E7NA 1SGEE 4Y0YE 2H5DA 5E8EH 1AWHB 1BRBE 1HRTH 1A61H 1PYTD 3OX7U 2RCEA 1D4PB 1BBRH 1BB0B 5EIYA 4FUEA 2KAIA 1V2ST 5KGOA 3W1EA 2GDEH 3ZZBA 1ESBA 3ZZCA 1F0SA 2FO9A 1DANH 4AFQA 2TIOA 4B6EA 3UTUH 2AH4X 2VWMA 5JDUB 4GHQA 4H42U 1O2TA 1HNEE 1GI4A 2KCOA 3RXFA 3A7YA 1BMMH 1P09A 2GMTB 2R3YA 1ELAA 3RXDA 3GCTG 2FODA 4IMQA 3QGJA 1WQSA 2XYAA 1ZR0A 4AFUA 2I6QA 3SNDA 3VEQB 2V0BA 3P8GA 3EDXB 3L3TA 3EE0B 4Z0KA 1WOFA 2GCTB 1YLCA 1DUAA 1KXAA 1D3DB 1P2KA 3TU7H 1V2UT 2PUQH 2FLBH 3RLWH 1ZPZA 3HKJB 1JOUB 4RT1A 3SV7A 1AUJA 3RMMH 1G9IE 3MWIU 3SU6A 1C1OA 1ANCA 1HB0B 2RA0A 2QXHA 3FFGA 1UVPA 1AY6H 1NBMD 3KQEA 3T62A 3S7HB 1UTOA 1YBWA 1CBWB 1FQ3A 2FZZA 3E6PH 1O2VA 1TA2A 2ZHQH 1Y8TA 1DVAH 4JZ1A 1UTMA 2OINA 2WV5A 1A3BH 1DM4B 5F8ZA 3GCHC 4E7RG 1AD8H 1CT2E 1TA6A 4X8VH 2A2XH 2NU4E 3Q3XA 4K5ZA 3P92A 1O34A 1O3HA 1THRH 1ZPCA 2OC7A 1XKBC 4ZUHA 1BTZA 1ANDA 1AWFH 3QK1A 2W6JD 4CHAB 3U1JB 4UFEH 2C8YB 2ZU1A 3QGNB 4FVDA 1O5GH 2FS9A 3SO3A 3OFND 1UK3A 2ANWA 3MOCA 2PKSC 3A84A 5E0GA 3O8CA 1C5XB 1ZMLA 1HPGA 3TJNA 4CRCA 3AASA 1A1RA 1P9UA 2JH0D 2ALPA 2ZDAH 2P59A 3CS0A 3MH5A 3MH4A 2B0FA 1MTNC 1L1GA 1TRYA 2VVVA 1D3QB 3BG8A 3DCLA 1QIXB 1YPEH 1TMUH 4U01A 3A82A 2YMSD 1N8OB 2J4IA 1ID5H 1ZSKA 2SNVA 3FVFB 4X0WU 1QJ7B 1HCGA 2Y7XA 1BA8B 2STBE 2JH5D 1ZHRA 2CJIA 1J17T 4MPXA 1SVPA 1MU8B 1BBRK 1ZTJA 5LPFA 4ISLA 4Y11E 1FY8E 1QB6A 1ZZZA 3SJOA 3RM2H 2A32A 2JETC 4WWYA 3TJVA 3DSGA 1ACBE 2A31A 1AZZA 3NCLA 2FOHA 3F9EA 1HBTH 3M7QA 1NFWA 1UTLM 3UNSA 2Z94A 1C2LA 2GD4B 2OC1A 2ULLA 3OEED 5ETXA 1KDQB 2Q6GA 5FXLA 3GCNA 4U30A 2XNIA 1EJNA 1Z1JA 4FXGH 4I33A 4Y7AA 1ZTLA 4UFFH 1FDPA 1Z6EA 1QL7A 1IHSH 2QXIA 5BPEA 1C2GA 2GTBA 3A89A 5DK1A 3PMJA 3I29A 7LPRA 2LP6A 1MCVA 1GL0E 5F53A 1EXFA 4PROA 3ATLA 4DURA 1TBQH 2GV6A 2WUCA 2QCYA 1LKAA 4OS7A 2GZ8A 1TBRH 1V2NT 4CRFA 1O2QA 4YT6H 1BRAA 1T31A 2QN5T 3A83A 2G51A 4CH2B 2O8UA 2AERH 2ZHFH 1GMHF 3ZVAA 4ACAA 2D26C 2GMTC 1HAHH 2BD7A 1E0FD 2F9PA 3EA9A 3RDZA 4D76A 2BD8A 1BTPA 2A4GA 3TNTA 1EP5A 4XSKU 4X6NA 5EXMA 1J8AA 4BAKB 1GDUA 4Q7XA 1LHGH 1V2JT 4XBBA 1OP0A 4ZXXH 1HV7A 3BV9B 1ETTH 3LH1A 1QB1A 1THPB 1Q2WA 2GCTC 4DGJA 1EFRD 2BZ6H 1OYTH 4CBOA 3UWIA 2IPQX 2BVSH 2OC0A 4A1XA 1ZLRA 1O3OA 3U69H 5KECA 4Y79A 1XUHA 2BYAX 1Z1IA 2A2QH 2Y80A 3QN7A 2H9EH 2UWPA 1EB2A 1GMHG 1QGFA 5C0UA 1MBQA 1PPCE 1QZ8A 3HK6B 2ZDKA 4NIWA 3VPKA 1K28D 1CHOG 2CF9H 1NY22 1IQHA 3FP7E 1LVOA 2PSXA 1Y3YA 1Z6JH 4ZKRU 2HRVA 1SOZA 1JIMA 2VIPA 1EPTA 1MU6B 2C4FH 1GI6A 3TK9A 1LHCH 1DITH 3RU4D 3UQVA 1F5RA 2A0QB 1GI1A 2VH6A 1GHBG 4CREA 2XW9A 4UDWH 1HJAB 1W14U 3MFJA 4CHAC 3BEFB 2SGFE 1EJAA 4WXIA 3F9FA 4MNVA 2BMGB 2WPMS 2B9LA 4BTUB 4ZKSU 4MG3A 4FUBA 2BOHB 1GMDF 3RXAA 4QT8C 1C9PA 3ZV8A 2ZDNA 1MTUA 1L0ZA 1ELBA 2AIQA 4Y71A 3UUZA 2P93A 1B0FA 4LOYH 1EJMA 1O5CB 1YKTA 3E1XB 5DSFA 3ATKA 1ARBA 4E05H 1OWDA 1S0RA 1NS3A 1ORFA 2A5KA 3OY6U 2QXGA 3U1IB 4AB8A 1DSUA 1N8OC 3A86A 3OSYA 1O35A 2YOLA 5CHBA 1D3TB 2F83A 1O3AA 1E37B 1RXPA 2ODYB 2BQ7B 3TGKE 3P17H 3VXEH 4ASHA 3M36A 4Y7BA 1SBWA 1MBMA 3VG8A 1T8NA 3RXGA 4SGAE 1G3BA 4DIHH 1KXCA 1BUIA 2G4TA 1P8VC 2AHME 4GHTA 1QL8A 1W12U 1BRUP 3ZV9A 1SL3A 4GAWA 1O5FH 1UTNA 5C94A 4AFSA 1H4WA 3DD2H 1V6DA 5ABWA 3E8LA 1VJAU 1DUEA 3BTTE 2AIPA 3SQEE 1P2QA 4ZROA 3SOSA 2XBYA 2XNDD 4JCNA 1TX7A 4AYYB 5AFYH 3QTOH 1E34B 3KHVA 3PMBB 1X7AC 2ZFSA 1EOLA 3RXVA 2WHXA 2AYWA 2THFB 1FNIA 3AVZA 3PTBA 1B0EA 1OKXA 3W94A 1GVZA 2GT8A 3SGQE 1FZZA 2ZCLP 1C5ZB 1E38B 2CXVA 2PFEA 2ZC9H 2QF4A 5CHAB 4YLQH 1P2JA 4CH8B 4B76A 4X1QU 5T6GA 2B8OH 5K7RA 2BDGA 2KCPA 4NCYA 1GCDA 2H9TH 1LPKB 1D9IA 4DIIH 1OSSA 3PV4A 1W7XH 3WY8A 1YGCH 1FN8A 1T32A 2CGAA 1FY3A 1YPKH 1KLJH 1ELTA 6GCHG 4RKJB 1KIGH 1EP6A 3BEIB 1Z71A 3GCOA 1IQIA 1GDNA 1ZMNA 2B5TB 5A8XA 1T8OA 1YCPH 5LPRA 2VU8E 4F48B 2WPLS 3GISB 4AYVB 4CBNA 4D7GA 2FTLE 1HAVA 1DX5M 1C2FA 1O2KA 2TRMA 1ELFA 6ESTA 4CRBA 3Q77A 1AFQB 3MU8A 1UCYE 2J34A 2ZFTA 4IN1A 3VB7A 1WU1A 1A4WH 2P8OB 4IC5A 1A7SA 2BY7X 1NFYA 1KY9A 1Z8JB 2G5NA 4FUDA 1P04A 4MNXA 7GCHG 2XTTB 3SU0A 1O5BB 4XFQA 4ABGA 1YWUA 1IQKA 2ZTXA 2G5VA 1TX8A 1ANBA 2BOKA 5EODA 3TH4H 3SHAH 1Z8GA 3PMAB 2PGQB 3GYMA 3LU9B 2F9NA 1B5GH 1GBIA 1VZQH 4D9QA 4K1EA 1A0LA 3QWCH 2IOTA 3FZDA 1GJAB 1HJAC 1O5DH 4IMZA 3HGPA 2FIRH 3TGIE 1ELVA 2EI8A 2ZCHP 1TGTA 3SGAE 4INHA 1DT2A 1YC0A 2FMJA 1Z8IB 2PP6A 3RXTA 3UB0A 2XC5A 4JYUH 4B73A 3F68H 3M3VA 1O2HA 1WUNH 1EAXA 5IK2D 1QA0A 4H6TA 1EASA 2BD2A 3PRBA 5EGMA 4GUXA 1LHDH 5T3HA 3UFAA 4RI0A 1WTHD 1O2YA 1O2ZA 4MLFB 2VH0A 5GDSH 4RN6A 3ZZ8A 2BVXH 1F2SE 3MMGA 1UVOA 3N7EA 3SN8A 2ZECA 2GP9B 1C5YB 1O2XA 2YMSB 3NRLA 1IQLA 5B6OA 2QIQA 3OEHD 5DP8A 1GJ6A 1SFQB 3RXEA 4YTAA 2EI7A 2WUBA 2BZAA 1FIWA 5GCHF 5A8ZA 2C3SA 1QFKH 1SGRE 2VNTA 1DXPA 1MH0A 3F1SB 4Q63A 5GJ4B 3I77A 5F03A 2J9NA 1AQ7A 3DSOA 2SFAA 1AO5A 4ZMAH 1WXRA 1YCPK 1UW7A 1O2UA 3GY8A 3SBKA 2OXSA 3C1KA 2A45B 4YESB 1PFXC 4ZKOU 4TWWA 5DP4A 1HDTH 2VVCA 1KXEA 5HM9A 1ABJH 3GOVB 4XBDA 2O8TA 3D62A 1HAXB 1ZOMA 3EYDA 1BZXE 1TWXB 1C5QA 2A7HA 3CS7A 2OUAA 2ZFFH 3RXQA 4H6SB 1EOJA 1RS0A 1TPOA 1Z8RA 2PSYA 3ZIAD 1BT7A 2XBVA 1O3GA 2KCYA 3KYGA 1AE8H 3RM0H 2C90B 4GLYA 4IW4E 4FUHA 2V3MA 2Z3EA 5ESTE 1OYQA 1BRCE 4DT4A 1IQEA 1NM6A 2V7QD 4E06H 1SGFA 4X6OA 4XOJA 5FL7D 3Q76A 2O9QA 3E90B 1TPAE 1AKSA 2YNBA 3U8OH 3ZVBA 1OX1A 1CT0E 3FANA 1A5GH 3LPRA 1BHXB 3MO6A 2F9VA 3QZQA 5C20A 1P02A 4I86A 1TNJA 2ASUB 2VINA 4JYVH 1O2JA 3WW7A 5A8YA 1AVWA 3BTHE 2IPHA 1JXPA 3AAUA 4WMEA 2WPJS 2OTVA 3PMHB 1EPTB 1FXYA 1AFQC 3SJKA 3M5LA 5IDKA 3MQKC 2P8OC 5A09A 1W7GH 1G3EA 3OE7D 4Q2KA 1E35B 3PLBA 1XUGA 3A8DA 3EAJA 2KFWA 1V2PT 1PQ5A 1SQOA 1O3JA 4NSYA 3GY7A 1SQTA 4BNRA 4K1TA 2CMYA 1NN6A 2V35A 1TLDA 2PGBB 3URCA 3V3MA 2LPRA 1JMOH 1LO6A 4NA7A 3SZEA 2EEKA 4KELA 1EZSC 3RUOA 3KQ5A 1A3EH 1DS2E 1L4DA 1VGCB 3TH2H 1GHZA 2P3TB 2OD3B 4X6MA 4ABHA 5EW2H 1OHHD 1T8MA 1C1MA 1TQ0B 4K69A 1F5KU 2ZU4A 4FUCA 3UY9A 1QBVH 2ZHWH 5DP7A 3SV2H 2F3CE 1NRPH 5DP3A 4FVBA 1ZRKA 2FX4A 1Y5UT 6CHAB 2PV9B 1NRQH 3ESTA 4Y6DA 1GBHA 3GY6A 3BTGE 1FJSA 1V2TT 1OWIA 3SNCA 2GGVB 2C8WB 2PR3A 2QF3A 2ZZUH 1P10A 2NWNA 3F9HA 2BDIA 5C1XA 1H8HD 4THNH 3B8JA 1IOEA 4OS1A 2G52A 1ZJKA 2FI4E 1LPGB 3ITIA 4Q80A 3FP8E 1UTPA 3PWBA 1LVMA 2YMSC 5HMAA 3KYFA 5C1YA 2HPQH 3ZYDA 2BLWA 4LZ1H 1P12E 1GBDA 5EXNA 4I32A 1V2OT 1W0JD 2W3KA 3A8BA 4NFFA 4Z1MD 1UVSH 3UOUA 2WSSD 1FIZA 1V3XA 1SMFE 3PV5A 4ISNA 1O39A 8LPRA 3T27A 3ZVFA 5L2ZH 1A0JA 1KMHB 1GJBB 1TGNA 3H09A 2A7CA 5CDFE 3RXUA 3A87A 1GI9B 4NZLA 2XC0A 1WTGH 1VKYA 1XX9A 1CQQA 2HGTH 2ZKSA 3PYHA 4KTUA 4BXSA 1ZSLA 2WYGA 3ZZ5A 1KTTB 1FONA 1SG8B 2BM2A 1NO9H 3BF6H 1GBAA 4ABDA 1JRSA 1S6LA 3M35A 4YOJA 1C2JA 3HKIB 4ZH8A 4BOHA 5JBCS 5JPMH 5C3NA 1Q31A 4INKA 1O3DA 1G36A 3AW1A 1SGNE 1TNLA 2ZF0H 1C4V2 3QDZB 1HAVB 2HLDD 2AEIH 3A85A 2TBSA 4NG9H 4FOUC 3ZVEA 1BHXF 1PQAA 1BTHH 2BY5X 5JYIA 5HXFA 5E0JA 1VITH 1BJVA 5EJ1A 1AHTH 1Q3XA 5EQSA 1W0KD 3TITA 3VB6A 2D2DA 3MH7A 3W95A 5C2ZA 3LGYA 1C9TA 2C8XB 5DO4H 1GBBA 1O3BA 5HM2A 1W3CA 2ANKH 4GSOA 1O3FA 4MNYA 1RFNA 1D3PB 1EPTC 2ZGXH 1PPZA 3BIVH 1EX3A 3UAIC 3M3TA 2HNTF 3BTQE 3K65B 3SV9A 1DWDH 3RLYH 1ELGA 2EY4C 3OTJE 1QRWA 1ELDE 9ESTA 2HVYB 5CE1A 4YZUA 1AVGH 2Y81A 1IQFA 4D8NA 3KEEA 4ASUD 2UWOA 1GL1A 1GCTB 2V6NA 2ANMH 3V12A 1SGDE 3F9GA 5E0HA 2EQNA 2VWLA 3DUXH 1TE0A 2ANYA 5FCKA 1KLIH 4IBLH 4BXWA 1O33A 4FUGA 2ZFPH 1DY8A 5FBEA 3U98H 3UOPA 4Q7ZA 1VGCC 1UTQA 1GBEA 1ELEE 3PWCA 1RRKA 3LC5A 2PW8H 3MU1A 1S6HA 2A4QA 1TNKA 5JB9S 1GI2A 1C2HA 3QZRA 3CENA 3SHCH 2ZU3A 3BEUA 3MNCA 1ZSJA 1OXGA 2Z9GA 5A2MH 1P0SH 4X2YA 2A7JA 2ZDMA 1PPBH 1GJDB 3TH3H 1Y3WA 6CHAC 1LKBA 3UR6A 1GG6B 1GJ9B 2BY6X 1JRTA 1A0HB 1C5OH 1SOTA 5I46H 1G37A 5DPAA 1TMBH 2WZQA 1O30A 1H8ED 1MAXA 1O37A 2BDHA 3IG6B 5SGAE 2RFKC 2OQUA 2ZTZA 3D23A 1CBWC 1F0UA 4WXVA 5FAHA 3GDSA 2UUJB 3LJOA 1GBMA 3L33A 3P95A 2BLOA 2J5UA 1H8IH 3NXPA 1RIWB 2A5AA 3QUMP 1W0ZU 3ZYEA 1GBTA 3RXBA 1AUTC 1TIOA 3G01A 4J1YA 4NIYA 4ABEA 4ACBA 1FLEE 4OGXA 4TYDA 3MU0A 1T8LA 2J98A 3SUGA 4LXBH 4GVUA 3VGCB 2OQ5A 4BTTB 3LC3A 1H9IE 4Q7YA 2ESTE 3SU2A 3N7DA 5C67A 2R0LA 1BCUH 1TB6H 1MKXH 1S0QA 4ZKNU 1ARCA 4MTBA 2FOEA 4DCDA 1GI3A 1EUFA 1S84A 1O3IA 4NFEA 1BIOA 1G32B 1P05A 3GY2A 2P3UB 2FDAA 4XBCA 2HLCA 1QCPA 1YPMH 5FX5A 1EB1H 5H4IB 4Y76A 5BRRE 2OC8A 1OPHB 4I8JA 2ZDVH 1GHVH 1O5AB 5FPTA 1FY5A 3KGPA 1EAUA 2PUXB 1C2EA 2XBXA 3BTFE 1GMDG 3BTDE 1GJ4H 3NPSA 4DVAU 3A81A 1KXBA 1VR1H 3KL6A 3SGBE 4KP0A 5EPYA 5EPNA 5L30H 1NZQH 2OBQA 1O2RA 1XVOA 1GI5A 1NU7B 2VIOA 4F4OC 2R2WU 1RJXB 2KCAA 4OGYA 2BX3A 4B74A 3LOXA 3UWJH 1CGHA 3FO8D 3PB1E 3ZVCA 1O3KA 1HXFH 1N6YA 3P70B 1QTFA 2Q6DA 2PWXA 3S7KB 2KAIB 1NBME 4A6LA 5DP9A 4MDSA 4TY7A 4XE4A 2XWBI 1XUJA 1MQ6A 4JK5A 2A4RA 2R0KA 1HAOH 2AGGX 4WVPE 1CHGA 2BXUH 3SORA 1GHYH 3A80A 4XRNA 5DP6A 4F55A 4ISOA 1AZ8A 5FPSA 3DSPA 2UUFB 1VITF 3M37A 5A0AE 1L1JA 1GCTC 4D9RA 4NA9H 2F91A 1NRRH 2J95A 3ZZDA 1GI8B 1S81A 2XCFA 1SB1H 2KR7A 4TY6A 3VXFH 2Y5GA 4I31A 4P00A 1AIXH 4ZAEA 1K1LA 3SUFA 2LNCA 2ZO3H 3UQOA 1Z7KA 4Y8XA 1WDIA 1K0HA 2F9BH 2VWOA 2AFQB 3PRDA 5F6MA 1GJCB 2JJ1D 4JK6A 1UTKA 2FTMA 3RMNH 1BQYA 3TLOA 1C1SA 1W13U 2AGIX 1UK2A 1KXDA 4IS5A 2HALA 1XUIA 2ALVA 4J2YB 1W2KH 2PLXA 2FOCA 3KQBA 4M9FA 2XC4A 3MU4A 3LH3A 1O2SA 1E1QD 1SLWB 2ZI2H 1Y5BT 1GG6C 3A8CA 3RXIA 1COWD 1LQDB 1MKXK 1MMJN 2H1UA 5HIZA 2Z9JA 1NTPA 2ODQA 1P9SA 3LDXH 1O2OA 1LHEH 2VGCB 2Q6FA 1MZAA 1JBUH 4XD7D 1DLKB 2QY0B 1J15A 3BTME 5EG4A 1RGQA 3M7UA 1AN1E 3URDA 1BOQA 7ESTE 1SHYA 5C1UA 1C4Y2 2ZCKP 5EXLA 2FEQH 1RIWC 5TCCA 1RTFB 1UHBA 4ESTE 1K1IA 2TGPZ 2O8LA 3BSQA 3Q3YA 1A5IA 5HGGA 5I25A 2HVXA 2TPIZ 1P3EA 3SI3H 2F43B 3VGCC 4INLA 4WMDA 1KDQA 2TGAA 2P16A 1IQJA 4IN2A 1DWBH 1F7ZA 1O2GH 3K9XB 4ISIH 5HKKD 1PPEE 3KN2A 1C1PA 4O03A 8GCHF 3E3TA 1EQ9A 1LVYA 1ZGVA 4K2YA 4ABAA 1XUFA 2GDDA 2Z9IA 1H9HE 1YCPM 3DFLA 1P03A 4H4FA 1SFIA 5C0TA 3AAVA 3DT0H 4NIVA 1EAIA 4BANB 1K22H 1SGQE 1UCYH 1IQMA 3QX5H 3BTWE 4OS2A 1A2CH 2C8ZB 1V2RT 1ZTKA 2PHBA 2FOMB 4ABJA 4A1TA 2ZDLA 3JZ1B 4FU8A 1TNGA 1EAWA 1MKWH 1O3LA 2FM2A 3F0OA 2JH6D 3A88A 4O9VA 4AN7A 4KTSA 1DY9A 3LT3A 2IJOB 1GBFA 4HZHA 2FOBA 1C1QA 1FY4A 2ZPRA 1AB9B 2GKVE 1C1VH 2G81E 3RXLA 2BQWB 4JZFH 2GZ9A 1GHAF 2J92A 3OY5U 4K3JA 2W7SA 1UMAH 2BB4A 1FMGA 1BMAA 2ZU5A 5B6LA 3T25A 1A46H 1SGTA 2C93B 5T1VA 1C5VA 5TJXA 1SLXB 1GGDB 3MU5A 3LGTA 3T5FH 2BLQA 2ZG0H 1BMLA 5GCHG 1DE7H 5CHAC 1MD7A 1QA7A 3RU4E 1Y3XA 3C27B 4OS6A 4SGBE 5LGOA 4X1SU 1AFEH 1BTYA 1S85A 3SUDA 2ZGJA 4FU9A 3S9AA 4K60A 5F8XA 2M5TA 3R0FA 2ZFRH 2O8MA 5C5NA 3SU4A 2JDID 1WCZA 3RC5A 1BBRE 4KTCA 4ABFA 1C5SA 1AI8H 1GBKA 1TOCB 1O38A 1P2OA 4WY3A 1EZXC 2Z3CA 2J97A 3U8TH 1WV7H 2EA3A 1OWKA 1GVLA 2H6MA 5DN6D 2VIDA 1YPHC 2XRCA 4MPWA 1H8DH 4D7FA 4RT0A 2DE9A 3M5MA 1BMFD 5J4QA 1MABB 1QRXA 1SQRA 1F92A 3LGWA 2XOKD 2TGTA 1DICA 2VGCC 1O2LA 4ZHLU 2SGQE 4AC9A 3U9AH 1NRSH 5LH8A 1J16A 1NFUA 1ELCA 2WPIS 1O31A 4NA8A 3MNSA 3SW2B 1O2IA 2J98B 4TWYA 1Y5AT 4ZXYH 2PTNA 4DW2U 1YYY1 1AU8A 3H5CB 1DWCH 1O3CA 1UVTH 2FI5E 4UD9H 1UCYK 5K0HA 1MTWA 1CE5A 2JIZD 3GCTF 9LPRA 1GWAA 5EU8A 1TBZH 3N7OA 3TPIZ 1P11E 1QL9A 2CK3D 2W26A 4Q4LA 5HYOA 3RXJA 3T28A 1MKWK 4MNWA 2SGEE 2ODPA 4JZEH 4Y8YA 3T26A 1Y3UA 3GS9A 4YO9A 1XXDA 2A1DB 4B6FA 4LZ4B 1SLVB 1BDAA 1C5NH 1TABE 3PLPA 2GZ7A 4DJZB 3N99A 1C5PA 1XVMA 3UREA 3F3BA 2QA9E 4AZ2B 1GHWH 1NT1A 1LDTT 3OTPA 4FUJA 1EATA 5FBIA 1HAIH 4B71A 5DP5A 1GHXH 1LTOA 1VCQA 2ZFQH 4YLUA 1T4UH 2WPDD 7KMEH 1RTLA 2TGDA 1AMHA 2Y7ZA 4I8KA 3TK6A 1CGIE 4HFPB 3F2GA 4ZHMU 2GV7A 1OP8A 1JIRA 4B2AA 5E2OA 2BXTH 3TK5A 3RXSA 3STJA 4AG1A 2HWLB 2CN0H 1UJ1A 3PO1B 1WYKA 4GCHF 2D8WA 2NU3E 2M2AA 2BD3A 2VIVA 2BDAA 4NGAH 1ZJDA 4OM9A 4R8TB 1G2MA 1TX6A 1XMNB 1S83A 2F9UA 3A7TA 3VB4A 5EW1H 1AB9C 5A0BA 3E0NB 2W7UA 1YPLH 5JB8S 1C2DA 4LK4A 5ESBA 5EOKA 3WWFA 4UFDH 1GDQA 1G3DA 1K1NA 4IC6A 1HAZB 1HIAA 2STAE 4B2BA 2OK5A 2G4UA 1V2KT 3MO9A 3E0PB 4KGAA 2L6OA 1GGDC 3PROA 2Z3DA 1T7CA 2OBOA 5EJZA 1LVBA 1GJ7B 4GCHG 1VJ9U 3KF2A 2BD5A 1SKYE 2CHAB 2ZHEH 4B75A 1CA8B 3ZZ6A 3LGUA 1O0DH 2K0QA 3MI4A 1ESAA 1XKAC 2JKHA 4FETA 5T6DA 2QXJA 4X1NU 1DWEH 4X1PU 1QURH 4AGKA 3Q00A 3R3GB 1O2NA 2ZGHA 5EJLA 4MQAA 3LKWA 3M7TA 1N1LA 2BD4A 1GBCA 1ZMJA 1VCPA 2RA3A 1ZGIA 4HTCH 2ZHDA 3T2NA 4O3UA 3GDUA 2QF0A 1SGYE 2G00A 3RXPA 3V13A 2IN2A 3UNRA 2KM0A 3PTNA 3WWBA 3SJ9A 1F5LA 2JJ2D 2VWNA 4JMYA 2PKAA 1GMCF 2FOGA 3TJOA 4I8HA 3LJJA 3BG4B 3F6UH 1V2LT 5EQRA 1NU9A 3A7WA 1GJ5H 1BTWA 1WAYB 5G4BA 3AW0A 3UR9A 3OYPA 1UHBB 2BY8X 3ODDA 2V3OH 4TPYA 1SR5C 1FPHH 1TNHA 3LIWA 3NUMA 1IAUA 1K1MA 2FS8A 2CF8H 1NRNH 2HNTC 3RP2A 1C5WB 3ATMA 3FZZA 3PM3A 4TPIZ 3RXHA 1CA0B 1YP9A 3SNAA 4BTIB 1H9LB 5FCRA 1F0RA 4U2WA 1OWEA 3TJUA 1GMCG 5GPIB 1UTJA 3PLKA 2XXLA 2J94A 4JYTA 2J38A 2VJ1A 3P6ZB 3KQDA 2ZPSA 2A5IA 1SSXA 3NK8A 3PV2A 1QHRB 2FYRA 1J14A 1TQ7B 3ENSB 3LONA 3RXRA 3RXCA 2ZQ1A 2ZNKH 2B7DH 4X2VA 1GI0A 2GT7A 1N6XA 3VB5A 3ZZ4A 2DUCA 3VFEA 1QBNA 4K1SA 1FAXA 1G3CA 4NWKA 3T29A 1O2WA 1IHTH 1UVUH 1ZRBA 3M5NA 1GJ8B 1SI5H 1H1BA 1D6WA 4R0IA 1TPSA 1KXFA 1AGJA 1MD8A 2WYJA 5C17A 3UNQA 3OAAD 1GVKB 4X1RU 3A7XA 1MCTA 3HATH 3MTYA 5GWZA 1K1JA 1A5HA 1O3NA 4I7YH 1HGTH 2GCHF 2WINI 1CHOF 2FPZA 3O8RA 1ZYOA 1OS8A 1PQ7A 1ZHPA 2V3HH 3TGJE 1CGJE 1YPJH 1YF4A 2FX6A 1JWTA 1S5SA 1ESTA 3ZZAA 3Q3KA 5CMXH 2Z7FE 4A92A 4MPVA 2BQ6B 3QLPH 5JBBS 1O5EH 4HI3A 5L2YH 1IQGA 1XM1A 1GHBF 3PO1C 3ZZ3A 3B9FH 2R2MB 1PPFE 3P8OA 1FV9A 5L6NH 1QNJA 2AGEX 3M3SA 1HFDA 2QE7D 1B7XB 3BN9A 3ZVGA 5AHGH 2GCHG 8KME2 3RXMA 3NWUA 5LPEA 1ETRH 2D1JA 1L4ZA 1C5TA 2SNWA 2KX4A 2H2ZA 4K8YA 1RD3B 2RDLA 3UIRA 1P01A 3P8NA 3QO6A 1VCWA 2OP9A 2BDYA 1K2I1 3A7ZA 2GVFA 4P02A 1QJ6B 4BAHB 3SYJA 1MTVA 2QF5A 3D65E 4I8LA 2ZP0H 2ZGBH 1NPMA 1PPGE 5EQQA 1AKSB 3GY4A 2EC9H 1DOJA 1HAGE 4X6PA 1HLTH 2CHAC 1XUKA 2K8IA 4U32A 4CRAA 1O2PA 4CRGA 2WV4A 1YPHE 4YOGA 4CR9A 1K1PA 3GYLB 1HAYB 2FWWA 2F9OA 4YM9A 2QGRA 1LQEA 1BTXA 1THSH 2HOBA 4NIXA 1MQ5A 1EZQA 1U6QA 3ZZ7A 2NU2E 1ANEA 2KZ4A 3H7TA 3ATWA 2FOFA 4O3TA 1C5RA 4UEHH 3FOAA 3STIA 1SHHB 1GI7B 2R3UA 3MYWA 3BG4C 3M61U 4X8SH 1GBJA 2G55A 4JZDH 3KCGH 1TALA 1O36A 1CSOE 2WPKS 2GX4A 3RMLH 4DY7B 1C2MA 3NZIA 2PTCE 1FPCH 1L2EA 2P3FH 3SU3A 2XCNA 1W10U 2FI3E 3F0PA 1FN6A 3RC4A 1NC6A 3SNEA 2QC2A 4FUFA 2BHGA 8ESTE 3IITA 3CP7A 3E91A 2ZU2A 1RTKA 4Z6AH 4ZCNA 3K2UA 1YY3A 1CA0C 1EKBB 1FY1A 1WBGB 4WMFA 2O8WA 3EQ0H 3SI4H 1LPZB 1P06A 1W11U 2BX4A 4ABIA 1Y59T 2Y82A 2L74A 2Z9KA 2H5CA 4Y10E 2UWLA 3FKSD 3EA7A 1ABIH 2ZQ2A 4AX9H 2CV3A 2FXRA 1FUJA 3GY5A 3FP6E 6GCHF 4ZHAA 4XDEA 5KEDA 4WJG2 1LMWB 3QTVH 5AFZH 2P95A 1D6RA 2UUYA 4B1TA 2IJD1 4UONA 4M7GA 2H9HA 1C1WH 2W6ID 5FHTA 1KSNA 4BAOB 1SC8U 1LCYA 1TPPA 3RXOA 2AS9A 3VB3A 3SZNA 2QAAA 3O8BA 1TGSZ 5A0CA 4ABBA 2G8TA 4A5TS 3SUEA 1E1RD 1G30B 1HUTH 1QR3E 1QBOA 4Y8ZA 1VITG 1TNIA 1YLDA 2BY9X 1OP2A 3LGVA 2FP7B 4DOQA 4KKDA 3HGNA 1J9CH 3U8RH 3MH6A 3MNXA 1AVXA 4TT3D 2Z9LA 2RDEA 2FOAA 4YXWD 3ELAH 3ATIA 2OLGA 1FAKH 3ZVDA 2ZIQH 5GIBA 7GCHF 1CO7E 5GNDA 2UUKB 1C5LH 1XXFA 1P57B 3TVJB 2YNAA 4A7IB 4VGCB 4TSFD 4YOIA 3BTKE 4NZQA 1TOMH 4WH6A 3HK3B 3E16B 2EI6A 4AGJA 1QB9A 3JZ2B 1TMTH 2Y5FA 1BTUA 1V2QT 5JBAS 2F4LA 3V0XA 4AG2A 1FI8A 4ISHH 1HIAB 1L1NA 1YPGH 3EE7A 1C5UA 3HPTB 1S82A 3IWMA 3SV6A 4IGDA 5DKMA 2BTCE 3O8DA 3NKKA 4NWLA 4Y0ZE 4DT7B 4X8TH 2BDCA 1LHFH 1YLNA 2NU1E 1OOKB 1W8BH 3MO3A 3AK5A 2AMQA 2XBWA 1IQNA 4MPUA 2BD9A 1INCA 5TCAA 1UK4A 1T4VH 4UE7H 1ZPBA 3MNBA 5DG6A 3I78A 1P2IA 5DJ7A 1P3CA
chains in the Genus database with same CATH topology
1DFPA 3EGKH 4OS4A 1SGIB 1O3PB 3B23B 4YT7H 1DSTA 4CRDA 4A1VA 1DXWA 3SJ8A 4B2CA 5DGJA 3RMOH 3M5OA 1C5MD 2Z6BD 2K1QA 2PKAB 1Y3VA 4RKOB 1SGCA 4UFGH 5C5OA 2VVUA 1BMNH 1C1NA 1V2MT 1CVWH 2WPHS 1KTSB 3UPEA 4F49A 3A8AA 3S0NA 3V7TA 1DDJA 2ZGCA 3TIUA 1C1UH 1ETSH 2ZEBA 4AFZA 2FLRH 5AF9H 1O32A 1M9UA 1SGFG 2HPPH 1DPOA 1GPZA 4GPGA 2XWAA 3SU1A 3TNSA 2BLVA 8GCHG 1HAPH 3RC6A 3L6PA 4O97A 1QQ4A 1TONA 1SPJA 1NROH 4AB9A 1PPHE 1AE5A 1QJ1B 3FAOA 2HNTE 1OWHA 3OU0A 1KLTA 1MUEB 1C1RA 5IYTA 2RG3A 2SGAA 2Y6TA 4AORA 1TRMA 1UO6A 1E36B 4OS5A 2DE8A 3K6ZA 1SLUB 1WSSH 2QV1A 1WQVH 3H7OA 1P2NA 3SNBA 5T6FA 3RU4T 3ZZ9A 2VB0A 3GCHB 1V2WT 1MTSA 1TAWA 3SU5A 1O2MA 5PTPA 1ZHMA 3DHKH 4X8UH 1HJ9A 2FESH 5AVDA 1KYNA 2BVRH 1K21H 3KQCA 1O3MA 3P8FA 2I6SA 1BITA 1QRZA 4HGCA 4BAQB 2A4OA 1C4U2 3SV8A 4NSVA 5F8TA 5E2PA 1PJPA 1OWJA 1TFXA 1P2MA 2AMPA 1EZUC 4WF8A 4RSPA 2PKSB 1C1TA 1S6FA 2R9PA 3DFJA 3SQHE 1GHAG 1QQUA 1F0TA 1HJ8A 3S9CA 3KIDU 4K8BA 5J4SA 1MTNB 2ZA5A 2SGDE 4FUIA 5FPYA 1YM0A 2ZPQA 2ILNA 4DG4A 4X2XA 3LGIA 2VIQA 1K1OA 1G2LA 1HYLA 1V2VT 1SGPE 4FU7A 1SQAA 5JBTA 3RXKA 2BDBA 3S9BA 3K6YA 6LPRA 1NFXA 3GDVA 1C2KA 1HXEH 1GBLA 1MAYA 1PYTC 1W0YH 2SGPE 4JZIA 1DLEA 3GICB 4CR5A 1QY6A 1TGBA 3DA9B 3S69A 2JETB 2Y5HA 1TRNA 2QYIA 2W5EA 1MZDA 4BAMB 2W3IA 2J2UA 5GXPA 1PQ8A 2FYQA 3A7VA 3BIUH 1TGCA 4WH8A 4VGCC 1NESE 5FX6A 3EA8A 2AMDA 2VIWA 1TYNA 4AOQA 4MVNA 3KNXA 2NU0E 1O3EA 4I8GA 2Q1JA 1CU1A 2ZTYA 1BJUA 3GY3A 2P94A 3BTEE 3D49H 3SJIA 2ZWLH 4X2WA 3MHWU 1C2IA 1CT4E 3ODFA 2OCVB 1K9OE 4E7NA 1SGEE 4Y0YE 2H5DA 5E8EH 1AWHB 1BRBE 1HRTH 1A61H 1PYTD 3OX7U 2RCEA 1D4PB 1BBRH 1BB0B 4FUEA 2KAIA 1V2ST 3ZZBA 2GDEH 1ESBA 3ZZCA 1F0SA 2FO9A 1DANH 4AFQA 2TIOA 3UTUH 2AH4X 2VWMA 5JDUB 4GHQA 4H42U 1O2TA 1HNEE 1GI4A 3RXFA 3A7YA 1BMMH 1P09A 2GMTB 2R3YA 1ELAA 3RXDA 3GCTG 2FODA 4IMQA 3QGJA 1WQSA 2XYAA 1ZR0A 4AFUA 2I6QA 3SNDA 3VEQB 2V0BA 3P8GA 3EDXB 3L3TA 3EE0B 4Z0KA 1WOFA 2GCTB 1YLCA 1DUAA 1KXAA 1D3DB 1P2KA 3TU7H 1V2UT 2PUQH 2FLBH 3RLWH 1ZPZA 3HKJB 1JOUB 3SV7A 1AUJA 3RMMH 1G9IE 3MWIU 3SU6A 1C1OA 1ANCA 1HB0B 2RA0A 2QXHA 3FFGA 1UVPA 1AY6H 3KQEA 3T62A 3S7HB 1UTOA 1YBWA 1CBWB 1FQ3A 2FZZA 3E6PH 1O2VA 1TA2A 2ZHQH 1Y8TA 1DVAH 4JZ1A 1UTMA 2OINA 2WV5A 1A3BH 1DM4B 5F8ZA 3GCHC 4E7RG 1AD8H 1CT2E 1TA6A 4X8VH 2A2XH 2NU4E 3Q3XA 4K5ZA 3P92A 1O34A 1O3HA 1THRH 1ZPCA 2OC7A 1XKBC 4ZUHA 1BTZA 1ANDA 1AWFH 3QK1A 4CHAB 3U1JB 4UFEH 2C8YB 2ZU1A 3QGNB 4FVDA 1O5GH 2FS9A 3SO3A 1UK3A 2ANWA 3MOCA 2PKSC 3A84A 5E0GA 3O8CA 1C5XB 1ZMLA 1HPGA 3TJNA 4CRCA 3AASA 1A1RA 1P9UA 2JH0D 2ALPA 2ZDAH 2P59A 3CS0A 3MH5A 3MH4A 2B0FA 1MTNC 1L1GA 1TRYA 2VVVA 1D3QB 3BG8A 1QIXB 1YPEH 1TMUH 4U01A 3A82A 1N8OB 2J4IA 1ID5H 1ZSKA 2SNVA 3FVFB 4X0WU 1QJ7B 1HCGA 2Y7XA 1BA8B 2STBE 2JH5D 1ZHRA 2CJIA 1J17T 4MPXA 1SVPA 1MU8B 1BBRK 1ZTJA 5LPFA 4ISLA 4Y11E 1FY8E 1QB6A 1ZZZA 3SJOA 3RM2H 2A32A 2JETC 4WWYA 3TJVA 1ACBE 2A31A 1AZZA 3NCLA 2FOHA 3F9EA 1HBTH 3M7QA 1NFWA 1UTLM 3UNSA 2Z94A 1C2LA 2GD4B 2OC1A 2ULLA 5ETXA 1KDQB 2Q6GA 5FXLA 3GCNA 4U30A 2XNIA 1EJNA 1Z1JA 4FXGH 4I33A 4Y7AA 1ZTLA 4UFFH 1FDPA 1Z6EA 1QL7A 1IHSH 2QXIA 5BPEA 1C2GA 2GTBA 3A89A 5DK1A 3PMJA 3I29A 7LPRA 1MCVA 1GL0E 1EXFA 4PROA 3ATLA 4DURA 1TBQH 2GV6A 2WUCA 2QCYA 1LKAA 4OS7A 2GZ8A 1TBRH 1V2NT 4CRFA 1O2QA 4YT6H 1BRAA 1T31A 2QN5T 3A83A 2G51A 4CH2B 2O8UA 2AERH 2ZHFH 1GMHF 3ZVAA 2D26C 2GMTC 1HAHH 2BD7A 1E0FD 2F9PA 3EA9A 3RDZA 4D76A 2BD8A 1BTPA 2A4GA 3TNTA 1EP5A 4XSKU 4X6NA 5EXMA 1J8AA 4BAKB 1GDUA 4Q7XA 1LHGH 1V2JT 4XBBA 1OP0A 4ZXXH 1HV7A 3BV9B 1ETTH 3LH1A 1QB1A 1THPB 1Q2WA 2GCTC 4DGJA 2BZ6H 1OYTH 4CBOA 3UWIA 2BVSH 2OC0A 4A1XA 1ZLRA 1O3OA 3U69H 4Y79A 1XUHA 2BYAX 1Z1IA 2A2QH 2Y80A 3QN7A 2H9EH 2UWPA 1EB2A 1GMHG 1QGFA 1MBQA 1PPCE 3HK6B 4NIWA 2ZDKA 3VPKA 1K28D 1CHOG 2CF9H 1NY22 1IQHA 3FP7E 1LVOA 2PSXA 1Y3YA 1Z6JH 4ZKRU 2HRVA 1SOZA 1JIMA 2VIPA 1EPTA 1MU6B 2C4FH 1GI6A 3TK9A 1LHCH 1DITH 3RU4D 3UQVA 1F5RA 2A0QB 1GI1A 2VH6A 1GHBG 4CREA 2XW9A 4UDWH 1HJAB 1W14U 3MFJA 4CHAC 3BEFB 2SGFE 1EJAA 4WXIA 3F9FA 4MNVA 2BMGB 2WPMS 2B9LA 4BTUB 4ZKSU 4MG3A 4FUBA 2BOHB 1GMDF 3RXAA 4QT8C 1C9PA 3ZV8A 2ZDNA 1MTUA 1L0ZA 1ELBA 2AIQA 4Y71A 3UUZA 2P93A 1B0FA 4LOYH 1EJMA 1O5CB 1YKTA 3E1XB 3ATKA 1ARBA 4E05H 1OWDA 1S0RA 1NS3A 1ORFA 2A5KA 3OY6U 2QXGA 3U1IB 4AB8A 1DSUA 1N8OC 3A86A 3OSYA 1O35A 2YOLA 1D3TB 2F83A 1O3AA 1E37B 1RXPA 2ODYB 2BQ7B 3TGKE 3P17H 3VXEH 4ASHA 3M36A 4Y7BA 1SBWA 1MBMA 1T8NA 3RXGA 4SGAE 1G3BA 4DIHH 1KXCA 1BUIA 2G4TA 1P8VC 4GHTA 1QL8A 1W12U 1BRUP 3ZV9A 1SL3A 4GAWA 1O5FH 1UTNA 4AFSA 1H4WA 3DD2H 1V6DA 5ABWA 3E8LA 1VJAU 1DUEA 3BTTE 2AIPA 3SQEE 1P2QA 4ZROA 3SOSA 2XBYA 4JCNA 1TX7A 4AYYB 5AFYH 3QTOH 1E34B 3KHVA 3PMBB 1X7AC 2ZFSA 1EOLA 3RXVA 2AYWA 2THFB 1FNIA 3AVZA 3PTBA 1B0EA 1OKXA 3W94A 1GVZA 2GT8A 3SGQE 1FZZA 2ZCLP 1C5ZB 1E38B 2CXVA 2PFEA 2ZC9H 5CHAB 4YLQH 1P2JA 4CH8B 4B76A 4X1QU 5T6GA 2B8OH 5K7RA 2BDGA 4NCYA 1GCDA 2H9TH 1LPKB 1D9IA 4DIIH 1OSSA 3PV4A 1W7XH 3WY8A 1YGCH 1FN8A 1T32A 2CGAA 1FY3A 1YPKH 1KLJH 1ELTA 6GCHG 4RKJB 1KIGH 1EP6A 3BEIB 1Z71A 3GCOA 1IQIA 1GDNA 1ZMNA 2B5TB 5A8XA 1T8OA 1YCPH 5LPRA 2VU8E 2WPLS 3GISB 4AYVB 4CBNA 4D7GA 2FTLE 1HAVA 1DX5M 1C2FA 1O2KA 2TRMA 1ELFA 6ESTA 4CRBA 3Q77A 1AFQB 3MU8A 1UCYE 2J34A 2ZFTA 4IN1A 3VB7A 1WU1A 1A4WH 2P8OB 4IC5A 1A7SA 2BY7X 1NFYA 1KY9A 1Z8JB 2G5NA 4FUDA 1P04A 4MNXA 7GCHG 2XTTB 3SU0A 1O5BB 4XFQA 4ABGA 2ZTXA 1IQKA 2G5VA 1TX8A 1ANBA 2BOKA 5EODA 3TH4H 3SHAH 1Z8GA 3PMAB 2PGQB 3GYMA 3LU9B 2F9NA 1B5GH 1GBIA 1VZQH 4D9QA 4K1EA 1A0LA 3QWCH 2IOTA 3FZDA 1GJAB 1HJAC 1O5DH 4IMZA 3HGPA 2FIRH 3TGIE 1ELVA 2EI8A 2ZCHP 1TGTA 3SGAE 4INHA 1DT2A 1YC0A 2FMJA 1Z8IB 3RXTA 2XC5A 4JYUH 4B73A 3F68H 3M3VA 1O2HA 1WUNH 1EAXA 1QA0A 4H6TA 1EASA 2BD2A 5EGMA 4GUXA 1LHDH 5T3HA 3UFAA 1WTHD 1O2YA 1O2ZA 4MLFB 2VH0A 5GDSH 4RN6A 3ZZ8A 2BVXH 1F2SE 3MMGA 1UVOA 3SN8A 2ZECA 2GP9B 1C5YB 1O2XA 1IQLA 5B6OA 2QIQA 5DP8A 1GJ6A 1SFQB 3RXEA 4YTAA 2EI7A 2WUBA 2BZAA 1FIWA 5GCHF 5A8ZA 2C3SA 1QFKH 1SGRE 2VNTA 1DXPA 1MH0A 3F1SB 5GJ4B 3I77A 5F03A 2J9NA 1AQ7A 2SFAA 1AO5A 4ZMAH 1YCPK 1O2UA 3GY8A 3SBKA 2OXSA 3C1KA 2A45B 4YESB 1PFXC 4ZKOU 4TWWA 5DP4A 1HDTH 2VVCA 1KXEA 5HM9A 1ABJH 3GOVB 4XBDA 2O8TA 3D62A 1HAXB 1ZOMA 3EYDA 1BZXE 1TWXB 1C5QA 2A7HA 3CS7A 2OUAA 2ZFFH 3RXQA 4H6SB 1EOJA 1RS0A 1TPOA 1Z8RA 2PSYA 1BT7A 2XBVA 1O3GA 1AE8H 3RM0H 2C90B 4GLYA 4IW4E 4FUHA 2Z3EA 5ESTE 1OYQA 1BRCE 1IQEA 1NM6A 4E06H 1SGFA 4X6OA 4XOJA 3Q76A 2O9QA 3E90B 1TPAE 1AKSA 2YNBA 3U8OH 3ZVBA 1OX1A 1CT0E 3FANA 1A5GH 3LPRA 1BHXB 3MO6A 2F9VA 3QZQA 5C20A 1P02A 1TNJA 2ASUB 2VINA 4JYVH 1O2JA 5A8YA 1AVWA 3BTHE 2IPHA 1JXPA 3AAUA 4WMEA 2WPJS 2OTVA 3PMHB 1EPTB 1FXYA 1AFQC 3SJKA 3M5LA 5IDKA 2P8OC 5A09A 1W7GH 1G3EA 4Q2KA 1E35B 3PLBA 1XUGA 3A8DA 3EAJA 1V2PT 1PQ5A 1SQOA 1O3JA 4NSYA 3GY7A 1SQTA 4BNRA 4K1TA 2CMYA 1NN6A 2V35A 1TLDA 2PGBB 3URCA 3V3MA 2LPRA 1JMOH 1LO6A 4NA7A 2EEKA 4KELA 1EZSC 3RUOA 1A3EH 1DS2E 1L4DA 1VGCB 3TH2H 1GHZA 2P3TB 2OD3B 4X6MA 4ABHA 5EW2H 1T8MA 1C1MA 1TQ0B 4K69A 1F5KU 2ZU4A 4FUCA 3UY9A 1QBVH 2ZHWH 5DP7A 3SV2H 2F3CE 1NRPH 5DP3A 4FVBA 1ZRKA 2FX4A 1Y5UT 6CHAB 2PV9B 1NRQH 3ESTA 4Y6DA 1GBHA 3GY6A 3BTGE 1FJSA 1V2TT 1OWIA 3SNCA 2GGVB 2C8WB 2PR3A 2QF3A 2ZZUH 1P10A 2NWNA 3F9HA 2BDIA 5C1XA 4THNH 3B8JA 1IOEA 4OS1A 2G52A 1ZJKA 2FI4E 1LPGB 3ITIA 4Q80A 3FP8E 1UTPA 3PWBA 1LVMA 5HMAA 5C1YA 2HPQH 3ZYDA 2BLWA 4LZ1H 1P12E 1GBDA 5EXNA 4I32A 1V2OT 2W3KA 3A8BA 4NFFA 1UVSH 3UOUA 1FIZA 1V3XA 1SMFE 4ISNA 1O39A 8LPRA 3T27A 3ZVFA 5L2ZH 1A0JA 1TGNA 1GJBB 2A7CA 3RXUA 3A87A 1GI9B 4NZLA 2XC0A 1WTGH 1XX9A 1CQQA 2HGTH 2ZKSA 3PYHA 4KTUA 4BXSA 1ZSLA 2WYGA 3ZZ5A 1KTTB 1FONA 1SG8B 2BM2A 1NO9H 3BF6H 1GBAA 4ABDA 1JRSA 3M35A 4YOJA 1C2JA 3HKIB 4ZH8A 4BOHA 5JBCS 5JPMH 5C3NA 1Q31A 4INKA 1O3DA 1G36A 3AW1A 1SGNE 1TNLA 2ZF0H 1C4V2 3QDZB 1HAVB 2AEIH 3A85A 2TBSA 4NG9H 3ZVEA 1BHXF 1PQAA 1BTHH 2BY5X 5JYIA 5HXFA 5E0JA 1VITH 1BJVA 1AHTH 1Q3XA 5EQSA 3TITA 3VB6A 2D2DA 3MH7A 3W95A 5C2ZA 3LGYA 1C9TA 2C8XB 5DO4H 1GBBA 1O3BA 5HM2A 1W3CA 2ANKH 4GSOA 1O3FA 4MNYA 1RFNA 1D3PB 1EPTC 2ZGXH