2FMJA

220-loop mutant of streptomyces griseus trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Conversion of trypsin into a Na(+)-activated enzyme.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA02
3UNQA 1VCQA 2ZFPH 1DICA 2KAIB 1CA0B 3M7UA 3TK6A 1UVTH 1SHYA 5A8ZA 1HV7A 1ABJH 4ASHA 1GJAB 1TLDA 1QQUA 5BPEA 2V3OH 2GMTC 4O03A 4NZQA 3N7OA 1TOMH 2ZDVH 1D4PB 2ZU2A 3KQDA 3PLBA 4Y0YE 2FOBA 4GHQA 2GZ9A 2VIWA 4B2AA 1SGCA 2B5TB 4YLQH 3MO3A 1PPHE 2XTTB 3HKJB 1BB0B 1GI9B 5I25A 2A45B 4AYYB 4YT6H 4NSVA 1RXPA 1FPCH 3M5OA 4BOHA 6LPRA 1RGQA 2GV7A 3MNBA 1GHVH 4MLFB 1XM1A 1TA2A 1WSSH 1BIOA 1EAXA 4JZ1A 2FDAA 4Y7AA 1TX8A 1E35B 2BB4A 3BIUH 5FXLA 1O2XA 5ESBA 5A2MH 2OC8A 2STAE 5K0HA 4XOJA 1XKBC 1CE5A 1SLUB 2ZHQH 3RXVA 1DOJA 1GGDB 1IHSH 2YOLA 3A8AA 1S0QA 4BXSA 4YOJA 1IAUA 1L2EA 1TBRH 1BTYA 5C1XA 1Q2WA 1CGIE 2FLRH 2W7UA 1N1LA 3D65E 4ZHMU 2Y5GA 3D62A 3PWBA 1YF4A 2EC9H 3ZVEA 2FM2A 1O3MA 4FUEA 1C5MD 4K3JA 1RFNA 1O2GH 1C1RA 2OBOA 1KDQA 1FIWA 1GHWH 4B2BA 5GDSH 4LOYH 3RC6A 3RC4A 1PFXC 5EU8A 4Q2KA 4OGXA 4CH2B 1P06A 4X6OA 4BAMB 1XXFA 3A8BA 1VJAU 1UVPA 2AGIX 2K1QA 2J9NA 2QGRA 4SGBE 4TY7A 2F9UA 1GBLA 2CF9H 2JH6D 3OTJE 4BTTB 5C1YA 2C8YB 3TPIZ 1QFKH 1C5VA 3PWCA 1DX5M 1BT7A 3MWIU 2BD3A 1YP9A 3AASA 3LT3A 3SJKA 2H5CA 3F9HA 2BY8X 4K1EA 1SSXA 2W3KA 2FO9A 3SQHE 3A8DA 1P2QA 1C5YB 1G2MA 1S85A 3L6PA 4DURA 1O2NA 4FUIA 1YCPM 3KEEA 4YO9A 5C20A 4ABAA 3E16B 2XYAA 3P8GA 3RXDA 1BQYA 4INKA 4I8GA 4D76A 1C5TA 2FOHA 2HPPH 1ZHPA 1MD8A 1J15A 4AFSA 3KQCA 1GCTB 2C93B 3ZZ4A 1GGDC 3BTKE 3JZ2B 1QL7A 1P2MA 1QBNA 3TGIE 1N8OB 4X1PU 1BITA 3BTME 1QQ4A 2VIVA 2VWNA 2O8TA 3E3TA 4R8TB 2SGQE 1HAGE 2ESTE 5AFYH 5GPIB 1HAYB 3QN7A 5K7RA 2VINA 4A1VA 1T8OA 5E8EH 5FBIA 1C2EA 2WYJA 2PUXB 4I32A 2NU0E 1HDTH 1GBJA 1KSNA 2V6NA 3OX7U 2P94A 4OGYA 1YPEH 1JWTA 2C8WB 2ODYB 1P01A 2AGEX 3H7TA 4NA9H 2G8TA 1HCGA 4MPVA 5A0CA 4AX9H 2Y81A 3GDVA 4INHA 1W7XH 4TPIZ 2V3HH 1V2VT 1NY22 4FUJA 5E2OA 1YC0A 1CQQA 2ZGHA 4KGAA 1P3EA 3NK8A 1GJDB 1Y8TA 4GPGA 3K2UA 4NFEA 4O3TA 2NU1E 1G3CA 1OSSA 1G9IE 2BDBA 5E0HA 2ZDAH 1YPKH 2BXTH 1SOZA 1AUTC 1DUEA 1C2FA 2H6MA 2HVXA 2BY7X 1P9SA 2A2QH 5C2ZA 3HK3B 3E6PH 3OY6U 1ZTLA 1BTWA 1Z8RA 1Y3YA 1T8NA 2PW8H 1GHYH 3UFAA 1B5GH 7GCHF 1LPGB 2GTBA 2ZCLP 1ELFA 1GL1A 1LKAA 2QIQA 2QF3A 4I8KA 5EQRA 3SU0A 1BJUA 3T29A 1NFUA 4B73A 3UPEA 5BRRE 3F9FA 4Q80A 1N8OC 1O5EH 1OWHA 1O2TA 1ZGIA 3O8BA 3TJNA 2HNTE 2D26C 1MQ5A 2AMQA 4A92A 2WPLS 3OYPA 3NKKA 4JYTA 4ABEA 3RXQA 3HGPA 1V2OT 2B8OH 1S83A 2F3CE 2P8OB 2PSXA 2Q6DA 3M3SA 2BQWB 3RXEA 1KLIH 1NROH 2WUBA 2ZFSA 3U8TH 5IYTA 4Y8ZA 5FPSA 1L1NA 3P92A 3S69A 5T6DA 1OKXA 2BY5X 1SLVB 4CH8B 1E38B 1ZJDA 3RC5A 1HBTH 3VGCB 3PO1B 6CHAB 2C3SA 4WJG2 1D6WA 1O3EA 2XC5A 3HK6B 4I33A 1FY1A 1SGYE 2FODA 1LVYA 4B71A 2CV3A 1EAWA 1O34A 3E8LA 1YPJH 2ZCHP 2D1JA 4LZ4B 1UK4A 1M9UA 1O5GH 2BZAA 2Q6FA 1KTTB 2XNIA 4WMFA 5DJ7A 5F03A 4AFQA 1SGFA 5PTPA 2WV5A 1O2WA 3ZVBA 1TNHA 4IN1A 2PWXA 3RXTA 1D3TB 3MI4A 3URCA 5CMXH 2OC1A 1A4WH 1OWEA 1PQ5A 2XWBI 2BLOA 4UFDH 1V2UT 1LHGH 2HALA 1JRSA 4AORA 1AVXA 4XBDA 1TBQH 3MH6A 3ZV9A 1HAVB 2ZO3H 2FOGA 2ZU5A 4ABDA 4UDWH 1ACBE 3MNXA 1W3CA 3A86A 4OS6A 1OP8A 1EJMA 1AFQC 1YPLH 1GJ5H 1QA7A 2BQ7B 4MVNA 1GG6B 2TRMA 3P95A 4DJZB 1XMNB 2TIOA 3MO9A 3UWJH 4CRGA 3SV8A 4B76A 4ZROA 1E37B 4ABGA 1IQMA 4Y71A 4MPXA 2IJOB 3KNXA 1RIWB 1AZZA 6GCHF 3KN2A 3SU6A 3RXGA 1THSH 1JIRA 3V7TA 3SNEA 2VVUA 2EI8A 2FI3E 1C4U2 3VGCC 6CHAC 2GCHG 2V0BA 4JZDH 1AWFH 1OWIA 1IQNA 1EB2A 1ESBA 2VVCA 2FOFA 1O3FA 2FYQA 4X6PA 2ZQ1A 4DY7B 3TJVA 4K8YA 1YM0A 4CHAC 2F9VA 1SGPE 1O5FH 2G4TA 1MZAA 1P2KA 3SI4H 3RLWH 3EGKH 1SL3A 3M5MA 3FP8E 3AAVA 5L30H 7LPRA 1MTNB 1FN6A 2IN2A 1GJ6A 2ZCKP 1GI6A 2ZC9H 2XRCA 4CRCA 1VITH 1MTVA 5GJ4B 1O3DA 2ZHFH 5TCCA 4AZ2B 4Y76A 3EAJA 1LHFH 3SU1A 1DY9A 4PROA 1ELGA 2QXGA 1DM4B 1S0RA 2ODQA 2EI7A 2WPJS 1H8DH 4MG3A 4Z6AH 2ZI2H 3SV9A 3MO6A 2CJIA 4H6SB 1ESAA 1O0DH 2A4QA 1SGDE 3LH3A 3BF6H 3SN8A 6GCHG 4FUCA 1CBWC 4NWKA 5DP8A 1FY3A 2J38A 1Z6JH 5EOKA 1MBQA 3SO3A 1RIWC 1GI7B 1TGTA 1NRRH 1FMGA 5EXMA 2P3TB 5A8YA 1V2KT 1NRNH 4DCDA 1GBCA 1UHBB 1ZGVA 4KTUA 3A7TA 5HM9A 3M3TA 1ZPZA 1P02A 1GMHF 1LHCH 1NTPA 1MMJN 2AGGX 4THNH 3ZZDA 4GLYA 2ZHEH 3NCLA 2A5IA 1F5KU 1GI0A 1HAVA 2ILNA 4ZKOU 1O5CB 1TMUH 3LGIA 1MUEB 1O33A 1S81A 3SBKA 1VGCB 3QO6A 1P2OA 2SGPE 2V35A 4JMYA 3PMJA 1GBFA 5GCHG 3P70B 1C1SA 1CU1A 1RD3B 2BD5A 1QB1A 1TX7A 2R2WU 3FVFB 1EJAA 4DT7B 2F83A 4KKDA 2BLWA 3RXSA 4NA7A 1NRPH 4BAQB 4TPYA 1K1LA 5EGMA 2ANYA 3LIWA 4FU9A 1TIOA 2FS9A 2BD7A 3BG4B 4JZEH 3T2NA 3BTHE 1W13U 2G00A 3EDXB 1ZRKA 1C1UH 2CGAA 1WQVH 1F0RA 1ARCA 4X0WU 1K28D 5E0GA 4IS5A 1O2OA 3SV7A 3GY6A 4K1TA 4ABHA 1ELEE 1GI8B 4IMQA 1PPBH 1UK3A 4E05H 1O3NA 2JKHA 2PFEA 2AS9A 4ZXXH 3O8DA 3M61U 4J2YB 1ANDA 4ZMAH 3QUMP 3SORA 3VXFH 4AOQA 1GMHG 1JBUH 1F0TA 1F0UA 1ZMLA 2PGBB 2H2ZA 2NWNA 2Y7ZA 3STIA 4E7NA 3UY9A 3RMOH 2BMGB 2PLXA 1AB9C 3RMNH 4Q7XA 2VJ1A 1AU8A 1K22H 3BTWE 3LGVA 4CR5A 4CRBA 1AE5A 1GDNA 1LHEH 3UTUH 3B9FH 2OP9A 4X1RU 2G4UA 2BOHB 1OPHB 4VGCB 2OD3B 1PPZA 1F5LA 3GY7A 1U6QA 1YLCA 1EKBB 1QRXA 1IQIA 1DXWA 1ZRBA 2BDGA 3VB4A 3GYLB 1C1TA 1Y3UA 1W12U 3E1XB 4U2WA 1HJ8A 1SQAA 1OXGA 3W94A 4MPUA 4K5ZA 1H8IH 1S6HA 3F68H 3ATLA 5CHAB 1YYY1 1Q3XA 4RKJB 3TGKE 2C8ZB 1J16A 3BG4C 3LGTA 1ZJKA 3RXHA 4ABFA 3NWUA 1TPPA 1UVUH 3SOSA 2F9NA 5EPYA 2B7DH 3IITA 2A0QB 3MH5A 1O2PA 1TX6A 3ZZ7A 2ZTXA 2ANMH 5DP4A 4X6NA 3MTYA 1CSOE 1L4ZA 1KDQB 1BTHH 2PSYA 2ZWLH 5DKMA 3FZZA 2VGCB 5DPAA 5EXLA 1HFDA 2GDDA 3QWCH 3S9CA 1EJNA 3TNSA 1FZZA 3SUGA 1G3EA 3E0PB 1ZHMA 3S9AA 1QJ6B 3GCTF 2OC7A 1FIZA 1A0HB 1OP2A 1TNKA 2WV4A 2G5NA 3A81A 5L2YH 2XCFA 4UFFH 3RXOA 2QCYA 5L6NH 3MMGA 1QGFA 1K1OA 3GOVB 2OQUA 4VGCC 1O3PB 3L3TA 1WTHD 1L0ZA 1B0EA 4A1TA 2GZ7A 5EXNA 3U1JB 2SGEE 1CGJE 5CE1A 1GBHA 5LPEA 1TMTH 2BX4A 3MHWU 3MOCA 2P16A 1NU9A 4BTUB 1C2KA 3GY3A 3M3VA 2CXVA 3I29A 1QBVH 2ZTZA 1P04A 2FI5E 1QR3E 1HXEH 2FPZA 3GCHB 1ZSJA 1SBWA 3RXKA 1BHXB 4LK4A 1UVOA 1KXDA 1O2MA 3K65B 1PQ7A 4I7YH 2ZU4A 1IQFA 2WPHS 2Q1JA 4X1QU 3ITIA 1DANH 2M5TA 2GV6A 3GCTG 4JYUH 4OS4A 3BTQE 1Z8GA 1O5AB 1PQ8A 4MNYA 1PJPA 4Q7YA 4HFPB 1HRTH 2ZGJA 1C1OA 1FPHH 1DLKB 1EX3A 1UTQA 2LPRA 2YNBA 2PKSC 3ODDA 4AGJA 4JK6A 2O9QA 1CA8B 1FJSA 3R0FA 1C4Y2 5A09A 4O3UA 3PROA 2EA3A 1FN8A 3RXPA 1ZLRA 4RN6A 4OS5A 1A5IA 1P11E 4GVUA 1FV9A 4CR9A 1QNJA 1CA0C 3T27A 2XBYA 1XX9A 3RXLA 1ZMNA 5FPYA 2A2XH 4GHTA 3KHVA 2Y5FA 1BDAA 5DP6A 2ZPQA 5T3HA 3SI3H 1MH0A 1O3CA 2PKAA 4X1NU 1GCDA 2HWLB 1ANBA 1G2LA 5JB9S 4NA8A 3RXJA 2HGTH 4B1TA 1WQSA 4ISNA 3SU3A 3GCHC 2Y82A 3VB5A 1MQ6A 3EYDA 4X8SH 4F4OC 1LHDH 3BTGE 1GI4A 4Y0ZE 4Y11E 1HYLA 4ABBA 3BEFB 3G01A 4WXVA 4ZKSU 3Q00A 1T32A 1QY6A 4UFGH 2BDAA 1TNGA 2F9OA 4GCHF 1EASA 1T31A 2FS8A 1TGCA 2FX6A 3UQVA 1C2LA 2GKVE 3FZDA 1GVKB 1F0SA 3ZVCA 1YPHC 2SNWA 4WH6A 2BX3A 3U69H 3MU4A 1C4V2 3Q76A 4AFUA 1FONA 3CS0A 4YLUA 7ESTE 2PGQB 1HXFH 1GMCF 1GBBA 3A82A 3RU4D 2XBVA 1SOTA 4BANB 1BTPA 2BDYA 2A32A 4FVDA 2B0FA 4X6MA 1SC8U 5LGOA 2Z7FE 1CT2E 3RP2A 4DOQA 5EPNA 1TOCB 3ZZ6A 5JDUB 3PLPA 1CGHA 4TY6A 2FZZA 2CF8H 1O32A 3JZ1B 5F8XA 1G30B 4MPWA 1JIMA 3DHKH 2ULLA 1GBAA 1WTGH 5JB8S 3URDA 1ORFA 1DWDH 5ABWA 5FPTA 4Z0KA 4RKOB 1XUIA 1GPZA 1O3JA 1ZPBA 1DWCH 1K1MA 1PYTC 4GCHG 1UJ1A 1P2NA 1FQ3A 1KY9A 1SGIB 1DPOA 3ZZ3A 1C1QA 1IQEA 1HAPH 1OS8A 1C9PA 1PPGE 1GJ4H 3LGYA 3ATIA 1YPGH 2ALPA 2R0KA 3RXUA 2BDCA 1P8VC 1EP5A 4NGAH 1TWXB 1TONA 2C8XB 2VIPA 2VIQA 2WINI 5TJXA 3RXAA 1V2RT 2PTCE 2J95A 1A46H 3ZVDA 1GCTC 4HTCH 1ELVA 4K8BA 4CRFA 1LMWB 1K1IA 5FHTA 1ANCA 1PPCE 3GDSA 1W7GH 1ZHRA 2TGTA 3SUEA 3IWMA 1NRQH 3TLOA 3MU5A 3BTDE 2BY6X 3ZZAA 2HNTF 4NIVA 5JBCS 3T5FH 3EE0B 1IQJA 4DVAU 5B6OA 1HAXB 2G52A 4D8NA 1AQ7A 2P59A 1W0ZU 2THFB 5F6MA 2H9HA 1AUJA 1VJ9U 1W11U 3Q3XA 2Q6GA 1RTLA 2R9PA 3IG6B 3PMHB 1D6RA 2OBQA 3LGUA 3AAUA 1HJAB 1MU6B 1ZSLA 2QC2A 1TRMA 4D9QA 5J4SA 1UTNA 2H9EH 3RM2H 3A80A 1ZYOA 2AMPA 1O3KA 2F91A 4IC6A 3VEQB 1O3OA 3PTBA 3TU7H 1KLJH 1V2ST 2G81E 7GCHG 3KQEA 3STJA 3TK5A 1AGJA 1MCTA 1WV7H 2A7HA 1FY5A 3S0NA 4I31A 3K9XB 3U98H 1IQKA 2PHBA 5ETXA 1LKBA 2HPQH 1QIXB 1GBEA 1DE7H 1WOFA 3F6UH 1F5RA 1GMDF 4ZKNU 2AEIH 3QGJA 1UTPA 3GDUA 4XFQA 1AD8H 4FUDA 2BXUH 1CHGA 3V12A 2WUCA 3VPKA 1QB6A 4CBNA 3A83A 1A2CH 2OTVA 1ETRH 3SJOA 3S9BA 3RLYH 3MNCA 3V13A 1O2UA 5E0JA 2ZNKH 1GHXH 2P8OC 5HXFA 1DWBH 1VITF 3BEUA 3LGWA 3KL6A 2W3IA 1O3IA 1X7AC 1C5LH 1GVLA 3CENA 2ZTYA 1IHTH 2SGFE 2Y7XA 1P2JA 3A7ZA 1Z6EA 1Z7KA 1C5QA 5AHGH 1PPEE 5EW1H 3FFGA 1A0JA 2JH0D 1E0FD 1FY8E 2P3UB 3PO1C 3ENSB 4HZHA 1LDTT 1TQ7B 5DP7A 2XXLA 4BXWA 4YT7H 4AG2A 4E06H 9LPRA 1GBDA 1V2TT 2C90B 2SGDE 2A1DB 1MTUA 1BTZA 1RJXB 1TMBH 1IOEA 5DK1A 1O2JA 1XUJA 2JETB 1RS0A 2HRVA 1O5DH 3BG8A 3DT0H 3AW0A 1BOQA 3E0NB 4DG4A 3UUZA 1Y3WA 2UUKB 2AMDA 2ZKSA 4Y79A 3LC3A 1AN1E 2FOEA 3A7VA 8KME2 3SJ9A 1K9OE 1O2IA 1C5NH 2HNTC 1NPMA 1NO9H 4X8VH 1NFWA 1NU7B 2ZEBA 1XUKA 4H42U 1UTOA 1MCVA 2BYAX 3FP7E 1ZOMA 1HIAA 3RM0H 1TYNA 1DY8A 1FLEE 3U9AH 1O3HA 4NCYA 4X1SU 1EPTB 1GI2A 3ZYEA 1SGNE 3E90B 4XBBA 1FAKH 1GG6C 3DUXH 1IQGA 1J8AA 5HMAA 1CT4E 1S6FA 5E2PA 3TK9A 1TFXA 4MQAA 2W7SA 4FUGA 3EA9A 2A5KA 1S84A 4D7FA 1W10U 2WPIS 1BRAA 1LPZB 1LVBA 1DSTA 2TGAA 1V2WT 1NN6A 1ZTJA 3PB1E 3S7KB 1ZZZA 1AZ8A 1C9TA 3UOPA 1A7SA 3FANA 1O2RA 2W26A 3BEIB 1GBIA 3M5NA 1TABE 1Y59T 4UE7H 4FXGH 1ESTA 4NWLA 4Y7BA 1TA6A 2OLGA 4Q7ZA 3D49H 5T6FA 3RXFA 4DIIH 2QAAA 2GT8A 3TGJE 1NZQH 3OSYA 2ZDKA 4KELA 1A3BH 2JETC 4I8JA 1MD7A 1WAYB 1EZSC 2GZ8A 2QYIA 1HPGA 4MNVA 3F9GA 3GCNA 1C1WH 1TRNA 1ABIH 1AVGH 2BDHA 1MTNC 4BNRA 1V2JT 2SGAA 2J34A 1OWKA 2TBSA 3LJJA 3P6ZB 3B23B 4NG9H 2QA9E 4J1YA 4NZLA 1AY6H 5JBBS 4XDEA 4IN2A 1SI5H 1C2HA 1TRYA 1SGEE 4ZXYH 2FI4E 1FAXA 1KIGH 5LPFA 1GBMA 1DLEA 1GJ7B 1JRTA 4TWYA 1CO7E 3RUOA 4ZHLU 2TGDA 1Z71A 5LH8A 1ZTKA 2GT7A 3AW1A 1GHBF 1BMLA 4KP0A 1O3BA 3WY8A 3ZVGA 4NFFA 1ID5H 1Y3XA 3TVJB 5TCAA 3QZRA 5A0BA 3UNRA 2AFQB 2EEKA 1BBRK 2Z9IA 3TNTA 5FCKA 3K6YA 1T8LA 5GXPA 1AO5A 1L1JA 1AWHB 1EOLA 2OC0A 4HI3A 1EPTA 3LPRA 4I8HA 1VGCC 1QB9A 5F8ZA 5DP3A 1QJ1B 5DO4H 2GP9B 1SHHB 3SGAE 3ZZ5A 1MTSA 3KCGH 2H1UA 2BD8A 3P8FA 1K1PA 2AH4X 1FXYA 2ZZUH 1IQHA 1KXFA 1SLWB 5G4BA 3ZZBA 2UUYA 1AI8H 4NIXA 6ESTA 1HLTH 3RMMH 1UK2A 1GJ8B 4WMEA 4ZKRU 1Y3VA 3FP6E 2QF0A 1GI5A 2O8UA 4IMZA 1E34B 1GHBG 1LCYA 1RRKA 2UWOA 5F8TA 4U01A 8GCHF 1UCYK 1ELDE 1C5RA 1PYTD 1O2KA 4DW2U 2ZGXH 5GWZA 2ZQ2A 1ELCA 2GCTB 3M7TA 2ZPRA 1T8MA 1BHXF 3V3MA 2I6SA 1SR5C 1QA0A 4F49A 1TQ0B 2PKAB 2ZFRH 3EA8A 2Z3DA 2I6QA 3LC5A 2QY0B 3RXCA 3BV9B 2GGVB 2R3YA 1C1VH 2CHAB 3FAOA 4MNWA 3TH4H 1P10A 1J9CH 1H9LB 1TNJA 2P93A 2QXIA 2Z9GA 5JPMH 3DFLA 3EQ0H 4QT8C 3RXRA 1HUTH 3HATH 4UFEH 1BMMH 1GHZA 3AVZA 1AIXH 1F2SE 1YPHE 3SUFA 1GDQA 4YTAA 1V6DA 3A85A 1HAZB 3M36A 4TWWA 5C5NA 3UREA 4DIHH 1Z8IB 2J92A 1QRZA 2ZFTA 3M5LA 5CHAC 1Z1IA 2O8MA 2STBE 1QURH 1D3QB 3A88A 1C5ZB 1NESE 4K60A 1AVWA 1A3EH 2ANWA 2CN0H 2R0LA 1C2JA 3MYWA 2OUAA 1Y5AT 4NIYA 2A4OA 1ZSKA 1AE8H 3F9EA 4LZ1H 3OU0A 2PTNA 1GWAA 5FX6A 3RXBA 2VIOA 1KTSB 3UR9A 1Z1JA 4WXIA 2FWWA 3SGQE 4FU7A 4ABIA 1HAHH 2GCTC 1OYTH 1G36A 2OCVB 3A7XA 1Q31A 4H4FA 1XVOA 2VGCC 1O39A 4X2VA 1ARBA 4IBLH 2DE8A 3GCOA 3UNSA 5EW2H 2WPKS 4YZUA 1TBZH 2HOBA 3CS7A 2A5AA 3ATWA 4YESB 2GVFA 1JMOH 4ESTE 3TIUA 1NC6A 2CHAC 2XCNA 4KTCA 1ZR0A 1NFYA 1W2KH 1O38A 1MAXA 1SPJA 1QJ7B 3QTOH 1H9HE 4CBOA 3SHAH 5IDKA 1ETSH 1A5GH 1WBGB 4B74A 4B75A 3HKIB 1THPB 1INCA 1P09A 2BVRH 5C67A 1YPMH 1KLTA 2UWPA 5EG4A 1FI8A 1D9IA 1UTLM 1SGQE 4A6LA 4H6TA 1YGCH 1BMNH 4RSPA 4X2XA 1DT2A 1F92A 1G37A 1RTFB 2BTCE 1VZQH 3PTNA 2Z3CA 4E7RG 4BAHB 1DXPA 2G51A 2B9LA 3QX5H 4CRAA 5L2ZH 5FAHA 3P8OA 1ETTH 4XSKU 1LTOA 1OYQA 3SU2A 4AN7A 1BBRE 2BQ6B 1P05A 5JYIA 2AIQA 1V3XA 4ISIH 1A61H 3RU4T 3QK1A 1K1JA 1TPAE 4SGAE 4D7GA 3NZIA 2AIPA 3K6ZA 1O2YA 3MH7A 3QZQA 1EZQA 5I46H 1BTUA 1UTKA 3VB7A 3A87A 1NS3A 1AMHA 2QXHA 3CP7A 2WYGA 1J14A 5FBEA 3BIVH 1CHOF 1GBKA 1XXDA 1Z8JB 4INLA 1SVPA 1XUHA 3LH1A 3H7OA 1YBWA 3L33A 2ZDNA 3Q3YA 1TAWA 2KAIA 5SGAE 3MNSA 1BUIA 1G3BA 1GL0E 1KYNA 3S7HB 1EQ9A 2AYWA 1HGTH 4WY3A 2DUCA 1EAIA 2Y6TA 3A8CA 1XKAC 5C3NA 1RTKA 1A1RA 4CREA 2VWMA 2BD4A 3F1SB 1SGFG 1C1MA 2G55A 1G32B 2A4GA 1C5WB 5EODA 2SNVA 3PLKA 1UCYE 3M37A 1VCPA 3HPTB 5J4QA 1H4WA 1P12E 1MKXH 3TITA 3MU1A 2J2UA 4Y6DA 4O9VA 2GDEH 1O5BB 2VVVA 1GHAF 1XVMA 4MDSA 3VB3A 3SZNA 4Y8YA 1G3DA 3R3GB 1NFXA 3A89A 3LJOA 1BBRH 1C5OH 1MKWH 3KIDU 1V2NT 4I8LA 1KXAA 2ZG0H 1EZUC 2H5DA 1SB1H 2VWOA 4FU8A 2RCEA 3ZZCA 4AYVB 2GD4B 5H4IB 4ISLA 4WF8A 1O2SA 2P3FH 4MTBA 2ZA5A 2VWLA 4X2WA 1CHOG 3MU8A 3PV4A 3LOXA 1BJVA 3GY2A 1GJ9B 1P57B 1GMCG 3M7QA 1ZMJA 2ZDMA 3ATMA 2ZFQH 1ELAA 4U30A 1HAIH 1LO6A 2BM2A 1MBMA 1O3LA 4FUHA 1OWJA 1TNLA 2VH0A 3U1IB 2FOAA 3PMAB 2VIDA 5EQSA 2PR3A 1O30A 1DITH 1MU8B 1C5PA 2OQ5A 1O3AA 1O31A 2VH6A 2ZHWH 4ISHH 1EAUA 3ATKA 3TJUA 2XBWA 3SJ8A 1UCYH 1GHAG 3RU4E 3A7WA 3MFJA 2BY9X 3T62A 1C1NA 1DFPA 3QLPH 4R0IA 2ZP0H 4D9RA 1O36A 1D3DB 2FMJA 3LDXH 2FLBH 2BOKA 2QV1A 2R2MB 4ZHAA 1EUFA 1AFEH 4FVBA 1QCPA 1EOJA 1AFQB 1HIAB 3U8RH 1GJBB 2VU8E 4YOIA 2ZIQH 5C5OA 4JCNA 2RA0A 2BD9A 1GI3A 5HM2A 2OXSA 2QXJA 1GVZA 4IGDA 2R3UA 5JBAS 1NT1A 3UR6A 4LXBH 2O8WA 2Z9LA 3GICB 4X2YA 1QL8A 3ODFA 5A8XA 1YCPK 3ZZ9A 1UO6A 1K1NA 4JZFH 2UUJB 2FOMB 1QRWA 1IQLA 3SQEE 1OP0A 3TH2H 2ASUB 1N6YA 1QHRB 4AB9A 2FP7B 1A5HA 1UTMA 4WH8A 3D23A 3SNDA 3VB6A 3E91A 1HJ9A 4GUXA 1EP6A 5ESTE 4CHAB 5JBTA 3RXIA 2D8WA 2GCHF 3KF2A 4XE4A 2QN5T 1QL9A 3ESTA 4ZUHA 3GY5A 2ZU1A 4KTSA 3ELAH 1TPSA 1BA8B 2IPHA 3QDZB 3UIRA 1O2HA 1BTXA 1B7XB 1SG8B 3C27B 2Z94A 2FOCA 3SNBA 3SNAA 2XBXA 1ANEA 2Z9KA 5C1UA 1TGSZ 4K1SA 1W0YH 2VNTA 1EB1H 1JXPA 4FUBA 2FEQH 1YKTA 1BZXE 5HGGA 1HJAC 2YNAA 1P0SH 4CRDA 1EATA 4NSYA 1E36B 2IOTA 3DFJA 3I78A 1TALA 4FUFA 1CBWB 1NM6A 2XC0A 1HB0B 4UONA 4BAOB 3W95A 1MTWA 4GAWA 2ZHDA 2D2DA 5DGJA 1GMDG 2OINA 2BD2A 2ODPA 3ZVAA 4AB8A 1QBOA 4WMDA 1MZDA 2G5VA 1VCWA 4O97A 5HYOA 4B2CA 1WU1A 2BDIA 3RMLH 5A0AE 1A0LA 2BLVA 4JZIA 2FYRA 2H9TH 3LONA 3BN9A 1W8BH 1T4VH 1VITG 5DG6A 1K21H 4A5TS 2XWAA 1GDUA 1WCZA 3SW2B 3TJOA 1BMAA 1C2IA 2ZECA 1GBTA 1V2QT 3OY5U 4AGKA 1HAOH 2Y5HA 2ALVA 4OS2A 1BRBE 4X8UH 4YM9A 1XUGA 1P3CA 3ZVFA 4OS7A 5DP5A 2NU3E 2FIRH 3LU9B 5GCHF 3QTVH 4NIWA 1FDPA 1TPOA 1XUFA 2GX4A 3B8JA 1TE0A 1L1GA 1O2LA 2HLCA 1VR1H 1KXBA 5FX5A 1UMAH 1C5UA 3SU4A 1L4DA 1LQEA 5LPRA 1TNIA 1JOUB 4IC5A 1SQTA 4K2YA 4A1XA 3NPSA 2ZGBH 4TYDA 1C2DA 1PPFE 4IW4E 4U32A 1PQAA 3PYHA 3DA9B 4JYVH 5AFZH 2VB0A 2FTLE 2ZPSA 1ELTA 3U8OH 3UOUA 1H9IE 3M35A 2WPMS 5EQQA 1AB9B 4HGCA 3ZV8A 4BTIB 1O3GA 2RG3A 4GSOA 4M7GA 4ABJA 1SLXB 2Y80A 2LNCA 2RA3A 3T25A 3C1KA 1YLDA 1THRH 3SJIA 3Q77A 1DS2E 1DSUA 3UQOA 3PMBB 3TH3H 3ZZ8A 1S5SA 4K69A 1N6XA 3SU5A 1AKSB 2F9PA 2NU4E 3T28A 1O2VA 2ZU3A 1LQDB 1UTJA 4ZAEA 1O2QA 1EPTC 3MU0A 3O8CA 3Q3KA 1F7ZA 5AF9H 3ZYDA 3GISB 1H1BA 3LKWA 1GJCB 5DP9A 3O8RA 4XBCA 3A7YA 2ZFFH 2PUQH 1SFIA 3SHCH 1HNEE 4Y10E 1SGRE 1T4UH 1MKXK 2P95A 2ZF0H 2A4RA 2TGPZ 1LVMA 1SFQB 4AFZA 1TGBA 2A31A 7KMEH 2BVSH 3T26A 1MKWK 1C2MA 3RDZA 1J17T 4OS1A 2O8LA 3P8NA 1V2MT 1O35A 1BCUH 2J4IA 1BRCE 3BTEE 2UWLA 8LPRA 2Z6BD 4ZH8A 3KGPA 2C4FH 3P17H 1MAYA 1SMFE 2UUFB 3KQBA 1FY4A 1K2I1 3I77A 4BAKB 3V0XA 3GYMA 2JH5D 1P03A 2TPIZ 1P2IA 3MH4A 1FUJA 1Y5UT 1C1PA 3SNCA 8ESTE 1D3PB 3SUDA 2ZDLA 1DWEH 1WUNH 2SFAA 3DD2H 5T6GA 1T7CA 3UWIA 1CVWH 4UEHH 1V2LT 2NU2E 2EI6A 4UD9H 1GI1A 2FXRA 5FCRA 3A84A 1C5XB 3SV2H 1DDJA 4WVPE 3RXMA 1DUAA 1FNIA 1TGNA 4ISOA 3GY8A 2ANKH 1W14U 2GMTB 1UVSH 1SGTA 1DVAH 2FESH 2W5EA 5AVDA 1UHBA 1YCPH 2BZ6H 2F9BH 2PV9B 5GIBA 1EZXC 3BSQA 2BHGA 1KXCA 3HGNA 1LPKB 1Y5BT 2FX4A 3NUMA 3PM3A 1O2ZA 2AERH 1P9UA 3SGBE 1B0FA 1C5SA 4YOGA 2Z3EA 1CT0E 1O37A 4Y8XA 1BRUP 2Z9JA 1KXEA 4JK5A 1OOKB 3NXPA 2A7JA 4WWYA 1AHTH 1AKSA 2BLQA 2FTMA 4A7IB 2RDLA 4MNXA 2J94A 1C2GA 1WYKA 4AG1A 2A7CA 9ESTA 1QTFA 3VFEA 2XW9A 3BTTE 2PKSB 1ZPCA 3QGNB 3GY4A 1LVOA 3EA7A 1OWDA 1NRSH 4DGJA 2DE9A 1ELBA 2CMYA 1OX1A 4X8TH 1TB6H 2BVXH 2XC4A 1SQOA 3VXEH 8GCHG 1S82A 1V2PT 3H5CB 2ZGCA 3SV6A 3BTFE 1EXFA
chains in the Genus database with same CATH superfamily
3UNQA 1VCQA 2ZFPH 1DICA 2KAIB 1CA0B 3M7UA 3TK6A 1UVTH 2KR7A 1SHYA 5A8ZA 1HV7A 1ABJH 4ASHA 1GJAB 1TLDA 1QQUA 5BPEA 2V3OH 2GMTC 4O03A 4NZQA 3N7OA 1TOMH 2ZDVH 1D4PB 2ZU2A 3KQDA 3PLBA 4Y0YE 2QE7D 2FOBA 4GHQA 2GZ9A 2VIWA 4B2AA 1SGCA 1NBMD 2B5TB 4YLQH 3MO3A 1PPHE 2XTTB 3HKJB 1BB0B 1GI9B 5I25A 2A45B 4AYYB 4YT6H 4NSVA 1RXPA 1FPCH 3M5OA 1H8ED 4BOHA 6LPRA 1RGQA 2GV7A 3MNBA 1GHVH 4MLFB 1XM1A 1TA2A 5C94A 1WSSH 1BIOA 1EAXA 4JZ1A 2FDAA 4Y7AA 1TX8A 1E35B 2BB4A 3BIUH 5FXLA 1O2XA 5ESBA 5A2MH 2OC8A 2STAE 5K0HA 4XOJA 1XKBC 1CE5A 1SLUB 2ZHQH 3RXVA 1DOJA 1GGDB 1IHSH 2YOLA 3A8AA 1S0QA 4BXSA 4YOJA 1IAUA 1L2EA 1TBRH 1BTYA 5C1XA 1Q2WA 1CGIE 2FLRH 2W7UA 1N1LA 3D65E 4ZHMU 2Y5GA 3D62A 3F2HA 3PWBA 1YF4A 2EC9H 3ZVEA 2FM2A 1O3MA 4FUEA 1C5MD 4K3JA 1RFNA 1O2GH 1C1RA 2OBOA 1KDQA 1FIWA 1GHWH 4B2BA 2EY4C 5GDSH 4LOYH 3RC6A 3RC4A 1PFXC 5EU8A 4Q2KA 4OGXA 4CH2B 3OFND 1P06A 4X6OA 4BAMB 1XXFA 3A8BA 1VJAU 1UVPA 2AGIX 2K1QA 2J9NA 2QGRA 4SGBE 4TY7A 2F9UA 1GBLA 2CF9H 2JH6D 3OTJE 4BTTB 5C1YA 2C8YB 3TPIZ 1QFKH 1C5VA 3PWCA 1DX5M 1BT7A 3MWIU 2BD3A 1YP9A 3AASA 3LT3A 3SJKA 2H5CA 3F9HA 2BY8X 4K1EA 1SSXA 2W3KA 2FO9A 3SQHE 3A8DA 1P2QA 1C5YB 1G2MA 1S85A 3L6PA 4DURA 1O2NA 4FUIA 1YCPM 3KEEA 4YO9A 5C20A 4ABAA 3E16B 2XYAA 3P8GA 3RXDA 1BQYA 4INKA 4I8GA 4D76A 1C5TA 2FOHA 2HPPH 1ZHPA 1MD8A 1J15A 4AFSA 3KQCA 1GCTB 2C93B 3ZZ4A 1GGDC 3BTKE 3JZ2B 1QL7A 1P2MA 1QBNA 3TGIE 1N8OB 4X1PU 1BITA 3BTME 1QQ4A 2VIVA 2VWNA 2O8TA 3E3TA 4R8TB 2SGQE 1HAGE 2ESTE 5AFYH 5GPIB 1HAYB 3QN7A 5K7RA 2VINA 4A1VA 1T8OA 5E8EH 5FBIA 1C2EA 2WYJA 2PUXB 4I32A 2NU0E 1HDTH 1GBJA 1KSNA 2V6NA 3OX7U 2P94A 4OGYA 1YPEH 1JWTA 2C8WB 2ODYB 1P01A 2AGEX 3H7TA 4NA9H 2G8TA 1HCGA 4MPVA 5A0CA 4AX9H 2Y81A 3GDVA 4INHA 1W7XH 4TPIZ 2V3HH 1V2VT 1KMHB 1NY22 4FUJA 4FOUC 5E2OA 1YC0A 1CQQA 2ZGHA 4KGAA 1P3EA 3NK8A 1GJDB 1Y8TA 4GPGA 3K2UA 4NFEA 4O3TA 2NU1E 1G3CA 1OSSA 1G9IE 2BDBA 5E0HA 2ZDAH 4ACAA 1YPKH 2BXTH 1SOZA 1AUTC 1DUEA 1C2FA 2H6MA 2HVXA 2BY7X 1P9SA 2A2QH 5C2ZA 3HK3B 3E6PH 3OY6U 1ZTLA 1BTWA 5DSFA 1Z8RA 1Y3YA 1T8NA 2PW8H 1GHYH 3UFAA 1B5GH 7GCHF 1LPGB 2GTBA 2ZCLP 1ELFA 1GL1A 1LKAA 2QIQA 2QF3A 4I8KA 5EQRA 3SU0A 1BJUA 3T29A 1NFUA 4B73A 3UPEA 5C0TA 5BRRE 3F9FA 4Q80A 1N8OC 1O5EH 1OWHA 1O2TA 1ZGIA 3O8BA 3TJNA 2HNTE 2D26C 1MQ5A 3W1EA 2AMQA 4A92A 2WPLS 3OYPA 3NKKA 2JIZD 4JYTA 4ABEA 3RXQA 3HGPA 1V2OT 2B8OH 1S83A 2F3CE 2P8OB 2PSXA 2Q6DA 3M3SA 2BQWB 3RXEA 1KLIH 1NROH 2HLDD 2WUBA 2ZFSA 3U8TH 5IYTA 4Y8ZA 5FPSA 1L1NA 3P92A 3S69A 5T6DA 1OKXA 2BY5X 1SLVB 4CH8B 1E38B 1ZJDA 3RC5A 1HBTH 3VGCB 3PO1B 6CHAB 2C3SA 4WJG2 1D6WA 1O3EA 2XC5A 3HK6B 4I33A 1FY1A 1SGYE 2FODA 1LVYA 4B71A 2CV3A 1EAWA 1O34A 3E8LA 1YPJH 2ZCHP 2D1JA 4LZ4B 1UK4A 1M9UA 1O5GH 2BZAA 2Q6FA 1KTTB 2XNIA 4WMFA 5DJ7A 5F03A 4AFQA 1SGFA 5PTPA 2WV5A 1O2WA 3ZVBA 1TNHA 4IN1A 2PWXA 3RXTA 1D3TB 3MI4A 3URCA 5EJLA 5CMXH 2OC1A 1A4WH 1OWEA 1PQ5A 2XWBI 2BLOA 4UFDH 1V2UT 1LHGH 2HALA 1JRSA 5EJZA 4AORA 4RT1A 1AVXA 4XBDA 1TBQH 3MH6A 5HIYA 3ZV9A 1HAVB 2ZO3H 2FOGA 2ZU5A 4ABDA 4UDWH 1ACBE 3MNXA 1W3CA 3A86A 4OS6A 1OP8A 1EJMA 1AFQC 1YPLH 1GJ5H 1QA7A 2BQ7B 4MVNA 1GG6B 2TRMA 3P95A 4DJZB 1XMNB 2TIOA 3MO9A 3UWJH 4CRGA 3SV8A 5KGOA 4B76A 4ZROA 1E37B 4ABGA 1IQMA 4Y71A 4MPXA 2IJOB 2AHME 3KNXA 1RIWB 3OAAD 1AZZA 6GCHF 3KN2A 3SU6A 3RXGA 1THSH 1JIRA 3V7TA 3SNEA 4F55A 2VVUA 2EI8A 2FI3E 3DSGA 1C4U2 3F0OA 3VGCC 6CHAC 2GCHG 2V0BA 4JZDH 1AWFH 1OWIA 1IQNA 1EB2A 1ESBA 2VVCA 2FOFA 1O3FA 2FYQA 4X6PA 2ZQ1A 4DY7B 3TJVA 4K8YA 1YM0A 4CHAC 2F9VA 1SGPE 1O5FH 2G4TA 1MZAA 1P2KA 3SI4H 3RLWH 3EGKH 1SL3A 3M5MA 2PP6A 3FP8E 3AAVA 5L30H 7LPRA 1MTNB 1FN6A 2IN2A 1GJ6A 2ZCKP 1GI6A 2ZC9H 2XRCA 4CRCA 1VITH 1MTVA 5GJ4B 1O3DA 2ZHFH 5TCCA 2WV9A 4AZ2B 4Y76A 2KM0A 3EAJA 1LHFH 3SU1A 1DY9A 4PROA 1ELGA 2QXGA 1DM4B 1S0RA 2EI7A 2ODQA 2WPJS 1H8DH 3EE7A 4MG3A 5GNDA 2ZI2H 4Z6AH 3MO6A 5DN6D 3SV9A 2CJIA 4H6SB 2XNDD 1ESAA 1O0DH 2A4QA 1SGDE 3LH3A 3BF6H 3SN8A 6GCHG 4FUCA 1CBWC 4NWKA 5DP8A 1FY3A 2J38A 3OEED 1Z6JH 5EOKA 1MBQA 3SO3A 1RIWC 1GI7B 1TGTA 1NRRH 1FMGA 5EXMA 2P3TB 3KYGA 5A8YA 1V2KT 1NRNH 4DCDA 1GBCA 1UHBB 1ZGVA 4KTUA 3A7TA 5HM9A 3M3TA 1ZPZA 1P02A 1GMHF 1LHCH 1NTPA 1MMJN 2AGGX 4THNH 3ZZDA 1EFRD 2QF4A 4GLYA 2ZHEH 3NCLA 2A5IA 1F5KU 1GI0A 1HAVA 2ILNA 4ZKOU 1O5CB 1TMUH 3LGIA 1MUEB 1O33A 1S81A 3SBKA 1VGCB 3QO6A 1P2OA 2SGPE 2V35A 4JMYA 3PMJA 1GBFA 5GCHG 3P70B 1C1SA 1CU1A 1RD3B 2BD5A 1QB1A 1TX7A 2R2WU 3FVFB 1EJAA 3H09A 2F83A 4KKDA 4DT7B 2BLWA 3RXSA 4NA7A 1NRPH 4BAQB 4TPYA 1K1LA 5EGMA 2J98B 4F48B 2ANYA 3LIWA 4FU9A 1TIOA 2FS9A 2BD7A 3BG4B 4JZEH 3T2NA 3BTHE 1W13U 2G00A 3EDXB 1SQRA 1ZRKA 1C1UH 2CGAA 1WQVH 5F53A 1F0RA 1ARCA 4X0WU 1K28D 5E0GA 4IS5A 1O2OA 1QZ8A 3SV7A 3GY6A 4K1TA 4ABHA 1ELEE 1GI8B 4IMQA 1PPBH 3DSOA 5C0UA 1UK3A 4E05H 1O3NA 2JKHA 3FOAA 2PFEA 2AS9A 4ZXXH 3O8DA 3M61U 2VBCA 1ANDA 4J2YB 4ZMAH 3QUMP 3SORA 3VXFH 4AOQA 1GMHG 1JBUH 1F0TA 1F0UA 1ZMLA 2PGBB 2H2ZA 2NWNA 2Y7ZA 2JDID 3STIA 4E7NA 3UY9A 3RMOH 2BMGB 2PLXA 1AB9C 3RMNH 4Q7XA 2VJ1A 1AU8A 1K22H 3BTWE 3LGVA 4CR5A 4CRBA 1AE5A 1GDNA 1LHEH 3NRLA 3UTUH 3B9FH 2OP9A 4X1RU 2G4UA 2BOHB 1OPHB 4VGCB 2OD3B 1PPZA 1F5LA 3GY7A 1U6QA 1YLCA 1EKBB 1QRXA 1IQIA 1DXWA 1ZRBA 2BDGA 3VB4A 3GYLB 1C1TA 1Y3UA 1W12U 3E1XB 4U2WA 4XD7D 1HJ8A 1SQAA 1OXGA 3W94A 4MPUA 4K5ZA 1H8IH 1S6HA 3F68H 3ATLA 5CHAB 1YYY1 1Q3XA 4RKJB 3TGKE 2C8ZB 1J16A 3BG4C 3LGTA 1ZJKA 3RXHA 4ABFA 3NWUA 1TPPA 1UVUH 3SOSA 2F9NA 5EPYA 2B7DH 3IITA 2A0QB 3MH5A 1O2PA 1TX6A 1SKYE 3ZZ7A 2ZTXA 2ANMH 5DP4A 4X6NA 3MTYA 1CSOE 1L4ZA 1KDQB 1YLNA 1BTHH 2PSYA 2ZWLH 5HIZA 5KEDA 5DKMA 3FZZA 2VGCB 5DPAA 2LP6A 5EXLA 1HFDA 2GDDA 3QWCH 3S9CA 1EJNA 3TNSA 1FZZA 3SUGA 1G3EA 3UB0A 2J98A 3E0PB 3MQKC 1ZHMA 3S9AA 1QJ6B 3GCTF 2OC7A 1FIZA 1A0HB 1OP2A 1TNKA 2KX4A 2WV4A 1YWUA 2G5NA 3A81A 5L2YH 2XCFA 4UFFH 3RXOA 2QCYA 5L6NH 3MMGA 1QGFA 1K1OA 3GOVB 2OQUA 4VGCC 1O3PB 3L3TA 1WTHD 1L0ZA 1B0EA 4A1TA 2GZ7A 5EXNA 3U1JB 2SGEE 5HKKD 1CGJE 5CE1A 1GBHA 5LPEA 1TMTH 2BX4A 3MHWU 3MOCA 2P16A 2YMSB 1COWD 1NU9A 4BTUB 1C2KA 3GY3A 3M3VA 2CXVA 3I29A 1QBVH 2ZTZA 1P04A 2FI5E 1QR3E 1HXEH 2FPZA 3GCHB 1ZSJA 1SBWA 3RXKA 1BHXB 4LK4A 1UVOA 4ZCNA 1KXDA 1O2MA 3K65B 1PQ7A 4I7YH 2ZU4A 1IQFA 2WPHS 2Q1JA 4X1QU 3ITIA 1DANH 2M5TA 2GV6A 3GCTG 4JYUH 4OS4A 3BTQE 1Z8GA 1FX0B 1O5AB 1PQ8A 4MNYA 1PJPA 4Q7YA 4HFPB 1HRTH 2ZGJA 1C1OA 1FPHH 1DLKB 1EX3A 1UTQA 2LPRA 2YNBA 2PKSC 3ODDA 4AGJA 4JK6A 2O9QA 1CA8B 1FJSA 3R0FA 1C4Y2 5A09A 4O3UA 3PROA 2EA3A 2K0QA 1FN8A 3RXPA 1ZLRA 4RN6A 4OS5A 1A5IA 1P11E 4GVUA 1FV9A 4CR9A 1QNJA 1CA0C 3T27A 2XBYA 1XX9A 3RXLA 1ZMNA 5FPYA 2A2XH 4GHTA 3KHVA 4DT4A 2Y5FA 2YMSC 1BDAA 5DP6A 2ZPQA 5T3HA 3SI3H 1MH0A 1O3CA 2PKAA 4X1NU 1GCDA 2HWLB 1ANBA 3KQ5A 1G2LA 5JB9S 4NA8A 3RXJA 1WDIA 2HGTH 4B1TA 1WQSA 4ISNA 3SU3A 3GCHC 2Y82A 3VB5A 1MQ6A 3EYDA 4X8SH 4F4OC 1LHDH 3BTGE 1GI4A 4Y0ZE 4Y11E 1HYLA 4ABBA 1H8HD 3BEFB 3G01A 4WXVA 4ZKSU 3Q00A 4ACBA 1T32A 2WPDD 1QY6A 4UFGH 2BDAA 1TNGA 2F9OA 4GCHF 1EASA 1T31A 2FS8A 5FL7D 1NBME 1TGCA 2FX6A 3UQVA 1C2LA 2GKVE 3FZDA 1GVKB 1F0SA 3ZVCA 1YPHC 2SNWA 4WH6A 2BX3A 3U69H 3MU4A 1C4V2 3Q76A 4AFUA 1FONA 3CS0A 4YLUA 7ESTE 2PGQB 1HXFH 1GMCF 1GBBA 3A82A 3RU4D 2XBVA 1SOTA 4BANB 1BTPA 2BDYA 2A32A 4FVDA 2B0FA 4X6MA 2L6OA 1SC8U 5LGOA 2Z7FE 1CT2E 3RP2A 4DOQA 5EPNA 1TOCB 3ZZ6A 2QF5A 5JDUB 3PLPA 1CGHA 4TY6A 2FZZA 2CF8H 1O32A 3JZ1B 5F8XA 1G30B 4MPWA 1JIMA 3DHKH 2ULLA 1GBAA 1WTGH 5JB8S 3URDA 1ORFA 1DWDH 5ABWA 5FPTA 4Z0KA 4RKOB 1XUIA 1GPZA 1O3JA 1ZPBA 1DWCH 1K1MA 1PYTC 4GCHG 1UJ1A 1P2NA 1FQ3A 1KY9A 1SGIB 1DPOA 3ZZ3A 1C1QA 1IQEA 3DCLA 1HAPH 1OS8A 1C9PA 1PPGE 1GJ4H 3LGYA 3ATIA 1YPGH 2ALPA 2R0KA 3RXUA 2BDCA 1P8VC 1EP5A 4NGAH 1TWXB 1TONA 2C8XB 2VIPA 2VIQA 2WINI 5TJXA 3RXAA 1V2RT 2PTCE 2J95A 1A46H 3ZVDA 1GCTC 4HTCH 1ELVA 3ZIAD 4K8BA 4CRFA 1LMWB 1K1IA 5FHTA 1ANCA 1PPCE 4AC9A 3GDSA 1W7GH 1ZHRA 2TGTA 3SUEA 3IWMA 1NRQH 3TLOA 3MU5A 3BTDE 2BY6X 3ZZAA 2HNTF 4NIVA 5JBCS 3T5FH 3EE0B 1IQJA 4DVAU 5B6OA 1HAXB 2G52A 4D8NA 1AQ7A 2P59A 4P00A 1W0ZU 2THFB 5F6MA 2H9HA 1AUJA 1VJ9U 1W11U 3Q3XA 2Q6GA 1RTLA 2R9PA 5C17A 3IG6B 3PMHB 1D6RA 2OBQA 3LGUA 3AAUA 1HJAB 1MU6B 1ZSLA 2QC2A 3PRDA 1TRMA 4D9QA 5J4SA 1UTNA 2H9EH 3RM2H 3A80A 1ZYOA 2AMPA 1O3KA 2F91A 4IC6A 3VEQB 1O3OA 3PTBA 3TU7H 1KLJH 1V2ST 2G81E 7GCHG 3KQEA 4Q4LA 3STJA 3TK5A 1AGJA 1MCTA 1WV7H 2A7HA 4XRNA 1FY5A 3S0NA 4I31A 3K9XB 3U98H 1IQKA 2PHBA 5ETXA 1LKBA 2HPQH 3N7EA 1QIXB 1GBEA 1DE7H 1WOFA 3F6UH 1F5RA 1E1QD 1GMDF 4ZKNU 2AEIH 3QGJA 1UTPA 3GDUA 4XFQA 1AD8H 4FUDA 2BXUH 1CHGA 3V12A 2WUCA 3VPKA 1QB6A 4CBNA 4M9FA 3A83A 1A2CH 2OTVA 1ETRH 3SJOA 3S9BA 3RLYH 3MNCA 3V13A 1O2UA 5E0JA 2ZNKH 1GHXH 2P8OC 5HXFA 1DWBH 1E79D 1VITF 3BEUA 3LGWA 3KL6A 2W3IA 1O3IA 1X7AC 1C5LH 1GVLA 3CENA 2ZTYA 1IHTH 2SGFE 2Y7XA 1P2JA 3A7ZA 1Z6EA 3DSPA 1Z7KA 1C5QA 5EJ1A 5AHGH 1PPEE 5EW1H 3FFGA 1A0JA 2JH0D 1E0FD 1FY8E 2P3UB 3PO1C 3ENSB 4HZHA 1LDTT 1TQ7B 5DP7A 2XXLA 4BXWA 4YT7H 4AG2A 4E06H 9LPRA 1GBDA 1V2TT 2C90B 2SGDE 2A1DB 1MTUA 3FKSD 1BTZA 1RJXB 1TMBH 2IPQX 1IOEA 5DK1A 1O2JA 1K0HA 1XUJA 2JETB 1RS0A 2HRVA 4TT3D 1O5DH 3BG8A 3DT0H 3AW0A 1BOQA 3E0NB 4DG4A 3UUZA 1Y3WA 2UUKB 2AMDA 2ZKSA 3N7DA 4Y79A 3LC3A 1AN1E 2FOEA 3A7VA 8KME2 3SJ9A 1K9OE 1O2IA 1C5NH 1VKYA 2HNTC 1NPMA 1NO9H 4X8VH 1NFWA 1NU7B 2ZEBA 1XUKA 4H42U 1UTOA 1MCVA 2BYAX 3FP7E 1ZOMA 1HIAA 3RM0H 1TYNA 1DY8A 1FLEE 3U9AH 4B6FA 1O3HA 4NCYA 4X1SU 1EPTB 1GI2A 3ZYEA 1SGNE 3E90B 4XBBA 1FAKH 2GJGA 1GG6C 3DUXH 1IQGA 1J8AA 5HMAA 1CT4E 1S6FA 5E2PA 3TK9A 1TFXA 4MQAA 2W7SA 4FUGA 3EA9A 2A5KA 1S84A 4D7FA 1W10U 2WPIS 1BRAA 1LPZB 1LVBA 1DSTA 2TGAA 1V2WT 1NN6A 1ZTJA 3PB1E 4RI0A 3S7KB 2KCYA 1ZZZA 1AZ8A 2KCPA 1C9TA 3UOPA 1A7SA 3FANA 1O2RA 2W26A 3BEIB 1GBIA 3M5NA 1TABE 1Y59T 4UE7H 4FXGH 1ESTA 4NWLA 4Y7BA 1TA6A 2OLGA 4Q7ZA 3D49H 5T6FA 3RXFA 4DIIH 5CHBA 2QAAA 2GT8A 3TGJE 1NZQH 3OSYA 2ZDKA 4KELA 1A3BH 2JETC 4I8JA 1MD7A 1WXRA 1WAYB 1EZSC 2GZ8A 2QYIA 1HPGA 4MNVA 3F9GA 3GCNA 2EQNA 1C1WH 1TRNA 1ABIH 1AVGH 2BDHA 1MTNC 4BNRA 1V2JT 2SGAA 2J34A 1OWKA 2WHXA 2TBSA 3LJJA 3OTPA 3B23B 3P6ZB 4NG9H 2QA9E 4J1YA 4NZLA 1AY6H 5JBBS 4XDEA 2YMSD 3WWBA 4IN2A 1SI5H 1C2HA 1TRYA 1SGEE 4ZXYH 2FI4E 1FAXA 1KIGH 5LPFA 1GBMA 1DLEA 1GJ7B 1JRTA 4TWYA 1CO7E 3RUOA 4ZHLU 2TGDA 1Z71A 3PV2A 5LH8A 1ZTKA 2GT7A 3AW1A 1GHBF 1BMLA 4KP0A 1O3BA 3WY8A 2KZ4A 3ZVGA 4NFFA 1ID5H 1Y3XA 3TVJB 5TCAA 3QZRA 5A0BA 3UNRA 2AFQB 2K8IA 2EEKA 1BBRK 2Z9IA 3TNTA 5FCKA 3K6YA 1T8LA 5GXPA 1AO5A 3FO8D 5T1VA 1L1JA 1AWHB 1EOLA 2OC0A 4HI3A 1EPTA 3LPRA 4I8HA 4Q63A 1VGCC 1QB9A 5F8ZA 5DP3A 1QJ1B 5DO4H 2JJ1D 2GP9B 3F2GA 1SHHB 3SGAE 3ZZ5A 1MTSA 3KCGH 2H1UA 4RT0A 3SZEA 2BD8A 3P8FA 1K1PA 2AH4X 1FXYA 2ZZUH 1IQHA 1KXFA 1SLWB 5G4BA 3ZZBA 2UUYA 1AI8H 4NIXA 6ESTA 1HLTH 3RMMH 1UK2A 1GJ8B 4WMEA 4ZKRU 1Y3VA 3FP6E 2QF0A 1GI5A 2O8UA 4IMZA 1E34B 1GHBG 1LCYA 1RRKA 2UWOA 5F8TA 4U01A 8GCHF 1UCYK 1ELDE 1C5RA 1PYTD 1O2KA 4DW2U 3AK5A 2ZGXH 4TSFD 5GWZA 2ZQ2A 1ELCA 2GCTB 3M7TA 2ZPRA 1T8MA 1BHXF 1W0JD 3V3MA 2I6SA 1SR5C 1QA0A 4F49A 1TQ0B 2PKAB 2ZFRH 3EA8A 2Z3DA 2I6QA 3LC5A 2QY0B 2V3MA 2L74A 3RXCA 3BV9B 2GGVB 2R3YA 2J97A 1C1VH 2CHAB 3FAOA 4MNWA 3TH4H 1P10A 1J9CH 1H9LB 1TNJA 2P93A 2QXIA 2Z9GA 5JPMH 1OHHD 3DFLA 3EQ0H 4QT8C 3RXRA 1HUTH 3HATH 4UFEH 1BMMH 1GHZA 3AVZA 1AIXH 1F2SE 1YPHE 3SUFA 5IK2D 1GDQA 4YTAA 1V6DA 3A85A 1HAZB 3M36A 4TWWA 5C5NA 3UREA 4DIHH 1Z8IB 5EIYA 2J92A 1QRZA 2ZFTA 3M5LA 5CHAC 1Z1IA 2O8MA 2STBE 1QURH 1D3QB 3A88A 1C5ZB 1NESE 4K60A 1AVWA 1A3EH 2ANWA 2CN0H 2R0LA 1C2JA 3MYWA 2OUAA 1Y5AT 4NIYA 2A4OA 1ZSKA 1AE8H 2KCOA 3F9EA 4LZ1H 3OU0A 2PTNA 1GWAA 5FX6A 3RXBA 2VIOA 1KTSB 3UR9A 1Z1JA 4WXIA 2FWWA 3SGQE 4FU7A 4ABIA 1HAHH 2GCTC 1OYTH 1G36A 2OCVB 3A7XA 1Q31A 4H4FA 1XVOA 2VGCC 1O39A 4X2VA 1ARBA 4IBLH 2DE8A 3GCOA 3UNSA 5EW2H 2WPKS 4YZUA 1TBZH 2HOBA 3CS7A 2A5AA 3WW7A 3ATWA 4YESB 2GVFA 4HG6A 1JMOH 4ESTE 3TIUA 1NC6A 2CHAC 2XCNA 4KTCA 1ZR0A 1NFYA 1W2KH 1O38A 1MAXA 1SPJA 2XOKD 1QJ7B 3QTOH 1H9HE 4CBOA 3SHAH 5IDKA 1ETSH 1A5GH 1WBGB 4B74A 4B75A 3HKIB 1THPB 1INCA 1P09A 3KYFA 2BVRH 5C67A 1YPMH 1KLTA 2UWPA 5EG4A 1FI8A 1D9IA 1UTLM 1SGQE 4A6LA 4H6TA 1YGCH 1BMNH 4RSPA 4X2XA 1DT2A 1F92A 1G37A 1RTFB 2BTCE 1VZQH 3PTNA 2Z3CA 4E7RG 4BAHB 3F3BA 1DXPA 2G51A 2B9LA 3QX5H 4CRAA 5L2ZH 5FAHA 3P8OA 1ETTH 4XSKU 1LTOA 1OYQA 3SU2A 4AN7A 1BBRE 2BQ6B 1P05A 3UAIC 5JYIA 2AIQA 1V3XA 5CDFE 2JJ2D 4ISIH 1A61H 3RU4T 3QK1A 1K1JA 1TPAE 4SGAE 4D7GA 3NZIA 2AIPA 3K6ZA 1O2YA 3MH7A 3QZQA 1EZQA 5I46H 1BTUA 1UTKA 3VB7A 3A87A 2LELA 1NS3A 1AMHA 2QXHA 3CP7A 2WYGA 1J14A 5FBEA 3BIVH 1CHOF 1GBKA 1XXDA 1Z8JB 2F43B 4INLA 1SVPA 1XUHA 3LH1A 3H7OA 1YBWA 3L33A 2ZDNA 3Q3YA 4Z1MD 1TAWA 2KAIA 5SGAE 3MNSA 1BUIA 1G3BA 1GL0E 1KYNA 3S7HB 1EQ9A 2AYWA 1HGTH 4WY3A 2DUCA 1EAIA 2RFKC 2Y6TA 3A8CA 1XKAC 5C3NA 1RTKA 1A1RA 4CREA 2VWMA 2BD4A 3F1SB 1SGFG 1C1MA 2G55A 1G32B 2A4GA 1C5WB 5EODA 2SNVA 1MABB 1S6LA 3PLKA 1UCYE 3M37A 1VCPA 3HPTB 5KECA 5J4QA 1H4WA 1P12E 1MKXH 3TITA 3MU1A 2J2UA 4Y6DA 4O9VA 2GDEH 1O5BB 2VVVA 1GHAF 1XVMA 4MDSA 3VB3A 3SZNA 4Y8YA 4B6EA 1G3DA 3R3GB 1NFXA 3A89A 4P02A 3LJOA 4YXWD 1BBRH 1C5OH 1MKWH 3KIDU 1V2NT 4I86A 4I8LA 1KXAA 2ZG0H 1EZUC 2H5DA 1SB1H 2VWOA 4FU8A 2RCEA 3ZZCA 4AYVB 2GD4B 5H4IB 4ISLA 4WF8A 1O2SA 2P3FH 4MTBA 2ZA5A 2VWLA 4X2WA 1CHOG 3MU8A 3PV4A 3LOXA 1BJVA 3GY2A 1GJ9B 1P57B 1GMCG 3M7QA 1ZMJA 2ZDMA 3ATMA 3FN8A 2ZFQH 1ELAA 4U30A 1HAIH 1LO6A 2BM2A 1MBMA 1O3LA 4FUHA 1OWJA 1TNLA 2VH0A 3WWFA 3U1IB 2FOAA 3PMAB 2VIDA 5EQSA 2PR3A 1O30A 1DITH 1MU8B 2KFWA 1C5PA 1W0KD 2OQ5A 1O3AA 1O31A 2VH6A 2ZHWH 4ISHH 1EAUA 3ATKA 3TJUA 2XBWA 3SJ8A 1UCYH 1GHAG 3RU4E 2HVYB 3A7WA 3MFJA 2BY9X 3T62A 1C1NA 1DFPA 3QLPH 4R0IA 2ZP0H 4D9RA 1O36A 1D3DB 2FMJA 3LDXH 2FLBH 2BOKA 2QV1A 2R2MB 2IJD1 4ZHAA 1EUFA 1AFEH 4FVBA 1QCPA 1EOJA 1AFQB 1HIAB 3U8RH 1GJBB 3U28C 2VU8E 4YOIA 2ZIQH 5C5OA 4JCNA 2RA0A 2BD9A 1GI3A 5HM2A 2OXSA 2QXJA 1GVZA 3OEHD 4IGDA 2R3UA 2F4LA 5JBAS 1NT1A 3UR6A 4LXBH 2O8WA 2Z9LA 3GICB 4X2YA 1QL8A 3ODFA 5A8XA 1YCPK 3ZZ9A 1UO6A 1K1NA 4JZFH 2UUJB 2FOMB 1QRWA 1IQLA 3SQEE 1OP0A 3TH2H 2ASUB 1N6YA 1QHRB 4AB9A 2FP7B 1A5HA 1UTMA 4WH8A 3D23A 3SNDA 3VB6A 3E91A 1HJ9A 4GUXA 1EP6A 5ESTE 4CHAB 5JBTA 3RXIA 2D8WA 2GCHF 3KF2A 4XE4A 2QN5T 1QL9A 3ESTA 4ZUHA 3GY5A 2ZU1A 4KTSA 3ELAH 1TPSA 1BA8B 2IPHA 3QDZB 3UIRA 1O2HA 1BTXA 1B7XB 1SG8B 3C27B 2Z94A 2FOCA 3SNBA 3SNAA 2XBXA 1ANEA 2Z9KA 5C1UA 1TGSZ 4K1SA 1W0YH 2VNTA 1EB1H 1JXPA 2KCAA 4FUBA 2FEQH 1YKTA 1BZXE 5HGGA 1HJAC 3SYJA 2YNAA 1P0SH 4CRDA 1EATA 4NSYA 1E36B 2IOTA 3DFJA 3I78A 1TALA 4FUFA 1CBWB 1NM6A 2XC0A 1HB0B 2J5UA 4UONA 4BAOB 3W95A 1MTWA 4GAWA 2ZHDA 2D2DA 5DGJA 1GMDG 2OINA 2BD2A 2ODPA 3ZVAA 4AB8A 1QBOA 4WMDA 1MZDA 2G5VA 1VCWA 2W6JD 4O97A 5HYOA 4B2CA 1WU1A 2BDIA 3RMLH 5A0AE 1A0LA 1UW7A 2BLVA 4JZIA 2FYRA 2H9TH 2W6ID 3LONA 3BN9A 1W8BH 1T4VH 1VITG 5DG6A 1K21H 4A5TS 2XWAA 1GDUA 1WCZA 3SW2B 3TJOA 1BMAA 1C2IA 2ZECA 1GBTA 1V2QT 3OY5U 4AGKA 1HAOH 2Y5HA 2ALVA 4OS2A 1BRBE 4X8UH 4YM9A 2CK3D 1XUGA 1P3CA 3ZVFA 4OS7A 5DP5A 2NU3E 2FIRH 3F2FA 3LU9B 3GS9A 5GCHF 3QTVH 4NIWA 1FDPA 1TPOA 1XUFA 2GX4A 2RDEA 3B8JA 1TE0A 1L1GA 4OM9A 1O2LA 2HLCA 1VR1H 1E1RD 1KXBA 5FX5A 1UMAH 1C5UA 3SU4A 4ASUD 1L4DA 1LQEA 5LPRA 1TNIA 1JOUB 4IC5A 1SQTA 4K2YA 4A1XA 3NPSA 2ZGBH 4TYDA 1C2DA 3CNRA 1PPFE 4IW4E 4U32A 1PQAA 3PYHA 3DA9B 4JYVH 5AFZH 2VB0A 2FTLE 2ZPSA 1ELTA 3U8OH 3UOUA 1H9IE 3M35A 2WPMS 5EQQA 1AB9B 4HGCA 3ZV8A 4BTIB 1O3GA 2RG3A 2M2AA 4GSOA 4M7GA 4FETA 4ABJA 1SLXB 2Y80A 2LNCA 2RA3A 3T25A 3C1KA 1YLDA 1THRH 3SJIA 3Q77A 1DS2E 1DSUA 3UQOA 3PMBB 3TH3H 3ZZ8A 1S5SA 4K69A 1N6XA 3SU5A 1AKSB 2F9PA 2NU4E 3T28A 1O2VA 2ZU3A 1LQDB 1UTJA 4ZAEA 1O2QA 1EPTC 3MU0A 3O8CA 3Q3KA 1F7ZA 5AF9H 3F0PA 3ZYDA 3GISB 1H1BA 3LKWA 1GJCB 5DP9A 3O8RA 4XBCA 3A7YA 2ZFFH 2PUQH 1SFIA 2V7QD 3SHCH 1HNEE 4Y10E 1SGRE 1T4UH 1MKXK 2P95A 2ZF0H 2A4RA 2TGPZ 1LVMA 1SFQB 4AFZA 1TGBA 2A31A 7KMEH 2BVSH 3T26A 1MKWK 1C2MA 3RDZA 1J17T 5B6LA 4OS1A 2O8LA 3P8NA 1V2MT 2OK5A 1O35A 2WZQA 1BCUH 2J4IA 1BRCE 3BTEE 2UWLA 8LPRA 2Z6BD 4ZH8A 3KGPA 2C4FH 3P17H 1MAYA 1SMFE 2UUFB 3KQBA 1FY4A 1K2I1 3I77A 4BAKB 3V0XA 3GYMA 2JH5D 1P03A 2TPIZ 1P2IA 3MH4A 3PRBA 1FUJA 1Y5UT 1C1PA 3SNCA 8ESTE 1D3PB 3SUDA 3OE7D 2ZDLA 1DWEH 1WUNH 2SFAA 3DD2H 5T6GA 1T7CA 3UWIA 1CVWH 4UEHH 1V2LT 2NU2E 2EI6A 4UD9H 1GI1A 2FXRA 5FCRA 3A84A 1C5XB 3SV2H 1DDJA 4WVPE 3RXMA 1DUAA 1FNIA 1TGNA 4ISOA 3GY8A 2ANKH 1W14U 2GMTB 1UVSH 1SGTA 1DVAH 2FESH 2W5EA 5AVDA 1UHBA 1YCPH 2BZ6H 2F9BH 2PV9B 5GIBA 1EZXC 3BSQA 2BHGA 1KXCA 3HGNA 1BMFD 1LPKB 1Y5BT 2FX4A 3NUMA 3PM3A 1O2ZA 2AERH 1P9UA 3SGBE 1B0FA 1C5SA 4YOGA 2Z3EA 1CT0E 1O37A 4Y8XA 1BRUP 2Z9JA 1KXEA 4JK5A 1OOKB 3NXPA 2A7JA 4WWYA 1AHTH 1AKSA 2BLQA 1YY3A 2FTMA 3PV5A 4A7IB 2RDLA 4MNXA 2J94A 1C2GA 1WYKA 4AG1A 2A7CA 9ESTA 1QTFA 3VFEA 2XW9A 3BTTE 2PKSB 3VG8A 1ZPCA 2WSSD 3QGNB 3GY4A 1LVOA 3EA7A 3N99A 1OWDA 1NRSH 4DGJA 2DE9A 1ELBA 2CMYA 1OX1A 4X8TH 1TB6H 2BVXH 2XC4A 1SQOA 3VXEH 8GCHG 1S82A 1V2PT 3H5CB 2ZGCA 3SV6A 3BTFE 1EXFA
chains in the Genus database with same CATH topology
3UNQA 1VCQA 2ZFPH 1DICA 2KAIB 1CA0B 3M7UA 3TK6A 1UVTH 1SHYA 5A8ZA 1HV7A 1ABJH 4ASHA 1GJAB 1TLDA 1QQUA 5BPEA 2V3OH 2GMTC 4O03A 4NZQA 3N7OA 1TOMH 2ZDVH 1D4PB 2ZU2A 3KQDA 3PLBA 4Y0YE 2FOBA 4GHQA 2GZ9A 2VIWA 4B2AA 1SGCA 2B5TB 4YLQH 3MO3A 1PPHE 2XTTB 3HKJB 1BB0B 1GI9B 5I25A 2A45B 4AYYB 4YT6H 4NSVA 1RXPA 1FPCH 3M5OA 4BOHA 6LPRA 1RGQA 2GV7A 3MNBA 1GHVH 4MLFB 1XM1A 1TA2A 1WSSH 1BIOA 1EAXA 4JZ1A 2FDAA 4Y7AA 1TX8A 1E35B 2BB4A 3BIUH 5FXLA 1O2XA 5ESBA 5A2MH 2OC8A 2STAE 5K0HA 4XOJA 1XKBC 1CE5A 1SLUB 2ZHQH 3RXVA 1DOJA 1GGDB 1IHSH 2YOLA 3A8AA 1S0QA 4BXSA 4YOJA 1IAUA 1L2EA 1TBRH 1BTYA 5C1XA 1Q2WA 1CGIE 2FLRH 2W7UA 1N1LA 3D65E 4ZHMU 2Y5GA 3D62A 3PWBA 1YF4A 2EC9H 3ZVEA 2FM2A 1O3MA 4FUEA 1C5MD 4K3JA 1RFNA 1O2GH 1C1RA 2OBOA 1KDQA 1FIWA 1GHWH 4B2BA 5GDSH 4LOYH 3RC6A 3RC4A 1PFXC 5EU8A 4Q2KA 4OGXA 4CH2B 1P06A 4X6OA 4BAMB 1XXFA 3A8BA 1VJAU 1UVPA 2AGIX 2K1QA 2J9NA 2QGRA 4SGBE 4TY7A 2F9UA 1GBLA 2CF9H 2JH6D 3OTJE 4BTTB 5C1YA 2C8YB 3TPIZ 1QFKH 1C5VA 3PWCA 1DX5M 1BT7A 3MWIU 2BD3A 1YP9A 3AASA 3LT3A 3SJKA 2H5CA 3F9HA 2BY8X 4K1EA 1SSXA 2W3KA 2FO9A 3SQHE 3A8DA 1P2QA 1C5YB 1G2MA 1S85A 3L6PA 4DURA 1O2NA 4FUIA 1YCPM 3KEEA 4YO9A 5C20A 4ABAA 3E16B 2XYAA 3P8GA 3RXDA 1BQYA 4INKA 4I8GA 4D76A 1C5TA 2FOHA 2HPPH 1ZHPA 1MD8A 1J15A 4AFSA 3KQCA 1GCTB 2C93B 3ZZ4A 1GGDC 3BTKE 3JZ2B 1QL7A 1P2MA 1QBNA 3TGIE 1N8OB 4X1PU 1BITA 3BTME 1QQ4A 2VIVA 2VWNA 2O8TA 3E3TA 4R8TB 2SGQE 1HAGE 2ESTE 5AFYH 5GPIB 1HAYB 3QN7A 5K7RA 2VINA 4A1VA 1T8OA 5E8EH 5FBIA 1C2EA 2WYJA 2PUXB 4I32A 2NU0E 1HDTH 1GBJA 1KSNA 2V6NA 3OX7U 2P94A 4OGYA 1YPEH 1JWTA 2C8WB 2ODYB 1P01A 2AGEX 3H7TA 4NA9H 2G8TA 1HCGA 4MPVA 5A0CA 4AX9H 2Y81A 3GDVA 4INHA 1W7XH 4TPIZ 2V3HH 1V2VT 1NY22 4FUJA 5E2OA 1YC0A 1CQQA 2ZGHA 4KGAA 1P3EA 3NK8A 1GJDB 1Y8TA 4GPGA 3K2UA 4NFEA 4O3TA 2NU1E 1G3CA 1OSSA 1G9IE 2BDBA 5E0HA 2ZDAH 1YPKH 2BXTH 1SOZA 1AUTC 1DUEA 1C2FA 2H6MA 2HVXA 2BY7X 1P9SA 2A2QH 5C2ZA 3HK3B 3E6PH 3OY6U 1ZTLA 1BTWA 1Z8RA 1Y3YA 1T8NA 2PW8H 1GHYH 3UFAA 1B5GH 7GCHF 1LPGB 2GTBA 2ZCLP 1ELFA 1GL1A 1LKAA 2QIQA 2QF3A 4I8KA 5EQRA 3SU0A 1BJUA 3T29A 1NFUA 4B73A 3UPEA 5BRRE 3F9FA 4Q80A 1N8OC 1O5EH 1OWHA 1O2TA 1ZGIA 3O8BA 3TJNA 2HNTE 2D26C 1MQ5A 2AMQA 4A92A 2WPLS 3OYPA 3NKKA 4JYTA 4ABEA 3RXQA 3HGPA 1V2OT 2B8OH 1S83A 2F3CE 2P8OB 2PSXA 2Q6DA 3M3SA 2BQWB 3RXEA 1KLIH 1NROH 2WUBA 2ZFSA 3U8TH 5IYTA 4Y8ZA 5FPSA 1L1NA 3P92A 3S69A 5T6DA 1OKXA 2BY5X 1SLVB 4CH8B 1E38B 1ZJDA 3RC5A 1HBTH 3VGCB 3PO1B 6CHAB 2C3SA 4WJG2 1D6WA 1O3EA 2XC5A 3HK6B 4I33A 1FY1A 1SGYE 2FODA 1LVYA 4B71A 2CV3A 1EAWA 1O34A 3E8LA 1YPJH 2ZCHP 2D1JA 4LZ4B 1UK4A 1M9UA 1O5GH 2BZAA 2Q6FA 1KTTB 2XNIA 4WMFA 5DJ7A 5F03A 4AFQA 1SGFA 5PTPA 2WV5A 1O2WA 3ZVBA 1TNHA 4IN1A 2PWXA 3RXTA 1D3TB 3MI4A 3URCA 5CMXH 2OC1A 1A4WH 1OWEA 1PQ5A 2XWBI 2BLOA 4UFDH 1V2UT 1LHGH 2HALA 1JRSA 4AORA 1AVXA 4XBDA 1TBQH 3MH6A 3ZV9A 1HAVB 2ZO3H 2FOGA 2ZU5A 4ABDA 4UDWH 1ACBE 3MNXA 1W3CA 3A86A 4OS6A 1OP8A 1EJMA 1AFQC 1YPLH 1GJ5H 1QA7A 2BQ7B 4MVNA 1GG6B 2TRMA 3P95A 4DJZB 1XMNB 2TIOA 3MO9A 3UWJH 4CRGA 3SV8A 4B76A 4ZROA 1E37B 4ABGA 1IQMA 4Y71A 4MPXA 2IJOB 3KNXA 1RIWB 1AZZA 6GCHF 3KN2A 3SU6A 3RXGA 1THSH 1JIRA 3V7TA 3SNEA 2VVUA 2EI8A 2FI3E 1C4U2 3VGCC 6CHAC 2GCHG 2V0BA 4JZDH 1AWFH 1OWIA 1IQNA 1EB2A 1ESBA 2VVCA 2FOFA 1O3FA 2FYQA 4X6PA 2ZQ1A 4DY7B 3TJVA 4K8YA 1YM0A 4CHAC 2F9VA 1SGPE 1O5FH 2G4TA 1MZAA 1P2KA 3SI4H 3RLWH 3EGKH 1SL3A 3M5MA 3FP8E 3AAVA 5L30H 7LPRA 1MTNB 1FN6A 2IN2A 1GJ6A 2ZCKP 1GI6A 2ZC9H 2XRCA 4CRCA 1VITH 1MTVA 5GJ4B 1O3DA 2ZHFH 5TCCA 4AZ2B 4Y76A 3EAJA 1LHFH 3SU1A 1DY9A 4PROA 1ELGA 2QXGA 1DM4B 1S0RA 2ODQA 2EI7A 2WPJS 1H8DH 4MG3A 4Z6AH 2ZI2H 3SV9A 3MO6A 2CJIA 4H6SB 1ESAA 1O0DH 2A4QA 1SGDE 3LH3A 3BF6H 3SN8A 6GCHG 4FUCA 1CBWC 4NWKA 5DP8A 1FY3A 2J38A 1Z6JH 5EOKA 1MBQA 3SO3A 1RIWC 1GI7B 1TGTA 1NRRH 1FMGA 5EXMA 2P3TB 5A8YA 1V2KT 1NRNH 4DCDA 1GBCA 1UHBB 1ZGVA 4KTUA 3A7TA 5HM9A 3M3TA 1ZPZA 1P02A 1GMHF 1LHCH 1NTPA 1MMJN 2AGGX 4THNH 3ZZDA 4GLYA 2ZHEH 3NCLA 2A5IA 1F5KU 1GI0A 1HAVA 2ILNA 4ZKOU 1O5CB 1TMUH 3LGIA 1MUEB 1O33A 1S81A 3SBKA 1VGCB 3QO6A 1P2OA 2SGPE 2V35A 4JMYA 3PMJA 1GBFA 5GCHG 3P70B 1C1SA 1CU1A 1RD3B 2BD5A 1QB1A 1TX7A 2R2WU 3FVFB 1EJAA 4DT7B 2F83A 4KKDA 2BLWA 3RXSA 4NA7A 1NRPH 4BAQB 4TPYA 1K1LA 5EGMA 2ANYA 3LIWA 4FU9A 1TIOA 2FS9A 2BD7A 3BG4B 4JZEH 3T2NA 3BTHE 1W13U 2G00A 3EDXB 1ZRKA 1C1UH 2CGAA 1WQVH 1F0RA 1ARCA 4X0WU 1K28D 5E0GA 4IS5A 1O2OA 3SV7A 3GY6A 4K1TA 4ABHA 1ELEE 1GI8B 4IMQA 1PPBH 1UK3A 4E05H 1O3NA 2JKHA 2PFEA 2AS9A 4ZXXH 3O8DA 3M61U 4J2YB 1ANDA 4ZMAH 3QUMP 3SORA 3VXFH 4AOQA 1GMHG 1JBUH 1F0TA 1F0UA 1ZMLA 2PGBB 2H2ZA 2NWNA 2Y7ZA 3STIA 4E7NA 3UY9A 3RMOH 2BMGB 2PLXA 1AB9C 3RMNH 4Q7XA 2VJ1A 1AU8A 1K22H 3BTWE 3LGVA 4CR5A 4CRBA 1AE5A 1GDNA 1LHEH 3UTUH 3B9FH 2OP9A 4X1RU 2G4UA 2BOHB 1OPHB 4VGCB 2OD3B 1PPZA 1F5LA 3GY7A 1U6QA 1YLCA 1EKBB 1QRXA 1IQIA 1DXWA 1ZRBA 2BDGA 3VB4A 3GYLB 1C1TA 1Y3UA 1W12U 3E1XB 4U2WA 1HJ8A 1SQAA 1OXGA 3W94A 4MPUA 4K5ZA 1H8IH 1S6HA 3F68H 3ATLA 5CHAB 1YYY1 1Q3XA 4RKJB 3TGKE 2C8ZB 1J16A 3BG4C 3LGTA 1ZJKA 3RXHA 4ABFA 3NWUA 1TPPA 1UVUH 3SOSA 2F9NA 5EPYA 2B7DH 3IITA 2A0QB 3MH5A 1O2PA 1TX6A 3ZZ7A 2ZTXA 2ANMH 5DP4A 4X6NA 3MTYA 1CSOE 1L4ZA 1KDQB 1BTHH 2PSYA 2ZWLH 5DKMA 3FZZA 2VGCB 5DPAA 5EXLA 1HFDA 2GDDA 3QWCH 3S9CA 1EJNA 3TNSA 1FZZA 3SUGA 1G3EA 3E0PB 1ZHMA 3S9AA 1QJ6B 3GCTF 2OC7A 1FIZA 1A0HB 1OP2A 1TNKA 2WV4A 2G5NA 3A81A 5L2YH 2XCFA 4UFFH 3RXOA 2QCYA 5L6NH 3MMGA 1QGFA 1K1OA 3GOVB 2OQUA 4VGCC 1O3PB 3L3TA 1WTHD 1L0ZA 1B0EA 4A1TA 2GZ7A 5EXNA 3U1JB 2SGEE 1CGJE 5CE1A 1GBHA 5LPEA 1TMTH 2BX4A 3MHWU 3MOCA 2P16A 1NU9A 4BTUB 1C2KA 3GY3A 3M3VA 2CXVA 3I29A 1QBVH 2ZTZA 1P04A 2FI5E 1QR3E 1HXEH 2FPZA 3GCHB 1ZSJA 1SBWA 3RXKA 1BHXB 4LK4A 1UVOA 1KXDA 1O2MA 3K65B 1PQ7A 4I7YH 2ZU4A 1IQFA 2WPHS 2Q1JA 4X1QU 3ITIA 1DANH 2M5TA 2GV6A 3GCTG 4JYUH 4OS4A 3BTQE 1Z8GA 1O5AB 1PQ8A 4MNYA 1PJPA 4Q7YA 4HFPB 1HRTH 2ZGJA 1C1OA 1FPHH 1DLKB 1EX3A 1UTQA 2LPRA 2YNBA 2PKSC 3ODDA 4AGJA 4JK6A 2O9QA 1CA8B 1FJSA 3R0FA 1C4Y2 5A09A 4O3UA 3PROA 2EA3A 1FN8A 3RXPA 1ZLRA 4RN6A 4OS5A 1A5IA 1P11E 4GVUA 1FV9A 4CR9A 1QNJA 1CA0C 3T27A 2XBYA 1XX9A 3RXLA 1ZMNA 5FPYA 2A2XH 4GHTA 3KHVA 2Y5FA 1BDAA 5DP6A 2ZPQA 5T3HA 3SI3H 1MH0A 1O3CA 2PKAA 4X1NU 1GCDA 2HWLB 1ANBA 1G2LA 5JB9S 4NA8A 3RXJA 2HGTH 4B1TA 1WQSA 4ISNA 3SU3A 3GCHC 2Y82A 3VB5A 1MQ6A 3EYDA 4X8SH 4F4OC 1LHDH 3BTGE 1GI4A 4Y0ZE 4Y11E 1HYLA 4ABBA 3BEFB 3G01A 4WXVA 4ZKSU 3Q00A 1T32A 1QY6A 4UFGH 2BDAA 1TNGA 2F9OA 4GCHF 1EASA 1T31A 2FS8A 1TGCA 2FX6A 3UQVA 1C2LA 2GKVE 3FZDA 1GVKB 1F0SA 3ZVCA 1YPHC 2SNWA 4WH6A 2BX3A 3U69H 3MU4A 1C4V2 3Q76A 4AFUA 1FONA 3CS0A 4YLUA 7ESTE 2PGQB 1HXFH 1GMCF 1GBBA 3A82A 3RU4D 2XBVA 1SOTA 4BANB 1BTPA 2BDYA 2A32A 4FVDA 2B0FA 4X6MA 1SC8U 5LGOA 2Z7FE 1CT2E 3RP2A 4DOQA 5EPNA 1TOCB 3ZZ6A 5JDUB 3PLPA 1CGHA 4TY6A 2FZZA 2CF8H 1O32A 3JZ1B 5F8XA 1G30B 4MPWA 1JIMA 3DHKH 2ULLA 1GBAA 1WTGH 5JB8S 3URDA 1ORFA 1DWDH 5ABWA 5FPTA 4Z0KA 4RKOB 1XUIA 1GPZA 1O3JA 1ZPBA 1DWCH 1K1MA 1PYTC 4GCHG 1UJ1A 1P2NA 1FQ3A 1KY9A 1SGIB 1DPOA 3ZZ3A 1C1QA 1IQEA 1HAPH 1OS8A 1C9PA 1PPGE 1GJ4H 3LGYA 3ATIA 1YPGH 2ALPA 2R0KA 3RXUA 2BDCA 1P8VC 1EP5A 4NGAH 1TWXB 1TONA 2C8XB 2VIPA 2VIQA 2WINI 5TJXA 3RXAA 1V2RT 2PTCE 2J95A 1A46H 3ZVDA 1GCTC 4HTCH 1ELVA 4K8BA 4CRFA 1LMWB 1K1IA 5FHTA 1ANCA 1PPCE 3GDSA 1W7GH 1ZHRA 2TGTA 3SUEA 3IWMA 1NRQH 3TLOA 3MU5A 3BTDE 2BY6X 3ZZAA 2HNTF 4NIVA 5JBCS 3T5FH 3EE0B 1IQJA 4DVAU 5B6OA 1HAXB 2G52A 4D8NA 1AQ7A 2P59A 1W0ZU 2THFB 5F6MA 2H9HA 1AUJA 1VJ9U 1W11U 3Q3XA 2Q6GA 1RTLA 2R9PA 3IG6B 3PMHB 1D6RA 2OBQA 3LGUA 3AAUA 1HJAB 1MU6B 1ZSLA 2QC2A 1TRMA 4D9QA 5J4SA 1UTNA 2H9EH 3RM2H 3A80A 1ZYOA 2AMPA 1O3KA 2F91A 4IC6A 3VEQB 1O3OA 3PTBA 3TU7H 1KLJH 1V2ST 2G81E 7GCHG 3KQEA 3STJA 3TK5A 1AGJA 1MCTA 1WV7H 2A7HA 1FY5A 3S0NA 4I31A 3K9XB 3U98H 1IQKA 2PHBA 5ETXA 1LKBA 2HPQH 1QIXB 1GBEA 1DE7H 1WOFA 3F6UH 1F5RA 1GMDF 4ZKNU 2AEIH 3QGJA 1UTPA 3GDUA 4XFQA 1AD8H 4FUDA 2BXUH 1CHGA 3V12A 2WUCA 3VPKA 1QB6A 4CBNA 3A83A 1A2CH 2OTVA 1ETRH 3SJOA 3S9BA 3RLYH 3MNCA 3V13A