2FMJA

220-loop mutant of streptomyces griseus trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Conversion of trypsin into a Na(+)-activated enzyme.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA02
1XVMA 3RXMA 3ZYDA 3ZVBA 4ABBA 2GMTC 3UREA 2QGRA 2GZ8A 1SR5C 1WV7H 2BDCA 5L2YH 3PTBA 3MHWU 3JZ1B 1FUJA 1E38B 4X1NU 2A2XH 4YTAA 3RXHA 2FIRH 2FXRA 5EODA 3VB7A 3DD2H 3KN2A 1BZXE 3RXLA 1FQ3A 1QRWA 2V6NA 1GI9B 1QL8A 1Z71A 4Q2KA 2WPKS 1F0SA 1FY4A 1ZOMA 4X2WA 2W3KA 2FZZA 2HNTE 4MTBA 1IQMA 1O3JA 2ZGJA 4WMDA 1AU8A 1DLEA 1UK3A 3S0NA 1YBWA 1QBOA 2BMGB 4I32A 2GD4B 5EOKA 3E0NB 1T4UH 1TGCA 3GY8A 4X8TH 3T2NA 3KQCA 1MQ5A 1SHYA 1O3AA 1VCPA 1GI4A 1JBUH 2C90B 2BY6X 2SGEE 4KP0A 1C2IA 1H9IE 4WH8A 1V3XA 1PQ5A 1YPGH 4X2XA 4NSYA 4AG1A 1N1LA 3RC5A 1VITF 3M5LA 2ZDAH 2GKVE 1MQ6A 4TYDA 2UUFB 1GMDF 4TY6A 5F8ZA 1K1JA 2EEKA 2JH6D 1WBGB 2TBSA 2ZTZA 3LC5A 1FY5A 3LONA 1BJVA 3HKJB 4CREA 4Y0ZE 2BOHB 3WY8A 3GY2A 2FESH 1C4Y2 1O3HA 1O3DA 1MKWK 2AH4X 2HPQH 1TGBA 2VGCB 1GMHF 5TCCA 1A0HB 2BD4A 2ZHFH 3CS0A 4CH2B 2VWOA 5FHTA 3HPTB 2GCTB 1C1SA 3P17H 4ZMAH 1PPEE 1GMCG 2J94A 1O2SA 2BD2A 3QN7A 1O3LA 1TGNA 1XUKA 3RXRA 5DO4H 1AE8H 1QTFA 5EGMA 1NC6A 3MO3A 2PSYA 1YF4A 3NUMA 1GGDB 2C8WB 3A88A 3DHKH 2ZWLH 1NU7B 2FOHA 4JZFH 5DK1A 1Y3VA 8LPRA 2ODQA 3UFAA 1GBDA 1EATA 3DT0H 3QGJA 4X8VH 4JCNA 1GI5A 1Y8TA 4NG9H 5C1XA 1FN6A 5EPYA 2EC9H 2PWXA 4IMQA 3RXTA 3TJUA 2PHBA 2WINI 3TJNA 2BB4A 3ATWA 3MU1A 3MH6A 5FX6A 1V2TT 1LHFH 3QLPH 1O5FH 2QYIA 5EPNA 2GV7A 3RXGA 3BG4C 1O2HA 3BEFB 4NA8A 2AFQB 3TJOA 1TPOA 3L33A 1G3EA 4X6PA 3U8RH 1RTKA 4YOJA 4MVNA 1SC8U 4XE4A 2J38A 3IG6B 2BD9A 3MU5A 1BOQA 6CHAB 2FLBH 4RSPA 1TA2A 3C27B 1GHAF 2ZFQH 4A1TA 4E7NA 4TWYA 5T6FA 3D23A 3LGTA 2Z6BD 2KAIA 2TGDA 3A8AA 1P2IA 5E0HA 1CE5A 2B0FA 4B2CA 1B0FA 1NZQH 1HAIH 2C3SA 5DP7A 4ABHA 2GV6A 1VZQH 1EP6A 3RXPA 2RG3A 5JB8S 1F5LA 3MMGA 3PMBB 2VWNA 1BRAA 3E3TA 3PROA 4MPVA 3MH5A 3LJJA 5FBEA 3BG8A 2C8YB 1DM4B 1WUNH 3SUGA 3GICB 1FI8A 2PTNA 3BEIB 3BTWE 1ANCA 2V3HH 1EAXA 3B9FH 4BOHA 1CQQA 3RXJA 1YPJH 3T27A 2ZIQH 2A7CA 1ID5H 1KIGH 5L2ZH 5GJ4B 2O9QA 3QTVH 2AGGX 3QO6A 4Y8YA 1YC0A 4ZXXH 1RTFB 1QHRB 1C5YB 4LK4A 1SOTA 1SSXA 3V3MA 1GVZA 4XBDA 4AFQA 4K60A 1RJXB 5L6NH 1HJ8A 1P09A 1G9IE 1EQ9A 1SMFE 2A5AA 3RXBA 1DOJA 2OCVB 3NPSA 3O8CA 2XCNA 1G2LA 3R0FA 3MU8A 4O97A 5LPFA 2ZFSA 3RUOA 4Y6DA 2VWLA 3O8DA 3Q3KA 2VIVA 1O3OA 1GBCA 1EJMA 1V2NT 2GDDA 1LHDH 1TQ7B 2G5NA 5E0JA 3MO6A 1ZTLA 2P3FH 2WYGA 4K8YA 1DWEH 3ZVAA 2F3CE 3RC4A 4CR5A 1O2NA 1YLDA 3Q77A 1YKTA 2FP7B 3PMAB 1BTUA 2AERH 1BQYA 1TX6A 5C5OA 4ZXYH 1ELEE 2PR3A 1BTYA 1C1MA 4O3TA 3RU4D 1TBRH 2R3YA 4AYVB 1BIOA 1C2MA 1C2GA 1MBQA 1DSUA 2AGEX 1GBEA 1HRTH 5ETXA 1BB0B 1E36B 2GVFA 3RMOH 8ESTE 4IS5A 1TNKA 4XBBA 2FYRA 2H2ZA 1MKWH 2BDHA 1MTNC 3GDSA 2OLGA 2QN5T 4IW4E 1FY8E 1TGSZ 2OUAA 1HB0B 4CRAA 4A5TS 1O5GH 1TMTH 1DY9A 1ETSH 1GBIA 1TNLA 4BXWA 3D62A 2F9OA 2NU1E 4MPXA 1OYTH 1C5NH 1RXPA 5FPYA 2NU3E 1HAXB 3U98H 1IQLA 3KNXA 1GVLA 2O8LA 1D9IA 1WAYB 1HAPH 2OC0A 2ZGBH 3RXEA 5FCKA 2ZDKA 1W13U 4BAMB 1HAYB 3LIWA 4Q80A 1EX3A 1ZRBA 4NIXA 1TQ0B 2QV1A 1CA8B 1KY9A 4DT7B 1J8AA 2ANKH 1O5CB 3F68H 1AHTH 3BIVH 3BEUA 4X1RU 2OC1A 1EP5A 4O3UA 1A3BH 2FOMB 3M3VA 1K1LA 1JXPA 4DG4A 2NU2E 3VEQB 1K21H 6GCHF 2B9LA 4IC6A 3GCTG 2ZPQA 2CHAB 1L4DA 2W7UA 2BY9X 1CSOE 3B23B 4ISLA 4LXBH 1CGJE 3KQEA 1MD8A 1W2KH 3SJOA 3PMJA 5CE1A 4A6LA 4JZIA 2ZG0H 4K3JA 4NA7A 2I6QA 2WPLS 4WF8A 4XFQA 1YP9A 3GDVA 3PB1E 2FOGA 2PUQH 1LO6A 1SI5H 1T8NA 3E6PH 5F8XA 2RCEA 1AB9C 4I8KA 4B75A 1MBMA 3PWBA 1O2TA 1ZTKA 1Z6EA 1O2ZA 1CT0E 2Y80A 2IJOB 2BVXH 4HZHA 2ESTE 1OP0A 4DVAU 2ZHQH 1EAWA 4H42U 2HLCA 4ISNA 3KHVA 5GDSH 3NZIA 2GT7A 1G2MA 2D8WA 3GOVB 1C5OH 1FONA 3UTUH 1ELFA 1F2SE 1TMUH 4SGAE 3Q3YA 2UWPA 1EUFA 2HVXA 2AS9A 2BYAX 1FN8A 3C1KA 3A8BA 5EU8A 1P2KA 4TY7A 1ZPBA 2VINA 4FUGA 4AZ2B 3D49H 2VIDA 4YOGA 2VNTA 2CGAA 4VGCB 5C1YA 3TH2H 1OP2A 1KXAA 3EA7A 3VB3A 3SU4A 5CHAB 3SN8A 4XSKU 1O3NA 5F6MA 4ZH8A 3PLBA 1QRXA 2C4FH 1LPGB 1GJ8B 3RXVA 3GY5A 7ESTE 1SFIA 1UTLM 2F9BH 1BHXF 3URDA 3U8OH 2WUCA 3NWUA 1C5TA 4WH6A 2V3OH 3OSYA 2P16A 1FLEE 1BJUA 1TOMH 1EPTA 3SUDA 4YT6H 4B2AA 2XTTB 2HWLB 1P03A 1W10U 2Q6FA 2Z9IA 3SOSA 5EQSA 4KTSA 1RS0A 2UUKB 3SGAE 1AE5A 1NESE 1K2I1 1DLKB 3JZ2B 4TPYA 2NU4E 5JBCS 2XBYA 2ZU2A 3VGCC 2P94A 3GCOA 4AX9H 5JB9S 1GJ9B 2XXLA 3SI4H 5DKMA 1EAIA 2ULLA 5F8TA 2A31A 1QJ1B 1K28D 3PLKA 1V2UT 3ATKA 1Z7KA 3A81A 6ESTA 1ZYOA 2BHGA 4O9VA 3F9FA 1KXFA 1NY22 2VJ1A 5A8ZA 1CGIE 1OP8A 5FCRA 2XWBI 3SW2B 1K1OA 4WVPE 2G52A 4YZUA 2D26C 3TPIZ 1EJNA 1Z8GA 4D9QA 3MI4A 1IOEA 2OD3B 1GJAB 1SGRE 4INLA 2FTLE 4XDEA 1ZSJA 1O2LA 3Q76A 4Y0YE 4KTCA 2FS9A 1S0QA 3LGUA 4CBNA 1AKSB 1NFYA 4ZKOU 1OS8A 1C2LA 1AFQB 4WXVA 4K8BA 2J9NA 1P02A 1FXYA 2O8WA 1TWXB 1IHSH 1DWDH 1E0FD 2P8OB 4U2WA 1BBRE 2VH0A 5DP6A 3SNBA 1TNGA 5FBIA 4IN1A 1AMHA 1FPCH 1SGDE 1BTHH 2OINA 1LKBA 3FZDA 1Z8IB 3EA8A 4RKJB 5JPMH 3KF2A 1C2EA 2P3UB 3SJIA 1P2NA 1SLUB 3RU4T 1GI1A 1SGNE 3SJKA 1F0RA 2H9EH 5GIBA 3RXCA 3CS7A 3LC3A 3KQBA 2P8OC 2R9PA 2QIQA 1FPHH 3S69A 3PTNA 2BD8A 3TH4H 1ARBA 4ISIH 1P2MA 2W5EA 1OYQA 1LHEH 2Y6TA 1C4V2 1W11U 1A5HA 1GJBB 3LOXA 2OC7A 1DWCH 3MH4A 5LPRA 1IQNA 2HOBA 1G32B 2PGBB 2C8XB 2ZFPH 2FOAA 1YPLH 2OXSA 2FI3E 1UCYE 3ZV9A 1TRMA 3MNCA 2A4RA 1IQEA 2GCHG 3Q00A 2ZFTA 1MAXA 3S7KB 1HCGA 1SGFA 2XYAA 2RDLA 2J4IA 5DPAA 4GSOA 3L3TA 2QF3A 1SGTA 2BD5A 1G3CA 3TNSA 3RMLH 1GDUA 1DSTA 1F0UA 2AYWA 2ZGXH 3RLWH 1UK2A 1DDJA 1QA7A 3BN9A 4CRGA 1EOJA 5G4BA 1GHXH 3P8OA 5B6OA 5E8EH 2DE8A 1ZJKA 3CENA 1TRNA 4ZHLU 2SGDE 4AB9A 3F9HA 1O2UA 1OXGA 3ZZ8A 1SGYE 3VB5A 1HFDA 3AW0A 1XVOA 1TMBH 4FVDA 2A2QH 5AVDA 1CA0B 2WV4A 1O5BB 3OYPA 5C67A 4OS4A 1GWAA 1Y3UA 1TPAE 1TIOA 1A4WH 3UQOA 1ANBA 4BTIB 3P92A 1EXFA 3STIA 5HGGA 2G55A 1N6XA 1QGFA 4R0IA 4XOJA 1HDTH 4ABAA 1Q2WA 1J9CH 1QB9A 3BTGE 4JYVH 1F5RA 3EQ0H 3SU0A 5IYTA 1RIWB 1VGCB 1HAZB 3SV6A 1D3QB 1TNHA 2Q6DA 4WWYA 1XMNB 4JZDH 3EGKH 1S0RA 3SQEE 4BTUB 1GI6A 1KDQA 3UIRA 1LKAA 3V12A 5EXMA 1SGCA 1P9UA 3QZRA 4OGXA 1KLJH 2R0LA 1QQUA 2OP9A 1E37B 2UUJB 5ESTE 3U1IB 4BAOB 2CXVA 5TCAA 2W7SA 1GBLA 2SGQE 1FJSA 1T31A 4CRBA 1WQVH 4NA9H 1WQSA 1TE0A 3P6ZB 5HXFA 1M9UA 1YPMH 4BNRA 2IN2A 2ZKSA 1C2KA 1VCQA 1SGQE 1RIWC 1D3DB 2ANWA 1Z8RA 1GL0E 2ALPA 4INHA 3S9AA 2D2DA 3TITA 4Y10E 5A8XA 1GBTA 1NRRH 3LPRA 3RP2A 2I6SA 4CH8B 4ABEA 2A45B 2VGCC 5LH8A 3QTOH 4ABFA 2ZC9H 3TVJB 1C5ZB 2GCTC 1QFKH 3I78A 6LPRA 4AGKA 2BX3A 1H8IH 3UY9A 1AO5A 1QB6A 1C1VH 3MYWA 3AW1A 1TA6A 9LPRA 1GHYH 3QZQA 3P8GA 4NFFA 3TJVA 2DE9A 1GGDC 1TOCB 4MNYA 4B76A 3TGJE 1YYY1 2QA9E 1SBWA 2ZU1A 1O3IA 2K1QA 1OWIA 1AWFH 1L0ZA 3GY4A 4NFEA 4AGJA 1CBWB 1TBZH 5HM2A 1W3CA 4MNXA 3M5MA 1BDAA 4Y8ZA 1CHOG 1DT2A 1T7CA 1FNIA 1QJ6B 3GCHB 5FXLA 1EKBB 5C20A 3A7XA 1KTTB 4Y7AA 1XUJA 1A0LA 1ZGVA 4NIYA 1C1QA 1TPPA 2ZFFH 2FLRH 3LGVA 5EQQA 1GHBG 1GBHA 1DWBH 2ZI2H 1K9OE 3DUXH 2Z3CA 1C5QA 3B8JA 3SJ9A 1ZMNA 3SNAA 1F7ZA 1QL9A 4CRCA 4D76A 1G37A 1CBWC 1GMCF 1LPKB 1MTSA 1SQOA 2PKSB 2BD3A 1C2JA 1EASA 3ZZ3A 6CHAC 4CHAB 1G30B 3PMHB 1ELBA 4I8LA 5T6DA 3E91A 1TALA 2ODYB 4DURA 3RXDA 3SNDA 1O38A 4GVUA 4I8GA 3I77A 4UE7H 3RM2H 1D3PB 2FYQA 2Z94A 2H6MA 1ELVA 5BRRE 1KSNA 4Y11E 3UWIA 1HGTH 4I7YH 2VU8E 3OTJE 3ZVDA 2HNTC 1DPOA 5T6GA 1XXDA 3QDZB 4CR9A 4X6OA 5CMXH 1C9PA 3EE0B 1ZLRA 1GJ4H 1SGPE 5DP5A 2WPJS 3ZV8A 1OKXA 2QXGA 2JETB 3E0PB 1XUGA 1C5MD 2AEIH 3K6ZA 2ODPA 2BZ6H 1FV9A 1O2MA 2G8TA 2XW9A 2W3IA 2KAIB 4K1EA 1QY6A 3ZZDA 1ZMLA 3QX5H 1SLWB 1CHOF 4I33A 1P8VC 2QC2A 4D7FA 1S81A 5A0AE 1C1PA 3OY6U 3VB4A 3RDZA 1F0TA 4DIHH 3VXEH 1D3TB 2ZDVH 4X2VA 2GGVB 1Y5BT 4DOQA 1PQAA 1NM6A 4YLUA 2PV9B 3KQDA 1N8OB 1KXCA 1DUAA 2UWLA 3HKIB 2BVSH 2VH6A 3M35A 3O8RA 1Q31A 1QA0A 3SJ8A 4KGAA 2A0QB 2G4UA 2G81E 1MTWA 1Y59T 2G5VA 3PV4A 3BTTE 1YLCA 1XKBC 1DANH 4Y76A 3SU3A 2XWAA 4Y79A 3KCGH 2ZU3A 2GT8A 3ATMA 3V0XA 1INCA 1HBTH 5A2MH 2F9PA 1GBBA 1W7GH 4FUBA 1AY6H 3EAJA 3SHCH 3UOUA 4GHQA 3V13A 3EA9A 1BRCE 2F9NA 4FUJA 1GBAA 1PFXC 1GI8B 1TRYA 4MNWA 2EI8A 3M37A 1PPGE 1J15A 2J92A 3OX7U 2ZCHP 2R0KA 1UVUH 4X8UH 5DJ7A 5JBTA 1WTHD 1EZUC 5DP8A 1UCYK 2SGFE 1GHZA 3RXIA 1O34A 3L6PA 3BTDE 1MZAA 4Y71A 3TGIE 2VIQA 1TONA 1MKXK 1TB6H 4JK6A 1IQFA 4JMYA 1ELDE 1BMMH 1AZZA 1YPHC 3A86A 4OS2A 2ZO3H 1BTXA 2BQWB 1NFWA 2C93B 3UNSA 3VXFH 2QXHA 2Z3EA 5I25A 1C5UA 2ZHDA 2F83A 3KGPA 2THFB 1CO7E 4KELA 4O03A 4THNH 4UD9H 1D6RA 4WMFA 4U01A 3MU4A 4X0WU 2LNCA 1GBFA 3UOPA 5A09A 3E16B 3SNEA 2YNBA 1P11E 1ESAA 1RTLA 1P0SH 5J4QA 1OWKA 1LQEA 1O33A 1P06A 2SGAA 1QBNA 3F6UH 4Y7BA 2UUYA 4OGYA 5GPIB 2WPIS 1A2CH 4GUXA 2CHAC 3ZVEA 4ABIA 1MTUA 1GJ5H 3T25A 3LGIA 1V2RT 2M5TA 1V2MT 3LT3A 1O32A 1GJDB 2BXTH 1H9HE 3SI3H 4AORA 3P70B 1ELCA 3F9EA 3RXKA 7LPRA 5I46H 1YCPK 5PTPA 1AI8H 1JIRA 1P2QA 1IQKA 5LPEA 2D1JA 3KIDU 1DS2E 3RXSA 4ZUHA 1AZ8A 3SU5A 1J14A 4UFEH 5FPTA 1D6WA 1G36A 5LGOA 5C3NA 2ALVA 1WSSH 4D9RA 2FWWA 4UFDH 1TBQH 1VJ9U 3PWCA 5ABWA 3ATIA 1MH0A 3H7TA 3R3GB 1HIAA 1MMJN 1JRTA 4K69A 2HGTH 1SLVB 3MU0A 2WUBA 3BTHE 2ZDNA 1O2VA 4I31A 3URCA 3RLYH 1L4ZA 4J2YB 1AUTC 1RRKA 1YGCH 4U30A 4TWWA 3GCTF 2CV3A 1AN1E 3NCLA 4WJG2 3TK6A 1RGQA 1C5PA 2W26A 1WTGH 1W12U 3BF6H 3P8NA 1K1IA 3GY6A 4IC5A 3A83A 1HXFH 3HK6B 1TLDA 3STJA 2ZPSA 3KEEA 1C5WB 1UJ1A 4NGAH 2A4QA 2BDAA 4VGCC 4YOIA 5A0BA 2A5KA 1RFNA 5AHGH 2QXIA 1ABIH 1QCPA 2RA3A 4MQAA 3RXOA 5CHAC 1THSH 1KXEA 1GBJA 1GCTB 2H9TH 4GCHG 3T28A 1MUEB 1TX8A 2Y7XA 1AGJA 1C5VA 4NIVA 1SL3A 1AD8H 1YM0A 2NWNA 2TGTA 4Q7ZA 3SUEA 4FUIA 4I8JA 2A7JA 1H1BA 4FU9A 1HAHH 5TJXA 1QQ4A 1OWHA 2QF0A 1LPZB 1GG6B 1HIAB 1C1UH 4JK5A 5HMAA 4ZKSU 4GLYA 1HUTH 2PW8H 1MD7A 3BTKE 1ARCA 4Z0KA 1O2WA 3ITIA 4IN2A 1WU1A 4MG3A 4B1TA 1V2ST 5DP9A 2ZU5A 1UVTH 3SU6A 4KTUA 2GDEH 3HGNA 2BY8X 2PKAA 1L1JA 4AFZA 2ZCLP 5A0CA 1A3EH 1WYKA 4CRDA 1O2RA 2FO9A 3UNRA 1UTOA 1GBMA 4X6NA 1HNEE 1O2OA 1BTWA 1H4WA 2BVRH 1UTJA 4NSVA 1HAVA 3TU7H 3NK8A 4CBOA 1QB1A 2FOFA 1EZSC 1UCYH 2R2MB 4BAQB 1AVGH 1J17T 3RXFA 9ESTA 4B74A 1EOLA 4QT8C 1OSSA 1C2HA 1C1OA 3DA9B 1EPTB 1A46H 1O3GA 1XM1A 4DY7B 2HPPH 2VB0A 1IHTH 2FI5E 4ESTE 1U6QA 2CJIA 3HK3B 3V7TA 1UO6A 3DFLA 1Q3XA 1NRPH 3PM3A 4AYYB 3S9BA 3FP8E 5GXPA 3TH3H 2Y82A 1IQGA 4NCYA 1C4U2 1AFQC 4Z6AH 1GJ7B 1ETTH 3AASA 1SOZA 2G00A 1A5GH 3UNQA 5DGJA 3P8FA 1A5IA 2JH0D 3RXAA 3UWJH 3GDUA 3SU2A 3ZVFA 2BDIA 4X6MA 1L1GA 1JIMA 1ABJH 1SFQB 1W0ZU 3I29A 1K1MA 4AFUA 1C1TA 2FDAA 1BA8B 3IITA 1KXDA 1E35B 5K0HA 2PSXA 1OWEA 4X1SU 2V35A 5JBBS 1Y3XA 1PQ7A 4E05H 3M36A 3ZZAA 1P2OA 1ZHRA 2P3TB 2PKAB 2YOLA 4IMZA 1C9TA 5ESBA 2SNWA 3FFGA 2WYJA 3FVFB 1GI0A 1VITG 1UMAH 1XUHA 4K5ZA 1TX7A 3TK9A 3ZYEA 2GX4A 1S85A 1KLIH 3SUFA 1O36A 1GMDG 2PGQB 1QURH 1ZHMA 3BTME 2VIPA 1GI7B 1YCPH 1AIXH 2CF8H 1OWJA 5IDKA 4WY3A 4A92A 1ZHPA 1B7XB 4H6TA 1ANDA 1AUJA 4E06H 1CVWH 4RKOB 1ZRKA 1O3EA 3M5NA 1QJ7B 1O3FA 2Q1JA 1UK4A 4LOYH 3BTFE 3O8BA 4HGCA 4A7IB 2PFEA 1GMHG 1THRH 2Z3DA 3GYMA 1FIWA 4GAWA 4H6SB 4AFSA 1V2PT 1O3BA 4RN6A 4ZKRU 1N6YA 1C5SA 2ZTYA 2FEQH 2WV5A 2XC4A 4BANB 4IGDA 1SGFG 4YM9A 1V2VT 4MNVA 1IQJA 5JBAS 1PQ8A 2ZTXA 3BIUH 2FOCA 2VIOA 3A82A 1NROH 1UVPA 5DP3A 1QIXB 2ZDLA 1UTNA 1O31A 1GJ6A 4NZLA 3ZZ5A 1VJAU 2FOBA 2BQ7B 3Q3XA 3M3SA 1NFUA 1TNJA 3PO1B 4FUFA 1ETRH 2ZU4A 4YT7H 5EG4A 4DIIH 1XKAC 2SNVA 2XBVA 5EQRA 1VCWA 4K2YA 1CA0C 4OS7A 1BT7A 1O39A 1QL7A 2FM2A 2XRCA 2BLWA 1V2KT 3ZZBA 3TGKE 1DY8A 3SO3A 1C1WH 4XBCA 2BM2A 1YCPM 1GDNA 1BRUP 2A7HA 2ZFRH 2HALA 3SHAH 2GCHF 1KYNA 1PPZA 5EW1H 4ISOA 4OS5A 1IQHA 2IOTA 1C2DA 3PYHA 2BDYA 2TPIZ 2TIOA 3M3TA 3PO1C 4YO9A 5DG6A 1CT4E 3QK1A 4ZKNU 1VGCC 5EXLA 2ZP0H 1GHAG 1XXFA 2H5CA 2BTCE 4B71A 3UUZA 1SVPA 5GCHG 1A61H 1P57B 3E90B 4UFGH 1TYNA 3A84A 3OY5U 1QNJA 1S5SA 3E8LA 1ZPCA 2ZA5A 2ZHWH 2CN0H 1DUEA 3ZZ6A 2QY0B 2Y5GA 4DW2U 1A0JA 1JWTA 2O8TA 3K6YA 3A7WA 3SV9A 3HATH 4DJZB 1NRQH 5BPEA 4FUCA 8GCHG 1UTMA 3UR6A 4ABDA 1JMOH 2BZAA 3LH3A 3BG4B 3H5CB 1ESTA 1O2IA 3M7TA 3LJOA 3FANA 2XBXA 3PLPA 2QCYA 2ZGCA 4M7GA 1GJCB 1KDQB 1PYTD 3ZZCA 2H5DA 1LVMA 3SU1A 2TGPZ 2OBQA 3G01A 4ZAEA 2FS8A 3VB6A 4F4OC 3K9XB 5H4IB 3U8TH 2J34A 2XCFA 1Z1JA 2FX6A 1YPHE 4JZEH 7KMEH 2HRVA 1DICA 1W7XH 2A32A 1HV7A 1GBKA 1ZPZA 3S9CA 1UVOA 1WOFA 4ASHA 5L30H 1O2KA 2Y5FA 2PTCE 4FVBA 3M7UA 1MU6B 3SGBE 2Z9GA 1G3DA 2GZ9A 2NU0E 1LHGH 1T8MA 3GCHC 2OQUA 5GCHF 4R8TB 1J16A 1YPEH 2ZPRA 2ZECA 3UR9A 2A5IA 3RMMH 2VVVA 3A85A 2XNIA 1AVWA 2V0BA 1X7AC 5E2OA 2BQ6B 1VR1H 2B5TB 2OQ5A 1V2WT 1L2EA 1S6FA 2B7DH 3N7OA 1EAUA 5C1UA 1P3EA 1C5LH 2ZF0H 1NU9A 8GCHF 4IBLH 4UEHH 3KL6A 2PKSC 3GY7A 4X2YA 2BDBA 5E2PA 3T29A 4CHAC 3ODDA 2G4TA 2JKHA 1L1NA 4B73A 3W95A 1V2LT 5DP4A 2ZQ1A 1ELAA 5JDUB 3AVZA 1FAXA 1ZR0A 1FZZA 1V2QT 1GL1A 1DE7H 1TFXA 3H7OA 1PPHE 4I8HA 4A1XA 5J4SA 2ILNA 3U69H 2AIQA 3VPKA 1T4VH 5HYOA 3A80A 2HNTF 2RA0A 3A89A 3A7ZA 3LDXH 4UFFH 1EZQA 3AAUA 3D65E 4BXSA 4ISHH 1CGHA 1F92A 2Z7FE 4DCDA 1WCZA 2ZEBA 1GHBF 4BAHB 2AIPA 4GHTA 2JETC 2ZHEH 1AVXA 1BBRK 1S82A 1MTNB 1KTSB 5EW2H 2AMDA 3LGYA 2P93A 3RXQA 6GCHG 1BRBE 1EJAA 4HTCH 2FI4E 3SBKA 1H8DH 1C2FA 2LPRA 1XUIA 3UPEA 1E34B 2EA3A 5SGAE 4FXGH 2Y5HA 2WPHS 3GYLB 3ATLA 3U9AH 4UONA 1K22H 1B0EA 1JRSA 1O35A 4U32A 3T5FH 3NXPA 4YESB 4UDWH 4FU7A 1SHHB 3E1XB 1ZJDA 4LZ4B 1ELTA 2SFAA 1TPSA 5FAHA 1O3CA 3EDXB 1SLXB 4MPWA 3T62A 1N8OC 1DX5M 1O5EH 3ENSB 1NT1A 1P2JA 1HXEH 4AOQA 2R3UA 1KLTA 8KME2 1GDQA 3GCNA 1GCDA 3QWCH 4ZHAA 3RU4E 2ZGHA 2STAE 5HM9A 1SB1H 4HI3A 3SNCA 1P3CA 1MU8B 1BCUH 1SPJA 2QXJA 3M7QA 3SORA 1LCYA 1O5AB 1MZDA 1UVSH 1FIZA 2GTBA 3A8DA 1A7SA 1MCVA 4PROA 3U1JB 3A7VA 1BITA 3TIUA 4CRFA 1DXWA 1NO9H 3GY3A 1TAWA 2XBWA 3RXUA 1C1NA 1PPFE 4K1SA 2AGIX 1HJAB 2BX4A 3AAVA 4LZ1H 1P04A 2CF9H 1GI3A 2ZZUH 4SGBE 1AB9B 4X1PU 4FUDA 1O2GH 3ODFA 1Z1IA 3A7YA 3SV7A 4B2BA 4MPUA 2FOEA 2G51A 5JYIA 5C2ZA 1O0DH 3A7TA 1PYTC 3MH7A 1LVYA 1SQTA 2GZ7A 1UTQA 2DUCA 1S84A 4D8NA 3BV9B 1PPBH 1O2PA 1T8LA 1O2YA 3RC6A 1THPB 1W0YH 2J2UA 1ZMJA 1AFEH 1OX1A 1HJAC 1O5DH 1OWDA 4JYUH 1AQ7A 1C5XB 3ELAH 4AG2A 1LVOA 2H1UA 3A87A 3EYDA 1LVBA 1LDTT 2C8ZB 3QGNB 2FODA 1P9SA 1VITH 1ESBA 1IAUA 5E0GA 1NRNH 2ZDMA 2VVUA 4X8SH 1Y5UT 3RMNH 2XC5A 4AB8A 1NN6A 3SV8A 4WMEA 3BTEE 1O2XA 4GPGA 1MCTA 1PJPA 5EXNA 4OS1A 3QUMP 1ZZZA 1ZSLA 4HFPB 1BHXB 2ZQ2A 5GWZA 2A1DB 2TRMA 2TGAA 3BSQA 1LMWB 4NWLA 5FX5A 1GI2A 5AFYH 1OOKB 2JH5D 3MNSA 1G3BA 1BUIA 1CT2E 2STBE 2PUXB 1W8BH 2Q6GA 4NWKA 4OS6A 3TK5A 3ZZ4A 2F9UA 4X1QU 1MTVA 1EB2A 4Q7XA 1Y5AT 2XC0A 4A1VA 1BMNH 5C5NA 2FX4A 4Q7YA 2P95A 1CU1A 1SGEE 2OTVA 2BY5X 4FUHA 1UTKA 2O8MA 1ORFA 2F91A 1AWHB 2OC8A 4MLFB 4MDSA 1C1RA 3M61U 3LKWA 1SQAA 1C5RA 1ZGIA 3TNTA 7GCHG 2SGPE 1FAKH 2QAAA 1AKSA 3VGCB 1GVKB 1BBRH 5A8YA 3S7HB 1FY3A 1PPCE 2IPHA 2VVCA 1YPKH 1MAYA 1LQDB 1LTOA 1ELGA 1FMGA 1O30A 3MO9A 2Z9KA 2Z9JA 5K7RA 1FY1A 1TABE 1FDPA 1BTZA 1A1RA 1P12E 1BMAA 2Y81A 3ZZ9A 1CHGA 3LU9B 2O8UA 3LH1A 4J1YA 1H9LB 2OBOA 1NRSH 1ANEA 3K2UA 1W14U 3MFJA 3ESTA 1P10A 2WPMS 1O3KA 2BDGA 4DGJA 1F5KU 2BLQA 1GCTC 1O3PB 3FZZA 1V2JT 3SGQE 5AF9H 1TGTA 1O37A 1UTPA 3MTYA 1TNIA 1Z8JB 3FP7E 2BXUH 1D4PB 1K1NA 1P01A 1Y3YA 4NIWA 1HYLA 2BD7A 1EB1H 2BOKA 2F9VA 3W94A 2EI7A 1GHVH 2P59A 3ZVGA 3UQVA 1GG6C 4ZROA 2B8OH 2FPZA 2ZNKH 3F9GA 2ZCKP 4JYTA 2BLOA 1DITH 1QRZA 1V6DA 4ABJA 4YLQH 1MKXH 2VWMA 4H4FA 1UHBA 1KXBA 1S83A 1OPHB 1XUFA 4JZ1A 1NFXA 1NS3A 4INKA 4KKDA 1SG8B 5FPSA 3VFEA 2A4GA 3IWMA 1BTPA 4D7GA 3HGPA 2FTMA 4E7RG 4FU8A 1QR3E 4F49A 1ACBE 1ZSKA 1HAOH 2ANMH 2BY7X 1GHWH 2EI6A 4WXIA 7GCHF 1LHCH 3MWIU 3M5OA 4K1TA 1DVAH 3SZNA 2Y7ZA 3RM0H 1V2OT 3MOCA 1EZXC 1O2JA 4GCHF 1O2QA 2R2WU 2J95A 3DFJA 1EPTC 3T26A 4BTTB 2ANYA 3CP7A 3ZVCA 2A4OA 3GISB 5AFZH 1DXPA 2UWOA 3FAOA 3FP6E 2BLVA 3SV2H 1HLTH 4Y8XA 3SQHE 1O3MA 1JOUB 3MNBA 1T32A 2GP9B 3MNXA 3OU0A 3P95A 3LGWA 1QBVH 1SGIB 3A8CA 2H9HA 5F03A 3ZZ7A 4TPIZ 1NPMA 1XX9A 5T3HA 1HJ9A 3BTQE 2AMPA 2CMYA 1Z6JH 2GMTB 2FMJA 1HAVB 2YNAA 1ZTJA 4FUEA 4ABGA 1P05A 1S6HA 3NKKA 1NTPA 2VIWA 4BAKB 2PLXA 3TLOA 1UHBB 1IQIA 1HPGA 4NZQA 1DFPA 1Y3WA 4AN7A 2Z9LA 1BMLA 3F1SB 4ZHMU 1RD3B 1K1PA 1T8OA 1HAGE 1GPZA 2AMQA 2ASUB 1B5GH 3K65B
chains in the Genus database with same CATH superfamily
1XVMA 3RXMA 3ZYDA 3ZVBA 4ABBA 2GMTC 3UREA 2QGRA 2GZ8A 1SR5C 1WV7H 2BDCA 5L2YH 3PTBA 3MHWU 3JZ1B 1FUJA 1E38B 4X1NU 2A2XH 4YTAA 4HG6A 3RXHA 2FIRH 2FXRA 5EODA 3VB7A 3DD2H 3KN2A 1BZXE 3RXLA 1FQ3A 1QRWA 2V6NA 1GI9B 1QL8A 1Z71A 4Q2KA 2WPKS 1F0SA 1FY4A 1ZOMA 4X2WA 2W3KA 2FZZA 2HNTE 4MTBA 1IQMA 1O3JA 2ZGJA 4WMDA 1AU8A 1DLEA 1UK3A 3S0NA 1YBWA 1QBOA 2BMGB 4I32A 2GD4B 5EOKA 3E0NB 1T4UH 1TGCA 3GY8A 4X8TH 3T2NA 3KQCA 1MQ5A 1SHYA 1O3AA 1VCPA 1GI4A 1JBUH 2C90B 2BY6X 2SGEE 4KP0A 1C2IA 1H9IE 4WH8A 1V3XA 1PQ5A 1YPGH 4X2XA 4NSYA 4AG1A 1N1LA 3RC5A 1VITF 3M5LA 2ZDAH 2GKVE 1MQ6A 4TYDA 2UUFB 1GMDF 4TY6A 5F8ZA 1K1JA 2EEKA 2JH6D 1WBGB 2TBSA 2KCOA 2ZTZA 3LC5A 1FY5A 3LONA 1BJVA 3HKJB 4CREA 4Y0ZE 2BOHB 3WY8A 3GY2A 2FESH 2LP6A 4OM9A 1C4Y2 1O3HA 1O3DA 1MKWK 2AH4X 2HPQH 1TGBA 2VGCB 1GMHF 5TCCA 1A0HB 2BD4A 2ZHFH 3CS0A 4CH2B 2VWOA 5FHTA 3HPTB 2GCTB 1C1SA 2KZ4A 3P17H 4ZMAH 1PPEE 1GMCG 2J94A 1O2SA 2BD2A 3QN7A 1O3LA 1TGNA 1XUKA 3RXRA 3H09A 5DO4H 1AE8H 1QTFA 4RT0A 1NC6A 3MO3A 5EGMA 2PSYA 1YF4A 3NUMA 1GGDB 2C8WB 3A88A 3DHKH 2ZWLH 1NU7B 2FOHA 4JZFH 5DK1A 1Y3VA 8LPRA 2ODQA 3UFAA 1GBDA 1EATA 3DT0H 3QGJA 4X8VH 4JCNA 1GI5A 1Y8TA 4NG9H 3CNRA 5C1XA 1FN6A 5EPYA 2EC9H 2PWXA 4IMQA 3PV2A 3RXTA 3TJUA 2PHBA 2WINI 3TJNA 2BB4A 3ATWA 3MU1A 3MH6A 5FX6A 1V2TT 1LHFH 3QLPH 1O5FH 2QYIA 5EPNA 2GV7A 3RXGA 3BG4C 1O2HA 3BEFB 4NA8A 2AFQB 3TJOA 1TPOA 3L33A 1G3EA 4X6PA 3U8RH 1RTKA 2W6JD 2AHME 4YOJA 4MVNA 1SC8U 4XE4A 2J38A 3IG6B 2BD9A 3MU5A 1BOQA 6CHAB 2FLBH 4RSPA 1TA2A 3C27B 1GHAF 2ZFQH 4A1TA 4E7NA 4TWYA 5T6FA 3D23A 3LGTA 2Z6BD 2KAIA 2TGDA 3A8AA 1P2IA 5E0HA 1CE5A 2B0FA 4B2CA 1B0FA 1NZQH 1HAIH 2C3SA 5DP7A 4ABHA 2GV6A 1VZQH 1EP6A 3RXPA 2RG3A 5JB8S 1F5LA 3MMGA 3PMBB 2VWNA 1BRAA 3E3TA 3PROA 4MPVA 3MH5A 3LJJA 5FBEA 3BG8A 2C8YB 1DM4B 1WUNH 3SUGA 5T1VA 3GICB 1FI8A 2PTNA 3BEIB 3BTWE 1ANCA 2V3HH 1EAXA 3B9FH 4BOHA 1CQQA 3RXJA 1EFRD 1YPJH 5EJZA 3T27A 2ZIQH 2A7CA 3OAAD 1ID5H 1KIGH 5L2ZH 5GJ4B 2O9QA 3QTVH 2AGGX 3QO6A 3F2GA 4Y8YA 2HLDD 1YC0A 4ZXXH 1RTFB 1QHRB 4F55A 1C5YB 4LK4A 1SOTA 1SSXA 3V3MA 1GVZA 1E79D 4XBDA 4AFQA 4K60A 1RJXB 3PRBA 1HJ8A 1P09A 1G9IE 5L6NH 2WZQA 1EQ9A 1SMFE 2A5AA 2QF5A 3RXBA 1DOJA 2OCVB 3NPSA 1E1QD 3O8CA 2XCNA 1G2LA 3R0FA 3MU8A 4O97A 5LPFA 2ZFSA 3RUOA 2V3MA 4Y6DA 1OHHD 1VKYA 2VWLA 3O8DA 3Q3KA 2VIVA 1O3OA 1GBCA 1EJMA 1V2NT 2GDDA 1LHDH 1TQ7B 2G5NA 5E0JA 4ACAA 3MO6A 1ZTLA 2P3FH 2WYGA 4K8YA 1DWEH 3ZVAA 2F3CE 3RC4A 4CR5A 1O2NA 1YLDA 3Q77A 1YKTA 2FP7B 3PMAB 1BTUA 2AERH 1BQYA 1TX6A 5C5OA 4ZXYH 1ELEE 2PR3A 1BTYA 1C1MA 4O3TA 3RU4D 1TBRH 2R3YA 4AYVB 1BIOA 1C2MA 1C2GA 1MBQA 3FOAA 1DSUA 2AGEX 1GBEA 1HRTH 5ETXA 1BB0B 1E36B 2GVFA 3RMOH 8ESTE 4IS5A 1TNKA 4XBBA 2FYRA 2H2ZA 1MKWH 2BDHA 1MTNC 3GDSA 2OLGA 2QN5T 4IW4E 1FY8E 1TGSZ 2OUAA 1HB0B 4CRAA 4A5TS 1O5GH 1TMTH 1DY9A 1ETSH 1GBIA 1TNLA 4BXWA 3D62A 2F9OA 2NU1E 3SZEA 4MPXA 1OYTH 1C5NH 1RXPA 5FPYA 2NU3E 1HAXB 3U98H 1IQLA 3KNXA 1GVLA 2O8LA 1D9IA 1WAYB 1HAPH 2OC0A 2ZGBH 3RXEA 5FCKA 2ZDKA 1W13U 4BAMB 2KX4A 1HAYB 3LIWA 4Q80A 1EX3A 1ZRBA 4NIXA 1TQ0B 2QV1A 1CA8B 1KY9A 4DT7B 1J8AA 2ANKH 1O5CB 3F68H 1AHTH 3BIVH 3BEUA 4X1RU 2OC1A 1EP5A 4O3UA 1A3BH 2FOMB 3M3VA 1K1LA 1JXPA 4DG4A 2NU2E 3VEQB 1K21H 6GCHF 2B9LA 4TSFD 4IC6A 3GCTG 2ZPQA 2CHAB 1L4DA 2W7UA 2BY9X 1CSOE 3B23B 4ISLA 4LXBH 1CGJE 3KQEA 1MD8A 1W2KH 3SJOA 3PMJA 5CE1A 4A6LA 4JZIA 2ZG0H 4K3JA 4NA7A 2I6QA 2WPLS 3DCLA 4WF8A 4XFQA 1YP9A 3GDVA 3PB1E 2RFKC 2FOGA 2PUQH 1LO6A 1SI5H 1T8NA 3E6PH 5F8XA 2RCEA 1AB9C 4I8KA 4B75A 1MBMA 3PWBA 1O2TA 1ZTKA 1Z6EA 1O2ZA 1CT0E 2Y80A 2IJOB 2BVXH 4HZHA 2ESTE 1OP0A 4DVAU 2ZHQH 1EAWA 4H42U 2HLCA 4ISNA 3KHVA 5GDSH 3NZIA 2GT7A 1G2MA 2D8WA 3GOVB 4XD7D 1C5OH 1FONA 3UTUH 5C0TA 1ELFA 1F2SE 4ASUD 1TMUH 2V7QD 4SGAE 2XOKD 3Q3YA 2UWPA 1EUFA 2HVXA 2AS9A 2BYAX 1YLNA 1FN8A 3C1KA 3A8BA 5EU8A 1P2KA 4TY7A 1ZPBA 2VINA 4FUGA 4AZ2B 3D49H 2VIDA 4YOGA 2VNTA 2CGAA 4VGCB 5C1YA 3TH2H 1OP2A 1KXAA 3EA7A 3VB3A 3SU4A 5CHAB 3SN8A 4XSKU 1O3NA 5F6MA 4ZH8A 3PLBA 1QRXA 2C4FH 1LPGB 1GJ8B 3PRDA 3RXVA 3GY5A 7ESTE 1SFIA 1UTLM 2F9BH 1BHXF 3URDA 3U8OH 2WUCA 3NWUA 1C5TA 4WH6A 2V3OH 3OSYA 2P16A 1FLEE 1BJUA 1TOMH 1EPTA 3SUDA 4YT6H 4B2AA 2XTTB 2HWLB 1P03A 1W10U 2Q6FA 2Z9IA 3SOSA 5EQSA 4KTSA 1RS0A 2UUKB 3SGAE 1AE5A 1NESE 1K2I1 1DLKB 3JZ2B 4TPYA 1YWUA 2NU4E 5JBCS 2XBYA 2ZU2A 3VGCC 2P94A 3GCOA 4AX9H 5JB9S 1GJ9B 2XXLA 3SI4H 5DKMA 1EAIA 2ULLA 5F8TA 2A31A 1QJ1B 1K28D 3PLKA 1V2UT 3ATKA 1Z7KA 3A81A 6ESTA 1ZYOA 2BHGA 4O9VA 3F9FA 1KXFA 1NY22 2VJ1A 5A8ZA 1CGIE 1OP8A 5EJ1A 5FCRA 2XWBI 3SW2B 1K1OA 1YY3A 4WVPE 2G52A 4YZUA 2D26C 3TPIZ 1EJNA 1Z8GA 4D9QA 3MI4A 2W6ID 1IOEA 2OD3B 1GJAB 1SGRE 4INLA 2FTLE 4XDEA 1ZSJA 1O2LA 3Q76A 4Y0YE 4KTCA 2FS9A 1S0QA 3LGUA 4CBNA 5CDFE 1AKSB 1NFYA 4ZKOU 3F3BA 4Z1MD 1OS8A 1C2LA 1AFQB 4WXVA 4K8BA 2J9NA 1P02A 1FXYA 2O8WA 3N7DA 1TWXB 1IHSH 1DWDH 1E0FD 2P8OB 4U2WA 1BBRE 2VH0A 5DP6A 3SNBA 1TNGA 5FBIA 4IN1A 1AMHA 1FPCH 1SGDE 1BTHH 2OINA 1LKBA 3FZDA 2JDID 1Z8IB 3EA8A 4RKJB 5JPMH 3KF2A 4I86A 1C2EA 2P3UB 3SJIA 1P2NA 1SLUB 3RU4T 1GI1A 1SGNE 5HKKD 3SJKA 1F0RA 2H9EH 5GIBA 3RXCA 3CS7A 3LC3A 2F43B 3KQBA 2P8OC 2R9PA 2QIQA 1FPHH 3S69A 3PTNA 2BD8A 2OK5A 3TH4H 1ARBA 4ISIH 1P2MA 2W5EA 4B6FA 3OEHD 1OYQA 1LHEH 2Y6TA 1C4V2 1W11U 1A5HA 1GJBB 3LOXA 2OC7A 1DWCH 3MH4A 5LPRA 1IQNA 2HOBA 1G32B 2PGBB 2C8XB 2ZFPH 2FOAA 1YPLH 2OXSA 2FI3E 1UCYE 3ZV9A 1TRMA 3MNCA 2A4RA 1IQEA 2GCHG 3Q00A 2ZFTA 1MAXA 3S7KB 1HCGA 1SGFA 2XYAA 2RDLA 2J4IA 5DPAA 4GSOA 3L3TA 2QF3A 1SGTA 2BD5A 1G3CA 3TNSA 3RMLH 2PP6A 1GDUA 3OE7D 1DSTA 1F0UA 2AYWA 2ZGXH 3RLWH 1UK2A 1DDJA 1QA7A 3BN9A 4CRGA 1EOJA 5G4BA 1GHXH 3P8OA 5B6OA 5E8EH 2DE8A 1ZJKA 3CENA 1TRNA 4ZHLU 3EE7A 2SGDE 4AB9A 3F9HA 1O2UA 1OXGA 3ZZ8A 1SGYE 3VB5A 1HFDA 3AW0A 1XVOA 1TMBH 4FVDA 2A2QH 5AVDA 1CA0B 2WV4A 4ACBA 1O5BB 3OYPA 5C67A 3FO8D 4OS4A 1GWAA 1MABB 1Y3UA 1TPAE 1TIOA 1A4WH 3UQOA 1ANBA 4BTIB 3P92A 1EXFA 3STIA 5HGGA 2G55A 1N6XA 1QGFA 4R0IA 4XOJA 1HDTH 4ABAA 1Q2WA 1J9CH 1QB9A 3BTGE 4JYVH 1F5RA 3EQ0H 3SU0A 5IYTA 1RIWB 1VGCB 1HAZB 3SV6A 1D3QB 1TNHA 2Q6DA 4WWYA 1XMNB 4JZDH 3EGKH 1S0RA 3SQEE 4BTUB 1GI6A 1KDQA 3UIRA 1LKAA 3V12A 5EXMA 1SGCA 1P9UA 3QZRA 4OGXA 1KLJH 2R0LA 1QQUA 2OP9A 1E37B 2UUJB 5ESTE 3U1IB 4BAOB 5EJLA 2CXVA 5TCAA 2W7SA 1GBLA 2SGQE 1FJSA 1T31A 4CRBA 1WQVH 4NA9H 1WQSA 1TE0A 3P6ZB 5HXFA 1M9UA 1YPMH 4BNRA 2IN2A 2WSSD 2ZKSA 1C2KA 1VCQA 1SGQE 1RIWC 1D3DB 4FOUC 2ANWA 1Z8RA 1GL0E 2ALPA 4INHA 2QE7D 3S9AA 2D2DA 3TITA 4Y10E 5A8XA 1GBTA 1NRRH 3LPRA 3RP2A 2I6SA 4CH8B 4ABEA 2A45B 2J98A 2VGCC 5LH8A 3QTOH 4ABFA 2ZC9H 3TVJB 1C5ZB 2GCTC 1QFKH 3I78A 6LPRA 4P00A 4AGKA 2BX3A 1H8IH 2VBCA 2EY4C 3UY9A 1AO5A 1QB6A 1C1VH 3MYWA 3AW1A 1TA6A 9LPRA 1GHYH 3QZQA 3P8GA 4NFFA 3TJVA 2DE9A 1GGDC 1TOCB 4MNYA 3NRLA 4B76A 3TGJE 1YYY1 2QA9E 1SBWA 2ZU1A 1O3IA 2K1QA 1OWIA 1AWFH 1L0ZA 3GY4A 4NFEA 2KR7A 4AGJA 1CBWB 1TBZH 5HM2A 1W3CA 4MNXA 3M5MA 1BDAA 4Y8ZA 1CHOG 1DT2A 1T7CA 1FNIA 1QJ6B 3GCHB 5FXLA 1EKBB 5C20A 3A7XA 1KTTB 4Y7AA 1XUJA 1A0LA 1ZGVA 4NIYA 1C1QA 1TPPA 2ZFFH 2FLRH 3LGVA 5EQQA 1GHBG 5IK2D 1GBHA 1DWBH 2ZI2H 1K9OE 3DUXH 2Z3CA 1C5QA 3B8JA 3SJ9A 1ZMNA 3SNAA 1F7ZA 1QL9A 4CRCA 4D76A 1G37A 1CBWC 2KCAA 1GMCF 1LPKB 1MTSA 1SQOA 2PKSB 2BD3A 1C2JA 2KFWA 1EASA 3ZZ3A 6CHAC 4CHAB 2IPQX 1G30B 3PMHB 1ELBA 4I8LA 5T6DA 3E91A 1TALA 2ODYB 3PV5A 3RXDA 4DURA 3SNDA 1O38A 4GVUA 4I8GA 3I77A 4UE7H 3RM2H 1D3PB 2FYQA 2Z94A 2H6MA 1ELVA 5BRRE 1KSNA 4Y11E 3UWIA 5B6LA 4XRNA 1HGTH 3ZIAD 4I7YH 2VU8E 3OTJE 3ZVDA 2HNTC 1DPOA 5T6GA 1XXDA 3QDZB 4CR9A 4X6OA 5CMXH 1C9PA 3EE0B 1ZLRA 1GJ4H 1SGPE 5DP5A 2WPJS 3ZV8A 1OKXA 2QXGA 2JETB 3E0PB 1XUGA 1C5MD 2AEIH 3K6ZA 2ODPA 2BZ6H 1FV9A 1O2MA 2G8TA 2XW9A 2W3IA 2KAIB 4K1EA 1QY6A 3ZZDA 1ZMLA 3QX5H 1SLWB 1CHOF 4I33A 1P8VC 2QC2A 4D7FA 5DN6D 1NBME 1S81A 5A0AE 1C1PA 3OY6U 3VB4A 5CHBA 4RI0A 3RDZA 1F0TA 4DIHH 3VXEH 1D3TB 2ZDVH 4X2VA 2GGVB 1Y5BT 5C94A 4DOQA 1PQAA 1NM6A 4YLUA 2PV9B 3KQDA 1N8OB 1KXCA 1DUAA 2UWLA 3HKIB 2BVSH 2VH6A 3M35A 3O8RA 1Q31A 1QA0A 3SJ8A 4KGAA 2A0QB 2G4UA 2G81E 1MTWA 1Y59T 2G5VA 3PV4A 3BTTE 1YLCA 1XKBC 1DANH 4Y76A 3SU3A 2XWAA 4Y79A 3KCGH 2ZU3A 2JIZD 2GT8A 3ATMA 3V0XA 1INCA 1HBTH 5A2MH 2F9PA 1GBBA 1W7GH 4FUBA 1AY6H 3EAJA 3SHCH 3UOUA 4GHQA 3V13A 3EA9A 1BRCE 2F9NA 4FUJA 1GBAA 1PFXC 1GI8B 1TRYA 2LELA 4MNWA 2EI8A 3M37A 1PPGE 1J15A 5KECA 2J92A 3OX7U 2ZCHP 2R0KA 1UVUH 4X8UH 5DJ7A 5JBTA 1WTHD 1EZUC 5DP8A 1UCYK 2SGFE 1GHZA 3RXIA 1O34A 3L6PA 3BTDE 1MZAA 4Y71A 3TGIE 2VIQA 1TONA 1MKXK 1TB6H 4JK6A 1IQFA 4JMYA 1ELDE 1BMMH 1AZZA 1YPHC 3A86A 4OS2A 2ZO3H 1BTXA 2BQWB 1NFWA 2C93B 3UNSA 3VXFH 2QXHA 2Z3EA 5I25A 1C5UA 2ZHDA 2F83A 3KGPA 2THFB 1CO7E 4KELA 4O03A 4THNH 4UD9H 1D6RA 4WMFA 4U01A 3MU4A 4X0WU 2LNCA 1GBFA 1SQRA 3UOPA 3E16B 3SNEA 5A09A 2YNBA 2JJ2D 1P11E 4Q4LA 1ESAA 1RTLA 1P0SH 5J4QA 1OWKA 1LQEA 1O33A 1P06A 2L74A 2SGAA 1QBNA 3F6UH 4Y7BA 2UUYA 4OGYA 5GPIB 2WPIS 1A2CH 4GUXA 2CHAC 3ZVEA 4ABIA 1MTUA 1GJ5H 3T25A 3LGIA 1V2RT 2M5TA 1V2MT 3LT3A 1O32A 1GJDB 2BXTH 1H9HE 3SI3H 4AORA 3P70B 2KCYA 1ELCA 3F9EA 3RXKA 7LPRA 5I46H 1YCPK 5PTPA 1AI8H 1JIRA 1P2QA 1IQKA 5LPEA 2D1JA 3KIDU 1DS2E 3RXSA 4ZUHA 2XNDD 1AZ8A 3SU5A 1J14A 4UFEH 5FPTA 1D6WA 1G36A 5LGOA 5C3NA 1S6LA 2ALVA 1WSSH 4D9RA 2FWWA 4UFDH 1TBQH 1VJ9U 3PWCA 5ABWA 3ATIA 1MH0A 3H7TA 3R3GB 1HIAA 1MMJN 1JRTA 4K69A 2HGTH 1SLVB 3MU0A 2WUBA 3BTHE 2ZDNA 1O2VA 4I31A 3URCA 3RLYH 1L4ZA 4J2YB 1AUTC 1RRKA 1YGCH 4U30A 2IJD1 4TWWA 3AK5A 3GCTF 2CV3A 1AN1E 3NCLA 4WJG2 3TK6A 1RGQA 1C5PA 2W26A 1WTGH 1W12U 3BF6H 3P8NA 1K1IA 3GY6A 4IC5A 3A83A 1HXFH 3HK6B 1TLDA 3STJA 2ZPSA 5KGOA 3KEEA 3N7EA 1C5WB 1UJ1A 4NGAH 2A4QA 2BDAA 4VGCC 4YOIA 5A0BA 2A5KA 1RFNA 5AHGH 2QXIA 1ABIH 1QCPA 2RA3A 4MQAA 3RXOA 3WWBA 5CHAC 1THSH 1KXEA 1GBJA 1GCTB 2H9TH 4GCHG 3T28A 1MUEB 1TX8A 2Y7XA 1AGJA 1C5VA 4NIVA 1SL3A 1AD8H 1YM0A 2NWNA 2TGTA 4Q7ZA 3SUEA 4FUIA 4I8JA 2A7JA 1H1BA 4FU9A 1HAHH 5TJXA 1QQ4A 1OWHA 2QF0A 1LPZB 1GG6B 1HIAB 1C1UH 4JK5A 5HMAA 4ZKSU 4GLYA 1HUTH 2PW8H 1MD7A 3BTKE 1ARCA 4Z0KA 1O2WA 3ITIA 4IN2A 1WU1A 4MG3A 4B1TA 1V2ST 5DP9A 2ZU5A 1UVTH 3SU6A 4KTUA 2GDEH 3HGNA 2BY8X 2PKAA 1L1JA 4AFZA 2ZCLP 5A0CA 1A3EH 1WYKA 4CRDA 1O2RA 2FO9A 3UNRA 1UTOA 1GBMA 4X6NA 1HNEE 1O2OA 2M2AA 1BTWA 1H4WA 2BVRH 1UTJA 4NSVA 2RDEA 1HAVA 3TU7H 3NK8A 4CBOA 1QB1A 2FOFA 1EZSC 1UCYH 2R2MB 4BAQB 1AVGH 1J17T 3RXFA 9ESTA 4B74A 1EOLA 4QT8C 1OSSA 1C2HA 1C1OA 3DA9B 1EPTB 1A46H 1O3GA 1XM1A 3U28C 4DY7B 2HPPH 2VB0A 1IHTH 2FI5E 4ESTE 1U6QA 2CJIA 3HK3B 3V7TA 1UO6A 3DFLA 1Q3XA 1NRPH 3PM3A 1H8HD 4AYYB 3S9BA 3FP8E 5GXPA 3TH3H 2Y82A 3WW7A 1IQGA 4NCYA 1C4U2 1AFQC 4Z6AH 1GJ7B 1ETTH 2CK3D 1SOZA 3AASA 2JJ1D 2G00A 1A5GH 3UNQA 1E1RD 5DGJA 3P8FA 1A5IA 2JH0D 3RXAA 3UWJH 3GDUA 3SU2A 3ZVFA 2BDIA 4X6MA 1L1GA 1JIMA 5C17A 1ABJH 1SFQB 1W0ZU 3I29A 4M9FA 1K1MA 4AFUA 1C1TA 2FDAA 1BA8B 3IITA 1KXDA 1E35B 5K0HA 2PSXA 1OWEA 4X1SU 2V35A 5JBBS 1Y3XA 1PQ7A 4E05H 3M36A 3ZZAA 1P2OA 1ZHRA 2P3TB 2WPDD 3OTPA 2PKAB 2YOLA 4IMZA 2HVYB 1C9TA 5ESBA 2SNWA 3FFGA 2WYJA 3FVFB 1GI0A 1VITG 1UMAH 1XUHA 4K5ZA 1TX7A 3TK9A 3ZYEA 2GX4A 1S85A 1KLIH 3SUFA 1O36A 1GMDG 2PGQB 1QURH 1ZHMA 3BTME 2VIPA 1GI7B 3OFND 1YCPH 1AIXH 2CF8H 1OWJA 5IDKA 4WY3A 1UW7A 4A92A 1ZHPA 4TT3D 1B7XB 4H6TA 1ANDA 1AUJA 4E06H 1CVWH 4RKOB 1ZRKA 1O3EA 3M5NA 1QJ7B 1O3FA 2Q1JA 1UK4A 4LOYH 3BTFE 3O8BA 4HGCA 4A7IB 2PFEA 1GMHG 1THRH 2Z3DA 3GYMA 1FIWA 4GAWA 4H6SB 4AFSA 1V2PT 1O3BA 4RN6A 4ZKRU 1N6YA 1C5SA 2ZTYA 2FEQH 1SKYE 2WV5A 2XC4A 4BANB 4IGDA 1SGFG 4YM9A 1V2VT 4MNVA 1IQJA 5JBAS 1PQ8A 2ZTXA 3W1EA 3BIUH 2FOCA 2VIOA 3A82A 5C0UA 1NROH 1UVPA 5DP3A 1QIXB 2ZDLA 1UTNA 1O31A 1GJ6A 4NZLA 3ZZ5A 1VJAU 2FOBA 2BQ7B 3Q3XA 3M3SA 1NFUA 1TNJA 3PO1B 4FUFA 1ETRH 2ZU4A 4YT7H 5EG4A 4DIIH 1XKAC 2SNVA 2XBVA 5EQRA 1VCWA 4K2YA 1CA0C 4OS7A 1BT7A 1O39A 1QL7A 2FM2A 2XRCA 2BLWA 1V2KT 3ZZBA 3TGKE 1DY8A 3KYGA 3SO3A 1C1WH 4XBCA 2J5UA 2BM2A 1YCPM 1GDNA 1BRUP 2A7HA 2ZFRH 2HALA 3SHAH 2GCHF 1KYNA 1PPZA 5EW1H 4ISOA 4OS5A 1IQHA 2IOTA 1C2DA 3PYHA 2BDYA 2TPIZ 2TIOA 3M3TA 3PO1C 4YO9A 5DG6A 1CT4E 3QK1A 4ZKNU 1VGCC 5EXLA 2ZP0H 1GHAG 1XXFA 2H5CA 2EQNA 2BTCE 4B71A 3UUZA 1SVPA 5GCHG 1A61H 1P57B 3WWFA 3E90B 4UFGH 1TYNA 3A84A 3OY5U 1QNJA 1S5SA 3E8LA 1ZPCA 2ZA5A 2ZHWH 2CN0H 1DUEA 1COWD 4P02A 3ZZ6A 2QY0B 2Y5GA 4DW2U 1A0JA 1JWTA 1H8ED 2O8TA 3K6YA 3A7WA 3SV9A 3HATH 1BMFD 4DJZB 1NRQH 3DSOA 5BPEA 4FUCA 8GCHG 1UTMA 3UR6A 4ABDA 1JMOH 2BZAA 3LH3A 3BG4B 3H5CB 1ESTA 1O2IA 3M7TA 3LJOA 3DSPA 3FANA 2XBXA 3PLPA 3F2FA 2QCYA 2ZGCA 4M7GA 1GJCB 1KDQB 1PYTD 3ZZCA 2H5DA 1LVMA 3SU1A 2TGPZ 2OBQA 3G01A 4ZAEA 2FS8A 3VB6A 4F4OC 3K9XB 5H4IB 3U8TH 2J34A 2XCFA 1Z1JA 2FX6A 1YPHE 4JZEH 7KMEH 2HRVA 1DICA 1W7XH 2A32A 1HV7A 1GBKA 1ZPZA 3S9CA 1UVOA 1WOFA 4ASHA 5KEDA 5L30H 1O2KA 3UAIC 1WXRA 2Y5FA 2PTCE 4FVBA 3M7UA 1MU6B 3SGBE 2Z9GA 1G3DA 2GZ9A 2NU0E 1LHGH 1T8MA 2J98B 3GCHC 2OQUA 5GCHF 4R8TB 1J16A 1YPEH 2ZPRA 2ZECA 3UR9A 2A5IA 3RMMH 2VVVA 3SYJA 3OEED 3A85A 2XNIA 1AVWA 2V0BA 1X7AC 5E2OA 2BQ6B 1VR1H 2B5TB 2OQ5A 1V2WT 1L2EA 1S6FA 2B7DH 3N7OA 1EAUA 5C1UA 1P3EA 1C5LH 2ZF0H 1NU9A 8GCHF 4IBLH 1NBMD 4UEHH 3KL6A 2PKSC 2KM0A 3GY7A 4X2YA 2BDBA 5E2PA 3T29A 4CHAC 3KYFA 3ODDA 2G4TA 2JKHA 1L1NA 4B73A 3W95A 1V2LT 5DP4A 2ZQ1A 1ELAA 5JDUB 3AVZA 1FAXA 1ZR0A 1FZZA 1V2QT 1GL1A 1DE7H 1TFXA 3H7OA 1PPHE 4I8HA 4A1XA 5J4SA 2ILNA 3U69H 2AIQA 5GNDA 3VPKA 1T4VH 5HYOA 3A80A 2HNTF 2RA0A 3A89A 3A7ZA 3LDXH 4UFFH 1EZQA 3AAUA 3D65E 4BXSA 4ISHH 2K8IA 1CGHA 1F92A 2Z7FE 4DCDA 1WCZA 2ZEBA 1GHBF 4BAHB 2AIPA 4GHTA 2JETC 2ZHEH 1AVXA 1BBRK 1S82A 1MTNB 1KTSB 5EW2H 2AMDA 3LGYA 2P93A 3RXQA 6GCHG 1BRBE 1EJAA 4HTCH 2FI4E 3SBKA 1H8DH 1C2FA 2LPRA 1XUIA 3UPEA 1E34B 2EA3A 5SGAE 4FXGH 2Y5HA 3KQ5A 2WPHS 3GYLB 3ATLA 3U9AH 4UONA 1K22H 1B0EA 1JRSA 1O35A 4U32A 3T5FH 3FN8A 3NXPA 4YESB 4UDWH 4FU7A 1SHHB 3E1XB 1ZJDA 4LZ4B 1ELTA 2SFAA 5FL7D 1TPSA 5FAHA 1O3CA 3EDXB 1SLXB 4MPWA 3T62A 1N8OC 1DX5M 1O5EH 3ENSB 2WV9A 1NT1A 1P2JA 1HXEH 4RT1A 4AOQA 2R3UA 1KLTA 8KME2 2J97A 1GDQA 3GCNA 1GCDA 5HIYA 3VG8A 3QWCH 4ZHAA 3RU4E 2ZGHA 2STAE 1W0JD 5HM9A 1SB1H 4HI3A 3SNCA 1P3CA 1MU8B 1BCUH 1KMHB 1SPJA 2QXJA 3M7QA 3SORA 1LCYA 1O5AB 1MZDA 3UB0A 3F0PA 1UVSH 1FIZA 2GTBA 3A8DA 4DT4A 1A7SA 1MCVA 4PROA 3U1JB 3A7VA 1BITA 3TIUA 4CRFA 1DXWA 1NO9H 3GY3A 1TAWA 2XBWA 3RXUA 1C1NA 1PPFE 1K0HA 4K1SA 2AGIX 1HJAB 2BX4A 3AAVA 2YMSD 1P04A 2CF9H 4LZ1H 1GI3A 2ZZUH 4SGBE 1AB9B 4X1PU 4FUDA 1O2GH 3ODFA 1Z1IA 3A7YA 3SV7A 4B2BA 4MPUA 2FOEA 2G51A 5JYIA 5C2ZA 1O0DH 3N99A 2WHXA 3A7TA 1PYTC 3MH7A 1LVYA 1SQTA 2GZ7A 1UTQA 2DUCA 1S84A 1FX0B 4D8NA 3BV9B 1PPBH 1O2PA 1T8LA 1O2YA 3RC6A 1THPB 1W0YH 2J2UA 1ZMJA 1AFEH 5EIYA 3DSGA 4YXWD 1OX1A 1HJAC 1O5DH 1OWDA 4JYUH 1AQ7A 1C5XB 3ELAH 4AG2A 1LVOA 2H1UA 3A87A 3EYDA 1LVBA 3MQKC 1LDTT 2C8ZB 4FETA 3F2HA 2K0QA 3QGNB 2FODA 1P9SA 1VITH 1ESBA 1IAUA 5E0GA 1NRNH 2ZDMA 2VVUA 4X8SH 1Y5UT 3RMNH 2XC5A 4AB8A 1NN6A 3SV8A 4WMEA 3BTEE 1O2XA 4GPGA 1MCTA 1PJPA 5EXNA 4OS1A 3QUMP 1ZZZA 1ZSLA 4HFPB 1BHXB 2ZQ2A 5GWZA 2A1DB 2TRMA 2TGAA 3BSQA 1LMWB 4NWLA 5FX5A 1GI2A 5AFYH 1OOKB 2JH5D 3MNSA 1G3BA 1BUIA 1CT2E 2STBE 2PUXB 1W8BH 2Q6GA 4NWKA 4OS6A 3TK5A 3ZZ4A 2F9UA 4X1QU 1MTVA 3FKSD 1EB2A 4Q7XA 1Y5AT 2XC0A 4A1VA 1BMNH 5C5NA 2FX4A 3F0OA 4Q7YA 2P95A 1CU1A 1SGEE 1W0KD 2OTVA 2BY5X 4FUHA 1UTKA 2O8MA 1ORFA 2F91A 1AWHB 2OC8A 4MLFB 4MDSA 1C1RA 3M61U 3LKWA 1SQAA 1QZ8A 1C5RA 1ZGIA 2F4LA 3TNTA 7GCHG 2SGPE 1FAKH 2QAAA 1AKSA 3VGCB 1GVKB 1BBRH 5A8YA 3S7HB 1FY3A 1PPCE 2IPHA 2VVCA 1YPKH 1MAYA 1LQDB 1LTOA 1ELGA 1FMGA 1O30A 3MO9A 2Z9KA 2Z9JA 5K7RA 1FY1A 1TABE 1FDPA 1BTZA 1A1RA 1WDIA 1P12E 2L6OA 1BMAA 2Y81A 3ZZ9A 1CHGA 3LU9B 2O8UA 3LH1A 4J1YA 1H9LB 2OBOA 1NRSH 1ANEA 3K2UA 1W14U 3MFJA 3ESTA 1P10A 2WPMS 1O3KA 2BDGA 4DGJA 1F5KU 2BLQA 1GCTC 1O3PB 3FZZA 1V2JT 3SGQE 5AF9H 1TGTA 1O37A 1UTPA 3MTYA 1TNIA 1Z8JB 3FP7E 2BXUH 1D4PB 1K1NA 1P01A 1Y3YA 4NIWA 1HYLA 2BD7A 1EB1H 2BOKA 2F9VA 3W94A 2EI7A 1GHVH 2P59A 3ZVGA 3UQVA 1GG6C 4ZROA 2B8OH 2FPZA 2ZNKH 3F9GA 2ZCKP 4JYTA 2BLOA 1DITH 1QRZA 1V6DA 4ABJA 4YLQH 1MKXH 2VWMA 4H4FA 1UHBA 2QF4A 1KXBA 1S83A 1OPHB 1XUFA 4JZ1A 1NFXA 1NS3A 4INKA 4KKDA 1SG8B 5DSFA 4B6EA 5FPSA 3VFEA 2A4GA 3IWMA 1BTPA 4D7GA 3HGPA 2FTMA 4E7RG 4FU8A 1QR3E 2YMSB 4F49A 1ACBE 1ZSKA 1HAOH 2ANMH 2BY7X 1GHWH 2EI6A 4WXIA 7GCHF 1LHCH 3MWIU 3M5OA 4K1TA 1DVAH 3SZNA 2Y7ZA 3RM0H 5HIZA 1V2OT 3MOCA 1EZXC 1O2JA 4GCHF 1O2QA 4Q63A 2R2WU 2J95A 3DFJA 1EPTC 3T26A 4BTTB 2ANYA 3CP7A 3ZVCA 2A4OA 3GISB 5AFZH 1DXPA 2UWOA 3FAOA 3FP6E 2BLVA 3SV2H 1HLTH 4Y8XA 3SQHE 1O3MA 1JOUB 3MNBA 1T32A 2GP9B 3MNXA 3OU0A 4ZCNA 3P95A 3LGWA 1QBVH 1SGIB 2YMSC 3A8CA 2H9HA 5F03A 3ZZ7A 4TPIZ 1NPMA 1XX9A 5T3HA 1HJ9A 3BTQE 2AMPA 2CMYA 3GS9A 1Z6JH 2GMTB 2FMJA 1HAVB 2YNAA 1ZTJA 4FUEA 4ABGA 1P05A 1S6HA 3NKKA 2GJGA 1NTPA 2VIWA 4BAKB 2PLXA 3TLOA 5F53A 1UHBB 1IQIA 1HPGA 4NZQA 1DFPA 1Y3WA 4AN7A 2Z9LA 1BMLA 3F1SB 4ZHMU 1RD3B 1K1PA 1T8OA 1HAGE 1GPZA 2AMQA 4F48B 2ASUB 2KCPA 4AC9A 1B5GH 3K65B
chains in the Genus database with same CATH topology
1XVMA 3RXMA 3ZYDA 3ZVBA 4ABBA 2GMTC 3UREA 2QGRA 2GZ8A 1SR5C 1WV7H 2BDCA 5L2YH 3PTBA 3MHWU 3JZ1B 1FUJA 1E38B 4X1NU 2A2XH 4YTAA 3RXHA 2FIRH 2FXRA 5EODA 3VB7A 3DD2H 3KN2A 1BZXE 3RXLA 1FQ3A 1QRWA 2V6NA 1GI9B 1QL8A 1Z71A 4Q2KA 2WPKS 1F0SA 1FY4A 1ZOMA 4X2WA 2W3KA 2FZZA 2HNTE 4MTBA 1IQMA 1O3JA 2ZGJA 4WMDA 1AU8A 1DLEA 1UK3A 3S0NA 1YBWA 1QBOA 2BMGB 4I32A 2GD4B 5EOKA 3E0NB 1T4UH 1TGCA 3GY8A 4X8TH 3T2NA 3KQCA 1MQ5A 1SHYA 1O3AA 1VCPA 1GI4A 1JBUH 2C90B 2BY6X 2SGEE 4KP0A 1C2IA 1H9IE 4WH8A 1V3XA 1PQ5A 1YPGH 4X2XA 4NSYA 4AG1A 1N1LA 3RC5A 1VITF 3M5LA 2ZDAH 2GKVE 1MQ6A 4TYDA 2UUFB 1GMDF 4TY6A 5F8ZA 1K1JA 2EEKA 2JH6D 1WBGB 2TBSA 2ZTZA 3LC5A 1FY5A 3LONA 1BJVA 3HKJB 4CREA 4Y0ZE 2BOHB 3WY8A 3GY2A 2FESH 1C4Y2 1O3HA 1O3DA 1MKWK 2AH4X 2HPQH 1TGBA 2VGCB 1GMHF 5TCCA 1A0HB 2BD4A 2ZHFH 3CS0A 4CH2B 2VWOA 5FHTA 3HPTB 2GCTB 1C1SA 3P17H 4ZMAH 1PPEE 1GMCG 2J94A 1O2SA 2BD2A 3QN7A 1O3LA 1TGNA 1XUKA 3RXRA 5DO4H 1AE8H 1QTFA 5EGMA 1NC6A 3MO3A 2PSYA 1YF4A 3NUMA 1GGDB 2C8WB 3A88A 3DHKH 2ZWLH 1NU7B 2FOHA 4JZFH 5DK1A 1Y3VA 8LPRA 2ODQA 3UFAA 1GBDA 1EATA 3DT0H 3QGJA 4X8VH 4JCNA 1GI5A 1Y8TA 4NG9H 5C1XA 1FN6A 5EPYA 2EC9H 2PWXA 4IMQA 3RXTA 3TJUA 2PHBA 2WINI 3TJNA 2BB4A 3ATWA 3MU1A 3MH6A 5FX6A 1V2TT 1LHFH 3QLPH 1O5FH 2QYIA 5EPNA 2GV7A 3RXGA 3BG4C 1O2HA 3BEFB 4NA8A 2AFQB 3TJOA 1TPOA 3L33A 1G3EA 4X6PA 3U8RH 1RTKA 4YOJA 4MVNA 1SC8U 4XE4A 2J38A 3IG6B 2BD9A 3MU5A 1BOQA 6CHAB 2FLBH 4RSPA 1TA2A 3C27B 1GHAF 2ZFQH 4A1TA 4E7NA 4TWYA 5T6FA 3D23A 3LGTA 2Z6BD 2KAIA 2TGDA 3A8AA 1P2IA 5E0HA 1CE5A 2B0FA 4B2CA 1B0FA 1NZQH 1HAIH 2C3SA 5DP7A 4ABHA 2GV6A 1VZQH 1EP6A 3RXPA 2RG3A 5JB8S 1F5LA 3MMGA 3PMBB 2VWNA 1BRAA 3E3TA 3PROA 4MPVA 3MH5A 3LJJA 5FBEA 3BG8A 2C8YB 1DM4B 1WUNH 3SUGA 3GICB 1FI8A 2PTNA 3BEIB 3BTWE 1ANCA 2V3HH 1EAXA 3B9FH 4BOHA 1CQQA 3RXJA 1YPJH 3T27A 2ZIQH 2A7CA 1ID5H 1KIGH 5L2ZH 5GJ4B 2O9QA 3QTVH 2AGGX 3QO6A 4Y8YA 1YC0A 4ZXXH 1RTFB 1QHRB 1C5YB 4LK4A 1SOTA 1SSXA 3V3MA 1GVZA 4XBDA 4AFQA 4K60A 1RJXB 5L6NH 1HJ8A 1P09A 1G9IE 1EQ9A 1SMFE 2A5AA 3RXBA 1DOJA 2OCVB 3NPSA 3O8CA 2XCNA 1G2LA 3R0FA 3MU8A 4O97A 5LPFA 2ZFSA 3RUOA 4Y6DA 2VWLA 3O8DA 3Q3KA 2VIVA 1O3OA 1GBCA 1EJMA 1V2NT 2GDDA 1LHDH 1TQ7B 2G5NA 5E0JA 3MO6A 1ZTLA 2P3FH 2WYGA 4K8YA 1DWEH 3ZVAA 2F3CE 3RC4A 4CR5A 1O2NA 1YLDA 3Q77A 1YKTA 2FP7B 3PMAB 1BTUA 2AERH 1BQYA 1TX6A 5C5OA 4ZXYH 1ELEE 2PR3A 1BTYA 1C1MA 4O3TA 3RU4D 1TBRH 2R3YA 4AYVB 1BIOA 1C2MA 1C2GA 1MBQA 1DSUA 2AGEX 1GBEA 1HRTH 5ETXA 1BB0B 1E36B 2GVFA 3RMOH 8ESTE 4IS5A 1TNKA 4XBBA 2FYRA 2H2ZA 1MKWH 2BDHA 1MTNC 3GDSA 2OLGA 2QN5T 4IW4E 1FY8E 1TGSZ 2OUAA 1HB0B 4CRAA 4A5TS 1O5GH 1TMTH 1DY9A 1ETSH 1GBIA 1TNLA 4BXWA 3D62A 2F9OA 2NU1E 4MPXA 1OYTH 1C5NH 1RXPA 5FPYA 2NU3E 1HAXB 3U98H 1IQLA 3KNXA 1GVLA 2O8LA 1D9IA 1WAYB 1HAPH 2OC0A 2ZGBH 3RXEA 5FCKA 2ZDKA 1W13U 4BAMB 1HAYB 3LIWA 4Q80A 1EX3A 1ZRBA 4NIXA 1TQ0B 2QV1A 1CA8B 1KY9A 4DT7B 1J8AA 2ANKH 1O5CB 3F68H 1AHTH 3BIVH 3BEUA 4X1RU 2OC1A 1EP5A 4O3UA 1A3BH 2FOMB 3M3VA 1K1LA 1JXPA 4DG4A 2NU2E 3VEQB 1K21H 6GCHF 2B9LA 4IC6A 3GCTG 2ZPQA 2CHAB 1L4DA 2W7UA 2BY9X 1CSOE 3B23B 4ISLA 4LXBH 1CGJE 3KQEA 1MD8A 1W2KH 3SJOA 3PMJA 5CE1A 4A6LA 4JZIA 2ZG0H 4K3JA 4NA7A 2I6QA 2WPLS 4WF8A 4XFQA 1YP9A 3GDVA 3PB1E 2FOGA 2PUQH 1LO6A 1SI5H 1T8NA 3E6PH 5F8XA 2RCEA 1AB9C 4I8KA 4B75A 1MBMA 3PWBA 1O2TA 1ZTKA 1Z6EA 1O2ZA 1CT0E 2Y80A 2IJOB 2BVXH 4HZHA 2ESTE 1OP0A 4DVAU 2ZHQH 1EAWA 4H42U 2HLCA 4ISNA 3KHVA 5GDSH 3NZIA 2GT7A 1G2MA 2D8WA 3GOVB 1C5OH 1FONA 3UTUH 1ELFA 1F2SE 1TMUH 4SGAE 3Q3YA 2UWPA 1EUFA 2HVXA 2AS9A 2BYAX 1FN8A 3C1KA 3A8BA 5EU8A 1P2KA 4TY7A 1ZPBA 2VINA 4FUGA 4AZ2B 3D49H 2VIDA 4YOGA 2VNTA 2CGAA 4VGCB 5C1YA 3TH2H 1OP2A 1KXAA 3EA7A 3VB3A 3SU4A 5CHAB 3SN8A 4XSKU 1O3NA 5F6MA 4ZH8A 3PLBA 1QRXA 2C4FH 1LPGB 1GJ8B 3RXVA 3GY5A 7ESTE 1SFIA 1UTLM 2F9BH 1BHXF 3URDA 3U8OH 2WUCA 3NWUA 1C5TA 4WH6A 2V3OH 3OSYA 2P16A 1FLEE 1BJUA 1TOMH 1EPTA 3SUDA 4YT6H 4B2AA 2XTTB 2HWLB 1P03A 1W10U 2Q6FA 2Z9IA 3SOSA 5EQSA 4KTSA 1RS0A 2UUKB 3SGAE 1AE5A 1NESE 1K2I1 1DLKB 3JZ2B 4TPYA 2NU4E 5JBCS 2XBYA 2ZU2A 3VGCC 2P94A 3GCOA 4AX9H 5JB9S 1GJ9B 2XXLA 3SI4H 5DKMA 1EAIA 2ULLA 5F8TA 2A31A 1QJ1B 1K28D 3PLKA 1V2UT 3ATKA 1Z7KA 3A81A 6ESTA 1ZYOA 2BHGA 4O9VA 3F9FA 1KXFA 1NY22 2VJ1A 5A8ZA 1CGIE 1OP8A 5FCRA 2XWBI 3SW2B 1K1OA 4WVPE 2G52A 4YZUA 2D26C 3TPIZ 1EJNA 1Z8GA 4D9QA 3MI4A 1IOEA 2OD3B 1GJAB 1SGRE 4INLA 2FTLE 4XDEA 1ZSJA 1O2LA 3Q76A 4Y0YE 4KTCA 2FS9A 1S0QA 3LGUA 4CBNA 1AKSB 1NFYA 4ZKOU 1OS8A 1C2LA 1AFQB 4WXVA 4K8BA 2J9NA 1P02A 1FXYA 2O8WA 1TWXB 1IHSH 1DWDH 1E0FD 2P8OB 4U2WA 1BBRE 2VH0A 5DP6A 3SNBA 1TNGA 5FBIA 4IN1A 1AMHA 1FPCH 1SGDE 1BTHH 2OINA 1LKBA 3FZDA 1Z8IB 3EA8A 4RKJB 5JPMH 3KF2A 1C2EA 2P3UB 3SJIA 1P2NA 1SLUB 3RU4T 1GI1A 1SGNE 3SJKA 1F0RA 2H9EH 5GIBA 3RXCA 3CS7A 3LC3A 3KQBA 2P8OC 2R9PA 2QIQA 1FPHH 3S69A 3PTNA 2BD8A 3TH4H 1ARBA 4ISIH 1P2MA 2W5EA 1OYQA 1LHEH 2Y6TA 1C4V2 1W11U 1A5HA 1GJBB 3LOXA 2OC7A 1DWCH 3MH4A 5LPRA 1IQNA 2HOBA 1G32B 2PGBB 2C8XB 2ZFPH 2FOAA 1YPLH 2OXSA 2FI3E 1UCYE 3ZV9A 1TRMA 3MNCA 2A4RA 1IQEA 2GCHG 3Q00A 2ZFTA 1MAXA 3S7KB 1HCGA 1SGFA 2XYAA 2RDLA 2J4IA 5DPAA 4GSOA 3L3TA 2QF3A 1SGTA 2BD5A 1G3CA 3TNSA 3RMLH 1GDUA 1DSTA 1F0UA 2AYWA 2ZGXH 3RLWH 1UK2A 1DDJA 1QA7A 3BN9A 4CRGA 1EOJA 5G4BA 1GHXH 3P8OA 5B6OA 5E8EH 2DE8A 1ZJKA 3CENA 1TRNA 4ZHLU 2SGDE 4AB9A 3F9HA 1O2UA 1OXGA 3ZZ8A 1SGYE 3VB5A 1HFDA 3AW0A 1XVOA 1TMBH 4FVDA 2A2QH 5AVDA 1CA0B 2WV4A 1O5BB 3OYPA 5C67A 4OS4A 1GWAA 1Y3UA 1TPAE 1TIOA 1A4WH 3UQOA 1ANBA 4BTIB 3P92A 1EXFA 3STIA 5HGGA 2G55A 1N6XA 1QGFA 4R0IA 4XOJA 1HDTH 4ABAA 1Q2WA 1J9CH 1QB9A 3BTGE 4JYVH 1F5RA 3EQ0H 3SU0A 5IYTA 1RIWB 1VGCB 1HAZB 3SV6A 1D3QB 1TNHA 2Q6DA 4WWYA 1XMNB 4JZDH 3EGKH 1S0RA 3SQEE 4BTUB 1GI6A 1KDQA 3UIRA 1LKAA 3V12A 5EXMA 1SGCA 1P9UA 3QZRA 4OGXA 1KLJH 2R0LA 1QQUA 2OP9A 1E37B 2UUJB 5ESTE 3U1IB 4BAOB 2CXVA 5TCAA 2W7SA 1GBLA 2SGQE 1FJSA 1T31A 4CRBA 1WQVH 4NA9H 1WQSA 1TE0A 3P6ZB 5HXFA 1M9UA 1YPMH 4BNRA 2IN2A 2ZKSA 1C2KA 1VCQA 1SGQE 1RIWC 1D3DB 2ANWA 1Z8RA 1GL0E 2ALPA 4INHA 3S9AA 2D2DA 3TITA 4Y10E 5A8XA 1GBTA 1NRRH 3LPRA 3RP2A 2I6SA 4CH8B 4ABEA 2A45B 2VGCC 5LH8A 3QTOH 4ABFA 2ZC9H 3TVJB 1C5ZB 2GCTC 1QFKH 3I78A 6LPRA 4AGKA 2BX3A 1H8IH 3UY9A 1AO5A 1QB6A 1C1VH 3MYWA 3AW1A 1TA6A 9LPRA 1GHYH 3QZQA 3P8GA 4NFFA 3TJVA 2DE9A 1GGDC 1TOCB 4MNYA 4B76A 3TGJE 1YYY1 2QA9E 1SBWA 2ZU1A 1O3IA 2K1QA 1OWIA 1AWFH 1L0ZA 3GY4A 4NFEA 4AGJA 1CBWB 1TBZH 5HM2A 1W3CA 4MNXA 3M5MA 1BDAA 4Y8ZA 1CHOG 1DT2A 1T7CA 1FNIA 1QJ6B 3GCHB 5FXLA 1EKBB 5C20A 3A7XA 1KTTB 4Y7AA 1XUJA 1A0LA 1ZGVA 4NIYA 1C1QA 1TPPA 2ZFFH 2FLRH 3LGVA 5EQQA 1GHBG 1GBHA 1DWBH 2ZI2H 1K9OE 3DUXH 2Z3CA 1C5QA 3B8JA 3SJ9A 1ZMNA 3SNAA 1F7ZA 1QL9A 4CRCA 4D76A 1G37A 1CBWC 1GMCF 1LPKB 1MTSA 1SQOA 2PKSB 2BD3A 1C2JA 1EASA 3ZZ3A 6CHAC 4CHAB 1G30B 3PMHB 1ELBA 4I8LA 5T6DA 3E91A 1TALA 2ODYB 4DURA 3RXDA 3SNDA 1O38A 4GVUA 4I8GA 3I77A 4UE7H 3RM2H 1D3PB 2FYQA 2Z94A 2H6MA 1ELVA 5BRRE 1KSNA 4Y11E 3UWIA 1HGTH 4I7YH 2VU8E 3OTJE 3ZVDA 2HNTC 1DPOA 5T6GA 1XXDA 3QDZB 4CR9A 4X6OA 5CMXH 1C9PA 3EE0B 1ZLRA 1GJ4H 1SGPE 5DP5A 2WPJS 3ZV8A 1OKXA 2QXGA 2JETB 3E0PB 1XUGA 1C5MD 2AEIH 3K6ZA 2ODPA 2BZ6H 1FV9A 1O2MA 2G8TA 2XW9A 2W3IA 2KAIB 4K1EA 1QY6A 3ZZDA 1ZMLA 3QX5H 1SLWB 1CHOF 4I33A 1P8VC 2QC2A 4D7FA 1S81A 5A0AE 1C1PA 3OY6U 3VB4A 3RDZA 1F0TA 4DIHH 3VXEH 1D3TB 2ZDVH 4X2VA 2GGVB 1Y5BT 4DOQA 1PQAA 1NM6A 4YLUA 2PV9B 3KQDA 1N8OB 1KXCA 1DUAA 2UWLA 3HKIB 2BVSH 2VH6A 3M35A 3O8RA 1Q31A 1QA0A 3SJ8A 4KGAA 2A0QB 2G4UA 2G81E 1MTWA 1Y59T 2G5VA 3PV4A 3BTTE 1YLCA 1XKBC 1DANH 4Y76A 3SU3A 2XWAA 4Y79A 3KCGH 2ZU3A 2GT8A 3ATMA 3V0XA 1INCA 1HBTH 5A2MH 2F9PA 1GBBA 1W7GH 4FUBA 1AY6H 3EAJA 3SHCH 3UOUA 4GHQA 3V13A 3EA9A 1BRCE 2F9NA 4FUJA 1GBAA 1PFXC 1GI8B 1TRYA 4MNWA 2EI8A 3M37A 1PPGE 1J15A 2J92A 3OX7U 2ZCHP 2R0KA 1UVUH 4X8UH 5DJ7A 5JBTA 1WTHD 1EZUC 5DP8A 1UCYK 2SGFE 1GHZA 3RXIA 1O34A 3L6PA 3BTDE 1MZAA 4Y71A 3TGIE 2VIQA 1TONA 1MKXK 1TB6H 4JK6A 1IQFA 4JMYA 1ELDE 1BMMH 1AZZA 1YPHC 3A86A 4OS2A 2ZO3H 1BTXA 2BQWB 1NFWA 2C93B 3UNSA 3VXFH