1FNIA

Crystal structure of porcine beta trypsin with 0.01% polydocanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fniA02
2FOEA 1UK3A 1ZHMA 1B0FA 2ZGCA 2ZTYA 4X1SU 1P2QA 1JOUB 4IBLH 2P94A 1KXBA 1AD8H 3OTJE 1KTSB 1FJSA 1PJPA 5EXMA 1PYTD 2I6SA 2H5CA 1G32B 1BHXF 7ESTE 1ZMJA 3H5CB 4Y8XA 3ENSB 5B6OA 4AFQA 1YCPM 3KQEA 1SGQE 1O2UA 5JBAS 3A7TA 1E38B 2Z9GA 2OBQA 2P95A 3C27B 4YZUA 4LK4A 3QK1A 3UNQA 1QL8A 2SNWA 1SGFA 4JK6A 1BJUA 2G4TA 2FODA 3TNTA 2J92A 2GZ7A 3QGJA 1IAUA 1Z6EA 4SGAE 5K0HA 1HJ9A 4U30A 1TPAE 4O97A 1T31A 4GHQA 3BTWE 1SI5H 1EJAA 1P01A 3PM3A 1MCTA 3SNEA 1WV7H 3ZV8A 3A8AA 2GVFA 5E2OA 3U8TH 3SHAH 4X1PU 4R8TB 1KTTB 1RRKA 2YNAA 3M3VA 1O3CA 1QY6A 3M5MA 1F0UA 2B5TB 2F3CE 2W3KA 3RU4D 1NU7B 3D49H 3M7UA 2OC8A 3ZZCA 5C5NA 2ZDNA 5GIBA 3RXEA 3SN8A 1O34A 4YT7H 3MU5A 4GLYA 1TNLA 1IQLA 2A5IA 2ZNKH 1GI4A 3RLWH 3M5NA 1IQKA 1MMJN 2ILNA 5E2PA 2O8LA 3HKIB 2NU3E 4I8KA 4BTTB 1UCYH 4JZ1A 3TNSA 4CHAC 2C8WB 1XUFA 1C1SA 4YLUA 1V2KT 1MBMA 1TPOA 2UWOA 1GVZA 3QX5H 1EZQA 4NWLA 1KXCA 1C1WH 1OWDA 1MU6B 2V3HH 1FY4A 4KKDA 4WF8A 5A09A 1TLDA 3LGTA 1YGCH 4UE7H 1ZJKA 4K1TA 2ULLA 1C9PA 2ZDVH 1QNJA 3LPRA 2FYQA 3K65B 1KDQA 3UOUA 1J14A 3FFGA 1A3EH 2CHAC 3QUMP 2BMGB 2K1QA 4NSYA 2WPHS 1AI8H 1GMCG 1S82A 1QR3E 3ZZDA 3L3TA 2J38A 3PROA 1H9HE 4TPYA 3SQHE 1E36B 3VGCB 1HFDA 6CHAB 1FY8E 1TABE 4ZXYH 1EASA 1P12E 1NC6A 2D2DA 4FU8A 2QC2A 1TA2A 1TB6H 4UFFH 1TNJA 3FANA 2Y82A 2VH6A 4ABGA 5DO4H 1TNHA 3SNDA 1CA0B 1FNIA 1EAXA 3RM0H 1BDAA 1OX1A 3MH4A 2Y81A 3JZ1B 1SGEE 1HNEE 1W10U 1V2UT 4THNH 1CGJE 1Y3UA 4ZUHA 1BMLA 1EX3A 4TWWA 1S85A 4CREA 1O2VA 1AFQC 1BMMH 3T27A 1O2YA 5T3HA 2QIQA 2BOKA 1J9CH 1XUHA 1MH0A 1A4WH 1S0QA 1DDJA 2W7UA 2Y80A 5JYIA 2PKSC 1H9IE 1EZSC 2ZKSA 1NZQH 1IQMA 1BTPA 1YC0A 2NU2E 4FUDA 4OS7A 1GJ7B 3RU4T 2VIPA 1BJVA 2XXLA 3MU8A 3O8RA 2ZU3A 3W94A 3ZV9A 3BEUA 1MTWA 4LOYH 5JB8S 1BITA 5FPYA 1KDQB 3D62A 2Z94A 1RJXB 3MU4A 1SPJA 1YP9A 1YYY1 1DPOA 3SV8A 4E7RG 1ARCA 3MNXA 1K1IA 2C90B 3EGKH 5JBBS 5FCKA 4A7IB 2O8UA 2OC7A 1AVGH 4ESTE 2QXJA 1N1LA 5GDSH 1T8MA 1LPKB 3HGNA 1GG6B 3ZZ7A 5C20A 1MTNC 1FDPA 5LPRA 2P16A 5C1UA 3SJKA 5CMXH 3S0NA 1AN1E 5EOKA 2XBYA 4YTAA 2P3TB 1K1JA 4YOIA 1XVOA 3T28A 1QB1A 1Z71A 4X6PA 5AFYH 2BX3A 4YOGA 4JZFH 1OP2A 1K2I1 3S69A 1NFXA 2G8TA 3GICB 4K69A 2CF8H 4MDSA 1QQ4A 2ZPQA 1QBVH 3URCA 3S7KB 3SGQE 3QWCH 4ZHLU 4NCYA 1TOCB 1IHSH 4X2VA 1FY1A 1K21H 1V2ST 1GVKB 4WJG2 3GDUA 4GSOA 2PUXB 5FBIA 5IYTA 1ANBA 5DKMA 5F8XA 2FOCA 1C2HA 4WXIA 5EPYA 3TH2H 1A1RA 2A5AA 4WH8A 2BD8A 1C2IA 1FXYA 1W3CA 1Y8TA 1CBWB 2EI6A 4AOQA 3TGKE 5LGOA 1SQTA 3RXHA 3U8OH 1MCVA 1ZYOA 5J4SA 1Y59T 2AMQA 2TGAA 4FVDA 1O5FH 1Z6JH 2BY7X 3T2NA 5AFZH 1V2OT 2ZGXH 2PHBA 1ESTA 1VR1H 1YLDA 5EXLA 4CRAA 1O2SA 1P2KA 4AYVB 1GHZA 1XKBC 4AB8A 1KIGH 4ABAA 5FX6A 2Y5HA 3F6UH 3SV6A 1TAWA 3E3TA 5FBEA 3LC5A 1C1QA 5G4BA 1BQYA 2HPPH 1DWBH 1TGBA 1P3CA 2QCYA 3GCHB 3RXDA 1KLJH 3RXQA 3LJOA 3MO9A 3ZYDA 1YPJH 1TQ7B 2HOBA 5DP4A 1GBJA 4F49A 1NPMA 3UPEA 4XBBA 4ABEA 3MI4A 2Q6FA 2D8WA 3E6PH 4MNWA 4YT6H 1TQ0B 2PSXA 4MPXA 2YOLA 1O2PA 3BTTE 1BOQA 1TX6A 4O9VA 3T29A 1NRQH 1THSH 4FUGA 1ELDE 3F9EA 2SGQE 2QGRA 2BX4A 3MO3A 3V3MA 2GZ8A 2EI7A 1WTGH 2M5TA 4U32A 3TU7H 3SUEA 3S9CA 1HGTH 4BAKB 1TMTH 3RUOA 5AF9H 3OY6U 2OP9A 2Y7ZA 3SOSA 4A1TA 1C5VA 3ZVAA 3QZQA 3SU4A 3SJOA 4IS5A 3T25A 2GZ9A 4JCNA 5T6GA 3ZYEA 4KELA 4CR5A 3LU9B 3LKWA 1DUAA 1XM1A 4E05H 1HAXB 1F5LA 1DVAH 2ZC9H 1FY5A 1THPB 1ETRH 1C5YB 3ZVGA 2R0KA 1K1LA 2BQ7B 3UR9A 5GXPA 2RA3A 2ZZUH 1N8OB 3Q3XA 1GHWH 1SGNE 4NIWA 5F8TA 1DFPA 1FPCH 4HFPB 4NGAH 1DX5M 2OQUA 1HAIH 3MNBA 1BIOA 3RXKA 5EG4A 3UY9A 3DFLA 1BUIA 3BG4B 3UREA 2PR3A 2ODPA 2J9NA 1S81A 2VWLA 1DY8A 1LQEA 3QTOH 3BV9B 4A1VA 1C2DA 2XW9A 1GBLA 1O36A 2ZFRH 1BTHH 2XCNA 1INCA 2AGGX 4VGCC 1O38A 2A4GA 3BN9A 2CMYA 2BXTH 2A0QB 4FUEA 4MNVA 1FUJA 2FDAA 1RD3B 4AFZA 2SGFE 1BTXA 2FOGA 4CBOA 1BZXE 1CSOE 2UWLA 3KQDA 4FUJA 1GI1A 3MH7A 1AVWA 3ZVFA 2AERH 1GI7B 4MTBA 1P04A 1GMDG 2AMPA 2GT7A 1C1VH 4H4FA 4DCDA 1GI9B 2EC9H 4OS4A 1GGDC 1UVOA 1SLUB 3MMGA 3NUMA 2FS8A 1WBGB 3P8GA 1TX7A 3SNAA 1O5CB 1F92A 1NFUA 3BIVH 2GCTC 1HDTH 2IJOB 2ZU5A 1ABIH 2SGPE 1QBNA 1Z8GA 3IITA 3ODFA 1AE8H 5K7RA 1YPMH 2ZIQH 3UUZA 1DWEH 1AO5A 4CRDA 2H2ZA 2AMDA 4IMZA 4MPVA 1QHRB 5J4QA 1O3OA 3MH6A 2F9OA 3BTHE 4Y11E 1OPHB 1TPPA 4CBNA 3K9XB 1O39A 3U69H 3VPKA 1SL3A 4X6OA 1C2FA 1K22H 1ANDA 2BD5A 1AUTC 3RXLA 1UTNA 3DUXH 1YCPH 3DA9B 1FAXA 3S7HB 1GMDF 3DFJA 1UTOA 4GPGA 3IG6B 2RCEA 1AU8A 1NO9H 4D8NA 1MTVA 1BBRH 2C8XB 4BAOB 1YPLH 3GCNA 1XUGA 2CXVA 1P2JA 1TALA 2ZFPH 2PGBB 1A3BH 1GI5A 1C5OH 3R3GB 1QCPA 1EZUC 1E35B 1Y5BT 2TIOA 1UTPA 1G3BA 2LPRA 1V2QT 1FQ3A 1C9TA 2A2XH 1KSNA 2ZGJA 1QRWA 4CHAB 3A87A 1HYLA 1S0RA 4DW2U 4KTUA 2GDEH 3DD2H 1ANEA 1W0YH 3A85A 5FXLA 3SUFA 2FOAA 1HBTH 2PTCE 3T5FH 4I31A 5FHTA 1FONA 2OQ5A 3PLKA 1TRYA 3P95A 1TX8A 2PLXA 2A5KA 3KCGH 1UTJA 3FP7E 4YM9A 2CHAB 3PMAB 3UTUH 2EI8A 3ZZ8A 2AH4X 1G37A 1QL9A 4HI3A 2ZCLP 5FX5A 1S83A 1C4U2 1S6FA 1GHBF 3A89A 2FOHA 4ZHAA 2ANWA 2CN0H 4ZAEA 4B74A 5GJ4B 3P92A 1H1BA 1O2QA 2H9HA 1UJ1A 2Z9JA 1GHXH 3MH5A 4ZKNU 1NM6A 4XDEA 2R3UA 3BTME 1GBHA 3VFEA 5HMAA 2OUAA 3SU3A 1ZZZA 2A4QA 3E16B 4JK5A 1ID5H 5EW2H 1V2PT 3RXPA 1Z8IB 3AASA 5FCRA 3Q3YA 2WV4A 1MKWK 4Q7ZA 1QIXB 2Y5GA 1W13U 1YM0A 4INHA 4O03A 4F4OC 2Z9KA 1EAUA 1DANH 3KQCA 4BOHA 2XRCA 3FZDA 1AFQB 2QXGA 5FPTA 1VITG 2FOBA 3RC6A 3SZNA 1T4VH 1NROH 1TRNA 1VCQA 1O33A 1V2VT 1P03A 2AGIX 2HLCA 2ZDLA 4DY7B 3NKKA 4I33A 3VXEH 6GCHG 1OWHA 1O3NA 1QRXA 1A7SA 1Y3XA 2F9NA 2W5EA 4OS6A 3NPSA 1W0ZU 1OWKA 1LVBA 2QAAA 1ZHRA 3ESTA 1UVSH 3BTQE 3Q77A 1A61H 4A5TS 1LKBA 4K3JA 1E0FD 3EYDA 4BAMB 4X6MA 1O0DH 2W7SA 4ABHA 2WPLS 1O32A 1BB0B 8GCHG 2QF0A 3BF6H 5DP7A 4Y8ZA 1VITF 2F9VA 2FLRH 3M3TA 4JYVH 1NU9A 1C5NH 2QV1A 3M7TA 1ZSLA 2BD9A 1MTNB 3NK8A 1TONA 1IQFA 3QTVH 4DT7B 3RMOH 2FTMA 1A5IA 1NRRH 3ZZAA 2QY0B 3RU4E 1NT1A 4AG1A 2JKHA 2BY8X 2R9PA 2VINA 1MQ6A 2BVSH 1CO7E 3TK6A 1PPGE 4YLQH 4GAWA 6GCHF 3SGAE 1A46H 1HB0B 1PFXC 5C2ZA 2B9LA 3HKJB 2ZDMA 1LDTT 2JETC 4ABIA 1JRTA 1ELVA 5DGJA 4ZROA 2VIDA 2ZFFH 5BPEA 3OYPA 2A1DB 1CT4E 5F6MA 2VIWA 4WWYA 3NZIA 1HCGA 3D65E 1LHEH 1SLVB 3ITIA 2STAE 1ELEE 4INLA 1CE5A 1MUEB 8GCHF 1TFXA 2FXRA 1BT7A 1NTPA 3PWBA 1O2TA 2WUBA 2FM2A 1C5MD 2ZPRA 4ASHA 3M5OA 4D7GA 3ATKA 1H4WA 3UNRA 1FIZA 1T4UH 1E37B 2W3IA 1ESBA 3I77A 1CT2E 4ISNA 2A4RA 1O3EA 3HGPA 3TGIE 5DG6A 1QA7A 1AZ8A 1GJBB 4LXBH 4U01A 4XSKU 1SGYE 3QN7A 2ANKH 3VXFH 2BDCA 3P70B 1TGTA 1N6XA 2FZZA 3SBKA 3RXBA 1VJ9U 1EJNA 1CVWH 1EAIA 1L1GA 5DP3A 4NA8A 3AAUA 3SNCA 3GY4A 4I32A 2VIVA 1MBQA 4FUHA 2O8WA 1ZPBA 3STJA 3ZZ9A 2XCFA 4DIHH 4OGXA 5FPSA 1MKXH 7GCHG 5H4IB 3OU0A 2V35A 1O2IA 1L1JA 2FIRH 1QJ6B 2HNTE 2OTVA 3TPIZ 1QB9A 1BMNH 2J34A 4BTIB 1IHTH 1C4Y2 4WMFA 2XBXA 3M3SA 1F5RA 2UUKB 3BTKE 1UK4A 1UCYK 3PO1C 1GMCF 1NESE 1QL7A 3ZVDA 1TYNA 2WYGA 1G3EA 1DWDH 3A84A 1HJAC 1TBZH 1M9UA 1UVUH 2V3OH 3KEEA 4Y76A 4K8YA 1CT0E 3Q3KA 3VB5A 2VVVA 2F91A 3ZVBA 2F9BH 1ZGIA 2BY5X 1BTYA 4ABJA 1CU1A 2GD4B 3A86A 2ZHWH 1GI6A 1O3JA 1VGCC 3TJUA 2ZHFH 1GBFA 1XVMA 2G52A 4JMYA 3GCOA 3RC4A 1O2ZA 1TOMH 1MZAA 4AORA 1MD7A 1OXGA 5EQRA 3TIUA 6LPRA 2GTBA 1SGTA 2Z7FE 1FN8A 1O3DA 3SI3H 5DP6A 2O8MA 1DICA 2F9PA 3GISB 5GWZA 1P57B 1O2GH 4TY6A 1XMNB 4MVNA 2DE8A 3SW2B 2XC5A 3U9AH 1GJ6A 2A7CA 3B9FH 2VVUA 1GDUA 1ELGA 4B2CA 1VITH 2BDIA 4HTCH 2G5NA 1MKXK 1Y5AT 1NRSH 1OYTH 2BVRH 2ZFTA 1EB2A 2NU4E 1D6WA 1P2NA 1BBRE 1HAGE 2P8OC 3UWJH 1L4ZA 3FZZA 2VIQA 3B23B 3SU6A 1A5GH 4Y79A 1AKSA 2TGPZ 4VGCB 2SGDE 1WCZA 1BTWA 1TBRH 1O2HA 4TPIZ 1C1TA 4MNXA 1KXDA 1NY22 1LVYA 4ZHMU 4NIVA 2FTLE 3A82A 1O2RA 1CGHA 4Q7YA 4IN2A 3V7TA 2BDAA 1O2JA 4WY3A 1ELFA 3A7VA 2PSYA 1FLEE 4K8BA 4B2BA 4KTCA 4Q7XA 4DGJA 1EP6A 2BZAA 3PYHA 5ESBA 3RMMH 3QDZB 1TE0A 2GGVB 1JMOH 4J1YA 3AAVA 1E34B 2ASUB 2FESH 3LJJA 3F1SB 3RXGA 1GGDB 2XBVA 1C5SA 5DP8A 2D1JA 4NZQA 1HIAA 1J15A 1P09A 4NA9H 3E91A 1Z1IA 2UUJB 1D3QB 3LDXH 3LGYA 2HGTH 2GCTB 2A32A 3E0NB 4D9RA 1F5KU 5C1YA 1F7ZA 4A6LA 2TBSA 1H9LB 1W8BH 3F68H 3PB1E 4NIXA 1P2MA 2R0LA 4IN1A 4M7GA 1L0ZA 1C2KA 1GPZA 1ZTKA 1GBAA 3A7YA 4ZKRU 2VJ1A 1WYKA 1D9IA 1GDNA 1ZJDA 3ATWA 1GBKA 3F9GA 1AGJA 1F0SA 2Y6TA 1Z8JB 1A0LA 2Z6BD 3LGVA 1UO6A 2BXUH 3Q00A 2KAIA 3E90B 3ZZ3A 2BD2A 1UVPA 2FP7B 1TGSZ 1IQHA 4X8SH 3AW0A 2P93A 1HXFH 2PTNA 1WQVH 4B76A 2ZGHA 3BEFB 2AYWA 3SU0A 5L2YH 2BLQA 3SO3A 2FI5E 3VEQB 4RKJB 2C8YB 1OSSA 4X1QU 1AKSB 3ZZ6A 3TGJE 4NFFA 1LMWB 1SSXA 1HUTH 5EPNA 3BG8A 1WU1A 2GMTC 4NA7A 2ZWLH 2ZTZA 2YNBA 2XBWA 2ZHQH 1AFEH 1JXPA 3ODDA 3KNXA 2FEQH 2FI3E 2ZU2A 1MAXA 4IW4E 1GI3A 1GBTA 1ZLRA 2ODQA 3SJ8A 2Z3DA 1LTOA 5DP5A 2HVXA 1ZMLA 1SLXB 4NFEA 4CRCA 3BSQA 1C1NA 2CJIA 2QN5T 2PW8H 2G4UA 1PQAA 1ETSH 1J16A 2Y7XA 5DPAA 1HIAB 3S9AA 1ZTLA 4AFUA 3SV9A 2Z3EA 4DVAU 1Q3XA 3BTGE 1FY3A 2O8TA 2VGCC 1O3FA 1YPEH 2QF3A 4Y7BA 5HXFA 4ZKOU 2AS9A 5L30H 1LHGH 4X1RU 1P11E 2H5DA 1LPGB 2F9UA 2SGEE 2UWPA 5F8ZA 3SQEE 5JB9S 4IGDA 1O31A 5DK1A 1D3TB 1GDQA 1V3XA 4MPUA 1O5AB 1SR5C 2FI4E 1TRMA 1UTLM 4R0IA 2Z9IA 2A31A 3SU5A 5C67A 1MAYA 3RXAA 1DXPA 1ZGVA 2KAIB 3L6PA 4Q2KA 6ESTA 3RMLH 4ISLA 1FN6A 1S5SA 1SHHB 3LT3A 1P9UA 3MNCA 2I6QA 4BAQB 3NWUA 3LC3A 2ZG0H 1THRH 3PTBA 2FX4A 1D3DB 1ZPZA 1QJ1B 1IQNA 2CF9H 3EA7A 1BCUH 2AEIH 4UDWH 1J17T 1RTKA 4Y8YA 1KXFA 1GHAG 3A7XA 4DG4A 1T32A 3P8OA 3RXFA 4YESB 1V2RT 1BRAA 2FS9A 3AVZA 3OY5U 1DLKB 1K1OA 1YBWA 1MTUA 2H6MA 5LH8A 4O3TA 4MQAA 4AZ2B 1GMHG 2FX6A 3K6YA 2GT8A 3OX7U 2GKVE 1EPTC 2DUCA 4I7YH 4OS2A 3KF2A 1GBBA 2XC4A 1C1MA 4JZIA 3RXRA 2P3UB 1ZRBA 1AWFH 4X2WA 1G3CA 1GI0A 4ISIH 2O9QA 3A80A 3A8CA 1MZDA 4BXSA 2BQ6B 2C8ZB 9LPRA 1AB9C 1NRNH 1XXFA 4ZKSU 4K1EA 3F9HA 1GHAF 3RXMA 4AYYB 2ZTXA 4GCHG 2GV6A 1PQ7A 2HWLB 1MD8A 1XKAC 1O2LA 2AIQA 3UOPA 1SQOA 1HAZB 1FI8A 3K2UA 3MO6A 3FVFB 3G01A 1GMHF 4NG9H 1O5GH 2WV5A 2JETB 1U6QA 1MU8B 1FAKH 3U98H 1TGNA 1Z7KA 2ZHEH 1LQDB 2OC0A 4AN7A 2VWMA 2OD3B 4FXGH 1O2OA 2C93B 3SNBA 1AIXH 1EATA 4CRGA 1GI8B 1DT2A 1OP8A 2A7JA 2FLBH 1PPCE 5GCHG 3W95A 3KN2A 2B0FA 1UK2A 3F9FA 3CP7A 9ESTA 1AMHA 2TGDA 2D26C 3LOXA 2ZGBH 2UUYA 3GYMA 4GCHF 3N7OA 1O3LA 1SOZA 1AY6H 3TVJB 1PQ5A 4IC6A 1V2TT 1W12U 4RN6A 1S6HA 2GX4A 1K1PA 2Z9LA 1P8VC 1WSSH 2J4IA 3MU0A 5GPIB 5A8YA 1B5GH 1D4PB 2BYAX 4X6NA 4Z6AH 3RC5A 1F2SE 3M7QA 2BOHB 3RLYH 5TJXA 3M5LA 4J2YB 1AHTH 3SJ9A 4WH6A 1W7XH 4BAHB 1O2MA 1RIWC 1XUIA 3RXJA 1YCPK 1O37A 2G81E 5DP9A 1WUNH 2UUFB 1SGIB 2JH6D 2XWBI 4YOJA 1EOLA 3RXOA 3T26A 2EA3A 1BBRK 1YPGH 2FOMB 5GCHF 1SOTA 4OGYA 2R3YA 2BB4A 2ZU4A 1MTSA 1C5XB 4HGCA 4BANB 1SLWB 2DE9A 1GCTC 3P8FA 4E06H 1AQ7A 5JDUB 1HV7A 1ARBA 4D76A 4AGKA 1GHVH 3TH4H 3UQOA 2Z3CA 3PO1B 1L4DA 4NWKA 3VB3A 1J8AA 3L33A 4WMEA 1DM4B 4K1SA 4KP0A 2PKSB 1QRZA 1DXWA 1HJAB 3LGWA 2ZCHP 1P2OA 2ZECA 1C5LH 4ZXXH 1BHXB 3RXUA 4AG2A 2XWAA 3GDSA 3GY8A 1GVLA 1QJ7B 1YPHE 2WPIS 3GYLB 1EKBB 5EU8A 3A88A 3PMBB 4HZHA 5EGMA 1RS0A 1VGCB 2B8OH 1TMBH 4Q80A 3TJNA 8LPRA 3BTFE 2RG3A 1L2EA 3NXPA 1XUKA 1GBMA 4DIIH 1B7XB 3ATIA 3A81A 4K60A 4IMQA 1YKTA 3GCTG 2GV7A 1F0RA 4AB9A 1W2KH 5EQQA 5JBTA 2PGQB 5E0GA 4FU7A 3TK9A 1CQQA 2J94A 1UMAH 2AFQB 2ZCKP 1SGFG 4UFEH 2EEKA 2QXHA 2G51A 1GHYH 4UFDH 1OS8A 1QQUA 1Y3WA 1IQJA 1CHOG 4X8TH 2IPHA 1XX9A 1BTUA 5FAHA 4I8LA 1GJDB 3SU1A 1QTFA 2G00A 2OCVB 4JYUH 1L1NA 4KGAA 4MPWA 4Z0KA 1ESAA 3VB7A 4ISHH 1SHYA 2P8OB 1O2XA 4DURA 1GBDA 1EP5A 1EAWA 3GY6A 2ZQ2A 5C1XA 4KTSA 1ZTJA 5A0CA 2ALVA 1AWHB 1SMFE 4XOJA 2SFAA 2GCHG 1UTKA 1GJ5H 5ABWA 4QT8C 1SFIA 3ELAH 3OSYA 3PV4A 1KXEA 2ESTE 1DY9A 3PLPA 3GCTF 4LZ1H 1D3PB 2GDDA 1W7GH 1HPGA 3QLPH 2HRVA 2ANYA 4CRFA 3CS0A 1K1NA 3CENA 1T8OA 4RSPA 1DSUA 1SFQB 1Y5UT 3LGIA 4I8JA 1WOFA 1G30B 1CHOF 5JPMH 2WPKS 1W11U 2W26A 1DOJA 1ACBE 1S84A 1ANCA 1AZZA 1C5RA 1EB1H 3EQ0H 5CE1A 1IOEA 4JZEH 3RM2H 1OP0A 5EQSA 3UNSA 3ATMA 1Q31A 1C5QA 3UWIA 1JIRA 2PWXA 2B7DH 5E8EH 1HLTH 3RDZA 3RMNH 3UFAA 3LGUA 3ZZ5A 2CV3A 2GCHF 2FYRA 3V12A 1ELAA 2IN2A 4UD9H 1P05A 2ZPSA 1PQ8A 4NSVA 1BRBE 1EJMA 1C2MA 1O2WA 1IQIA 1LHFH 2BLWA 5CHAC 1C2JA 1EXFA 4O3UA 1KLIH 2ZA5A 2IOTA 3LH1A 1D6RA 1TGCA 2Y5FA 2ZEBA 4YO9A 5HYOA 1ORFA 1CHGA 5TCCA 2ZFQH 3V0XA 3GDVA 4K5ZA 1CA8B 1C5PA 2NWNA 5HM9A 1O2KA 4ZH8A 3BEIB 2RA0A 1AE5A 4AGJA 4OS1A 2QXIA 3QGNB 1V2JT 4JYTA 1Y3VA 3TJVA 2Q6DA 1H8DH 3SU2A 2ZI2H 4B71A 2GMTB 3GY5A 1T8NA 3QO6A 4B75A 2V6NA 2FO9A 3EAJA 1NS3A 2WPMS 2HALA 1HRTH 5E0HA 1X7AC 5PTPA 1SB1H 3GY2A 4D9QA 1A2CH 4AFSA 2H9TH 1QFKH 2XNIA 3HATH 3I78A 3SV2H 5F03A 3O8DA 1GWAA 1O3HA 3MOCA 3P6ZB 1DSTA 7GCHF 1JWTA 1TMUH 1RTLA 1OWJA 1EPTA 1OKXA 4Y7AA 1ZRKA 1ZPCA 2VGCB 5EODA 3R0FA 1UVTH 1FMGA 2THFB 2WINI 2ANMH 2BY9X 1O5EH 2BLVA 3MWIU 2BTCE 4AX9H 3GY7A 3RXVA 2PFEA 3DT0H 1HAVA 1Q2WA 4A1XA 3HK3B 2HNTF 2FWWA 1G9IE 2ZHDA 3A8BA 3SUGA 1VZQH 2BVXH 2A45B 1UHBA 1HJ8A 1GBEA 1K28D 1GL0E 3TK5A 3H7OA 3PTNA 1P10A 5C5OA 2VIOA 1GJ9B 1SG8B 1HAYB 1O3KA 2OLGA 3SJIA 1P2IA 3KQBA 3HK6B 5E0JA 2BHGA 3MYWA 4RKOB 4NZLA 1O2NA 1PYTC 1QURH 3TJOA 2XYAA 4X2XA 3V13A 1G3DA 1OYQA 1G36A 1OWEA 1PPBH 1P02A 3P8NA 1JIMA 4I8HA 4FUBA 2ZDAH 1O35A 4OS5A 2ZU1A 5I46H 3NCLA 4XE4A 1T8LA 3RXCA 1FZZA 4XBCA 1C1OA 3E8LA 5T6FA 1WTHD 1YPHC 2SNVA 2J95A 3EA8A 1BA8B 3ZVEA 1DE7H 3AW1A 1V6DA 3JZ2B 3BTEE 5BRRE 1VCPA 3TH3H 3T62A 1BTZA 2BZ6H 1N6YA 1V2NT 5LPEA 1ETTH 1TIOA 3CS7A 1FPHH 1PPZA 4FU9A 1OOKB 3PWCA 4WMDA 2VWOA 5HM2A 5TCAA 1EPTB 2J2UA 2ZP0H 4DOQA 3GY3A 2QA9E 4CR9A 3HPTB 3Q76A 2BQWB 3E0PB 2A4OA 2PUQH 4INKA 1QB6A 1SGPE 1JBUH 1HAVB 1T7CA 1XUJA 1O30A 1AB9B 1OWIA 2XTTB 3KHVA 5SGAE 4Y0YE 2ZF0H 3VGCC 1LCYA 1C1RA 6CHAC 5AHGH 3ZZ4A 1WAYB 3QZRA 1LVOA 1UHBB 4X1NU 1IQGA 1PPHE 1TNKA 1WQSA 1Y3YA 1G2LA 1LHDH 1VJAU 5I25A 1GCDA 1ELCA 4DJZB 4SGBE 1A5HA 1CA0C 1GI2A 1EQ9A 2BDYA 4CH2B 4WVPE 1KY9A 4Y10E 3BIUH 1AUJA 5IDKA 2P59A 1HAPH 3SORA 3SV7A 3DHKH 2VH0A 4K2YA 3S9BA 2WYJA 2WUCA 1O3PB 2PV9B 4XBDA 3FAOA 1Z8RA 2G5VA 2C4FH 1W14U 3MNSA 5L2ZH 3ZZBA 5A8ZA 2FMJA 4BTUB 2FPZA 1GJ4H 1C5ZB 4GUXA 2A2QH 1NN6A 1C4V2 1C1PA 4PROA 1PPFE 1LVMA 2WPJS 1RXPA 1TNIA 1HAOH 5EXNA 1ZR0A 2BDBA 1C5WB 2OXSA 4B2AA 8KME2 2AIPA 5ESTE 1GBCA 4MG3A 1C1UH 1AVXA 2VWNA 1RIWB 1P0SH 2Q6GA 3WY8A 4GVUA 1EUFA 1XXDA 4TWYA 1DWCH 4CH8B 3M61U 3MU1A 3BTDE 4LZ4B 3A7WA 4NIYA 7KMEH 3FP8E 2HNTC 3UR6A 1GG6C 1FV9A 1B0EA 1MQ5A 1QBOA 4FUFA 2PKAA 4MNYA 2OBOA 3I29A 3FP6E 4TY7A 1GCTB 1NFWA 1K9OE 1H8IH 4BNRA 4XFQA 3O8CA 5JBCS 1YF4A 2BLOA 1QA0A 5T6DA 4D7FA 1KXAA 3ATLA 1P06A 3RP2A 3SI4H 4ZMAH 1LPZB 2STBE 3PMHB 2ODYB 3U1JB 1HAHH 2BM2A 4Y71A 1LKAA 1C2GA 2BY6X 5L6NH 3EDXB 3MTYA 1SVPA 3E1XB 4IC5A 4A92A 2HPQH 1UCYE 5A2MH 1G2MA 1C5UA 1ZOMA 5AVDA 1O3GA 1QGFA 1O3AA 2A7HA 1VCWA 1SBWA 2R2WU 4X8VH 2OC1A 2G55A 4Y0ZE 5EW1H 1IQEA 1CBWC 3UQVA 1GJAB 4H6SB 1YLCA 4BXWA 1ABJH 3MFJA 3UIRA 3B8JA 5HGGA 1V2WT 2F83A 1A0HB 3ZVCA 3EE0B 3VB6A 3VB4A 1NFYA 2C3SA 1P9SA 3RXTA 4JZDH 4GHTA 5A8XA 4X8UH 1ELBA 1C2EA 1V2LT 1Z1JA 1RGQA 1YPKH 3M37A 3MHWU 5ETXA 4FUCA 1HXEH 4X0WU 4E7NA 1SGDE 1KLTA 1LHCH 2PKAB 1DS2E 4ABFA 4ISOA 2BDHA 3P17H 2XC0A 1TPSA 7LPRA 3GCHC 1SC8U 1BRUP 4Y6DA 2ZQ1A 4TYDA 1ELTA 1P3EA 1RTFB 2JH0D 2FOFA 1GBIA 2Q1JA 4I8GA 3RXIA 3TITA 1V2MT 2VNTA 1TNGA 4U2WA 2CGAA 3LIWA 1PPEE 2VU8E 1TWXB 4UFGH 3C1KA 4FVBA 4H6TA 3IWMA 2ZFSA 1MKWH 1SGCA 3A7ZA 1GHBG 1LO6A 1KYNA 1GL1A 5DJ7A 1TA6A 2H1UA 4FUIA 1UTQA 4B1TA 1UTMA 1BRCE 3LH3A 1GJ8B 2SGAA 3K6ZA 3PLBA 4CRBA 1O3MA 2V0BA 3STIA 5A0AE 1SQAA 2P3FH 4H42U 3M35A 1ZHPA 3LONA 4ABBA 2ZO3H 1DLEA 5A0BA 2GP9B 1ZSKA 1RFNA 1DITH 2NU1E 1FIWA 2TPIZ 4X2YA 4UEHH 5C3NA 3SHCH 1O5BB 2RDLA 1DUEA 2ZDKA 3A8DA 3RXSA 2OINA 3D23A 2BD3A 4B73A 1EOJA 2LNCA 2BDGA 4WXVA 2R2MB 1F0TA 1JRSA 1CGIE 3A83A 1ZSJA 3PMJA 4ABDA 2JH5D 3KIDU 3KGPA 1K1MA 1C2LA 2VB0A 3U8RH 2H9EH 1NRPH 1A0JA 1N8OC 2QYIA 5CHAB 3GOVB 1O5DH 2BD7A 1O3IA 3U1IB 1BMAA 8ESTE 1SGRE 3TLOA 1GJCB 1O3BA 1EZXC 1TBQH 3BG4C 3EA9A 2AGEX 3O8BA 2ALPA 4MLFB 5LPFA 1C5TA 1ZMNA 3URDA 3H7TA 2BD4A 3SUDA 4UONA 2NU0E 2TGTA 3M36A 3SGBE 2VVCA 3KL6A 2TRMA
chains in the Genus database with same CATH superfamily
2FOEA 1UK3A 1ZHMA 1B0FA 2ZGCA 5EJZA 2ZTYA 4Q4LA 1P2QA 1JOUB 4X1SU 4IBLH 2P94A 1KXBA 1AD8H 3OTJE 1KTSB 1FJSA 1PJPA 5EXMA 1PYTD 2I6SA 2H5CA 1G32B 1BHXF 7ESTE 1ZMJA 3H5CB 4Y8XA 3ENSB 5B6OA 4AFQA 1YCPM 3KQEA 1SGQE 1O2UA 5JBAS 3A7TA 1E38B 2Z9GA 2OBQA 2P95A 3C27B 5FL7D 3FKSD 4YZUA 4LK4A 3QK1A 3UNQA 1QL8A 2SNWA 1SGFA 4JK6A 2EY4C 2W6ID 1BJUA 2G4TA 2FODA 3TNTA 2J92A 2GZ7A 3KYGA 3QGJA 1IAUA 1Z6EA 4SGAE 2J97A 5K0HA 1HJ9A 4U30A 1TPAE 4O97A 1T31A 4GHQA 3BTWE 1SI5H 1EJAA 1P01A 3PM3A 1MCTA 3SNEA 1WV7H 3ZV8A 3A8AA 2GVFA 5E2OA 3PV5A 3U8TH 3SHAH 4X1PU 4R8TB 1KTTB 1RRKA 2YNAA 3M3VA 1O3CA 1QY6A 3M5MA 1F0UA 2B5TB 2F3CE 2W3KA 3RU4D 1NU7B 3D49H 3M7UA 2OC8A 3ZZCA 5C5NA 2ZDNA 5GIBA 3RXEA 3SN8A 1O34A 4YT7H 3MU5A 4GLYA 1TNLA 1IQLA 2A5IA 2ZNKH 1E79D 1GI4A 3RLWH 3M5NA 1IQKA 1MMJN 2ILNA 5E2PA 2O8LA 3HKIB 5IK2D 2NU3E 4I8KA 4BTTB 1UCYH 4JZ1A 3TNSA 4CHAC 2C8WB 1XUFA 1C1SA 4YLUA 1V2KT 1MBMA 1TPOA 2UWOA 1GVZA 3QX5H 5C94A 1EZQA 4NWLA 1KXCA 1C1WH 1OWDA 1MU6B 2V3HH 1FY4A 4KKDA 4WF8A 5A09A 1TLDA 3LGTA 1YGCH 4UE7H 1ZJKA 4K1TA 2ULLA 5C0TA 1C9PA 2ZDVH 1QNJA 3LPRA 2JJ2D 2FYQA 3K65B 1KDQA 3UOUA 3WWFA 1J14A 3FFGA 1A3EH 2CHAC 3QUMP 2BMGB 2K1QA 4NSYA 4XD7D 2WPHS 1AI8H 1GMCG 1S82A 1QR3E 3ZZDA 3L3TA 2J38A 3PROA 1H9HE 4TPYA 3SQHE 1E36B 3VGCB 1HFDA 5KGOA 6CHAB 1FY8E 1TABE 4ZXYH 1EASA 1P12E 1NC6A 1W0JD 2D2DA 4FU8A 2QC2A 1TA2A 1TB6H 4UFFH 1TNJA 3FANA 2Y82A 5T1VA 2VH6A 4ABGA 5DO4H 1TNHA 3SNDA 2AHME 1CA0B 1FNIA 1EAXA 3RM0H 1BDAA 1OX1A 3MH4A 2Y81A 3JZ1B 1SGEE 1HNEE 1W10U 1V2UT 4THNH 1CGJE 1Y3UA 4YXWD 4ZUHA 1BMLA 1EX3A 4TWWA 1S85A 4CREA 1O2VA 1AFQC 1BMMH 3T27A 1O2YA 5T3HA 2QIQA 2BOKA 1J9CH 1XUHA 1MH0A 1A4WH 1S0QA 1DDJA 2W7UA 2Y80A 5JYIA 2PKSC 1H9IE 1EZSC 4A6LA 2ZKSA 1NZQH 1IQMA 1BTPA 1YC0A 2NU2E 4FUDA 4OS7A 1GJ7B 3RU4T 2VIPA 3GS9A 1BJVA 2XXLA 3MU8A 3O8RA 2ZU3A 3W94A 3ZV9A 3BEUA 1MTWA 4LOYH 5JB8S 1BITA 5FPYA 1KDQB 3D62A 2Z94A 1RJXB 2RDEA 3MU4A 1SPJA 1YP9A 1YYY1 1DPOA 3SV8A 4E7RG 1ARCA 3MNXA 1K1IA 2C90B 3EGKH 5JBBS 5FCKA 4A7IB 2O8UA 2OC7A 1AVGH 4ESTE 2QXJA 1N1LA 5GDSH 1T8MA 1LPKB 3HGNA 1GG6B 3ZZ7A 5C20A 1MTNC 1FDPA 5LPRA 2P16A 5C1UA 3SJKA 5CMXH 3S0NA 1AN1E 3FO8D 1NBMD 5EOKA 2XBYA 4YTAA 2P3TB 1K1JA 4YOIA 1XVOA 3T28A 1QB1A 1Z71A 4X6PA 5AFYH 2BX3A 4YOGA 4JZFH 1OP2A 1K2I1 3S69A 1NFXA 2G8TA 3GICB 4K69A 2CF8H 4MDSA 1QQ4A 2ZPQA 1QBVH 3URCA 3S7KB 3SGQE 3QWCH 4ZHLU 2KX4A 4NCYA 1TOCB 1IHSH 4X2VA 1FY1A 1K21H 1V2ST 1GVKB 4WJG2 3GDUA 4GSOA 2PUXB 5FBIA 5IYTA 1ANBA 5DKMA 5F8XA 3EE7A 5GNDA 2FOCA 1C2HA 2K0QA 4WXIA 5EPYA 3TH2H 1A1RA 2A5AA 3SYJA 4WH8A 2BD8A 1C2IA 1FXYA 1W3CA 1Y8TA 1CBWB 2EI6A 4AOQA 3TGKE 5LGOA 1SQTA 3F3BA 3RXHA 3U8OH 1MCVA 1ZYOA 5J4SA 1Y59T 2AMQA 2TGAA 4FVDA 1O5FH 1Z6JH 2BY7X 3T2NA 5AFZH 1V2OT 2ZGXH 2PHBA 1ESTA 1VR1H 1YLDA 5EXLA 4CRAA 1O2SA 1P2KA 4AYVB 1GHZA 1XKBC 4AB8A 1KIGH 4ABAA 5FX6A 2Y5HA 3F6UH 3SV6A 1TAWA 3E3TA 5FBEA 3LC5A 1C1QA 3F2FA 5G4BA 1BQYA 2HPPH 4RI0A 3KYFA 1DWBH 1TGBA 1P3CA 2QCYA 3GCHB 3RXDA 1KLJH 2YMSC 3RXQA 3LJOA 5C17A 3MO9A 3ZYDA 1YPJH 1TQ7B 2HOBA 5DP4A 1GBJA 4F49A 1NPMA 1VKYA 3UPEA 4XBBA 4ABEA 3MI4A 2Q6FA 5KECA 2D8WA 3E6PH 4MNWA 4YT6H 1TQ0B 2PSXA 4MPXA 2YOLA 1O2PA 3BTTE 1BOQA 1TX6A 4O9VA 3T29A 1NRQH 1THSH 4FUGA 1ELDE 3F9EA 2SGQE 2QGRA 2BX4A 3MO3A 3V3MA 4F48B 2GZ8A 2EI7A 1WTGH 2M5TA 4U32A 3TU7H 3SUEA 3S9CA 1HGTH 4BAKB 1TMTH 3RUOA 5AF9H 3OY6U 2OP9A 2Y7ZA 3SOSA 4A1TA 1C5VA 3ZVAA 3QZQA 3SU4A 3SJOA 4IS5A 3T25A 2GZ9A 4JCNA 5T6GA 3ZYEA 4KELA 4CR5A 3LU9B 3LKWA 1DUAA 1XM1A 4E05H 1HAXB 1F5LA 1DVAH 2ZC9H 1FY5A 1THPB 1ETRH 1H8ED 1C5YB 3ZVGA 2R0KA 1K1LA 2BQ7B 3UR9A 5GXPA 2RA3A 2ZZUH 1N8OB 3Q3XA 1GHWH 1SGNE 4NIWA 5F8TA 1DFPA 1FPCH 4HFPB 4NGAH 3OE7D 1E1QD 3OAAD 1DX5M 2OQUA 1HAIH 3MNBA 1BIOA 3RXKA 5EG4A 3UY9A 3DFLA 1BUIA 3BG4B 3UREA 2PR3A 2ODPA 2J9NA 1S81A 2L74A 2VWLA 1DY8A 1LQEA 3QTOH 3BV9B 4A1VA 1C2DA 2XW9A 1GBLA 1O36A 2ZFRH 1BTHH 2XCNA 1INCA 2AGGX 4VGCC 1O38A 2A4GA 3BN9A 2CMYA 2BXTH 2A0QB 1WXRA 4FUEA 4MNVA 1FUJA 2FDAA 1RD3B 4AFZA 2SGFE 1BTXA 2FOGA 4CBOA 1BZXE 1CSOE 2UWLA 3KQDA 4FUJA 1GI1A 3MH7A 1AVWA 3ZVFA 2AERH 1GI7B 4MTBA 1P04A 1GMDG 2AMPA 2GT7A 1C1VH 4H4FA 5F53A 2IJD1 4DCDA 1GI9B 2EC9H 4OS4A 1GGDC 1UVOA 1SLUB 3MMGA 3NUMA 2FS8A 1WBGB 3P8GA 1TX7A 3SNAA 1O5CB 1F92A 1NFUA 3BIVH 2GCTC 1HDTH 2IJOB 2ZU5A 1ABIH 2SGPE 1YWUA 1QBNA 1Z8GA 3IITA 3ODFA 1AE8H 5K7RA 1YPMH 2ZIQH 3UUZA 1DWEH 1AO5A 4CRDA 2H2ZA 2AMDA 4IMZA 4MPVA 1QHRB 5J4QA 1O3OA 3MH6A 2F9OA 3BTHE 4Y11E 1OPHB 1TPPA 4CBNA 3K9XB 1O39A 3U69H 3VPKA 1SL3A 4X6OA 1C2FA 1K22H 1ANDA 2BD5A 1AUTC 3RXLA 1UTNA 3DUXH 1YCPH 3DA9B 1FAXA 3S7HB 1GMDF 3DFJA 1UTOA 4GPGA 3IG6B 2RCEA 1AU8A 1NO9H 4D8NA 1MTVA 1BBRH 2C8XB 4BAOB 1YPLH 1YLNA 3GCNA 1XUGA 2CXVA 1P2JA 1TALA 1QZ8A 2ZFPH 2PGBB 1A3BH 1GI5A 1C5OH 3R3GB 1QCPA 1EZUC 1E35B 1Y5BT 2TIOA 1UTPA 1G3BA 2LPRA 1V2QT 1FQ3A 1C9TA 2A2XH 1KSNA 2ZGJA 1QRWA 4CHAB 3A87A 1HYLA 1S0RA 4FETA 4DW2U 4KTUA 2GDEH 3DD2H 1ANEA 1W0YH 3A85A 5FXLA 3SUFA 2FOAA 1HBTH 2PTCE 3T5FH 4I31A 5FHTA 1FONA 2OQ5A 3PLKA 1TRYA 3P95A 1TX8A 2PLXA 2A5KA 3KCGH 1UTJA 3FP7E 4YM9A 2CHAB 3PMAB 3UTUH 2EI8A 3ZZ8A 2AH4X 1G37A 1QL9A 4HI3A 2ZCLP 5FX5A 1S83A 1C4U2 1S6FA 1GHBF 3A89A 2FOHA 4ZHAA 2ANWA 2CN0H 4ZAEA 4B74A 5GJ4B 3P92A 1H1BA 1O2QA 2H9HA 1UJ1A 2Z9JA 1EFRD 1GHXH 3MH5A 4ZKNU 1NM6A 4XDEA 2R3UA 5C0UA 3BTME 1GBHA 3VFEA 5HMAA 2OUAA 3SU3A 2XOKD 1ZZZA 2A4QA 3E16B 3H09A 4JK5A 1ID5H 5EW2H 1V2PT 3RXPA 1Z8IB 3AASA 5FCRA 3Q3YA 2WV4A 1MKWK 4Q7ZA 1QIXB 2Y5GA 2PP6A 1W13U 1YM0A 4INHA 4O03A 4F4OC 2Z9KA 1EAUA 1DANH 3KQCA 4BOHA 2XRCA 2OK5A 3FZDA 1AFQB 2QXGA 5FPTA 1VITG 2FOBA 3RC6A 3SZNA 1T4VH 1NROH 1TRNA 1VCQA 4B6EA 1O33A 1V2VT 1P03A 2AGIX 2HLCA 2ZDLA 4DY7B 3NKKA 5CDFE 4I33A 3VXEH 3F2GA 6GCHG 1OWHA 1O3NA 1QRXA 1A7SA 1Y3XA 5HKKD 2F9NA 2W5EA 4OS6A 3NPSA 1W0ZU 1OWKA 1LVBA 5HIYA 2QAAA 3ZIAD 1ZHRA 3DSOA 3ESTA 1UVSH 3BTQE 3Q77A 1A61H 4A5TS 1LKBA 4K3JA 1E0FD 3EYDA 4BAMB 4X6MA 1O0DH 2W7SA 4ABHA 2WPLS 1O32A 1BB0B 8GCHG 2QF0A 3BF6H 4I86A 5DP7A 4Y8ZA 1VITF 2F9VA 2FLRH 3M3TA 4JYVH 1NU9A 1C5NH 2KCAA 2QV1A 3M7TA 1ZSLA 2BD9A 1MTNB 3NK8A 1TONA 1IQFA 3QTVH 4DT7B 3RMOH 2FTMA 1A5IA 1NRRH 3ZZAA 2QY0B 3RU4E 1NT1A 4AG1A 2JKHA 2BY8X 2R9PA 2VINA 1MQ6A 2BVSH 1CO7E 3TK6A 5B6LA 1PPGE 4YLQH 4GAWA 6GCHF 3SGAE 1A46H 1HB0B 1PFXC 5C2ZA 2B9LA 3HKJB 2ZDMA 1LDTT 2JETC 4ABIA 1JRTA 1ELVA 4XRNA 5DGJA 2VIDA 4ZROA 2ZFFH 5BPEA 3OYPA 2A1DB 1CT4E 5F6MA 2VIWA 4WWYA 3NZIA 1HCGA 3D65E 1LHEH 3VG8A 1SLVB 3ITIA 2STAE 1ELEE 4INLA 1CE5A 1MUEB 8GCHF 1TFXA 2FXRA 1BT7A 1NTPA 3PWBA 1O2TA 2EQNA 2WUBA 2FM2A 1C5MD 2ZPRA 4ASHA 3M5OA 4D7GA 2K8IA 3ATKA 1H4WA 3UNRA 1FIZA 1T4UH 1E37B 2W3IA 1ESBA 3I77A 1CT2E 4ISNA 2A4RA 1BMFD 1O3EA 3HGPA 1SQRA 3TGIE 5DG6A 1QA7A 1AZ8A 1GJBB 4LXBH 4U01A 4XSKU 2L6OA 1SGYE 3QN7A 2ANKH 3VXFH 2BDCA 3P70B 1TGTA 1N6XA 2FZZA 3SBKA 3RXBA 1VJ9U 1EJNA 1CVWH 1EAIA 1L1GA 5DP3A 1UW7A 4NA8A 3AAUA 3SNCA 3GY4A 4I32A 2VIVA 1MBQA 4FUHA 2O8WA 1ZPBA 3STJA 3ZZ9A 2XCFA 4DIHH 4OGXA 5FPSA 1MKXH 2KFWA 2YMSB 5H4IB 7GCHG 3OU0A 2V35A 1O2IA 1L1JA 2FIRH 1QJ6B 2HNTE 2OTVA 3TPIZ 1QB9A 1BMNH 2J34A 4BTIB 1IHTH 1C4Y2 4WMFA 2XBXA 3M3SA 1F5RA 2UUKB 3BTKE 3PRBA 1UK4A 1UCYK 3PO1C 1GMCF 1NESE 1QL7A 3ZVDA 1TYNA 2WYGA 1G3EA 1DWDH 3A84A 1HJAC 1TBZH 1M9UA 1UVUH 2V3OH 3KEEA 4Y76A 4K8YA 1CT0E 3Q3KA 3VB5A 3N7DA 2VVVA 2F91A 2HLDD 3ZVBA 2F9BH 1ZGIA 2BY5X 1BTYA 4ABJA 1CU1A 2GD4B 3A86A 2ZHWH 1GI6A 1O3JA 1VGCC 1MABB 3TJUA 2ZHFH 1GBFA 1XVMA 2G52A 4JMYA 3GCOA 3RC4A 1O2ZA 1TOMH 1MZAA 4AORA 4RT1A 1KMHB 1MD7A 1OXGA 5EQRA 3TIUA 6LPRA 2GTBA 1SGTA 2Z7FE 1FN8A 1O3DA 3SI3H 5DP6A 2O8MA 1DICA 2F9PA 3GISB 2W6JD 5GWZA 1P57B 1O2GH 4TY6A 1XMNB 4MVNA 2DE8A 3SW2B 2XC5A 3U9AH 1GJ6A 2A7CA 3B9FH 2VVUA 3N99A 1GDUA 1ELGA 4B2CA 1VITH 2BDIA 4HTCH 2G5NA 1MKXK 1Y5AT 1NRSH 1OYTH 2BVRH 2ZFTA 4M9FA 1EB2A 2NU4E 1D6WA 1P2NA 1BBRE 1HAGE 2P8OC 3UWJH 1L4ZA 3FZZA 2VIQA 3B23B 3SU6A 1A5GH 1YY3A 4Y79A 1AKSA 2TGPZ 4VGCB 2SGDE 1WCZA 4P00A 1BTWA 1TBRH 1O2HA 4TPIZ 1C1TA 4MNXA 1KXDA 1NY22 1LVYA 4ZHMU 4NIVA 2FTLE 3A82A 1O2RA 1CGHA 4Q7YA 4IN2A 3V7TA 4B6FA 2BDAA 1O2JA 4WY3A 1ELFA 3A7VA 2PSYA 1FLEE 4K8BA 4B2BA 4KTCA 4Q7XA 4DGJA 1EP6A 2BZAA 3PYHA 5ESBA 3RMMH 3QDZB 1TE0A 2GGVB 2GJGA 1JMOH 2KR7A 4J1YA 3AAVA 1E34B 2ASUB 2FESH 3LJJA 3F1SB 3RXGA 1GGDB 2XBVA 1C5SA 5DP8A 2D1JA 4NZQA 1HIAA 1J15A 1P09A 4NA9H 3E91A 1Z1IA 2UUJB 1D3QB 3LDXH 3LGYA 5EJLA 3OTPA 2HGTH 2GCTB 2A32A 3E0NB 4D9RA 1F5KU 2J5UA 1F7ZA 5C1YA 2TBSA 1H9LB 1W8BH 3F68H 3PB1E 4NIXA 1P2MA 2R0LA 4IN1A 4M7GA 1L0ZA 1C2KA 1GPZA 1ZTKA 1GBAA 3A7YA 4ZKRU 2VJ1A 1WYKA 1D9IA 1GDNA 1ZJDA 3ATWA 1GBKA 3F9GA 1AGJA 1F0SA 2Y6TA 1Z8JB 1A0LA 2Z6BD 3LGVA 1UO6A 2BXUH 3Q00A 2KAIA 3E90B 3ZZ3A 2BD2A 1UVPA 2FP7B 1TGSZ 3DSGA 1IQHA 4X8SH 3AW0A 2P93A 1HXFH 4F55A 2PTNA 3PV2A 1WQVH 4B76A 2ZGHA 3BEFB 2AYWA 3SU0A 5L2YH 2BLQA 3SO3A 2FI5E 3VEQB 4RKJB 2C8YB 1OSSA 4X1QU 1AKSB 3ZZ6A 3TGJE 4NFFA 4TT3D 1LMWB 1SSXA 1HUTH 5EPNA 3BG8A 1WU1A 2GMTC 4NA7A 2ZWLH 2ZTZA 2YNBA 2XBWA 2ZHQH 1AFEH 1JXPA 3ODDA 3KNXA 4P02A 2FEQH 2FI3E 2ZU2A 1MAXA 4IW4E 1GI3A 1GBTA 1ZLRA 2ODQA 3SJ8A 2Z3DA 1LTOA 5DP5A 2HVXA 1ZMLA 1SLXB 4NFEA 4CRCA 3BSQA 1C1NA 2CJIA 2QN5T 2PW8H 2G4UA 1PQAA 1ETSH 4Q63A 1J16A 2Y7XA 5DPAA 1HIAB 3S9AA 1ZTLA 4AFUA 3SV9A 2Z3EA 4DVAU 1Q3XA 3BTGE 1FY3A 2O8TA 2VGCC 1O3FA 1YPEH 2QF3A 4Y7BA 5HXFA 4ZKOU 2AS9A 5L30H 1LHGH 4X1RU 1P11E 2H5DA 1LPGB 2F9UA 2SGEE 2UWPA 5F8ZA 3SQEE 5JB9S 4IGDA 1O31A 5DK1A 1D3TB 1GDQA 1V3XA 4MPUA 1O5AB 1SR5C 5HIZA 2FI4E 1TRMA 1UTLM 4R0IA 2Z9IA 2A31A 3SU5A 5C67A 1MAYA 3RXAA 1DXPA 1ZGVA 2KAIB 3L6PA 4Q2KA 6ESTA 3RMLH 4ISLA 1FN6A 1S5SA 1SHHB 4OM9A 3LT3A 1P9UA 3F2HA 3MNCA 2I6QA 4BAQB 3NWUA 3LC3A 2ZG0H 1THRH 3PTBA 2FX4A 1D3DB 5EIYA 1ZPZA 1QJ1B 1IQNA 2CF9H 3EA7A 1BCUH 2AEIH 4UDWH 1J17T 1RTKA 4Y8YA 1KXFA 1GHAG 3A7XA 4DG4A 1T32A 3P8OA 1FX0B 3RXFA 4YESB 1V2RT 1BRAA 2FS9A 3AVZA 3OY5U 1DLKB 1K1OA 1YBWA 1MTUA 2H6MA 5LH8A 4O3TA 2QE7D 4MQAA 4AZ2B 1GMHG 2FX6A 3K6YA 2GT8A 3OX7U 2GKVE 1EPTC 2DUCA 4I7YH 4OS2A 3KF2A 1GBBA 2XC4A 1C1MA 4JZIA 1COWD 2V3MA 3RXRA 2P3UB 1ZRBA 1AWFH 4X2WA 1G3CA 1GI0A 4ISIH 2O9QA 3A80A 3A8CA 1MZDA 4BXSA 2BQ6B 2C8ZB 9LPRA 1AB9C 1NRNH 1XXFA 4ZKSU 4K1EA 3F9HA 1E1RD 1SKYE 1GHAF 3RXMA 4AYYB 2ZTXA 4GCHG 5EJ1A 2GV6A 3UB0A 1PQ7A 2HWLB 1MD8A 1XKAC 3SZEA 1O2LA 2AIQA 3UOPA 1SQOA 1HAZB 1FI8A 2KCOA 3K2UA 3MO6A 3FVFB 3G01A 1GMHF 4NG9H 1O5GH 2WV5A 2JETB 2HVYB 1U6QA 1MU8B 1FAKH 3U98H 2KZ4A 1TGNA 1Z7KA 2ZHEH 1LQDB 4ACAA 2OC0A 4AN7A 2VWMA 2OD3B 4FXGH 1O2OA 2C93B 3SNBA 2IPQX 1AIXH 1EATA 4CRGA 1GI8B 1DT2A 1OP8A 2A7JA 1OHHD 2FLBH 1PPCE 5GCHG 3W95A 3KN2A 2B0FA 1UK2A 3MQKC 3F9FA 3CP7A 9ESTA 1AMHA 4ACBA 2TGDA 2D26C 3LOXA 2ZGBH 2UUYA 2WZQA 3GYMA 4GCHF 3N7OA 1O3LA 1SOZA 1AY6H 3TVJB 1PQ5A 4IC6A 1V2TT 1W12U 4RN6A 1S6HA 2GX4A 1K1PA 2Z9LA 1P8VC 1WSSH 2J4IA 3MU0A 5GPIB 5A8YA 1B5GH 1D4PB 2BYAX 4X6NA 4Z6AH 3RC5A 1F2SE 3M7QA 2BOHB 3RLYH 5TJXA 3M5LA 4J2YB 1AHTH 3SJ9A 4WH6A 1W7XH 4BAHB 1O2MA 1RIWC 1XUIA 3RXJA 4ASUD 1YCPK 1O37A 2G81E 3U28C 5DP9A 1WUNH 2UUFB 1SGIB 2JH6D 2XWBI 4YOJA 1EOLA 2WSSD 3RXOA 3T26A 2EA3A 1BBRK 1YPGH 2FOMB 2QF4A 5GCHF 1SOTA 3FOAA 2JIZD 4OGYA 2R3YA 2BB4A 2ZU4A 1MTSA 1C5XB 4HGCA 4BANB 1SLWB 2DE9A 1GCTC 3P8FA 4E06H 1AQ7A 5JDUB 1HV7A 1ARBA 4D76A 4AGKA 1GHVH 3TH4H 3UQOA 2Z3CA 3PO1B 1L4DA 4NWKA 3VB3A 1J8AA 3L33A 4WMEA 1DM4B 4K1SA 4KP0A 2PKSB 1QRZA 1DXWA 1HJAB 3LGWA 2ZCHP 1P2OA 2ZECA 1C5LH 4ZXXH 1BHXB 3RXUA 4AG2A 2XNDD 2XWAA 5KEDA 3GDSA 3GY8A 1GVLA 1QJ7B 1YPHE 2WPIS 3GYLB 1EKBB 5EU8A 2F43B 3A88A 3PMBB 4HZHA 5EGMA 1RS0A 1VGCB 2B8OH 1TMBH 4Q80A 3TJNA 8LPRA 3BTFE 2RG3A 2LP6A 1L2EA 3NXPA 1XUKA 1GBMA 4DIIH 1B7XB 3ATIA 3A81A 4K60A 4IMQA 1YKTA 3GCTG 2GV7A 1F0RA 4AB9A 1W2KH 5DSFA 5EQQA 5JBTA 2JDID 2KCYA 2PGQB 5E0GA 4FU7A 3TK9A 1CQQA 2J94A 1UMAH 2AFQB 2ZCKP 1SGFG 4UFEH 2EEKA 2QXHA 2G51A 1GHYH 4UFDH 1OS8A 1QQUA 1Y3WA 1IQJA 1CHOG 4X8TH 2IPHA 1XX9A 1BTUA 5FAHA 4I8LA 1GJDB 1WDIA 3SU1A 1QTFA 2G00A 2OCVB 4JYUH 1L1NA 4KGAA 4MPWA 4Z0KA 1ESAA 3VB7A 4ISHH 1SHYA 2P8OB 1O2XA 4DURA 1GBDA 1EP5A 1EAWA 3GY6A 2ZQ2A 5C1XA 4KTSA 1ZTJA 5A0CA 2ALVA 1AWHB 1SMFE 4XOJA 2YMSD 2SFAA 2GCHG 3OEED 1UTKA 1GJ5H 5ABWA 4QT8C 1SFIA 3ELAH 4TSFD 3OSYA 3PV4A 1KXEA 2ESTE 1DY9A 3PLPA 3GCTF 4LZ1H 1W0KD 1D3PB 2GDDA 1W7GH 3W1EA 1HPGA 3QLPH 2HRVA 2ANYA 4CRFA 3CS0A 1K1NA 3CENA 1T8OA 4RSPA 1DSUA 1SFQB 1Y5UT 3LGIA 4I8JA 1WOFA 1G30B 1CHOF 5JPMH 2WPKS 1W11U 2W26A 2M2AA 1DOJA 1ACBE 1S84A 1ANCA 1AZZA 1C5RA 1EB1H 3EQ0H 5CE1A 1IOEA 4JZEH 3RM2H 1OP0A 5EQSA 2J98A 3UNSA 3ATMA 1Q31A 1C5QA 3UWIA 2F4LA 1JIRA 2PWXA 2B7DH 5E8EH 1HLTH 3RDZA 3RMNH 3UFAA 3CNRA 3LGUA 3ZZ5A 2CV3A 2GCHF 2FYRA 3V12A 1ELAA 2IN2A 4UD9H 1P05A 2ZPSA 1PQ8A 4NSVA 1BRBE 1EJMA 1C2MA 1O2WA 1IQIA 1LHFH 2BLWA 5CHAC 1C2JA 1EXFA 4O3UA 1KLIH 2ZA5A 2IOTA 3LH1A 1D6RA 1TGCA 2Y5FA 2ZEBA 4YO9A 5HYOA 1ORFA 1CHGA 5TCCA 2ZFQH 3V0XA 3GDVA 4K5ZA 1CA8B 1C5PA 2NWNA 3DCLA 5HM9A 1O2KA 4ZH8A 3BEIB 4FOUC 2RA0A 1AE5A 1S6LA 4AGJA 4OS1A 2QXIA 3QGNB 1V2JT 4JYTA 1Y3VA 3TJVA 2Q6DA 1H8DH 3SU2A 2ZI2H 4B71A 2GMTB 3GY5A 1T8NA 3QO6A 4B75A 2V6NA 2FO9A 5DN6D 3EAJA 1NS3A 2WPMS 2HALA 1HRTH 3FN8A 1X7AC 5E0HA 5PTPA 1SB1H 3GY2A 4D9QA 1A2CH 4AFSA 3NRLA 2H9TH 1QFKH 2XNIA 3HATH 3I78A 3SV2H 5F03A 3O8DA 1GWAA 1O3HA 3MOCA 3P6ZB 1DSTA 7GCHF 1JWTA 1TMUH 1RTLA 1OWJA 1EPTA 1OKXA 4Y7AA 1ZRKA 1ZPCA 2VGCB 5EODA 3R0FA 4HG6A 1UVTH 1FMGA 2THFB 2WINI 2ANMH 2BY9X 1O5EH 2J98B 2BLVA 3MWIU 2BTCE 4AX9H 3GY7A 3RXVA 2PFEA 3DT0H 1HAVA 1Q2WA 4A1XA 3HK3B 2HNTF 2FWWA 1G9IE 2ZHDA 3A8BA 1NBME 3SUGA 1VZQH 2BVXH 2A45B 1UHBA 1HJ8A 1GBEA 1K28D 1GL0E 3TK5A 3H7OA 3PTNA 3UAIC 1P10A 5C5OA 2VIOA 1GJ9B 1SG8B 1HAYB 1O3KA 2OLGA 3SJIA 1P2IA 3KQBA 3HK6B 5E0JA 2BHGA 3MYWA 4RKOB 4NZLA 1O2NA 5CHBA 1PYTC 1QURH 3TJOA 2WHXA 2XYAA 4X2XA 3V13A 1G3DA 1OYQA 1G36A 1OWEA 1PPBH 1P02A 3KQ5A 1JIMA 3P8NA 4I8HA 3F0OA 4FUBA 2ZDAH 1O35A 4OS5A 4DT4A 2ZU1A 5I46H 3NCLA 4XE4A 1T8LA 3RXCA 1FZZA 4XBCA 1C1OA 3E8LA 5T6FA 1WTHD 1YPHC 2SNVA 2J95A 3EA8A 1BA8B 3ZVEA 1DE7H 3AW1A 1V6DA 3JZ2B 3BTEE 5BRRE 1VCPA 3TH3H 3T62A 2KCPA 1BTZA 2BZ6H 1N6YA 1V2NT 5LPEA 1ETTH 1TIOA 3CS7A 1FPHH 1PPZA 4FU9A 1OOKB 3PWCA 4WMDA 2VWOA 5HM2A 5TCAA 2WV9A 1EPTB 2J2UA 2ZP0H 4DOQA 3GY3A 2QA9E 4CR9A 3HPTB 3Q76A 2BQWB 3E0PB 2A4OA 2PUQH 4INKA 1QB6A 1SGPE 1JBUH 1HAVB 1T7CA 1XUJA 1O30A 1AB9B 1OWIA 2XTTB 3KHVA 5SGAE 4Y0YE 2ZF0H 3VGCC 1LCYA 1C1RA 6CHAC 5AHGH 3ZZ4A 1WAYB 3QZRA 1LVOA 1UHBB 4X1NU 1IQGA 3DSPA 1PPHE 1TNKA 1WQSA 1Y3YA 3F0PA 1G2LA 1LHDH 1VJAU 5I25A 1GCDA 1ELCA 4DJZB 4SGBE 1A5HA 1CA0C 1GI2A 1EQ9A 2BDYA 4CH2B 1H8HD 4WVPE 1KY9A 2VBCA 4Y10E 3BIUH 1AUJA 5IDKA 2P59A 1HAPH 3SORA 3SV7A 3DHKH 2VH0A 4K2YA 3S9BA 2WYJA 2WUCA 1O3PB 2PV9B 4XBDA 3FAOA 1Z8RA 2G5VA 2C4FH 3PRDA 3WWBA 1W14U 3MNSA 5L2ZH 3ZZBA 5A8ZA 2FMJA 4BTUB 2FPZA 1GJ4H 1C5ZB 4GUXA 2A2QH 4Z1MD 1NN6A 1C4V2 1C1PA 4PROA 1PPFE 1LVMA 2WPJS 1RXPA 1TNIA 1HAOH 5EXNA 1ZR0A 2BDBA 1C5WB 2OXSA 4B2AA 8KME2 2AIPA 5ESTE 1GBCA 4MG3A 1C1UH 1AVXA 2VWNA 1RIWB 1P0SH 2Q6GA 2WPDD 3WY8A 4GVUA 1EUFA 1XXDA 4TWYA 1DWCH 4CH8B 3M61U 3MU1A 3BTDE 4LZ4B 3A7WA 4NIYA 7KMEH 3FP8E 2HNTC 3UR6A 1GG6C 1FV9A 1B0EA 1MQ5A 1QBOA 4FUFA 2PKAA 4MNYA 2OBOA 3I29A 3FP6E 4TY7A 1GCTB 2CK3D 1NFWA 1K9OE 1H8IH 4BNRA 4XFQA 3O8CA 5JBCS 1YF4A 2BLOA 1QA0A 5T6DA 4D7FA 1KXAA 3AK5A 3ATLA 1P06A 3RP2A 3SI4H 4ZMAH 1LPZB 2STBE 3PMHB 2ODYB 3U1JB 1HAHH 2BM2A 4Y71A 1LKAA 1C2GA 2BY6X 5L6NH 3EDXB 3MTYA 1SVPA 3E1XB 4IC5A 4A92A 2HPQH 1UCYE 5A2MH 1G2MA 1C5UA 1ZOMA 5AVDA 1O3GA 1QGFA 1O3AA 2A7HA 1VCWA 1SBWA 2R2WU 4X8VH 2OC1A 2G55A 4Y0ZE 5EW1H 1IQEA 1CBWC 1K0HA 3UQVA 1GJAB 4H6SB 1YLCA 4BXWA 1ABJH 3MFJA 3UIRA 3B8JA 5HGGA 1V2WT 2F83A 1A0HB 3ZVCA 3EE0B 3VB6A 3VB4A 1NFYA 2C3SA 1P9SA 3RXTA 4JZDH 4GHTA 5A8XA 4X8UH 1ELBA 1C2EA 1V2LT 1Z1JA 1RGQA 1YPKH 3M37A 3MHWU 5ETXA 4FUCA 1HXEH 4X0WU 4E7NA 1SGDE 2JJ1D 1KLTA 1LHCH 2PKAB 1DS2E 4ABFA 4ISOA 2BDHA 3P17H 2XC0A 1TPSA 7LPRA 3GCHC 1SC8U 1BRUP 4Y6DA 2ZQ1A 4TYDA 1ELTA 1P3EA 1RTFB 2JH0D 2FOFA 1GBIA 2Q1JA 4I8GA 3RXIA 3TITA 1V2MT 2VNTA 1TNGA 4U2WA 2CGAA 3LIWA 1PPEE 2VU8E 1TWXB 4UFGH 3C1KA 4FVBA 4H6TA 3IWMA 2ZFSA 1MKWH 1SGCA 3A7ZA 1GHBG 1LO6A 1KYNA 1GL1A 5DJ7A 1TA6A 2H1UA 4FUIA 1UTQA 4B1TA 1UTMA 1BRCE 3LH3A 1GJ8B 3N7EA 2SGAA 3K6ZA 3PLBA 4CRBA 1O3MA 2V0BA 3STIA 5A0AE 1SQAA 2P3FH 4H42U 3M35A 1ZHPA 3LONA 4ZCNA 4ABBA 2ZO3H 1DLEA 5A0BA 2GP9B 1ZSKA 3OFND 1RFNA 1DITH 2NU1E 1FIWA 2TPIZ 4X2YA 4UEHH 5C3NA 3SHCH 1O5BB 2RDLA 1DUEA 2ZDKA 3A8DA 3RXSA 2OINA 3D23A 2BD3A 4B73A 3WW7A 1EOJA 2LNCA 2BDGA 4WXVA 2R2MB 1F0TA 1JRSA 2RFKC 1CGIE 3A83A 1ZSJA 3PMJA 4AC9A 4ABDA 2JH5D 3KIDU 3KGPA 1K1MA 1C2LA 2VB0A 3U8RH 2H9EH 4RT0A 1NRPH 1A0JA 1N8OC 2QYIA 5CHAB 3GOVB 1O5DH 2BD7A 1O3IA 3U1IB 1BMAA 8ESTE 1SGRE 3TLOA 1GJCB 3OEHD 1O3BA 1EZXC 1TBQH 3BG4C 3EA9A 2AGEX 3O8BA 2ALPA 4MLFB 5LPFA 1C5TA 1ZMNA 3URDA 3H7TA 2BD4A 3SUDA 4UONA 2NU0E 2LELA 2TGTA 2V7QD 3M36A 2QF5A 3SGBE 2KM0A 2VVCA 3KL6A 2TRMA
chains in the Genus database with same CATH topology
2FOEA 1UK3A 1ZHMA 1B0FA 2ZGCA 2ZTYA 4X1SU 1P2QA 1JOUB 4IBLH 2P94A 1KXBA 1AD8H 3OTJE 1KTSB 1FJSA 1PJPA 5EXMA 1PYTD 2I6SA 2H5CA 1G32B 1BHXF 7ESTE 1ZMJA 3H5CB 4Y8XA 3ENSB 5B6OA 4AFQA 1YCPM 3KQEA 1SGQE 1O2UA 5JBAS 3A7TA 1E38B 2Z9GA 2OBQA 2P95A 3C27B 4YZUA 4LK4A 3QK1A 3UNQA 1QL8A 2SNWA 1SGFA 4JK6A 1BJUA 2G4TA 2FODA 3TNTA 2J92A 2GZ7A 3QGJA 1IAUA 1Z6EA 4SGAE 5K0HA 1HJ9A 4U30A 1TPAE 4O97A 1T31A 4GHQA 3BTWE 1SI5H 1EJAA 1P01A 3PM3A 1MCTA 3SNEA 1WV7H 3ZV8A 3A8AA 2GVFA 5E2OA 3U8TH 3SHAH 4X1PU 4R8TB 1KTTB 1RRKA 2YNAA 3M3VA 1O3CA 1QY6A 3M5MA 1F0UA 2B5TB 2F3CE 2W3KA 3RU4D 1NU7B 3D49H 3M7UA 2OC8A 3ZZCA 5C5NA 2ZDNA 5GIBA 3RXEA 3SN8A 1O34A 4YT7H 3MU5A 4GLYA 1TNLA 1IQLA 2A5IA 2ZNKH 1GI4A 3RLWH 3M5NA 1IQKA 1MMJN 2ILNA 5E2PA 2O8LA 3HKIB 2NU3E 4I8KA 4BTTB 1UCYH 4JZ1A 3TNSA 4CHAC 2C8WB 1XUFA 1C1SA 4YLUA 1V2KT 1MBMA 1TPOA 2UWOA 1GVZA 3QX5H 1EZQA 4NWLA 1KXCA 1C1WH 1OWDA 1MU6B 2V3HH 1FY4A 4KKDA 4WF8A 5A09A 1TLDA 3LGTA 1YGCH 4UE7H 1ZJKA 4K1TA 2ULLA 1C9PA 2ZDVH 1QNJA 3LPRA 2FYQA 3K65B 1KDQA 3UOUA 1J14A 3FFGA 1A3EH 2CHAC 3QUMP 2BMGB 2K1QA 4NSYA 2WPHS 1AI8H 1GMCG 1S82A 1QR3E 3ZZDA 3L3TA 2J38A 3PROA 1H9HE 4TPYA 3SQHE 1E36B 3VGCB 1HFDA 6CHAB 1FY8E 1TABE 4ZXYH 1EASA 1P12E 1NC6A 2D2DA 4FU8A 2QC2A 1TA2A 1TB6H 4UFFH 1TNJA 3FANA 2Y82A 2VH6A 4ABGA 5DO4H 1TNHA 3SNDA 1CA0B 1FNIA 1EAXA 3RM0H 1BDAA 1OX1A 3MH4A 2Y81A 3JZ1B 1SGEE 1HNEE 1W10U 1V2UT 4THNH 1CGJE 1Y3UA 4ZUHA 1BMLA 1EX3A 4TWWA 1S85A 4CREA 1O2VA 1AFQC 1BMMH 3T27A 1O2YA 5T3HA 2QIQA 2BOKA 1J9CH 1XUHA 1MH0A 1A4WH 1S0QA 1DDJA 2W7UA 2Y80A 5JYIA 2PKSC 1H9IE 1EZSC 2ZKSA 1NZQH 1IQMA 1BTPA 1YC0A 2NU2E 4FUDA 4OS7A 1GJ7B 3RU4T 2VIPA 1BJVA 2XXLA 3MU8A 3O8RA 2ZU3A 3W94A 3ZV9A 3BEUA 1MTWA 4LOYH 5JB8S 1BITA 5FPYA 1KDQB 3D62A 2Z94A 1RJXB 3MU4A 1SPJA 1YP9A 1YYY1 1DPOA 3SV8A 4E7RG 1ARCA 3MNXA 1K1IA 2C90B 3EGKH 5JBBS 5FCKA 4A7IB 2O8UA 2OC7A 1AVGH 4ESTE 2QXJA 1N1LA 5GDSH 1T8MA 1LPKB 3HGNA 1GG6B 3ZZ7A 5C20A 1MTNC 1FDPA 5LPRA 2P16A 5C1UA 3SJKA 5CMXH 3S0NA 1AN1E 5EOKA 2XBYA 4YTAA 2P3TB 1K1JA 4YOIA 1XVOA 3T28A 1QB1A 1Z71A 4X6PA 5AFYH 2BX3A 4YOGA 4JZFH 1OP2A 1K2I1 3S69A 1NFXA 2G8TA 3GICB 4K69A 2CF8H 4MDSA 1QQ4A 2ZPQA 1QBVH 3URCA 3S7KB 3SGQE 3QWCH 4ZHLU 4NCYA 1TOCB 1IHSH 4X2VA 1FY1A 1K21H 1V2ST 1GVKB 4WJG2 3GDUA 4GSOA 2PUXB 5FBIA 5IYTA 1ANBA 5DKMA 5F8XA 2FOCA 1C2HA 4WXIA 5EPYA 3TH2H 1A1RA 2A5AA 4WH8A 2BD8A 1C2IA 1FXYA 1W3CA 1Y8TA 1CBWB 2EI6A 4AOQA 3TGKE 5LGOA 1SQTA 3RXHA 3U8OH 1MCVA 1ZYOA 5J4SA 1Y59T 2AMQA 2TGAA 4FVDA 1O5FH 1Z6JH 2BY7X 3T2NA 5AFZH 1V2OT 2ZGXH 2PHBA 1ESTA 1VR1H 1YLDA 5EXLA 4CRAA 1O2SA 1P2KA 4AYVB 1GHZA 1XKBC 4AB8A 1KIGH 4ABAA 5FX6A 2Y5HA 3F6UH 3SV6A 1TAWA 3E3TA 5FBEA 3LC5A 1C1QA 5G4BA 1BQYA 2HPPH 1DWBH 1TGBA 1P3CA 2QCYA 3GCHB 3RXDA 1KLJH 3RXQA 3LJOA 3MO9A 3ZYDA 1YPJH 1TQ7B 2HOBA 5DP4A 1GBJA 4F49A 1NPMA 3UPEA 4XBBA 4ABEA 3MI4A 2Q6FA 2D8WA 3E6PH 4MNWA 4YT6H 1TQ0B 2PSXA 4MPXA 2YOLA 1O2PA 3BTTE 1BOQA 1TX6A 4O9VA 3T29A 1NRQH 1THSH 4FUGA 1ELDE 3F9EA 2SGQE 2QGRA 2BX4A 3MO3A 3V3MA 2GZ8A 2EI7A 1WTGH 2M5TA 4U32A 3TU7H 3SUEA 3S9CA 1HGTH 4BAKB 1TMTH 3RUOA 5AF9H 3OY6U 2OP9A 2Y7ZA 3SOSA 4A1TA 1C5VA 3ZVAA 3QZQA 3SU4A 3SJOA 4IS5A 3T25A 2GZ9A 4JCNA 5T6GA 3ZYEA 4KELA 4CR5A 3LU9B 3LKWA 1DUAA 1XM1A 4E05H 1HAXB 1F5LA 1DVAH 2ZC9H 1FY5A 1THPB 1ETRH 1C5YB 3ZVGA 2R0KA 1K1LA 2BQ7B 3UR9A 5GXPA 2RA3A 2ZZUH 1N8OB 3Q3XA 1GHWH 1SGNE 4NIWA 5F8TA 1DFPA 1FPCH 4HFPB 4NGAH 1DX5M 2OQUA 1HAIH 3MNBA 1BIOA 3RXKA 5EG4A 3UY9A 3DFLA 1BUIA 3BG4B 3UREA 2PR3A 2ODPA 2J9NA 1S81A 2VWLA 1DY8A 1LQEA 3QTOH 3BV9B 4A1VA 1C2DA 2XW9A 1GBLA 1O36A 2ZFRH 1BTHH 2XCNA 1INCA 2AGGX 4VGCC 1O38A 2A4GA 3BN9A 2CMYA 2BXTH 2A0QB 4FUEA 4MNVA 1FUJA 2FDAA 1RD3B 4AFZA 2SGFE 1BTXA 2FOGA 4CBOA 1BZXE 1CSOE 2UWLA 3KQDA 4FUJA 1GI1A 3MH7A 1AVWA 3ZVFA 2AERH 1GI7B 4MTBA 1P04A 1GMDG 2AMPA 2GT7A 1C1VH 4H4FA 4DCDA 1GI9B 2EC9H 4OS4A 1GGDC 1UVOA 1SLUB 3MMGA 3NUMA 2FS8A 1WBGB 3P8GA 1TX7A 3SNAA 1O5CB 1F92A 1NFUA 3BIVH 2GCTC 1HDTH 2IJOB 2ZU5A 1ABIH 2SGPE 1QBNA 1Z8GA 3IITA 3ODFA 1AE8H 5K7RA 1YPMH 2ZIQH 3UUZA 1DWEH 1AO5A 4CRDA 2H2ZA 2AMDA 4IMZA 4MPVA 1QHRB 5J4QA 1O3OA 3MH6A 2F9OA 3BTHE 4Y11E 1OPHB 1TPPA 4CBNA 3K9XB 1O39A 3U69H 3VPKA 1SL3A 4X6OA 1C2FA 1K22H 1ANDA 2BD5A 1AUTC 3RXLA 1UTNA 3DUXH 1YCPH 3DA9B 1FAXA 3S7HB 1GMDF 3DFJA 1UTOA 4GPGA 3IG6B 2RCEA 1AU8A 1NO9H 4D8NA 1MTVA 1BBRH 2C8XB 4BAOB 1YPLH 3GCNA 1XUGA 2CXVA 1P2JA 1TALA 2ZFPH 2PGBB 1A3BH 1GI5A 1C5OH 3R3GB 1QCPA 1EZUC 1E35B 1Y5BT 2TIOA 1UTPA 1G3BA 2LPRA 1V2QT 1FQ3A 1C9TA 2A2XH 1KSNA 2ZGJA 1QRWA 4CHAB 3A87A 1HYLA 1S0RA 4DW2U 4KTUA 2GDEH 3DD2H 1ANEA 1W0YH 3A85A 5FXLA 3SUFA 2FOAA 1HBTH 2PTCE 3T5FH 4I31A 5FHTA 1FONA 2OQ5A 3PLKA 1TRYA 3P95A 1TX8A 2PLXA 2A5KA 3KCGH 1UTJA 3FP7E 4YM9A 2CHAB 3PMAB 3UTUH 2EI8A 3ZZ8A 2AH4X 1G37A 1QL9A 4HI3A 2ZCLP 5FX5A 1S83A 1C4U2 1S6FA 1GHBF 3A89A 2FOHA 4ZHAA 2ANWA 2CN0H 4ZAEA 4B74A 5GJ4B 3P92A 1H1BA 1O2QA 2H9HA 1UJ1A 2Z9JA 1GHXH 3MH5A 4ZKNU 1NM6A 4XDEA 2R3UA 3BTME 1GBHA 3VFEA 5HMAA 2OUAA 3SU3A 1ZZZA 2A4QA 3E16B 4JK5A 1ID5H 5EW2H 1V2PT 3RXPA 1Z8IB 3AASA 5FCRA 3Q3YA 2WV4A 1MKWK 4Q7ZA 1QIXB 2Y5GA 1W13U 1YM0A 4INHA 4O03A 4F4OC 2Z9KA 1EAUA 1DANH 3KQCA 4BOHA 2XRCA 3FZDA 1AFQB 2QXGA 5FPTA 1VITG 2FOBA 3RC6A 3SZNA 1T4VH 1NROH 1TRNA 1VCQA 1O33A 1V2VT 1P03A 2AGIX 2HLCA 2ZDLA 4DY7B 3NKKA 4I33A 3VXEH 6GCHG 1OWHA 1O3NA 1QRXA 1A7SA 1Y3XA 2F9NA 2W5EA 4OS6A 3NPSA 1W0ZU 1OWKA 1LVBA 2QAAA 1ZHRA 3ESTA 1UVSH 3BTQE 3Q77A 1A61H 4A5TS 1LKBA 4K3JA 1E0FD 3EYDA 4BAMB 4X6MA 1O0DH 2W7SA 4ABHA 2WPLS 1O32A 1BB0B 8GCHG 2QF0A 3BF6H 5DP7A 4Y8ZA 1VITF 2F9VA 2FLRH 3M3TA 4JYVH 1NU9A 1C5NH 2QV1A 3M7TA 1ZSLA 2BD9A 1MTNB 3NK8A 1TONA 1IQFA 3QTVH 4DT7B 3RMOH 2FTMA 1A5IA 1NRRH 3ZZAA 2QY0B 3RU4E 1NT1A 4AG1A 2JKHA 2BY8X 2R9PA 2VINA 1MQ6A 2BVSH 1CO7E 3TK6A 1PPGE 4YLQH 4GAWA 6GCHF 3SGAE 1A46H 1HB0B 1PFXC 5C2ZA 2B9LA 3HKJB 2ZDMA 1LDTT 2JETC 4ABIA 1JRTA 1ELVA 5DGJA 4ZROA 2VIDA 2ZFFH 5BPEA 3OYPA 2A1DB 1CT4E 5F6MA 2VIWA 4WWYA 3NZIA 1HCGA 3D65E 1LHEH 1SLVB 3ITIA 2STAE 1ELEE 4INLA 1CE5A 1MUEB 8GCHF 1TFXA 2FXRA 1BT7A 1NTPA 3PWBA 1O2TA 2WUBA 2FM2A 1C5MD 2ZPRA 4ASHA 3M5OA 4D7GA 3ATKA 1H4WA 3UNRA 1FIZA 1T4UH 1E37B 2W3IA 1ESBA 3I77A 1CT2E 4ISNA 2A4RA 1O3EA 3HGPA 3TGIE 5DG6A 1QA7A 1AZ8A 1GJBB 4LXBH 4U01A 4XSKU 1SGYE 3QN7A 2ANKH 3VXFH 2BDCA 3P70B 1TGTA 1N6XA 2FZZA 3SBKA 3RXBA 1VJ9U 1EJNA 1CVWH 1EAIA 1L1GA 5DP3A 4NA8A 3AAUA 3SNCA 3GY4A 4I32A 2VIVA 1MBQA 4FUHA 2O8WA 1ZPBA 3STJA 3ZZ9A 2XCFA 4DIHH 4OGXA 5FPSA 1MKXH 7GCHG 5H4IB 3OU0A 2V35A 1O2IA 1L1JA 2FIRH 1QJ6B 2HNTE 2OTVA 3TPIZ 1QB9A 1BMNH 2J34A 4BTIB 1IHTH 1C4Y2 4WMFA 2XBXA 3M3SA 1F5RA 2UUKB 3BTKE 1UK4A 1UCYK 3PO1C 1GMCF 1NESE 1QL7A 3ZVDA 1TYNA 2WYGA 1G3EA 1DWDH 3A84A 1HJAC 1TBZH 1M9UA 1UVUH 2V3OH 3KEEA 4Y76A 4K8YA 1CT0E 3Q3KA 3VB5A 2VVVA 2F91A 3ZVBA 2F9BH 1ZGIA 2BY5X 1BTYA 4ABJA 1CU1A 2GD4B 3A86A 2ZHWH 1GI6A 1O3JA 1VGCC 3TJUA 2ZHFH 1GBFA 1XVMA 2G52A 4JMYA 3GCOA 3RC4A 1O2ZA 1TOMH 1MZAA 4AORA 1MD7A 1OXGA 5EQRA 3TIUA 6LPRA 2GTBA 1SGTA 2Z7FE 1FN8A 1O3DA 3SI3H 5DP6A 2O8MA 1DICA 2F9PA 3GISB 5GWZA 1P57B 1O2GH 4TY6A 1XMNB 4MVNA 2DE8A 3SW2B 2XC5A 3U9AH 1GJ6A 2A7CA 3B9FH 2VVUA 1GDUA 1ELGA 4B2CA 1VITH 2BDIA 4HTCH 2G5NA 1MKXK 1Y5AT 1NRSH 1OYTH 2BVRH 2ZFTA 1EB2A 2NU4E 1D6WA 1P2NA 1BBRE 1HAGE 2P8OC 3UWJH 1L4ZA 3FZZA 2VIQA 3B23B 3SU6A 1A5GH 4Y79A 1AKSA 2TGPZ 4VGCB 2SGDE 1WCZA 1BTWA 1TBRH 1O2HA 4TPIZ 1C1TA 4MNXA 1KXDA 1NY22 1LVYA 4ZHMU 4NIVA 2FTLE 3A82A 1O2RA 1CGHA 4Q7YA 4IN2A 3V7TA 2BDAA 1O2JA 4WY3A 1ELFA 3A7VA 2PSYA 1FLEE 4K8BA 4B2BA 4KTCA 4Q7XA 4DGJA 1EP6A 2BZAA 3PYHA 5ESBA 3RMMH 3QDZB 1TE0A 2GGVB 1JMOH 4J1YA 3AAVA 1E34B 2ASUB 2FESH 3LJJA 3F1SB 3RXGA 1GGDB 2XBVA 1C5SA 5DP8A 2D1JA 4NZQA 1HIAA 1J15A 1P09A 4NA9H 3E91A 1Z1IA 2UUJB 1D3QB 3LDXH 3LGYA 2HGTH 2GCTB 2A32A 3E0NB 4D9RA 1F5KU 5C1YA 1F7ZA 4A6LA 2TBSA 1H9LB 1W8BH 3F68H 3PB1E 4NIXA 1P2MA 2R0LA 4IN1A 4M7GA 1L0ZA 1C2KA 1GPZA 1ZTKA 1GBAA 3A7YA 4ZKRU 2VJ1A 1WYKA 1D9IA 1GDNA 1ZJDA 3ATWA 1GBKA 3F9GA 1AGJA 1F0SA 2Y6TA 1Z8JB 1A0LA 2Z6BD 3LGVA