1FNIA

Crystal structure of porcine beta trypsin with 0.01% polydocanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fniA02
2JETC 3L33A 4KTSA 1HJ8A 2FM2A 1O3LA 5LGOA 1F0SA 2AMQA 1C1RA 4AZ2B 5K0HA 1LPZB 2CJIA 1ANBA 1PQ7A 2ZDNA 3RXKA 1BQYA 2V0BA 1E38B 2A5AA 4U32A 4FUGA 5A8ZA 1FIWA 3PO1B 1ESAA 3EA8A 4SGAE 1GG6C 4DVAU 1BDAA 1WTHD 3P8FA 3BV9B 4RKOB 4X2VA 1ANDA 1W8BH 4X1SU 1HAIH 2C3SA 1ELCA 4U2WA 2FOGA 4GHTA 4Y8ZA 1AU8A 1GHAG 2AH4X 1BTZA 2ZHWH 3PMJA 2EI8A 3SNCA 1Y59T 1C2LA 2J94A 1K1LA 3M5LA 1PYTC 1GJ4H 1C5WB 1LMWB 2IOTA 2D26C 1NRQH 4WXIA 2QXHA 4MDSA 1ZSLA 1O2WA 1QRXA 3SJIA 1C4U2 2FI5E 2P93A 1IQEA 3MYWA 1YPMH 4MNWA 3BTHE 2ZIQH 4CHAC 1HJAC 1Z6JH 1DY8A 3URDA 1O2XA 1V2PT 1C2KA 3QGNB 3RU4D 1VGCC 2G55A 2GX4A 3LH3A 2NWNA 4I8HA 2CMYA 5ESBA 1GBTA 1P3EA 4JYUH 4J1YA 1HRTH 3A7XA 1MQ6A 3G01A 3MH5A 4DGJA 2VH0A 3OY5U 5ABWA 3OU0A 1GJ7B 2F9NA 1UTJA 2B7DH 2IN2A 2G4TA 1JWTA 5HXFA 1GI5A 1AUJA 1XKBC 5EQSA 3RXRA 1SI5H 3SU2A 3GDSA 3VB6A 2OCVB 2AGEX 2FO9A 1XKAC 1FY1A 4WVPE 1CVWH 1BTUA 4TWYA 1O2YA 1QNJA 1O2SA 1XUFA 2WUBA 1ZMJA 3V0XA 1X7AC 1GHBF 1TGNA 1Y3XA 3GICB 1WQVH 2ZHQH 4K60A 4A5TS 1H8IH 3F9EA 4VGCC 2HPQH 4AFSA 2ZCHP 2VIQA 1QL8A 4NCYA 3B9FH 2BDYA 4GCHF 4AGJA 4UEHH 2Y80A 1UTLM 2A7CA 3RXPA 1P09A 1O2OA 3SUEA 3U1IB 4YOJA 4BAOB 2BOHB 1BZXE 1KXFA 1ZSKA 3BIUH 1CT2E 4DY7B 3LGWA 1ZLRA 1SR5C 2OINA 4FUJA 2HRVA 4FVDA 1O30A 1NFXA 3Q3KA 2C90B 1BTPA 3P17H 1P9SA 1JOUB 4FUHA 1A4WH 1KXCA 2FLBH 2Z9IA 1NPMA 1U6QA 5HMAA 3K6ZA 3ZV8A 3VB7A 1V3XA 1C5TA 3HPTB 4GPGA 5I25A 4NFEA 5DP6A 1AMHA 5GIBA 1C2HA 1SFIA 3ZYDA 1OYQA 1W13U 2A1DB 1O5AB 2ILNA 4YESB 1W7GH 2ZGJA 2EI6A 1THRH 3PLKA 4FUEA 1C1TA 3EA7A 3GCHB 5EPNA 1BCUH 2ANMH 1FXYA 1WYKA 2J38A 2ZHEH 1RFNA 3MU1A 5A09A 2CHAC 3M5MA 3T2NA 4YZUA 3VB3A 5CHAB 1SBWA 1SQTA 1WV7H 3QZRA 5EOKA 5C5OA 3DA9B 4KTUA 1G3BA 2O9QA 1FN6A 1O5BB 2A4OA 1RD3B 1J16A 1LQDB 1GJ8B 1P06A 1HIAB 1O0DH 3RXTA 1QL9A 2I6QA 4Q7ZA 7KMEH 1HGTH 2Z6BD 3U8RH 1QHRB 1LTOA 2Z7FE 2VWLA 3OY6U 2B8OH 1S0QA 2BLWA 2XXLA 1CGJE 1KDQA 1O3GA 1OPHB 2GT8A 1G3CA 3RC5A 3VGCC 1SGFA 4TWWA 3BTTE 4B76A 1DS2E 1LHFH 4WF8A 3QWCH 1O33A 3RU4E 1YPGH 1ELTA 1SOTA 3ITIA 2FP7B 1UTMA 2GCHG 2FODA 1UCYH 5L2YH 3A83A 5J4SA 5EQRA 4LZ4B 1P10A 2OC0A 4A92A 2BDGA 1Y3YA 1GJ5H 5IYTA 3GY8A 1O3MA 1C1QA 3FZDA 1RIWB 4ABDA 1BTYA 4J2YB 4MQAA 4Y6DA 1TPPA 4AYYB 3ZZ6A 1F7ZA 1S82A 1GI3A 2G8TA 1KYNA 1CA0C 1SPJA 3BTQE 1L4DA 1O34A 5GXPA 3SNAA 1DDJA 9ESTA 1C9PA 2ZU5A 1C1NA 1NO9H 3SGQE 1NU7B 4FUDA 3DFJA 1DFPA 3E0NB 1MU6B 3MNXA 3ZZCA 1ETTH 8GCHF 1G3EA 2ZPQA 1GL1A 1O3KA 3QN7A 1EB1H 4A7IB 4RKJB 2W7UA 1UMAH 1BTWA 3GDVA 3MFJA 1TNLA 1TA2A 1GMCG 2TGTA 4AB8A 2D1JA 2KAIB 1AUTC 1AFQB 1OP2A 2PGQB 1Q31A 3KCGH 1G9IE 2VU8E 3STIA 1O3IA 3SN8A 1TGBA 4MLFB 3LONA 3TH3H 2VWMA 7GCHG 4R8TB 3V3MA 2WV4A 4BAKB 2XBVA 4IGDA 2AIPA 2AEIH 2R3UA 1TALA 1TYNA 4RN6A 2B5TB 4WJG2 1Q2WA 1UCYK 2QYIA 3PMAB 1HCGA 2P8OB 4O03A 5EQQA 3ZZ4A 3UTUH 1Z7KA 1VJ9U 2ZHDA 1EP6A 2XTTB 3SUDA 2H5CA 1E34B 5C1XA 3P8NA 3E8LA 1SGTA 3QGJA 1UTKA 1NRRH 2PTNA 1HAYB 1UTOA 1LO6A 4F49A 5E8EH 1AVXA 6CHAC 1Y3VA 1SFQB 1HXEH 1SHYA 1P05A 3M7TA 1GHWH 4JZFH 5JBTA 4XDEA 1CT0E 4JZ1A 1GI2A 2PTCE 3MOCA 2QAAA 1EOLA 1ZJKA 2QGRA 5HM9A 1S6HA 4Q80A 3L3TA 1ELAA 2AGGX 1XXFA 1UVOA 1EX3A 4AG1A 1C4V2 2IPHA 3TNSA 4DIIH 1DLKB 5EXMA 1YPHC 1YF4A 3HK3B 2BLOA 2ZU3A 1F0RA 1A0LA 4E7RG 1TQ7B 1SGCA 3SU4A 4FU8A 2A32A 2FTLE 3ODFA 3RMMH 1T7CA 2ZA5A 1DPOA 1TBZH 5DK1A 1O2PA 4F4OC 1L4ZA 3AW1A 4K1SA 1IQJA 1S5SA 1K9OE 2SGFE 4DJZB 1AIXH 1LKAA 2ZU4A 1EPTB 1GDUA 1SGFG 1F5LA 1BB0B 1S0RA 4LZ1H 5F8XA 1O2JA 2O8MA 2D2DA 3MMGA 5L6NH 2Q6DA 3RXMA 3M7UA 3BEUA 1HAGE 2ALVA 1ID5H 4B2AA 1LHEH 1TA6A 2V3OH 1KIGH 3PMBB 1O5FH 3SV7A 1QFKH 2HALA 1Z8JB 3ZVFA 1QGFA 3OYPA 2SGPE 2BDAA 2HGTH 5EXLA 3UIRA 2C8ZB 1ORFA 2A4QA 4H6TA 4HFPB 1LHCH 3SO3A 1JMOH 1L1NA 1AY6H 5FPSA 1GJAB 5FPYA 1UK4A 1EKBB 5JBCS 4AOQA 2BVRH 2H5DA 1FZZA 3BEIB 3RXBA 4X8VH 1AWFH 4UFGH 4NG9H 3A82A 1GBDA 2P3TB 1O2UA 3KGPA 4FUFA 1O3DA 1ZPZA 2V6NA 1G32B 1NM6A 3UUZA 1O39A 1GHZA 1B7XB 3ZZ7A 1F0TA 2P3UB 2AFQB 4FVBA 2OUAA 2O8TA 1Q3XA 1YKTA 3A7WA 1QCPA 1TGSZ 4FU9A 4X6MA 1C4Y2 1SGQE 2ZQ1A 1G3DA 1C1SA 1P2QA 3RMNH 3TLOA 1TBQH 1YCPM 1OKXA 3VXFH 1ZSJA 4MPUA 1N8OB 1C5VA 2G00A 1A46H 2GCTC 1UTPA 1Y3UA 1QR3E 3GY2A 1O2RA 2P59A 4K8BA 2GV7A 2BXUH 3QO6A 3O8RA 4IN1A 1NTPA 3UR6A 4NSVA 1CHOG 4IMZA 2I6SA 1GDNA 1V2WT 4D9RA 1PQ5A 3AASA 1SOZA 4BTIB 4XSKU 3DFLA 3U8TH 2AMDA 5GWZA 4K8YA 1ETSH 1QB1A 1BHXB 2PV9B 2FI4E 1GCTB 1HIAA 4WMEA 4B71A 3SJOA 1E37B 2R9PA 4HTCH 1TPSA 3MNCA 4X1PU 2YOLA 4YO9A 3GCTG 3PWCA 2UUKB 1OWIA 4M7GA 2ZWLH 1GWAA 1QY6A 4Z6AH 1BBRE 1EP5A 1C2DA 1Y8TA 3CS7A 1BT7A 4Q7XA 3TGJE 1IQNA 2BMGB 1NU9A 1FY8E 1QJ6B 1TE0A 1GBCA 4MPWA 1AE8H 4AN7A 1HAPH 1OSSA 1QURH 1ELEE 1KSNA 1YM0A 3RP2A 3KL6A 3ZVBA 5FHTA 1DWBH 1Z71A 1V2TT 3I29A 3RXAA 4A6LA 3RXQA 3K9XB 1LVMA 1O3PB 2BM2A 1QRZA 1NC6A 3Q00A 3FANA 1K1NA 1JIMA 2OD3B 1K2I1 2Y5HA 2VGCB 1P2JA 5JPMH 1W0ZU 2AS9A 2A45B 1C5RA 1UTQA 1GI6A 3EAJA 5F6MA 4DCDA 2EC9H 5E2OA 3SORA 1IQHA 1K28D 1WQSA 3BTKE 2FESH 2HLCA 3S9CA 1XUIA 4GHQA 1D6RA 1TX7A 2ANWA 2GV6A 2RG3A 3KF2A 3HKIB 3FFGA 3HKJB 3K2UA 4ABJA 4O3UA 1AHTH 2PKSC 2ZECA 5A0BA 1L2EA 1BBRH 4LK4A 5DJ7A 1AKSB 1LKBA 2ALPA 2BD8A 1A5IA 5HYOA 4Z0KA 2BDCA 2QF3A 3TIUA 1SGDE 1O3FA 2ZDLA 1D3TB 2KAIA 2B9LA 4UFEH 3GCNA 3KQBA 1SGRE 2H6MA 1D9IA 1O2MA 1V2JT 3SBKA 2TRMA 1C5YB 3UNQA 5GPIB 1BMNH 3MH7A 1RTKA 2ZI2H 3EQ0H 2PWXA 4NFFA 1ABJH 1GVZA 5FAHA 1DOJA 4BNRA 2BVXH 4O9VA 1VITG 5C1UA 2OLGA 3P6ZB 1F0UA 4OS2A 2ZKSA 2XNIA 1EAXA 1TMBH 1GCDA 5TCAA 1K22H 1O2HA 2AIQA 3P92A 4JZEH 5ESTE 1C1UH 4ABEA 5G4BA 1NRNH 5FPTA 3ZZ8A 2PR3A 1TRMA 2OBOA 3PO1C 3MHWU 2Y7XA 1ANCA 1GJCB 3MTYA 5FXLA 1LDTT 2XCNA 2G51A 5J4QA 2O8UA 1NFUA 3RXIA 1OXGA 1FQ3A 2CF9H 1SMFE 3NZIA 1FPCH 4IS5A 1TNJA 1DITH 4IC6A 3IWMA 1J9CH 4WMDA 1W3CA 4NA8A 1P9UA 1OYTH 3E16B 1BBRK 1ELVA 3GDUA 3Q3YA 4IMQA 1BUIA 2DE9A 3V12A 1MD8A 1ABIH 4WY3A 1SL3A 1MKWH 1GMHG 2GZ8A 2RA3A 4NIWA 1TOCB 6LPRA 3A86A 1MBMA 1TONA 3KIDU 2NU1E 3SV8A 2BXTH 3R3GB 3SU3A 2Y7ZA 1DSTA 2J9NA 2PLXA 4OGXA 1WSSH 1QRWA 1JBUH 4X2XA 1GI8B 3PTBA 3A7YA 1B0FA 1NESE 2ZQ2A 1P0SH 4R0IA 1HYLA 1MTNB 2GP9B 3GOVB 2RA0A 1RXPA 2BTCE 1EPTA 1WOFA 1Z1IA 3C1KA 1GHAF 3GY3A 2SGDE 4AFUA 1C5ZB 2F83A 1ELFA 1L1GA 1LPGB 1P2IA 5T6DA 4K1EA 4KTCA 4ZAEA 2CN0H 3P8GA 2FMJA 2QA9E 4JZDH 1C5LH 5A0CA 2ZFSA 1CO7E 3W95A 1GGDC 1H9HE 3RM0H 3RXGA 6GCHG 1DWEH 4ZMAH 2GMTB 1GJ6A 2BY8X 1FAXA 3ZVAA 1BJUA 5CE1A 3ZVCA 1YPKH 3I78A 2F9OA 2Z3EA 2P3FH 2P95A 1MH0A 1Z1JA 2DUCA 5E2PA 4ZH8A 1EZSC 1HNEE 1BMAA 3U69H 3TITA 2ESTE 1QQ4A 1MKWK 2CXVA 1HAZB 2FPZA 2OTVA 2ODPA 4MG3A 1SLXB 2J34A 1C2MA 1HBTH 2WYJA 1NS3A 2G81E 1KY9A 3ZZ9A 1NROH 4DW2U 3Q76A 1SHHB 4YM9A 3ZV9A 5TJXA 1DX5M 3RXUA 1BIOA 5E0GA 1GJBB 3FP6E 3S9BA 1P2MA 1HJ9A 3EDXB 1CBWC 1O38A 2BD5A 2NU3E 2H2ZA 1GI4A 3UNSA 4FUIA 2UUYA 2FOEA 2ZGCA 2PFEA 2UWOA 1UCYE 5JB8S 1SGIB 1S83A 1O2LA 3PB1E 4ABAA 3LJJA 1NFYA 1HAHH 1UTNA 1V2KT 3GCHC 3S7HB 1ZJDA 4NGAH 4CRGA 5EPYA 5DP4A 5FBEA 3MNBA 5CHAC 3FP8E 4AFQA 1O3OA 2WPMS 2XW9A 3U98H 1F5KU 3U1JB 2ZCKP 2XWBI 1TRNA 1SQOA 1CSOE 1MTSA 1W11U 5E0HA 1O2VA 4I8GA 2QV1A 4X8SH 1AB9B 4D7GA 1DXWA 1C5UA 3L6PA 3BTEE 4O3TA 2ZTYA 1BRCE 3P95A 2H9EH 4OS1A 2ODYB 4U30A 3KQCA 3EGKH 3LGVA 2VVVA 1A5GH 4CBNA 1Y5UT 2Z9GA 1V2ST 1P04A 4DIHH 3PYHA 1NZQH 1H9LB 4FUCA 3BTDE 4BTTB 1BA8B 1GMDG 2C4FH 4ISNA 2TGDA 4IW4E 4Y79A 2WV5A 1D3DB 4TPIZ 1DVAH 4Y11E 4I8KA 2UUFB 1PJPA 3QDZB 4WMFA 1XUGA 1O2IA 3M37A 1C1VH 2ZDKA 2XYAA 2TIOA 3TU7H 2OXSA 3SOSA 3OTJE 3O8BA 3VGCB 1ZMLA 1XUJA 5JB9S 4YLQH 3CENA 5DPAA 1FNIA 8LPRA 1FN8A 1NT1A 3LDXH 1YLDA 1RIWC 2HVXA 3BF6H 4UONA 2ZDVH 3LOXA 3F9FA 3STJA 9LPRA 1O5GH 2R2MB 3MI4A 1TNIA 4YOGA 1MQ5A 2PKAB 2QY0B 4INLA 4BAMB 2Y81A 1G30B 1CGHA 3M5NA 3UR9A 4ZKNU 1T4VH 2BD2A 1O3JA 5GJ4B 4PROA 4Y76A 1LPKB 1AKSA 1GDQA 2VWOA 4FU7A 3PWBA 4NZLA 3A85A 1P01A 1EOJA 2FLRH 4WH8A 1H9IE 2FEQH 2G4UA 4BOHA 1C9TA 2NU2E 1EAWA 2HNTF 1FUJA 1O2QA 4FXGH 1BITA 2A5KA 2BQ6B 1OOKB 1LVBA 3T27A 1WU1A 2VIWA 1ELGA 1TGCA 4Y8XA 1YBWA 2FOCA 5E0JA 3E0PB 1FY5A 2FYQA 1DANH 3F9HA 1GBIA 1LVYA 1OX1A 2FOAA 2ZZUH 1ZOMA 4D8NA 2R0LA 3A81A 1RTFB 2GCHF 1FY3A 4H42U 1ZZZA 1T31A 2ZEBA 5LPRA 4DOQA 5TCCA 1S6FA 3SI4H 2PUQH 5DG6A 1VCWA 1YP9A 2Z9LA 3ZVEA 1CE5A 1GJDB 2NU0E 3UWJH 1HXFH 2LPRA 1ELBA 1XMNB 1ARBA 3LIWA 2P8OC 3TPIZ 3BTME 3GY5A 3UNRA 1VITH 2A2XH 1GI9B 4X6PA 1NRPH 5ETXA 4XFQA 2ANYA 4BTUB 2TGPZ 1V2QT 1Z8GA 2VIDA 3IG6B 4MNXA 2ZFTA 3T25A 3M35A 4X6NA 1Y3WA 2BLQA 1TQ0B 4ABFA 1ZPBA 2Q6GA 1QTFA 4E06H 1D6WA 1LQEA 1GBBA 2BDHA 2BY7X 2FX4A 1VZQH 1W12U 4Y71A 3NUMA 3MO3A 3TJOA 2GZ7A 1EQ9A 2HNTC 4ISOA 3KQDA 4MTBA 1GMCF 3SGAE 5FBIA 1C2FA 1ESBA 1O36A 2ODQA 2SGEE 1QBNA 2ZPRA 3GY7A 2LNCA 4LOYH 2VVCA 2Z9JA 7GCHF 5EW1H 1CHGA 1G36A 3MU0A 1VCPA 4B2BA 4D7FA 1O3AA 2GDDA 1YYY1 3RU4T 1GVLA 4UFDH 1EZUC 1MD7A 1YPEH 1SGYE 1UVSH 1MTVA 3V13A 3FZZA 1HPGA 2JKHA 4KGAA 3RC6A 4WH6A 2OQUA 5GCHG 1G2MA 2EEKA 2ZC9H 1T8LA 1NRSH 2F9UA 3ATMA 1E36B 3S0NA 4I8JA 2G5NA 4Q2KA 3LC3A 4OGYA 2QXIA 1EPTC 3UOPA 3SHCH 1VCQA 1HAVB 1N1LA 1RJXB 4AB9A 3FAOA 4BXSA 4XBDA 1GHYH 1QJ7B 1RGQA 3E3TA 1LHGH 3RLWH 1O37A 4AORA 3ATKA 5EXNA 2M5TA 2THFB 1GBAA 4ISLA 1GVKB 4A1VA 4X6OA 2R2WU 4X1RU 1S85A 1EATA 2WPIS 3TK6A 5DKMA 1V2MT 1VJAU 4X1NU 4UE7H 2GD4B 1QA0A 2Y6TA 2WPHS 3DD2H 2F9BH 4X2YA 3TH4H 4ZXXH 2JH6D 2ZCLP 5DP9A 1P03A 2O8LA 1M9UA 5T6GA 4NZQA 3PLPA 1BRAA 1DWDH 3ATLA 3BG4B 1O2GH 1P3CA 2J95A 1GBJA 3V7TA 3GYMA 1K1MA 1EJNA 3ODDA 1FJSA 1TLDA 1PFXC 1ZPCA 3RC4A 1XUKA 3GY4A 2W26A 2QF0A 1MAYA 1ZR0A 3GCOA 4NSYA 5LPFA 3B8JA 1FIZA 1K1OA 2BD3A 3AAUA 1N8OC 2AMPA 3LGTA 4CR9A 2SFAA 1YGCH 2ZNKH 4ZHLU 1GBHA 3T62A 2W3IA 1B5GH 2A0QB 3M36A 2XBYA 4CRBA 4ESTE 3QX5H 2FXRA 4B74A 1Z6EA 1DSUA 1W7XH 1YPHE 2GCTB 3QZQA 5EODA 1SLWB 1TNGA 3DUXH 3BEFB 2ZDMA 4IBLH 1IQLA 3EE0B 3JZ2B 1DLEA 2YNBA 3BIVH 6ESTA 2ZFQH 1GCTC 4ABBA 1UO6A 1XVMA 1ZRKA 1BMLA 5DP3A 3M3TA 2GDEH 4WXVA 1JRTA 1O3NA 4X1QU 1DWCH 1JRSA 1L1JA 2FOBA 4BAQB 4WWYA 2XC0A 4B75A 3SU1A 3SU6A 1TPOA 3UOUA 3A88A 3H5CB 4YTAA 3GYLB 1AVGH 1O35A 1AN1E 4I32A 1TX6A 1EAIA 1GBLA 3DT0H 1THSH 1P12E 2BD9A 2VVUA 3PROA 1XX9A 1FMGA 4K2YA 4CRCA 5C5NA 2WINI 1A0HB 2VGCC 3QUMP 2OQ5A 1HAXB 3A8AA 1CHOF 1LVOA 1TNKA 4YT6H 3AVZA 3LC5A 5AF9H 2A5IA 2B0FA 1C5SA 1YPLH 1MAXA 1DUAA 3QTVH 1OP0A 1WBGB 2ASUB 1HAOH 2ZU2A 2BZAA 2JH5D 2PKAA 1H1BA 1SB1H 2D8WA 2BDBA 3SUFA 1T8OA 3LGYA 2BLVA 5A8YA 3GCTF 1ZHRA 1P8VC 3MWIU 1FLEE 4I7YH 3BSQA 4K69A 7ESTE 1IHSH 3F6UH 2RDLA 3E90B 3UY9A 3NCLA 2ZTXA 1ZYOA 3FVFB 3TNTA 2BY5X 1UVUH 3BN9A 4GUXA 4YOIA 1HLTH 2GTBA 2QXGA 4HI3A 1AVWA 1C5QA 3HK6B 3LH1A 4TY6A 4LXBH 2G52A 4YLUA 5C2ZA 1PYTD 2F9VA 3VPKA 1QBOA 1GHVH 2TBSA 2PSXA 2W7SA 4JYVH 2FDAA 3ZVDA 1C1PA 1C1MA 1VR1H 2STBE 4MNYA 2JETB 2VNTA 3LKWA 4CRDA 3MH6A 1NFWA 2XC5A 1SGEE 2Q6FA 3BG8A 1A3EH 1CT4E 2XCFA 3VFEA 1AZ8A 3C27B 3ZZBA 3F68H 3A7VA 3M61U 1J14A 5EG4A 1MZDA 4Y0ZE 1DT2A 3A89A 3NWUA 1GBMA 1DM4B 5JBBS 1O5EH 1QJ1B 3HGNA 1GG6B 4INKA 1KXDA 3RXLA 4B73A 1S81A 3SGBE 3K65B 5EW2H 3RXSA 1DUEA 2A2QH 5JDUB 3BTFE 4Q7YA 5SGAE 1B0EA 3JZ1B 3SZNA 4ABHA 3H7OA 4INHA 2BY9X 2HPPH 1Z8IB 5HGGA 1ELDE 1IAUA 3QK1A 1A0JA 4XE4A 4D9QA 1KXBA 1ZGVA 4H6SB 1C2JA 4B2CA 1YCPK 1GHBG 1GJ9B 1C5OH 1QL7A 1VITF 2BB4A 3D49H 3MU4A 4MPXA 2F91A 3TJNA 2SNVA 2OC1A 1EUFA 1KXAA 2VIOA 1O3EA 1BTXA 1KLTA 1SLVB 3UQVA 3FP7E 3MNSA 2FI3E 2OC8A 3RMOH 3RXCA 4CHAB 2EA3A 1HJAB 1ANEA 1VGCB 4A1TA 5FCKA 4GCHG 2XC4A 4I33A 1G2LA 1BMMH 1MTNC 1SG8B 3ZYEA 4CBOA 1GL0E 3A7ZA 4D76A 4I8LA 3M7QA 1O31A 2GVFA 4UFFH 2JH0D 1P57B 5A2MH 4NA7A 1HAVA 2YNAA 3UFAA 3VB5A 1KLIH 3M3VA 1FY4A 2XWAA 2C93B 3MU5A 3A7TA 2XRCA 1OWHA 3ATWA 5PTPA 2ZTZA 1XVOA 3PV4A 1IQMA 2A31A 1AWHB 1MTUA 3RXJA 3NKKA 1IQKA 1GBKA 3Q77A 2GMTC 1CU1A 2CF8H 2UWPA 3CP7A 3QTOH 3A8CA 3MU8A 5AHGH 1GMHF 4XBCA 5EGMA 3SNEA 2ZGXH 1QB9A 1GGDB 1NN6A 1PPGE 2BZ6H 2FX6A 4ZROA 1RS0A 3A8DA 3D23A 1TX8A 1WCZA 4VGCB 1EJAA 3OSYA 1XM1A 3LT3A 1A5HA 4XOJA 1HUTH 1CQQA 1ESTA 1TGTA 2Z94A 3S7KB 4JMYA 5DO4H 4BAHB 3H7TA 4RSPA 4X2WA 4ZKRU 1AE5A 1RRKA 1V2VT 3RDZA 2FS9A 1OS8A 2GGVB 1ACBE 2VH6A 5L2ZH 4ZXYH 2C8YB 3P70B 1KLJH 2ZP0H 4UD9H 1EASA 2BX3A 2QN5T 5K7RA 1XXDA 1GBFA 1ZTLA 5T6FA 1CBWB 2OP9A 2V3HH 3SU5A 1A2CH 3AW0A 8KME2 1GI7B 1ZGIA 6GCHF 2ZF0H 1TB6H 4K3JA 1A3BH 4CH8B 1GHXH 3CS0A 4IN2A 3U8OH 1TPAE 1O2ZA 1H8DH 3TVJB 2QCYA 1INCA 4CREA 5JBAS 2CHAB 4NWLA 3GY6A 2ZFFH 5F03A 3S69A 3TK9A 2Q1JA 1SGNE 3A87A 2WYGA 1AB9C 1FAKH 1IQFA 1LHDH 1S84A 3SV6A 2RCEA 1FPHH 3P8OA 4NIVA 1C1OA 5AFZH 3ESTA 4HZHA 8GCHG 1TOMH 2ULLA 1IHTH 1UHBB 2OBQA 3KEEA 1RTLA 4DURA 1YC0A 2PUXB 3WY8A 3LPRA 3A8BA 4JYTA 5CMXH 3VEQB 4X0WU 3NPSA 4MPVA 1F92A 1OWKA 2BD7A 3MH4A 1BRUP 4OS4A 1J17T 3M3SA 5A0AE 5DP8A 1K1PA 1T4UH 3HGPA 1OWDA 3DHKH 1V2OT 2F3CE 2SGQE 1E0FD 5LPEA 3KQEA 4CRFA 2Y82A 1SSXA 3RXOA 2UUJB 3SNBA 3SHAH 2VJ1A 4TY7A 4ABIA 3W94A 4ZUHA 5JYIA 2BX4A 8ESTE 3LGUA 1O2KA 4TPYA 3EYDA 1CA0B 3RMLH 4AX9H 2ZFPH 1PPBH 1V2RT 2A7HA 5C1YA 3LGIA 2R0KA 2AERH 1SLUB 1TAWA 2ZO3H 4JCNA 3VB4A 2P94A 1GMDF 1AFQC 2BHGA 3RUOA 1WUNH 1Y5BT 1YPJH 4CR5A 4GAWA 4GSOA 1PPCE 1KTSB 2ZFRH 2QC2A 1PQAA 5EU8A 2FOMB 1IQIA 1D4PB 2FWWA 2VWNA 1ZHMA 1V2UT 2CGAA 2AYWA 1MUEB 3RXDA 3TK5A 2ZGBH 1O3BA 1OWEA 3K6YA 4AG2A 5AFYH 1AI8H 1W2KH 2VB0A 1BTHH 4SGBE 3D65E 1WAYB 4AYVB 3BTGE 3SW2B 1K1JA 4ZKOU 2VIVA 3O8CA 2FYRA 4AFZA 1C2EA 1DY9A 3OX7U 2VIPA 4JZIA 3RM2H 3A84A 5F8ZA 1SQAA 1FONA 3Q3XA 1FV9A 1BJVA 2STAE 3LU9B 3N7OA 2XBXA 3D62A 3PMHB 1C2GA 4XBBA 1CA8B 3SV9A 2ZGHA 1K1IA 3SV2H 3UPEA 1HDTH 3BTWE 4NIXA 2J2UA 1MTWA 3KNXA 5GDSH 5C3NA 3U9AH 1THPB 6CHAB 1QB6A 2TGAA 2Z9KA 3F9GA 4QT8C 1GI0A 1P2NA 3KN2A 4Y7BA 4CRAA 2FOFA 1AFEH 3IITA 2WUCA 2BQ7B 1C2IA 1NY22 1PPZA 3E1XB 3UWIA 4O97A 2BYAX 4ZHMU 1UK2A 4Y0YE 1MMJN 1TBRH 3R0FA 1ZTJA 4BXWA 4TYDA 1J15A 1KTTB 4OS7A 1T8NA 3SQEE 2SGAA 1AO5A 1DXPA 2FOHA 4THNH 1QBVH 2A4RA 5AVDA 2FIRH 1BRBE 1FDPA 1ZRBA 1IOEA 2ANKH 3AAVA 1MKXH 3T26A 4BANB 1AGJA 3ZZ3A 1O3CA 4K1TA 3TJVA 3ENSB 1GBEA 2BOKA 2FZZA 1C5MD 1PPHE 1IQGA 1SGPE 1O2NA 2IJOB 3UREA 2BVSH 3SJKA 1L0ZA 2PSYA 5FX5A 2DE8A 4UDWH 3T29A 4NA9H 1ETRH 1H4WA 1C5PA 1W14U 2AGIX 4FUBA 2J4IA 1ZHPA 1Y5AT 1P2OA 2C8XB 2PHBA 4ZHAA 1O5DH 1D3QB 5H4IB 1D3PB 1K21H 1O3HA 1G37A 3ZZDA 1P02A 4NIYA 1BHXF 1SC8U 2WPLS 1C5NH 2C8WB 1EZQA 1AQ7A 2GKVE 5T3HA 3URCA 2A4GA 1EZXC 1N6YA 5BRRE 4I31A 3TGIE 3SQHE 3BG4C 1JIRA 2ZPSA 5GCHF 1ZTKA 5FCRA 1PPFE 4KP0A 3NK8A 1O2TA 2NU4E 1A1RA 3ZVGA 1FI8A 5A8XA 3HATH 1TFXA 4GVUA 1MZAA 1TRYA 4CH2B 3TGKE 4MNVA 3UQOA 4JK6A 2GZ9A 1TIOA 1ARCA 2HNTE 1W10U 3RXFA 1TMTH 1BOQA 2H9HA 5DP5A 2CV3A 4KELA 5HM2A 1EAUA 2ZDAH 1P2KA 1MKXK 1UK3A 1F2SE 1HFDA 3B23B 1UVTH 1UVPA 5DGJA 1ZMNA 5C67A 2A7JA 2BDIA 2TPIZ 3MO6A 1JXPA 1PQ8A 2H1UA 3KHVA 1WTGH 1V2LT 1QA7A 4ZKSU 4OS5A 3SJ8A 3SJ9A 3NXPA 2Z3CA 3TJUA 2J92A 1J8AA 2ZHFH 4DG4A 4B1TA 2BY6X 2HWLB 5DP7A 4U01A 1TMUH 3E91A 5BPEA 1C1WH 1O5CB 1YLCA 1A61H 2FTMA 4ISHH 3M5OA 4MVNA 5IDKA 1MCTA 4HGCA 3PM3A 2QIQA 4X8UH 2OC7A 1PPEE 2Z3DA 3A80A 1KXEA 3PLBA 3ATIA 1N6XA 3RXHA 3PTNA 3T5FH 3TH2H 1CGIE 3LJOA 2W5EA 4A1XA 1LCYA 1A7SA 4KKDA 4Y10E 1AZZA 5F8TA 1GI1A 1UHBA 3RXEA 2WPKS 4NWKA 1T8MA 3ZZ5A 1QQUA 3I77A 4K5ZA 2FS8A 1MCVA 1KDQB 2PW8H 5L30H 3GISB 3MO9A 3F1SB 3SU0A 1XUHA 3EA9A 2GT7A 1HB0B 3ELAH 7LPRA 4AGKA 1UJ1A 1MU8B 1T32A 2O8WA 4YT7H 5LH8A 4H4FA 1QIXB 2ZG0H 5FX6A 1TWXB 2VINA 1GPZA 1AD8H 3ZZAA 1DE7H 5C20A 2BD4A 2K1QA 2UWLA 3SI3H 1EJMA 3S9AA 1Z8RA 1EB2A 1TABE 3T28A 3SUGA 2WPJS 1P11E 2H9TH 1MBQA 4X8TH 4ASHA 3O8DA 4Y8YA 2G5VA 4E05H 3E6PH 1OWJA 2F9PA 1O32A 2PGBB 1C5XB 1F5RA 2QXJA 2BQWB 4ISIH 3SNDA 3RXVA 2PKSB 2SNWA 3VXEH 1YCPH 2W3KA 1OP8A 1DICA 2P16A 1E35B 4JK5A 4ABGA 4GLYA 4E7NA 2ZU1A 1V2NT 5I46H 1HV7A 4IC5A 2Y5FA 4OS6A 3QLPH 4Y7AA 1TNHA 4DT7B 2HOBA 3RLYH 2R3YA 2V35A 1V6DA 1EXFA 2EI7A 2XBWA 1W0YH 1SVPA 5B6OA 2Y5GA
chains in the Genus database with same CATH superfamily
2JETC 3L33A 4KTSA 1HJ8A 2FM2A 1O3LA 5LGOA 1F0SA 2AMQA 1C1RA 4AZ2B 5K0HA 1LPZB 2CJIA 1ANBA 1PQ7A 2ZDNA 3RXKA 1BQYA 2V0BA 1E38B 2A5AA 4U32A 4FUGA 5A8ZA 3CNRA 1FIWA 3PO1B 1ESAA 3EA8A 4SGAE 1GG6C 4DVAU 1BDAA 1WTHD 3P8FA 3BV9B 4RKOB 4X2VA 1ANDA 1W8BH 4X1SU 1HAIH 2C3SA 1ELCA 4U2WA 2FOGA 4GHTA 4Y8ZA 1AU8A 1GHAG 2AH4X 1BTZA 2ZHWH 3PMJA 2EI8A 4F48B 5T1VA 3SNCA 1Y59T 1C2LA 2J94A 1K1LA 3M5LA 1PYTC 1GJ4H 1C5WB 1LMWB 2IOTA 2D26C 1NRQH 3AK5A 4WXIA 2QXHA 4MDSA 1ZSLA 1O2WA 1QRXA 3SJIA 1C4U2 2FI5E 2P93A 1IQEA 4YXWD 3MYWA 1YPMH 4MNWA 3BTHE 2ZIQH 4CHAC 1HJAC 1Z6JH 1DY8A 3URDA 1O2XA 1V2PT 1C2KA 2KX4A 3QGNB 1VGCC 3RU4D 2G55A 2GX4A 3LH3A 2NWNA 2K0QA 4I8HA 2CMYA 5ESBA 1GBTA 1P3EA 4JYUH 4J1YA 1HRTH 3A7XA 1MQ6A 3G01A 3MH5A 4DGJA 2VH0A 3OY5U 5ABWA 3OU0A 1GJ7B 2F9NA 1UTJA 2B7DH 2IN2A 2G4TA 1JWTA 5HXFA 5KECA 1GI5A 1AUJA 1XKBC 5EQSA 3RXRA 1SI5H 3SU2A 3GDSA 2WSSD 3VB6A 2OCVB 2AGEX 2FO9A 1XKAC 1FY1A 4WVPE 1CVWH 1BTUA 1MABB 4TWYA 1O2YA 1QNJA 1O2SA 1XUFA 2WUBA 1ZMJA 4FOUC 3V0XA 1X7AC 1GHBF 1TGNA 1Y3XA 3GICB 1WQVH 2ZHQH 4K60A 4A5TS 1H8IH 3F9EA 4VGCC 2HPQH 4AFSA 2ZCHP 2VIQA 1QL8A 4NCYA 3B9FH 2WZQA 2KCPA 2BDYA 4GCHF 4AGJA 4UEHH 2Y80A 1UTLM 2A7CA 3RXPA 1P09A 4Q63A 1O2OA 3SUEA 3U1IB 4YOJA 4BAOB 2BOHB 1BZXE 1KXFA 1ZSKA 3BIUH 1CT2E 4DY7B 3LGWA 1ZLRA 1SR5C 2OINA 4FUJA 2HRVA 4FVDA 1O30A 1NFXA 3Q3KA 2C90B 1BTPA 3P17H 1P9SA 1JOUB 4FUHA 1A4WH 1KXCA 2FLBH 2Z9IA 1NPMA 1U6QA 5HMAA 3K6ZA 3ZV8A 3VB7A 1V3XA 1C5TA 3HPTB 4GPGA 5I25A 4NFEA 5DP6A 1AMHA 5GIBA 1C2HA 1SFIA 3ZYDA 1OYQA 1W13U 2A1DB 1O5AB 2ILNA 4YESB 1W7GH 2ZGJA 2EI6A 1THRH 3PLKA 4FUEA 2YMSD 1C1TA 3EA7A 3GCHB 5EPNA 1BCUH 2ANMH 1FXYA 1WYKA 2J38A 2ZHEH 1RFNA 3MU1A 5A09A 2CHAC 3M5MA 3T2NA 4YZUA 3VB3A 5CHAB 1SBWA 3W1EA 1SQTA 1WV7H 3QZRA 5EOKA 5C5OA 3DA9B 4KTUA 1G3BA 1FN6A 2O9QA 1O5BB 2A4OA 1RD3B 1J16A 1LQDB 1GJ8B 5HIZA 1P06A 1HIAB 1O0DH 3RXTA 1QL9A 2I6QA 4Q7ZA 2J98B 7KMEH 5EJ1A 1HGTH 2Z6BD 3U8RH 1QHRB 1LTOA 2Z7FE 2VWLA 3OY6U 2B8OH 3FOAA 1S0QA 2BLWA 2XXLA 1CGJE 1KDQA 1O3GA 1OPHB 2GT8A 1G3CA 3RC5A 3VGCC 1SGFA 4TWWA 3BTTE 4B76A 1DS2E 1LHFH 4WF8A 3QWCH 1O33A 1W0JD 4RT0A 3RU4E 1YPGH 1ELTA 1SOTA 3ITIA 2FP7B 1UTMA 2GCHG 2FODA 1UCYH 5L2YH 2YMSB 3A83A 5J4SA 5EQRA 4LZ4B 1P10A 2OC0A 4A92A 2BDGA 1Y3YA 1GJ5H 5IYTA 3GY8A 1O3MA 1C1QA 3FZDA 1RIWB 4ABDA 1BTYA 3KYGA 4J2YB 4MQAA 4Y6DA 1TPPA 5FL7D 4AYYB 3ZZ6A 1F7ZA 1S82A 1GI3A 2G8TA 1KYNA 1CA0C 1SPJA 3BTQE 1L4DA 2KZ4A 1O34A 5GXPA 3SNAA 1DDJA 1E1RD 9ESTA 1C9PA 3F3BA 2ZU5A 1C1NA 1NO9H 3SGQE 1NU7B 4FUDA 3DFJA 1DFPA 3E0NB 1MU6B 3MNXA 3ZZCA 1ETTH 8GCHF 1G3EA 2ZPQA 1GL1A 1O3KA 3QN7A 1EB1H 4A7IB 4OM9A 4RKJB 2W7UA 1UMAH 2KCYA 1BTWA 3GDVA 3MFJA 1TNLA 1TA2A 1GMCG 2TGTA 4AB8A 2D1JA 2KAIB 1AUTC 1AFQB 1OP2A 2KCAA 1Q31A 2PGQB 3KCGH 1G9IE 2VU8E 3STIA 1O3IA 3SN8A 1TGBA 4MLFB 3LONA 3TH3H 2VWMA 7GCHG 4R8TB 3V3MA 2WV4A 2QF4A 4BAKB 2XBVA 4IGDA 5DSFA 2AIPA 2AEIH 2R3UA 1TALA 1TYNA 1NBME 4RN6A 2B5TB 4WJG2 1Q2WA 1UCYK 2QYIA 3PMAB 1HCGA 2P8OB 4O03A 5EQQA 3ZZ4A 3UTUH 1Z7KA 3MQKC 1VJ9U 2ZHDA 1EP6A 3OFND 2XTTB 3SUDA 2H5CA 1E34B 5C1XA 3P8NA 3E8LA 1SGTA 3QGJA 1UTKA 1NRRH 2PTNA 1HAYB 1UTOA 1LO6A 4F49A 5E8EH 1AVXA 6CHAC 1Y3VA 1SFQB 1HXEH 1SHYA 1P05A 3M7TA 1GHWH 4JZFH 5JBTA 4XDEA 1CT0E 4JZ1A 1GI2A 2PTCE 3MOCA 2QAAA 1EOLA 1ZJKA 2QGRA 3KYFA 5HM9A 1S6HA 4Q80A 1WXRA 3L3TA 1ELAA 2AGGX 1XXFA 1UVOA 1EX3A 4AG1A 1C4V2 2IPHA 3TNSA 4DIIH 1DLKB 5EXMA 1YPHC 1YF4A 3HK3B 2BLOA 2ZU3A 1F0RA 1A0LA 4E7RG 1TQ7B 1SGCA 3SU4A 4FU8A 3SZEA 3NRLA 2A32A 2FTLE 3ODFA 3RMMH 1T7CA 2ZA5A 1DPOA 1TBZH 5DK1A 1O2PA 4F4OC 1L4ZA 3AW1A 4K1SA 1IQJA 1S5SA 1K9OE 2SGFE 4DJZB 1AIXH 1LKAA 2ZU4A 1EPTB 1GDUA 1SGFG 1F5LA 1BB0B 1S0RA 4LZ1H 5F8XA 1O2JA 2O8MA 2D2DA 3MMGA 2HVYB 5L6NH 2JIZD 2Q6DA 3RXMA 3M7UA 3BEUA 1HAGE 2ALVA 1ID5H 4B2AA 1LHEH 1TA6A 2V3OH 1KIGH 3PMBB 1O5FH 3SV7A 1QFKH 2HALA 1Z8JB 3ZVFA 1QGFA 3OYPA 2SGPE 2BDAA 2HGTH 5EXLA 3UIRA 2C8ZB 1ORFA 2A4QA 4H6TA 4HFPB 1LHCH 3SO3A 1JMOH 1L1NA 1AY6H 5FPSA 1GJAB 5FPYA 1UK4A 1EKBB 5JBCS 4AOQA 2BVRH 2H5DA 1FZZA 3BEIB 3RXBA 4X8VH 3FKSD 1AWFH 4UFGH 4NG9H 3A82A 1GBDA 2P3TB 1O2UA 3KGPA 4FUFA 1O3DA 1ZPZA 2V6NA 1G32B 1NM6A 3UUZA 1O39A 1GHZA 1B7XB 3ZZ7A 1F0TA 2P3UB 2AFQB 4FVBA 2OUAA 2O8TA 1Q3XA 1YKTA 3A7WA 1QCPA 1TGSZ 4FU9A 4X6MA 1C4Y2 1SGQE 2ZQ1A 2KFWA 1G3DA 1C1SA 1P2QA 3RMNH 3TLOA 1TBQH 1YCPM 1OKXA 3VXFH 1ZSJA 3DSGA 4MPUA 1N8OB 1C5VA 2G00A 1A46H 2GCTC 2WHXA 1UTPA 5C0TA 4RI0A 1Y3UA 1QR3E 3GY2A 1O2RA 2P59A 4K8BA 2GV7A 2BXUH 2W6ID 3QO6A 4IN1A 3O8RA 1NTPA 3UR6A 4NSVA 1CHOG 4IMZA 5KGOA 2I6SA 1GDNA 1V2WT 4D9RA 1PQ5A 3AASA 1SOZA 4BTIB 4XSKU 3DFLA 3U8TH 2AMDA 5GWZA 4K8YA 1ETSH 1QB1A 1BHXB 2PV9B 1VKYA 2FI4E 1GCTB 1EFRD 1HIAA 4WMEA 4B71A 3SJOA 1E37B 2R9PA 4HTCH 1TPSA 3MNCA 4X1PU 2J98A 2YOLA 4YO9A 3GCTG 3PWCA 2UUKB 1OWIA 4M7GA 2ZWLH 1GWAA 1QY6A 4Z6AH 1BBRE 1EP5A 1C2DA 1Y8TA 3CS7A 1BT7A 4Q7XA 3TGJE 1IQNA 4Q4LA 2BMGB 1NU9A 1FY8E 1QJ6B 1TE0A 1GBCA 4MPWA 1AE8H 4AN7A 4B6EA 5CDFE 1OSSA 1HAPH 1QURH 1ELEE 1KSNA 1YM0A 3RP2A 3KL6A 3ZVBA 5FHTA 1DWBH 1Z71A 1V2TT 3I29A 5HIYA 3RXAA 4A6LA 3RXQA 3K9XB 1LVMA 1O3PB 2BM2A 1QRZA 1NC6A 3Q00A 3FANA 1K1NA 1JIMA 2OD3B 1K2I1 2Y5HA 2VGCB 1P2JA 5JPMH 1W0ZU 2AS9A 2A45B 1C5RA 1UTQA 1GI6A 3EAJA 1FX0B 5F6MA 4DCDA 2EC9H 5E2OA 3SORA 1IQHA 1K28D 1WQSA 3BTKE 2FESH 2HLCA 3S9CA 1XUIA 1YLNA 4GHQA 1D6RA 1TX7A 2ANWA 2GV6A 2RG3A 3KF2A 3HKIB 3FFGA 3WW7A 3HKJB 3K2UA 4ABJA 4O3UA 1AHTH 2PKSC 2JDID 2ZECA 5A0BA 1L2EA 1BBRH 4LK4A 5DJ7A 1AKSB 1LKBA 2ALPA 2BD8A 1A5IA 5HYOA 4Z0KA 2BDCA 2QF3A 3TIUA 1SGDE 1O3FA 2ZDLA 1D3TB 2KAIA 2B9LA 4UFEH 3GCNA 3KQBA 1SGRE 2H6MA 1D9IA 1O2MA 1V2JT 3SBKA 2TRMA 1C5YB 3UNQA 5GPIB 1BMNH 3MH7A 1RTKA 2ZI2H 3EQ0H 2PWXA 4NFFA 1ABJH 1GVZA 5FAHA 1DOJA 4BNRA 2BVXH 4O9VA 1VITG 5C1UA 2OLGA 3P6ZB 1F0UA 4OS2A 2ZKSA 2XNIA 1EAXA 1TMBH 1GCDA 5TCAA 1K22H 1O2HA 2AIQA 3P92A 4JZEH 5ESTE 1C1UH 4ABEA 5G4BA 1NRNH 5FPTA 3ZZ8A 2PR3A 1TRMA 2OBOA 3PO1C 3MHWU 2Y7XA 1ANCA 1GJCB 3MTYA 5FXLA 1LDTT 2XCNA 2G51A 5J4QA 2O8UA 1NFUA 3RXIA 1OXGA 1FQ3A 2CF9H 1SMFE 3NZIA 1FPCH 4IS5A 1TNJA 1DITH 4IC6A 3IWMA 1J9CH 4WMDA 1COWD 1W3CA 4NA8A 1P9UA 1OYTH 3E16B 1BBRK 1ELVA 3GDUA 3Q3YA 4IMQA 1BUIA 2DE9A 3V12A 1MD8A 1ABIH 4WY3A 1SL3A 1MKWH 1GMHG 2GZ8A 2RA3A 4NIWA 1TOCB 6LPRA 3A86A 3PRBA 3KQ5A 1MBMA 1TONA 3KIDU 2NU1E 3SV8A 2BXTH 3R3GB 3SU3A 2Y7ZA 1DSTA 2J9NA 2PLXA 4OGXA 1WSSH 1QRWA 1JBUH 4X2XA 1H8HD 1GI8B 3PTBA 3A7YA 1B0FA 1NESE 2ZQ2A 1P0SH 4R0IA 1HYLA 1MTNB 2GP9B 3GOVB 2RA0A 1RXPA 2BTCE 1EPTA 1WOFA 1Z1IA 2KR7A 3C1KA 1GHAF 3GY3A 2SGDE 4AFUA 1C5ZB 2F83A 1ELFA 1L1GA 1LPGB 1P2IA 5T6DA 4K1EA 4KTCA 4ZAEA 2CN0H 4FETA 4ZCNA 3P8GA 2FMJA 2QA9E 4JZDH 1C5LH 5A0CA 2ZFSA 1CO7E 3W95A 1GGDC 1H9HE 3RM0H 3RXGA 6GCHG 1DWEH 4ZMAH 2GMTB 1GJ6A 2BY8X 1FAXA 3ZVAA 1BJUA 5CE1A 3ZVCA 1YPKH 3I78A 3UB0A 2F9OA 2Z3EA 2P3FH 4M9FA 2P95A 1S6LA 1WDIA 1MH0A 1Z1JA 2DUCA 5E2PA 4ZH8A 1EZSC 1HNEE 1BMAA 5B6LA 3U69H 3TITA 2ESTE 1QQ4A 1MKWK 2CXVA 1HAZB 2FPZA 2OTVA 2ODPA 4MG3A 1SLXB 2J34A 1C2MA 1HBTH 2WYJA 1NS3A 2G81E 1KY9A 3ZZ9A 1NROH 4DW2U 1NBMD 1SHHB 3Q76A 3ZV9A 4YM9A 5TJXA 1DX5M 3RXUA 1BIOA 5E0GA 3GS9A 1GJBB 3FP6E 3S9BA 1P2MA 1HJ9A 3EDXB 1CBWC 1O38A 4TT3D 2BD5A 2NU3E 2H2ZA 1BMFD 1GI4A 3DSPA 3UNSA 4FUIA 2UUYA 2FOEA 2ZGCA 2PFEA 2UWOA 1UCYE 5JB8S 1SGIB 1S83A 1O2LA 3PB1E 4ABAA 3LJJA 1NFYA 1HAHH 1UTNA 1V2KT 3GCHC 3S7HB 1ZJDA 4NGAH 4CRGA 5EPYA 5DP4A 5FBEA 3MNBA 5CHAC 3FP8E 4AFQA 1O3OA 2WPMS 2XW9A 3U98H 1F5KU 3U1JB 2ZCKP 2XWBI 1TRNA 1SQOA 1CSOE 1MTSA 1W11U 5E0HA 1O2VA 4I8GA 2QV1A 4X8SH 1AB9B 4D7GA 1DXWA 1C5UA 3L6PA 3BTEE 4O3TA 2IJD1 2ZTYA 1BRCE 3P95A 2H9EH 4OS1A 2ODYB 4U30A 3KQCA 3EGKH 3LGVA 2VVVA 1A5GH 4CBNA 1Y5UT 2Z9GA 1V2ST 1P04A 4DIHH 3H09A 3PYHA 1NZQH 2EQNA 1H9LB 4FUCA 3ZIAD 3BTDE 4BTTB 1BA8B 1GMDG 2C4FH 4ISNA 2TGDA 4IW4E 4Y79A 2WV5A 1D3DB 4TPIZ 1DVAH 4Y11E 4I8KA 2UUFB 1PJPA 3QDZB 4WMFA 1XUGA 1O2IA 3M37A 1C1VH 2ZDKA 2XYAA 2TIOA 3TU7H 2OXSA 2YMSC 3SOSA 3OTJE 3O8BA 3VGCB 1ZMLA 1XUJA 5JB9S 4YLQH 3CENA 5DPAA 1FNIA 8LPRA 1FN8A 1NT1A 3LDXH 1YLDA 1RIWC 2HVXA 3BF6H 4UONA 2ZDVH 3LOXA 3F9FA 3STJA 9LPRA 1O5GH 2R2MB 3MI4A 1TNIA 4YOGA 1MQ5A 2PKAB 2QY0B 4HG6A 4INLA 4BAMB 2Y81A 1G30B 1CGHA 3M5NA 2L6OA 3UR9A 4ZKNU 1T4VH 2BD2A 1O3JA 5GJ4B 4PROA 4Y76A 1LPKB 1AKSA 1GDQA 2VWOA 4FU7A 3PWBA 4NZLA 3A85A 1P01A 1EOJA 2FLRH 4WH8A 1H9IE 2FEQH 2G4UA 4BOHA 1C9TA 1EAWA 2NU2E 2JJ2D 2HNTF 1FUJA 1O2QA 4FXGH 1BITA 2A5KA 2BQ6B 1OOKB 1LVBA 3T27A 1WU1A 2VIWA 1ELGA 1TGCA 4Y8XA 1YBWA 2FOCA 5E0JA 3E0PB 1FY5A 2FYQA 1DANH 3F9HA 1GBIA 1LVYA 1OX1A 3F2GA 2FOAA 1KMHB 1ZOMA 2ZZUH 4D8NA 2R0LA 3A81A 3SYJA 1RTFB 2GCHF 2L74A 1FY3A 4H42U 1ZZZA 1T31A 2ZEBA 5LPRA 4DOQA 5TCCA 1S6FA 3SI4H 2PUQH 5DG6A 1VCWA 1YP9A 2Z9LA 3ZVEA 1CE5A 1GJDB 2NU0E 3UWJH 1HXFH 3DCLA 2LPRA 1ELBA 1XMNB 1ARBA 3LIWA 4P00A 2P8OC 3TPIZ 3BTME 3GY5A 3UNRA 1VITH 2A2XH 1GI9B 4X6PA 1NRPH 5ETXA 4XFQA 2ANYA 4XD7D 4BTUB 2TGPZ 1V2QT 1Z8GA 2VIDA 3IG6B 5GNDA 4MNXA 2ZFTA 3T25A 3M35A 3PRDA 4X6NA 1Y3WA 2BLQA 1TQ0B 4ABFA 1ZPBA 2Q6GA 1QTFA 4E06H 1D6WA 1LQEA 1GBBA 2BDHA 2BY7X 2FX4A 1VZQH 1W12U 4Y71A 3NUMA 3MO3A 3TJOA 2GZ7A 1EQ9A 2HNTC 4ISOA 3KQDA 4MTBA 1GMCF 3SGAE 5FBIA 1C2FA 1ESBA 1O36A 2ODQA 2SGEE 1QBNA 2ZPRA 4I86A 3GY7A 2LNCA 3VG8A 4LOYH 2VVCA 2Z9JA 7GCHF 5EW1H 1CHGA 1G36A 3MU0A 1VCPA 4B2BA 4D7FA 1O3AA 2GDDA 1YYY1 3RU4T 1GVLA 4UFDH 1EZUC 5DN6D 1MD7A 1YPEH 1SGYE 1UVSH 1MTVA 3V13A 3FZZA 1HPGA 2JKHA 4KGAA 3RC6A 4WH6A 2OQUA 5GCHG 5F53A 1G2MA 2EEKA 2ZC9H 1T8LA 1NRSH 5EJZA 2F9UA 3ATMA 3PV2A 1E36B 3S0NA 4I8JA 2G5NA 4Q2KA 3LC3A 4OGYA 2QXIA 1EPTC 3UOPA 2KM0A 1VCQA 3SHCH 1HAVB 1N1LA 1RJXB 4AB9A 2W6JD 3FAOA 4BXSA 4XBDA 1GHYH 1QJ7B 1RGQA 3E3TA 1LHGH 3RLWH 1O37A 4AORA 3ATKA 5EXNA 2M5TA 2THFB 1GBAA 4ISLA 1GVKB 4A1VA 4X6OA 2R2WU 4X1RU 1S85A 1EATA 2WPIS 2JJ1D 3TK6A 5DKMA 1V2MT 1VJAU 4X1NU 4UE7H 2GD4B 1QA0A 2Y6TA 2WPHS 3DD2H 2F9BH 4X2YA 3TH4H 4ZXXH 2JH6D 2ZCLP 5DP9A 1P03A 2O8LA 1M9UA 5T6GA 4NZQA 3PLPA 1BRAA 1DWDH 3ATLA 3BG4B 1O2GH 3N7DA 1P3CA 2J95A 1GBJA 3V7TA 3GYMA 1K1MA 1EJNA 3ODDA 2RDEA 1FJSA 1TLDA 1PFXC 1ZPCA 3RC4A 1XUKA 3GY4A 2W26A 2QF0A 1MAYA 1ZR0A 3WWBA 3GCOA 3DSOA 4NSYA 5LPFA 3B8JA 1FIZA 1K1OA 2BD3A 3AAUA 1N8OC 2AMPA 3LGTA 4CR9A 2SFAA 1YGCH 2ZNKH 4ZHLU 1GBHA 3T62A 2W3IA 1B5GH 2A0QB 3M36A 2XBYA 4CRBA 4ESTE 3QX5H 2FXRA 4B74A 1Z6EA 1DSUA 1W7XH 1YPHE 2GCTB 3QZQA 5EODA 1SLWB 1TNGA 3DUXH 3BEFB 2ZDMA 4IBLH 1IQLA 3EE0B 3JZ2B 1DLEA 2YNBA 3BIVH 3F2FA 6ESTA 2ZFQH 1GCTC 2QF5A 4ABBA 1UO6A 1XVMA 1ZRKA 1BMLA 5DP3A 3M3TA 2GDEH 3F0PA 4WXVA 1JRTA 1O3NA 4X1QU 1DWCH 1JRSA 1L1JA 2FOBA 4BAQB 4WWYA 2XC0A 1QZ8A 2QE7D 4B75A 3SU1A 3SU6A 1TPOA 3UOUA 3A88A 3H5CB 4YTAA 4ACBA 3GYLB 1AVGH 1O35A 1AN1E 4I32A 1TX6A 1EAIA 1GBLA 3DT0H 1THSH 1P12E 2BD9A 2VVUA 3PROA 1XX9A 1FMGA 4K2YA 4CRCA 5C5NA 2EY4C 2WINI 1A0HB 2VGCC 3QUMP 2OQ5A 1HAXB 3A8AA 1CHOF 1LVOA 1TNKA 4YT6H 3AVZA 3LC5A 5AF9H 5EIYA 2A5IA 2B0FA 1C5SA 1YPLH 1MAXA 1DUAA 3QTVH 1OP0A 1WBGB 2ASUB 1HAOH 2ZU2A 2BZAA 2JH5D 2PKAA 1H1BA 1SB1H 2D8WA 2BDBA 3SUFA 1T8OA 3PV5A 3LGYA 2BLVA 5A8YA 3GCTF 2XNDD 1ZHRA 1P8VC 3MWIU 1FLEE 4P02A 4I7YH 3BSQA 4K69A 7ESTE 1IHSH 3F6UH 2RDLA 3E90B 3UY9A 3NCLA 2ZTXA 1ZYOA 3FVFB 3TNTA 2BY5X 3F0OA 1UVUH 3BN9A 4GUXA 4YOIA 1HLTH 2GTBA 2QXGA 4HI3A 1AVWA 1C5QA 3HK6B 3LH1A 4TY6A 4LXBH 2G52A 4YLUA 5C2ZA 1PYTD 2F9VA 3VPKA 1QBOA 1GHVH 2TBSA 2PSXA 2W7SA 4JYVH 2FDAA 3ZVDA 1C1PA 2K8IA 1C1MA 1VR1H 2STBE 4MNYA 2JETB 2VNTA 3LKWA 4CRDA 3MH6A 1NFWA 2XC5A 1SGEE 2Q6FA 3BG8A 1A3EH 1CT4E 2XCFA 3VFEA 1AZ8A 3C27B 3ZZBA 3F68H 3A7VA 3M61U 1J14A 5EG4A 1MZDA 4Y0ZE 1DT2A 3A89A 3NWUA 1GBMA 1DM4B 4ASUD 5C94A 5JBBS 1O5EH 1QJ1B 3HGNA 1GG6B 4INKA 1KXDA 3RXLA 4B73A 1S81A 3SGBE 3K65B 5EW2H 3RXSA 1DUEA 2A2QH 5JDUB 3BTFE 4Q7YA 5SGAE 1B0EA 3JZ1B 3SZNA 4ABHA 3H7OA 4INHA 2BY9X 2HPPH 1Z8IB 5HGGA 1ELDE 1IAUA 3QK1A 1A0JA 2IPQX 4XE4A 4D9QA 1KXBA 1ZGVA 4H6SB 1C2JA 4B2CA 1YCPK 1GHBG 1GJ9B 3OAAD 1C5OH 1QL7A 1VITF 2BB4A 3D49H 3MU4A 4MPXA 2F91A 3TJNA 2SNVA 2OC1A 1EUFA 1KXAA 2VIOA 1O3EA 1BTXA 1KLTA 1SLVB 1YWUA 3FP7E 3MNSA 3UQVA 2FI3E 2OC8A 3RMOH 3RXCA 4CHAB 2EA3A 1HJAB 1ANEA 1VGCB 4A1TA 5FCKA 4GCHG 2XC4A 4I33A 1G2LA 1BMMH 1MTNC 1SG8B 3ZYEA 4CBOA 1GL0E 3A7ZA 4D76A 4I8LA 3M7QA 1O31A 2GVFA 4UFFH 2JH0D 1P57B 5A2MH 4NA7A 1HAVA 2YNAA 3UFAA 3VB5A 1KLIH 3M3VA 1FY4A 4Z1MD 2XWAA 2C93B 3MU5A 3A7TA 2XRCA 1OWHA 3ATWA 5PTPA 2ZTZA 2J5UA 1XVOA 3PV4A 1IQMA 2A31A 1AWHB 1MTUA 3RXJA 3NKKA 1IQKA 1GBKA 3Q77A 2GMTC 1CU1A 2CF8H 2UWPA 3CP7A 3QTOH 3A8CA 3MU8A 5AHGH 1GMHF 4XBCA 5EGMA 3SNEA 2ZGXH 1QB9A 1GGDB 1NN6A 1PPGE 2BZ6H 2FX6A 4ZROA 1RS0A 3A8DA 3D23A 1TX8A 1WCZA 4VGCB 1EJAA 3OSYA 1XM1A 3LT3A 1A5HA 4XOJA 1HUTH 1CQQA 1ESTA 1TGTA 2Z94A 3S7KB 2KCOA 4JMYA 5DO4H 4BAHB 3H7TA 4RSPA 4X2WA 4ZKRU 1AE5A 1RRKA 1V2VT 3RDZA 2FS9A 1OS8A 2GGVB 1ACBE 1SKYE 2VH6A 5L2ZH 4ZXYH 3OEHD 2C8YB 3P70B 1KLJH 2ZP0H 4UD9H 1EASA 2BX3A 2QN5T 5K7RA 1XXDA 1GBFA 1ZTLA 5T6FA 1CBWB 2OP9A 2V3HH 3SU5A 1A2CH 3AW0A 8KME2 1GI7B 1ZGIA 6GCHF 2ZF0H 3OTPA 1TB6H 4K3JA 1A3BH 4CH8B 1GHXH 3CS0A 4IN2A 3U8OH 1TPAE 2F4LA 2WV9A 1O2ZA 1H8DH 3FO8D 3TVJB 2QCYA 1INCA 4CREA 2LP6A 5JBAS 2CHAB 4NWLA 3GY6A 2ZFFH 5F03A 3S69A 3TK9A 2Q1JA 1SGNE 1W0KD 3A87A 2WYGA 1AB9C 1FAKH 1H8ED 4DT4A 1IQFA 1LHDH 1S84A 3SV6A 2RCEA 2VBCA 1FPHH 3P8OA 4NIVA 1C1OA 5AFZH 5IK2D 3ESTA 4HZHA 8GCHG 1TOMH 2ULLA 1IHTH 5HKKD 1UHBB 2CK3D 2OBQA 3KEEA 1RTLA 4DURA 1YC0A 2PUXB 3WY8A 3LPRA 3A8BA 4JYTA 5CMXH 3VEQB 4X0WU 3NPSA 4MPVA 1F92A 1OWKA 2BD7A 3MH4A 4ACAA 1BRUP 4OS4A 1J17T 2F43B 2XOKD 3M3SA 5A0AE 5DP8A 1K1PA 1T4UH 3HGPA 1OWDA 3DHKH 1V2OT 2F3CE 2SGQE 1E0FD 5LPEA 3KQEA 4CRFA 2Y82A 1SSXA 3RXOA 2UUJB 3SNBA 3SHAH 2VJ1A 4TY7A 4ABIA 3W94A 4ZUHA 5JYIA 2BX4A 8ESTE 3LGUA 1O2KA 4TPYA 3EYDA 1CA0B 3RMLH 4AX9H 2ZFPH 5C0UA 1PPBH 1V2RT 2A7HA 5C1YA 3LGIA 2R0KA 3OEED 2AERH 5EJLA 2GJGA 1SLUB 1TAWA 2ZO3H 4JCNA 3VB4A 2P94A 1GMDF 1AFQC 2BHGA 3RUOA 1WUNH 1Y5BT 1YPJH 3OE7D 4CR5A 4GAWA 4GSOA 1PPCE 1KTSB 2ZFRH 2QC2A 1PQAA 5EU8A 2FOMB 1IQIA 1D4PB 2FWWA 2VWNA 1ZHMA 1V2UT 2CGAA 2AYWA 1MUEB 3RXDA 3TK5A 2ZGBH 1O3BA 1OWEA 3N7EA 2M2AA 3K6YA 4AG2A 5AFYH 1AI8H 1W2KH 2VB0A 1BTHH 4SGBE 1OHHD 3D65E 1WAYB 4AYVB 3BTGE 3SW2B 1K1JA 4ZKOU 2RFKC 2VIVA 3O8CA 4AC9A 2FYRA 1UW7A 4AFZA 1C2EA 1DY9A 3OX7U 2HLDD 2VIPA 4JZIA 3RM2H 3A84A 5F8ZA 1SQAA 1FONA 3Q3XA 1FV9A 1BJVA 2STAE 3LU9B 3N7OA 2XBXA 3D62A 3PMHB 4B6FA 1YY3A 1C2GA 4XBBA 1CA8B 3SV9A 2ZGHA 1K1IA 3SV2H 3UPEA 1HDTH 3BTWE 4NIXA 2J2UA 1MTWA 3KNXA 5GDSH 5C3NA 3U9AH 1THPB 6CHAB 1QB6A 2TGAA 2Z9KA 3F9GA 4QT8C 1GI0A 1P2NA 3KN2A 4Y7BA 4CRAA 2FOFA 1AFEH 3IITA 2WUCA 2BQ7B 1C2IA 1NY22 1PPZA 3E1XB 3UWIA 2PP6A 4O97A 2BYAX 4ZHMU 1UK2A 4Y0YE 1MMJN 3F2HA 1TBRH 3R0FA 1ZTJA 4BXWA 4TYDA 3FN8A 1J15A 1KTTB 2LELA 4OS7A 1T8NA 3SQEE 2SGAA 1AO5A 1DXPA 2FOHA 4THNH 1QBVH 2A4RA 5AVDA 2FIRH 1BRBE 1FDPA 1ZRBA 1IOEA 2ANKH 3AAVA 1MKXH 3T26A 4BANB 2AHME 1AGJA 3ZZ3A 1O3CA 4K1TA 3TJVA 3ENSB 1GBEA 2BOKA 2FZZA 1C5MD 1PPHE 1IQGA 1SGPE 1O2NA 2IJOB 3UREA 2BVSH 3SJKA 1L0ZA 2PSYA 5FX5A 2DE8A 4UDWH 3T29A 4NA9H 1ETRH 1H4WA 1C5PA 1W14U 2AGIX 4FUBA 2J4IA 1ZHPA 1Y5AT 1P2OA 2C8XB 2PHBA 4ZHAA 1O5DH 1D3QB 5H4IB 1D3PB 1K21H 1O3HA 1G37A 3ZZDA 1P02A 4NIYA 5CHBA 1BHXF 1SC8U 2WPLS 1C5NH 2C8WB 1EZQA 1AQ7A 2GKVE 5T3HA 3URCA 2A4GA 1EZXC 1N6YA 5BRRE 4I31A 3TGIE 3SQHE 3BG4C 1JIRA 2ZPSA 5GCHF 1ZTKA 5FCRA 1E79D 1PPFE 3UAIC 4XRNA 4KP0A 3NK8A 1O2TA 2NU4E 1A1RA 3ZVGA 1FI8A 5A8XA 3HATH 1TFXA 4GVUA 1MZAA 1TRYA 4CH2B 3TGKE 4MNVA 3UQOA 4JK6A 2GZ9A 1TIOA 2V3MA 1ARCA 2HNTE 1W10U 3RXFA 1TMTH 1BOQA 2H9HA 5DP5A 2CV3A 4KELA 5HM2A 1EAUA 2ZDAH 1P2KA 1MKXK 1UK3A 1F2SE 1HFDA 3B23B 1UVTH 1UVPA 5DGJA 1ZMNA 5C67A 2A7JA 2BDIA 2TPIZ 3MO6A 1JXPA 1PQ8A 2H1UA 3KHVA 3WWFA 1WTGH 1SQRA 3EE7A 1V2LT 5KEDA 1QA7A 4ZKSU 4OS5A 3SJ8A 3SJ9A 3NXPA 2Z3CA 3TJUA 2J92A 1J8AA 2ZHFH 4DG4A 4B1TA 2BY6X 2HWLB 5DP7A 4U01A 1TMUH 3E91A 5BPEA 1C1WH 1O5CB 1YLCA 1A61H 2FTMA 4ISHH 3M5OA 3U28C 4MVNA 5IDKA 1MCTA 4HGCA 3PM3A 2QIQA 4X8UH 2OC7A 1PPEE 2Z3DA 3A80A 1KXEA 3PLBA 3ATIA 1N6XA 3RXHA 1K0HA 3PTNA 3T5FH 3TH2H 1CGIE 3LJOA 2W5EA 4A1XA 1LCYA 1A7SA 4KKDA 4Y10E 1AZZA 5F8TA 1GI1A 1UHBA 3RXEA 2WPKS 4NWKA 1T8MA 3ZZ5A 1QQUA 3I77A 4K5ZA 2FS8A 1MCVA 1KDQB 2PW8H 5L30H 3GISB 3MO9A 3F1SB 3SU0A 1XUHA 3EA9A 2GT7A 1HB0B 3ELAH 7LPRA 4AGKA 1UJ1A 1MU8B 1T32A 2O8WA 4YT7H 5LH8A 4H4FA 1QIXB 2ZG0H 5FX6A 1TWXB 2VINA 1GPZA 1AD8H 3ZZAA 1DE7H 5C20A 2BD4A 2K1QA 2UWLA 3SI3H 1EJMA 3S9AA 4TSFD 1Z8RA 1EB2A 1TABE 3T28A 2J97A 3SUGA 2WPJS 1P11E 2H9TH 1MBQA 4X8TH 4ASHA 4F55A 3O8DA 4Y8YA 2G5VA 4E05H 3E6PH 1OWJA 2F9PA 1O32A 2PGBB 1C5XB 1F5RA 2QXJA 2BQWB 4ISIH 2WPDD 1E1QD 3SNDA 3RXVA 2PKSB 2V7QD 2SNWA 3VXEH 1YCPH 2W3KA 1OP8A 1DICA 2P16A 1E35B 4JK5A 4ABGA 3N99A 4GLYA 4E7NA 2ZU1A 5C17A 1V2NT 5I46H 1HV7A 4IC5A 4RT1A 2Y5FA 4OS6A 3QLPH 4Y7AA 1TNHA 2OK5A 4DT7B 2HOBA 3RLYH 2R3YA 2V35A 1V6DA 1EXFA 2EI7A 2XBWA 1W0YH 1SVPA 5B6OA 2Y5GA
chains in the Genus database with same CATH topology
2JETC 3L33A 4KTSA 1HJ8A 2FM2A 1O3LA 5LGOA 1F0SA 2AMQA 1C1RA 4AZ2B 5K0HA 1LPZB 2CJIA 1ANBA 1PQ7A 2ZDNA 3RXKA 1BQYA 2V0BA 1E38B 2A5AA 4U32A 4FUGA 5A8ZA 1FIWA 3PO1B 1ESAA 3EA8A 4SGAE 1GG6C 4DVAU 1BDAA 1WTHD 3P8FA 3BV9B 4RKOB 4X2VA 1ANDA 1W8BH 4X1SU 1HAIH 2C3SA 1ELCA 4U2WA 2FOGA 4GHTA 4Y8ZA 1AU8A 1GHAG 2AH4X 1BTZA 2ZHWH 3PMJA 2EI8A 3SNCA 1Y59T 1C2LA 2J94A 1K1LA 3M5LA 1PYTC 1GJ4H 1C5WB 1LMWB 2IOTA 2D26C 1NRQH 4WXIA 2QXHA 4MDSA 1ZSLA 1O2WA 1QRXA 3SJIA 1C4U2 2FI5E 2P93A 1IQEA 3MYWA 1YPMH 4MNWA 3BTHE 2ZIQH 4CHAC 1HJAC 1Z6JH 1DY8A 3URDA 1O2XA 1V2PT 1C2KA 3QGNB 3RU4D 1VGCC 2G55A 2GX4A 3LH3A 2NWNA 4I8HA 2CMYA 5ESBA 1GBTA 1P3EA 4JYUH 4J1YA 1HRTH 3A7XA 1MQ6A 3G01A 3MH5A 4DGJA 2VH0A 3OY5U 5ABWA 3OU0A 1GJ7B 2F9NA 1UTJA 2B7DH 2IN2A 2G4TA 1JWTA 5HXFA 1GI5A 1AUJA 1XKBC 5EQSA 3RXRA 1SI5H 3SU2A 3GDSA 3VB6A 2OCVB 2AGEX 2FO9A 1XKAC 1FY1A 4WVPE 1CVWH 1BTUA 4TWYA 1O2YA 1QNJA 1O2SA 1XUFA 2WUBA 1ZMJA 3V0XA 1X7AC 1GHBF 1TGNA 1Y3XA 3GICB 1WQVH 2ZHQH 4K60A 4A5TS 1H8IH 3F9EA 4VGCC 2HPQH 4AFSA 2ZCHP 2VIQA 1QL8A 4NCYA 3B9FH 2BDYA 4GCHF 4AGJA 4UEHH 2Y80A 1UTLM 2A7CA 3RXPA 1P09A 1O2OA 3SUEA 3U1IB 4YOJA 4BAOB 2BOHB 1BZXE 1KXFA 1ZSKA 3BIUH 1CT2E 4DY7B 3LGWA 1ZLRA 1SR5C 2OINA 4FUJA 2HRVA 4FVDA 1O30A 1NFXA 3Q3KA 2C90B 1BTPA 3P17H 1P9SA 1JOUB 4FUHA 1A4WH 1KXCA 2FLBH 2Z9IA 1NPMA 1U6QA 5HMAA 3K6ZA 3ZV8A 3VB7A 1V3XA 1C5TA 3HPTB 4GPGA 5I25A 4NFEA 5DP6A 1AMHA 5GIBA 1C2HA 1SFIA 3ZYDA 1OYQA 1W13U 2A1DB 1O5AB 2ILNA 4YESB 1W7GH 2ZGJA 2EI6A 1THRH 3PLKA 4FUEA 1C1TA 3EA7A 3GCHB 5EPNA 1BCUH 2ANMH 1FXYA 1WYKA 2J38A 2ZHEH 1RFNA 3MU1A 5A09A 2CHAC 3M5MA 3T2NA 4YZUA 3VB3A 5CHAB 1SBWA 1SQTA 1WV7H 3QZRA 5EOKA 5C5OA 3DA9B 4KTUA 1G3BA 2O9QA 1FN6A 1O5BB 2A4OA 1RD3B 1J16A 1LQDB 1GJ8B 1P06A 1HIAB 1O0DH 3RXTA 1QL9A 2I6QA 4Q7ZA 7KMEH 1HGTH 2Z6BD 3U8RH 1QHRB 1LTOA 2Z7FE 2VWLA 3OY6U 2B8OH 1S0QA 2BLWA 2XXLA 1CGJE 1KDQA 1O3GA 1OPHB 2GT8A 1G3CA 3RC5A 3VGCC 1SGFA 4TWWA 3BTTE 4B76A 1DS2E 1LHFH 4WF8A 3QWCH 1O33A 3RU4E 1YPGH 1ELTA 1SOTA 3ITIA 2FP7B 1UTMA 2GCHG 2FODA 1UCYH 5L2YH 3A83A 5J4SA 5EQRA 4LZ4B 1P10A 2OC0A 4A92A 2BDGA 1Y3YA 1GJ5H 5IYTA 3GY8A 1O3MA 1C1QA 3FZDA 1RIWB 4ABDA 1BTYA 4J2YB 4MQAA 4Y6DA 1TPPA 4AYYB 3ZZ6A 1F7ZA 1S82A 1GI3A 2G8TA 1KYNA 1CA0C 1SPJA 3BTQE 1L4DA 1O34A 5GXPA 3SNAA 1DDJA 9ESTA 1C9PA 2ZU5A 1C1NA 1NO9H 3SGQE 1NU7B 4FUDA 3DFJA 1DFPA 3E0NB 1MU6B 3MNXA 3ZZCA 1ETTH 8GCHF 1G3EA 2ZPQA 1GL1A 1O3KA 3QN7A 1EB1H 4A7IB 4RKJB 2W7UA 1UMAH 1BTWA 3GDVA 3MFJA 1TNLA 1TA2A 1GMCG 2TGTA 4AB8A 2D1JA 2KAIB 1AUTC 1AFQB 1OP2A 2PGQB 1Q31A 3KCGH 1G9IE 2VU8E 3STIA 1O3IA 3SN8A 1TGBA 4MLFB 3LONA 3TH3H 2VWMA 7GCHG 4R8TB 3V3MA 2WV4A 4BAKB 2XBVA 4IGDA 2AIPA 2AEIH 2R3UA 1TALA 1TYNA 4RN6A 2B5TB 4WJG2 1Q2WA 1UCYK 2QYIA 3PMAB 1HCGA 2P8OB 4O03A 5EQQA 3ZZ4A 3UTUH 1Z7KA 1VJ9U 2ZHDA 1EP6A 2XTTB 3SUDA 2H5CA 1E34B 5C1XA 3P8NA 3E8LA 1SGTA 3QGJA 1UTKA 1NRRH 2PTNA 1HAYB 1UTOA 1LO6A 4F49A 5E8EH 1AVXA 6CHAC 1Y3VA 1SFQB 1HXEH 1SHYA 1P05A 3M7TA 1GHWH 4JZFH 5JBTA 4XDEA 1CT0E 4JZ1A 1GI2A 2PTCE 3MOCA 2QAAA 1EOLA 1ZJKA 2QGRA 5HM9A 1S6HA 4Q80A 3L3TA 1ELAA 2AGGX 1XXFA 1UVOA 1EX3A 4AG1A 1C4V2 2IPHA 3TNSA 4DIIH 1DLKB 5EXMA 1YPHC 1YF4A 3HK3B 2BLOA 2ZU3A 1F0RA 1A0LA 4E7RG 1TQ7B 1SGCA 3SU4A 4FU8A 2A32A 2FTLE 3ODFA 3RMMH 1T7CA 2ZA5A 1DPOA 1TBZH 5DK1A 1O2PA 4F4OC 1L4ZA 3AW1A 4K1SA 1IQJA 1S5SA 1K9OE 2SGFE 4DJZB 1AIXH 1LKAA 2ZU4A 1EPTB 1GDUA 1SGFG 1F5LA 1BB0B 1S0RA 4LZ1H 5F8XA 1O2JA 2O8MA 2D2DA 3MMGA 5L6NH 2Q6DA 3RXMA 3M7UA 3BEUA 1HAGE 2ALVA 1ID5H 4B2AA 1LHEH 1TA6A 2V3OH 1KIGH 3PMBB 1O5FH 3SV7A 1QFKH 2HALA 1Z8JB 3ZVFA 1QGFA 3OYPA 2SGPE 2BDAA 2HGTH 5EXLA 3UIRA 2C8ZB 1ORFA 2A4QA 4H6TA 4HFPB 1LHCH 3SO3A 1JMOH 1L1NA 1AY6H 5FPSA 1GJAB 5FPYA 1UK4A 1EKBB 5JBCS 4AOQA 2BVRH 2H5DA 1FZZA 3BEIB 3RXBA 4X8VH 1AWFH 4UFGH 4NG9H 3A82A 1GBDA 2P3TB 1O2UA 3KGPA 4FUFA 1O3DA 1ZPZA 2V6NA 1G32B 1NM6A 3UUZA 1O39A 1GHZA 1B7XB 3ZZ7A 1F0TA 2P3UB 2AFQB 4FVBA 2OUAA 2O8TA 1Q3XA 1YKTA 3A7WA 1QCPA 1TGSZ 4FU9A 4X6MA 1C4Y2 1SGQE 2ZQ1A 1G3DA 1C1SA 1P2QA 3RMNH 3TLOA 1TBQH 1YCPM 1OKXA 3VXFH 1ZSJA 4MPUA 1N8OB 1C5VA 2G00A 1A46H 2GCTC 1UTPA 1Y3UA 1QR3E 3GY2A 1O2RA 2P59A 4K8BA 2GV7A 2BXUH 3QO6A 3O8RA 4IN1A 1NTPA 3UR6A 4NSVA 1CHOG 4IMZA 2I6SA 1GDNA 1V2WT 4D9RA 1PQ5A 3AASA 1SOZA 4BTIB 4XSKU 3DFLA 3U8TH 2AMDA 5GWZA 4K8YA 1ETSH 1QB1A 1BHXB 2PV9B 2FI4E 1GCTB 1HIAA 4WMEA 4B71A 3SJOA 1E37B 2R9PA 4HTCH 1TPSA 3MNCA 4X1PU 2YOLA 4YO9A 3GCTG 3PWCA 2UUKB 1OWIA 4M7GA 2ZWLH 1GWAA 1QY6A 4Z6AH 1BBRE 1EP5A 1C2DA 1Y8TA 3CS7A 1BT7A 4Q7XA 3TGJE 1IQNA 2BMGB 1NU9A 1FY8E 1QJ6B 1TE0A 1GBCA 4MPWA 1AE8H 4AN7A 1HAPH 1OSSA 1QURH 1ELEE 1KSNA 1YM0A 3RP2A 3KL6A 3ZVBA 5FHTA 1DWBH 1Z71A 1V2TT 3I29A 3RXAA 4A6LA 3RXQA 3K9XB 1LVMA 1O3PB 2BM2A 1QRZA 1NC6A 3Q00A 3FANA 1K1NA 1JIMA 2OD3B 1K2I1 2Y5HA 2VGCB 1P2JA 5JPMH 1W0ZU 2AS9A 2A45B 1C5RA 1UTQA 1GI6A 3EAJA 5F6MA 4DCDA 2EC9H 5E2OA 3SORA 1IQHA 1K28D 1WQSA 3BTKE 2FESH 2HLCA 3S9CA 1XUIA 4GHQA 1D6RA 1TX7A 2ANWA 2GV6A 2RG3A 3KF2A 3HKIB 3FFGA 3HKJB 3K2UA 4ABJA 4O3UA 1AHTH 2PKSC 2ZECA 5A0BA 1L2EA 1BBRH 4LK4A 5DJ7A 1AKSB 1LKBA 2ALPA 2BD8A 1A5IA 5HYOA 4Z0KA 2BDCA 2QF3A 3TIUA 1SGDE 1O3FA 2ZDLA 1D3TB 2KAIA 2B9LA 4UFEH 3GCNA 3KQBA 1SGRE 2H6MA 1D9IA 1O2MA 1V2JT 3SBKA 2TRMA 1C5YB 3UNQA 5GPIB 1BMNH 3MH7A 1RTKA 2ZI2H 3EQ0H 2PWXA 4NFFA 1ABJH 1GVZA 5FAHA 1DOJA 4BNRA 2BVXH 4O9VA 1VITG 5C1UA 2OLGA 3P6ZB 1F0UA 4OS2A 2ZKSA 2XNIA 1EAXA 1TMBH 1GCDA 5TCAA 1K22H 1O2HA 2AIQA 3P92A 4JZEH 5ESTE 1C1UH 4ABEA 5G4BA 1NRNH 5FPTA 3ZZ8A 2PR3A 1TRMA 2OBOA 3PO1C 3MHWU 2Y7XA 1ANCA 1GJCB 3MTYA 5FXLA 1LDTT 2XCNA 2G51A 5J4QA 2O8UA 1NFUA 3RXIA 1OXGA 1FQ3A 2CF9H 1SMFE 3NZIA 1FPCH 4IS5A 1TNJA 1DITH 4IC6A 3IWMA 1J9CH 4WMDA 1W3CA 4NA8A 1P9UA 1OYTH 3E16B 1BBRK 1ELVA 3GDUA 3Q3YA 4IMQA 1BUIA 2DE9A 3V12A 1MD8A 1ABIH 4WY3A 1SL3A 1MKWH 1GMHG 2GZ8A 2RA3A 4NIWA 1TOCB 6LPRA 3A86A 1MBMA 1TONA 3KIDU 2NU1E 3SV8A 2BXTH 3R3GB 3SU3A 2Y7ZA 1DSTA 2J9NA 2PLXA 4OGXA 1WSSH 1QRWA 1JBUH 4X2XA 1GI8B 3PTBA 3A7YA 1B0FA 1NESE 2ZQ2A 1P0SH 4R0IA 1HYLA 1MTNB 2GP9B 3GOVB 2RA0A 1RXPA 2BTCE 1EPTA 1WOFA 1Z1IA 3C1KA 1GHAF 3GY3A 2SGDE 4AFUA 1C5ZB 2F83A 1ELFA 1L1GA 1LPGB 1P2IA 5T6DA 4K1EA 4KTCA 4ZAEA 2CN0H 3P8GA 2FMJA 2QA9E 4JZDH 1C5LH 5A0CA 2ZFSA 1CO7E 3W95A 1GGDC 1H9HE 3RM0H 3RXGA 6GCHG 1DWEH 4ZMAH 2GMTB 1GJ6A 2BY8X 1FAXA 3ZVAA 1BJUA 5CE1A 3ZVCA 1YPKH 3I78A 2F9OA 2Z3EA 2P3FH 2P95A 1MH0A 1Z1JA 2DUCA 5E2PA 4ZH8A 1EZSC 1HNEE 1BMAA 3U69H 3TITA 2ESTE 1QQ4A 1MKWK 2CXVA 1HAZB 2FPZA 2OTVA 2ODPA 4MG3A 1SLXB 2J34A 1C2MA 1HBTH 2WYJA 1NS3A 2G81E 1KY9A 3ZZ9A 1NROH 4DW2U 3Q76A 1SHHB 4YM9A 3ZV9A 5TJXA 1DX5M 3RXUA 1BIOA 5E0GA 1GJBB 3FP6E 3S9BA 1P2MA 1HJ9A 3EDXB 1CBWC 1O38A 2BD5A 2NU3E 2H2ZA 1GI4A 3UNSA 4FUIA 2UUYA 2FOEA 2ZGCA 2PFEA 2UWOA 1UCYE 5JB8S 1SGIB 1S83A 1O2LA 3PB1E 4ABAA 3LJJA 1NFYA 1HAHH 1UTNA 1V2KT 3GCHC 3S7HB 1ZJDA 4NGAH 4CRGA 5EPYA 5DP4A 5FBEA 3MNBA 5CHAC 3FP8E 4AFQA 1O3OA 2WPMS 2XW9A 3U98H 1F5KU 3U1JB 2ZCKP 2XWBI 1TRNA 1SQOA 1CSOE 1MTSA 1W11U 5E0HA 1O2VA 4I8GA 2QV1A 4X8SH 1AB9B 4D7GA 1DXWA 1C5UA 3L6PA 3BTEE 4O3TA 2ZTYA 1BRCE 3P95A 2H9EH 4OS1A 2ODYB 4U30A 3KQCA 3EGKH 3LGVA 2VVVA 1A5GH 4CBNA 1Y5UT 2Z9GA 1V2ST 1P04A 4DIHH 3PYHA 1NZQH 1H9LB 4FUCA 3BTDE 4BTTB 1BA8B 1GMDG 2C4FH 4ISNA 2TGDA 4IW4E 4Y79A 2WV5A 1D3DB 4TPIZ 1DVAH 4Y11E 4I8KA 2UUFB 1PJPA 3QDZB 4WMFA 1XUGA 1O2IA 3M37A 1C1VH 2ZDKA 2XYAA 2TIOA 3TU7H 2OXSA 3SOSA 3OTJE 3O8BA 3VGCB 1ZMLA 1XUJA 5JB9S 4YLQH 3CENA 5DPAA 1FNIA 8LPRA 1FN8A 1NT1A 3LDXH 1YLDA 1RIWC 2HVXA 3BF6H 4UONA 2ZDVH 3LOXA 3F9FA 3STJA 9LPRA 1O5GH 2R2MB 3MI4A 1TNIA 4YOGA 1MQ5A 2PKAB 2QY0B 4INLA 4BAMB 2Y81A 1G30B 1CGHA 3M5NA 3UR9A 4ZKNU 1T4VH 2BD2A 1O3JA 5GJ4B 4PROA 4Y76A 1LPKB 1AKSA 1GDQA 2VWOA 4FU7A 3PWBA 4NZLA 3A85A 1P01A 1EOJA 2FLRH 4WH8A 1H9IE 2FEQH 2G4UA 4BOHA 1C9TA 2NU2E 1EAWA 2HNTF 1FUJA 1O2QA 4FXGH 1BITA 2A5KA 2BQ6B 1OOKB 1LVBA 3T27A 1WU1A 2VIWA 1ELGA 1TGCA 4Y8XA 1YBWA 2FOCA 5E0JA 3E0PB 1FY5A 2FYQA 1DANH 3F9HA 1GBIA 1LVYA 1OX1A 2FOAA 2ZZUH 1ZOMA 4D8NA 2R0LA 3A81A 1RTFB