4GSOA

Structure of jararacussin-i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Jararacussin-I: The highly negatively charged catalytic interface contributes to macromolecular selectivity in snake venom thrombin-like enzymes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Thrombin-like enzyme BjussuSP-1
total genus 45
structure length 232
sequence length 232
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA02
1NFWA 3N7OA 2I6QA 2ZDVH 3TJOA 3DFLA 1RTFB 4TY6A 1OPHB 1TE0A 3M61U 4J2YB 1Z1IA 2SGAA 3IITA 1PQ8A 4IN1A 1TRYA 1EP5A 1Z1JA 3DFJA 2OUAA 2BD9A 2YOLA 3PM3A 1VJAU 4R8TB 1IQFA 1KTSB 5AHGH 3NCLA 1P9UA 5L2ZH 4YO9A 2SGEE 3RMLH 1K1MA 8LPRA 3ZVEA 1EASA 3D65E 4FUHA 1MKXK 2PGBB 3A88A 4JK5A 3ZZ6A 4WF8A 2Y81A 3RU4D 3SNAA 6CHAC 1YPHE 2NU2E 1P06A 1TPPA 5HMAA 1SPJA 2BVSH 2TRMA 4FUEA 1HBTH 4IS5A 4CREA 4NIXA 2HVXA 2XC0A 4DY7B 2SFAA 1W0ZU 3E16B 1S84A 3O8DA 1ELVA 3ATWA 1CHOF 3T27A 4FUGA 3LOXA 5BRRE 4FUCA 3T2NA 1HLTH 1XUJA 1DY9A 1GBFA 1U6QA 4FU9A 3QDZB 4K60A 2ZF0H 3VB5A 1GI3A 2SNWA 2NU4E 1AU8A 1TAWA 1HAVA 4BANB 1BTZA 5AFZH 4GHTA 4CR5A 2C8ZB 2J2UA 1GDNA 4MNYA 2VWOA 1ARCA 4AGJA 2AFQB 2VIWA 3K65B 1EZQA 1P03A 1UVTH 5F8XA 3TNSA 3LU9B 2A4OA 3Q3XA 1QJ6B 1W0YH 2FO9A 2OQ5A 1W12U 1P2KA 1C5ZB 3TK6A 1S85A 1O2KA 4Y71A 5I46H 5JDUB 1Y3UA 2TGDA 1ZPCA 1EP6A 3SJ9A 1O3AA 2A5IA 1O3DA 2PHBA 3BTDE 1QQ4A 2JH0D 1RTKA 1UHBA 4NFFA 1LVBA 1YGCH 1TONA 2V35A 5E0JA 1BZXE 1AUJA 3VGCC 2ZGBH 1GJ9B 2WUBA 4B1TA 1EKBB 1O2LA 2R0KA 4K5ZA 4A7IB 1TOMH 1RRKA 2BZAA 3SV2H 1Y5AT 3RXMA 2BD5A 1DFPA 3MI4A 2BXUH 4NGAH 2K1QA 3A81A 3TH2H 1O2PA 2VVCA 2OXSA 3RXOA 4AGKA 4I8LA 3SNEA 2Z3CA 1TX6A 1CE5A 4DCDA 2F91A 2ZFRH 3ZZBA 4BTUB 1TLDA 4IMQA 1NPMA 1FLEE 4I7YH 3OY5U 1HUTH 4RN6A 3H7OA 5ESBA 1L0ZA 5L30H 1DS2E 1JIRA 1P2JA 1S0RA 1SGYE 1YPEH 3TIUA 1BRBE 2AGIX 1ETSH 3AAUA 4YT7H 1P2MA 3QK1A 2BQWB 2BY9X 2FODA 2VVUA 1O2HA 2W7SA 4Q80A 1THSH 3QZQA 4DIIH 2ZFFH 2F3CE 3IWMA 1CA0B 2W3KA 3GY4A 1QA0A 1AD8H 4NA9H 1QGFA 1DSUA 1BTUA 1DICA 1MZDA 2GZ9A 2EI7A 5HM9A 4MG3A 4JYUH 5EQSA 3RXKA 3QN7A 4AZ2B 3SOSA 2ZHQH 1SSXA 1XUHA 2VB0A 3ATLA 4TY7A 3SU0A 3PLBA 1SOZA 1HJAC 1F5KU 1F92A 1KTTB 1GJ5H 2Y7ZA 3LGTA 5DO4H 3EGKH 1N6YA 3AW0A 1NU9A 3VB6A 4UD9H 1SG8B 1ZTLA 2EC9H 1MH0A 2BZ6H 4KKDA 3LC5A 3V0XA 3KQDA 1Z8IB 1H4WA 3V3MA 2ZP0H 1T8LA 4K1TA 3T29A 2QCYA 3RXUA 1GHYH 1MBQA 3ZZCA 1CHGA 1O36A 3BV9B 1C1NA 1N6XA 3LGWA 2FZZA 2H5CA 2ZFSA 4HZHA 4BXWA 2GKVE 3MYWA 1CA8B 2WPHS 4LXBH 4INKA 1DT2A 1ESBA 5DP7A 4XOJA 3BG4C 4O3TA 1P9SA 1VITF 1AFEH 3GISB 3HGNA 4JZIA 2TPIZ 2V0BA 3SBKA 1A2CH 2Y80A 3VGCB 4KTUA 3P92A 2WYGA 4CRFA 2ZCLP 4ZXYH 5GXPA 2ESTE 1QB9A 2AS9A 2ZTYA 1O32A 3RXCA 1FONA 3SHAH 1G3DA 2ZU1A 1UTPA 3D23A 3TNTA 4Y0YE 3U98H 4AG1A 2ZDLA 2V3HH 3SN8A 1BHXB 1UTQA 2GX4A 5FBEA 4J1YA 2C90B 4B74A 2CF9H 4QT8C 1FI8A 4VGCB 2PLXA 1DXPA 1P57B 1A46H 5EPYA 1B7XB 5A8XA 3HKJB 1S83A 2F9VA 4OS2A 1Y3VA 2FS8A 1QBOA 1DUEA 4OS6A 1TQ0B 5FCKA 4CHAC 1GBTA 3GY6A 2Q6DA 1GHAF 1ZYOA 3G01A 2PKSC 4MPXA 8GCHG 1K1NA 3L33A 2ZWLH 2O8MA 5HXFA 3I78A 2BLQA 5F03A 1XMNB 4Q7YA 2W3IA 4ISOA 1XUFA 3BIVH 2EEKA 1BJVA 1EJMA 4FXGH 3ZZ5A 1CGJE 3S0NA 5DP5A 1C5XB 1TGSZ 1VITH 3F9GA 2A7JA 1LHGH 4K1SA 4Q7ZA 2O8UA 1XUIA 1N1LA 1BTPA 5JBAS 1GI5A 3LJJA 4U32A 1C5MD 3RM2H 8ESTE 5JB9S 2FX6A 4LK4A 1E35B 3CS0A 2BD2A 4GHQA 1SQOA 2BY8X 2BB4A 1LMWB 1T4VH 2O9QA 1P02A 4X1QU 5E2PA 1MTVA 2VWMA 3EA8A 1MU8B 3A8DA 4OS5A 1HJAB 1GHVH 2FWWA 1SFQB 3STJA 1O2RA 3SGAE 3UFAA 1G9IE 2Z3EA 1V6DA 1G30B 2A31A 3W95A 3T25A 4RKJB 3ZZ8A 1IAUA 1GI0A 2G4UA 3P70B 4ZKSU 4ZH8A 2QAAA 2XXLA 2OBOA 1A0JA 1ZPZA 1EX3A 9ESTA 1O3GA 2A5AA 3BIUH 1BBRE 2ODQA 4X1PU 2W26A 2UWLA 4NZQA 3LGYA 1A0HB 4SGAE 4CRGA 1A61H 5C3NA 2R3UA 3LJOA 2WV4A 1ABIH 2XCFA 4NSVA 1C2FA 1MTWA 2ZDNA 3ODFA 1K1LA 4ASHA 4KGAA 4Q2KA 4ZHAA 3STIA 3MO3A 2IPHA 4Z6AH 1GCTC 4AFUA 2LNCA 1XUKA 2Z6BD 1HAVB 1GMCG 3H5CB 3QTVH 1O30A 1GJAB 1L4DA 1HAYB 3MNSA 1QR3E 1TRMA 3K6YA 5T6DA 1PQ7A 7ESTE 2O8LA 1K9OE 4WWYA 3C27B 1HAPH 5CE1A 1D4PB 1S5SA 4X1SU 3GOVB 3RXFA 4AB9A 2FEQH 1LDTT 5ETXA 2OINA 1O5BB 3HGPA 1K1IA 2VNTA 1AHTH 1UTOA 3BTHE 4CBNA 4GCHF 3FZZA 4U30A 1O2VA 4ISNA 4DJZB 2R2MB 3Q00A 3NK8A 5JPMH 3A85A 1EATA 1P10A 4X6OA 3RXJA 1MMJN 2BVXH 2VGCC 3M5LA 2HLCA 3RLWH 1IHTH 1C1SA 1TOCB 1E36B 4YOIA 4GVUA 4O03A 5DPAA 3KQCA 3I29A 4I31A 1L1JA 1GHZA 2ZDAH 1NRRH 6GCHF 1LPKB 3E0PB 1WSSH 1AY6H 3M37A 2JKHA 3A8AA 1H9IE 3SHCH 1Z6JH 4D9RA 3T26A 3ZZAA 1ZSJA 3OX7U 4Y76A 1VCQA 2ASUB 1OP8A 1ZJDA 4RSPA 5EG4A 4IC5A 2F9OA 4WXIA 5EQQA 3LH3A 2H9EH 3SNCA 5JBCS 3WY8A 3UOPA 1GJCB 1OWKA 2Q6FA 2QF0A 1JXPA 2P8OB 4YLQH 4B2AA 5FCRA 1DOJA 1MKWK 4U2WA 4CR9A 2ULLA 3L3TA 4LZ1H 1ETTH 3QO6A 3K9XB 2ZQ1A 1J14A 1QTFA 1QBNA 1IQMA 5J4QA 4U01A 2BDCA 1GI4A 1VZQH 1YPJH 3K6ZA 3A87A 4E7RG 1SLXB 2A4QA 1TMTH 1WTGH 3F9FA 1DX5M 1QJ7B 1F0RA 1O2NA 3MWIU 4B71A 1V3XA 1FAKH 1NT1A 1TBRH 4JZFH 3HK6B 1T8NA 3MH5A 4X6PA 5DP3A 2BX4A 2Z9LA 5K7RA 1B5GH 1GCDA 3PROA 3GY2A 3VB3A 2OD3B 3RXTA 3UY9A 3SU1A 1T4UH 1NFUA 4JZEH 1ZRBA 4HI3A 4X2YA 1QFKH 1OXGA 5L2YH 5FX6A 4NA7A 4WJG2 3RUOA 1V2TT 4MDSA 1YPHC 1C5WB 1C5RA 3U9AH 3KNXA 3SJIA 4ZUHA 5JYIA 1ELDE 2AIQA 2C93B 1EZUC 4A5TS 1SGFA 4WVPE 4BNRA 1W11U 3QWCH 4Y6DA 3RDZA 5C1UA 1NROH 1TNJA 4XBCA 1GGDB 3UREA 2H9TH 1QBVH 3KGPA 4HGCA 2PW8H 3K2UA 2Z9GA 4UEHH 4YESB 2ZHDA 2BD3A 1A5IA 2ALVA 1T7CA 2BMGB 3KCGH 2FESH 3P8GA 4ESTE 1TPSA 3M3SA 1S6HA 1K1OA 4M7GA 6CHAB 2UUKB 5J4SA 1UTKA 1WAYB 3OTJE 5FX5A 7LPRA 2RDLA 4FUBA 2H6MA 2Y7XA 4JCNA 3RXIA 2BDGA 2GCTB 2BDIA 4IC6A 2Y6TA 1QJ1B 1D9IA 1C4U2 5G4BA 2ANKH 1KDQA 3TGKE 1YPLH 3FP8E 3MMGA 1CQQA 3E8LA 1C1UH 1KXEA 2F83A 1KYNA 4VGCC 1QRXA 3ZVBA 1HNEE 3UNSA 1DY8A 4JMYA 3EA9A 2A32A 4XBBA 2B7DH 5A2MH 2XTTB 1INCA 1ELTA 1SQTA 2ZGJA 4K69A 3T62A 1BTXA 1HDTH 4JYVH 3U1JB 3TJUA 1O3MA 1HV7A 1V2RT 4GPGA 2P94A 2CMYA 1LCYA 2FX4A 3V13A 1N8OC 1HJ8A 2CXVA 2QXIA 2FTMA 1TX8A 3PYHA 1OP2A 3BTFE 1BTWA 2AMPA 1KY9A 1XVOA 4X6NA 1A0LA 3CP7A 1ELCA 1SR5C 2BD8A 4Y8XA 2G51A 1TNKA 3P8FA 2G5NA 1DWBH 1V2WT 1WYKA 3RC4A 1MTNC 4ZXXH 2QA9E 1SBWA 2ZGCA 1HAXB 3ATKA 2VIOA 1Z7KA 1P2OA 1MCVA 2F9NA 1TMUH 1BTYA 1GJ4H 1HAGE 2FS9A 2GV6A 1IQJA 2SGQE 3LPRA 1KXFA 2AYWA 1DUAA 2BD7A 3VFEA 1RTLA 2KAIA 3CENA 3RXRA 3SV9A 3MU5A 4DOQA 1MTSA 1C1RA 5DGJA 1V2OT 1V2ST 2WPLS 2FI4E 1C1QA 1O2IA 4ZKNU 3GICB 3BEIB 3SGQE 1EB1H 1OKXA 5I25A 3UWIA 1MAYA 1QRZA 1RGQA 4NIVA 2ZZUH 1OWIA 2D26C 3MTYA 5AFYH 1OWDA 5CMXH 2BDAA 3LGVA 1KLTA 2ZPQA 4YT6H 2NWNA 1FAXA 3DHKH 4GAWA 1GGDC 3B8JA 2HWLB 1AFQB 1WTHD 2C3SA 1W7XH 2B8OH 4MPUA 4I32A 3ZVGA 1EAUA 3A80A 2C4FH 2ZPRA 3RMNH 1C2DA 4MPWA 4ISLA 1TBZH 1OS8A 1V2NT 4WY3A 1W3CA 2FTLE 2ODYB 1C5PA 2ZPSA 3TJVA 3RXHA 4BAMB 2QYIA 2HNTE 1ELGA 5JB8S 3VPKA 1TRNA 2B9LA 1GDUA 1FIWA 2BTCE 1BHXF 2F9UA 1YPGH 1ZSKA 4KTCA 2J38A 2CF8H 2BD4A 1O2QA 1SGFG 1FXYA 4WH8A 2PTCE 1HB0B 3GCHB 1TGBA 2R2WU 1FDPA 4AOQA 4ABAA 1YLDA 1DDJA 3VEQB 1T8MA 1ZTJA 6ESTA 1ZHMA 1GBCA 4CBOA 1QNJA 2XNIA 1IOEA 2BQ7B 2XRCA 1THRH 3MU1A 3QZRA 7GCHG 1MZAA 2QXJA 5EU8A 3VXFH 5A8ZA 1DPOA 1O2XA 2BLOA 1QURH 2FOCA 3PMAB 3SNBA 4K2YA 5HGGA 1K1JA 2QV1A 2PKAB 1CSOE 1BQYA 1CBWB 1DE7H 1GG6B 1AKSB 3A8CA 3RXDA 1QQUA 2ZEBA 1PPBH 2ANYA 1JIMA 3RC5A 1ZJKA 2OQUA 3BG8A 2FI5E 2OCVB 3SV6A 3KIDU 3SU2A 1C5YB 3ODDA 5A0AE 5TJXA 2WPJS 5DJ7A 1HIAA 3F1SB 3MNXA 1HAHH 2PSXA 3MNBA 3OYPA 3S9CA 3E1XB 2BY5X 3LGIA 3PO1C 4XFQA 1LHDH 1T31A 1CVWH 5HYOA 3NZIA 4NCYA 1QHRB 4PROA 4FU8A 2A2QH 3ZZ4A 2SGDE 1KXBA 3GCHC 2FIRH 5BPEA 1P09A 2D2DA 3JZ2B 1P2IA 1O34A 1VITG 1PPGE 1KLJH 1O3KA 3DT0H 3SQHE 2BVRH 5ABWA 1O2OA 3M7QA 1F5RA 1QCPA 4YLUA 3Q3KA 4RKOB 1DXWA 1GL0E 3LH1A 1AKSA 1F0UA 1L4ZA 1OX1A 1O2ZA 3GCNA 1T32A 2IN2A 4YZUA 3FP7E 3P8OA 1NTPA 5LGOA 1L2EA 1C1MA 2A5KA 1VJ9U 4IMZA 1X7AC 1O2SA 1Z8RA 3GY5A 2XBXA 3T5FH 2O8WA 1P2QA 2GP9B 3BEFB 3F68H 3SV7A 4YOJA 1O5GH 1FQ3A 1FV9A 1GBKA 2ALPA 4KTSA 1UVUH 1KLIH 4JYTA 2BOKA 1V2LT 1EPTC 4I8GA 2QC2A 3NWUA 2BQ6B 1J16A 3R0FA 4BXSA 3PTBA 4X8UH 1O37A 1IQEA 4BAKB 1K21H 1Y59T 2FYQA 4O9VA 1HAIH 1TX7A 3PWBA 2XWBI 1ZMJA 3Q77A 2EA3A 2VGCB 1P3CA 1ZGIA 2FYRA 4AX9H 1ZMNA 1Y5BT 2HPPH 2BOHB 1WU1A 3BF6H 3A7XA 2VINA 3A89A 3SJOA 2XCNA 3EYDA 2XBVA 1ID5H 1GMHF 1EXFA 3M3VA 2RG3A 3TITA 2GCHF 1C5NH 3B23B 1NRNH 2PUXB 3ZVCA 1G3EA 1GVKB 3TGIE 1IQGA 4Y8YA 1P01A 2UWOA 5EQRA 2WINI 5GDSH 4ZKOU 4MQAA 1HXEH 2CHAC 1O33A 1VGCC 1F2SE 1TGNA 5SGAE 1CGIE 1O3NA 1ARBA 1O35A 2XWAA 1GBBA 4A1TA 4DURA 3SU4A 3A7VA 4LOYH 2D8WA 2ZTXA 3MFJA 2STAE 1B0FA 1ZZZA 5C67A 1XX9A 3UUZA 4XBDA 3UR6A 3S9AA 1GCTB 1GI8B 1Y3YA 1OWHA 1IQIA 1XKAC 1GI1A 4CRBA 3O8BA 1QA7A 1PPCE 3PO1B 2GT7A 4ABGA 1RIWC 1TABE 1F0SA 3VB7A 1O3FA 5EODA 3UIRA 1N8OB 2AGEX 4HFPB 2PGQB 3MU4A 2VJ1A 2GZ8A 1GHXH 4GLYA 4IGDA 5AVDA 2PSYA 1GL1A 2UUJB 4HTCH 3RLYH 1ZLRA 3SU6A 3DUXH 1GWAA 4GCHG 1PYTD 1QL9A 3BTTE 1BMLA 1J9CH 1C5QA 1D3DB 1C5UA 4ABJA 1UHBB 4B2CA 1EOLA 1KXDA 3QGNB 1OP0A 1C2JA 2GMTB 4I8JA 2GDDA 1CT4E 4UFEH 3P95A 2WPIS 2GTBA 1C4Y2 1GMDF 1PPFE 1HGTH 4UE7H 1SB1H 1Y5UT 2KAIB 3D62A 4ABIA 4OGYA 4K8BA 1QL7A 2C8WB 4INHA 2XBYA 1C9TA 3SU3A 4YOGA 1O5CB 1EAIA 1GHBF 4WMDA 4BAHB 1O2JA 5FBIA 4JZDH 1EUFA 4H4FA 1ESTA 2FMJA 4CRCA 2ZECA 4B2BA 1V2JT 1ELAA 4Y79A 1W13U 1O2TA 3KQEA 3UWJH 3UR9A 3ZZ9A 3SNDA 1V2VT 3SI3H 3HK3B 1K2I1 1YF4A 1HCGA 3U1IB 1XXFA 1O3HA 1BRUP 2Y5FA 5F8ZA 1UTLM 1IQNA 3ZYDA 5GIBA 2BDYA 4NIYA 3ATIA 1K22H 3QGJA 1YBWA 1GPZA 2BXTH 1TNIA 1DSTA 1VCWA 2H2ZA 3TVJB 5C1XA 2ZIQH 1NU7B 4H42U 1HPGA 1ZTKA 5IYTA 5HM2A 4ABHA 1ELFA 1TIOA 1V2KT 1ZR0A 5DP8A 1CT0E 4UDWH 2A0QB 2XW9A 3M3TA 1OOKB 1YCPK 4ZMAH 1W8BH 3ZV8A 1JMOH 2HNTC 1DWEH 2JH6D 2SGPE 5E2OA 1LHCH 2ZCKP 4SGBE 2YNAA 5LPEA 1GG6C 2BHGA 1H8IH 1P8VC 5GCHF 2TIOA 1UK4A 3LIWA 3PV4A 1EOJA 2GMTC 1GHBG 4OS4A 3TU7H 1IQKA 5EXMA 1MTUA 2P8OC 1FUJA 1KXAA 4Q7XA 4CH8B 1FY3A 5TCCA 1GBLA 1D3PB 3EAJA 1C1OA 5CHAB 1UCYH 3QTOH 1GI9B 2Y5HA 1MU6B 2M5TA 4GUXA 3S7HB 3AW1A 1RXPA 1GMDG 1NRSH 3BSQA 2GT8A 1WQVH 2FOAA 4A1VA 1S82A 2VIDA 3TH4H 1NRQH 3E3TA 1NY22 4IN2A 5FPTA 3MNCA 1C5LH 3UQOA 1Y8TA 4XSKU 3RXSA 3URCA 5JBTA 2FOGA 2EI6A 5FAHA 4FU7A 1BIOA 1EPTA 1ANBA 4DGJA 1F5LA 4DW2U 2FDAA 1HIAB 1C2IA 2HRVA 5TCAA 1TA2A 2WUCA 1ANCA 4OS1A 2GD4B 1NS3A 1P3EA 2UUYA 1Z8JB 4XE4A 3ZZ3A 1IHSH 3RXBA 1MD7A 1MBMA 3L6PA 1NO9H 1AI8H 2LPRA 1GJ8B 5DKMA 3U8TH 1SVPA 5FPSA 2H1UA 3DD2H 3PB1E 1SHYA 1YCPM 3SUDA 3MH4A 4DIHH 3NPSA 4JZ1A 4X2WA 3GCOA 4X1RU 2FP7B 5L6NH 1IQLA 3SUFA 5GPIB 2BDBA 5A8YA 1AB9C 5E8EH 5EXNA 1A3EH 1EB2A 1C2HA 1TALA 1SGCA 1MTNB 1XM1A 1KDQB 1SLWB 1AQ7A 1W7GH 1EPTB 2V3OH 4X2VA 1GBEA 2BDHA 2FOEA 3ESTA 3LONA 3V12A 2P16A 3S7KB 1C5TA 3MU8A 3T28A 1SOTA 2GCTC 2J34A 4BTIB 1ZOMA 5DP6A 5E0HA 1C5VA 2XYAA 3F9HA 2TBSA 3MH7A 3BTEE 1VR1H 4H6TA 1O2MA 5H4IB 1G36A 1O2WA 2ODPA 2G4TA 1C2GA 1F7ZA 1OWEA 3JZ1B 1GHWH 1V2PT 4Z0KA 2DE8A 3S69A 1YP9A 1OWJA 3A7TA 1SMFE 2V6NA 2F9BH 5DP9A 3W94A 1GI6A 1HJ9A 1C5OH 2WV5A 1O38A 2CHAB 3U8RH 1GI7B 4ABEA 1SI5H 2XC5A 3KF2A 2QIQA 3A84A 4ZHLU 2A2XH 4K1EA 1OYTH 3TH3H 1LQDB 1EQ9A 2FLBH 2OC7A 3A7ZA 2UUFB 1Z8GA 5AF9H 1GBHA 1C1WH 5K0HA 1UVPA 1ORFA 2ZDKA 4NWLA 4D8NA 4TWYA 5A09A 1MQ5A 1BRCE 3GCTG 2AGGX 3GYLB 6LPRA 7KMEH 1ELBA 1ZPBA 1O5DH 2Z94A 2BLWA 3GY7A 2OC0A 2VVVA 2ZU3A 1TFXA 2ZNKH 4BTTB 1L1GA 2OC1A 4FUJA 4WXVA 4AFQA 1AIXH 1BRAA 1W10U 1A1RA 4X1NU 3TGJE 2AEIH 3RXEA 1RFNA 4CRDA 5LPRA 1AGJA 1AMHA 4FVDA 1SGTA 3FVFB 2G81E 1JWTA 2CJIA 4AN7A 1KSNA 1MQ6A 1E34B 1FNIA 1LVYA 1Z6EA 1TYNA 5EPNA 5A0BA 1XUGA 5EW2H 3A83A 1PFXC 1TGCA 1GBDA 1BA8B 3QX5H 3LDXH 1NM6A 1CGHA 1GI2A 3OU0A 3U8OH 1H9LB 2G8TA 1A7SA 1B0EA 1C2MA 4AB8A 4A1XA 2QY0B 1TA6A 1DM4B 1UK2A 3A7YA 3FP6E 1G3BA 4E05H 4F4OC 3E90B 1AZ8A 4MLFB 5GJ4B 4Y11E 1C1TA 3BTQE 4IW4E 3RMMH 2W5EA 2W7UA 4E06H 1CT2E 2NU3E 3ATMA 4YM9A 4X8SH 1O3CA 2G55A 4JK6A 2D1JA 1LTOA 2XBWA 1JRSA 3HATH 1CU1A 1WUNH 2GCHG 1AVGH 2B5TB 3GDVA 3A7WA 4MVNA 1JBUH 3KHVA 3M35A 1WCZA 2FM2A 3LC3A 3AVZA 1ANDA 3RXPA 1UMAH 1YLCA 1SQAA 2QXGA 1AO5A 1SFIA 2Z9JA 1ACBE 1S81A 4X0WU 3URDA 7GCHF 2PWXA 2G52A 1C5SA 1GMCF 1BT7A 1PQ5A 1NFYA 5C5NA 3EE0B 1PJPA 1TGTA 2Z7FE 3VXEH 2A1DB 1MCTA 3RM0H 1UTMA 1GJDB 4K8YA 1BMAA 3DA9B 4R0IA 5FHTA 4BOHA 1AVWA 3SV8A 4CRAA 2NU0E 1K1PA 1BOQA 1C2EA 3U69H 2G00A 1ZRKA 3ZV9A 2RA3A 3EDXB 3FANA 3SI4H 1SLVB 4BAOB 4ZAEA 3D49H 2OC8A 1XVMA 5LPFA 1UO6A 2ZC9H 3E91A 1TQ7B 2R9PA 3EQ0H 1ZHRA 1ELEE 1G3CA 2FOFA 2QF3A 4X6MA 1FN8A 5ESTE 3I77A 3ZVFA 3M5MA 2P3FH 1C9PA 4NA8A 3BN9A 2R3YA 2FLRH 2PFEA 1ZSLA 3BTME 1V2MT 1AB9B 1O31A 2GDEH 4AYYB 2QGRA 2OLGA 1O5FH 3B9FH 4I33A 1E37B 1FMGA 3E6PH 3ELAH 3KEEA 1AUTC 1NC6A 2ZU4A 2Z9IA 1BDAA 4TPIZ 1VGCB 3TJNA 6GCHG 1H8DH 1P05A 1QY6A 4Y10E 1SGNE 3UOUA 2ZKSA 5IDKA 1C4V2 1K28D 2A4RA 3MH6A 5EOKA 1S0QA 1J8AA 1FPCH 2VIQA 5B6OA 3TK9A 2AH4X 3PTNA 4MNVA 3AAVA 1SGEE 1YKTA 1O3JA 1DANH 1LPGB 3SUEA 3PWCA 3ZYEA 1TNHA 4F49A 1BBRK 2HALA 3SUGA 2AMQA 1TWXB 1UTJA 1CO7E 4AFSA 1DWDH 2SNVA 1ESAA 3F9EA 1O39A 2TGPZ 3SO3A 4NG9H 3SW2B 3MOCA 1TNLA 4UONA 1FIZA 4NZLA 2THFB 1SHHB 3QLPH 3UNQA 2H9HA 4ABDA 3ZVAA 2GZ7A 1GHAG 1EZSC 3GDSA 1MD8A 4OS7A 2A4GA 2WPKS 2CN0H 3BEUA 4FUDA 4LZ4B 2JH5D 1VCPA 2H5DA 4THNH 4K3JA 3ZZDA 4ZHMU 4CH2B 2VH6A 4FUFA 4H6SB 1O3IA 2BX3A 1LPZB 1FY5A 1A5HA 2FOHA 2ZU2A 2OTVA 2CGAA 4IBLH 1YC0A 3OY6U 1OSSA 1EAXA 2C8YB 2P3TB 3O8RA 1ETRH 2HOBA 1G2MA 1LVOA 1D6WA 5EW1H 1MKXH 1V2QT 1FN6A 3RU4E 3V7TA 9LPRA 1Y3XA 3MO6A 4NSYA 2VU8E 2AIPA 1YYY1 4ABBA 5C2ZA 3PLPA 4AG2A 2VIPA 3M5NA 4A6LA 4Y8ZA 2ZTZA 4UFFH 1HFDA 1O5AB 1SGQE 1AFQC 1KIGH 1PQAA 4XDEA 3RXAA 1ANEA 1BCUH 1SGIB 1PPHE 1WV7H 1TMBH 1O3PB 2ZHFH 1XKBC 2J4IA 4D7FA 3VB4A 2ZU5A 3E0NB 1CA0C 1SLUB 1UJ1A 3ENSB 4AORA 2O8TA 4KP0A 4TPYA 5F8TA 1G37A 1O3EA 4ISIH 1V2UT 3A8BA 1SGPE 1GBIA 3NXPA 3RXVA 1CBWC 1QB1A 3TPIZ 2ZFPH 3R3GB 1BTHH 1GMHG 2BLVA 1C1VH 1LVMA 5EXLA 1O2UA 3P8NA 2Z9KA 2BYAX 1G32B 1UCYK 3M7UA 1E0FD 2ZCHP 1O3OA 4Y0ZE 1LQEA 1PPZA 1GVZA 1JRTA 1BBRH 4NWKA 2ZDMA 3HKIB 3KN2A 4O3UA 1QB6A 4GSOA 2J9NA 2ZHEH 1UVOA 4UFDH 2TGAA 1THPB 5FXLA 3SORA 3HPTB 1QIXB 3F6UH 3SZNA 4Y7AA 2ZQ2A 1AZZA 1FZZA 3RXQA 4FUIA 3MO9A 2PTNA 1RS0A 2BM2A 3IG6B 2FI3E 4BAQB 2ZGHA 3PMBB 1SC8U 2P59A 1DVAH 3KQBA 1NN6A 1GBJA 2UWPA 8KME2 2P3UB 1ZGVA 2SGFE 1NESE 2J95A 3NKKA 1L1NA 2A7HA 2CV3A 1NFXA 2ZI2H 2F9PA 3ITIA 1EZXC 2DUCA 3SJ8A 2PKSB 1EJAA 4WMFA 1AN1E 4DT7B 1LKAA 3LGUA 1Y3WA 1LO6A 2GGVB 3Q76A 3GDUA 1QRWA 5EGMA 5PTPA 1LHFH 5E0GA 1YM0A 4B75A 1Q2WA 5T6GA 3MU0A 2J92A 3TLOA 5F6MA 4X2XA 1IQHA 1BMNH 4TWWA 4TYDA 4DG4A 3S9BA 1HXFH 3PMHB 1GVLA 3RP2A 3Q3YA 2ZFQH 4YTAA 1P11E 5DK1A 1A5GH 2FOMB 3FFGA 1G2LA 2XC4A 1M9UA 2PV9B 4WMEA 1AWHB 2TGTA 3RC6A 1Q3XA 2FOBA 4X8TH 5T3HA 1BJUA 4MNXA 1LHEH 2EI8A 3BTWE 1MUEB 2WPMS 2B0FA 3UQVA 3GCTF 1HRTH 4MPVA 1HYLA 1EJNA 1C2KA 1WQSA 4MTBA 2JETC 1AE8H 2ANMH 1BMMH 1O3BA 1MKWH 1F0TA 3RMOH 1P04A 1ZHPA 3C1KA 2Q6GA 2AMDA 2OBQA 2WYJA 3UNRA 1XXDA 4I8KA 2BY7X 2HGTH 1AVXA 2IOTA 2BY6X 1YPMH 3OSYA 1P12E 4ZKRU 1YCPH 1T8OA 4B73A 1YPKH 1D3TB 1GJ6A 3CS7A 3FZDA 3A86A 3P6ZB 4ZROA 1DLEA 3H7TA 4O97A 1D6RA 1NZQH 1FJSA 3QUMP 3PMJA 2QXHA 5T6FA 1GDQA 3AASA 1C1PA 2FPZA 3A82A 1CHOG 1DITH 5DP4A 3BG4B 4ABFA 4NIWA 3SGBE 1BB0B 2Q1JA 5CHAC 1KXCA 1A4WH 4ISHH 3SQEE 1O2GH 1J17T 1W14U 5JBBS 3LT3A 3SJKA 1Q31A 1P2NA 4KELA 1FPHH 1Z71A 1GJBB 2VH0A 4CHAB 1TNGA 5LH8A 3BTGE 3RU4T 1GBAA 1D3QB 1OYQA 1SGDE 1A3BH 1NRPH 3LKWA 5GWZA 1O3LA 1BITA 2ZO3H 2STBE 1AE5A 1TPAE 4MNWA 3MHWU 1TPOA 3NUMA 2P93A 1UCYE 1PPEE 3ZVDA 2PKAA 2NU1E 2A7CA 1DWCH 4WH6A 1C2LA 1JOUB 2HPQH 3RXGA 4AYVB 1H1BA 3GY3A 3M36A 4INLA 3FAOA 4DVAU 1EAWA 4X8VH 3PLKA 1HAOH 3TK5A 4FVBA 2C8XB 4NFEA 4B76A 1O2YA 2HNTF 5C5OA 1QL8A 3GYMA 1ZMLA 1P0SH 2AERH 2JETB 4D7GA 3UPEA 2DE9A 4I8HA 2ZGXH 1S6FA 1UK3A 2G5VA 5C1YA 1UVSH 1DLKB 2Y82A 1PYTC 2Z3DA 3BTKE 2P95A 1O5EH 3GY8A 3RXLA 1W2KH 3O8CA 1FY8E 4Y7BA 2ZFTA 3P17H 1FY1A 2GVFA 4AFZA 1TB6H 2RCEA 4D76A 2RA0A 2VWNA 4OGXA 4A92A 2QN5T 1O0DH 2ZHWH 3ZZ7A 1WOFA 8GCHF 3M5OA 5C20A 4E7NA 1UTNA 5DG6A 1LKBA 1RIWB 1GJ7B 2ZA5A 4UFGH 1TBQH 1E38B 3KL6A 2OP9A 2ANWA 2I6SA 2ZG0H 2ILNA 2FXRA 2R0LA 3EA7A 1SGRE 5GCHG 1AWFH 2A45B 2IJOB 1RJXB 1MAXA 3UTUH 1J15A 1GBMA 1RD3B 2PR3A 1HAZB 2Y5GA 2J94A 2VIVA 5A0CA 1SL3A 1BUIA 2VWLA 1FY4A 1ABJH 4D9QA 3SU5A 2GV7A 2YNBA 5FPYA 2PUQH 1H9HE 3M7TA 1WBGB
chains in the Genus database with same CATH superfamily
1NFWA 3N7OA 2I6QA 2ZDVH 3TJOA 3DFLA 1RTFB 4TY6A 1OPHB 1TE0A 3M61U 4J2YB 1Z1IA 2SGAA 3IITA 1PQ8A 4IN1A 5T1VA 1TRYA 1EP5A 1Z1JA 3DFJA 2OUAA 2BD9A 2YOLA 3PM3A 1VJAU 4R8TB 1IQFA 3F2HA 1KTSB 5AHGH 3NCLA 1P9UA 5L2ZH 4YO9A 2SGEE 3RMLH 1K1MA 1E1RD 8LPRA 3ZVEA 1EASA 3D65E 4FUHA 1MKXK 2PGBB 3A88A 4JK5A 3ZZ6A 4WF8A 2Y81A 3RU4D 3SNAA 6CHAC 1YPHE 2NU2E 1P06A 1TPPA 5HMAA 1SPJA 2BVSH 2TRMA 4FUEA 1HBTH 2J98A 4IS5A 4NIXA 4CREA 2HVXA 2XC0A 4DY7B 2SFAA 1W0ZU 3E16B 1S84A 3O8DA 1ELVA 3ATWA 1CHOF 3OE7D 3T27A 4FUGA 3LOXA 5BRRE 4FUCA 3T2NA 1HLTH 1XUJA 1DY9A 1GBFA 1U6QA 4FU9A 3QDZB 4K60A 2ZF0H 3VB5A 1GI3A 2SNWA 2NU4E 1AU8A 1TAWA 1HAVA 4BANB 1BTZA 5AFZH 2KR7A 4GHTA 4CR5A 2C8ZB 2J2UA 1GDNA 4MNYA 2VWOA 1ARCA 4AGJA 2AFQB 2VIWA 3K65B 1EZQA 1P03A 1UVTH 5F8XA 3TNSA 3LU9B 2A4OA 3Q3XA 1QJ6B 1W0YH 2FO9A 2OQ5A 1W12U 1P2KA 1C5ZB 3TK6A 3UB0A 1S85A 5KECA 1O2KA 4Y71A 5I46H 5JDUB 1Y3UA 2TGDA 1ZPCA 1EP6A 3SJ9A 1O3AA 2A5IA 1O3DA 2PHBA 3BTDE 1QQ4A 2JH0D 1RTKA 1UHBA 4NFFA 1LVBA 1YGCH 1TONA 2V35A 5E0JA 1BZXE 1AUJA 3VGCC 2ZGBH 1GJ9B 2WUBA 3PV2A 4B1TA 1EKBB 1O2LA 2PP6A 2R0KA 4K5ZA 4A7IB 1TOMH 1RRKA 2BZAA 3SV2H 1Y5AT 3RXMA 2BD5A 1DFPA 3FKSD 3MI4A 2BXUH 4NGAH 2K1QA 3A81A 3TH2H 1O2PA 2VVCA 2OXSA 3RXOA 4AGKA 4I8LA 3SNEA 2Z3CA 1TX6A 1CE5A 4DCDA 2F91A 2ZFRH 3ZZBA 4BTUB 1TLDA 4IMQA 1NPMA 4RI0A 1FLEE 4I7YH 3OY5U 4I86A 1HUTH 2QF4A 4RN6A 3H7OA 5ESBA 1L0ZA 5L30H 1DS2E 1JIRA 1P2JA 1S0RA 1SGYE 1YPEH 3TIUA 1BRBE 2AGIX 1ETSH 3AAUA 3WW7A 1P2MA 4YT7H 3QK1A 2BQWB 2BY9X 2FODA 2VVUA 1O2HA 2W7SA 2F4LA 4Q80A 1THSH 3QZQA 4DIIH 2ZFFH 2F3CE 3IWMA 1CA0B 2W3KA 3GY4A 1QA0A 1AD8H 4NA9H 1QGFA 1DSUA 1BTUA 1DICA 1MZDA 2GZ9A 2EI7A 5HM9A 4MG3A 4JYUH 5EQSA 3RXKA 3QN7A 4AZ2B 2KCAA 3SOSA 2ZHQH 1SSXA 1XUHA 2VB0A 3ATLA 4TY7A 3SU0A 2HVYB 3PLBA 1SOZA 1HJAC 1F5KU 1F92A 1KTTB 1E79D 1GJ5H 2Y7ZA 3LGTA 5DO4H 3EGKH 1N6YA 3AW0A 1NU9A 3VB6A 4UD9H 5HIYA 1SG8B 1ZTLA 5HIZA 2EC9H 1MH0A 2BZ6H 4KKDA 3LC5A 3V0XA 5DN6D 3KQDA 1Z8IB 1H4WA 3V3MA 2ZP0H 1T8LA 2KCPA 4K1TA 3T29A 2QCYA 3RXUA 1GHYH 1MBQA 3ZZCA 1CHGA 1O36A 3BV9B 1C1NA 1N6XA 3LGWA 2FZZA 2H5CA 2ZFSA 4HZHA 4BXWA 2GKVE 3MYWA 1CA8B 2WPHS 4LXBH 4INKA 1DT2A 3KYFA 1ESBA 5DP7A 4XOJA 3BG4C 4O3TA 1P9SA 1VITF 4OM9A 1AFEH 3OFND 3GISB 2YMSD 3HGNA 4JZIA 2TPIZ 2V0BA 3SBKA 1A2CH 2Y80A 3VGCB 4KTUA 3P92A 2WYGA 4CRFA 2ZCLP 4ZXYH 5GXPA 5EJLA 5IK2D 2ESTE 1QB9A 2AS9A 2ZTYA 1O32A 3RXCA 1FONA 4TT3D 3SHAH 1G3DA 2ZU1A 1UTPA 3D23A 3TNTA 4Y0YE 3U98H 4AG1A 2ZDLA 2V3HH 3SN8A 1BHXB 1UTQA 2GX4A 5FBEA 4J1YA 2C90B 4B74A 2CF9H 4QT8C 1FI8A 4VGCB 2PLXA 1DXPA 1P57B 1A46H 5EPYA 1B7XB 5A8XA 3HKJB 1S83A 2F9VA 4OS2A 1Y3VA 2FS8A 1QBOA 1DUEA 4OS6A 1TQ0B 5FCKA 4CHAC 1GBTA 3GY6A 2Q6DA 1GHAF 1ZYOA 3G01A 2PKSC 4MPXA 8GCHG 1K1NA 3L33A 3N99A 2ZWLH 2O8MA 5HXFA 3I78A 2BLQA 5F03A 1XMNB 4XD7D 4Q7YA 2W3IA 4ISOA 1XUFA 3BIVH 2EEKA 1BJVA 1EJMA 4FXGH 3ZZ5A 1CGJE 3S0NA 5DP5A 1C5XB 1TGSZ 1VITH 3F9GA 2A7JA 1LHGH 4K1SA 2JJ2D 4Q7ZA 2O8UA 1XUIA 1N1LA 2RDEA 1BTPA 3U28C 5JBAS 1GI5A 3LJJA 4U32A 1C5MD 3RM2H 8ESTE 5JB9S 2FX6A 4LK4A 1E35B 3CS0A 2BD2A 4GHQA 1SQOA 2BY8X 4AC9A 2BB4A 1LMWB 1T4VH 2O9QA 1P02A 4X1QU 5E2PA 1MTVA 2VWMA 3EA8A 1MU8B 3A8DA 4OS5A 1HJAB 1GHVH 2FWWA 1SFQB 3STJA 1O2RA 3SGAE 3UFAA 1G9IE 1NBME 2Z3EA 1V6DA 1G30B 2A31A 3W95A 4P00A 3T25A 4RKJB 3ZZ8A 1IAUA 1GI0A 2G4UA 3P70B 4ZKSU 4ZH8A 2QAAA 2XXLA 2OBOA 1A0JA 1ZPZA 1EX3A 2YMSB 1O3GA 2A5AA 3BIUH 9ESTA 1BBRE 2ODQA 4X1PU 2W26A 2UWLA 4NZQA 3LGYA 1A0HB 4SGAE 4CRGA 1A61H 5C3NA 2R3UA 3LJOA 2WV4A 1ABIH 2XCFA 2F43B 4NSVA 1C2FA 1MTWA 2ZDNA 3ODFA 1K1LA 4ASHA 4KGAA 4Q2KA 4B6EA 4ZHAA 3STIA 3MO3A 2IPHA 4Z6AH 1GCTC 4AFUA 2AHME 2LNCA 1XUKA 2Z6BD 1HAVB 1GMCG 3H5CB 3QTVH 1O30A 1GJAB 1L4DA 1HAYB 3MNSA 1QR3E 1TRMA 3K6YA 5T6DA 1PQ7A 7ESTE 5KEDA 3CNRA 2O8LA 1K9OE 4WWYA 3C27B 1HAPH 5CE1A 1D4PB 1S5SA 4X1SU 3GOVB 3RXFA 4AB9A 2FEQH 1LDTT 5ETXA 2OINA 1O5BB 3HGPA 1K1IA 2GJGA 2VNTA 3F3BA 1AHTH 1UTOA 3BTHE 4CBNA 4GCHF 3FZZA 4U30A 1O2VA 4ISNA 4DJZB 2R2MB 3Q00A 3NK8A 5JPMH 3A85A 1EATA 1P10A 4X6OA 3RXJA 1MMJN 2BVXH 2VGCC 3M5LA 2HLCA 3RLWH 1IHTH 1C1SA 1TOCB 4ASUD 1E36B 4YOIA 4GVUA 4O03A 5DPAA 4RT0A 3KQCA 3I29A 4I31A 1L1JA 1GHZA 2ZDAH 1NRRH 6GCHF 1LPKB 3E0PB 1WSSH 1AY6H 1H8HD 3M37A 2JKHA 2JDID 3A8AA 1H9IE 3SHCH 1Z6JH 4D9RA 3T26A 3ZZAA 1ZSJA 3OX7U 4Y76A 1VCQA 2ASUB 1OP8A 1ZJDA 4RSPA 5EG4A 4IC5A 2F9OA 4WXIA 5EQQA 3LH3A 2H9EH 3SNCA 5JBCS 3WY8A 3UOPA 1GJCB 1OWKA 2Q6FA 2QF0A 1JXPA 2P8OB 4YLQH 2HLDD 3FN8A 4B2AA 5FCRA 1DOJA 1MKWK 4U2WA 4CR9A 2ULLA 3DSOA 3L3TA 4LZ1H 1ETTH 3QO6A 4F48B 3K9XB 4Z1MD 2ZQ1A 1J14A 1QTFA 1QBNA 1IQMA 5J4QA 4U01A 2BDCA 1GI4A 1VZQH 1YPJH 3K6ZA 3A87A 4E7RG 1YWUA 1SLXB 2A4QA 1TMTH 1WTGH 2QE7D 1DX5M 1QJ7B 3F9FA 1F0RA 1O2NA 3MWIU 4B71A 1V3XA 1FAKH 1NT1A 1TBRH 4JZFH 3HK6B 1T8NA 3MH5A 4X6PA 5DP3A 2BX4A 2Z9LA 5K7RA 1B5GH 1GCDA 3PROA 3GY2A 3VB3A 2OD3B 3RXTA 3UY9A 3SU1A 1T4UH 1NFUA 4JZEH 1ZRBA 4HI3A 4X2YA 1QFKH 1OXGA 5L2YH 4Q63A 5FX6A 4NA7A 4WJG2 3RUOA 1V2TT 4MDSA 1YPHC 1C5WB 1C5RA 3U9AH 3KNXA 3SJIA 4ZUHA 5JYIA 1ELDE 2AIQA 2C93B 1EZUC 4A5TS 1SGFA 4WVPE 4BNRA 1W11U 3SZEA 2WV9A 3QWCH 4Y6DA 3RDZA 5C1UA 1NROH 1TNJA 4XBCA 1GGDB 3UREA 2H9TH 1QBVH 3KGPA 4HGCA 2PW8H 3K2UA 2Z9GA 4UEHH 4YESB 2ZHDA 2BD3A 1A5IA 2ALVA 1T7CA 2KCYA 2BMGB 3KCGH 2FESH 3P8GA 4ESTE 1TPSA 3M3SA 1S6HA 1K1OA 4M7GA 6CHAB 1K0HA 2UUKB 5J4SA 1UTKA 1WAYB 3OTJE 5FX5A 7LPRA 2RDLA 4FUBA 2XOKD 2H6MA 2Y7XA 4JCNA 3RXIA 3OTPA 2BDGA 2GCTB 2BDIA 4IC6A 2Y6TA 1QJ1B 1D9IA 1C4U2 5G4BA 2ANKH 1KDQA 3TGKE 1YPLH 3FP8E 3MMGA 1CQQA 3E8LA 3PRBA 1C1UH 4XRNA 1KXEA 2F83A 1KYNA 4VGCC 1QRXA 3ZVBA 1HNEE 5DSFA 3UNSA 1DY8A 4JMYA 3EA9A 2A32A 4XBBA 2B7DH 5A2MH 2XTTB 1INCA 1ELTA 1SQTA 2ZGJA 4K69A 3T62A 1BTXA 1HDTH 4JYVH 3U1JB 3TJUA 1O3MA 1HV7A 1V2RT 4GPGA 2P94A 2CMYA 1LCYA 2FX4A 3V13A 1OHHD 1N8OC 3KQ5A 1HJ8A 2CXVA 2QXIA 2FTMA 1TX8A 3PYHA 1OP2A 3BTFE 1BTWA 2AMPA 1KY9A 1XVOA 4X6NA 1A0LA 2VBCA 1ELCA 3CP7A 1SR5C 2BD8A 4Y8XA 5FL7D 2G51A 1TNKA 3P8FA 2G5NA 1DWBH 1V2WT 4ACBA 1WYKA 3RC4A 3W1EA 1MTNC 4ZXXH 2QA9E 1SBWA 2ZGCA 1HAXB 3ATKA 2VIOA 1Z7KA 1P2OA 1MCVA 2F9NA 2M2AA 1TMUH 1BTYA 1GJ4H 1HAGE 2FS9A 2GV6A 1IQJA 2SGQE 3LPRA 1KXFA 2AYWA 1DUAA 2BD7A 3VFEA 2XNDD 1RTLA 2KAIA 3CENA 3RXRA 3SV9A 3MU5A 4DOQA 1MTSA 4FETA 1C1RA 5DGJA 1V2OT 1V2ST 2WPLS 2FI4E 1C1QA 1O2IA 4ZKNU 3GICB 3BEIB 3SGQE 1EB1H 1OKXA 3OEHD 1W0KD 5I25A 3UWIA 1MAYA 1QRZA 1RGQA 4NIVA 2ZZUH 1OWIA 2D26C 3MTYA 5AFYH 1OWDA 5F53A 5CMXH 2BDAA 3LGVA 1KLTA 2ZPQA 4YT6H 2NWNA 1FAXA 3DHKH 4GAWA 1GGDC 3B8JA 2WZQA 2HWLB 1AFQB 1WTHD 2C3SA 1W7XH 2B8OH 4MPUA 4I32A 3ZVGA 1EAUA 3A80A 2C4FH 2ZPRA 3RMNH 1C2DA 4MPWA 1QZ8A 4ISLA 1TBZH 1OS8A 1V2NT 4WY3A 1W3CA 2FTLE 2ODYB 1C5PA 2ZPSA 3TJVA 3RXHA 4BAMB 2QYIA 2HNTE 1ELGA 5JB8S 3VPKA 1TRNA 5GNDA 2B9LA 1GDUA 1FIWA 2BTCE 1BHXF 2F9UA 1YPGH 1E1QD 1ZSKA 4KTCA 2J38A 2CF8H 2BD4A 1O2QA 1SGFG 1FXYA 4WH8A 2PTCE 1HB0B 3VG8A 3GCHB 1TGBA 2R2WU 1FDPA 4AOQA 4ABAA 1YLDA 1DDJA 3VEQB 1T8MA 1ZTJA 6ESTA 1ZHMA 1GBCA 4CBOA 1QNJA 2XNIA 1IOEA 2BQ7B 2XRCA 2W6ID 1THRH 3MU1A 3QZRA 7GCHG 1MZAA 2QXJA 5EU8A 3VXFH 5A8ZA 1DPOA 1O2XA 2BLOA 1QURH 2FOCA 3PMAB 3SNBA 4K2YA 5HGGA 1K1JA 2QV1A 2PKAB 1CSOE 1BQYA 1CBWB 1DE7H 1GG6B 1AKSB 1H8ED 3A8CA 3RXDA 1QQUA 2ZEBA 1PPBH 2ANYA 1JIMA 3RC5A 1ZJKA 2KFWA 2OQUA 2FI5E 2OCVB 3BG8A 3F0OA 3SV6A 3KIDU 3SU2A 1C5YB 3ODDA 5A0AE 5TJXA 2WPJS 5DJ7A 1HIAA 3F1SB 3MNXA 1HAHH 2PSXA 3MNBA 3OYPA 3S9CA 3E1XB 2BY5X 3LGIA 3PO1C 4XFQA 1LHDH 1T31A 2IPQX 1CVWH 5HYOA 3NZIA 4NCYA 1QHRB 4PROA 4FU8A 2A2QH 3ZZ4A 2SGDE 1KXBA 3GCHC 2FIRH 5BPEA 1P09A 2D2DA 3JZ2B 1P2IA 1O34A 1VITG 1PPGE 1KLJH 2WSSD 1O3KA 3DT0H 3SQHE 2V7QD 2BVRH 5ABWA 1O2OA 3M7QA 1F5RA 1QCPA 4YLUA 3Q3KA 4RKOB 1DXWA 1GL0E 3LH1A 1AKSA 1F0UA 1L4ZA 1OX1A 2K8IA 1O2ZA 3GCNA 1T32A 2IN2A 4YZUA 3FP7E 3P8OA 1NTPA 5LGOA 1L2EA 1C1MA 2A5KA 3SYJA 1VJ9U 4IMZA 3DCLA 1X7AC 1O2SA 1Z8RA 2WHXA 3GY5A 2XBXA 3T5FH 2O8WA 1P2QA 2GP9B 3BEFB 3F68H 3SV7A 4YOJA 1O5GH 1FQ3A 1FV9A 1GBKA 2ALPA 4KTSA 1UVUH 1KLIH 4JYTA 2BOKA 1V2LT 1EPTC 4I8GA 2QC2A 1SQRA 3NWUA 2BQ6B 1J16A 3R0FA 4BXSA 3PTBA 4X8UH 1O37A 2KM0A 1IQEA 4BAKB 1K21H 1Y59T 2FYQA 4O9VA 1HAIH 1TX7A 2L6OA 3PWBA 2XWBI 1ZMJA 3Q77A 2EA3A 2VGCB 1P3CA 1ZGIA 2FYRA 4AX9H 1ZMNA 1Y5BT 2HPPH 2BOHB 1WU1A 3BF6H 3A7XA 2VINA 3A89A 3SJOA 2XCNA 3EYDA 2XBVA 5HKKD 1ID5H 5C0TA 1GMHF 1EXFA 3M3VA 2RG3A 4P02A 3TITA 2GCHF 1C5NH 3B23B 1NRNH 2PUXB 3ZVCA 1G3EA 1GVKB 3TGIE 1IQGA 4Y8YA 1P01A 2UWOA 5EQRA 2WINI 5GDSH 4ZKOU 1KMHB 4MQAA 1HXEH 2CHAC 1O33A 1VGCC 1F2SE 1TGNA 5SGAE 1CGIE 1O3NA 1ARBA 1O35A 2XWAA 1GBBA 4A1TA 4DURA 3SU4A 3A7VA 4LOYH 3AK5A 2D8WA 2ZTXA 3MFJA 2STAE 1B0FA 1ZZZA 5C67A 1XX9A 3UUZA 4XBDA 3UR6A 3S9AA 1GCTB 1GI8B 1Y3YA 1OWHA 1IQIA 1XKAC 1GI1A 4CRBA 3O8BA 1QA7A 1PPCE 3PO1B 2GT7A 4ABGA 1RIWC 1TABE 1F0SA 3VB7A 1O3FA 5EODA 3UIRA 1N8OB 2AGEX 4HFPB 2PGQB 3MU4A 2VJ1A 2GZ8A 1GHXH 3PV5A 4GLYA 4IGDA 5AVDA 2PSYA 1GL1A 2UUJB 4HTCH 3RLYH 1ZLRA 3SU6A 3DUXH 1GWAA 4GCHG 1PYTD 1QL9A 3BTTE 1BMLA 1J9CH 1C5QA 1D3DB 1C5UA 4ABJA 1UHBB 4B2CA 1EOLA 1KXDA 3QGNB 1OP0A 1C2JA 2GMTB 4I8JA 2GDDA 1CT4E 4UFEH 3P95A 2WPIS 2GTBA 1C4Y2 1GMDF 1PPFE 1HGTH 4UE7H 1SB1H 1Y5UT 2KAIB 3D62A 4ABIA 4OGYA 4K8BA 1QL7A 2C8WB 4INHA 2XBYA 1C9TA 3DSPA 3SU3A 4YOGA 1O5CB 1EAIA 1GHBF 4WMDA 4BAHB 1O2JA 5FBIA 4JZDH 1EUFA 4H4FA 1ESTA 2FMJA 4CRCA 2ZECA 4B2BA 1V2JT 1ELAA 4Y79A 1W13U 1O2TA 3KQEA 3UWJH 3UR9A 3ZZ9A 3SNDA 1V2VT 3SI3H 3HK3B 1K2I1 1YF4A 1HCGA 3U1IB 1XXFA 1O3HA 1BRUP 2Y5FA 5F8ZA 1UTLM 1IQNA 3ZYDA 5GIBA 2BDYA 1VKYA 4NIYA 3ATIA 1K22H 3QGJA 1YBWA 1GPZA 1WDIA 2BXTH 1TNIA 1DSTA 1VCWA 2H2ZA 3TVJB 5C1XA 2ZIQH 1NU7B 4H42U 1HPGA 1ZTKA 5IYTA 5HM2A 4ABHA 1ELFA 1TIOA 1V2KT 1ZR0A 5DP8A 1S6LA 1CT0E 4UDWH 2A0QB 2XW9A 3M3TA 2YMSC 1OOKB 1YCPK 4ZMAH 1W8BH 4HG6A 3ZV8A 1JMOH 2HNTC 1DWEH 2JH6D 2SGPE 5E2OA 1LHCH 2ZCKP 4SGBE 2YNAA 5LPEA 1GG6C 2BHGA 1H8IH 1P8VC 5GCHF 2TIOA 1UK4A 3LIWA 3PV4A 1EOJA 2GMTC 1GHBG 4OS4A 3TU7H 1IQKA 5EXMA 1MTUA 2P8OC 1FUJA 1KXAA 4Q7XA 4CH8B 1FY3A 5TCCA 1GBLA 1D3PB 3EAJA 1C1OA 5CHAB 1UCYH 3QTOH 1GI9B 2Y5HA 1MU6B 2M5TA 4GUXA 3S7HB 3AW1A 2J97A 1RXPA 1GMDG 1NRSH 3BSQA 2GT8A 2JIZD 1WQVH 2FOAA 4A1VA 1S82A 2VIDA 3TH4H 1NRQH 3E3TA 1NY22 4IN2A 5FPTA 3MNCA 3N7EA 1C5LH 2WPDD 3UQOA 1Y8TA 4XSKU 3RXSA 3URCA 5JBTA 2FOGA 2EI6A 2J5UA 5FAHA 4FU7A 1BIOA 1EPTA 1ANBA 4DGJA 1F5LA 4DW2U 2FDAA 1HIAB 1C2IA 2HRVA 5TCAA 1TA2A 2WUCA 1ANCA 4OS1A 2GD4B 1NS3A 1P3EA 2UUYA 1Z8JB 4XE4A 3ZZ3A 1IHSH 3RXBA 1MD7A 1MBMA 3L6PA 1NO9H 1AI8H 2LPRA 1GJ8B 5DKMA 3U8TH 1SVPA 2KZ4A 5FPSA 2H1UA 3DD2H 3PB1E 5EJ1A 1SHYA 1YCPM 3SUDA 3MH4A 4DIHH 3NPSA 5B6LA 4JZ1A 4X2WA 3GCOA 4X1RU 2FP7B 5L6NH 1IQLA 3SUFA 5GPIB 2BDBA 5A8YA 1AB9C 5E8EH 5EXNA 1A3EH 1EB2A 1C2HA 1TALA 1SGCA 1MTNB 1XM1A 1KDQB 1SLWB 1AQ7A 1W7GH 1EPTB 2V3OH 4X2VA 1GBEA 2BDHA 2FOEA 3ESTA 3LONA 3V12A 2P16A 3S7KB 1C5TA 3MU8A 3T28A 1SOTA 2GCTC 1NBMD 2J34A 4BTIB 1ZOMA 5DP6A 5E0HA 1C5VA 2XYAA 3F9HA 2TBSA 3MH7A 3BTEE 1VR1H 4H6TA 1O2MA 5H4IB 1G36A 1O2WA 2ODPA 2G4TA 1C2GA 1F7ZA 1OWEA 3JZ1B 1GHWH 1V2PT 4Z0KA 2DE8A 3S69A 1YP9A 1OWJA 5C94A 3A7TA 1SMFE 2V6NA 2F9BH 2L74A 5DP9A 3W94A 1GI6A 3N7DA 1HJ9A 1C5OH 2WV5A 1O38A 2CHAB 3U8RH 1GI7B 4ABEA 1SI5H 2XC5A 3KF2A 2QIQA 2LELA 3A84A 2A2XH 4K1EA 4ZHLU 1OYTH 3TH3H 1LQDB 1EQ9A 2FLBH 2LP6A 2OC7A 3A7ZA 2UUFB 1Z8GA 5AF9H 1GBHA 1C1WH 5K0HA 1UVPA 1ORFA 2ZDKA 4NWLA 4D8NA 4TWYA 5A09A 1MQ5A 1BRCE 1EFRD 3GCTG 2AGGX 3GYLB 6LPRA 7KMEH 1ELBA 1ZPBA 1O5DH 4TSFD 2Z94A 2BLWA 3GY7A 2OC0A 2VVVA 2ZU3A 1TFXA 2ZNKH 4BTTB 1L1GA 2OC1A 4FUJA 4WXVA 4AFQA 1AIXH 1BRAA 1W10U 4F55A 1A1RA 4X1NU 3TGJE 2AEIH 3RXEA 1RFNA 4CRDA 5LPRA 1AGJA 1AMHA 2JJ1D 4FVDA 1SGTA 3FVFB 2G81E 2OK5A 1JWTA 2CJIA 4AN7A 2QF5A 1YLNA 1KSNA 1MQ6A 1E34B 1FNIA 1LVYA 1Z6EA 1TYNA 5EPNA 4DT4A 1XUGA 5A0BA 5EW2H 3A83A 1PFXC 1TGCA 3KYGA 1GBDA 1BA8B 3QX5H 3LDXH 1NM6A 1CGHA 1GI2A 3OU0A 3U8OH 1H9LB 2G8TA 1A7SA 1B0EA 1C2MA 2J98B 4AB8A 4A1XA 2QY0B 1TA6A 1DM4B 1UK2A 3A7YA 3FP6E 1G3BA 4E05H 4F4OC 3E90B 1AZ8A 4MLFB 5GJ4B 4Y11E 5C17A 1C1TA 3BTQE 4IW4E 3RMMH 4RT1A 2W5EA 2W7UA 4E06H 1CT2E 2NU3E 3ATMA 4YM9A 4X8SH 1O3CA 4YXWD 2G55A 4JK6A 2D1JA 1LTOA 2XBWA 1JRSA 3HATH 1CU1A 1WUNH 2GCHG 1AVGH 2B5TB 3GDVA 3A7WA 4MVNA 1JBUH 3KHVA 3M35A 1WCZA 2FM2A 3OAAD 3LC3A 3AVZA 4B6FA 3OEED 1ANDA 3RXPA 1UMAH 1YLCA 1SQAA 2QXGA 5CHBA 1AO5A 1SFIA 2Z9JA 1ACBE 1S81A 4X0WU 3URDA 7GCHF 2PWXA 2G52A 1C5SA 1GMCF 1BT7A 1BMFD 1PQ5A 1NFYA 5C5NA 3EE0B 1PJPA 1TGTA 2Z7FE 3VXEH 2A1DB 1MCTA 2EQNA 3RM0H 1UTMA 1GJDB 4K8YA 1BMAA 3DA9B 4R0IA 5FHTA 4BOHA 1AVWA 3SV8A 4CRAA 2NU0E 1K1PA 1BOQA 1C2EA 3U69H 2G00A 1ZRKA 3ZV9A 2RA3A 3EDXB 3FANA 3SI4H 2RFKC 1SLVB 4BAOB 4ZAEA 3D49H 2OC8A 1XVMA 5LPFA 1UO6A 2ZC9H 3E91A 1TQ7B 2R9PA 3MQKC 3EQ0H 1ZHRA 1ELEE 1G3CA 2FOFA 2QF3A 4X6MA 1FN8A 5ESTE 3ZIAD 3I77A 5EIYA 3ZVFA 3M5MA 2P3FH 1C9PA 4NA8A 3BN9A 2R3YA 2FLRH 2PFEA 1ZSLA 3BTME 1V2MT 1AB9B 1O31A 2GDEH 4AYYB 2QGRA 2OLGA 1O5FH 3B9FH 4I33A 1E37B 1FMGA 3E6PH 3ELAH 3KEEA 1AUTC 1NC6A 2ZU4A 2Z9IA 5C0UA 4ZCNA 1BDAA 4TPIZ 1VGCB 2EY4C 3TJNA 6GCHG 1H8DH 1P05A 1QY6A 4Y10E 1SGNE 3UOUA 2ZKSA 5IDKA 1C4V2 1K28D 2A4RA 3MH6A 5EOKA 1S0QA 1J8AA 1FPCH 2VIQA 5B6OA 3TK9A 2AH4X 3PTNA 4MNVA 3AAVA 1SGEE 1YKTA 1O3JA 1DANH 1LPGB 3SUEA 3PWCA 3ZYEA 3NRLA 1TNHA 4F49A 1BBRK 2HALA 3SUGA 2AMQA 1TWXB 1UTJA 1CO7E 4AFSA 1DWDH 2SNVA 1ESAA 3F9EA 1O39A 2TGPZ 3SO3A 4NG9H 3SW2B 3MOCA 3GS9A 1TNLA 4UONA 1FIZA 3DSGA 2THFB 4NZLA 1SHHB 3QLPH 3UNQA 2H9HA 4ABDA 4Q4LA 3ZVAA 2GZ7A 1GHAG 1EZSC 3GDSA 1MD8A 4OS7A 2A4GA 2WPKS 2CN0H 3BEUA 4FUDA 4LZ4B 2JH5D 1VCPA 2H5DA 4THNH 4K3JA 3ZZDA 4ZHMU 4M9FA 4CH2B 2VH6A 4FUFA 4H6SB 1O3IA 2BX3A 1LPZB 1FY5A 1A5HA 2FOHA 2ZU2A 2OTVA 2CGAA 4IBLH 1YC0A 3OY6U 1OSSA 1EAXA 2C8YB 2P3TB 3O8RA 1ETRH 2HOBA 1G2MA 1LVOA 1D6WA 5EW1H 1MKXH 3PRDA 1V2QT 1FN6A 3RU4E 3V7TA 9LPRA 1Y3XA 3MO6A 4NSYA 2VU8E 2K0QA 2AIPA 1YYY1 4ABBA 3WWBA 5C2ZA 3PLPA 4AG2A 2VIPA 3M5NA 4A6LA 1YY3A 4Y8ZA 2ZTZA 4UFFH 1HFDA 1O5AB 1SGQE 1AFQC 1KIGH 1PQAA 4XDEA 3RXAA 1ANEA 1BCUH 1SGIB 1PPHE 4FOUC 1WV7H 1TMBH 1O3PB 2ZHFH 1XKBC 2J4IA 4D7FA 3VB4A 2ZU5A 3E0NB 1CA0C 1SLUB 1UJ1A 3ENSB 4AORA 3F2GA 2O8TA 4KP0A 4TPYA 5F8TA 1G37A 1O3EA 4ISIH 1V2UT 3A8BA 1SGPE 1GBIA 3NXPA 3RXVA 1FX0B 1CBWC 1QB1A 3TPIZ 2ZFPH 3R3GB 1BTHH 1GMHG 2BLVA 1C1VH 1LVMA 5EXLA 1O2UA 3P8NA 2Z9KA 2BYAX 1G32B 1UCYK 3M7UA 1E0FD 2ZCHP 1O3OA 4Y0ZE 1LQEA 1PPZA 1GVZA 1JRTA 1BBRH 4NWKA 2ZDMA 2IJD1 3HKIB 3KN2A 4O3UA 1QB6A 4GSOA 2J9NA 2ZHEH 1UVOA 4UFDH 2TGAA 1THPB 5FXLA 3SORA 3HPTB 1QIXB 4ACAA 3F6UH 3SZNA 4Y7AA 2ZQ2A 1AZZA 1FZZA 3RXQA 4FUIA 3MO9A 2PTNA 1RS0A 2BM2A 3IG6B 2FI3E 4BAQB 2ZGHA 3F0PA 3PMBB 1SC8U 2P59A 1DVAH 3KQBA 1NN6A 1GBJA 2UWPA 8KME2 2P3UB 1ZGVA 2SGFE 1NESE 2J95A 3NKKA 1L1NA 2A7HA 2CV3A 1NFXA 2ZI2H 2F9PA 3ITIA 1EZXC 2DUCA 3SJ8A 2PKSB 1EJAA 4WMFA 1AN1E 4DT7B 1LKAA 3LGUA 1Y3WA 1LO6A 2GGVB 3Q76A 3GDUA 1QRWA 5EGMA 5PTPA 1LHFH 5E0GA 1YM0A 4B75A 1Q2WA 5T6GA 3MU0A 2J92A 3TLOA 5F6MA 4X2XA 1IQHA 1BMNH 4TWWA 4TYDA 4DG4A 1COWD 1HXFH 3PMHB 1GVLA 3RP2A 3S9BA 3Q3YA 2ZFQH 4YTAA 1P11E 5DK1A 1A5GH 2FOMB 3FFGA 1G2LA 2XC4A 1M9UA 2PV9B 4WMEA 1AWHB 2TGTA 3RC6A 1Q3XA 2FOBA 4X8TH 5T3HA 1BJUA 4MNXA 5KGOA 1LHEH 2EI8A 3BTWE 1MUEB 2WPMS 2B0FA 3UQVA 3GCTF 1HRTH 4MPVA 1HYLA 1EJNA 1C2KA 1WQSA 4MTBA 2JETC 1AE8H 2ANMH 1BMMH 1O3BA 1MKWH 1F0TA 3RMOH 1P04A 1ZHPA 3C1KA 2Q6GA 2AMDA 2OBQA 2WYJA 3UNRA 1XXDA 1UW7A 4I8KA 2BY7X 2HGTH 1AVXA 1SKYE 2KX4A 2IOTA 2BY6X 1YPMH 3OSYA 1P12E 4ZKRU 1YCPH 1T8OA 4B73A 1YPKH 1D3TB 1GJ6A 3CS7A 3FZDA 3A86A 3P6ZB 4ZROA 1DLEA 3H7TA 4O97A 1D6RA 1NZQH 1FJSA 3QUMP 3PMJA 2QXHA 5T6FA 1GDQA 3AASA 1C1PA 2FPZA 3A82A 1CHOG 1DITH 5DP4A 3BG4B 4ABFA 4NIWA 3SGBE 1BB0B 2Q1JA 5CHAC 1KXCA 1A4WH 4ISHH 3SQEE 1O2GH 1J17T 1W14U 1WXRA 5JBBS 3LT3A 3SJKA 1Q31A 1P2NA 5EJZA 4KELA 1FPHH 1Z71A 1GJBB 2VH0A 4CHAB 1TNGA 5LH8A 3BTGE 3RU4T 1GBAA 1D3QB 1OYQA 3F2FA 1SGDE 1A3BH 1NRPH 3UAIC 3LKWA 5GWZA 1O3LA 1BITA 2ZO3H 2STBE 1AE5A 1TPAE 4MNWA 5CDFE 3MHWU 1TPOA 3NUMA 2P93A 1UCYE 1PPEE 3ZVDA 1MABB 2PKAA 2NU1E 3FOAA 2A7CA 1DWCH 4WH6A 1C2LA 1JOUB 2HPQH 3RXGA 4AYVB 1H1BA 3GY3A 3M36A 4INLA 3FAOA 3FO8D 4DVAU 1EAWA 4X8VH 3PLKA 1HAOH 3TK5A 2KCOA 4FVBA 2C8XB 4NFEA 4B76A 1O2YA 2HNTF 5C5OA 1QL8A 3GYMA 1ZMLA 1P0SH 2AERH 2JETB 4D7GA 3UPEA 2DE9A 4I8HA 2ZGXH 1S6FA 1UK3A 2G5VA 1W0JD 5C1YA 1UVSH 1DLKB 2Y82A 1PYTC 2Z3DA 3BTKE 2P95A 1O5EH 3GY8A 3RXLA 1W2KH 3O8CA 1FY8E 4Y7BA 2ZFTA 3P17H 1FY1A 2GVFA 4AFZA 1TB6H 2RCEA 2V3MA 4D76A 2RA0A 2VWNA 4OGXA 4A92A 2QN5T 1O0DH 2ZHWH 3ZZ7A 1WOFA 8GCHF 3M5OA 5C20A 4E7NA 1UTNA 5DG6A 1LKBA 2W6JD 1RIWB 1GJ7B 2ZA5A 4UFGH 1TBQH 1E38B 3H09A 3KL6A 2OP9A 2ANWA 2I6SA 2ZG0H 2CK3D 2ILNA 2FXRA 2R0LA 3EA7A 1SGRE 5GCHG 1AWFH 2A45B 2IJOB 1RJXB 1MAXA 3UTUH 1J15A 1GBMA 1RD3B 2PR3A 1HAZB 3EE7A 3WWFA 2Y5GA 2J94A 2VIVA 5A0CA 1SL3A 1BUIA 2VWLA 1FY4A 1ABJH 4D9QA 3SU5A 2GV7A 2YNBA 5FPYA 2PUQH 1H9HE 3M7TA 1WBGB
chains in the Genus database with same CATH topology
1NFWA 3N7OA 2I6QA 2ZDVH 3TJOA 3DFLA 1RTFB 4TY6A 1OPHB 1TE0A 3M61U 4J2YB 1Z1IA 2SGAA 3IITA 1PQ8A 4IN1A 1TRYA 1EP5A 1Z1JA 3DFJA 2OUAA 2BD9A 2YOLA 3PM3A 1VJAU 4R8TB 1IQFA 1KTSB 5AHGH 3NCLA 1P9UA 5L2ZH 4YO9A 2SGEE 3RMLH 1K1MA 8LPRA 3ZVEA 1EASA 3D65E 4FUHA 1MKXK 2PGBB 3A88A 4JK5A 3ZZ6A 4WF8A 2Y81A 3RU4D 3SNAA 6CHAC 1YPHE 2NU2E 1P06A 1TPPA 5HMAA 1SPJA 2BVSH 2TRMA 4FUEA 1HBTH 4IS5A 4CREA 4NIXA 2HVXA 2XC0A 4DY7B 2SFAA 1W0ZU 3E16B 1S84A 3O8DA 1ELVA 3ATWA 1CHOF 3T27A 4FUGA 3LOXA 5BRRE 4FUCA 3T2NA 1HLTH 1XUJA 1DY9A 1GBFA 1U6QA 4FU9A 3QDZB 4K60A 2ZF0H 3VB5A 1GI3A 2SNWA 2NU4E 1AU8A 1TAWA 1HAVA 4BANB 1BTZA 5AFZH 4GHTA 4CR5A 2C8ZB 2J2UA 1GDNA 4MNYA 2VWOA 1ARCA 4AGJA 2AFQB 2VIWA 3K65B 1EZQA 1P03A 1UVTH 5F8XA 3TNSA 3LU9B 2A4OA 3Q3XA 1QJ6B 1W0YH 2FO9A 2OQ5A 1W12U 1P2KA 1C5ZB 3TK6A 1S85A 1O2KA 4Y71A 5I46H 5JDUB 1Y3UA 2TGDA 1ZPCA 1EP6A 3SJ9A 1O3AA 2A5IA 1O3DA 2PHBA 3BTDE 1QQ4A 2JH0D 1RTKA 1UHBA 4NFFA 1LVBA 1YGCH 1TONA 2V35A 5E0JA 1BZXE 1AUJA 3VGCC 2ZGBH 1GJ9B 2WUBA 4B1TA 1EKBB 1O2LA 2R0KA 4K5ZA 4A7IB 1TOMH 1RRKA 2BZAA 3SV2H 1Y5AT 3RXMA 2BD5A 1DFPA 3MI4A 2BXUH 4NGAH 2K1QA 3A81A 3TH2H 1O2PA 2VVCA 2OXSA 3RXOA 4AGKA 4I8LA 3SNEA 2Z3CA 1TX6A 1CE5A 4DCDA 2F91A 2ZFRH 3ZZBA 4BTUB 1TLDA 4IMQA 1NPMA 1FLEE 4I7YH 3OY5U 1HUTH 4RN6A 3H7OA 5ESBA 1L0ZA 5L30H 1DS2E 1JIRA 1P2JA 1S0RA 1SGYE 1YPEH 3TIUA 1BRBE 2AGIX 1ETSH 3AAUA 4YT7H 1P2MA 3QK1A 2BQWB 2BY9X 2FODA 2VVUA 1O2HA 2W7SA 4Q80A 1THSH 3QZQA 4DIIH 2ZFFH 2F3CE 3IWMA 1CA0B 2W3KA 3GY4A 1QA0A 1AD8H 4NA9H 1QGFA 1DSUA 1BTUA 1DICA 1MZDA 2GZ9A 2EI7A 5HM9A 4MG3A 4JYUH 5EQSA 3RXKA 3QN7A 4AZ2B 3SOSA 2ZHQH 1SSXA 1XUHA 2VB0A 3ATLA 4TY7A 3SU0A 3PLBA 1SOZA 1HJAC 1F5KU 1F92A 1KTTB 1GJ5H 2Y7ZA 3LGTA 5DO4H 3EGKH 1N6YA 3AW0A 1NU9A 3VB6A 4UD9H 1SG8B 1ZTLA 2EC9H 1MH0A 2BZ6H 4KKDA 3LC5A 3V0XA 3KQDA 1Z8IB 1H4WA 3V3MA 2ZP0H 1T8LA 4K1TA 3T29A 2QCYA 3RXUA 1GHYH 1MBQA 3ZZCA 1CHGA 1O36A 3BV9B 1C1NA 1N6XA 3LGWA 2FZZA 2H5CA 2ZFSA 4HZHA 4BXWA 2GKVE 3MYWA 1CA8B 2WPHS 4LXBH 4INKA 1DT2A 1ESBA 5DP7A 4XOJA 3BG4C 4O3TA 1P9SA 1VITF 1AFEH 3GISB 3HGNA 4JZIA 2TPIZ 2V0BA 3SBKA 1A2CH 2Y80A 3VGCB 4KTUA 3P92A 2WYGA 4CRFA 2ZCLP 4ZXYH 5GXPA 2ESTE 1QB9A 2AS9A 2ZTYA 1O32A 3RXCA 1FONA 3SHAH 1G3DA 2ZU1A 1UTPA 3D23A 3TNTA 4Y0YE 3U98H 4AG1A 2ZDLA 2V3HH 3SN8A 1BHXB 1UTQA 2GX4A 5FBEA 4J1YA 2C90B 4B74A 2CF9H 4QT8C 1FI8A 4VGCB 2PLXA 1DXPA 1P57B 1A46H 5EPYA 1B7XB 5A8XA 3HKJB 1S83A 2F9VA 4OS2A 1Y3VA 2FS8A 1QBOA 1DUEA 4OS6A 1TQ0B 5FCKA 4CHAC 1GBTA 3GY6A 2Q6DA 1GHAF 1ZYOA 3G01A 2PKSC 4MPXA 8GCHG 1K1NA 3L33A 2ZWLH 2O8MA 5HXFA 3I78A 2BLQA 5F03A 1XMNB 4Q7YA 2W3IA 4ISOA 1XUFA 3BIVH 2EEKA 1BJVA 1EJMA 4FXGH 3ZZ5A 1CGJE 3S0NA 5DP5A 1C5XB 1TGSZ 1VITH 3F9GA 2A7JA 1LHGH 4K1SA 4Q7ZA 2O8UA 1XUIA 1N1LA 1BTPA 5JBAS 1GI5A 3LJJA 4U32A 1C5MD 3RM2H 8ESTE 5JB9S 2FX6A 4LK4A 1E35B 3CS0A 2BD2A 4GHQA 1SQOA 2BY8X 2BB4A 1LMWB 1T4VH 2O9QA 1P02A 4X1QU 5E2PA 1MTVA 2VWMA 3EA8A 1MU8B 3A8DA 4OS5A 1HJAB 1GHVH 2FWWA 1SFQB 3STJA 1O2RA 3SGAE 3UFAA 1G9IE 2Z3EA 1V6DA 1G30B 2A31A 3W95A 3T25A 4RKJB 3ZZ8A 1IAUA 1GI0A 2G4UA 3P70B 4ZKSU 4ZH8A 2QAAA 2XXLA 2OBOA 1A0JA 1ZPZA 1EX3A 9ESTA 1O3GA 2A5AA 3BIUH 1BBRE 2ODQA 4X1PU 2W26A 2UWLA 4NZQA 3LGYA 1A0HB 4SGAE 4CRGA 1A61H 5C3NA 2R3UA 3LJOA 2WV4A 1ABIH 2XCFA 4NSVA 1C2FA 1MTWA 2ZDNA 3ODFA 1K1LA 4ASHA 4KGAA 4Q2KA 4ZHAA 3STIA 3MO3A 2IPHA 4Z6AH 1GCTC 4AFUA 2LNCA 1XUKA 2Z6BD 1HAVB 1GMCG 3H5CB 3QTVH 1O30A 1GJAB 1L4DA 1HAYB 3MNSA 1QR3E 1TRMA 3K6YA 5T6DA 1PQ7A 7ESTE 2O8LA 1K9OE 4WWYA 3C27B 1HAPH 5CE1A 1D4PB 1S5SA 4X1SU 3GOVB 3RXFA 4AB9A 2FEQH 1LDTT 5ETXA 2OINA 1O5BB 3HGPA 1K1IA 2VNTA 1AHTH 1UTOA 3BTHE 4CBNA 4GCHF 3FZZA 4U30A 1O2VA 4ISNA 4DJZB 2R2MB 3Q00A 3NK8A 5JPMH 3A85A 1EATA 1P10A 4X6OA 3RXJA 1MMJN 2BVXH 2VGCC 3M5LA 2HLCA 3RLWH 1IHTH 1C1SA 1TOCB 1E36B 4YOIA 4GVUA 4O03A 5DPAA 3KQCA 3I29A 4I31A 1L1JA 1GHZA 2ZDAH 1NRRH 6GCHF 1LPKB 3E0PB 1WSSH 1AY6H 3M37A 2JKHA 3A8AA 1H9IE 3SHCH 1Z6JH 4D9RA 3T26A 3ZZAA 1ZSJA 3OX7U 4Y76A 1VCQA 2ASUB 1OP8A 1ZJDA 4RSPA 5EG4A 4IC5A 2F9OA 4WXIA 5EQQA 3LH3A 2H9EH 3SNCA 5JBCS 3WY8A 3UOPA 1GJCB 1OWKA 2Q6FA 2QF0A 1JXPA 2P8OB 4YLQH 4B2AA 5FCRA 1DOJA 1MKWK 4U2WA 4CR9A 2ULLA 3L3TA 4LZ1H 1ETTH 3QO6A 3K9XB 2ZQ1A 1J14A 1QTFA 1QBNA 1IQMA 5J4QA 4U01A 2BDCA 1GI4A 1VZQH 1YPJH 3K6ZA 3A87A 4E7RG 1SLXB 2A4QA 1TMTH 1WTGH 3F9FA 1DX5M 1QJ7B 1F0RA 1O2NA 3MWIU 4B71A 1V3XA 1FAKH 1NT1A 1TBRH 4JZFH 3HK6B 1T8NA 3MH5A 4X6PA 5DP3A 2BX4A 2Z9LA 5K7RA 1B5GH 1GCDA 3PROA 3GY2A 3VB3A 2OD3B 3RXTA 3UY9A 3SU1A 1T4UH 1NFUA 4JZEH 1ZRBA 4HI3A 4X2YA 1QFKH 1OXGA 5L2YH 5FX6A 4NA7A 4WJG2 3RUOA 1V2TT 4MDSA 1YPHC 1C5WB 1C5RA 3U9AH 3KNXA 3SJIA 4ZUHA 5JYIA 1ELDE 2AIQA 2C93B 1EZUC 4A5TS 1SGFA 4WVPE 4BNRA 1W11U 3QWCH 4Y6DA 3RDZA 5C1UA 1NROH 1TNJA 4XBCA 1GGDB 3UREA 2H9TH 1QBVH 3KGPA 4HGCA 2PW8H 3K2UA 2Z9GA 4UEHH 4YESB 2ZHDA 2BD3A 1A5IA 2ALVA 1T7CA 2BMGB 3KCGH 2FESH 3P8GA 4ESTE 1TPSA 3M3SA 1S6HA 1K1OA 4M7GA 6CHAB 2UUKB 5J4SA 1UTKA 1WAYB 3OTJE 5FX5A 7LPRA 2RDLA 4FUBA 2H6MA 2Y7XA 4JCNA 3RXIA 2BDGA 2GCTB 2BDIA 4IC6A 2Y6TA 1QJ1B 1D9IA 1C4U2 5G4BA 2ANKH 1KDQA 3TGKE 1YPLH 3FP8E 3MMGA 1CQQA 3E8LA 1C1UH 1KXEA 2F83A 1KYNA 4VGCC 1QRXA 3ZVBA 1HNEE 3UNSA 1DY8A 4JMYA 3EA9A 2A32A 4XBBA 2B7DH 5A2MH 2XTTB 1INCA 1ELTA 1SQTA 2ZGJA 4K69A 3T62A 1BTXA 1HDTH 4JYVH 3U1JB 3TJUA 1O3MA 1HV7A 1V2RT 4GPGA 2P94A 2CMYA 1LCYA 2FX4A 3V13A 1N8OC 1HJ8A 2CXVA 2QXIA 2FTMA 1TX8A 3PYHA 1OP2A 3BTFE 1BTWA 2AMPA 1KY9A 1XVOA 4X6NA 1A0LA 3CP7A 1ELCA 1SR5C 2BD8A 4Y8XA 2G51A 1TNKA 3P8FA 2G5NA 1DWBH 1V2WT 1WYKA 3RC4A 1MTNC 4ZXXH 2QA9E 1SBWA 2ZGCA 1HAXB 3ATKA 2VIOA 1Z7KA 1P2OA 1MCVA 2F9NA 1TMUH 1BTYA 1GJ4H 1HAGE 2FS9A 2GV6A 1IQJA 2SGQE 3LPRA 1KXFA 2AYWA 1DUAA 2BD7A 3VFEA 1RTLA 2KAIA 3CENA 3RXRA 3SV9A 3MU5A 4DOQA 1MTSA 1C1RA 5DGJA 1V2OT 1V2ST 2WPLS 2FI4E 1C1QA 1O2IA 4ZKNU 3GICB 3BEIB 3SGQE 1EB1H 1OKXA 5I25A 3UWIA 1MAYA 1QRZA 1RGQA 4NIVA 2ZZUH 1OWIA 2D26C 3MTYA 5AFYH 1OWDA 5CMXH 2BDAA 3LGVA 1KLTA 2ZPQA 4YT6H 2NWNA 1FAXA 3DHKH 4GAWA 1GGDC 3B8JA 2HWLB 1AFQB 1WTHD 2C3SA 1W7XH 2B8OH 4MPUA 4I32A 3ZVGA 1EAUA 3A80A 2C4FH 2ZPRA 3RMNH 1C2DA 4MPWA 4ISLA 1TBZH 1OS8A 1V2NT 4WY3A 1W3CA 2FTLE 2ODYB 1C5PA 2ZPSA 3TJVA 3RXHA 4BAMB 2QYIA 2HNTE 1ELGA 5JB8S 3VPKA 1TRNA 2B9LA 1GDUA 1FIWA 2BTCE 1BHXF 2F9UA 1YPGH 1ZSKA 4KTCA 2J38A 2CF8H 2BD4A 1O2QA 1SGFG 1FXYA 4WH8A 2PTCE 1HB0B 3GCHB 1TGBA 2R2WU 1FDPA 4AOQA 4ABAA 1YLDA 1DDJA 3VEQB 1T8MA 1ZTJA 6ESTA 1ZHMA 1GBCA 4CBOA 1QNJA 2XNIA 1IOEA 2BQ7B 2XRCA 1THRH 3MU1A 3QZRA 7GCHG 1MZAA 2QXJA 5EU8A 3VXFH 5A8ZA 1DPOA 1O2XA 2BLOA 1QURH 2FOCA 3PMAB 3SNBA 4K2YA 5HGGA 1K1JA 2QV1A 2PKAB 1CSOE 1BQYA 1CBWB 1DE7H 1GG6B 1AKSB 3A8CA 3RXDA 1QQUA 2ZEBA 1PPBH 2ANYA 1JIMA 3RC5A 1ZJKA 2OQUA 3BG8A 2FI5E 2OCVB 3SV6A 3KIDU 3SU2A 1C5YB 3ODDA 5A0AE 5TJXA 2WPJS 5DJ7A 1HIAA 3F1SB 3MNXA 1HAHH 2PSXA 3MNBA 3OYPA 3S9CA 3E1XB 2BY5X 3LGIA 3PO1C 4XFQA 1LHDH 1T31A 1CVWH 5HYOA 3NZIA 4NCYA 1QHRB 4PROA 4FU8A 2A2QH 3ZZ4A 2SGDE 1KXBA 3GCHC 2FIRH 5BPEA 1P09A 2D2DA 3JZ2B 1P2IA 1O34A 1VITG 1PPGE 1KLJH 1O3KA 3DT0H 3SQHE 2BVRH 5ABWA 1O2OA 3M7QA 1F5RA 1QCPA 4YLUA 3Q3KA 4RKOB 1DXWA 1GL0E 3LH1A 1AKSA 1F0UA 1L4ZA 1OX1A 1O2ZA 3GCNA 1T32A 2IN2A 4YZUA 3FP7E 3P8OA 1NTPA 5LGOA 1L2EA 1C1MA 2A5KA 1VJ9U 4IMZA 1X7AC 1O2SA 1Z8RA 3GY5A 2XBXA 3T5FH 2O8WA 1P2QA 2GP9B 3BEFB 3F68H 3SV7A 4YOJA 1O5GH 1FQ3A 1FV9A 1GBKA 2ALPA 4KTSA 1UVUH 1KLIH 4JYTA 2BOKA 1V2LT 1EPTC 4I8GA 2QC2A 3NWUA 2BQ6B 1J16A 3R0FA 4BXSA 3PTBA 4X8UH 1O37A 1IQEA 4BAKB 1K21H 1Y59T 2FYQA 4O9VA 1HAIH 1TX7A 3PWBA 2XWBI 1ZMJA 3Q77A 2EA3A 2VGCB 1P3CA 1ZGIA 2FYRA 4AX9H 1ZMNA 1Y5BT 2HPPH 2BOHB 1WU1A 3BF6H 3A7XA 2VINA 3A89A 3SJOA 2XCNA 3EYDA 2XBVA 1ID5H 1GMHF 1EXFA 3M3VA 2RG3A 3TITA 2GCHF 1C5NH 3B23B 1NRNH 2PUXB 3ZVCA 1G3EA 1GVKB 3TGIE 1IQGA 4Y8YA 1P01A 2UWOA 5EQRA 2WINI 5GDSH 4ZKOU 4MQAA 1HXEH 2CHAC 1O33A 1VGCC 1F2SE 1TGNA 5SGAE 1CGIE 1O3NA 1ARBA 1O35A 2XWAA 1GBBA 4A1TA 4DURA 3SU4A 3A7VA 4LOYH 2D8WA 2ZTXA 3MFJA 2STAE 1B0FA 1ZZZA 5C67A 1XX9A 3UUZA 4XBDA 3UR6A 3S9AA 1GCTB