4GSOA

Structure of jararacussin-i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Jararacussin-I: The highly negatively charged catalytic interface contributes to macromolecular selectivity in snake venom thrombin-like enzymes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Thrombin-like enzyme BjussuSP-1
total genus 45
structure length 232
sequence length 232
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA02
1DY9A 1ESAA 2ANKH 1H8IH 2WUBA 1MTVA 4KTCA 1J9CH 5ESBA 1TA6A 3SV7A 4DJZB 4Y7BA 4K1EA 1NRNH 2H5CA 4YLUA 1W10U 1CHGA 3ZYEA 1TX7A 1CA8B 2OC7A 4OS4A 1NPMA 1XUGA 2UWOA 1NRQH 1IHSH 3S9BA 5DO4H 2J34A 4ZKNU 3O8BA 5HYOA 1L1NA 2GP9B 1LMWB 1MKXH 2SNWA 3ZZ4A 4ZUHA 1E37B 1UVSH 5FCRA 3TU7H 3GCHC 4GHQA 4RKJB 1QB6A 1S6FA 1MZDA 1EPTC 1EZXC 5AF9H 1AD8H 1UCYH 1T31A 2BD4A 5SGAE 4Q7YA 1A4WH 4MLFB 1MTNC 4ABDA 1IAUA 1UO6A 1UTPA 4XBDA 3DA9B 3PLPA 4UD9H 1EJMA 1QY6A 2FMJA 1DY8A 3NXPA 4IC6A 1SHHB 3N7OA 5IYTA 4AZ2B 1MD7A 4JCNA 2FTMA 1K22H 3SO3A 4ABHA 5EOKA 4FUIA 3GY7A 3FP8E 3GYLB 2ILNA 5AFYH 1DWCH 2GT7A 1C2HA 1FV9A 1FMGA 1UVOA 2SGAA 2STAE 2ZCHP 3E90B 3KHVA 2Z3DA 2BDHA 5DP8A 4RKOB 4E05H 1GDNA 1TNJA 1W7GH 1L4ZA 2H9TH 8KME2 4E06H 3M5MA 3RMLH 5TCCA 1O2RA 4RN6A 3SV2H 4IMQA 1AMHA 1OP0A 2ODPA 1ELDE 1C1WH 1QNJA 2WPKS 1KTSB 4UE7H 4B73A 5FBEA 1O2IA 4NA7A 4TY6A 4I7YH 3EQ0H 1O35A 1EOLA 2VGCC 1P05A 4OGXA 2J4IA 5C1XA 1XUKA 1F7ZA 4MPVA 6ESTA 1XKBC 3NWUA 3U9AH 1TX8A 1LVMA 1Z8RA 3BG4C 1C5MD 3KQBA 1QJ7B 2Z9GA 4I8GA 2HWLB 1D3QB 2G55A 1LPZB 3M61U 1VITG 3MO6A 3RXIA 3KQCA 3RXEA 3Q3YA 1K9OE 1C5OH 1CSOE 1AWFH 3A87A 4AGKA 4K5ZA 4NZLA 2BLQA 3SU1A 5A8XA 3RC5A 1Y8TA 1O5EH 2A7HA 2JETB 4O3UA 3ZYDA 1O5CB 1GMHF 3BIVH 2FOAA 1F2SE 2NU1E 3URCA 1GVZA 1K21H 4FUCA 2H5DA 1O2LA 2VJ1A 2VIDA 1VGCB 1PYTD 3F9EA 2OC8A 3BTWE 1G9IE 1O5AB 1UTMA 1BMNH 1RGQA 3TGJE 2NU3E 2VINA 1GBEA 3ZVEA 3NKKA 4JMYA 1VITH 1T8NA 4MNVA 4ZHAA 1KTTB 1YPLH 2VIOA 4HTCH 3ODFA 4JZIA 1GJ7B 1KXCA 3EDXB 1QJ6B 1FPCH 3PMJA 4R8TB 3VB6A 2BXUH 4A1VA 1YPJH 3ZV8A 1E0FD 1C1RA 2YNBA 2NU2E 1KXBA 2W26A 4KP0A 5AHGH 1O2QA 3RXGA 2O9QA 2BD2A 3TITA 1CBWB 4YOJA 3ATLA 2A0QB 1ZLRA 1C5WB 3MFJA 1A2CH 1O3PB 2FX6A 5EPYA 2BHGA 3FP6E 1V6DA 4J1YA 1HCGA 3U1IB 4AB8A 4BNRA 1BMMH 4FU8A 8GCHG 4WY3A 1P2JA 2ZF0H 4AG1A 5A2MH 5DKMA 1DWDH 4B75A 5DGJA 2BOKA 3MH7A 1ELFA 1P01A 1YCPH 1MBMA 1K1OA 3ZZ9A 2ZCLP 2Z7FE 1A5HA 2GV6A 3HATH 4CREA 2RCEA 1HNEE 5E2OA 1GPZA 5T6GA 4WJG2 3RXVA 4R0IA 1PQ8A 5AFZH 3GISB 2VH0A 2FOMB 4BTUB 1O3OA 1YPHE 1QBNA 2WV4A 3B9FH 1NFUA 1OWEA 4BXWA 1HIAB 2XC4A 2Y5GA 1K2I1 4ZMAH 3SUDA 3MNBA 1A46H 3SW2B 5J4SA 1F5LA 1GVLA 2EEKA 1C2IA 5EW2H 2VWOA 4AX9H 5HM9A 4DGJA 1GBBA 1IQIA 1MD8A 1EPTB 3MO3A 2AFQB 1MCTA 4I8HA 2W7SA 3TH3H 3PROA 2FOFA 1BJVA 3A82A 4U30A 1OYQA 3MOCA 1FY5A 3SORA 2R0KA 1HGTH 3LDXH 3MNCA 1ID5H 1O0DH 4B76A 4WXIA 4YOIA 2A5KA 2XC0A 4K1TA 1TGBA 2O8TA 2KAIB 3U8OH 2PSYA 1XUJA 2WPLS 1YCPK 1GI1A 2CF9H 1TNLA 2GVFA 3QLPH 1AKSB 1BMAA 1JIMA 4WMDA 3JZ2B 1W11U 1C9PA 3SJIA 3QZRA 2F9UA 3DT0H 2XW9A 1BBRK 4AFSA 1ZSJA 1SGFG 1AZ8A 2ZKSA 1Y5BT 4K3JA 4IGDA 1G30B 4NCYA 1UCYE 5LPEA 2F9PA 1LHDH 4JZEH 6GCHG 3GYMA 3TK9A 1C5TA 1YPMH 1NY22 3OY5U 4TWYA 2UWLA 5EXLA 1A0HB 4YLQH 1IOEA 3K65B 5A09A 3GY8A 3KQEA 1OXGA 2Z9KA 4GPGA 3G01A 4U2WA 3V0XA 4Y0ZE 1LO6A 3SZNA 1O2JA 2G5VA 3SV8A 1C1SA 1C5ZB 2UUKB 3MU1A 3ENSB 3TJVA 1CO7E 3QDZB 3ZVFA 1SGCA 4AFQA 2VVCA 3SNBA 2ZCKP 1L4DA 4ABFA 1D9IA 3L3TA 3EAJA 2CGAA 1PPEE 4K69A 3BF6H 1C5LH 1GBKA 1YP9A 2F83A 1HAIH 1ZOMA 1DSUA 1C1OA 3ZVAA 2J94A 4ZKRU 3QUMP 1BMLA 5ABWA 1O5FH 2ZGJA 2BMGB 1GI2A 3RXJA 2CMYA 3M37A 1S0RA 3QTOH 3SU2A 1GJBB 5FX6A 5EQSA 3LC3A 2I6SA 2BDCA 1AVGH 1C5NH 5C20A 2FI4E 1FONA 1GCTC 4ISIH 1Y3WA 2ZGBH 1SGQE 3LOXA 2ZO3H 4MPUA 1FY4A 1GJ9B 3T2NA 1O2ZA 1TONA 4CRDA 5DPAA 1DXPA 2BXTH 1GJ6A 4ESTE 1QQ4A 3GDSA 3Q77A 1W8BH 1F92A 1P03A 2GX4A 3SGQE 1G3CA 2QN5T 2FODA 1HFDA 4DT7B 2ZI2H 3ATKA 1ZMNA 4X6MA 2V3OH 2XTTB 1O2VA 1VR1H 1SG8B 1TLDA 1G36A 1ZJDA 5JDUB 2VWLA 1O3NA 3VFEA 2W7UA 4B2AA 1C1UH 3MNSA 2CF8H 1EP5A 3PMBB 1YLDA 1AE8H 3RXAA 1Z6EA 5I25A 3RXUA 1YGCH 2ZTYA 1TMBH 2ZFFH 3BEFB 2SFAA 1V2UT 1O2MA 1GHAG 4BAOB 1MQ6A 3QO6A 2P3UB 1GJ4H 3T5FH 1IQNA 3AW0A 2R3UA 4FUDA 4OS5A 5DP6A 1HAHH 1W0YH 3UQVA 1CA0B 3RC6A 3GCTF 2OBOA 1DSTA 4IMZA 2ZHQH 4BAQB 4DG4A 2V3HH 2HPQH 3SU6A 4JZDH 2P16A 2EA3A 3RXTA 5A0CA 1N8OC 3VB7A 1K1JA 2VVUA 4SGBE 1GJ8B 1NFYA 5EU8A 6CHAC 1GMCG 4ABBA 3L6PA 4AOQA 3SNAA 3STIA 3HPTB 1CU1A 1AUJA 1WTGH 2CN0H 1RJXB 6LPRA 1TNKA 4YM9A 1TFXA 2WPMS 1DUEA 3ATIA 1FDPA 1BB0B 2AIPA 1SVPA 2HALA 1J16A 1HIAA 2PUQH 3Q3KA 3UWIA 4X1QU 1GDQA 3ZZ3A 1NU9A 1GBCA 5C1UA 2W3IA 1A5GH 1GGDC 1THRH 2XBVA 1O3CA 3UOUA 4K1SA 1DE7H 1GBLA 4YOGA 3OU0A 3ZZ7A 1CBWC 3MH5A 3RXKA 3SUFA 3GDVA 5GIBA 5EG4A 3LGYA 1LPKB 3CP7A 3V12A 1CA0C 1D3PB 3DUXH 3P95A 1KXEA 5H4IB 1BJUA 3SU4A 1HAVB 3A81A 2TGDA 3ZZBA 3LT3A 1ZMLA 1SLWB 1SGPE 3ZV9A 1C5QA 1FNIA 1NC6A 3MI4A 5T6DA 1FN6A 1QB1A 1A3BH 1INCA 1S81A 1NT1A 2ZU4A 1E34B 1JBUH 1ACBE 1OS8A 4D8NA 1HRTH 1TPAE 1GHBG 1QCPA 2BDGA 4DY7B 5FPTA 1OWJA 1UK4A 2HVXA 2VIPA 5K7RA 2GZ8A 4NIVA 1T4VH 4D9RA 2Z94A 2ZHWH 1ZPCA 2Y7XA 1TQ7B 1Z8GA 4D7FA 2PUXB 1NO9H 4CHAC 1V2LT 2GCHG 4E7NA 1TRYA 3PM3A 2ZPSA 2F9NA 1JXPA 3RP2A 4TPYA 3SUEA 2Q6DA 4CR5A 2ZDMA 3EYDA 1ZTLA 2BB4A 3SU0A 1QIXB 2XRCA 1JWTA 1BTHH 1HDTH 3CS7A 1EATA 3R3GB 2P59A 2QYIA 1EB1H 2Y5HA 1GBFA 5CHAC 4X6NA 1S84A 2QC2A 1WU1A 1ZSKA 3LGUA 2F3CE 1BTWA 1UVPA 4CR9A 2ANWA 3ITIA 3B8JA 1ESBA 4KGAA 6CHAB 1YM0A 1DPOA 1EAUA 3E3TA 4GCHF 2TIOA 4BANB 3LONA 1D4PB 3RXMA 2H1UA 1SHYA 3V7TA 1C4Y2 1LVOA 4KELA 5C5OA 1SGYE 1F5KU 1S85A 3V13A 3NUMA 1C2JA 4Y0YE 1V2ST 1EKBB 3GY6A 2AS9A 5A8ZA 1EAWA 3IITA 3URDA 1O38A 2A4GA 1WCZA 2UUYA 3Q3XA 1Y3XA 3FZZA 4X2XA 5FAHA 3TJUA 2BQ7B 1WQSA 2EC9H 4H42U 1K1MA 3RC4A 4UFGH 3S9AA 3SJ8A 1FY1A 1TABE 4OS2A 1LPGB 3MO9A 1V2OT 2GDDA 1UCYK 1J15A 4ZXXH 1FQ3A 5CMXH 2RA0A 1NRPH 1H1BA 1V2NT 2VIWA 5B6OA 4I33A 1GBAA 1YC0A 2HLCA 5FX5A 4INLA 8LPRA 4BTIB 4I8LA 1OYTH 4UFDH 1THSH 1KXAA 3LH1A 1C5XB 1WQVH 1G2LA 1RFNA 2GMTB 1MH0A 2G4TA 5HGGA 7KMEH 1G37A 3EA7A 4FU7A 3R0FA 3BTKE 1P2NA 4BAHB 1FAXA 2WV5A 2ZDKA 1C5VA 2ZFQH 4BTTB 3E0PB 2BTCE 4OGYA 5HMAA 3HKIB 4B2BA 1XUFA 2NU0E 1P0SH 4ZXYH 1EX3A 1O31A 3MNXA 2A7CA 4FUEA 1QL8A 5C5NA 3E8LA 2R2WU 3O8RA 2H9HA 4ABIA 1BZXE 1O2NA 1HAVA 2G4UA 2VVVA 1THPB 1ZTKA 1UTOA 1FPHH 3M3SA 1SLUB 4WWYA 1BTZA 1NU7B 1MQ5A 2DUCA 1AIXH 3H5CB 3O8DA 3ZVCA 4CRCA 2HRVA 2JH6D 2AMPA 3RLYH 2TBSA 2HPPH 1MBQA 1QB9A 1TX6A 3RXQA 1H9LB 1A7SA 2A4RA 4QT8C 5EXMA 4VGCC 5C3NA 1UK2A 3PLBA 1P2OA 2Q6FA 2FOBA 1GCDA 2G52A 1O3AA 5C1YA 5GXPA 1ZZZA 1TMTH 4BAKB 1GHZA 3A8AA 1KLIH 5E2PA 2FPZA 4K60A 1DOJA 4J2YB 2QAAA 3PTBA 1O36A 2IOTA 2FOCA 1IQKA 4WF8A 4JYUH 1MZAA 2CV3A 1E38B 4A6LA 4MQAA 2Z6BD 1HAPH 1ZSLA 2ASUB 1SGIB 2I6QA 4ABGA 3FZDA 3ZVDA 2PKSB 1PPHE 3GCNA 1Y5AT 4Y11E 3TJOA 1SI5H 1S82A 2ZA5A 2XNIA 3SGBE 3W95A 3RXHA 1EAIA 3ZZ5A 1P10A 1UVUH 2M5TA 2QXGA 1ANBA 1IQGA 4ABAA 5L6NH 1P02A 1UK3A 2ZDVH 2KAIA 1O3HA 1PYTC 2ZQ1A 5LPRA 1SQOA 2C4FH 1CHOF 2AGEX 1DX5M 1GJ5H 1OWKA 4MPWA 1A0JA 1P11E 2BDBA 4ZAEA 4Y8YA 4CRBA 1BBRE 2ZG0H 3OX7U 2C8WB 3VPKA 1AVWA 1ELVA 1ZRBA 4BOHA 4CBNA 4D7GA 4X2WA 3C27B 1DLKB 1O3MA 1CHOG 2OP9A 4Q2KA 4AORA 2QXJA 1OX1A 1ANDA 3ELAH 3B23B 2C93B 4YO9A 1C1VH 5K0HA 2OBQA 1C2LA 2VIQA 2QA9E 4AFUA 3HKJB 4INHA 2PHBA 4Y79A 1UVTH 1W14U 1XX9A 1XVOA 2FTLE 1K1LA 4XBBA 5C67A 1EZSC 1BTPA 1OWDA 1D6RA 4MVNA 2Q6GA 1GBDA 4IBLH 1O39A 1GHBF 3KL6A 1LTOA 1NFWA 3A84A 3LH3A 2LPRA 1VITF 2ZU5A 3U69H 5EQRA 2ZC9H 3PYHA 1MKWK 4MTBA 3A7YA 3SGAE 3M35A 1C1MA 1F0TA 1AFQC 1DFPA 2XXLA 1H9IE 3MU8A 2BLWA 2TGTA 2XWBI 2JH5D 1GL0E 3UTUH 1ZRKA 4CHAB 1EUFA 1QJ1B 5JB8S 3UWJH 9LPRA 1UTLM 3UQOA 2PKAA 3VEQB 5JBBS 1HUTH 1SL3A 1O2TA 4X6PA 1SR5C 1IQMA 3BG8A 1FIZA 3VGCC 2C8XB 1Z8JB 3BIUH 5JYIA 1V2VT 5L2ZH 2JKHA 1CT0E 1O5BB 4Q7ZA 2ZDNA 2O8MA 1O30A 2BYAX 3BG4B 4GSOA 1P2IA 1BHXF 4YESB 1ELBA 1SB1H 1TMUH 1O2XA 3OTJE 2V6NA 1TRNA 3RXBA 1O3JA 1VCWA 2STBE 1DICA 3E91A 3LPRA 1FIWA 4ZROA 4JYVH 2BD5A 2BD9A 3A7WA 2IJOB 1Z6JH 3SQEE 3ZVBA 2H2ZA 3A80A 1QBVH 1TB6H 3V3MA 1ABIH 1O2HA 4I8JA 5DP3A 1ZHRA 1SQAA 1C2GA 1Q3XA 2GCHF 4K8YA 1GG6C 1N1LA 3RMNH 3VGCB 1KLJH 5ESTE 1WOFA 1SC8U 2ZPRA 1QRWA 1CT4E 1LQEA 3MYWA 3AVZA 3NPSA 2QCYA 3PO1B 4DW2U 3E1XB 1ETSH 1GBHA 3A7VA 4KTUA 2B8OH 1VGCC 3EE0B 2SGQE 2FM2A 1JOUB 1CGIE 4UDWH 4B2CA 1B0FA 2YOLA 2DE8A 2PTNA 3PMAB 3ZZ6A 1QTFA 4LZ4B 1XUIA 1Z1IA 4A7IB 1O5GH 3ATMA 1HPGA 3SV6A 1AGJA 2R0LA 1HLTH 5ETXA 1MCVA 4ABEA 4Z6AH 1BRCE 3SHAH 2BDIA 1AFQB 1C5UA 1X7AC 2WUCA 2ZTXA 1NESE 2HGTH 1GBIA 1U6QA 2GKVE 2B5TB 3A7ZA 1AZZA 2OD3B 4ZKSU 2CJIA 2TGPZ 3GCHB 1TNGA 1Z71A 1FXYA 3F9FA 4FUGA 4E7RG 2P94A 3GDUA 2FI5E 4JK5A 1A0LA 1SBWA 2O8WA 2OUAA 2R3YA 2GGVB 2AIQA 3MH6A 3EA8A 2FI3E 2VGCB 3F6UH 3F1SB 4X2YA 3SI4H 2BY8X 3TNSA 3U8RH 2BDAA 2J9NA 3OYPA 3TPIZ 2XBWA 1TIOA 4UEHH 1GGDB 3VB5A 1QQUA 1LQDB 4DIHH 3BTHE 4TPIZ 1BQYA 1PPZA 3SNCA 1BTXA 5L2YH 3WY8A 1HYLA 2OLGA 4O03A 3RU4E 2CXVA 3ZZCA 3W94A 3PTNA 2ZGCA 3UY9A 4YTAA 3TIUA 3OSYA 5FXLA 3UFAA 1MTSA 2D26C 1FAKH 1O3DA 2NWNA 1C5YB 1EASA 1GCTB 2BY5X 3GOVB 3DHKH 3A8BA 2OC1A 1V2WT 1C1QA 2IPHA 2ZU2A 1LHFH 1AI8H 3BTQE 3BTGE 1UHBA 1ZYOA 4F49A 2PKSC 2TPIZ 2BD3A 2AH4X 1IQJA 1MTNB 2FXRA 3FANA 3PLKA 4JK6A 4D76A 6GCHF 1O3FA 1BBRH 1V2KT 3KCGH 3TLOA 1YPGH 2A2QH 1PFXC 1D6WA 1YLCA 2P3FH 1Y59T 2HNTF 3D65E 1C1TA 3K6YA 3QZQA 1O2OA 4I32A 3KIDU 5GWZA 1C5SA 1C9TA 1KY9A 1QGFA 1BA8B 1LHEH 1QL9A 2QF0A 2WPIS 2BVXH 3D62A 1ZR0A 4O3TA 3SJ9A 1QL7A 2W5EA 2P95A 3NK8A 5BPEA 2ZECA 2QXHA 3AASA 4B1TA 1HAGE 1HJAB 2P8OC 1BRUP 2FYRA 1DM4B 4O9VA 1L1GA 3RXCA 1TPSA 1O32A 1GI6A 1O3EA 4H6TA 2PSXA 2O8LA 4FUHA 3SV9A 1FY8E 4X8TH 1OSSA 1CT2E 2BDYA 1HXFH 4TY7A 2OINA 1IQLA 1IQEA 7ESTE 1ANEA 1GBTA 1RIWC 3M5LA 4A5TS 1IHTH 1OP2A 1SOTA 1WV7H 1FJSA 3QWCH 1HJ8A 1TGCA 2HOBA 2ULLA 2ZDAH 3M3VA 4B74A 1FN8A 5DK1A 3T29A 2PKAB 1TQ0B 4UFEH 2P8OB 4NG9H 1QFKH 3T28A 1PJPA 3A85A 3LKWA 1FZZA 4FUFA 2BZAA 1NN6A 1MKXK 4KKDA 5GCHF 1EPTA 3I77A 1C4U2 2GTBA 4X8UH 1BOQA 1C5PA 1BIOA 1L0ZA 4WH8A 1SMFE 1PPCE 1TBRH 2TGAA 1ARCA 1AUTC 1J14A 2C90B 2A31A 3ODDA 4DVAU 4FU9A 5LGOA 1NRRH 5FPSA 3S7KB 1MU6B 4ISNA 3TK6A 5F8ZA 2HNTE 1HXEH 1XM1A 1VJAU 3RUOA 5DG6A 1O37A 2ZQ2A 3BTME 3RM0H 3TGKE 1KDQA 2ANYA 5DP7A 3O8CA 5DJ7A 1AKSA 1AHTH 1TPOA 2QV1A 1V2RT 3RMMH 1EQ9A 1ZGVA 2G8TA 3M7TA 1GI8B 1GJDB 3LC5A 5JPMH 1GHYH 2GCTB 2SNVA 2BY6X 1KLTA 1P04A 1DITH 3NZIA 4NFEA 4XFQA 1TOCB 5AVDA 1GI4A 4WMFA 1J8AA 1BITA 4ISOA 3QTVH 3UOPA 4ASHA 3OY6U 1O34A 3K6ZA 4ZHMU 3HGNA 1NS3A 1O5DH 4GHTA 1PPGE 1GMCF 3HK3B 1EZQA 3A8DA 3L33A 1FUJA 1LKAA 1O2UA 1XUHA 2WPJS 4DURA 5HM2A 3RLWH 1ZTJA 1DDJA 3RMOH 1NFXA 2D1JA 4H6SB 2Y7ZA 3GCTG 1YBWA 2HNTC 5GDSH 3P8NA 4Y10E 1P3CA 1E35B 1WTHD 1DLEA 1W2KH 2ZEBA 3P70B 2ZNKH 5EQQA 4NGAH 1F5RA 1FLEE 4YZUA 1SPJA 1O3BA 1O2SA 1ZGIA 4TYDA 1ELCA 1M9UA 2FO9A 1UTJA 2BD8A 3MU5A 1LVYA 4TWWA 2ODYB 1KDQB 1OOKB 1O2YA 1KYNA 1O2PA 1B0EA 4INKA 4IW4E 4D9QA 2TRMA 3BN9A 4YT6H 4A1XA 3Q00A 1GI7B 2GZ9A 3IWMA 1XXDA 3ZZAA 3MU0A 5EW1H 1K1PA 1QRXA 2GDEH 2ZFTA 1W7XH 2OCVB 1HBTH 1XVMA 3SQHE 3LGWA 1UTNA 2W3KA 1DWBH 1VCQA 4HZHA 1TPPA 1MKWH 2OTVA 4AGJA 2SGEE 5TJXA 1MAYA 1ZMJA 4IN2A 1H8DH 5E8EH 2C3SA 3SOSA 2FS8A 5TCAA 4Y76A 2F9BH 3MH4A 1VCPA 1E36B 3BV9B 4MNYA 1O3KA 2JETC 2QGRA 5GPIB 3ESTA 2Y5FA 5DP4A 1WYKA 2BLVA 8ESTE 1GI9B 4HFPB 2ZU1A 5FBIA 3S7HB 5JBAS 1ELEE 1OKXA 2GZ7A 1K1IA 4ZHLU 3RXLA 2CHAB 3A7TA 1Q2WA 1GG6B 1SGFA 3GICB 1AN1E 3T27A 3NCLA 2UUFB 1GHVH 3GY3A 2AGIX 5J4QA 3SNDA 3RU4D 4XE4A 3T25A 1NROH 5BRRE 2ZGXH 2BVSH 1KXFA 3PB1E 2FX4A 2SGDE 1EJAA 2EI6A 3JZ1B 1GI0A 2NU4E 1V2PT 2OQUA 1T8LA 1W3CA 2Q1JA 1TBQH 2H6MA 4NA9H 3BTEE 2V35A 5DP5A 1TBZH 4AYYB 2XBXA 1ETTH 3A88A 4I31A 3F68H 5IDKA 2FP7B 2PR3A 1KIGH 2P93A 1YPKH 3ZZDA 4LK4A 5L30H 3P8GA 4LZ1H 1V2MT 3RDZA 1CGJE 1HJ9A 4Q80A 1SGNE 4RSPA 2XCFA 3KQDA 2Y81A 1ZHMA 1SOZA 4A92A 4MPXA 2RG3A 4FUJA 1TNHA 3M5NA 1O2WA 4CRGA 1ELGA 1UHBB 1BDAA 1G2MA 3HGPA 5JBCS 2WPHS 3QGNB 1AU8A 1C2KA 2C8ZB 1SGEE 2VIVA 4BAMB 3P8OA 3DD2H 4O97A 2AGGX 4NA8A 3D49H 2UWPA 4A1TA 5T6FA 3MTYA 3AAVA 4HGCA 1ORFA 1B7XB 2FESH 4CBOA 1DT2A 3TH4H 3RXPA 2THFB 2VH6A 1QR3E 3CS0A 3VB3A 5A0BA 3IG6B 2PTCE 1LHCH 5PTPA 4X0WU 4X2VA 3A86A 2BVRH 2Z3CA 1AFEH 1YCPM 3UR9A 2Z3EA 2BY7X 4F4OC 2WINI 2J92A 1TGNA 5F8XA 5E0GA 3UIRA 4FUBA 2GD4B 3RM2H 1NZQH 3P8FA 2BOHB 4NIWA 7GCHF 2QF3A 2ZFPH 3E16B 3UNQA 3PV4A 3A89A 3GCOA 4NZQA 5FHTA 1T8OA 1PQ5A 2BLOA 1ESTA 1GMDG 2GCTC 1C5RA 3S69A 3T26A 1P09A 3K9XB 1RS0A 1J17T 2ALPA 1OPHB 3TJNA 3I78A 2FIRH 2C8YB 2OXSA 3VXFH 1XMNB 1AVXA 2F91A 2Y6TA 1EAXA 3KGPA 2O8UA 2UUJB 2PW8H 5JBTA 1MU8B 4THNH 3RXDA 1ZHPA 3QK1A 2ODQA 1VZQH 1YKTA 4CH2B 1HAOH 1H4WA 1UJ1A 1OWIA 5F8TA 1MAXA 1DXWA 1F0RA 2A1DB 3U98H 3QGJA 1A3EH 3BEUA 1P8VC 5EXNA 3H7TA 1O2KA 1ARBA 1RRKA 3PMHB 3P6ZB 4FVDA 1SQTA 1MUEB 2GV7A 1UTQA 4WXVA 3ATWA 1WBGB 1RIWB 2ZFSA 3U8TH 1C2DA 1D3TB 4U01A 3TK5A 2G51A 7GCHG 3TNTA 1JRSA 2ZFRH 1PPFE 2RA3A 3MMGA 1SGTA 4AYVB 1RD3B 3LGIA 4VGCB 2LNCA 1HJAC 1TOMH 1BHXB 1O3LA 2PGQB 5EGMA 3SUGA 2XBYA 1G3EA 1N6XA 4I8KA 2GMTC 1UMAH 5FPYA 2ZHDA 1F0UA 2ZU3A 1PPBH 4NIYA 4KTSA 1O3IA 4NWLA 2ANMH 1SLXB 3E6PH 5JB9S 1TYNA 1V3XA 4ZKOU 1IQHA 3MWIU 4SGAE 1S83A 1KXDA 1BTYA 3LGVA 3MU4A 4DCDA 5A8YA 4MDSA 4OS1A 1PQ7A 2WYGA 3RU4T 4WH6A 1TA2A 3LIWA 4Y6DA 3KNXA 1BRBE 3RXFA 1YPHC 4DIIH 2OQ5A 4X8VH 2G5NA 1NRSH 2FEQH 5E0JA 1UTKA 4K2YA 3LU9B 1AY6H 2B0FA 3FP7E 4DOQA 4UONA 1DANH 3CENA 3QN7A 3S9CA 1WUNH 2A7JA 1EZUC 3LJOA 3BSQA 3SI3H 1IQFA 1AB9C 2YNAA 1JMOH 3PWCA 4OS7A 3TH2H 1WAYB 5C2ZA 4X1PU 3DFJA 2EI7A 3FAOA 4Y8ZA 3AW1A 4YT7H 3D23A 2BZ6H 4IC5A 5F6MA 1C1PA 2XYAA 3C1KA 1Y3UA 2OC0A 5HXFA 2AERH 4OS6A 1CQQA 2RDLA 5T3HA 5GCHG 3BTDE 1AQ7A 3SHCH 1V2QT 3E0NB 4PROA 3P92A 4CRAA 2A32A 2BX3A 3UREA 1ELTA 4AG2A 4XDEA 1SFIA 5LH8A 3A83A 2A4QA 1QBOA 2ESTE 4BXSA 2QY0B 3EGKH 7LPRA 2FOEA 1SSXA 1ELAA 2AMDA 2SGFE 3UPEA 1GHWH 4JZFH 3TVJB 4XOJA 5EODA 2ZDLA 1V2JT 1GI5A 2XWAA 1BRAA 3RXRA 1RXPA 1TWXB 4NSVA 2BX4A 1C4V2 1V2TT 2PGBB 1Y5UT 4FXGH 3UUZA 1GBMA 2Y80A 2PV9B 2QIQA 1W0ZU 2FYQA 1AWHB 1T4UH 1C2FA 1ANCA 1Z7KA 2QXIA 5CHAB 1GHXH 1P9SA 2VWMA 2A5IA 4Y71A 1Z8IB 3T62A 1CVWH 1DS2E 2FLBH 3QX5H 2PLXA 2ZIQH 1KSNA 4GUXA 4GVUA 4X8SH 4CH8B 1Q31A 4XBCA 1GVKB 1EXFA 3LGTA 1G32B 1B5GH 4XSKU 3ZZ8A 1LDTT 1HAYB 1GHAF 1Y3VA 1MTWA 1HAZB 3VB4A 1T7CA 1CE5A 1TRMA 1TE0A 3M3TA 1W13U 4MNWA 3KN2A 1TNIA 4X1SU 1P57B 2H9EH 1FY3A 1P2KA 1WSSH 3GY2A 1BT7A 5LPFA 1CGHA 1G3BA 2CHAC 1NTPA 1SGRE 2FWWA 2FDAA 1ZPZA 2XCNA 3SBKA 3PO1C 5G4BA 9ESTA 2BY9X 4Y8XA 3PWBA 1EP6A 1P2MA 4Y7AA 1A1RA 2ZWLH 4LOYH 1C1NA 2ZGHA 3UR6A 3BTFE 1YYY1 3STJA 2K1QA 3EA9A 2AMQA 3MHWU 4M7GA 1RTLA 2ZZUH 1T32A 2BQ6B 4WVPE 1EJNA 1D3DB 1O33A 2FOGA 1A5IA 1QA7A 1G3DA 2AEIH 1ABJH 1AO5A 2Z9IA 1L2EA 1F0SA 2P3TB 2B7DH 2DE9A 2D8WA 2PWXA 3ZVGA 1P06A 3F9HA 4NSYA 1QRZA 1H9HE 1P2QA 8GCHF 1LKBA 1P9UA 3SU5A 1GJAB 5DP9A 4B71A 2ZTZA 4Z0KA 1Y3YA 1JRTA 1N8OB 3KEEA 3S0NA 2F9OA 2ZPQA 1GI3A 3GY4A 3HK6B 1NM6A 1L1JA 3SJOA 2BQWB 5E0HA 4JZ1A 1GL1A 1GDUA 3BEIB 4GAWA 1S5SA 3RXOA 1LHGH 1ZPBA 3TGIE 2Z9LA 4K8BA 5FCKA 1T8MA 1SLVB 1XXFA 1YPEH 1FI8A 1JIRA 1HAXB 1OP8A 1QURH 4MG3A 3SU3A 3FFGA 3UNRA 1AE5A 2G00A 1K28D 2XC5A 4GLYA 1XKAC 3M7UA 1DWEH 1GWAA 1O2GH 4AB9A 3M7QA 1HV7A 4NIXA 3SNEA 1MTUA 1N6YA 4WMEA 1TGTA 1QA0A 2JH0D 2GT8A 2ZHEH 4IS5A 4HI3A 4NWKA 3H7OA 5F03A 3AAUA 3M36A 1GMHG 5I46H 3A8CA 2Z9JA 2FOHA 2J2UA 1P12E 4ISHH 1BCUH 1EOJA 3BTTE 2VB0A 1K1NA 1TALA 2VNTA 1ZJKA 5EPNA 2A45B 5GJ4B 3FVFB 1RTKA 3RXSA 2ALVA 4H4FA 3GY5A 3A7XA 2FZZA 4JYTA 1OWHA 3SJKA 2SGPE 1GJCB 4IN1A 2ZP0H 2G81E 1SFQB 2F9VA 4ABJA 1EB2A 4ZH8A 3P17H 4UFFH 2PFEA 4LXBH 2FS9A 3U1JB 1C2EA 2BM2A 1LVBA 3F9GA 1O3GA 1P3EA 3Q76A 1AB9B 3LJJA 1GMDF 1MMJN 2B9LA 4NFFA 1VJ9U 4Q7XA 1ETRH 1GBJA 1DUAA 4X6OA 4CRFA 1LCYA 2A4OA 4ISLA 2A2XH 4FVBA 1BTUA 2EI8A 1YF4A 2VU8E 4U32A 3SN8A 3M5OA 1DVAH 1S6HA 1C2MA 1A61H 2WYJA 4X1NU 1TGSZ 4AFZA 3K2UA 3UNSA 2A5AA 2J95A 3VXEH 1SGDE 1PQAA 1S0QA 2Y82A 1QHRB 1BUIA 2V0BA 2D2DA 4AN7A 4MNXA 2AYWA 2R9PA 1RTFB 2J38A 1TAWA 5A0AE 1Z1JA 2FLRH 5CE1A 2IN2A 4GCHG 2VWNA 3KF2A 4X1RU 1HB0B 2ZHFH 2BD7A 3DFLA 2R2MB 1W12U 3I29A
chains in the Genus database with same CATH superfamily
1DY9A 1ESAA 5DN6D 2ANKH 1H8IH 2WUBA 1MTVA 4KTCA 1J9CH 5ESBA 1TA6A 3SV7A 4DJZB 4Y7BA 4K1EA 1NRNH 2H5CA 4YLUA 5IK2D 1W10U 1CHGA 3ZYEA 1TX7A 1CA8B 2OC7A 4OS4A 1NPMA 1XUGA 2UWOA 1NRQH 1IHSH 3S9BA 5DO4H 2J34A 4ZKNU 3O8BA 5HYOA 1L1NA 2GP9B 1LMWB 1MKXH 2SNWA 3ZZ4A 4ZUHA 1E37B 1UVSH 5FCRA 3TU7H 3GCHC 4GHQA 4RKJB 1QB6A 1S6FA 1MZDA 1EPTC 1EZXC 2KCAA 5AF9H 1AD8H 1UCYH 1T31A 2BD4A 5SGAE 4Q7YA 1A4WH 4MLFB 1MTNC 4ABDA 1IAUA 1UO6A 1UTPA 4XBDA 3DA9B 3PLPA 4UD9H 1EJMA 1QY6A 2FMJA 1DY8A 3NXPA 4IC6A 1SHHB 3N7OA 5IYTA 4AZ2B 1MD7A 4JCNA 2FTMA 1K22H 3SO3A 4ABHA 5EOKA 4FUIA 3GY7A 4ASUD 3FP8E 3GYLB 2ILNA 5AFYH 1DWCH 2GT7A 1C2HA 1FV9A 1FMGA 1UVOA 2SGAA 2STAE 2ZCHP 3E90B 3KHVA 2Z3DA 2BDHA 1W0KD 5DP8A 4RKOB 4E05H 1GDNA 1TNJA 1W7GH 3DSGA 1L4ZA 2H9TH 8KME2 1YWUA 3OEHD 4E06H 3M5MA 3RMLH 5TCCA 3WW7A 1O2RA 4RN6A 3SV2H 4IMQA 1AMHA 1OP0A 2ODPA 1ELDE 1C1WH 1QNJA 2WPKS 1KTSB 4UE7H 4B73A 5FBEA 3AK5A 1O2IA 4NA7A 4TY6A 4I7YH 3EQ0H 1O35A 1EOLA 2VGCC 1P05A 2W6JD 4OGXA 2J4IA 5C1XA 1XUKA 1F7ZA 4MPVA 6ESTA 1XKBC 3NWUA 3U9AH 1TX8A 1LVMA 1Z8RA 3BG4C 1C5MD 3KQBA 1QZ8A 1QJ7B 2Z9GA 4I8GA 2HWLB 1D3QB 2G55A 1LPZB 3M61U 1VITG 3MO6A 3RXIA 3KQCA 4YXWD 3RXEA 3Q3YA 1K9OE 1C5OH 1CSOE 1AWFH 3A87A 4AGKA 4K5ZA 4NZLA 2BLQA 3SU1A 3WWFA 5A8XA 3RC5A 1Y8TA 1O5EH 2A7HA 2JETB 4O3UA 3ZYDA 1O5CB 1GMHF 4FOUC 3BIVH 2FOAA 1F2SE 2NU1E 3URCA 1GVZA 1K21H 4FUCA 1FX0B 2H5DA 1O2LA 2VJ1A 3WWBA 2VIDA 5KECA 1VGCB 1PYTD 3F9EA 2OC8A 3BTWE 1G9IE 1O5AB 2PP6A 1UTMA 1BMNH 1RGQA 3TGJE 3SZEA 2NU3E 5F53A 2VINA 1GBEA 3ZVEA 3NKKA 4JMYA 1VITH 1T8NA 4MNVA 4ZHAA 1KTTB 1YPLH 2VIOA 4HTCH 3ODFA 4JZIA 1GJ7B 1KXCA 3EDXB 1QJ6B 1FPCH 3PMJA 4R8TB 3VB6A 2BXUH 4A1VA 1YPJH 3ZV8A 1E0FD 1C1RA 2YNBA 2NU2E 1KXBA 2W26A 4KP0A 5AHGH 1O2QA 3RXGA 2HVYB 2EQNA 2O9QA 2BD2A 3TITA 1CBWB 4YOJA 3ATLA 2A0QB 1ZLRA 1C5WB 3MFJA 1A2CH 1O3PB 2FX6A 5EPYA 2BHGA 3FP6E 1V6DA 4J1YA 1HCGA 3U1IB 4AB8A 1BMFD 4BNRA 1BMMH 4FU8A 8GCHG 4WY3A 2KM0A 1P2JA 2ZF0H 4AG1A 5A2MH 5DKMA 1DWDH 4B75A 5DGJA 2BOKA 3MH7A 1ELFA 1P01A 1YCPH 1MBMA 1K1OA 3ZZ9A 2ZCLP 2Z7FE 1A5HA 2GV6A 3HATH 4CREA 2RCEA 1HNEE 5E2OA 1GPZA 5T6GA 4WJG2 3RXVA 4R0IA 1PQ8A 5AFZH 3F2HA 3GISB 2VH0A 2FOMB 4BTUB 1O3OA 1YPHE 1QBNA 2WV4A 3B9FH 1NFUA 1OWEA 4BXWA 1HIAB 2XC4A 2Y5GA 1K2I1 4ZMAH 3SUDA 3MNBA 1A46H 3SW2B 5J4SA 1F5LA 1GVLA 2EEKA 1C2IA 5EW2H 2VWOA 4AX9H 5HM9A 4DGJA 2JIZD 1GBBA 1IQIA 1MD8A 1EPTB 3MO3A 2AFQB 1MCTA 4I8HA 2W7SA 3TH3H 3PROA 2FOFA 1BJVA 3A82A 4U30A 3OFND 1OYQA 3MOCA 1FY5A 3SORA 2R0KA 1HGTH 3LDXH 3MNCA 1ID5H 1O0DH 4B76A 4WXIA 4YOIA 2A5KA 2XC0A 4K1TA 1TGBA 2O8TA 1VKYA 2KAIB 3U8OH 2PSYA 1XUJA 2WPLS 1YCPK 1GI1A 2CF9H 1TNLA 2GVFA 3QLPH 1AKSB 1BMAA 1JIMA 4WMDA 3JZ2B 1W11U 1S6LA 1C9PA 3SJIA 3QZRA 2F9UA 3DT0H 2XW9A 1BBRK 5FL7D 4AFSA 1ZSJA 1SGFG 1AZ8A 2ZKSA 1Y5BT 4K3JA 4IGDA 1G30B 4NCYA 1UCYE 5LPEA 2F9PA 1LHDH 4JZEH 6GCHG 3GYMA 3TK9A 1C5TA 3U28C 1YPMH 1NY22 3OY5U 4TWYA 2UWLA 5EXLA 1A0HB 3PRBA 4YLQH 1IOEA 3K65B 5A09A 3GY8A 3KQEA 1OXGA 2LELA 2Z9KA 4GPGA 3G01A 4U2WA 3V0XA 4Y0ZE 1LO6A 3SZNA 1O2JA 2G5VA 3SV8A 3NRLA 1C1SA 2W6ID 1C5ZB 2K8IA 2UUKB 3ENSB 3MU1A 3TJVA 1CO7E 3QDZB 3ZVFA 1SGCA 4AFQA 2VVCA 3SNBA 2ZCKP 1L4DA 4ABFA 1D9IA 3L3TA 3EAJA 2CGAA 1PPEE 4K69A 3BF6H 1C5LH 1GBKA 4P00A 1YP9A 2F83A 1HAIH 1ZOMA 1DSUA 1C1OA 3ZVAA 2J94A 4ZKRU 3QUMP 1BMLA 5ABWA 1O5FH 2ZGJA 2BMGB 1GI2A 3RXJA 4F55A 2CMYA 3M37A 1S0RA 3QTOH 3SU2A 1GJBB 5FX6A 5EQSA 3LC3A 2I6SA 3FKSD 5B6LA 2BDCA 1AVGH 1C5NH 5C20A 2FI4E 1FONA 1GCTC 4ISIH 1Y3WA 2ZGBH 1SGQE 2JJ1D 3LOXA 1E1RD 2ZO3H 4MPUA 1FY4A 1GJ9B 3T2NA 1O2ZA 1TONA 4CRDA 5DPAA 1DXPA 2BXTH 1GJ6A 4ESTE 1QQ4A 3GDSA 3Q77A 5EJZA 1W8BH 1F92A 1P03A 2GX4A 3SGQE 1G3CA 2QN5T 2FODA 1HFDA 4DT7B 2ZI2H 3ATKA 1ZMNA 4X6MA 2V3OH 3H09A 4P02A 2XTTB 1O2VA 1VR1H 1SG8B 1TLDA 1G36A 1ZJDA 5JDUB 2VWLA 1O3NA 3VFEA 2W7UA 4B2AA 1C1UH 3MNSA 2CF8H 1EP5A 3PMBB 1YLDA 1AE8H 3RXAA 1Z6EA 5I25A 3RXUA 1YGCH 2ZTYA 1TMBH 2ZFFH 3BEFB 2SFAA 2F43B 1V2UT 1O2MA 1GHAG 4BAOB 1MQ6A 3QO6A 2P3UB 1GJ4H 3T5FH 1IQNA 3AW0A 2R3UA 4FUDA 4OS5A 5DP6A 1HAHH 1W0YH 3UQVA 1CA0B 3RC6A 3GCTF 2OBOA 5C0UA 1DSTA 4IMZA 2ZHQH 4BAQB 4DG4A 2QF4A 2V3HH 2HPQH 3SU6A 4JZDH 2P16A 2EA3A 3RXTA 5A0CA 1N8OC 3VB7A 1K1JA 2VVUA 4SGBE 1GJ8B 1NFYA 5EU8A 6CHAC 1GMCG 4ABBA 2EY4C 3L6PA 4TSFD 4AOQA 3SNAA 3ZIAD 3STIA 3HPTB 1CU1A 1AUJA 1WTGH 2CN0H 1RJXB 6LPRA 1TNKA 4YM9A 1TFXA 2WPMS 1DUEA 3ATIA 3F0OA 1FDPA 1BB0B 2AIPA 1SVPA 2HALA 2JJ2D 1J16A 1HIAA 2PUQH 3Q3KA 3UWIA 4X1QU 1GDQA 5KEDA 3ZZ3A 1NU9A 1GBCA 5C1UA 2W3IA 1A5GH 1GGDC 1THRH 2XBVA 1O3CA 3UOUA 4K1SA 1DE7H 1GBLA 4YOGA 3OU0A 3ZZ7A 1CBWC 3MH5A 3RXKA 3SUFA 3GDVA 5GIBA 5EG4A 3LGYA 1LPKB 3CP7A 3V12A 1CA0C 1D3PB 3DUXH 3P95A 3MQKC 1KXEA 5H4IB 1BJUA 3SU4A 3VG8A 2RFKC 1HAVB 3A81A 2TGDA 3ZZBA 3LT3A 1ZMLA 1SLWB 1SGPE 3ZV9A 1C5QA 1FNIA 1NC6A 3MI4A 5T6DA 1FN6A 1QB1A 1A3BH 1INCA 1S81A 2L74A 1NT1A 2ZU4A 1E34B 1JBUH 3N99A 1ACBE 1OS8A 4D8NA 1HRTH 1TPAE 1GHBG 1QCPA 2BDGA 4DY7B 5FPTA 1OWJA 1UK4A 2F4LA 2HVXA 2VIPA 5K7RA 2GZ8A 4NIVA 1T4VH 4D9RA 2Z94A 2ZHWH 1ZPCA 2Y7XA 1TQ7B 1Z8GA 4D7FA 2PUXB 1NO9H 4CHAC 1V2LT 2GCHG 4E7NA 1TRYA 3PM3A 2ZPSA 2F9NA 1JXPA 3RP2A 4TPYA 3SUEA 2Q6DA 4CR5A 2ZDMA 3EYDA 1ZTLA 2BB4A 3SU0A 1QIXB 2XRCA 1JWTA 1BTHH 1HDTH 3CS7A 3UAIC 1EATA 3R3GB 2P59A 2QYIA 1EB1H 2Y5HA 4ACBA 1GBFA 5CHAC 4X6NA 1S84A 2QC2A 1WU1A 1ZSKA 2K0QA 3LGUA 2F3CE 1YY3A 1BTWA 1UVPA 4CR9A 2ANWA 4Q4LA 3ITIA 3B8JA 1ESBA 4KGAA 6CHAB 1YM0A 1DPOA 1EAUA 3E3TA 4GCHF 2TIOA 4BANB 3LONA 1D4PB 3RXMA 2H1UA 1SHYA 3V7TA 1C4Y2 1LVOA 4KELA 5C5OA 1SGYE 1F5KU 1S85A 3V13A 3NUMA 1C2JA 2QE7D 4Y0YE 1V2ST 1EKBB 3GY6A 2AS9A 5A8ZA 1EAWA 3IITA 3URDA 1O38A 2A4GA 1WCZA 2UUYA 3Q3XA 1Y3XA 3FZZA 4X2XA 5FAHA 3TJUA 2BQ7B 1WQSA 2EC9H 4H42U 1K1MA 3RC4A 2J5UA 4UFGH 3S9AA 3SJ8A 1FY1A 1TABE 4OS2A 1LPGB 3MO9A 1V2OT 2GDDA 1UCYK 1J15A 4ZXXH 1FQ3A 5CMXH 2RA0A 1NRPH 1H1BA 1V2NT 2VIWA 5B6OA 2IPQX 4I33A 1GBAA 1YC0A 2HLCA 5FX5A 4INLA 8LPRA 4BTIB 4I8LA 4F48B 1OYTH 4UFDH 1THSH 1KXAA 3LH1A 1C5XB 1WQVH 1G2LA 1RFNA 2GMTB 1MH0A 2G4TA 5HGGA 7KMEH 1G37A 3EA7A 4FU7A 3R0FA 3BTKE 1P2NA 4BAHB 1FAXA 2WV5A 2ZDKA 1C5VA 2ZFQH 4BTTB 3E0PB 2BTCE 4OGYA 5HMAA 3HKIB 4B2BA 1XUFA 2NU0E 1P0SH 4ZXYH 1EX3A 1O31A 3MNXA 2A7CA 4FUEA 1QL8A 5C5NA 3E8LA 2R2WU 3O8RA 4ZCNA 2H9HA 4ABIA 1BZXE 1O2NA 1HAVA 2G4UA 2VVVA 1THPB 1ZTKA 3SYJA 1UTOA 1FPHH 3M3SA 1SLUB 4WWYA 1BTZA 1NU7B 1MQ5A 2DUCA 1AIXH 3H5CB 3O8DA 2KCPA 3ZVCA 4CRCA 2HRVA 2WV9A 2JH6D 2AMPA 3RLYH 2TBSA 2HPPH 3PV2A 1MBQA 1QB9A 1TX6A 3RXQA 1H9LB 1A7SA 2A4RA 4QT8C 5EXMA 2KR7A 4VGCC 5C3NA 1UK2A 3PLBA 1P2OA 2Q6FA 2FOBA 1GCDA 2G52A 5EIYA 1O3AA 5C94A 5C1YA 5GXPA 1ZZZA 1TMTH 4BAKB 1GHZA 3A8AA 1KLIH 5E2PA 2FPZA 4K60A 1DOJA 4J2YB 2QAAA 3F3BA 3PTBA 1O36A 2IOTA 2FOCA 1IQKA 4WF8A 4JYUH 1MZAA 2CV3A 1E38B 4A6LA 4MQAA 2Z6BD 3FOAA 1ZSLA 1HAPH 2ASUB 1SGIB 2I6QA 4ABGA 3FZDA 3ZVDA 2PKSB 1PPHE 3GCNA 1Y5AT 4Y11E 3TJOA 4HG6A 1SI5H 4XD7D 1S82A 2ZA5A 2XNIA 3SGBE 3W95A 3RXHA 1EAIA 3ZZ5A 1P10A 3PV5A 1UVUH 2M5TA 2KX4A 2QXGA 1ANBA 1IQGA 4ABAA 5L6NH 1P02A 1UK3A 2ZDVH 2J98B 2KAIA 1O3HA 1PYTC 2ZQ1A 5LPRA 1SQOA 2C4FH 1CHOF 2AGEX 1DX5M 1GJ5H 2VBCA 1OWKA 4MPWA 1A0JA 1P11E 2BDBA 4ZAEA 4Y8YA 4CRBA 1BBRE 2ZG0H 3OX7U 2C8WB 3VPKA 4M9FA 1AVWA 1ELVA 1ZRBA 4BOHA 4CBNA 4D7GA 4FETA 4X2WA 3C27B 1DLKB 2WZQA 1O3MA 1CHOG 2OP9A 4Q2KA 4AORA 2QXJA 1OX1A 1ANDA 3ELAH 3B23B 2C93B 4YO9A 1C1VH 5K0HA 2OBQA 1C2LA 2VIQA 2QA9E 4AFUA 3HKJB 4INHA 2PHBA 4Y79A 1UVTH 1W14U 1XX9A 1SQRA 1XVOA 2FTLE 1K1LA 4XBBA 5C67A 1EZSC 1BTPA 1OWDA 1D6RA 4MVNA 2Q6GA 1GBDA 4IBLH 1O39A 1GHBF 3KL6A 1LTOA 1NFWA 3A84A 3LH3A 2LPRA 1VITF 2ZU5A 3U69H 3UB0A 5EQRA 2ZC9H 3PYHA 1MKWK 4MTBA 3A7YA 3SGAE 3M35A 1C1MA 1F0TA 2XNDD 1AFQC 1DFPA 2XXLA 2JDID 1H9IE 3MU8A 2BLWA 2TGTA 2XWBI 2JH5D 5C17A 1GL0E 3UTUH 1ZRKA 4CHAB 1EUFA 1QJ1B 5JB8S 3UWJH 9LPRA 1UTLM 3UQOA 2PKAA 3VEQB 5JBBS 1HUTH 1SL3A 1O2TA 4X6PA 5EJ1A 1SR5C 5GNDA 2V7QD 1IQMA 3BG8A 1FIZA 3VGCC 2C8XB 1Z8JB 3BIUH 5JYIA 1V2VT 5L2ZH 2JKHA 1CT0E 1O5BB 4Q7ZA 2ZDNA 2O8MA 1O30A 2BYAX 3BG4B 4GSOA 1P2IA 1BHXF 4YESB 1ELBA 3F0PA 1SB1H 1TMUH 1O2XA 3OTJE 2V6NA 1TRNA 3RXBA 1O3JA 1VCWA 2STBE 1DICA 3E91A 3LPRA 1FIWA 4ZROA 4JYVH 2BD5A 2BD9A 3A7WA 2IJOB 1Z6JH 3SQEE 3ZVBA 2H2ZA 3A80A 1QBVH 1TB6H 3V3MA 1ABIH 1O2HA 4I8JA 5DP3A 1ZHRA 1SQAA 1C2GA 1Q3XA 2GCHF 4K8YA 1GG6C 1N1LA 3RMNH 3VGCB 1KLJH 5ESTE 1WOFA 1SC8U 2ZPRA 1QRWA 1CT4E 4Q63A 1LQEA 3MYWA 3AVZA 3NPSA 2QCYA 3PO1B 4DW2U 3E1XB 1ETSH 1GBHA 3A7VA 1NBME 4KTUA 2B8OH 1VGCC 3EE0B 2SGQE 2FM2A 1JOUB 1CGIE 4UDWH 4B2CA 1B0FA 2YOLA 2DE8A 2PTNA 3PMAB 3ZZ6A 1QTFA 4LZ4B 1XUIA 1Z1IA 4A7IB 1O5GH 3ATMA 1HPGA 3SV6A 1AGJA 2R0LA 2IJD1 1HLTH 5ETXA 1MCVA 4ABEA 4Z6AH 1BRCE 3SHAH 2BDIA 1AFQB 1C5UA 1X7AC 2WUCA 2ZTXA 1NESE 2HGTH 1GBIA 1U6QA 2GKVE 2B5TB 3A7ZA 1AZZA 2OD3B 4ZKSU 2CJIA 2TGPZ 3GCHB 1TNGA 1Z71A 1FXYA 3F9FA 4FUGA 4E7RG 2P94A 3GDUA 2FI5E 4JK5A 1A0LA 1SBWA 2O8WA 2OUAA 2R3YA 2GGVB 2AIQA 3MH6A 3EA8A 2FI3E 2VGCB 3EE7A 3F6UH 3F1SB 4X2YA 3SI4H 2BY8X 2J98A 3TNSA 3U8RH 2BDAA 2J9NA 3OYPA 3TPIZ 2XBWA 1TIOA 4UEHH 1GGDB 3VB5A 1QQUA 1LQDB 4DIHH 3BTHE 4TPIZ 1BQYA 1PPZA 3SNCA 1BTXA 5L2YH 3WY8A 1HYLA 2OLGA 4O03A 3RU4E 2CXVA 3ZZCA 3W94A 3PTNA 2ZGCA 3UY9A 4YTAA 3TIUA 3OSYA 2LP6A 5FXLA 3UFAA 4RT1A 1MTSA 2D26C 1FAKH 1O3DA 2NWNA 1C5YB 1EASA 1GCTB 2BY5X 3GOVB 3DHKH 3A8BA 2OC1A 1V2WT 1C1QA 3FO8D 2IPHA 2ZU2A 1LHFH 1AI8H 3BTQE 1WDIA 1WXRA 3BTGE 1UHBA 1ZYOA 4F49A 2PKSC 2TPIZ 2BD3A 2AH4X 1IQJA 1MTNB 2FXRA 3FANA 3PLKA 4JK6A 4D76A 6GCHF 1O3FA 1BBRH 1V2KT 3KCGH 3TLOA 1YPGH 2A2QH 1PFXC 1D6WA 1YLCA 2P3FH 1Y59T 2HNTF 3D65E 1C1TA 3K6YA 3QZQA 1O2OA 4I32A 3KIDU 5GWZA 1C5SA 1C9TA 1KY9A 1QGFA 1BA8B 1LHEH 1QL9A 2QF0A 2WPIS 2BVXH 3D62A 1ZR0A 4O3TA 3SJ9A 1QL7A 2W5EA 2P95A 3NK8A 5BPEA 2ZECA 2QXHA 3AASA 4B6FA 4B1TA 1HAGE 1HJAB 2P8OC 1BRUP 2FYRA 1DM4B 4O9VA 1L1GA 3RXCA 1TPSA 1O32A 1GI6A 1O3EA 4H6TA 2PSXA 2O8LA 4FUHA 3SV9A 1FY8E 4X8TH 1YLNA 1H8HD 1OSSA 2AHME 1CT2E 2BDYA 1HXFH 4TY7A 2OINA 1IQLA 1IQEA 7ESTE 1ANEA 1GBTA 1RIWC 3M5LA 4A5TS 1IHTH 1OP2A 1SOTA 1WV7H 1FJSA 3QWCH 1HJ8A 1TGCA 2HOBA 3PRDA 2ULLA 2ZDAH 3M3VA 4B74A 1FN8A 5DK1A 3T29A 2PKAB 1TQ0B 4UFEH 2P8OB 4NG9H 1QFKH 3T28A 1PJPA 3A85A 3LKWA 1FZZA 4FUFA 2BZAA 1NN6A 1MKXK 4KKDA 5GCHF 1EPTA 3I77A 1C4U2 2GTBA 4X8UH 1BOQA 1C5PA 1BIOA 1L0ZA 4WH8A 1SMFE 1PPCE 1TBRH 2TGAA 5EJLA 1ARCA 1AUTC 1J14A 2C90B 2A31A 3ODDA 4DVAU 4FU9A 5LGOA 1NRRH 5FPSA 3S7KB 1MU6B 4ISNA 3TK6A 5F8ZA 2HNTE 1HXEH 1XM1A 1VJAU 3RUOA 5DG6A 1O37A 2ZQ2A 3BTME 3RM0H 3TGKE 1KDQA 2ANYA 2WHXA 5DP7A 3O8CA 3CNRA 1AKSA 1AHTH 5DJ7A 1TPOA 2QV1A 1V2RT 3RMMH 1EQ9A 1ZGVA 2G8TA 3M7TA 1GI8B 1GJDB 3LC5A 5JPMH 1GHYH 2GCTB 2SNVA 2BY6X 1KLTA 1P04A 1DITH 3NZIA 4NFEA 4XFQA 1TOCB 5AVDA 1GI4A 4WMFA 1J8AA 1BITA 4ISOA 3QTVH 3UOPA 4ASHA 3OY6U 1O34A 3K6ZA 4ZHMU 3HGNA 1NS3A 1O5DH 4GHTA 1PPGE 3N7EA 1GMCF 3HK3B 1EZQA 3A8DA 3L33A 1FUJA 1LKAA 1O2UA 1XUHA 2WPJS 4DURA 5HM2A 2KCYA 3RLWH 1ZTJA 1DDJA 2QF5A 3RMOH 1NFXA 2D1JA 4H6SB 2Y7ZA 3GCTG 3DSPA 1YBWA 2HNTC 5GDSH 3P8NA 4Y10E 1P3CA 1E35B 1WTHD 1DLEA 1W2KH 2ZEBA 3P70B 2ZNKH 5CDFE 5EQQA 4NGAH 1F5RA 1FLEE 4YZUA 1SPJA 2YMSB 1O3BA 1O2SA 1NBMD 1ZGIA 4TYDA 1ELCA 1M9UA 2FO9A 1UTJA 2BD8A 3MU5A 3OAAD 1LVYA 4TWWA 2ODYB 4TT3D 1KDQB 4Z1MD 1OOKB 1O2YA 1KYNA 1O2PA 1B0EA 4INKA 4IW4E 4D9QA 2TRMA 3BN9A 4YT6H 4A1XA 3Q00A 1GI7B 2GZ9A 3IWMA 1XXDA 3ZZAA 3MU0A 1MABB 5EW1H 1K1PA 1QRXA 2GDEH 2ZFTA 1W7XH 2OCVB 1HBTH 1XVMA 3SQHE 3LGWA 1UTNA 2W3KA 1DWBH 1VCQA 4HZHA 1TPPA 1MKWH 2OTVA 4AGJA 2SGEE 5TJXA 1MAYA 1ZMJA 4IN2A 1H8DH 5E8EH 2C3SA 3SOSA 2FS8A 5TCAA 4Y76A 2F9BH 3MH4A 1K0HA 1VCPA 1E36B 3BV9B 3F2FA 4MNYA 1O3KA 2JETC 2QGRA 5GPIB 3ESTA 2Y5FA 5DP4A 1WYKA 2BLVA 8ESTE 1GI9B 4HFPB 2ZU1A 5FBIA 3FN8A 3S7HB 5JBAS 1ELEE 1OKXA 2GZ7A 1K1IA 4ZHLU 3RXLA 2CHAB 3A7TA 1Q2WA 1GG6B 1SGFA 3GICB 1AN1E 3T27A 3NCLA 2UUFB 1GHVH 3GY3A 2AGIX 5J4QA 3SNDA 3RU4D 4B6EA 4XE4A 3T25A 1NROH 5BRRE 2ZGXH 2BVSH 1KXFA 3PB1E 2FX4A 2SGDE 1EJAA 2EI6A 3JZ1B 1GI0A 2NU4E 1V2PT 2OQUA 1T8LA 1W3CA 2Q1JA 1TBQH 2H6MA 3OE7D 4NA9H 3BTEE 2V35A 5DP5A 1TBZH 4AYYB 3KQ5A 2XBXA 1ETTH 3A88A 5DSFA 4I31A 3F68H 5IDKA 2FP7B 2PR3A 1KIGH 2P93A 1YPKH 3ZZDA 4LK4A 5L30H 3P8GA 4LZ1H 1V2MT 3RDZA 1CGJE 1HJ9A 4Q80A 1SGNE 4RSPA 2XCFA 3KQDA 2Y81A 1ZHMA 1SOZA 4A92A 4MPXA 2RG3A 4FUJA 1TNHA 3M5NA 1O2WA 4CRGA 1ELGA 1UHBB 1BDAA 1G2MA 3HGPA 5JBCS 2WPHS 3QGNB 1AU8A 1C2KA 2C8ZB 1SGEE 2VIVA 4BAMB 3P8OA 3DD2H 4O97A 2AGGX 4NA8A 3D49H 2UWPA 4A1TA 5T6FA 2YMSC 3AAVA 3MTYA 4HGCA 1ORFA 1B7XB 2FESH 4CBOA 1DT2A 3TH4H 1COWD 3RXPA 2THFB 2VH6A 1QR3E 3CS0A 3VB3A 1E79D 5A0BA 3IG6B 2PTCE 1LHCH 5PTPA 4X0WU 4X2VA 3A86A 2BVRH 2Z3CA 1AFEH 1YCPM 3UR9A 2Z3EA 2BY7X 4F4OC 2WINI 5KGOA 2J92A 1TGNA 5F8XA 5E0GA 3UIRA 4FUBA 2GD4B 3RM2H 1NZQH 3P8FA 2BOHB 2WPDD 4NIWA 7GCHF 4OM9A 2QF3A 2ZFPH 3E16B 3KYFA 3UNQA 3PV4A 3A89A 3GCOA 4NZQA 5FHTA 1T8OA 1PQ5A 2BLOA 2RDEA 1ESTA 1GMDG 2GCTC 1C5RA 3S69A 3T26A 1P09A 3N7DA 3K9XB 1RS0A 1J17T 2ALPA 1OPHB 3TJNA 2YMSD 3I78A 2FIRH 2C8YB 2OXSA 3VXFH 1XMNB 1AVXA 2F91A 2Y6TA 4ACAA 1EAXA 3KGPA 2O8UA 2UUJB 2PW8H 5JBTA 1MU8B 4THNH 3RXDA 1ZHPA 2WSSD 3QK1A 2ODQA 1VZQH 1YKTA 4CH2B 1HAOH 1H4WA 1UJ1A 1OWIA 1KMHB 5F8TA 1MAXA 1DXWA 1F0RA 2A1DB 3U98H 3QGJA 1A3EH 1OHHD 3BEUA 1P8VC 5EXNA 3H7TA 1O2KA 1ARBA 1RRKA 3PMHB 3P6ZB 4FVDA 1SQTA 1MUEB 2GV7A 2V3MA 1UTQA 4WXVA 3ATWA 1WBGB 5C0TA 1RIWB 2ZFSA 3U8TH 1C2DA 1D3TB 4U01A 3TK5A 2G51A 7GCHG 3TNTA 1JRSA 2ZFRH 1PPFE 2RA3A 3MMGA 1SGTA 4AYVB 1RD3B 3LGIA 4VGCB 2LNCA 1HJAC 1TOMH 1BHXB 1O3LA 2PGQB 5EGMA 3SUGA 2XBYA 1G3EA 1N6XA 4I8KA 2GMTC 1UMAH 5FPYA 2ZHDA 1F0UA 2ZU3A 2KFWA 1PPBH 4NIYA 4KTSA 1O3IA 4NWLA 2ANMH 1SLXB 3E6PH 5JB9S 1TYNA 1V3XA 3DCLA 4ZKOU 1IQHA 3MWIU 4SGAE 1S83A 1KXDA 1BTYA 3LGVA 3MU4A 4DCDA 5A8YA 4MDSA 4OS1A 1PQ7A 2WYGA 3RU4T 4WH6A 1TA2A 3LIWA 4Y6DA 3KNXA 1BRBE 3RXFA 1YPHC 4DIIH 2L6OA 2OQ5A 4X8VH 2G5NA 1NRSH 2FEQH 5E0JA 1UTKA 4K2YA 3LU9B 1AY6H 2B0FA 3FP7E 4RT0A 4DOQA 4UONA 2J97A 1DANH 3CENA 3QN7A 3S9CA 1WUNH 2A7JA 1EZUC 3LJOA 3BSQA 3SI3H 1IQFA 1AB9C 2YNAA 1JMOH 3PWCA 4OS7A 3TH2H 1WAYB 5C2ZA 4X1PU 3DFJA 2EI7A 3FAOA 4XRNA 4Y8ZA 3AW1A 4YT7H 3D23A 2BZ6H 4IC5A 5F6MA 1C1PA 2XYAA 4RI0A 3C1KA 1Y3UA 2OC0A 5HXFA 2AERH 1UW7A 4OS6A 1CQQA 2RDLA 5T3HA 5GCHG 3BTDE 1AQ7A 3SHCH 5T1VA 1V2QT 3E0NB 3GS9A 4PROA 3P92A 4CRAA 2A32A 2BX3A 3UREA 1ELTA 4AG2A 4XDEA 1SFIA 5LH8A 3A83A 2A4QA 1QBOA 2ESTE 4BXSA 2QY0B 3EGKH 7LPRA 2FOEA 1SSXA 1ELAA 2AMDA 2SGFE 3UPEA 1GHWH 4JZFH 3TVJB 2HLDD 4XOJA 5EODA 2ZDLA 1V2JT 1GI5A 1W0JD 2XWAA 1BRAA 3RXRA 1RXPA 1TWXB 4NSVA 2BX4A 1C4V2 1V2TT 2PGBB 1Y5UT 4FXGH 3UUZA 1GBMA 2Y80A 2PV9B 2QIQA 1W0ZU 2FYQA 1AWHB 1T4UH 1C2FA 1ANCA 1Z7KA 2QXIA 5CHAB 1GHXH 1P9SA 2VWMA 2A5IA 4Y71A 2XOKD 1Z8IB 3T62A 1CVWH 1DS2E 2FLBH 3QX5H 2PLXA 2ZIQH 1KSNA 4GUXA 4GVUA 4X8SH 4CH8B 1Q31A 4XBCA 1GVKB 1EXFA 3LGTA 1G32B 1B5GH 4XSKU 3F2GA 3ZZ8A 1LDTT 1HAYB 1GHAF 1Y3VA 1MTWA 1HAZB 3VB4A 1T7CA 1CE5A 1TRMA 1E1QD 1TE0A 3M3TA 1W13U 4MNWA 3KN2A 1TNIA 4X1SU 1P57B 2H9EH 1FY3A 1P2KA 2OK5A 1WSSH 3OTPA 3GY2A 1BT7A 5LPFA 1CGHA 1G3BA 2CHAC 1NTPA 4I86A 1SGRE 2FWWA 2FDAA 1ZPZA 2XCNA 3SBKA 3PO1C 5G4BA 9ESTA 2BY9X 4Y8XA 3PWBA 1EP6A 1P2MA 4Y7AA 1A1RA 2ZWLH 2CK3D 4LOYH 1C1NA 2ZGHA 3UR6A 3BTFE 1YYY1 3STJA 2K1QA 4DT4A 3EA9A 2AMQA 3MHWU 4M7GA 1RTLA 2ZZUH 1T32A 2BQ6B 4WVPE 1EJNA 1D3DB 1O33A 2FOGA 1A5IA 2GJGA 1QA7A 1G3DA 1EFRD 2AEIH 1ABJH 1AO5A 2Z9IA 1L2EA 1F0SA 2P3TB 2B7DH 2DE9A 2D8WA 2PWXA 3DSOA 3ZVGA 1P06A 3F9HA 4NSYA 1QRZA 1H9HE 1P2QA 8GCHF 1LKBA 1P9UA 3SU5A 1GJAB 5DP9A 4B71A 2ZTZA 4Z0KA 1Y3YA 1JRTA 2M2AA 1N8OB 3KEEA 3S0NA 2F9OA 2ZPQA 1GI3A 3GY4A 3HK6B 1NM6A 1L1JA 3SJOA 2BQWB 5E0HA 4JZ1A 1GL1A 1GDUA 3BEIB 4GAWA 1S5SA 3RXOA 1LHGH 1ZPBA 3TGIE 2Z9LA 4K8BA 5FCKA 1T8MA 1SLVB 1XXFA 1YPEH 1FI8A 1JIRA 1HAXB 1OP8A 1QURH 4MG3A 3SU3A 3FFGA 3UNRA 1AE5A 2G00A 1K28D 2XC5A 4GLYA 1XKAC 3M7UA 5HIZA 1DWEH 1GWAA 1O2GH 3KYGA 3W1EA 4AB9A 3M7QA 1HV7A 4NIXA 3SNEA 1MTUA 1N6YA 4WMEA 1TGTA 1QA0A 2JH0D 2GT8A 2ZHEH 4IS5A 4HI3A 4NWKA 3H7OA 5HIYA 5F03A 3AAUA 3M36A 1GMHG 5I46H 3A8CA 2Z9JA 2FOHA 2J2UA 1P12E 4ISHH 1BCUH 1EOJA 3BTTE 2VB0A 1K1NA 1TALA 2VNTA 1ZJKA 5EPNA 2A45B 5GJ4B 3FVFB 1RTKA 3RXSA 2ALVA 4H4FA 3GY5A 3A7XA 2FZZA 4JYTA 1OWHA 3SJKA 2SGPE 1GJCB 4IN1A 2ZP0H 2G81E 1SFQB 2F9VA 4ABJA 1EB2A 2KCOA 2KZ4A 4ZH8A 3P17H 4UFFH 2PFEA 4LXBH 1SKYE 2FS9A 3U1JB 1C2EA 2BM2A 1LVBA 3F9GA 1O3GA 1P3EA 3Q76A 1AB9B 3LJJA 1GMDF 1MMJN 2B9LA 4NFFA 1VJ9U 4Q7XA 1ETRH 1GBJA 1DUAA 4X6OA 4CRFA 1LCYA 2A4OA 4ISLA 2A2XH 4FVBA 1BTUA 2EI8A 1YF4A 2VU8E 4U32A 3SN8A 3M5OA 1DVAH 1S6HA 1C2MA 1A61H 2WYJA 4X1NU 1TGSZ 5CHBA 4AFZA 3K2UA 3UNSA 3OEED 2A5AA 2J95A 3VXEH 1SGDE 5HKKD 1PQAA 1S0QA 2Y82A 1QHRB 1BUIA 2V0BA 4AC9A 2D2DA 4AN7A 4MNXA 2AYWA 2R9PA 1RTFB 2J38A 1TAWA 5A0AE 1Z1JA 2FLRH 5CE1A 2IN2A 4GCHG 2VWNA 1H8ED 3KF2A 4X1RU 1HB0B 2ZHFH 2BD7A 3DFLA 2R2MB 1W12U 3I29A
chains in the Genus database with same CATH topology
1DY9A 1ESAA 2ANKH 1H8IH 2WUBA 1MTVA 4KTCA 1J9CH 5ESBA 1TA6A 3SV7A 4DJZB 4Y7BA 4K1EA 1NRNH 2H5CA 4YLUA 1W10U 1CHGA 3ZYEA 1TX7A 1CA8B 2OC7A 4OS4A 1NPMA 1XUGA 2UWOA 1NRQH 1IHSH 3S9BA 5DO4H 2J34A 4ZKNU 3O8BA 5HYOA 1L1NA 2GP9B 1LMWB 1MKXH 2SNWA 3ZZ4A 4ZUHA 1E37B 1UVSH 5FCRA 3TU7H 3GCHC 4GHQA 4RKJB 1QB6A 1S6FA 1MZDA 1EPTC 1EZXC 5AF9H 1AD8H 1UCYH 1T31A 2BD4A 5SGAE 4Q7YA 1A4WH 4MLFB 1MTNC 4ABDA 1IAUA 1UO6A 1UTPA 4XBDA 3DA9B 3PLPA 4UD9H 1EJMA 1QY6A 2FMJA 1DY8A 3NXPA 4IC6A 1SHHB 3N7OA 5IYTA 4AZ2B 1MD7A 4JCNA 2FTMA 1K22H 3SO3A 4ABHA 5EOKA 4FUIA 3GY7A 3FP8E 3GYLB 2ILNA 5AFYH 1DWCH 2GT7A 1C2HA 1FV9A 1FMGA 1UVOA 2SGAA 2STAE 2ZCHP 3E90B 3KHVA 2Z3DA 2BDHA 5DP8A 4RKOB 4E05H 1GDNA 1TNJA 1W7GH 1L4ZA 2H9TH 8KME2 4E06H 3M5MA 3RMLH 5TCCA 1O2RA 4RN6A 3SV2H 4IMQA 1AMHA 1OP0A 2ODPA 1ELDE 1C1WH 1QNJA 2WPKS 1KTSB 4UE7H 4B73A 5FBEA 1O2IA 4NA7A 4TY6A 4I7YH 3EQ0H 1O35A 1EOLA 2VGCC 1P05A 4OGXA 2J4IA 5C1XA 1XUKA 1F7ZA 4MPVA 6ESTA 1XKBC 3NWUA 3U9AH 1TX8A 1LVMA 1Z8RA 3BG4C 1C5MD 3KQBA 1QJ7B 2Z9GA 4I8GA 2HWLB 1D3QB 2G55A 1LPZB 3M61U 1VITG 3MO6A 3RXIA 3KQCA 3RXEA 3Q3YA 1K9OE 1C5OH 1CSOE 1AWFH 3A87A 4AGKA 4K5ZA 4NZLA 2BLQA 3SU1A 5A8XA 3RC5A 1Y8TA 1O5EH 2A7HA 2JETB 4O3UA 3ZYDA 1O5CB 1GMHF 3BIVH 2FOAA 1F2SE 2NU1E 3URCA 1GVZA 1K21H 4FUCA 2H5DA 1O2LA 2VJ1A 2VIDA 1VGCB 1PYTD 3F9EA 2OC8A 3BTWE 1G9IE 1O5AB 1UTMA 1BMNH 1RGQA 3TGJE 2NU3E 2VINA 1GBEA 3ZVEA 3NKKA 4JMYA 1VITH 1T8NA 4MNVA 4ZHAA 1KTTB 1YPLH 2VIOA 4HTCH 3ODFA 4JZIA 1GJ7B 1KXCA 3EDXB 1QJ6B 1FPCH 3PMJA 4R8TB 3VB6A 2BXUH 4A1VA 1YPJH 3ZV8A 1E0FD 1C1RA 2YNBA 2NU2E 1KXBA 2W26A 4KP0A 5AHGH 1O2QA 3RXGA 2O9QA 2BD2A 3TITA 1CBWB 4YOJA 3ATLA 2A0QB 1ZLRA 1C5WB 3MFJA 1A2CH 1O3PB 2FX6A 5EPYA 2BHGA 3FP6E 1V6DA 4J1YA 1HCGA 3U1IB 4AB8A 4BNRA 1BMMH 4FU8A 8GCHG 4WY3A 1P2JA 2ZF0H 4AG1A 5A2MH 5DKMA 1DWDH 4B75A 5DGJA 2BOKA 3MH7A 1ELFA 1P01A 1YCPH 1MBMA 1K1OA 3ZZ9A 2ZCLP 2Z7FE 1A5HA 2GV6A 3HATH 4CREA 2RCEA 1HNEE 5E2OA 1GPZA 5T6GA 4WJG2 3RXVA 4R0IA 1PQ8A 5AFZH 3GISB 2VH0A 2FOMB 4BTUB 1O3OA 1YPHE 1QBNA 2WV4A 3B9FH 1NFUA 1OWEA 4BXWA 1HIAB 2XC4A 2Y5GA 1K2I1 4ZMAH 3SUDA 3MNBA 1A46H 3SW2B 5J4SA 1F5LA 1GVLA 2EEKA 1C2IA 5EW2H 2VWOA 4AX9H 5HM9A 4DGJA 1GBBA 1IQIA 1MD8A 1EPTB 3MO3A 2AFQB 1MCTA 4I8HA 2W7SA 3TH3H 3PROA 2FOFA 1BJVA 3A82A 4U30A 1OYQA 3MOCA 1FY5A 3SORA 2R0KA 1HGTH 3LDXH 3MNCA 1ID5H 1O0DH 4B76A 4WXIA 4YOIA 2A5KA 2XC0A 4K1TA 1TGBA 2O8TA 2KAIB 3U8OH 2PSYA 1XUJA 2WPLS 1YCPK 1GI1A 2CF9H 1TNLA 2GVFA 3QLPH 1AKSB 1BMAA 1JIMA 4WMDA 3JZ2B 1W11U 1C9PA 3SJIA 3QZRA 2F9UA 3DT0H 2XW9A 1BBRK 4AFSA 1ZSJA 1SGFG 1AZ8A 2ZKSA 1Y5BT 4K3JA 4IGDA 1G30B 4NCYA 1UCYE 5LPEA 2F9PA 1LHDH 4JZEH 6GCHG 3GYMA 3TK9A 1C5TA 1YPMH 1NY22 3OY5U 4TWYA 2UWLA 5EXLA 1A0HB 4YLQH 1IOEA 3K65B 5A09A 3GY8A 3KQEA 1OXGA 2Z9KA 4GPGA 3G01A 4U2WA 3V0XA 4Y0ZE 1LO6A 3SZNA 1O2JA 2G5VA 3SV8A 1C1SA 1C5ZB 2UUKB 3MU1A 3ENSB 3TJVA 1CO7E 3QDZB 3ZVFA 1SGCA 4AFQA 2VVCA 3SNBA 2ZCKP 1L4DA 4ABFA 1D9IA 3L3TA 3EAJA 2CGAA 1PPEE 4K69A 3BF6H 1C5LH 1GBKA 1YP9A 2F83A 1HAIH 1ZOMA 1DSUA 1C1OA 3ZVAA 2J94A 4ZKRU 3QUMP 1BMLA 5ABWA 1O5FH 2ZGJA 2BMGB 1GI2A 3RXJA 2CMYA 3M37A 1S0RA 3QTOH 3SU2A 1GJBB 5FX6A 5EQSA 3LC3A 2I6SA 2BDCA 1AVGH 1C5NH 5C20A 2FI4E 1FONA 1GCTC 4ISIH 1Y3WA 2ZGBH 1SGQE 3LOXA 2ZO3H 4MPUA 1FY4A 1GJ9B 3T2NA 1O2ZA 1TONA 4CRDA 5DPAA 1DXPA 2BXTH 1GJ6A 4ESTE 1QQ4A 3GDSA 3Q77A 1W8BH 1F92A 1P03A 2GX4A 3SGQE 1G3CA 2QN5T 2FODA 1HFDA 4DT7B 2ZI2H 3ATKA 1ZMNA 4X6MA 2V3OH 2XTTB 1O2VA 1VR1H 1SG8B 1TLDA 1G36A 1ZJDA 5JDUB 2VWLA 1O3NA 3VFEA 2W7UA 4B2AA 1C1UH 3MNSA 2CF8H 1EP5A 3PMBB 1YLDA 1AE8H 3RXAA 1Z6EA 5I25A 3RXUA 1YGCH 2ZTYA 1TMBH 2ZFFH 3BEFB 2SFAA 1V2UT 1O2MA 1GHAG 4BAOB 1MQ6A 3QO6A 2P3UB 1GJ4H 3T5FH 1IQNA 3AW0A 2R3UA 4FUDA 4OS5A 5DP6A 1HAHH 1W0YH 3UQVA 1CA0B 3RC6A 3GCTF 2OBOA 1DSTA 4IMZA 2ZHQH 4BAQB 4DG4A 2V3HH 2HPQH 3SU6A 4JZDH 2P16A 2EA3A 3RXTA 5A0CA 1N8OC 3VB7A 1K1JA 2VVUA 4SGBE 1GJ8B 1NFYA 5EU8A 6CHAC 1GMCG 4ABBA 3L6PA 4AOQA 3SNAA 3STIA 3HPTB 1CU1A 1AUJA 1WTGH 2CN0H 1RJXB 6LPRA 1TNKA 4YM9A 1TFXA 2WPMS 1DUEA 3ATIA 1FDPA 1BB0B 2AIPA 1SVPA 2HALA 1J16A 1HIAA 2PUQH 3Q3KA 3UWIA 4X1QU 1GDQA 3ZZ3A 1NU9A 1GBCA 5C1UA 2W3IA 1A5GH 1GGDC 1THRH 2XBVA 1O3CA 3UOUA 4K1SA 1DE7H 1GBLA 4YOGA 3OU0A 3ZZ7A 1CBWC 3MH5A 3RXKA 3SUFA 3GDVA 5GIBA 5EG4A 3LGYA 1LPKB 3CP7A 3V12A 1CA0C 1D3PB 3DUXH 3P95A 1KXEA 5H4IB 1BJUA 3SU4A 1HAVB 3A81A 2TGDA 3ZZBA 3LT3A 1ZMLA 1SLWB 1SGPE 3ZV9A 1C5QA 1FNIA 1NC6A 3MI4A 5T6DA 1FN6A 1QB1A 1A3BH 1INCA 1S81A 1NT1A 2ZU4A 1E34B 1JBUH 1ACBE 1OS8A 4D8NA 1HRTH 1TPAE 1GHBG 1QCPA 2BDGA 4DY7B 5FPTA 1OWJA 1UK4A 2HVXA 2VIPA 5K7RA 2GZ8A 4NIVA 1T4VH 4D9RA 2Z94A 2ZHWH 1ZPCA 2Y7XA 1TQ7B 1Z8GA 4D7FA 2PUXB 1NO9H 4CHAC 1V2LT 2GCHG 4E7NA 1TRYA 3PM3A 2ZPSA 2F9NA 1JXPA 3RP2A 4TPYA 3SUEA 2Q6DA 4CR5A 2ZDMA 3EYDA 1ZTLA 2BB4A 3SU0A 1QIXB 2XRCA 1JWTA 1BTHH 1HDTH 3CS7A 1EATA 3R3GB 2P59A 2QYIA 1EB1H 2Y5HA 1GBFA 5CHAC 4X6NA 1S84A 2QC2A 1WU1A 1ZSKA 3LGUA 2F3CE 1BTWA 1UVPA 4CR9A 2ANWA 3ITIA 3B8JA 1ESBA 4KGAA 6CHAB 1YM0A 1DPOA 1EAUA 3E3TA 4GCHF 2TIOA 4BANB 3LONA 1D4PB 3RXMA 2H1UA 1SHYA 3V7TA 1C4Y2 1LVOA 4KELA 5C5OA 1SGYE 1F5KU 1S85A 3V13A 3NUMA 1C2JA 4Y0YE 1V2ST 1EKBB 3GY6A 2AS9A 5A8ZA 1EAWA 3IITA 3URDA 1O38A 2A4GA 1WCZA 2UUYA 3Q3XA 1Y3XA 3FZZA 4X2XA 5FAHA 3TJUA 2BQ7B 1WQSA 2EC9H 4H42U 1K1MA 3RC4A 4UFGH 3S9AA 3SJ8A 1FY1A 1TABE 4OS2A 1LPGB 3MO9A 1V2OT 2GDDA 1UCYK 1J15A 4ZXXH 1FQ3A 5CMXH 2RA0A 1NRPH 1H1BA 1V2NT 2VIWA 5B6OA 4I33A 1GBAA 1YC0A 2HLCA 5FX5A 4INLA 8LPRA 4BTIB 4I8LA 1OYTH 4UFDH 1THSH 1KXAA 3LH1A 1C5XB 1WQVH 1G2LA 1RFNA 2GMTB 1MH0A 2G4TA 5HGGA 7KMEH 1G37A 3EA7A 4FU7A 3R0FA 3BTKE 1P2NA 4BAHB 1FAXA 2WV5A 2ZDKA 1C5VA 2ZFQH 4BTTB 3E0PB 2BTCE 4OGYA 5HMAA 3HKIB 4B2BA 1XUFA 2NU0E 1P0SH 4ZXYH 1EX3A 1O31A 3MNXA 2A7CA 4FUEA 1QL8A 5C5NA 3E8LA 2R2WU 3O8RA 2H9HA 4ABIA 1BZXE 1O2NA 1HAVA 2G4UA 2VVVA 1THPB 1ZTKA 1UTOA 1FPHH 3M3SA 1SLUB 4WWYA 1BTZA 1NU7B 1MQ5A 2DUCA 1AIXH 3H5CB 3O8DA 3ZVCA 4CRCA 2HRVA 2JH6D 2AMPA 3RLYH 2TBSA 2HPPH 1MBQA 1QB9A 1TX6A 3RXQA 1H9LB 1A7SA 2A4RA 4QT8C 5EXMA 4VGCC 5C3NA 1UK2A 3PLBA 1P2OA 2Q6FA 2FOBA 1GCDA 2G52A 1O3AA 5C1YA 5GXPA 1ZZZA 1TMTH 4BAKB 1GHZA 3A8AA 1KLIH 5E2PA 2FPZA 4K60A 1DOJA 4J2YB 2QAAA 3PTBA 1O36A 2IOTA 2FOCA 1IQKA 4WF8A 4JYUH 1MZAA 2CV3A 1E38B 4A6LA 4MQAA 2Z6BD 1HAPH 1ZSLA 2ASUB 1SGIB 2I6QA 4ABGA 3FZDA 3ZVDA 2PKSB 1PPHE 3GCNA 1Y5AT 4Y11E 3TJOA 1SI5H 1S82A 2ZA5A 2XNIA 3SGBE 3W95A 3RXHA 1EAIA 3ZZ5A 1P10A 1UVUH 2M5TA 2QXGA 1ANBA 1IQGA 4ABAA 5L6NH 1P02A 1UK3A 2ZDVH 2KAIA 1O3HA 1PYTC 2ZQ1A 5LPRA 1SQOA 2C4FH 1CHOF 2AGEX 1DX5M 1GJ5H 1OWKA 4MPWA 1A0JA 1P11E 2BDBA 4ZAEA 4Y8YA 4CRBA 1BBRE 2ZG0H 3OX7U 2C8WB 3VPKA 1AVWA 1ELVA 1ZRBA 4BOHA 4CBNA 4D7GA 4X2WA 3C27B 1DLKB 1O3MA 1CHOG 2OP9A 4Q2KA 4AORA 2QXJA 1OX1A 1ANDA 3ELAH 3B23B 2C93B 4YO9A 1C1VH 5K0HA 2OBQA 1C2LA 2VIQA 2QA9E 4AFUA 3HKJB 4INHA 2PHBA 4Y79A 1UVTH 1W14U 1XX9A 1XVOA 2FTLE 1K1LA 4XBBA 5C67A 1EZSC 1BTPA 1OWDA 1D6RA 4MVNA 2Q6GA 1GBDA 4IBLH 1O39A 1GHBF 3KL6A 1LTOA 1NFWA 3A84A 3LH3A 2LPRA 1VITF 2ZU5A 3U69H 5EQRA 2ZC9H 3PYHA 1MKWK 4MTBA 3A7YA 3SGAE 3M35A 1C1MA 1F0TA 1AFQC 1DFPA 2XXLA 1H9IE 3MU8A 2BLWA 2TGTA 2XWBI 2JH5D 1GL0E 3UTUH 1ZRKA 4CHAB 1EUFA 1QJ1B 5JB8S 3UWJH 9LPRA 1UTLM 3UQOA 2PKAA 3VEQB 5JBBS 1HUTH 1SL3A 1O2TA 4X6PA 1SR5C 1IQMA 3BG8A 1FIZA 3VGCC 2C8XB 1Z8JB 3BIUH 5JYIA 1V2VT 5L2ZH 2JKHA 1CT0E 1O5BB 4Q7ZA 2ZDNA 2O8MA 1O30A 2BYAX 3BG4B 4GSOA 1P2IA 1BHXF 4YESB 1ELBA 1SB1H 1TMUH 1O2XA 3OTJE 2V6NA 1TRNA 3RXBA 1O3JA 1VCWA 2STBE 1DICA 3E91A 3LPRA 1FIWA 4ZROA 4JYVH 2BD5A 2BD9A 3A7WA 2IJOB 1Z6JH 3SQEE 3ZVBA 2H2ZA 3A80A 1QBVH 1TB6H 3V3MA 1ABIH 1O2HA 4I8JA 5DP3A 1ZHRA 1SQAA 1C2GA 1Q3XA 2GCHF 4K8YA 1GG6C 1N1LA 3RMNH 3VGCB 1KLJH 5ESTE 1WOFA 1SC8U 2ZPRA 1QRWA 1CT4E 1LQEA 3MYWA 3AVZA 3NPSA 2QCYA 3PO1B 4DW2U 3E1XB 1ETSH 1GBHA 3A7VA 4KTUA 2B8OH 1VGCC 3EE0B 2SGQE 2FM2A 1JOUB 1CGIE 4UDWH 4B2CA 1B0FA 2YOLA 2DE8A 2PTNA 3PMAB 3ZZ6A 1QTFA 4LZ4B 1XUIA 1Z1IA 4A7IB 1O5GH 3ATMA 1HPGA 3SV6A 1AGJA 2R0LA 1HLTH 5ETXA 1MCVA