4GSOA

Structure of jararacussin-i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thrombin-like enzyme BjussuSP-1
publication title Crystal structure of Jararacussin-I: The highly negatively charged catalytic interface contributes to macromolecular selectivity in snake venom thrombin-like enzymes.
pubmed doi rcsb
total genus 45
structure length 232
sequence length 232
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA02
2XCNA 1O39A 2THFB 1SPJA 2CXVA 1EPTC 1Z6EA 4X1NU 3LH3A 1B7XB 1ZMLA 3ZVAA 4GUXA 3RXFA 4AORA 2JH0D 3VB7A 1QQ4A 1KYNA 1L4DA 1MH0A 1G2LA 5FX5A 2OBQA 1EB2A 1DICA 3MI4A 3F9FA 3FZDA 3UR6A 3PM3A 1QY6A 4MNVA 3BTFE 3P17H 1TQ7B 3QGJA 1O2WA 2ZNKH 3AW1A 4X6PA 1N6XA 2M5TA 4XBCA 1BMNH 3RXDA 2Y81A 4AYYB 3PTNA 5ETXA 3V12A 1GBEA 3ENSB 1RRKA 3UFAA 5K7RA 5A0BA 1XUJA 1HJAB 1T32A 1P9SA 2B8OH 3BIVH 1A61H 3Q3KA 1E36B 1C2DA 1HDTH 3ZVDA 4IN2A 1TRNA 2BXUH 4MNWA 5SGAE 1FMGA 1CT4E 2Z3CA 1O5CB 5HXFA 1AUTC 2BXTH 4LZ1H 1CGHA 1THSH 1TOCB 2UUYA 3LT3A 1B0EA 4BAHB 1VITG 4I8HA 3MU4A 1O31A 5CHAB 2C8YB 3SJIA 1DWCH 2IN2A 3PMHB 3PMJA 5CMXH 5F8TA 4JZIA 4K60A 4X6OA 2DE9A 1SGTA 3SGBE 3NWUA 5F8XA 4LK4A 3LONA 1XUFA 3U1JB 1LVMA 2O8MA 2XWBI 3GCHC 4DY7B 2ZCKP 1HAGE 3S9BA 5FX6A 2B0FA 1VCQA 2OCVB 2FS9A 1D6WA 1V3XA 1ZPZA 1YKTA 3ZVCA 1ETRH 1NO9H 4HGCA 4JZDH 3A86A 1BRCE 1TGSZ 1V2RT 2Q6DA 1S0RA 3RXKA 1SFIA 1BTYA 4K5ZA 3TNTA 3WY8A 1GPZA 2ZU1A 4DJZB 3LGTA 1QNJA 1DX5M 1XMNB 2BMGB 1YP9A 2GZ7A 1C1MA 1KTSB 2ZGJA 3SU2A 2Z9JA 4AZ2B 3TITA 1GI0A 2TGDA 1FNIA 1O5BB 5FPYA 2VH0A 2FIRH 1DVAH 4THNH 4Q7YA 2BVRH 3URDA 2Y5GA 2O8UA 4ZUHA 1BTUA 1NU7B 1C5QA 2ALVA 2XCFA 1L1JA 1GBJA 3QZQA 2OLGA 2TGPZ 1LPZB 1AQ7A 4AFSA 3W94A 1ZPCA 2ZU5A 3HPTB 1N8OB 4X2XA 3SN8A 3MNSA 5E0GA 2BDIA 1JOUB 2QV1A 5EOKA 1WTHD 2XBXA 2FO9A 1O3JA 4I8LA 1SOZA 3DT0H 5EG4A 2C8WB 2VGCB 3EAJA 1V2PT 3F1SB 4GHQA 1YLDA 3DFJA 1LCYA 6ESTA 3GDUA 1SI5H 1OKXA 3QUMP 2BB4A 1SL3A 4HTCH 2NU3E 5HGGA 1LKAA 3F68H 1BRAA 4K1SA 2A1DB 1ELGA 1CQQA 1SBWA 3KCGH 3SJ9A 4NA8A 3QLPH 1W8BH 1S5SA 2QXJA 1B5GH 2BD2A 2J94A 1W14U 1Y3XA 3BTQE 2UUFB 3MYWA 3I77A 1GI4A 1HUTH 3MFJA 2ZA5A 1SGFA 1KXDA 1V2TT 3QTOH 3P95A 3TK5A 4Q2KA 1F5KU 1IQEA 4I32A 1GMCG 2B7DH 3QTVH 2B9LA 3U8TH 3ZZ9A 1ELCA 1FY1A 2FOHA 3MNCA 4INKA 2ZG0H 2BD9A 3SI4H 1ESBA 2VGCC 4QT8C 3T28A 1C5WB 1THPB 3TNSA 1ZHMA 2G81E 2Z94A 3U98H 2SGDE 2ZGCA 5C1YA 7ESTE 1A1RA 3SV2H 1CT0E 3QO6A 1V2UT 3U9AH 4YTAA 1AE5A 2PKSB 1D9IA 3GCNA 2GKVE 2GX4A 1CBWB 2H5CA 3MNBA 2HVXA 4MLFB 4B74A 1JRSA 3A81A 7GCHF 2H5DA 1Y8TA 3UWIA 1EAXA 2XW9A 1TGNA 3SNAA 3VB3A 1C5MD 2H2ZA 2R0KA 4GCHF 2NU4E 1K1NA 4X0WU 1V6DA 2FOBA 3URCA 1O3FA 4NWLA 2SGFE 3M3TA 4UONA 1GI5A 2F9BH 4FVBA 3A7VA 1L1GA 4OS2A 4BTIB 1KLTA 2F83A 3KQDA 1LPGB 4FUJA 2A5KA 4AOQA 1H4WA 1G3EA 1GI7B 4IC5A 3UY9A 3LIWA 3GY5A 4X2WA 3ZVEA 1O3IA 9ESTA 2ANMH 3UQVA 4WMEA 2BDHA 1CE5A 2Y82A 1H8DH 5ESBA 1TONA 1P03A 3BEFB 3U8OH 5DP4A 5JBAS 1AD8H 3FFGA 3V0XA 4XOJA 1OP2A 1T4VH 3ZVGA 4Y79A 2OD3B 2FESH 4I8GA 1OWKA 4DURA 2F9VA 2P94A 1WBGB 3DFLA 2QXHA 1AFQB 1O5AB 1G36A 3BTWE 2EI6A 4AG2A 1UTQA 4GLYA 1MKXK 3M3VA 4NA9H 1PJPA 1TNIA 3RXQA 1BRUP 3STIA 2FOAA 1Y3VA 1P12E 4DGJA 5HYOA 4K8BA 5T6DA 1GJDB 4RN6A 1O2YA 4MVNA 2W26A 1MZAA 5E8EH 1CGJE 1HAVA 1KLIH 2BD8A 2C3SA 1IQKA 1Z6JH 1GHZA 3AAUA 5EW1H 4B76A 1E37B 4Z0KA 1HRTH 1M9UA 2P59A 4UFFH 1S85A 1TA2A 1H9LB 1HXEH 3HKIB 4I31A 3T2NA 2XBVA 3LDXH 2BQWB 4FUGA 3T29A 4X2VA 1C1PA 4OGYA 8GCHF 1XXFA 1HNEE 1UTKA 2XXLA 1W0YH 1ORFA 5AFYH 1MTWA 1BA8B 2AMPA 4DVAU 1Y3YA 2FOCA 1SB1H 5JB8S 4IW4E 1N6YA 2WUBA 3ZZ7A 2ZFTA 5DKMA 1EXFA 2G8TA 1GJ9B 2SGAA 4X6NA 2BDAA 1MQ5A 4ABFA 5LH8A 3OYPA 2ZQ2A 1G9IE 1PPCE 5C20A 1HAPH 5EXNA 1V2MT 1GBHA 2G00A 4B1TA 1KTTB 1DXPA 3QGNB 2ZHWH 3ZZCA 1OSSA 1O2GH 2W5EA 1HAVB 1ZJDA 5PTPA 1W2KH 4NIVA 1BB0B 1TQ0B 4AYVB 5T3HA 1MMJN 4K1TA 3TVJB 3RXBA 4CBOA 2ZFFH 1V2JT 4TY6A 4ZXXH 4Y7BA 2RDLA 3RC6A 2CMYA 1PYTD 1SMFE 1O2PA 1GBKA 1XUHA 1TBRH 1LVBA 2BVXH 1P2IA 4AGKA 5FBEA 3TGJE 4Y6DA 3T25A 1NU9A 1MQ6A 3M36A 1KXAA 1DLEA 2V3HH 3F6UH 5TCAA 3SU1A 5JYIA 2ZDKA 1V2NT 3BTHE 3RXAA 1C9PA 2WPMS 1G32B 2BLQA 4ZHLU 1YF4A 1F0RA 1FIZA 1PPFE 5I46H 1XXDA 2ULLA 4LOYH 1GI2A 1QFKH 3D49H 4WH6A 3MH4A 5IDKA 2FTMA 1G2MA 2ZGHA 5FHTA 1AY6H 3B9FH 1CT2E 2SFAA 1HGTH 4H6TA 5DP9A 3SJKA 2UWPA 2D2DA 1ZTKA 1ZSJA 8ESTE 1OWJA 1MAYA 4XDEA 4D8NA 2SGPE 1E0FD 4YZUA 1NY22 2PSXA 2BVSH 2VIPA 1C1TA 1YM0A 1O3KA 3UNRA 2FX6A 4XSKU 4YT7H 1LO6A 2XRCA 1HXFH 2BQ7B 4FUFA 1UCYH 1T8LA 1GGDB 1S84A 2FOMB 3BG8A 1OP8A 1FY8E 3SUFA 1IQNA 3JZ2B 1AWFH 1QTFA 2SNVA 1ETTH 1UHBA 1SQAA 2TGTA 1WV7H 1ARCA 5F8ZA 1MTVA 1GBAA 1O3LA 1A5IA 2FWWA 3FP6E 1T7CA 5C5NA 1O3BA 3PWCA 2Z9IA 3ZZ6A 5AFZH 1N1LA 2STAE 1QL9A 3D62A 4BAKB 1ESAA 3GCTF 1BOQA 1P02A 2GP9B 2AIPA 3VFEA 3TJNA 1L0ZA 5GWZA 1MTSA 1O3HA 1XUKA 2VWLA 1GHAG 2O8LA 4Y11E 4I8KA 5AF9H 3A87A 1PQ5A 2FP7B 1LQEA 3LGWA 3ZYDA 3BTEE 3DD2H 2VWMA 1CA8B 6GCHG 1SGFG 4CHAB 1V2LT 1O3PB 1O2HA 2A5IA 4K69A 4WJG2 2VIWA 1UK3A 3LOXA 2PV9B 1GGDC 1WAYB 1HAHH 3Q3XA 2FXRA 1CA0C 2BY8X 1ZR0A 1CO7E 1ZLRA 4IMQA 1LKBA 4FXGH 2VJ1A 4MPUA 4KP0A 3M3SA 1UJ1A 2Y5HA 2ZC9H 1GMHG 3GISB 2OXSA 1C5NH 3BV9B 4Y8YA 1GJ4H 3BTKE 2IJOB 4H4FA 2BLWA 2AMDA 3ODFA 3TH3H 5FPTA 1BBRK 1UHBB 3KF2A 1V2WT 3PB1E 1TNKA 4FU7A 2PSYA 5IYTA 1DSUA 2BX4A 1YPHE 1MD7A 1NS3A 2Y80A 3SJOA 2HLCA 5DO4H 1EATA 2C90B 3GCOA 3EYDA 1O35A 3OY6U 3B23B 1EJAA 1EX3A 2OINA 4CH8B 4FUDA 2FYRA 1YPHC 1UVPA 4NSYA 1BTXA 5CE1A 1J17T 2XNIA 3GY2A 3TJVA 1A5HA 1AN1E 1AO5A 1AFEH 5F6MA 3E8LA 1TGTA 2ODQA 2YNBA 4Z6AH 2BY7X 2A31A 3DHKH 1AWHB 3P8GA 1YGCH 4FUEA 2B5TB 2ODPA 4IC6A 1G3DA 5FPSA 1UTNA 2NU0E 1TNJA 1Z8RA 4JYVH 4BAOB 1W13U 5T6FA 4MG3A 5L2ZH 1GVZA 4UEHH 4H6SB 2PLXA 3S9AA 4A92A 4FU9A 4IBLH 1QGFA 2WV5A 1EAIA 1BMLA 1C1OA 4XFQA 3FANA 1TX7A 2W3IA 3E3TA 1FPCH 4ZXYH 2VU8E 1Y5UT 3A8CA 1C5RA 1KXEA 2JH5D 5BRRE 1PPEE 3RXVA 4DIHH 4AX9H 1AB9B 1ZRKA 3LGYA 5DP7A 1BTHH 4FU8A 1HAXB 1C5YB 5ABWA 3RLWH 3SNEA 2VVUA 1UCYE 1QRZA 3Q76A 3VPKA 2XWAA 3CS7A 5A8ZA 2FTLE 2GCTB 3R0FA 5GJ4B 3RXEA 3EA7A 3UOUA 4E7NA 4R0IA 3GICB 1GJ6A 1ZMJA 3ATLA 3GY8A 4WVPE 3A8BA 1EKBB 2GD4B 1A0HB 1S6FA 3EA9A 2VWNA 1C5XB 2OQUA 5C67A 2CF9H 4JZ1A 1Y5BT 1TBQH 5GCHG 4CRGA 1FV9A 1H9IE 1GHXH 1IQFA 1ZHRA 1AIXH 2QGRA 4GHTA 2P8OB 3GY7A 2SGQE 1MKWK 1NM6A 2FLRH 1BMMH 1BRBE 2QIQA 2UUJB 3KIDU 4NIWA 1QL7A 1EOJA 1QB1A 3SI3H 2AERH 3OU0A 2BHGA 1D3QB 1FIWA 2G55A 1O32A 4BOHA 1YCPK 1TBZH 1GI8B 1W3CA 3MU1A 1TGBA 1BQYA 1HJAC 3CP7A 1TGCA 1VITF 3RU4T 1ANCA 2GCTC 5JB9S 3PROA 2RA3A 1LHEH 5A0AE 2QN5T 1AU8A 1XVOA 3M7TA 4Q7ZA 1P2QA 1Q2WA 1P9UA 1SLUB 1NRPH 3M61U 1O2KA 1V2ST 5CHAC 2JETB 1O2ZA 4WF8A 3RXUA 1C2FA 3UWJH 1A3BH 3D23A 2BTCE 4A7IB 1EP5A 3A7ZA 4NIXA 2D8WA 4BANB 4ABJA 3FVFB 3H7OA 1UVTH 5F03A 1O3GA 4I8JA 4Y7AA 1GCDA 3MU5A 1C2JA 3PLBA 1GI9B 1A0LA 1JBUH 1Z8JB 1P2MA 4MPWA 3E1XB 1UK2A 4KELA 4IS5A 1D4PB 1C5TA 3M5OA 1T8NA 2BM2A 3KL6A 4O3UA 1RD3B 5EODA 1EP6A 4FUIA 2A4QA 1AZ8A 1DWDH 4CR5A 1G30B 4ZKNU 3RMMH 1VZQH 1Y5AT 2BOKA 1DE7H 1TPOA 4ZAEA 1QQUA 1GJBB 3K6YA 4UFDH 2GCHF 2BY9X 1ZTLA 4BAMB 4O3TA 2FOGA 1VCPA 4Y10E 1P06A 2DUCA 5K0HA 1F7ZA 1MBQA 3SU4A 1CHOG 3MU0A 1C1RA 4FVDA 3OTJE 2FODA 1TABE 4BNRA 1DANH 1QRWA 2VWOA 1TPPA 3TH4H 1RIWB 1AI8H 1N8OC 4LZ4B 2J38A 3JZ1B 4ZMAH 9LPRA 5L2YH 2OQ5A 1QCPA 3ITIA 3HKJB 5EGMA 3TU7H 2ZTYA 1BDAA 1LHDH 1GDNA 4MDSA 4NA7A 3TIUA 1ELFA 5DP5A 4X8VH 2GMTB 3GYMA 1SLVB 3IG6B 3UNSA 1ANEA 1J9CH 1K21H 2ZFRH 2QA9E 1YBWA 1UTMA 3EA8A 4E05H 1GBTA 1P2OA 1MZDA 4B2AA 1LHCH 2FEQH 1QA7A 1ZZZA 1H8IH 3L3TA 7GCHG 2W3KA 1GMCF 4K1EA 1KY9A 1GHVH 1O30A 1RXPA 1GCTB 2Z3DA 2LNCA 2AGEX 2O9QA 3E6PH 3HGPA 2XC0A 2ZKSA 1SVPA 1QR3E 5B6OA 4GVUA 3A7XA 2AH4X 4KKDA 4LXBH 1O2RA 2GZ9A 4ABEA 1Y3UA 1QURH 3PO1B 1TNHA 2A32A 4YESB 3MO3A 1D3DB 1HYLA 2C93B 1FY3A 1DS2E 1C1VH 1MTNB 1IQIA 1JWTA 2R3YA 1FAXA 2XYAA 4JMYA 3AASA 1O36A 2QYIA 4ABGA 1DDJA 1O3EA 3UUZA 1PQ7A 5JPMH 4YOGA 2CF8H 1SGNE 4CR9A 1DLKB 2PKSC 2BQ6B 2WPHS 1TRYA 2XTTB 1VGCB 2R3UA 1TMTH 2C8XB 2H9HA 1OPHB 1PPZA 1CBWC 3LKWA 1BCUH 2ZU4A 1TB6H 3T62A 1ELVA 1A4WH 2HNTE 3L33A 1XKBC 3A82A 5GDSH 2BDGA 3LC5A 1FXYA 5AHGH 1QHRB 3EE0B 4U32A 2ESTE 3M7UA 3VEQB 1KSNA 3BEIB 2HNTC 3RU4D 1OWDA 1ABJH 1RTFB 1TMBH 1A2CH 1LMWB 4OS5A 1C9TA 2ANYA 2H6MA 5LGOA 1ZSKA 2ZQ1A 2Z3EA 1AKSB 5DJ7A 2ZF0H 2BLVA 1MTNC 3SV8A 1G37A 2ZGXH 1TX6A 2OC8A 5EPYA 1GHWH 3VGCB 3SV6A 2PR3A 1IOEA 1NRRH 5A8YA 1P09A 2Q6FA 3DA9B 2J34A 3BIUH 1SGPE 2G4UA 4U2WA 1K1OA 8GCHG 1A7SA 3SBKA 1BTZA 3EQ0H 4O97A 2AGIX 3R3GB 4ISLA 1GG6B 1QJ6B 2ODYB 3SNBA 4A6LA 1PQ8A 4ZH8A 1Z1IA 1V2QT 3KEEA 1HPGA 5DG6A 2ZTXA 5JBBS 1W7GH 1P2JA 3SO3A 1ABIH 2WPKS 5ESTE 1YC0A 1AFQC 1F2SE 1AVWA 1QB9A 4SGAE 1ANDA 2W7UA 5EPNA 4DCDA 1EZQA 2J9NA 3SORA 3PMAB 1GJ7B 4MNYA 1BTPA 1PFXC 5JBTA 2FM2A 1RS0A 3QX5H 1O2MA 2EI7A 4ZHAA 5GXPA 1EAWA 1CVWH 4RKJB 4TPYA 3SGAE 1T8MA 2TIOA 3U8RH 1O2IA 4OS6A 1GMDG 2JH6D 1FY5A 2SNWA 3SUEA 3UIRA 3RLYH 1K1PA 3Q3YA 5FXLA 3RXLA 2QXGA 1GHYH 5C5OA 5A09A 4YT6H 1LPKB 4A1VA 4VGCB 3PLKA 4X8TH 1DUEA 2R2WU 2ZP0H 1DM4B 1RJXB 1S83A 1O2XA 5HMAA 4Q7XA 1P8VC 2ZFSA 3A7YA 1C5OH 1NT1A 1ZOMA 3BEUA 4NZQA 1ANBA 1GBFA 2HALA 1J15A 4KTCA 1RTLA 4MNXA 2VIVA 3N7OA 1OYQA 2ZHDA 1GHBG 4DOQA 1QL8A 1HCGA 1W10U 2TGAA 5DP3A 1P2NA 4J2YB 5HM9A 3S7KB 1ESTA 2FPZA 2GZ8A 2PTNA 3TLOA 3RU4E 1O3OA 1NFXA 3M35A 2IPHA 2VH6A 1UO6A 1SOTA 1EUFA 3UR9A 1DITH 2Q6GA 1O33A 2F9NA 1SGIB 1UTLM 1YPJH 1W12U 2GV7A 1G3CA 1QBVH 1NRNH 1DY9A 2WPLS 1GBMA 4ZKRU 1ZRBA 2VIOA 2FOEA 1BHXF 4YOIA 3ATWA 2BD5A 1GI3A 5GPIB 1J14A 4X8SH 1C2HA 2ZFPH 1MU8B 3MOCA 1GJ8B 1GBDA 3BSQA 4AFUA 1FPHH 4OGXA 3KNXA 8KME2 1IQJA 1T4UH 4MPVA 2ZZUH 3GY4A 1EZSC 1GBBA 2ZDVH 1QBOA 3UOPA 1WQSA 6CHAB 1C2IA 2ZPRA 3NPSA 4OS4A 3P6ZB 4TYDA 2R9PA 5H4IB 4B71A 3MU8A 2WV4A 2G5NA 1C5ZB 1DSTA 3MH5A 1MKXH 1UVSH 1OS8A 2ZDNA 3ZZ3A 4D9QA 2P3TB 3FAOA 4UE7H 1F0SA 3ZV9A 2CV3A 1IQGA 2Z9LA 3K9XB 1C1UH 3C27B 2WUCA 3PWBA 1DXWA 3M7QA 4NFFA 3T26A 2AEIH 2CGAA 3O8DA 1LHGH 2XBYA 2PHBA 2J4IA 4A1XA 4UD9H 1G3BA 2BY6X 1ZJKA 2VIDA 1L2EA 2HGTH 2RCEA 2ZHQH 3A8DA 4K8YA 5FBIA 2ZEBA 4JYTA 1TMUH 6CHAC 2ZECA 3LJJA 1OWIA 2XBWA 1SGCA 4RSPA 2ZDMA 3A89A 3TK9A 3UPEA 1NESE 4NGAH 1UTPA 4Y0YE 2BZAA 5JDUB 3BF6H 1SGEE 3BTDE 1PYTC 1C4V2 1P05A 1YYY1 3E16B 1LVOA 2BOHB 5EU8A 1D3TB 4KGAA 5A8XA 1KXCA 5DP6A 1D3PB 4NCYA 3SJ8A 3KQEA 1SR5C 2JKHA 1DT2A 4JZEH 3LH1A 3S9CA 1GHAF 2OTVA 5C1XA 2OBOA 4WWYA 2J92A 2PGBB 2CJIA 2FI5E 1XM1A 4TPIZ 4JYUH 3LGUA 1HLTH 1FJSA 3M5MA 1UTOA 3P8NA 4I33A 1TAWA 4CBNA 4BAQB 3W95A 6GCHF 3LU9B 5EXMA 4FUCA 1O2VA 3B8JA 2GVFA 3RXCA 1SC8U 1PPGE 1KLJH 1LHFH 2HOBA 3BG4B 1GMHF 3ZZ5A 1BIOA 4CHAC 1TA6A 1EB1H 3A80A 2A4GA 1GL0E 1ZTJA 2ZCLP 1Z8IB 4BXSA 1V2OT 1SGDE 1HJ9A 2F91A 1P10A 1WTGH 1O3NA 2Z9KA 4R8TB 3RXTA 3MWIU 1O34A 3V13A 2OC0A 3GY6A 3E0PB 3KGPA 3KQBA 1OP0A 2ANWA 5EXLA 1Q31A 1S82A 2HPQH 2R0LA 3I29A 2DE8A 2TBSA 1GVLA 4NFEA 2A7HA 3O8CA 2O8WA 1SGQE 2BDYA 2WYGA 3VXFH 1WYKA 4WH8A 2UUKB 4CRAA 3SV9A 1MU6B 2FX4A 3A88A 5L30H 3RM0H 2VVVA 1MAXA 4ISOA 4Q80A 1NFWA 4D7FA 1VR1H 2OC7A 5GIBA 1FONA 1AZZA 3A85A 2AFQB 2PGQB 3ZVBA 2O8TA 4DW2U 1GWAA 1P0SH 2G4TA 1AHTH 3GDSA 3BG4C 4AN7A 1C5LH 1OWHA 2SGEE 2F3CE 1WQVH 2XC4A 1O5FH 3TGIE 5E0HA 3GCHB 1E34B 1NZQH 4ESTE 4AFZA 1DOJA 3FZZA 1VJ9U 3I78A 1UK4A 3TJOA 1CGIE 2P3FH 1JRTA 1LQDB 3E90B 4U01A 1ZHPA 1S6HA 1O3DA 2AIQA 3NUMA 1IHTH 3GDVA 2BLOA 3PYHA 1O37A 2FI4E 1A5GH 4INLA 4CRFA 2D26C 2QF3A 2V6NA 1BJVA 1FY4A 2ASUB 1F5RA 2HRVA 2VIQA 3VB5A 2A2QH 3SQEE 3SGQE 3IWMA 1K22H 3SV7A 1SG8B 1KIGH 3RXRA 2G5VA 1S0QA 3RMNH 1AB9C 4ABAA 1ID5H 1C1QA 3TGKE 4ABIA 4AB8A 2PW8H 1L4ZA 5T6GA 3MNXA 5GCHF 1C1NA 1O2LA 4DIIH 4WY3A 1BJUA 4ABBA 1B0FA 4AFQA 2UWOA 2BD4A 1O2NA 4M7GA 1T8OA 1SFQB 3RM2H 1SHHB 1TRMA 5C1UA 1C5UA 1J8AA 3SOSA 2PKAA 3S0NA 2YOLA 1P01A 4X1SU 1RGQA 3RXSA 4NG9H 1XX9A 3PTBA 4SGBE 2P8OC 1O2UA 3P70B 2W7SA 2WINI 1OOKB 1YPGH 2ZCHP 3C1KA 1SHYA 1H9HE 1DY8A 4WXIA 5C2ZA 4B73A 2YNAA 4X1PU 3RMOH 1OWEA 3RXGA 1GDUA 1QB6A 2J2UA 2LPRA 4IGDA 1AGJA 4JZFH 2G52A 1BBRH 1FQ3A 1QJ7B 1EJNA 1DFPA 1JIRA 1TALA 2IOTA 3Q00A 4D76A 1ZMNA 3H5CB 3VXEH 3E91A 3SU5A 2QF0A 2OUAA 1TE0A 2VINA 2I6SA 2Z6BD 2GCHG 1BHXB 4ABHA 4F49A 3RDZA 4WMFA 2A2XH 3LGVA 1E35B 4IN1A 4X1QU 2JETC 3D65E 2A5AA 1J16A 2PKAB 4CRBA 3MO9A 3GY3A 2GV6A 1FAKH 4XBBA 1P11E 1TPAE 2Q1JA 4NZLA 1S81A 2V0BA 2AGGX 3A8AA 3RMLH 4O03A 4BTUB 2F9UA 2Y7XA 2Y7ZA 3RXPA 4A5TS 3F9GA 1O5DH 5J4SA 1C4Y2 1EJMA 2ALPA 1FI8A 1P57B 1GJCB 2EA3A 2QC2A 1KDQA 3FP8E 1X7AC 3QK1A 4OS1A 1XKAC 3ZVFA 2AMQA 1ELBA 1UMAH 1H1BA 1BTWA 4D9RA 1O2SA 1BITA 2AS9A 4UDWH 1TOMH 1CHOF 2PUXB 1LDTT 1IHSH 2V3OH 1EZUC 3F9EA 1QA0A 3QDZB 1QIXB 2AYWA 4TY7A 4PROA 4CRCA 1C5PA 1HIAA 1OX1A 3NZIA 1O2QA 1Z7KA 1YCPM 2P16A 3KQCA 4B2CA 4FUBA 4HFPB 2WPJS 3SU6A 5E2OA 5G4BA 2NU2E 1C2MA 1C1WH 3STJA 3T5FH 4YLUA 3LPRA 4D7GA 2BD7A 2FOFA 1YPMH 3QWCH 5LPEA 1FZZA 3K2UA 4MQAA 3T27A 1CU1A 4GCHG 2QXIA 3KN2A 2PFEA 4U30A 3V3MA 2A4OA 1MKWH 4TWWA 1AKSA 3AVZA 1AE8H 1RIWC 2GDDA 3AW0A 1P04A 4MPXA 3O8RA 2BX3A 3ZZBA 1SQTA 1EZXC 3SW2B 3U69H 2ANKH 3OSYA 1CHGA 1HB0B 1C2EA 1IQLA 4B2BA 1F0TA 2ZPQA 1YCPH 2P95A 4I7YH 2ZHFH 3NK8A 1KDQB 2XC5A 3SNDA 1MCVA 2GMTC 3TJUA 3RXMA 2F9PA 1SQOA 2BDBA 2EC9H 5EQRA 4X8UH 2GDEH 3MMGA 2HWLB 1NROH 1O38A 1Q3XA 1TNGA 1BUIA 1TIOA 1HIAB 3A83A 1OYTH 1AMHA 4INHA 1GCTC 1VITH 1NFYA 1HFDA 4JK6A 3ZV8A 2FYQA 4NWKA 3UREA 2F9OA 1YPLH 3HGNA 1BBRE 1MCTA 1WUNH 2FZZA 4UFGH 2GT7A 2ZGBH 1FDPA 5BPEA 1W0ZU 3TK6A 1SGYE 1P3EA 1K1MA 3NCLA 3SU3A 3ZYEA 3E0NB 3PO1C 1PPHE 4RKOB 1O2TA 3BTME 3ODDA 3SUDA 3RXHA 5A0CA 1W11U 1EOLA 3AAVA 1T31A 4K3JA 5DPAA 1C2LA 1TYNA 1UCYK 4ISHH 1GI1A 2P3UB 2Y6TA 5FCKA 1ETSH 1V2KT 2KAIA 1HAZB 3GYLB 3O8BA 4XE4A 1ELTA 1XUGA 1QBNA 3QN7A 1GJAB 1VGCC 3M37A 1NTPA 3RXOA 1MBMA 4KTUA 3SHAH 1C2KA 1C2GA 4AGJA 3MH7A 3A7WA 1TFXA 3LC3A 3P8OA 1O2OA 3F9HA 3RXJA 1SSXA 1WCZA 2QCYA 3OY5U 3HK6B 1BMAA 2ZO3H 3ZZ4A 3ZZAA 1IQHA 3KHVA 3PMBB 4GPGA 3M5LA 2ZU3A 4MTBA 2H1UA 1GJ5H 1KXBA 4YOJA 2TPIZ 1XUIA 4ZHMU 1F92A 3SZNA 3SHCH 3MTYA 1K1LA 3LGIA 1K2I1 1THRH 3UQOA 1A0JA 4HI3A 3VGCC 4GSOA 1JIMA 3CENA 4JCNA 1ZGIA 5DK1A 1A46H 1HAIH 1C5VA 1QJ1B 1C4U2 3UTUH 2WPIS 1DWEH 1HJ8A 1IAUA 1JXPA 1W7XH 1EQ9A 4WMDA 3NXPA 4Y71A 2A4RA 1GG6C 1ZGVA 4GAWA 3M5NA 1DPOA 2A45B 2KAIB 5I25A 4HZHA 3ZZDA 1ELAA 5DGJA 4NSVA 1PPBH 3MO6A 1AUJA 3RUOA 3P8FA 5EQSA 1VJAU 3S7HB 3RC4A 1Z71A 1V2VT 6LPRA 2HPPH 1TWXB 2FDAA 2VB0A 3ATKA 1ELDE 2CN0H 4TWYA 1P3CA 2ZHEH 4ISNA 3EGKH 1O3MA 4ISIH 4Y8XA 1GMDF 1FN8A 4IMZA 1O3AA 1Z8GA 2RA0A 4BTTB 5EW2H 4OS7A 1NFUA 4ASHA 1TX8A 4Y76A 8LPRA 4F4OC 2K1QA 2GT8A 2BY5X 2Z7FE 3Q77A 1RFNA 2ZIQH 1SLWB 3LJOA 2NU1E 5HM2A 2ZFQH 1LVYA 4WXVA 1MD8A 2A0QB 4ZKOU 1D6RA 2OC1A 1O0DH 3DUXH 4JK5A 3ZZ8A 1UVUH 2V35A 1MUEB 1O5GH 1YLCA 2FMJA 2BZ6H 2G51A 1GHBF 1RTKA 2ZDAH 4VGCC 1ELEE 2VNTA 5DP8A 4H42U 1HV7A 1F0UA 2QAAA 1ZYOA 1E38B 2Z9GA 1K1IA 4YO9A 3V7TA 4A1TA 4YLQH 3ATIA 5A2MH 1GBLA 1NRSH 1C1SA 2BDCA 3MHWU 3P92A 3ATMA 3SQHE 3G01A 4B75A 2PTCE 1F5LA 4AG1A 3EDXB 3SNCA 1LTOA 4BXWA 2ZPSA 4CH2B 1ZPBA 1O3CA 3A7TA 3IITA 3TH2H 1GI6A 1ARBA 4E7RG 1WSSH 2ZI2H 2FLBH 1P2KA 5L6NH 7LPRA 1EPTA 3OX7U 1NN6A 2CHAB 5JBCS 3GOVB 2ILNA 1AVXA 4DG4A 1TNLA 2H9TH 1GDQA 1GVKB 2PUQH 3GCTG 2GTBA 1IQMA 4FUHA 4DT7B 1TPSA 1FUJA 1O2JA 2VVCA 2QY0B 2FI3E 1JMOH 4O9VA 1CSOE 1SGRE 3K6ZA 2C8ZB 1CA0B 1AVGH 1EASA 3PLPA 1GL1A 4ABDA 1DWBH 4Y0ZE 2Y5FA 1MTUA 3UNQA 3QZRA 2I6QA 1SLXB 5C3NA 1O5EH 3H7TA 1QRXA 4KTSA 1GBIA 1A3EH 3SU0A 2A7CA 2BD3A 2UWLA 2J95A 3HK3B 2H9EH 5TCCA 2WYJA 4X1RU 3RP2A 3RXIA 2BYAX 5LPRA 3SUGA 2PWXA 1ACBE 1C5SA 2FS8A 1NRQH 4J1YA 1L1NA 3PV4A 7KMEH 1Y59T 4K2YA 2A7JA 4E06H 1FN6A 5FCRA 2TRMA 3RC5A 3HATH 1NPMA 4AB9A 4NIYA 3ESTA 3K65B 1K28D 4Y8ZA 2ZDLA 2P93A 1OXGA 3L6PA 2R2MB 4X2YA 2EI8A 5J4QA 2CHAC 4UFEH 1BZXE 1WU1A 4ZKSU 1HAYB 1HAOH 1DUAA 3FP7E 1HBTH 2ZWLH 1PQAA 2RG3A 1TLDA 1EPTB 2HNTF 3S69A 4ZROA 1GBCA 4X6MA 4CREA 1WOFA 1UVOA 2D1JA 1NC6A 5FAHA 2OP9A 3A84A 3U1IB 2ZU2A 2NWNA 3MH6A 1EAUA 5E2PA 1VCWA 3BN9A 1XVMA 2EEKA 3VB4A 3CS0A 5LPFA 1K1JA 5AVDA 3TPIZ 3ELAH 1YPKH 3VB6A 4YM9A 2C4FH 3BTGE 1KXFA 5EQQA 4CRDA 4XBDA 2ZTZA 1INCA 3NKKA 1BT7A 5TJXA 1Y3WA 1K9OE 5E0JA 2STBE 2GGVB 1ZSLA 1UTJA 3BTTE 1FLEE 1YPEH 1U6QA 1Z1JA
chains in the Genus database with same CATH superfamily
2XCNA 1O39A 2THFB 1SPJA 2CXVA 1EPTC 1Z6EA 4X1NU 3LH3A 1B7XB 1ZMLA 3ZVAA 4GUXA 3RXFA 4AORA 2JH0D 2LP6A 3VB7A 1QQ4A 1KYNA 5HIZA 1L4DA 1MH0A 1G2LA 5FX5A 2OBQA 1EB2A 1DICA 3MI4A 3F9FA 3FZDA 3UR6A 3PM3A 1QY6A 4MNVA 3BTFE 3P17H 1TQ7B 3FN8A 3QGJA 1O2WA 2ZNKH 3AW1A 4X6PA 1N6XA 2M5TA 3KYFA 4XBCA 1BMNH 3RXDA 2Y81A 4AYYB 3PTNA 5ETXA 3V12A 1GBEA 3ENSB 1RRKA 3UFAA 5K7RA 5A0BA 1XUJA 1HJAB 1T32A 1P9SA 2B8OH 3BIVH 2KM0A 1A61H 3Q3KA 1E36B 1C2DA 1HDTH 3ZVDA 4IN2A 1TRNA 2BXUH 4MNWA 5SGAE 1FMGA 5DN6D 1CT4E 2Z3CA 1O5CB 5HXFA 1AUTC 1WXRA 2BXTH 4LZ1H 1CGHA 1THSH 1TOCB 2UUYA 3LT3A 1B0EA 4BAHB 1VITG 4I8HA 3MU4A 1O31A 5CHAB 3OFND 2C8YB 3SJIA 1DWCH 2IN2A 3OEHD 3PMHB 3SZEA 3PMJA 5CMXH 5F8TA 4JZIA 4K60A 4X6OA 2KX4A 2DE9A 1SGTA 3SGBE 3NWUA 5F8XA 4LK4A 3LONA 1XUFA 4XD7D 3U1JB 1LVMA 2O8MA 2XWBI 2QE7D 3GCHC 4DY7B 2ZCKP 1YLNA 1HAGE 3S9BA 2KZ4A 5FX6A 2B0FA 1VCQA 2OCVB 2FS9A 1D6WA 1V3XA 1ZPZA 1YKTA 3ZVCA 1ETRH 3GS9A 1NO9H 4HGCA 4JZDH 3A86A 1BRCE 1TGSZ 1V2RT 2Q6DA 1S0RA 3RXKA 1SFIA 1BTYA 4K5ZA 3TNTA 3WY8A 1GPZA 2ZU1A 4DJZB 3LGTA 1QNJA 1DX5M 1XMNB 2BMGB 1YP9A 2GZ7A 1C1MA 1KTSB 2ZGJA 3SU2A 2Z9JA 4AZ2B 3TITA 1GI0A 2TGDA 1FNIA 1O5BB 5FPYA 2VH0A 2FIRH 1DVAH 4THNH 4Q7YA 2RFKC 2BVRH 3URDA 2Y5GA 2O8UA 4ZUHA 1BTUA 1NU7B 1C5QA 2ALVA 2XCFA 1L1JA 1GBJA 3QZQA 2J97A 2OLGA 2TGPZ 1LPZB 1AQ7A 4AFSA 3W94A 1ZPCA 2ZU5A 3HPTB 1N8OB 4X2XA 3SN8A 3MNSA 5E0GA 2BDIA 3PV2A 1JOUB 2QV1A 5EOKA 1WTHD 2XBXA 2FO9A 1O3JA 4I8LA 1SOZA 3DT0H 5EG4A 2C8WB 2VGCB 3EAJA 1V2PT 3F1SB 4GHQA 1YLDA 3DFJA 1LCYA 6ESTA 3GDUA 1SI5H 1OKXA 3QUMP 2BB4A 1SL3A 4HTCH 2NU3E 5HGGA 1LKAA 3F68H 1BRAA 4K1SA 2A1DB 1ELGA 1CQQA 1SBWA 3KCGH 3SJ9A 4NA8A 3QLPH 2HVYB 1W8BH 1S5SA 2QXJA 1B5GH 2BD2A 2J94A 1W14U 1Y3XA 3BTQE 2UUFB 3F3BA 3MYWA 3I77A 1GI4A 1HUTH 3MFJA 2ZA5A 1SGFA 1KXDA 1V2TT 5IK2D 5KECA 3QTOH 4FETA 3P95A 3TK5A 4Q2KA 1F5KU 1IQEA 4I32A 1GMCG 2B7DH 3QTVH 2B9LA 3U8TH 3ZZ9A 1ELCA 2W6ID 1FY1A 2FOHA 3MNCA 4INKA 2ZG0H 2BD9A 3SI4H 1ESBA 2VGCC 4QT8C 3T28A 1C5WB 1THPB 3TNSA 1E1QD 1NBMD 1ZHMA 2G81E 2Z94A 3U98H 2SGDE 2ZGCA 5C1YA 7ESTE 1A1RA 3SV2H 1CT0E 3QO6A 1V2UT 3U9AH 4YTAA 1AE5A 2PKSB 4Q63A 2XOKD 1D9IA 3GCNA 2GKVE 2GX4A 1CBWB 2H5CA 3MNBA 2HVXA 4MLFB 2EQNA 4B74A 1JRSA 3A81A 7GCHF 2H5DA 1Y8TA 3UWIA 1EAXA 2XW9A 1TGNA 3SNAA 3VB3A 1C5MD 2H2ZA 2R0KA 4GCHF 2NU4E 1K1NA 4X0WU 1V6DA 2FOBA 3URCA 1O3FA 4NWLA 2SGFE 3M3TA 4UONA 1GI5A 2F9BH 4FVBA 3A7VA 1L1GA 4OS2A 4BTIB 1KLTA 2F83A 3KQDA 1LPGB 4FUJA 2A5KA 4AOQA 1H4WA 1G3EA 2JJ2D 1GI7B 4IC5A 3UY9A 3LIWA 3GY5A 4X2WA 3ZVEA 1O3IA 9ESTA 2ANMH 3UQVA 4WMEA 2BDHA 1CE5A 2Y82A 1H8DH 2L6OA 5ESBA 1TONA 1P03A 3BEFB 3U8OH 5DP4A 5JBAS 1AD8H 2KCAA 3FFGA 3V0XA 4XOJA 1OP2A 1T4VH 3ZVGA 4Y79A 2OD3B 2FESH 4I8GA 1OWKA 4DURA 2F9VA 2P94A 1WBGB 3DFLA 2QXHA 1AFQB 1O5AB 1G36A 3BTWE 2EI6A 4AG2A 1UTQA 4GLYA 1MKXK 3M3VA 4NA9H 1PJPA 1TNIA 3RXQA 1BRUP 3STIA 2FOAA 1Y3VA 1P12E 4DGJA 5HYOA 4K8BA 5T6DA 2HLDD 1GJDB 4RN6A 1O2YA 4MVNA 2W26A 5CHBA 1MZAA 5E8EH 1CGJE 1HAVA 1KLIH 2BD8A 2C3SA 1IQKA 1Z6JH 1GHZA 5F53A 3AAUA 5EW1H 4B76A 1E37B 4Z0KA 1HRTH 1VKYA 1M9UA 2P59A 4UFFH 1S85A 1TA2A 1H9LB 1HXEH 3HKIB 4I31A 3T2NA 2XBVA 3LDXH 5HKKD 2BQWB 4FUGA 1NBME 3T29A 4X2VA 1C1PA 4OGYA 2WHXA 8GCHF 1XXFA 1HNEE 1UTKA 2XXLA 1W0YH 1ORFA 5AFYH 1MTWA 1BA8B 2AMPA 4DVAU 1Y3YA 2FOCA 1SB1H 5JB8S 4IW4E 1N6YA 2WUBA 3ZZ7A 2ZFTA 5DKMA 1EXFA 2G8TA 1GJ9B 2SGAA 4X6NA 2BDAA 1MQ5A 4ABFA 2RDEA 5LH8A 3OYPA 2ZQ2A 1G9IE 1PPCE 5C20A 1HAPH 5EXNA 1OHHD 1V2MT 3F2HA 1GBHA 2G00A 4B1TA 1KTTB 1DXPA 3QGNB 2ZHWH 3ZZCA 1OSSA 1O2GH 2W5EA 1HAVB 1ZJDA 5PTPA 1W2KH 4NIVA 1BB0B 1TQ0B 4B6EA 4AYVB 5T3HA 1MMJN 4K1TA 3OTPA 3TVJB 3RXBA 4CBOA 2ZFFH 1V2JT 4TY6A 4ZXXH 4Y7BA 2RDLA 3RC6A 2CMYA 1PYTD 1SMFE 1O2PA 1GBKA 1XUHA 2WV9A 1TBRH 1LVBA 2BVXH 2YMSB 1P2IA 4AGKA 5FBEA 3TGJE 2F43B 4Y6DA 1COWD 1NU9A 3T25A 1MQ6A 3M36A 1KXAA 1DLEA 2V3HH 3F6UH 5TCAA 3SU1A 3OAAD 2ZDKA 5JYIA 1V2NT 3BTHE 3RXAA 1C9PA 2WPMS 1G32B 2BLQA 4ZHLU 1YF4A 1F0RA 1FIZA 1PPFE 2J5UA 3AK5A 5I46H 1XXDA 2ULLA 4LOYH 1GI2A 1QFKH 3D49H 4WH6A 3MH4A 5IDKA 2FTMA 2JIZD 1G2MA 2ZGHA 5FHTA 2W6JD 1AY6H 3B9FH 1CT2E 2SFAA 1HGTH 4H6TA 5DP9A 3SJKA 2UWPA 2D2DA 1ZTKA 1ZSJA 8ESTE 1OWJA 1MAYA 4XDEA 4D8NA 2SGPE 1E0FD 4YZUA 1NY22 2PSXA 2BVSH 2VIPA 1C1TA 1YM0A 1O3KA 3UNRA 2FX6A 4XSKU 4YT7H 1LO6A 2XRCA 1HXFH 2BQ7B 4FUFA 1UCYH 1T8LA 1GGDB 1S84A 2FOMB 3BG8A 1OP8A 4TT3D 1FY8E 3SUFA 1IQNA 3JZ2B 1AWFH 1QTFA 2SNVA 1ETTH 1UHBA 1SQAA 2TGTA 1QZ8A 1WV7H 1ARCA 5F8ZA 1MTVA 1GBAA 1O3LA 1A5IA 2FWWA 3FP6E 1T7CA 5C5NA 1O3BA 3PWCA 2Z9IA 3ZZ6A 5AFZH 1N1LA 2STAE 1QL9A 3D62A 4BAKB 1ESAA 3GCTF 1BOQA 1P02A 3W1EA 2GP9B 2AIPA 3VFEA 3TJNA 1L0ZA 5GWZA 1MTSA 1O3HA 1XUKA 2VWLA 1GHAG 2O8LA 4Y11E 2KCOA 4I8KA 5AF9H 3A87A 1PQ5A 2FP7B 1LQEA 3LGWA 3ZYDA 3BTEE 3DD2H 2VWMA 1CA8B 3N7EA 6GCHG 1SGFG 4CHAB 1V2LT 1O3PB 1O2HA 2A5IA 4K69A 4WJG2 4ACBA 2VIWA 1UK3A 3LOXA 2PV9B 1GGDC 5B6LA 1WAYB 1HAHH 3Q3XA 2FXRA 1CA0C 2BY8X 1ZR0A 1CO7E 1ZLRA 4IMQA 1LKBA 4FXGH 2VJ1A 2K0QA 4MPUA 4KP0A 3M3SA 1UJ1A 2Y5HA 2ZC9H 1GMHG 3GISB 2OXSA 1C5NH 3BV9B 4Y8YA 1GJ4H 3BTKE 2IJOB 4H4FA 2BLWA 2AMDA 3F0PA 3ODFA 3TH3H 5FPTA 1BBRK 1UHBB 3KF2A 1V2WT 3PB1E 1TNKA 4FU7A 2PSYA 5IYTA 1DSUA 2BX4A 1YPHE 1MD7A 1NS3A 2Y80A 3SJOA 2HLCA 5DO4H 1EATA 2C90B 3GCOA 3EYDA 1O35A 3OY6U 3B23B 1EJAA 1EX3A 2OINA 2V7QD 4CH8B 4FUDA 2FYRA 1YPHC 4RT0A 1UVPA 4NSYA 1BTXA 5CE1A 1J17T 2XNIA 3GY2A 3TJVA 1A5HA 1AN1E 1AO5A 1AFEH 5F6MA 3E8LA 1TGTA 2ODQA 2YNBA 4Z6AH 2BY7X 2A31A 3DHKH 1AWHB 3P8GA 1YGCH 4FUEA 2B5TB 2ODPA 4IC6A 1G3DA 5FPSA 1UTNA 2NU0E 1TNJA 1Z8RA 4JYVH 4BAOB 1W13U 5T6FA 4MG3A 5L2ZH 1GVZA 4UEHH 4H6SB 2PLXA 3S9AA 4A92A 4FU9A 4IBLH 1QGFA 2WV5A 1EAIA 1BMLA 1C1OA 4XFQA 3FANA 1TX7A 2W3IA 3E3TA 1FPCH 4ZXYH 2VU8E 1Y5UT 3A8CA 1C5RA 1KXEA 2JH5D 5BRRE 1PPEE 3RXVA 4DIHH 4AX9H 1AB9B 1ZRKA 3LGYA 5DP7A 1BTHH 5C94A 4FU8A 1HAXB 1C5YB 5ABWA 3RLWH 3SNEA 2VVUA 1UCYE 1QRZA 3Q76A 3VPKA 2XWAA 3CS7A 5A8ZA 2FTLE 2JDID 2GCTB 3R0FA 5GJ4B 3RXEA 3EA7A 3UOUA 4E7NA 4R0IA 3GICB 1GJ6A 1ZMJA 3ATLA 3GY8A 4WVPE 3A8BA 1EKBB 2GD4B 1A0HB 1S6FA 3EA9A 2VWNA 1C5XB 2OQUA 5C67A 2CF9H 4JZ1A 1Y5BT 1TBQH 5GCHG 4CRGA 1FV9A 1H9IE 1GHXH 1IQFA 1ZHRA 1AIXH 2QGRA 4GHTA 2P8OB 3GY7A 2SGQE 1MKWK 1NM6A 2FLRH 1BMMH 3SYJA 1BRBE 2KCPA 2QIQA 2UUJB 3KIDU 4NIWA 1QL7A 1EOJA 1H8ED 1QB1A 3SI3H 2AERH 3OU0A 2BHGA 1D3QB 5DSFA 1FIWA 2G55A 1O32A 4BOHA 1YCPK 1TBZH 1GI8B 1W3CA 2VBCA 3MU1A 1TGBA 1BQYA 1HJAC 2JJ1D 3CP7A 1TGCA 1VITF 1MABB 3RU4T 1ANCA 2GCTC 5JB9S 3PROA 2RA3A 1LHEH 5A0AE 2QN5T 2EY4C 1AU8A 1XVOA 3M7TA 4Q7ZA 3FO8D 1P2QA 1Q2WA 1P9UA 1SLUB 1NRPH 3M61U 1O2KA 1V2ST 5CHAC 2JETB 1O2ZA 4WF8A 3RXUA 1C2FA 3UWJH 1A3BH 3D23A 2BTCE 4A7IB 2QF5A 1EP5A 3A7ZA 4NIXA 4B6FA 2D8WA 4BANB 4ABJA 3FVFB 3H7OA 1UVTH 5F03A 1O3GA 4I8JA 2AHME 4Y7AA 1GCDA 3MU5A 1C2JA 3PLBA 1GI9B 5KGOA 1A0LA 1JBUH 1Z8JB 1P2MA 4MPWA 3E1XB 1UK2A 4KELA 4IS5A 1D4PB 1C5TA 3M5OA 1T8NA 2BM2A 3KL6A 4O3UA 1RD3B 5EODA 1EP6A 3F2FA 4FUIA 2A4QA 1AZ8A 1DWDH 4CR5A 1G30B 4ZKNU 3RMMH 4F55A 1VZQH 1Y5AT 2BOKA 1DE7H 1TPOA 2XNDD 4ZAEA 1QQUA 1GJBB 3K6YA 4UFDH 2GCHF 3U28C 2BY9X 1ZTLA 4BAMB 4O3TA 2FOGA 1VCPA 4Y10E 1P06A 2DUCA 5K0HA 1F7ZA 1MBQA 3SU4A 1CHOG 3MU0A 1C1RA 4FVDA 3DSOA 3OTJE 2FODA 1TABE 4BNRA 1DANH 1QRWA 2VWOA 1TPPA 3TH4H 1RIWB 1AI8H 1N8OC 4LZ4B 2J38A 3JZ1B 4ZMAH 9LPRA 5L2YH 2OQ5A 1QCPA 3ITIA 3HKJB 5EGMA 3TU7H 2ZTYA 1BDAA 1LHDH 1GDNA 4MDSA 4NA7A 3TIUA 5EIYA 1ELFA 5DP5A 4X8VH 2GMTB 3GYMA 1SLVB 3IG6B 3UNSA 1ANEA 1J9CH 1K21H 2ZFRH 2QA9E 1YBWA 1UTMA 3EA8A 4E05H 1GBTA 1P2OA 5T1VA 1MZDA 4B2AA 1LHCH 2FEQH 1QA7A 1ZZZA 1H8IH 3L3TA 7GCHG 2W3KA 4DT4A 1GMCF 4K1EA 1KY9A 1BMFD 1GHVH 1O30A 1RXPA 1GCTB 2Z3DA 2LNCA 2AGEX 2O9QA 3E6PH 3HGPA 2XC0A 2ZKSA 1SVPA 1QR3E 5B6OA 3DCLA 4GVUA 3A7XA 2AH4X 4KKDA 2K8IA 4LXBH 1O2RA 2GZ9A 4ABEA 1Y3UA 3DSGA 1QURH 3PO1B 1TNHA 2A32A 4YESB 3MO3A 1D3DB 1HYLA 2C93B 1FY3A 1DS2E 1C1VH 1MTNB 1IQIA 1JWTA 2R3YA 1FAXA 2XYAA 1FX0B 1YY3A 4JMYA 3AASA 1O36A 2QYIA 4ABGA 1DDJA 1O3EA 3UUZA 1PQ7A 5JPMH 4YOGA 2CF8H 1SGNE 4CR9A 1DLKB 2PKSC 2BQ6B 2WPHS 1TRYA 2XTTB 1VGCB 2R3UA 1TMTH 2C8XB 2H9HA 1OPHB 2L74A 1PPZA 1CBWC 1E79D 3LKWA 1BCUH 2ZU4A 1TB6H 3T62A 1ELVA 1A4WH 2HNTE 3L33A 1XKBC 3A82A 5GDSH 2BDGA 3LC5A 1FXYA 5AHGH 1QHRB 3EE0B 4U32A 2ESTE 3M7UA 3VEQB 1KSNA 3BEIB 2HNTC 3RU4D 1OWDA 1ABJH 1RTFB 1TMBH 1A2CH 2CK3D 1LMWB 4OS5A 1C9TA 2ANYA 2H6MA 5LGOA 1ZSKA 2ZQ1A 2Z3EA 1AKSB 5DJ7A 2ZF0H 2BLVA 1MTNC 3SV8A 1G37A 2ZGXH 1TX6A 2OC8A 5EPYA 1GHWH 3VGCB 3SV6A 2PR3A 1IOEA 1NRRH 5A8YA 1P09A 2Q6FA 5FL7D 3DA9B 2J34A 3BIUH 1SGPE 2G4UA 4U2WA 1K1OA 8GCHG 1A7SA 3SBKA 1BTZA 3EQ0H 4O97A 2AGIX 2YMSD 3R3GB 1GG6B 1QJ6B 2ODYB 4ISLA 3SNBA 4A6LA 1PQ8A 4ZH8A 1Z1IA 1V2QT 3KEEA 1HPGA 5DG6A 2ZTXA 5JBBS 1W7GH 1P2JA 3SO3A 3MQKC 1ABIH 2WPKS 5ESTE 3WWFA 1YC0A 1AFQC 1F2SE 4HG6A 1AVWA 1QB9A 4SGAE 3PV5A 1ANDA 2W7UA 5EPNA 4DCDA 1EZQA 2J9NA 3SORA 3PMAB 1GJ7B 4MNYA 1BTPA 1PFXC 5JBTA 2FM2A 1RS0A 3QX5H 1O2MA 2EI7A 4ZHAA 5GXPA 1EAWA 1CVWH 4RKJB 4TPYA 3SGAE 1T8MA 2TIOA 3U8RH 1O2IA 3N7DA 4OS6A 1GMDG 2JH6D 1FY5A 2SNWA 3SUEA 3UIRA 3RLYH 1K1PA 3Q3YA 5FXLA 3RXLA 2QXGA 1GHYH 5C5OA 5A09A 4YT6H 1LPKB 4A1VA 4VGCB 3PLKA 4X8TH 1DUEA 2R2WU 2ZP0H 1DM4B 1RJXB 1S83A 1O2XA 5HMAA 4Q7XA 1P8VC 2ZFSA 3A7YA 1C5OH 1NT1A 1ZOMA 3BEUA 4NZQA 1ANBA 1GBFA 2HALA 1J15A 4KTCA 1RTLA 4MNXA 2VIVA 3N7OA 1E1RD 1OYQA 2ZHDA 1GHBG 4DOQA 1QL8A 1HCGA 1W10U 2TGAA 5DP3A 1P2NA 3KQ5A 4J2YB 5HM9A 3S7KB 1ESTA 2FPZA 2GZ8A 2PTNA 3TLOA 3RU4E 1O3OA 1NFXA 3M35A 2IPHA 2VH6A 1UO6A 1SOTA 1EUFA 3UR9A 1DITH 2Q6GA 1O33A 2F9NA 1SGIB 1UTLM 1YPJH 1W12U 3EE7A 2GV7A 1G3CA 1QBVH 1NRNH 1DY9A 2WPLS 1GBMA 4ZKRU 2V3MA 1ZRBA 2VIOA 2FOEA 1BHXF 4YOIA 3ATWA 2BD5A 1GI3A 5GPIB 1J14A 4X8SH 1C2HA 2ZFPH 1MU8B 3MOCA 1GJ8B 1GBDA 3BSQA 4AFUA 1FPHH 4OGXA 4RT1A 3KNXA 8KME2 1IQJA 1T4UH 4MPVA 2ZZUH 3GY4A 1EZSC 1GBBA 2ZDVH 1QBOA 3UOPA 1WQSA 6CHAB 1W0JD 1C2IA 2YMSC 2ZPRA 3NPSA 3FKSD 4OS4A 3P6ZB 4TYDA 2R9PA 5H4IB 4B71A 1W0KD 3MU8A 4YXWD 2WV4A 2G5NA 1C5ZB 1DSTA 3MH5A 1MKXH 1UVSH 1OS8A 2ZDNA 3ZZ3A 2WPDD 4D9QA 3PRDA 2P3TB 3FAOA 4UE7H 1YWUA 1F0SA 3ZV9A 2CV3A 1IQGA 2Z9LA 3K9XB 2IJD1 1C1UH 3C27B 2WUCA 3PWBA 1DXWA 3M7QA 4NFFA 3T26A 2AEIH 2CGAA 3O8DA 1LHGH 2XBYA 2F4LA 2PHBA 2J4IA 4A1XA 4UD9H 1G3BA 2BY6X 3F0OA 1ZJKA 2VIDA 1L2EA 2HGTH 2RCEA 2ZHQH 3A8DA 4K8YA 5FBIA 2ZEBA 4JYTA 1TMUH 6CHAC 2ZECA 3LJJA 1OWIA 2XBWA 1SGCA 4RI0A 4RSPA 2ZDMA 3A89A 3TK9A 3UPEA 1NESE 4NGAH 1UTPA 4Y0YE 2BZAA 5JDUB 3BF6H 1SGEE 3BTDE 1PYTC 1C4V2 1P05A 1YYY1 3E16B 1LVOA 2BOHB 4AC9A 5EU8A 1D3TB 4KGAA 5A8XA 1KXCA 5DP6A 1D3PB 4NCYA 5C17A 3SJ8A 3KQEA 1SR5C 2JKHA 1DT2A 4JZEH 3LH1A 3S9CA 1GHAF 2OTVA 5C1XA 2OBOA 4WWYA 2J92A 2PGBB 2CJIA 2FI5E 1XM1A 4TPIZ 4TSFD 4JYUH 3LGUA 1HLTH 1FJSA 3M5MA 1UTOA 3P8NA 4I33A 1TAWA 4CBNA 4BAQB 3W95A 6GCHF 3LU9B 5EXMA 4FUCA 1O2VA 3B8JA 2GVFA 3RXCA 1SC8U 1PPGE 1KLJH 1LHFH 2HOBA 3BG4B 1GMHF 3ZZ5A 1BIOA 4CHAC 1TA6A 1EB1H 3A80A 2A4GA 1GL0E 1ZTJA 2ZCLP 4Z1MD 1Z8IB 3H09A 4BXSA 1V2OT 1SGDE 1HJ9A 2F91A 1P10A 1WTGH 1O3NA 2Z9KA 4R8TB 3RXTA 3MWIU 1O34A 4P02A 3V13A 2OC0A 3GY6A 3E0PB 3KGPA 3KQBA 1OP0A 2ANWA 5EXLA 1Q31A 1S82A 2HPQH 2R0LA 3I29A 2DE8A 2M2AA 2TBSA 1GVLA 4NFEA 2A7HA 3O8CA 2O8WA 1SGQE 2BDYA 2WYGA 3VXFH 1WYKA 4WH8A 2UUKB 4CRAA 3SV9A 1MU6B 4Q4LA 2FX4A 3A88A 5L30H 3RM0H 2VVVA 1MAXA 4ISOA 4Q80A 1NFWA 4D7FA 1VR1H 2OC7A 5GIBA 1FONA 1AZZA 3A85A 2AFQB 2PGQB 3ZVBA 2O8TA 3WWBA 4DW2U 1GWAA 1P0SH 2G4TA 1AHTH 3GDSA 3BG4C 4AN7A 1C5LH 1OWHA 2SGEE 2F3CE 5C0UA 1WQVH 2XC4A 1O5FH 3TGIE 5E0HA 3GCHB 1E34B 1NZQH 4ESTE 4AFZA 1DOJA 3FZZA 1VJ9U 3I78A 1UK4A 3TJOA 1CGIE 2P3FH 3DSPA 1JRTA 1LQDB 3E90B 4U01A 1ZHPA 1S6HA 1O3DA 1UW7A 2AIQA 3NUMA 2J98A 1IHTH 3GDVA 2BLOA 3PYHA 1O37A 2FI4E 1A5GH 4INLA 4CRFA 2D26C 2QF3A 2V6NA 1BJVA 1FY4A 2ASUB 1F5RA 2HRVA 2KR7A 2VIQA 2A2QH 3VB5A 3SQEE 3SGQE 3IWMA 1K22H 3SV7A 1SG8B 1KIGH 3RXRA 2G5VA 1S0QA 3RMNH 1AB9C 4ABAA 1ID5H 1C1QA 3TGKE 4ABIA 4AB8A 2PW8H 1L4ZA 5T6GA 3MNXA 5GCHF 1C1NA 1O2LA 4DIIH 4WY3A 1BJUA 4ABBA 1B0FA 4AFQA 2UWOA 2BD4A 1O2NA 4M7GA 1T8OA 1SFQB 3RM2H 1SHHB 3WW7A 1TRMA 5C1UA 1C5UA 1J8AA 3SOSA 2PKAA 3S0NA 2YOLA 2OK5A 1P01A 4X1SU 1RGQA 3RXSA 4NG9H 1XX9A 3CNRA 3PTBA 4SGBE 2P8OC 5HIYA 1O2UA 3P70B 2W7SA 2WINI 1OOKB 1YPGH 2ZCHP 3C1KA 1SHYA 1H9HE 1DY8A 4WXIA 5C2ZA 4B73A 2J98B 2YNAA 3UAIC 4X1PU 3RMOH 1OWEA 3RXGA 1GDUA 1QB6A 2J2UA 2LPRA 4IGDA 1AGJA 4JZFH 2G52A 1BBRH 1FQ3A 1QJ7B 1EJNA 1DFPA 1JIRA 1TALA 2IOTA 3Q00A 4D76A 1ZMNA 3H5CB 3VXEH 3E91A 3SU5A 2QF0A 2OUAA 1TE0A 2VINA 2I6SA 2WZQA 2Z6BD 2GCHG 1BHXB 4ABHA 4F49A 3RDZA 4OM9A 4WMFA 2A2XH 3LGVA 1E35B 4IN1A 4X1QU 2JETC 3D65E 2A5AA 1J16A 2PKAB 4CRBA 3MO9A 3GY3A 2GV6A 1FAKH 4XBBA 1P11E 2PP6A 1TPAE 2Q1JA 4NZLA 1S81A 2V0BA 2AGGX 3A8AA 3RMLH 4O03A 4BTUB 2F9UA 2Y7XA 2Y7ZA 3RXPA 4A5TS 3F9GA 1O5DH 5J4SA 1C4Y2 1EJMA 2ALPA 1FI8A 1P57B 1GJCB 2EA3A 2QC2A 1KDQA 3FP8E 1X7AC 3QK1A 4OS1A 1XKAC 3ZVFA 2AMQA 1ELBA 1UMAH 1H1BA 1BTWA 5EJ1A 4D9RA 1O2SA 1BITA 2AS9A 4UDWH 1TOMH 3ZIAD 1CHOF 2PUXB 1LDTT 1IHSH 2V3OH 1EZUC 3F9EA 1QA0A 3QDZB 1QIXB 2AYWA 4TY7A 4PROA 4CRCA 1C5PA 1HIAA 1OX1A 3NZIA 4FOUC 1O2QA 1Z7KA 1YCPM 2P16A 3KQCA 4B2CA 4FUBA 4HFPB 2WPJS 1SQRA 3SU6A 5E2OA 5G4BA 2NU2E 1C2MA 1C1WH 3STJA 3T5FH 4YLUA 3LPRA 4D7GA 3FOAA 2BD7A 2FOFA 1YPMH 3QWCH 5LPEA 1FZZA 3K2UA 4MQAA 3T27A 1CU1A 4GCHG 2QXIA 3KN2A 2PFEA 4I86A 4U30A 3V3MA 2A4OA 1MKWH 4TWWA 1AKSA 3AVZA 1AE8H 1RIWC 2LELA 2GDDA 3AW0A 1P04A 4MPXA 3O8RA 2BX3A 3ZZBA 1SQTA 1EZXC 3SW2B 3U69H 2ANKH 3OSYA 1CHGA 1HB0B 5CDFE 1C2EA 1IQLA 4B2BA 1F0TA 2ZPQA 1YCPH 2P95A 4I7YH 2ZHFH 3NK8A 1KDQB 2XC5A 1S6LA 3SNDA 1MCVA 2GMTC 3TJUA 3RXMA 2F9PA 1SQOA 2BDBA 2EC9H 5EQRA 4X8UH 2GDEH 3MMGA 2HWLB 1NROH 1O38A 1Q3XA 1TNGA 1BUIA 1TIOA 1HIAB 3A83A 1OYTH 1AMHA 4INHA 1GCTC 1VITH 1NFYA 5EJZA 1HFDA 4JK6A 3ZV8A 2FYQA 4NWKA 3UREA 2F9OA 1YPLH 3HGNA 1BBRE 1MCTA 1WUNH 2FZZA 4F48B 4UFGH 2GT7A 2ZGBH 1FDPA 5BPEA 1W0ZU 3TK6A 1SGYE 1KMHB 1P3EA 1K1MA 3NCLA 3SU3A 3ZYEA 3E0NB 3PO1C 1PPHE 4RKOB 1O2TA 3PRBA 3BTME 3ODDA 3SUDA 3RXHA 5A0CA 1W11U 1EOLA 3AAVA 1T31A 4K3JA 5DPAA 1C2LA 1TYNA 1UCYK 4ISHH 1GI1A 2P3UB 2Y6TA 5FCKA 1ETSH 1V2KT 2KAIA 2GJGA 1HAZB 3GYLB 3O8BA 4XE4A 1ELTA 1XUGA 1QBNA 4ACAA 3QN7A 1GJAB 1VGCC 3M37A 1NTPA 3RXOA 1MBMA 4KTUA 3OEED 1C2KA 3SHAH 1C2GA 4AGJA 3MH7A 3A7WA 1TFXA 2KFWA 3LC3A 3P8OA 1O2OA 3F9HA 3RXJA 1SSXA 1WCZA 2QCYA 1EFRD 3OY5U 3HK6B 1BMAA 2ZO3H 3ZZ4A 3ZZAA 1IQHA 3KHVA 3PMBB 4GPGA 3M5LA 2ZU3A 4MTBA 2H1UA 1GJ5H 1KXBA 1WDIA 1H8HD 4YOJA 2TPIZ 1XUIA 4ZHMU 1F92A 3SZNA 3SHCH 3MTYA 1K1LA 3LGIA 1K2I1 1THRH 3UQOA 1A0JA 4HI3A 3VGCC 4GSOA 1JIMA 3CENA 4JCNA 1ZGIA 5DK1A 1A46H 1HAIH 1C5VA 1QJ1B 1C4U2 3UTUH 2WPIS 1DWEH 1HJ8A 1IAUA 1JXPA 1W7XH 1EQ9A 4WMDA 3NXPA 4Y71A 2A4RA 1GG6C 1ZGVA 4GAWA 3M5NA 1DPOA 2A45B 2KAIB 5I25A 4HZHA 3ZZDA 1ELAA 5DGJA 4NSVA 1PPBH 3MO6A 1AUJA 3RUOA 3P8FA 5EQSA 1VJAU 3S7HB 3RC4A 1Z71A 1V2VT 6LPRA 2HPPH 1TWXB 2FDAA 2VB0A 3ATKA 1ELDE 2CN0H 4TWYA 1P3CA 2ZHEH 3OE7D 4ISNA 3EGKH 1O3MA 4ISIH 4Y8XA 1GMDF 1FN8A 4IMZA 2QF4A 1O3AA 1Z8GA 2RA0A 4BTTB 5EW2H 4OS7A 1NFUA 4ASHA 1TX8A 4Y76A 8LPRA 4F4OC 2K1QA 2GT8A 2BY5X 2Z7FE 3Q77A 1RFNA 2ZIQH 1SLWB 3LJOA 2NU1E 5HM2A 2ZFQH 1LVYA 4WXVA 1MD8A 2A0QB 4ZKOU 1D6RA 2OC1A 1O0DH 3DUXH 4M9FA 4JK5A 3ZZ8A 1UVUH 2V35A 1MUEB 1O5GH 1K0HA 1YLCA 2FMJA 2BZ6H 2G51A 4ASUD 1GHBF 1RTKA 2ZDAH 4VGCC 1ELEE 2VNTA 5DP8A 3N99A 4H42U 1HV7A 1F0UA 2QAAA 1ZYOA 1E38B 2Z9GA 1K1IA 4YO9A 5EJLA 3V7TA 4A1TA 4YLQH 3ATIA 5A2MH 1GBLA 1NRSH 1C1SA 2BDCA 3MHWU 3P92A 3ATMA 3SQHE 3G01A 4B75A 2PTCE 1F5LA 4AG1A 3UB0A 3EDXB 3SNCA 1LTOA 4BXWA 2ZPSA 4CH2B 1ZPBA 1O3CA 3A7TA 3IITA 3TH2H 1GI6A 1ARBA 4E7RG 1WSSH 2ZI2H 2FLBH 1P2KA 5L6NH 7LPRA 1EPTA 3OX7U 5GNDA 1NN6A 2CHAB 5JBCS 3GOVB 2ILNA 1AVXA 4DG4A 1TNLA 2H9TH 1GDQA 1GVKB 2PUQH 3GCTG 2GTBA 1IQMA 4FUHA 4DT7B 1TPSA 1FUJA 1O2JA 2VVCA 2QY0B 2FI3E 1JMOH 4O9VA 1CSOE 1SGRE 3K6ZA 2C8ZB 1CA0B 1AVGH 1EASA 3PLPA 1GL1A 3KYGA 1DWBH 4ABDA 4Y0ZE 2Y5FA 1MTUA 3UNQA 3QZRA 2I6QA 1SLXB 5C3NA 1O5EH 3H7TA 1QRXA 2IPQX 4KTSA 1GBIA 1A3EH 3SU0A 2A7CA 2BD3A 2UWLA 2J95A 3HK3B 2H9EH 5TCCA 2WYJA 4X1RU 3RP2A 3RXIA 2BYAX 5LPRA 3SUGA 2PWXA 1ACBE 1C5SA 2FS8A 1NRQH 4J1YA 1L1NA 3PV4A 7KMEH 1Y59T 4K2YA 2A7JA 4E06H 1FN6A 5FCRA 2TRMA 3RC5A 5KEDA 3HATH 1NPMA 4AB9A 4NIYA 3ESTA 3K65B 4ZCNA 1K28D 4Y8ZA 2ZDLA 2P93A 3NRLA 1OXGA 3L6PA 2R2MB 4X2YA 2EI8A 5J4QA 2CHAC 4UFEH 1BZXE 1WU1A 4ZKSU 1HAYB 1HAOH 1DUAA 2KCYA 3FP7E 1HBTH 2ZWLH 1PQAA 4XRNA 2RG3A 1TLDA 1EPTB 2HNTF 3S69A 4ZROA 1GBCA 4X6MA 4CREA 1WOFA 1UVOA 2D1JA 1NC6A 5FAHA 2WSSD 2OP9A 3A84A 3U1IB 2ZU2A 2NWNA 3MH6A 1EAUA 5E2PA 1VCWA 3BN9A 1XVMA 2EEKA 3VB4A 3CS0A 5LPFA 1K1JA 5AVDA 3TPIZ 3ELAH 1YPKH 3VB6A 4YM9A 2C4FH 3BTGE 1KXFA 5EQQA 4CRDA 4XBDA 2ZTZA 1INCA 5C0TA 3NKKA 1BT7A 5TJXA 3VG8A 3F2GA 1Y3WA 4P00A 1SKYE 1K9OE 5E0JA 2STBE 2GGVB 1ZSLA 1UTJA 3BTTE 1FLEE 1YPEH 1U6QA 1Z1JA
chains in the Genus database with same CATH topology
2XCNA 1O39A 2THFB 1SPJA 2CXVA 1EPTC 1Z6EA 4X1NU 3LH3A 1B7XB 1ZMLA 3ZVAA 4GUXA 3RXFA 4AORA 2JH0D 3VB7A 1QQ4A 1KYNA 1L4DA 1MH0A 1G2LA 5FX5A 2OBQA 1EB2A 1DICA 3MI4A 3F9FA 3FZDA 3UR6A 3PM3A 1QY6A 4MNVA 3BTFE 3P17H 1TQ7B 3QGJA 1O2WA 2ZNKH 3AW1A 4X6PA 1N6XA 2M5TA 4XBCA 1BMNH 3RXDA 2Y81A 4AYYB 3PTNA 5ETXA 3V12A 1GBEA 3ENSB 1RRKA 3UFAA 5K7RA 5A0BA 1XUJA 1HJAB 1T32A 1P9SA 2B8OH 3BIVH 1A61H 3Q3KA 1E36B 1C2DA 1HDTH 3ZVDA 4IN2A 1TRNA 2BXUH 4MNWA 5SGAE 1FMGA 1CT4E 2Z3CA 1O5CB 5HXFA 1AUTC 2BXTH 4LZ1H 1CGHA 1THSH 1TOCB 2UUYA 3LT3A 1B0EA 4BAHB 1VITG 4I8HA 3MU4A 1O31A 5CHAB 2C8YB 3SJIA 1DWCH 2IN2A 3PMHB 3PMJA 5CMXH 5F8TA 4JZIA 4K60A 4X6OA 2DE9A 1SGTA 3SGBE 3NWUA 5F8XA 4LK4A 3LONA 1XUFA 3U1JB 1LVMA 2O8MA 2XWBI 3GCHC 4DY7B 2ZCKP 1HAGE 3S9BA 5FX6A 2B0FA 1VCQA 2OCVB 2FS9A 1D6WA 1V3XA 1ZPZA 1YKTA 3ZVCA 1ETRH 1NO9H 4HGCA 4JZDH 3A86A 1BRCE 1TGSZ 1V2RT 2Q6DA 1S0RA 3RXKA 1SFIA 1BTYA 4K5ZA 3TNTA 3WY8A 1GPZA 2ZU1A 4DJZB 3LGTA 1QNJA 1DX5M 1XMNB 2BMGB 1YP9A 2GZ7A 1C1MA 1KTSB 2ZGJA 3SU2A 2Z9JA 4AZ2B 3TITA 1GI0A 2TGDA 1FNIA 1O5BB 5FPYA 2VH0A 2FIRH 1DVAH 4THNH 4Q7YA 2BVRH 3URDA 2Y5GA 2O8UA 4ZUHA 1BTUA 1NU7B 1C5QA 2ALVA 2XCFA 1L1JA 1GBJA 3QZQA 2OLGA 2TGPZ 1LPZB 1AQ7A 4AFSA 3W94A 1ZPCA 2ZU5A 3HPTB 1N8OB 4X2XA 3SN8A 3MNSA 5E0GA 2BDIA 1JOUB 2QV1A 5EOKA 1WTHD 2XBXA 2FO9A 1O3JA 4I8LA 1SOZA 3DT0H 5EG4A 2C8WB 2VGCB 3EAJA 1V2PT 3F1SB 4GHQA 1YLDA 3DFJA 1LCYA 6ESTA 3GDUA 1SI5H 1OKXA 3QUMP 2BB4A 1SL3A 4HTCH 2NU3E 5HGGA 1LKAA 3F68H 1BRAA 4K1SA 2A1DB 1ELGA 1CQQA 1SBWA 3KCGH 3SJ9A 4NA8A 3QLPH 1W8BH 1S5SA 2QXJA 1B5GH 2BD2A 2J94A 1W14U 1Y3XA 3BTQE 2UUFB 3MYWA 3I77A 1GI4A 1HUTH 3MFJA 2ZA5A 1SGFA 1KXDA 1V2TT 3QTOH 3P95A 3TK5A 4Q2KA 1F5KU 1IQEA 4I32A 1GMCG 2B7DH 3QTVH 2B9LA 3U8TH 3ZZ9A 1ELCA 1FY1A 2FOHA 3MNCA 4INKA 2ZG0H 2BD9A 3SI4H 1ESBA 2VGCC 4QT8C 3T28A 1C5WB 1THPB 3TNSA 1ZHMA 2G81E 2Z94A 3U98H 2SGDE 2ZGCA 5C1YA 7ESTE 1A1RA 3SV2H 1CT0E 3QO6A 1V2UT 3U9AH 4YTAA 1AE5A 2PKSB 1D9IA 3GCNA 2GKVE 2GX4A 1CBWB 2H5CA 3MNBA 2HVXA 4MLFB 4B74A 1JRSA 3A81A 7GCHF 2H5DA 1Y8TA 3UWIA 1EAXA 2XW9A 1TGNA 3SNAA 3VB3A 1C5MD 2H2ZA 2R0KA 4GCHF 2NU4E 1K1NA 4X0WU 1V6DA 2FOBA 3URCA 1O3FA 4NWLA 2SGFE 3M3TA 4UONA 1GI5A 2F9BH 4FVBA 3A7VA 1L1GA 4OS2A 4BTIB 1KLTA 2F83A 3KQDA 1LPGB 4FUJA 2A5KA 4AOQA 1H4WA 1G3EA 1GI7B 4IC5A 3UY9A 3LIWA 3GY5A 4X2WA 3ZVEA 1O3IA 9ESTA 2ANMH 3UQVA 4WMEA 2BDHA 1CE5A 2Y82A 1H8DH 5ESBA 1TONA 1P03A 3BEFB 3U8OH 5DP4A 5JBAS 1AD8H 3FFGA 3V0XA 4XOJA 1OP2A 1T4VH 3ZVGA 4Y79A 2OD3B 2FESH 4I8GA 1OWKA 4DURA 2F9VA 2P94A 1WBGB 3DFLA 2QXHA 1AFQB 1O5AB 1G36A 3BTWE 2EI6A 4AG2A 1UTQA 4GLYA 1MKXK 3M3VA 4NA9H 1PJPA 1TNIA 3RXQA 1BRUP 3STIA 2FOAA 1Y3VA 1P12E 4DGJA 5HYOA 4K8BA 5T6DA 1GJDB 4RN6A 1O2YA 4MVNA 2W26A 1MZAA 5E8EH 1CGJE 1HAVA 1KLIH 2BD8A 2C3SA 1IQKA 1Z6JH 1GHZA 3AAUA 5EW1H 4B76A 1E37B 4Z0KA 1HRTH 1M9UA 2P59A 4UFFH 1S85A 1TA2A 1H9LB 1HXEH 3HKIB 4I31A 3T2NA 2XBVA 3LDXH 2BQWB 4FUGA 3T29A 4X2VA 1C1PA 4OGYA 8GCHF 1XXFA 1HNEE 1UTKA 2XXLA 1W0YH 1ORFA 5AFYH 1MTWA 1BA8B 2AMPA 4DVAU 1Y3YA 2FOCA 1SB1H 5JB8S 4IW4E 1N6YA 2WUBA 3ZZ7A 2ZFTA 5DKMA 1EXFA 2G8TA 1GJ9B 2SGAA 4X6NA 2BDAA 1MQ5A 4ABFA 5LH8A 3OYPA 2ZQ2A 1G9IE 1PPCE 5C20A 1HAPH 5EXNA 1V2MT 1GBHA 2G00A 4B1TA 1KTTB 1DXPA 3QGNB 2ZHWH 3ZZCA 1OSSA 1O2GH 2W5EA 1HAVB 1ZJDA 5PTPA 1W2KH 4NIVA 1BB0B 1TQ0B 4AYVB 5T3HA 1MMJN 4K1TA 3TVJB 3RXBA 4CBOA 2ZFFH 1V2JT 4TY6A 4ZXXH 4Y7BA 2RDLA 3RC6A 2CMYA 1PYTD 1SMFE 1O2PA 1GBKA 1XUHA 1TBRH 1LVBA 2BVXH 1P2IA 4AGKA 5FBEA 3TGJE 4Y6DA 3T25A 1NU9A 1MQ6A 3M36A 1KXAA 1DLEA 2V3HH 3F6UH 5TCAA 3SU1A 5JYIA 2ZDKA 1V2NT 3BTHE 3RXAA 1C9PA 2WPMS 1G32B 2BLQA 4ZHLU 1YF4A 1F0RA 1FIZA 1PPFE 5I46H 1XXDA 2ULLA 4LOYH 1GI2A 1QFKH 3D49H 4WH6A 3MH4A 5IDKA 2FTMA 1G2MA 2ZGHA 5FHTA 1AY6H 3B9FH 1CT2E 2SFAA 1HGTH 4H6TA 5DP9A 3SJKA 2UWPA 2D2DA 1ZTKA 1ZSJA 8ESTE 1OWJA 1MAYA 4XDEA 4D8NA 2SGPE 1E0FD 4YZUA 1NY22 2PSXA 2BVSH 2VIPA 1C1TA 1YM0A 1O3KA 3UNRA 2FX6A 4XSKU 4YT7H 1LO6A 2XRCA 1HXFH 2BQ7B 4FUFA 1UCYH 1T8LA 1GGDB 1S84A 2FOMB 3BG8A 1OP8A 1FY8E 3SUFA 1IQNA 3JZ2B 1AWFH 1QTFA 2SNVA 1ETTH 1UHBA 1SQAA 2TGTA 1WV7H 1ARCA 5F8ZA 1MTVA 1GBAA 1O3LA 1A5IA 2FWWA 3FP6E 1T7CA 5C5NA 1O3BA 3PWCA 2Z9IA 3ZZ6A 5AFZH 1N1LA 2STAE 1QL9A 3D62A 4BAKB 1ESAA 3GCTF 1BOQA 1P02A 2GP9B 2AIPA 3VFEA 3TJNA 1L0ZA 5GWZA 1MTSA 1O3HA 1XUKA 2VWLA 1GHAG 2O8LA 4Y11E 4I8KA 5AF9H 3A87A 1PQ5A 2FP7B 1LQEA 3LGWA 3ZYDA 3BTEE 3DD2H 2VWMA 1CA8B 6GCHG 1SGFG 4CHAB 1V2LT 1O3PB 1O2HA 2A5IA 4K69A 4WJG2 2VIWA 1UK3A 3LOXA 2PV9B 1GGDC 1WAYB 1HAHH 3Q3XA 2FXRA 1CA0C 2BY8X 1ZR0A 1CO7E 1ZLRA 4IMQA 1LKBA 4FXGH 2VJ1A 4MPUA 4KP0A 3M3SA 1UJ1A 2Y5HA 2ZC9H 1GMHG 3GISB 2OXSA 1C5NH 3BV9B 4Y8YA 1GJ4H 3BTKE 2IJOB 4H4FA 2BLWA 2AMDA 3ODFA 3TH3H 5FPTA 1BBRK 1UHBB 3KF2A 1V2WT 3PB1E 1TNKA 4FU7A 2PSYA 5IYTA 1DSUA 2BX4A 1YPHE 1MD7A 1NS3A 2Y80A 3SJOA 2HLCA 5DO4H 1EATA 2C90B 3GCOA 3EYDA 1O35A 3OY6U 3B23B 1EJAA 1EX3A 2OINA 4CH8B 4FUDA 2FYRA 1YPHC 1UVPA 4NSYA 1BTXA 5CE1A 1J17T 2XNIA 3GY2A 3TJVA 1A5HA 1AN1E 1AO5A 1AFEH 5F6MA 3E8LA 1TGTA 2ODQA 2YNBA 4Z6AH 2BY7X 2A31A 3DHKH 1AWHB 3P8GA 1YGCH 4FUEA 2B5TB 2ODPA 4IC6A 1G3DA 5FPSA 1UTNA 2NU0E 1TNJA 1Z8RA 4JYVH 4BAOB 1W13U 5T6FA 4MG3A 5L2ZH 1GVZA 4UEHH 4H6SB 2PLXA 3S9AA 4A92A 4FU9A 4IBLH 1QGFA 2WV5A 1EAIA 1BMLA 1C1OA 4XFQA 3FANA 1TX7A 2W3IA 3E3TA 1FPCH 4ZXYH 2VU8E 1Y5UT 3A8CA 1C5RA 1KXEA 2JH5D 5BRRE 1PPEE 3RXVA 4DIHH 4AX9H 1AB9B 1ZRKA 3LGYA 5DP7A 1BTHH 4FU8A 1HAXB 1C5YB 5ABWA 3RLWH 3SNEA 2VVUA 1UCYE 1QRZA 3Q76A 3VPKA 2XWAA 3CS7A 5A8ZA 2FTLE 2GCTB 3R0FA 5GJ4B 3RXEA 3EA7A 3UOUA 4E7NA 4R0IA 3GICB 1GJ6A 1ZMJA 3ATLA 3GY8A 4WVPE 3A8BA 1EKBB 2GD4B 1A0HB 1S6FA 3EA9A 2VWNA 1C5XB 2OQUA 5C67A 2CF9H 4JZ1A 1Y5BT 1TBQH 5GCHG 4CRGA 1FV9A 1H9IE 1GHXH 1IQFA 1ZHRA 1AIXH 2QGRA 4GHTA 2P8OB 3GY7A 2SGQE 1MKWK 1NM6A 2FLRH 1BMMH 1BRBE 2QIQA 2UUJB 3KIDU 4NIWA 1QL7A 1EOJA 1QB1A 3SI3H 2AERH 3OU0A 2BHGA 1D3QB 1FIWA 2G55A 1O32A 4BOHA 1YCPK 1TBZH 1GI8B 1W3CA 3MU1A 1TGBA 1BQYA 1HJAC 3CP7A 1TGCA 1VITF 3RU4T 1ANCA 2GCTC 5JB9S 3PROA 2RA3A 1LHEH 5A0AE 2QN5T 1AU8A 1XVOA 3M7TA 4Q7ZA 1P2QA 1Q2WA 1P9UA 1SLUB 1NRPH 3M61U 1O2KA 1V2ST 5CHAC 2JETB 1O2ZA 4WF8A 3RXUA 1C2FA 3UWJH 1A3BH 3D23A 2BTCE 4A7IB 1EP5A 3A7ZA 4NIXA 2D8WA 4BANB 4ABJA 3FVFB 3H7OA 1UVTH 5F03A 1O3GA 4I8JA 4Y7AA 1GCDA 3MU5A 1C2JA 3PLBA 1GI9B 1A0LA 1JBUH 1Z8JB 1P2MA 4MPWA 3E1XB 1UK2A 4KELA 4IS5A 1D4PB 1C5TA 3M5OA 1T8NA 2BM2A 3KL6A 4O3UA 1RD3B 5EODA 1EP6A 4FUIA 2A4QA 1AZ8A 1DWDH 4CR5A 1G30B 4ZKNU 3RMMH 1VZQH 1Y5AT 2BOKA 1DE7H 1TPOA 4ZAEA 1QQUA 1GJBB 3K6YA 4UFDH 2GCHF 2BY9X 1ZTLA 4BAMB 4O3TA 2FOGA 1VCPA 4Y10E 1P06A 2DUCA 5K0HA 1F7ZA 1MBQA 3SU4A 1CHOG 3MU0A 1C1RA 4FVDA 3OTJE 2FODA 1TABE 4BNRA 1DANH 1QRWA 2VWOA 1TPPA 3TH4H 1RIWB 1AI8H 1N8OC 4LZ4B 2J38A 3JZ1B 4ZMAH 9LPRA 5L2YH 2OQ5A 1QCPA 3ITIA 3HKJB 5EGMA 3TU7H 2ZTYA 1BDAA 1LHDH 1GDNA 4MDSA 4NA7A 3TIUA 1ELFA 5DP5A 4X8VH 2GMTB 3GYMA 1SLVB 3IG6B 3UNSA 1ANEA 1J9CH 1K21H 2ZFRH 2QA9E 1YBWA 1UTMA 3EA8A 4E05H 1GBTA 1P2OA 1MZDA 4B2AA 1LHCH 2FEQH 1QA7A 1ZZZA 1H8IH 3L3TA 7GCHG 2W3KA 1GMCF 4K1EA 1KY9A 1GHVH 1O30A 1RXPA 1GCTB 2Z3DA 2LNCA 2AGEX 2O9QA 3E6PH 3HGPA 2XC0A 2ZKSA 1SVPA 1QR3E 5B6OA 4GVUA 3A7XA 2AH4X 4KKDA 4LXBH 1O2RA 2GZ9A 4ABEA 1Y3UA 1QURH 3PO1B 1TNHA 2A32A 4YESB 3MO3A 1D3DB 1HYLA 2C93B 1FY3A 1DS2E 1C1VH 1MTNB 1IQIA 1JWTA 2R3YA 1FAXA 2XYAA 4JMYA 3AASA 1O36A 2QYIA 4ABGA 1DDJA 1O3EA 3UUZA 1PQ7A 5JPMH 4YOGA 2CF8H 1SGNE 4CR9A 1DLKB 2PKSC 2BQ6B 2WPHS 1TRYA 2XTTB 1VGCB 2R3UA 1TMTH 2C8XB 2H9HA 1OPHB 1PPZA 1CBWC 3LKWA 1BCUH 2ZU4A 1TB6H 3T62A 1ELVA 1A4WH 2HNTE 3L33A 1XKBC 3A82A 5GDSH 2BDGA 3LC5A 1FXYA 5AHGH 1QHRB 3EE0B 4U32A 2ESTE 3M7UA 3VEQB 1KSNA 3BEIB 2HNTC 3RU4D 1OWDA 1ABJH 1RTFB 1TMBH 1A2CH 1LMWB 4OS5A 1C9TA 2ANYA 2H6MA 5LGOA 1ZSKA 2ZQ1A 2Z3EA 1AKSB 5DJ7A 2ZF0H 2BLVA 1MTNC 3SV8A 1G37A 2ZGXH 1TX6A 2OC8A 5EPYA 1GHWH 3VGCB 3SV6A 2PR3A 1IOEA 1NRRH 5A8YA 1P09A 2Q6FA 3DA9B 2J34A 3BIUH 1SGPE 2G4UA 4U2WA 1K1OA 8GCHG 1A7SA 3SBKA 1BTZA 3EQ0H 4O97A 2AGIX 3R3GB 4ISLA 1GG6B 1QJ6B