4GSOA

Structure of jararacussin-i
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
232
structure length
232
Chain Sequence
VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin-like enzyme BjussuSP-1
publication title Crystal structure of Jararacussin-I: The highly negatively charged catalytic interface contributes to macromolecular selectivity in snake venom thrombin-like enzymes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 45
structure length 232
sequence length 232
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gsoA02
2YNAA 2GCTB 5EU8A 2ANWA 1YPJH 3TH2H 1F5LA 1P9UA 3CP7A 1HJAB 4ABIA 1TA6A 2FI5E 1C5ZB 3NZIA 4KGAA 2WPJS 1D3QB 3QO6A 1CQQA 1GJBB 1ZJDA 4KP0A 4YOIA 5F6MA 3FANA 3SGQE 2QAAA 2QF3A 1ANCA 3LJJA 2JETC 1C2GA 2G4TA 4OS2A 5EPNA 1SGCA 1QL9A 1B7XB 2VWNA 3Q00A 1TPPA 2BVSH 1FMGA 3GY3A 5EOKA 1QB9A 1SGDE 5C5OA 5DP4A 1H1BA 5JB8S 3SV7A 2TGPZ 5EQQA 4Y0ZE 2BM2A 4WJG2 3A8BA 4K2YA 1NFXA 1S84A 2QY0B 1TNHA 1O30A 1QJ7B 1ELBA 3BN9A 4YT7H 2JH6D 1MZAA 1VITH 1YPHC 3GDUA 1P2NA 1YYY1 4UFFH 2ZFTA 2F9BH 1QQUA 5G4BA 1PPCE 1CHOG 1XUFA 1EPTC 2J34A 2VIQA 1O3MA 1WBGB 3MHWU 2Y7ZA 2KAIB 5AFZH 2Q6GA 1YLDA 5EXNA 4Z0KA 1K22H 3B8JA 1OX1A 1TBRH 2A2XH 3M7TA 2BLOA 1ARCA 1YF4A 2TGTA 3ZZ4A 1XUJA 4D7GA 1C1MA 1SL3A 3SU2A 3PYHA 3RU4T 1V2ST 4UFGH 1GBCA 1HJ9A 2HWLB 1GBMA 1YPKH 1EQ9A 2Q6FA 1L1GA 4WXVA 3RM0H 1T8LA 1ZYOA 4HI3A 1BTHH 1GJCB 1XXDA 1ESTA 1G32B 4DJZB 4B76A 2Z94A 5AFYH 3SGAE 4ZAEA 3IG6B 5H4IB 3BEFB 1NS3A 4TY7A 1PYTC 2A7CA 1QA0A 2BXTH 1BTZA 1AE8H 2AMQA 4AB8A 6CHAB 2EA3A 3FP6E 4ASHA 1SGIB 4CRBA 4NSYA 4ABHA 3RU4E 3I77A 2CV3A 1SVPA 1PPZA 1XX9A 3SV6A 1TB6H 5GXPA 3RXAA 3KNXA 1ACBE 1TOMH 1SGEE 4BANB 2H9EH 8LPRA 2ZDNA 4E06H 5EODA 1HIAB 5E2OA 5A0AE 4OGYA 2C8YB 1MU6B 1C5YB 4AFUA 3L33A 1DUAA 4YO9A 3BIVH 4XSKU 1E0FD 2OQUA 2VWLA 3UTUH 3UNSA 1O5AB 3ZZDA 1ETTH 2QXIA 1HYLA 3VXEH 3UIRA 1C4V2 3MO6A 1IQGA 1HXEH 3KF2A 4A1XA 4NIYA 1C1RA 5F8TA 1K1IA 1O5EH 3U8RH 1A5HA 5DGJA 1F0SA 3QGJA 3BTTE 1BJVA 2FI3E 3V7TA 1FV9A 1F0TA 1AGJA 4FUEA 2F9NA 3RXCA 7GCHF 3U8TH 2BY9X 4NIXA 1CHGA 1K2I1 3TU7H 3ZVFA 3PLKA 3A83A 3EQ0H 4B2AA 1AVGH 1UVTH 1Y59T 1Y5AT 2QXGA 5EQSA 1C1NA 4K8YA 4NSVA 2XNIA 1GJ6A 4WWYA 1C5XB 2XBVA 1JIRA 3A7ZA 1KXFA 5A8XA 1PQ8A 1FY8E 1GVLA 1OWJA 4ZXXH 1BRBE 1BBRK 3ATKA 2G81E 5J4SA 3BTDE 1C5TA 2FZZA 1GBLA 3M36A 3HGPA 1V2TT 2GDEH 1RRKA 1QY6A 1GMDF 3ZVGA 2H5CA 3BTQE 3L6PA 3UWIA 1LVYA 4UFEH 1N8OC 1BDAA 1G3CA 5J4QA 1VR1H 1M9UA 3EGKH 4D9RA 2QA9E 3NWUA 1PFXC 1EB1H 2ANKH 4GSOA 1B0FA 1LVBA 1AIXH 1GJAB 3KEEA 2XCNA 2BD4A 1LHDH 4IC6A 1BUIA 2BZAA 2F9VA 4LZ4B 2KAIA 3ZZ7A 1FXYA 5ESBA 4ABDA 2FYRA 1P57B 2V6NA 1RGQA 1W7GH 1HAHH 4X6MA 4AGKA 2AGEX 2PKAA 4IN1A 1FJSA 1Z8IB 2OC1A 1WV7H 1O3KA 2GT8A 2FP7B 2J2UA 1DPOA 1O3DA 3SJIA 4HTCH 3P8OA 2G8TA 1YM0A 3TJOA 3S0NA 1O2KA 3A82A 1L4ZA 2JH5D 1IQKA 3TGKE 1C5SA 3A85A 3NXPA 5JBCS 3ZYDA 1NTPA 1GJ7B 2VVUA 1T32A 3MNBA 4GUXA 1O0DH 1DWBH 2G51A 2ZDAH 2GKVE 3RXVA 3UOPA 2NU4E 2BZ6H 4JMYA 1O2HA 4JZ1A 2FEQH 3EA7A 5E0JA 6GCHG 1YKTA 2SGEE 1UCYE 2BY7X 2GT7A 3PTNA 2PTCE 2ODPA 1O2GH 4K1TA 1J8AA 1ELGA 1QL7A 3UR6A 4JK6A 1C5MD 1D3TB 1IAUA 1GHWH 3UPEA 1EJAA 5FHTA 1HCGA 1TYNA 2VGCC 1O33A 1B5GH 2AFQB 5CHAB 4F4OC 2AIQA 1SG8B 3FZZA 4H42U 1ZHMA 3SNDA 5F03A 4XBDA 2ZGBH 4D9QA 2H6MA 3R3GB 1EKBB 1LHFH 4I31A 2XTTB 1HAVB 4I33A 3A7TA 1SHHB 2WPMS 5ABWA 3RXLA 3E1XB 3F1SB 1ZLRA 3E0NB 3I78A 1YGCH 1GBHA 1XKBC 3MH5A 1QR3E 2V0BA 3TLOA 1CO7E 2FLBH 3O8DA 4ABAA 4AN7A 1K1JA 1FN6A 3ATIA 4BAHB 3T25A 3A7XA 4WMFA 4OS7A 1OSSA 1AHTH 1F5RA 1BZXE 4DY7B 4JYVH 1G2MA 4MPXA 2EI6A 3A7YA 4X1QU 1O2JA 2O8TA 3FP7E 1DVAH 2EEKA 4NA7A 1SGFA 1WU1A 1GGDC 1O2PA 1P2QA 4X1RU 1BHXB 3K6ZA 1O39A 2VH0A 1GJ8B 1OXGA 2VB0A 4JZDH 1AFQB 2A7JA 1DT2A 1P2OA 1ZTKA 2VJ1A 1TPSA 1ZOMA 1TGBA 2NU0E 3IITA 1LQDB 1LHEH 2FTMA 2FIRH 1TRYA 3GY5A 8ESTE 5DG6A 1GBJA 3VB3A 4YT6H 1SFQB 1QGFA 3F9GA 2ZP0H 1GBFA 1O2YA 2A31A 3BTGE 5BRRE 1G3BA 2ZKSA 1ETRH 4TWYA 2R3YA 1C4Y2 3PWBA 1Z8JB 4A7IB 4XBCA 1P0SH 2OCVB 3RXSA 4SGAE 2HNTC 4Q80A 1DICA 3OSYA 3P70B 4Q7ZA 2FESH 1HJ8A 1SOTA 2VIDA 2XC5A 1SMFE 1CHOF 2BLQA 1MTNC 2ZHWH 3P17H 1THRH 1HAZB 4K69A 4NWLA 1O5BB 1HGTH 3MU0A 4IN2A 2PWXA 2LNCA 4X2VA 1TRNA 2GV6A 4FVDA 1AWHB 3STJA 2EI7A 4FUJA 3QWCH 5DP8A 1HFDA 2W7UA 1V6DA 4CRFA 1GBKA 1O3CA 1GWAA 2ZECA 3GYMA 4X8TH 3UNQA 4BAKB 3VGCC 4RKOB 1MTUA 1QBOA 2ZU5A 4MNXA 2ZHQH 4BXWA 2GV7A 3OX7U 2Y5GA 3GY2A 1TQ7B 2ZFRH 1BQYA 1P02A 3SJ8A 3P92A 1KTTB 1SGTA 1ETSH 1S0RA 1NFUA 1O2LA 2QCYA 4BTTB 5A2MH 1UVPA 1YPHE 3MO3A 3KGPA 4O3UA 4WY3A 2BB4A 2I6SA 5JB9S 1V2QT 2BVXH 4O9VA 3QDZB 1C2DA 4BAOB 2FPZA 5GCHG 1GI3A 4JZEH 1TX7A 3LGWA 1QRXA 1RFNA 1ZMNA 2ZFSA 2ZHFH 2J4IA 1BTUA 1Z1JA 4UONA 3ELAH 2B7DH 1GHAG 1ESBA 3LOXA 4Y8ZA 1ELEE 2C8XB 1ZSLA 2UWPA 1O32A 4X8VH 1QNJA 3BV9B 1UTKA 1N6XA 2BDYA 2RG3A 1LTOA 5C3NA 1SHYA 4K3JA 1J14A 2VH6A 3PV4A 3ZVDA 4ISOA 5PTPA 3MO9A 4WF8A 3QZQA 5JBTA 3ENSB 2PW8H 2Q1JA 3LT3A 3QLPH 4UDWH 2XXLA 4ZHLU 1O3JA 5DK1A 3SU3A 3D23A 2M5TA 2ZO3H 3TNSA 3ZVCA 4TWWA 4X1NU 3TH3H 5LPRA 3SNEA 2Z9LA 1O2RA 1TGNA 1C5WB 2J95A 3BTEE 1MKXH 3E3TA 4IMQA 1L4DA 1UCYH 2CGAA 2ZWLH 3RXKA 2VIOA 1O2QA 3RXIA 3A8CA 4LOYH 1C5LH 1FAKH 1BRUP 2FODA 3KHVA 1TBZH 1Z7KA 1EASA 3K9XB 1YPGH 3QN7A 4IBLH 3DT0H 1CGJE 3KN2A 4I8KA 1AB9C 3TNTA 2ZDMA 1DWDH 3H7TA 1EAWA 3T28A 4DW2U 4WVPE 1SQOA 4MQAA 3MH4A 3E16B 2IPHA 1H8DH 1AO5A 2QGRA 1MKXK 3SQEE 4X8SH 2V35A 2HRVA 4CRDA 1O3OA 2JETB 4FVBA 1Y3UA 3LKWA 3S9AA 1GBIA 4XFQA 1VJ9U 2BD7A 3M3TA 1HNEE 1C1WH 1VCQA 3V0XA 2TBSA 2VWMA 1C1PA 1Y3YA 1C5PA 3SUDA 1LHGH 2PUQH 9ESTA 1OWEA 1FPCH 1AU8A 1SB1H 1ZRBA 3BG4C 2G52A 1QA7A 1O3IA 1OWKA 1TA2A 3TK6A 3A8AA 2ZFPH 1DY9A 3RXMA 1TMUH 2C93B 4I8HA 2G00A 1NN6A 3W95A 1EPTB 3QGNB 2XC4A 1AVXA 1D4PB 3T5FH 1GHXH 5I46H 3RC4A 1FIWA 2BD9A 3V12A 3RXEA 3ESTA 1E38B 1O3NA 1ESAA 3ODFA 3AW1A 4AORA 1EATA 2UUYA 1KLJH 2ZU1A 2VIPA 1LQEA 1ARBA 4U01A 4F49A 1MCTA 1DM4B 1W11U 3DHKH 1UVSH 1C5QA 2FOCA 1QURH 3SI4H 1T31A 3K65B 3FP8E 2PFEA 5JPMH 4LK4A 2PGQB 4I7YH 3SJ9A 5EPYA 2ZDVH 1DWEH 4MG3A 3ZZ3A 1GI1A 3PMBB 1J15A 1PPHE 3HGNA 1LPZB 1ID5H 2FO9A 1SPJA 1P2JA 2ALPA 4BOHA 3JZ1B 1CBWC 1SLWB 2O9QA 1HXFH 5C20A 2J94A 3T2NA 3HATH 1S82A 1EAUA 4R8TB 1T4VH 2IOTA 1PQAA 5B6OA 6GCHF 1TGSZ 1V2VT 1BHXF 1W10U 1GCTC 1ZRKA 1ZPBA 5LH8A 3SORA 2VNTA 2AH4X 3LH1A 1TNLA 1P3CA 3ATMA 4AGJA 3MH7A 4XE4A 3CS7A 1GI0A 1AKSA 2DE9A 2GZ9A 1TLDA 2SGDE 2Q6DA 5EGMA 3C27B 2XRCA 1E37B 4KTCA 2UUFB 1BB0B 2FOEA 3A86A 1C5VA 2HPPH 1ELDE 2Z9IA 4CH8B 3Q77A 1NROH 1Y5UT 2WPHS 2H9HA 1DANH 2GP9B 3P8NA 2HOBA 1MKWK 1P09A 1DITH 1O35A 2P8OC 2SGAA 1W12U 3SHCH 1JRSA 2ZTZA 1H4WA 4HZHA 1T4UH 1GI9B 1QRWA 4X1SU 1O3PB 2CJIA 3SV2H 3LJOA 3BF6H 3RXOA 1C2EA 1O3BA 2BY6X 2ZPSA 3SU5A 3VFEA 2A1DB 2AS9A 4E05H 1FPHH 1V2KT 2IJOB 3RM2H 1O2TA 3P8FA 5A8ZA 2VIVA 1CVWH 2ZDKA 1H8IH 3A89A 3SV9A 1O34A 4OGXA 3S9BA 1KDQB 3FZDA 2ZHDA 3UREA 2BQ7B 5T6GA 2Z9JA 1TNGA 1UHBB 2ODQA 2PV9B 3U8OH 1WAYB 3PROA 2RA0A 2PKSC 1TMTH 2W26A 3PLBA 5LPEA 5FPTA 3V3MA 3LU9B 2UUJB 2BQ6B 1YCPK 1BBRH 3TK5A 2ZPQA 1A5IA 4Z6AH 4DG4A 5BPEA 1WSSH 1IQMA 1N8OB 2SFAA 1OYTH 4Y8YA 1AZZA 5JYIA 3TK9A 4X8UH 1F5KU 4X0WU 4GHTA 1SQTA 4NZLA 3RXDA 2BLWA 1LPGB 2FDAA 1YBWA 2GTBA 3AW0A 1TGCA 4M7GA 2FYQA 5C1UA 2B5TB 5T6DA 1TX6A 1EZQA 1W7XH 1V2WT 1FZZA 3P6ZB 4HFPB 4TY6A 4TYDA 4INKA 3LPRA 1Z71A 3ZZCA 5K7RA 1KXCA 2A4GA 1OWHA 4MTBA 3ATLA 4ZXYH 3R0FA 2GX4A 5ESTE 4CH2B 5E0HA 2W3KA 2ZFQH 4GVUA 1CA0C 4CBOA 1WTHD 4KELA 3EA9A 2BX3A 2DE8A 1GJ9B 4J2YB 3ITIA 3PM3A 5JDUB 1BCUH 4MNVA 1P2KA 3SNCA 1IQFA 1T8NA 2GGVB 2Y82A 1GVZA 1DUEA 2EI8A 4JZFH 2FWWA 4DGJA 2W7SA 1D3PB 1K1LA 3TGJE 2BOHB 2JKHA 1IQJA 5K0HA 2HNTE 4THNH 1PJPA 3UFAA 1GHZA 1XUHA 1HRTH 1HDTH 1Y3WA 2NWNA 5GCHF 3VXFH 4Y6DA 2BDBA 2ZU3A 2GCHG 3MNSA 3GCNA 3EYDA 2F91A 1GHAF 5A8YA 3PO1C 3HK3B 1MAYA 1W14U 2XW9A 4Y71A 3RXBA 1SGNE 1V2LT 2XBXA 3GCHC 3VB4A 4FUHA 3KQBA 1UVUH 4CR5A 1P10A 1TMBH 4I8LA 1KYNA 2ZFFH 4E7NA 1QTFA 1E34B 3STIA 4U2WA 1MZDA 4B74A 4RKJB 4OS5A 1XVOA 4I8JA 3RLWH 2VGCB 1FAXA 1SC8U 3H5CB 4ABBA 1E35B 1HUTH 1C5OH 2STBE 1BITA 4FUDA 1K28D 3MH6A 5E0GA 3JZ2B 2BTCE 4O97A 2FS9A 4A1TA 4CREA 1GJ4H 4NCYA 2BXUH 4YZUA 1P06A 3MMGA 1YC0A 1VCPA 1O2SA 5EQRA 1P05A 1Z6EA 1IHTH 4CR9A 2BHGA 3SV8A 1L1NA 1S0QA 5EXMA 2SGPE 2ZEBA 1A0LA 2QIQA 1D9IA 1HPGA 2GDDA 1HAYB 1GL1A 1Y3VA 2OBQA 1TONA 3QTVH 3O8CA 4FUFA 2C8WB 1OOKB 1EUFA 1P3EA 2ANMH 1NU9A 2ZU2A 1GGDB 1HIAA 5EXLA 1C2MA 1Z8RA 3F9EA 3SGBE 4ZUHA 1MCVA 1O2XA 1KXEA 1S85A 1ZHRA 2A2QH 2Z6BD 1V2UT 1WCZA 4H6TA 2ANYA 3M5NA 1UTJA 1LDTT 2K1QA 1HAIH 3A7WA 2WYJA 1XUIA 1QFKH 3NPSA 2XBYA 1P2MA 3KIDU 3VB7A 1ZMJA 1ANDA 2VWOA 2A7HA 2YOLA 4JYTA 1KTSB 2P95A 4HGCA 1X7AC 3DFJA 1AWFH 1SGQE 1BMLA 1VZQH 1NRSH 2TRMA 1DDJA 1ORFA 4A92A 1NFYA 4Y0YE 4B73A 2R0KA 1GJDB 4AYVB 1GVKB 1G9IE 3QZRA 1UVOA 1Y8TA 1NRPH 1SLUB 1EOLA 3RXPA 1YPMH 6ESTA 4ZHMU 1ELCA 5HMAA 2Z9GA 2Y6TA 3URDA 1MQ6A 5DP5A 3OY5U 1MTNB 2ZZUH 1H9IE 1QBNA 2J9NA 1SLXB 1ZGVA 1EXFA 3ZV8A 3RDZA 4H4FA 2D1JA 2CHAB 2WUBA 3M61U 1YPLH 3SZNA 4NZQA 2P3FH 2ZF0H 1GI4A 1O36A 1Y5BT 2OC7A 1PPFE 3VGCB 1SI5H 3E91A 3QUMP 3TJVA 1NO9H 4FUCA 1D6WA 2AERH 2QF0A 1EOJA 3DA9B 1CGIE 3DUXH 2B9LA 1WUNH 2O8LA 2ZIQH 1OP0A 2R2WU 3RUOA 4O3TA 2Z3DA 4Q2KA 1NRRH 3W94A 1EZSC 5DP3A 1GHBG 1C5RA 1UTOA 1O31A 1UTNA 1DLEA 2BDHA 2SNVA 3AAVA 4X2XA 1C1QA 2ZTXA 4MNYA 1HAGE 3RXRA 2H2ZA 3GICB 5EW2H 1RTLA 4IS5A 5DP9A 3FFGA 4JK5A 4FUGA 2Y80A 1TWXB 1UK3A 5L6NH 4RSPA 4AG1A 4NGAH 3ATWA 1D6RA 3B9FH 1P01A 1XMNB 1GG6C 2QN5T 2SNWA 1GMCG 2WPKS 3EA8A 1EZXC 2CHAC 3UUZA 1VJAU 5F8ZA 1O2MA 1O5GH 2ZCLP 3OU0A 3NKKA 4ZMAH 3RU4D 3RXUA 4OS4A 5E8EH 4XDEA 3AAUA 1FN8A 2W3IA 2RA3A 3MYWA 4ISHH 2FX6A 1VCWA 2QV1A 2ZHEH 4CBNA 3K2UA 3MI4A 1BMNH 4ZKOU 4INLA 5TJXA 1CT2E 2W5EA 2ZCKP 2Y7XA 1DFPA 1MMJN 1JWTA 2ZGXH 2WPLS 3GDSA 2NU2E 1LPKB 2TGAA 1IQNA 4U32A 4I8GA 2OP9A 2JH0D 4INHA 1F7ZA 1GMHG 1QRZA 1QCPA 4DCDA 2WV5A 3GY8A 1MUEB 1AI8H 5FX5A 4NFEA 4MPVA 4Q7XA 1L1JA 3LGIA 1AB9B 2GZ7A 1RS0A 1CA8B 5AHGH 4NFFA 1ELFA 2ZC9H 1QQ4A 4Y7AA 2TIOA 5HYOA 1YCPM 1HAOH 1FLEE 2OXSA 1TBQH 3SJKA 3MNXA 1CE5A 1A0HB 3QTOH 2B0FA 2FLRH 1HAVA 2FTLE 3SU0A 3BTWE 1UK4A 1P11E 2P94A 1TAWA 1P8VC 3IWMA 3BTFE 1JMOH 2J38A 1W3CA 4B75A 4IW4E 1VITG 1AFEH 1HB0B 3E0PB 1HV7A 3LGVA 2HPQH 1VGCC 4BAQB 2HGTH 1IQIA 3M35A 1BRCE 4WMDA 1O5CB 1AY6H 4TPIZ 1A61H 5L2YH 3EAJA 5EG4A 2DUCA 3KCGH 5CE1A 7ESTE 5HXFA 1AUTC 2AGIX 1PPEE 3BG4B 1G37A 4NIWA 3SOSA 1BJUA 3RC6A 3P8GA 4AFSA 1O3LA 5T6FA 2O8MA 1HBTH 1O2WA 2OQ5A 3DD2H 4LZ1H 1CU1A 2PSXA 1KLIH 2A5AA 1QB6A 1U6QA 4MPWA 1CSOE 4Y76A 2J92A 4U30A 1EJNA 1GBDA 1ZJKA 4BTUB 2VIWA 3FAOA 5DP7A 3CS0A 2BY8X 1O3AA 3DFLA 1MD8A 3EE0B 4PROA 3ZVAA 1KXBA 1O5DH 1UTPA 4GLYA 3H7OA 1V2JT 3RLYH 2FMJA 1ANBA 1G3DA 1S5SA 1WOFA 5HGGA 4ABEA 2BD3A 1E36B 2SGFE 4FUBA 2C90B 2GCHF 2HVXA 1Y3XA 2GVFA 1W0ZU 1K1NA 1CBWB 3A87A 3Q3XA 4FXGH 1NZQH 3GY6A 3MU1A 1LVMA 8GCHG 1OPHB 1PQ7A 1BTXA 1O3EA 3GY7A 3SNAA 1KIGH 3D65E 3SNBA 4YM9A 2AMPA 2CXVA 4E7RG 1ZSJA 1GCTB 3K6YA 3T62A 2PLXA 1DLKB 1L0ZA 1BOQA 2ALVA 1IHSH 1OP8A 4Y10E 1AUJA 1Z8GA 3OY6U 2A32A 3FVFB 2WINI 4D7FA 4FU9A 2VINA 1ANEA 4K1SA 2AEIH 5I25A 3Q3YA 1K21H 1XVMA 1G30B 3SO3A 2FXRA 3S9CA 3KL6A 1J9CH 4IGDA 1BTPA 1UMAH 3ZZ9A 4JZIA 1Q2WA 4VGCC 4ISLA 3GDVA 4A5TS 5C2ZA 2BYAX 3BIUH 2ZTYA 5DPAA 1DS2E 1FNIA 4AX9H 1SOZA 1PPGE 1C1TA 7LPRA 4YOJA 1IOEA 4AFZA 4CRCA 1EAXA 4NA8A 4YLQH 3SUFA 1QJ1B 1S6HA 1V2RT 3U98H 1K9OE 1GI8B 3NCLA 4YESB 2P8OB 1C4U2 2HNTF 1Q3XA 4A1VA 1TALA 3A7VA 4ABFA 1DX5M 1QL8A 1P04A 2GMTC 1MKWH 4NG9H 4D8NA 4X2WA 3RMLH 4WXIA 1THPB 2GCTC 1C2LA 1C2KA 2AIPA 3PTBA 1FY5A 4DIHH 3VB5A 2F9OA 3RXQA 1EB2A 1HJAC 3ZV9A 1C2IA 5FX6A 2ULLA 3S69A 1NRNH 4FU7A 4MPUA 3ZZ8A 3F6UH 3TITA 3RC5A 1EP5A 5FBIA 2PKAB 1PPBH 2BDIA 2BVRH 3RXHA 5EW1H 1A7SA 4SGBE 1G3EA 4JYUH 2BD8A 2ZDLA 1V2OT 1LHCH 1MTWA 2C8ZB 2PKSB 3G01A 3SUEA 1O2VA 1DWCH 1P9SA 1QIXB 5C5NA 1GBTA 3UQOA 1OS8A 1FUJA 3GY4A 3L3TA 1S83A 3TJUA 1YCPH 4Y11E 4JCNA 3BTHE 4FU8A 1T8OA 2WPIS 1Q31A 2BDGA 3PMAB 1ZMLA 2AYWA 3SN8A 4B2CA 2BY5X 1BMAA 3HPTB 4XOJA 1AZ8A 4AOQA 1TX8A 3SU4A 1SGFG 1A2CH 5HM2A 3GOVB 3B23B 3M3SA 1TQ0B 3ZVEA 3LGUA 3ZZ5A 2PGBB 3MU5A 1CT0E 1G36A 1KSNA 3O8RA 2P93A 1FY4A 1SFIA 2QYIA 5GDSH 1XKAC 3LDXH 3PMJA 5FCKA 1N1LA 1O37A 1CA0B 1GL0E 1GI6A 1SBWA 1BTWA 3ZVBA 4AB9A 1OYQA 4K1EA 1ZSKA 1SQAA 2CF8H 3TVJB 3SU6A 1MU8B 2HLCA 1GHBF 3RXTA 1CGHA 1GHYH 1LCYA 1N6YA 2QXHA 3LH3A 4AG2A 5GPIB 1BT7A 3N7OA 1H9LB 2AMDA 3M5OA 1HAPH 1ZTJA 3SBKA 4KKDA 1NY22 1KY9A 2TPIZ 1W8BH 1TNIA 3A80A 4GCHG 4NA9H 4ZROA 1J16A 6CHAC 4Y79A 1RIWB 4BNRA 2G55A 2P3UB 1O38A 3MFJA 5FCRA 1TFXA 1IQLA 1W0YH 1A0JA 4ZH8A 5TCAA 2XYAA 3PO1B 4BAMB 1AD8H 1GMCF 1EPTA 3GCHB 1WQSA 2AGGX 3U1IB 3U69H 2R0LA 5HM9A 1ABJH 1Z6JH 4WH8A 3M7QA 3TGIE 3CENA 1SLVB 1V2MT 2PR3A 2P3TB 3QK1A 2H9TH 1AQ7A 2CF9H 3SUGA 3LGYA 1NC6A 2GD4B 1EZUC 2CN0H 3S7KB 5T3HA 1CT4E 3F68H 3T27A 4H6SB 2ZPRA 4D76A 3ODDA 1LVOA 4Q7YA 4DOQA 3LC3A 1ZR0A 4CHAB 1F2SE 2TGDA 1RIWC 4GHQA 3UWJH 1ZTLA 1XM1A 2WYGA 2A4RA 1WTGH 2FM2A 1GMHF 3OYPA 4X2YA 1QBVH 5ETXA 1SGRE 1K1MA 1PYTD 4YTAA 2FOAA 2BDAA 2A0QB 1TNKA 1GHVH 1GI2A 2ASUB 3GCTG 1EX3A 1Z1IA 4YOGA 1DXWA 2Z3EA 3TPIZ 1C1SA 1QJ6B 4ZKRU 3LIWA 5L30H 1ZPCA 2OD3B 2F9UA 5SGAE 1AE5A 5FAHA 2ILNA 2QC2A 1XUKA 5JBBS 4BTIB 2FOFA 5DP6A 4ABJA 4AZ2B 3RMNH 2D2DA 1JRTA 1ELAA 5CMXH 4X6OA 2H1UA 2O8UA 1JOUB 3F9HA 1C9TA 3KQCA 2G5VA 1OWDA 4CHAC 2Z7FE 4LXBH 2G5NA 1GDNA 3KQEA 1VITF 3MOCA 2VVCA 2ZGCA 2FOGA 1O2UA 2BLVA 3SU1A 3VPKA 2V3HH 2BQWB 1MH0A 4NWKA 2PTNA 4WMEA 3NUMA 2A4QA 4XBBA 4ZHAA 5A0BA 4K8BA 2Z3CA 2PHBA 4UE7H 1K1PA 3T26A 3URCA 3S7HB 3D49H 5GJ4B 2ZG0H 5L2ZH 1O2ZA 2OINA 2D8WA 2O8WA 1J17T 1UTQA 4ISIH 3ZZBA 1DSTA 3A84A 4KTSA 2XCFA 2OC8A 2A5KA 3PMHB 1EP6A 5C67A 4BXSA 1JBUH 1B0EA 1KDQA 1NESE 3PWCA 4O03A 3ZZ6A 4DVAU 3Q76A 3TIUA 1W2KH 1UHBA 5DJ7A 1UTMA 1RJXB 1S81A 4A6LA 1C1UH 4Y7BA 2D26C 4OS1A 2ZGHA 1V3XA 1MTSA 2F3CE 3SJOA 1XXFA 1ABIH 9LPRA 1DE7H 3AASA 2NU1E 1FONA 1O2NA 3Q3KA 1HAXB 2H5DA 3UY9A 1KLTA 1A5GH 2A5IA 1GI7B 1V2NT 1T8MA 2FOMB 2OC0A 5IDKA 1LO6A 1RXPA 5DKMA 2BMGB 3MWIU 7KMEH 8GCHF 8KME2 3BEUA 2Y81A 1HLTH 1DOJA 1NM6A 4UD9H 3ZZAA 1AMHA 2ZGJA 3E6PH 1C9PA 1GG6B 1FIZA 1GDQA 3U9AH 3RP2A 2F9PA 2OLGA 2UWOA 2VVVA 4MVNA 2XBWA 4YLUA 3BG8A 3VEQB 3TH4H 3SW2B 5CHAC 4X6NA 1DY8A 1GDUA 2BDCA 2CMYA 4B2BA 3M7UA 2XWAA 3T29A 2R2MB 2C4FH 1SGYE 2P16A 1MBMA 5FPYA 1A46H 1C2FA 4GAWA 1GBEA 3OTJE 4Y8XA 1THSH 1GCDA 4ESTE 2GZ8A 1F92A 1UK2A 5E2PA 3UR9A 5LPFA 1ELTA 1ELVA 3LONA 3MU8A 1C1OA 1ZHPA 2A45B 1DXPA 1YLCA 2F83A 1F0UA 1MQ5A 1TE0A 2Y5FA 3QX5H 3VB6A 4MDSA 5AF9H 1WQVH 2PSYA 4ABGA 5A0CA 1FY1A 1RTFB 2I6QA 1IQHA 3UNRA 5FPSA 1GJ5H 1P2IA 4RN6A 5AVDA 7GCHG 2V3OH 3M5LA 3MNCA 1ZPZA 2FOBA 3D62A 2IN2A 5TCCA 4MNWA 4K5ZA 4UFDH 3UOUA 1T7CA 1O2IA 2LPRA 1AFQC 1S6FA 3U1JB 3RXJA 1C5UA 1C5NH 3GISB 5DO4H 1C1VH 2ZU4A 1UJ1A 2ZNKH 3PB1E 3HKJB 4CRGA 2WV4A 3A81A 4B1TA 4IMZA 5GWZA 5GIBA 3E90B 4GPGA 3A88A 1O3FA 2BD2A 1DSUA 1INCA 1RD3B 1IQEA 4UEHH 1TPOA 1VGCB 1YP9A 3M5MA 5FXLA 4AFQA 2B8OH 3RMMH 5LGOA 2R3UA 1GMDG 2BX4A 1GBAA 2ZI2H 5C1XA 1BIOA 2FX4A 2ZA5A 3BEIB 1OKXA 1SR5C 1TRMA 4B71A 3M37A 4TPYA 3M3VA 2UUKB 3O8BA 1OP2A 1A4WH 2YNBA 1O5FH 2EC9H 2OTVA 3C1KA 1C2JA 3SHAH 3TJNA 3ZYEA 1NT1A 1XUGA 2THFB 1BMMH 1BTYA 2ZCHP 1JXPA 5IYTA 1TOCB 1ZZZA 1EJMA 1GI5A 4K60A 2R9PA 2NU3E 1JIMA 1AKSB 5F8XA 2OUAA 2WUCA 4OS6A 5FBEA 2G4UA 2STAE 2BOKA 2VU8E 1MTVA 3EDXB 4DURA 1C2HA 1EAIA 1TNJA 1TIOA 2ESTE 2Z9KA 1FI8A 1G2LA 4I32A 1FQ3A 3E8LA 1O2OA 4GCHF 4IC5A 1TGTA 2SGQE 4MLFB 2QXJA 1LMWB 1SGPE 5JBAS 2PUXB 2XWBI 2ZQ1A 4ZKNU 1UTLM 1GPZA 2Y5HA 3F9FA 2ZQ2A 1ZGIA 2FOHA 4AYYB 2ODYB 1KXDA 1BBRE 3HKIB 3BTME 2P59A 1PQ5A 1NFWA 1KXAA 3BTKE 1NRQH 4DT7B 3MU4A 2FI4E 1TABE 1QB1A 3LGTA 3SQHE 3UQVA 1UO6A 2FS8A 2HALA 4R0IA 3V13A 3MTYA 4ISNA 3SI3H 1AVWA 3LC5A 1A1RA 1A3BH 5A09A 3WY8A 3P95A 1O3HA 3GCOA 1H9HE 2UWLA 5C1YA 4DIIH 1K1OA 2RDLA 4QT8C 1FY3A 3RXGA 4FUIA 4KTUA 1LKBA 4X1PU 1V2PT 1O3GA 1FDPA 4VGCB 1UCYK 3GYLB 3NK8A 4NIVA 4WH6A 1D3DB 2XC0A 3A8DA 1QHRB 1OWIA 3PLPA 1YPEH 1AN1E 2OBOA 3RXFA 2C3SA 1F0RA 1RTKA 4ZKSU 1WYKA 3AVZA 2RCEA 3I29A 1W13U 4J1YA 3BSQA 1P12E 1P03A 3GCTF 1MAXA 1NPMA 4CRAA 1NU7B 1SSXA 1L2EA 1BRAA 1TPAE 6LPRA 2GMTB 1GBBA 3RMOH 2BD5A 3KQDA 1LKAA 1MD7A 1MBQA 4X6PA 3HK6B 1BA8B 1A3EH 2A4OA
chains in the Genus database with same CATH superfamily
2YNAA 2GCTB 5EU8A 2ANWA 1UW7A 1YPJH 3TH2H 1F5LA 1P9UA 3CP7A 1HJAB 3SZEA 4ABIA 1TA6A 2FI5E 1C5ZB 3NZIA 4KGAA 2WPJS 1D3QB 3QO6A 1CQQA 1GJBB 1ZJDA 4KP0A 4YOIA 5F6MA 3FANA 3SGQE 2QAAA 2QF3A 1ANCA 3LJJA 2JETC 1C2GA 2G4TA 4OS2A 5EPNA 1SGCA 1QL9A 1B7XB 2VWNA 3Q00A 1TPPA 2BVSH 2KM0A 2WSSD 1FMGA 5EJLA 3GY3A 5EOKA 1QB9A 1SGDE 5C5OA 5DP4A 1H1BA 5JB8S 3SV7A 2TGPZ 5EQQA 4Y0ZE 2BM2A 4WJG2 3A8BA 4K2YA 1NFXA 1S84A 2QY0B 1TNHA 1O30A 1QJ7B 1ELBA 3BN9A 2YMSB 4YT7H 2JH6D 1MZAA 1VITH 1YPHC 3GDUA 1P2NA 1YYY1 4UFFH 2ZFTA 2F9BH 1QQUA 5G4BA 1PPCE 1CHOG 1XUFA 1EPTC 2J34A 2VIQA 1O3MA 1WBGB 3MHWU 2Y7ZA 2KAIB 5AFZH 2Q6GA 1YLDA 5EXNA 4Z0KA 1K22H 3B8JA 1OX1A 1TBRH 2A2XH 3M7TA 2BLOA 1ARCA 1YF4A 2TGTA 3ZZ4A 1XUJA 4D7GA 1C1MA 1SL3A 3SU2A 3PYHA 3RU4T 1V2ST 4UFGH 1GBCA 2KCYA 1HJ9A 2HWLB 1GBMA 1YPKH 1EQ9A 2Q6FA 1L1GA 4WXVA 3WWFA 3RM0H 1T8LA 1ZYOA 4HI3A 1BTHH 1GJCB 1XXDA 1ESTA 1G32B 4DJZB 4B76A 2Z94A 5AFYH 3SGAE 4ZAEA 5HIYA 3IG6B 5H4IB 3BEFB 1NS3A 4TY7A 1PYTC 2A7CA 1QA0A 2BXTH 1BTZA 1AE8H 2AMQA 4AB8A 6CHAB 2EA3A 3FP6E 4ASHA 1SGIB 4CRBA 3OE7D 4NSYA 1W0KD 4ABHA 3RU4E 3I77A 2CV3A 1SVPA 1PPZA 1XX9A 3SV6A 1TB6H 5GXPA 3RXAA 3KNXA 2JJ1D 1ACBE 1TOMH 1SGEE 4BANB 2H9EH 8LPRA 2ZDNA 4E06H 3F0PA 5EODA 1HIAB 5E2OA 5A0AE 4OGYA 2C8YB 1MU6B 1C5YB 4AFUA 4OM9A 3L33A 1DUAA 4YO9A 3BIVH 4XSKU 1E0FD 2OQUA 2VWLA 3UTUH 3UNSA 1O5AB 3ZZDA 1ETTH 2QXIA 1HYLA 3VXEH 3UIRA 1C4V2 3MO6A 1IQGA 4XD7D 1HXEH 3KF2A 4A1XA 4NIYA 1C1RA 5F8TA 1K1IA 1O5EH 3U8RH 2WHXA 1A5HA 2J5UA 5DGJA 1F0SA 3QGJA 3BTTE 1BJVA 2FI3E 3V7TA 1FV9A 1F0TA 1AGJA 4FUEA 2F9NA 3RXCA 7GCHF 3U8TH 2BY9X 2JIZD 4NIXA 1CHGA 1K2I1 3TU7H 3ZVFA 3PLKA 3A83A 3EQ0H 4B2AA 1AVGH 1UVTH 1Y59T 1Y5AT 2QXGA 5EQSA 1C1NA 4K8YA 4NSVA 2XNIA 4P02A 1GJ6A 4WWYA 1C5XB 2XBVA 1JIRA 3A7ZA 1KXFA 5A8XA 1PQ8A 1FY8E 1GVLA 1OWJA 4ZXXH 1BRBE 1BBRK 3ATKA 2G81E 5J4SA 3BTDE 1C5TA 2FZZA 3FO8D 1GBLA 3M36A 5C0UA 3HGPA 1V2TT 2WV9A 2GDEH 1RRKA 1QY6A 1GMDF 3ZVGA 2H5CA 3BTQE 3L6PA 3UWIA 1LVYA 4UFEH 1N8OC 1BDAA 1G3CA 5J4QA 1VR1H 1M9UA 3EGKH 4D9RA 2QA9E 3NWUA 1PFXC 1EB1H 4P00A 2ANKH 4GSOA 1B0FA 1LVBA 1MABB 1AIXH 4M9FA 1GJAB 3KEEA 2XCNA 2BD4A 1LHDH 4IC6A 1BUIA 2BZAA 2F9VA 4LZ4B 2KAIA 3ZZ7A 1FXYA 5ESBA 4ABDA 2FYRA 1P57B 2V6NA 1RGQA 1W7GH 2VBCA 1HAHH 4X6MA 4AGKA 2AGEX 2PKAA 4IN1A 1FJSA 1Z8IB 2OC1A 1WV7H 1O3KA 5F53A 2GT8A 2FP7B 2J2UA 1DPOA 1O3DA 3SJIA 4HTCH 3P8OA 2G8TA 1YM0A 3TJOA 3S0NA 1O2KA 3A82A 1L4ZA 2JH5D 1IQKA 3TGKE 3WWBA 1C5SA 3A85A 3NXPA 5JBCS 3ZYDA 1NTPA 1GJ7B 2VVUA 1T32A 3MNBA 4GUXA 1O0DH 1DWBH 2G51A 2ZDAH 2GKVE 3RXVA 3UOPA 2NU4E 2BZ6H 4JMYA 1O2HA 4JZ1A 2FEQH 3EA7A 5E0JA 6GCHG 1YKTA 2SGEE 1UCYE 2BY7X 2GT7A 3PTNA 4FOUC 2PTCE 2ODPA 1O2GH 4K1TA 1J8AA 1ELGA 1QL7A 3UR6A 4JK6A 1C5MD 1D3TB 1IAUA 1GHWH 3UPEA 1EJAA 2KX4A 5FHTA 1HCGA 1TYNA 2VGCC 1O33A 1B5GH 2AFQB 5CHAB 4F4OC 2AIQA 1SG8B 3FZZA 4H42U 1ZHMA 3SNDA 5F03A 4XBDA 2ZGBH 4D9QA 2H6MA 3R3GB 4XRNA 1EKBB 1LHFH 4I31A 2XTTB 1HAVB 4I33A 3A7TA 1SHHB 2WPMS 5ABWA 3RXLA 3E1XB 3F1SB 1ZLRA 3E0NB 3I78A 1YGCH 1GBHA 1XKBC 3MH5A 1QR3E 2V0BA 3TLOA 1CO7E 2FLBH 3O8DA 4ABAA 4AN7A 1K1JA 1FN6A 3ATIA 4BAHB 3T25A 3A7XA 4WMFA 4OS7A 1OSSA 1AHTH 1F5RA 1BZXE 4DY7B 3DSOA 4JYVH 1G2MA 4MPXA 2EI6A 3A7YA 4X1QU 1O2JA 2O8TA 3FP7E 1DVAH 2EEKA 4NA7A 1SGFA 1WU1A 1GGDC 1O2PA 1P2QA 4X1RU 1BHXB 3K6ZA 1O39A 2VH0A 1SQRA 1GJ8B 1OXGA 2VB0A 4JZDH 1AFQB 2A7JA 1DT2A 1P2OA 1ZTKA 2VJ1A 1TPSA 1ZOMA 4Q4LA 1TGBA 2NU0E 3IITA 1LQDB 1LHEH 2FTMA 2FIRH 1TRYA 3GY5A 8ESTE 5DG6A 1GBJA 3VB3A 4YT6H 1SFQB 1QGFA 3F9GA 2ZP0H 1GBFA 1O2YA 2A31A 3BTGE 5BRRE 1G3BA 2ZKSA 1ETRH 4TWYA 2R3YA 1C4Y2 3PWBA 2HLDD 1Z8JB 4A7IB 4XBCA 1P0SH 5C17A 2OCVB 3RXSA 4SGAE 2HNTC 4Q80A 1DICA 3OSYA 3P70B 4Q7ZA 2FESH 1HJ8A 1SOTA 2VIDA 2XC5A 1SMFE 1CHOF 2BLQA 1MTNC 2ZHWH 3P17H 1THRH 1HAZB 3FN8A 4K69A 1O5BB 1HGTH 4NWLA 2LP6A 3MU0A 4IN2A 2PWXA 2LNCA 4X2VA 1TRNA 2GV6A 4FVDA 1AWHB 3STJA 2EI7A 4FUJA 3QWCH 5DP8A 1HFDA 5IK2D 2W7UA 1V6DA 4CRFA 1GBKA 1O3CA 1GWAA 2ZECA 3GYMA 4X8TH 3UNQA 4BAKB 3VGCC 4RKOB 1MTUA 2GJGA 1QBOA 2ZU5A 4MNXA 2ZHQH 3VG8A 4BXWA 2GV7A 3OX7U 2Y5GA 3GY2A 1TQ7B 2ZFRH 1BQYA 1P02A 3SJ8A 3P92A 1KTTB 1SGTA 1ETSH 1S0RA 1NFUA 1O2LA 2QCYA 4BTTB 5A2MH 1UVPA 1YPHE 3MO3A 3KGPA 4O3UA 4WY3A 2BB4A 2I6SA 5JB9S 1V2QT 2BVXH 4O9VA 3QDZB 1C2DA 4BAOB 2FPZA 5GCHG 1GI3A 4JZEH 1TX7A 3LGWA 1QRXA 1RFNA 1ZMNA 2ZFSA 2ZHFH 2J4IA 1BTUA 1Z1JA 4UONA 1E1RD 2B7DH 3ELAH 2EY4C 1GHAG 1ESBA 3LOXA 4Y8ZA 1ELEE 2C8XB 1ZSLA 2UWPA 1O32A 4X8VH 1QNJA 3BV9B 1UTKA 1N6XA 1YLNA 2BDYA 2RG3A 1LTOA 5C3NA 1SHYA 4K3JA 1J14A 2VH6A 3PV4A 3ZVDA 4ISOA 5PTPA 3MO9A 4WF8A 3QZQA 5JBTA 3ENSB 2PW8H 3F2FA 2Q1JA 3LT3A 3QLPH 4UDWH 2XXLA 4ZHLU 1O3JA 5DK1A 3SU3A 3D23A 2M5TA 2ZO3H 3TNSA 3ZVCA 4TWWA 4X1NU 3TH3H 5LPRA 3SNEA 2Z9LA 1O2RA 1TGNA 1C5WB 2J95A 3BTEE 1MKXH 3E3TA 4IMQA 1L4DA 1UCYH 2CGAA 2ZWLH 3RXKA 2VIOA 3F3BA 1O2QA 3RXIA 3A8CA 4LOYH 1C5LH 1FAKH 1BRUP 2FODA 3KHVA 1TBZH 1Z7KA 1EASA 3K9XB 1YPGH 3QN7A 2LELA 4IBLH 3DT0H 1CGJE 3KN2A 4I8KA 1AB9C 3TNTA 2ZDMA 1DWDH 4AC9A 3H7TA 1EAWA 3T28A 4DW2U 4WVPE 1SQOA 3DSPA 4MQAA 5DSFA 3MH4A 3E16B 2IPHA 1H8DH 1AO5A 2QGRA 1MKXK 1WDIA 3SQEE 4X8SH 2V35A 1WXRA 2HRVA 4CRDA 1O3OA 4F48B 2J98B 2JETB 4FVBA 1Y3UA 3LKWA 3S9AA 1GBIA 4XFQA 1VJ9U 2BD7A 3M3TA 1HNEE 1C1WH 1VCQA 3V0XA 2TBSA 2VWMA 1C1PA 1Y3YA 3N99A 1C5PA 2V7QD 3SUDA 1LHGH 2PUQH 9ESTA 1OWEA 1FPCH 1AU8A 1SB1H 1ZRBA 3BG4C 2G52A 1QA7A 2IJD1 1O3IA 1OWKA 1TA2A 3TK6A 3A8AA 2ZFPH 1DY9A 3RXMA 2F4LA 1TMUH 2C93B 4I8HA 2G00A 1NN6A 4RT1A 3W95A 1EPTB 1H8ED 3QGNB 2XC4A 1AVXA 1D4PB 1S6LA 1GHXH 3T5FH 5I46H 3PV5A 3RC4A 1FIWA 2BD9A 3V12A 3RXEA 3ESTA 1E38B 1O3NA 1ESAA 3ODFA 3AW1A 4AORA 1EATA 2UUYA 1KLJH 2ZU1A 2VIPA 2KFWA 1LQEA 1ARBA 4U01A 4F49A 1MCTA 1DM4B 1W11U 3DHKH 1UVSH 1C5QA 2FOCA 1QURH 3SI4H 1T31A 3K65B 3FP8E 2PFEA 5JPMH 4LK4A 2PGQB 4I7YH 2OK5A 3SJ9A 5EPYA 2ZDVH 1DWEH 4MG3A 3ZZ3A 1GI1A 3PMBB 1J15A 1PPHE 3HGNA 1LPZB 1ID5H 2FO9A 1SPJA 1P2JA 2ALPA 4BOHA 3JZ1B 1CBWC 1SLWB 2O9QA 2WPDD 1HXFH 5C20A 2J94A 3T2NA 3HATH 1S82A 1EAUA 4R8TB 4ZCNA 1T4VH 2IOTA 1PQAA 5B6OA 2KR7A 6GCHF 1TGSZ 1V2VT 1BHXF 1NBME 1W10U 1GCTC 3KQ5A 1KMHB 1ZPBA 1ZRKA 5LH8A 3SORA 2VNTA 2AH4X 3LH1A 1TNLA 1P3CA 3ATMA 4AGJA 2K8IA 3MH7A 4XE4A 3CS7A 3OEED 3OTPA 1GI0A 1AKSA 2DE9A 2GZ9A 1TLDA 2SGDE 2Q6DA 5EGMA 3C27B 2XRCA 1E37B 4KTCA 2UUFB 2CK3D 1OHHD 1BB0B 2FOEA 3A86A 1C5VA 2HPPH 1ELDE 2Z9IA 4CH8B 3Q77A 1NROH 1Y5UT 2WPHS 2H9HA 1DANH 2GP9B 3P8NA 2HOBA 1MKWK 1P09A 1DITH 1O35A 2P8OC 2SGAA 1W12U 3SHCH 4B6FA 1JRSA 2ZTZA 1H4WA 4HZHA 1T4UH 1GI9B 1QRWA 4X1SU 1O3PB 2CJIA 3PRDA 3SV2H 3LJOA 3BF6H 2K0QA 3RXOA 1C2EA 1O3BA 2BY6X 2ZPSA 3SU5A 3VFEA 2A1DB 2AS9A 4E05H 1FPHH 1V2KT 2IJOB 3KYGA 3RM2H 1O2TA 3P8FA 5A8ZA 2VIVA 1CVWH 2WZQA 2ZDKA 1H8IH 3A89A 3SV9A 1O34A 4OGXA 3S9BA 1KDQB 3FZDA 2ZHDA 3UREA 2BQ7B 5T6GA 2Z9JA 1TNGA 1UHBB 3OEHD 2ODQA 2PV9B 3U8OH 1WAYB 3PROA 2RA0A 2PKSC 3OFND 1TMTH 2W26A 3PLBA 5LPEA 5FPTA 3V3MA 3LU9B 2UUJB 2BQ6B 1YCPK 1BBRH 3TK5A 2ZPQA 1A5IA 4Z6AH 4DG4A 5BPEA 1WSSH 1IQMA 1N8OB 2SFAA 1OYTH 4Y8YA 1AZZA 5JYIA 3TK9A 4X8UH 1F5KU 4X0WU 4GHTA 1SQTA 4NZLA 3RXDA 2BLWA 1LPGB 2FDAA 1YBWA 2GTBA 3AW0A 1TGCA 4M7GA 2FYQA 5C1UA 2B5TB 5T6DA 1TX6A 1EZQA 1W7XH 1V2WT 1FZZA 3P6ZB 4HFPB 4TY6A 4TYDA 4INKA 3LPRA 1Z71A 3ZZCA 5K7RA 1KXCA 2A4GA 1OWHA 4MTBA 3ATLA 4ZXYH 3R0FA 2GX4A 5ESTE 4CH2B 5E0HA 2W3KA 2ZFQH 4GVUA 1CA0C 4CBOA 1WTHD 4KELA 3EA9A 2BX3A 2DE8A 1GJ9B 4J2YB 3ITIA 3PM3A 5JDUB 1BCUH 4MNVA 2QF4A 1P2KA 1QZ8A 3SNCA 1IQFA 1T8NA 2GGVB 2Y82A 1GVZA 1DUEA 2EI8A 4F55A 4JZFH 2FWWA 4DGJA 2W7SA 1D3PB 1K1LA 3TGJE 2BOHB 2JKHA 1IQJA 5EJZA 5K0HA 2HNTE 4THNH 1PJPA 3UFAA 1GHZA 1XUHA 1HRTH 1HDTH 1Y3WA 2NWNA 5GCHF 3VXFH 4Y6DA 2BDBA 2ZU3A 2GCHG 3MNSA 3GCNA 3EYDA 2YMSD 2F91A 1GHAF 5A8YA 3PO1C 3HK3B 1MAYA 1W14U 2XW9A 4Y71A 3RXBA 1SGNE 1V2LT 2XBXA 3GCHC 3VB4A 4FUHA 3KQBA 1UVUH 4CR5A 1P10A 1TMBH 4I8LA 1KYNA 2ZFFH 4E7NA 1QTFA 1E34B 3STIA 4U2WA 1MZDA 4B74A 4RKJB 4OS5A 5KGOA 1XVOA 3KYFA 4I8JA 3RLWH 2VGCB 1FAXA 1SC8U 3H5CB 4ABBA 1E35B 1HUTH 1C5OH 2STBE 1BITA 2JJ2D 4FUDA 1K28D 3MH6A 2W6JD 5E0GA 3JZ2B 2BTCE 4O97A 2FS9A 4A1TA 4CREA 1GJ4H 4NCYA 2BXUH 4YZUA 1P06A 3MMGA 1YC0A 1VCPA 1O2SA 5EQRA 1P05A 1Z6EA 1IHTH 4CR9A 2BHGA 3SV8A 1L1NA 1S0QA 5EXMA 2SGPE 2W6ID 2ZEBA 1A0LA 2QIQA 1D9IA 1HPGA 2GDDA 1HAYB 1GL1A 1Y3VA 2OBQA 1TONA 3QTVH 3O8CA 4FUFA 2C8WB 1OOKB 1EUFA 1P3EA 2ANMH 1NU9A 2ZU2A 1GGDB 1HIAA 5EXLA 1C2MA 1Z8RA 3F9EA 3SGBE 4ZUHA 1MCVA 1O2XA 1KXEA 1S85A 1ZHRA 2EQNA 2A2QH 2Z6BD 1V2UT 1WCZA 4H6TA 2ANYA 3M5NA 1UTJA 1LDTT 2K1QA 1HAIH 3A7WA 2WYJA 1XUIA 1QFKH 3NPSA 2XBYA 1P2MA 3KIDU 3VB7A 5CHBA 1ZMJA 1ANDA 2VWOA 2A7HA 4DT4A 2YOLA 4JYTA 1KTSB 2P95A 4HGCA 1X7AC 3DFJA 1AWFH 1SGQE 1BMLA 1VZQH 1NRSH 2TRMA 1DDJA 1ORFA 4A92A 1NFYA 4Y0YE 4B73A 2R0KA 1GJDB 4AYVB 1GVKB 1G9IE 3QZRA 1UVOA 1Y8TA 1NRPH 1SLUB 1EOLA 3RXPA 1YPMH 6ESTA 4ZHMU 1ELCA 5HMAA 2Z9GA 2Y6TA 3URDA 1MQ6A 5DP5A 3OY5U 1MTNB 4B6EA 2ZZUH 1H9IE 2XOKD 1QBNA 2J9NA 1SLXB 1ZGVA 2L74A 1EXFA 3ZV8A 3RDZA 4H4FA 2D1JA 2CHAB 2WUBA 3M61U 1YPLH 3SZNA 4NZQA 2P3FH 2ZF0H 1GI4A 1O36A 1Y5BT 2OC7A 1PPFE 3VGCB 1SI5H 3CNRA 3E91A 3QUMP 3TJVA 1NBMD 1NO9H 4FUCA 1D6WA 2AERH 3ZIAD 2QF0A 1EOJA 3DA9B 1CGIE 1FX0B 3DUXH 2B9LA 1WUNH 2O8LA 2ZIQH 1OP0A 2R2WU 3RUOA 4O3TA 2Z3DA 4Q2KA 1NRRH 3W94A 1EZSC 5DP3A 1GHBG 1C5RA 1UTOA 1O31A 1UTNA 1DLEA 2BDHA 2SNVA 3AAVA 4X2XA 1C1QA 2ZTXA 4MNYA 1HAGE 3RXRA 2H2ZA 3GICB 5EW2H 4ACBA 1RTLA 4IS5A 5DP9A 3FFGA 4JK5A 4FUGA 2Y80A 3F0OA 1TWXB 1UK3A 5L6NH 4RSPA 4AG1A 4NGAH 3ATWA 1D6RA 3B9FH 1P01A 1XMNB 1GG6C 4ACAA 2QN5T 2SNWA 1GMCG 2WPKS 3EA8A 3N7DA 1EZXC 2CHAC 3UUZA 1VJAU 5F8ZA 1O2MA 1O5GH 2ZCLP 3OU0A 3NKKA 4ZMAH 2JDID 3RU4D 3RXUA 4OS4A 5E8EH 4XDEA 3AAUA 1FN8A 2W3IA 2RA3A 3MYWA 4ISHH 2FX6A 1VCWA 2QV1A 2ZHEH 4CBNA 3K2UA 3MI4A 1BMNH 4ZKOU 4INLA 5TJXA 1CT2E 2W5EA 2ZCKP 2Y7XA 1DFPA 3AK5A 2KCPA 1MMJN 1JWTA 2ZGXH 2WPLS 3GDSA 2NU2E 1LPKB 2TGAA 1IQNA 4U32A 4I8GA 2OP9A 2JH0D 4INHA 1F7ZA 1GMHG 5B6LA 1QRZA 1QCPA 2HVYB 4DCDA 2WV5A 3GY8A 1MUEB 1AI8H 5FX5A 4NFEA 4TT3D 3F2GA 1SKYE 4MPVA 4Q7XA 1L1JA 3LGIA 3SYJA 1AB9B 2GZ7A 1RS0A 1CA8B 5AHGH 4NFFA 1ELFA 2L6OA 2ZC9H 4Q63A 1QQ4A 4Y7AA 2TIOA 5HYOA 1YCPM 1HAOH 1FLEE 1BMFD 2OXSA 1TBQH 1E79D 3SJKA 3MNXA 1CE5A 1A0HB 4YXWD 3QTOH 2B0FA 2FLRH 1HAVA 2FTLE 3SU0A 3BTWE 1UK4A 1P11E 2P94A 1TAWA 3MQKC 1P8VC 3IWMA 3BTFE 1JMOH 2J38A 1W3CA 4B75A 4IW4E 1VITG 1AFEH 1HB0B 3OAAD 3E0PB 1HV7A 3LGVA 2HPQH 1VGCC 3DCLA 4BAQB 2HGTH 1IQIA 3M35A 2XNDD 4RT0A 1BRCE 4WMDA 1O5CB 1AY6H 4TPIZ 1A61H 5L2YH 3EAJA 5EG4A 2DUCA 3KCGH 5CE1A 7ESTE 5HXFA 1AUTC 2AGIX 1PPEE 3BG4B 1G37A 4NIWA 3SOSA 1BJUA 3RC6A 3P8GA 4AFSA 1O3LA 5T6FA 2O8MA 1HBTH 1O2WA 2OQ5A 3DD2H 4LZ1H 1CU1A 2PSXA 1KLIH 2A5AA 1QB6A 1U6QA 4MPWA 1CSOE 4Y76A 2J92A 4U30A 1EJNA 1GBDA 1ZJKA 4BTUB 2VIWA 3FAOA 5DP7A 3FKSD 3CS0A 2BY8X 1O3AA 3DFLA 1MD8A 3EE0B 4PROA 3ZVAA 2AHME 1KXBA 1O5DH 1UTPA 4GLYA 2KCAA 3H7OA 1V2JT 3RLYH 2FMJA 1ANBA 1G3DA 1S5SA 1WOFA 5HGGA 4ABEA 2BD3A 1E36B 2SGFE 4FUBA 2C90B 3DSGA 2GCHF 2HVXA 1Y3XA 2GVFA 1W0ZU 1K1NA 1CBWB 3A87A 3Q3XA 4FXGH 1NZQH 3GY6A 3MU1A 1LVMA 8GCHG 1OPHB 4ASUD 1PQ7A 3W1EA 1BTXA 1O3EA 3GY7A 3SNAA 1KIGH 3D65E 3SNBA 4YM9A 2AMPA 2CXVA 4E7RG 1ZSJA 1GCTB 3K6YA 3T62A 2PLXA 1DLKB 1L0ZA 1BOQA 2ALVA 1IHSH 1OP8A 4Y10E 1AUJA 1Z8GA 3OY6U 2A32A 3FVFB 2WINI 4D7FA 4FU9A 2VINA 1ANEA 4K1SA 2AEIH 5I25A 3Q3YA 1K21H 1XVMA 1G30B 3SO3A 2FXRA 3S9CA 3KL6A 1J9CH 4IGDA 1BTPA 1UMAH 3ZZ9A 4JZIA 1Q2WA 4VGCC 4ISLA 3GDVA 4A5TS 5C2ZA 2BYAX 3BIUH 2ZTYA 5DPAA 1DS2E 1FNIA 4AX9H 1SOZA 1PPGE 1C1TA 7LPRA 4YOJA 1IOEA 4AFZA 4CRCA 1EAXA 4NA8A 4YLQH 3SUFA 1QJ1B 1S6HA 1V2RT 2PP6A 3U98H 1K9OE 1VKYA 1GI8B 3NCLA 4YESB 2P8OB 1C4U2 2HNTF 1Q3XA 4A1VA 1TALA 3A7VA 4ABFA 1DX5M 1QL8A 1P04A 2GMTC 1MKWH 4NG9H 4D8NA 4X2WA 3RMLH 4WXIA 5HIZA 1THPB 2GCTC 1C2LA 1C2KA 2AIPA 3PTBA 1FY5A 4DIHH 3VB5A 2F9OA 3RXQA 1EB2A 1HJAC 2KCOA 3ZV9A 1C2IA 5FX6A 2ULLA 3S69A 1NRNH 4FU7A 4MPUA 3ZZ8A 3F6UH 3TITA 3RC5A 1EP5A 5FBIA 2PKAB 1PPBH 2BDIA 2BVRH 3RXHA 5EW1H 1A7SA 4SGBE 1G3EA 4JYUH 2BD8A 2ZDLA 1V2OT 1LHCH 1MTWA 2C8ZB 2PKSB 3G01A 3SUEA 1O2VA 1DWCH 1P9SA 1QIXB 5C5NA 1GBTA 3UQOA 1OS8A 1FUJA 3GY4A 2YMSC 3L3TA 1S83A 3TJUA 1YCPH 4Y11E 4JCNA 3BTHE 4FU8A 1T8OA 2WPIS 1Q31A 2BDGA 3PMAB 1ZMLA 2AYWA 3SN8A 4B2CA 2BY5X 1BMAA 3HPTB 4XOJA 1AZ8A 4AOQA 1TX8A 3SU4A 1SGFG 1A2CH 1YWUA 3GOVB 3B23B 3M3SA 3NRLA 5HM2A 1TQ0B 3ZVEA 3LGUA 3ZZ5A 2PGBB 3MU5A 2M2AA 1CT0E 1G36A 1KSNA 3O8RA 2P93A 1FY4A 1SFIA 2QYIA 5GDSH 1XKAC 3LDXH 3PMJA 4RI0A 5FCKA 1N1LA 1O37A 1CA0B 1GL0E 2J98A 1GI6A 3PRBA 1SBWA 1BTWA 3ZVBA 4AB9A 1OYQA 4K1EA 5KECA 1ZSKA 1SQAA 2CF8H 3TVJB 3SU6A 1MU8B 2HLCA 1GHBF 3RXTA 1CGHA 1GHYH 1LCYA 1N6YA 2QXHA 3LH3A 4AG2A 5GPIB 1BT7A 3N7OA 1H9LB 2AMDA 3M5OA 1HAPH 1W0JD 1ZTJA 3SBKA 4KKDA 1NY22 1KY9A 2TPIZ 1W8BH 1TNIA 3A80A 3FOAA 4GCHG 4NA9H 4ZROA 1J16A 6CHAC 3UB0A 4Y79A 1RIWB 4BNRA 2G55A 2P3UB 1O38A 3MFJA 5FCRA 1H8HD 1IQLA 1TFXA 1A0JA 1W0YH 4ZH8A 5TCAA 1K0HA 2XYAA 3PO1B 4BAMB 1AD8H 1GMCF 1EPTA 3GCHB 1WQSA 2AGGX 3U1IB 3U69H 2R0LA 5HM9A 1ABJH 1Z6JH 4WH8A 3M7QA 3TGIE 3CENA 1SLVB 1V2MT 2PR3A 2P3TB 3QK1A 2H9TH 1AQ7A 2CF9H 3SUGA 3LGYA 1NC6A 2GD4B 1EZUC 2CN0H 3S7KB 5T3HA 1CT4E 3F68H 5T1VA 3T27A 4H6SB 2ZPRA 4D76A 3ODDA 1LVOA 4Q7YA 4DOQA 3LC3A 1ZR0A 4CHAB 1F2SE 2TGDA 1RIWC 4GHQA 3UWJH 1ZTLA 1XM1A 2WYGA 2A4RA 5EJ1A 1WTGH 2FM2A 1GMHF 3OYPA 4HG6A 4X2YA 1QBVH 5ETXA 1SGRE 1K1MA 1PYTD 4YTAA 2FOAA 2BDAA 1YY3A 2A0QB 1TNKA 1GHVH 1GI2A 2ASUB 3GCTG 1EX3A 1Z1IA 4YOGA 1DXWA 2QE7D 2Z3EA 3TPIZ 1C1SA 1QJ6B 4ZKRU 3LIWA 5L30H 1ZPCA 2OD3B 2F9UA 5SGAE 1AE5A 5FAHA 2ILNA 5CDFE 2QC2A 1XUKA 5JBBS 4BTIB 2FOFA 5DP6A 4ABJA 4AZ2B 3RMNH 2D2DA 1JRTA 1ELAA 5CMXH 4X6OA 2H1UA 2O8UA 1JOUB 3F9HA 1C9TA 3KQCA 2G5VA 1OWDA 4CHAC 2Z7FE 4LXBH 2G5NA 1GDNA 3KQEA 1VITF 3MOCA 2VVCA 2ZGCA 2FOGA 1O2UA 2BLVA 3SU1A 3VPKA 2V3HH 2BQWB 1MH0A 4NWKA 2PTNA 4WMEA 3NUMA 2A4QA 4XBBA 4ZHAA 5A0BA 4K8BA 2Z3CA 2PHBA 4UE7H 1K1PA 3T26A 3URCA 3S7HB 3D49H 5C94A 3N7EA 5GJ4B 2ZG0H 5L2ZH 1O2ZA 2OINA 2D8WA 2O8WA 1J17T 1UTQA 4ISIH 3ZZBA 2IPQX 1DSTA 3A84A 4KTSA 5C0TA 2XCFA 2OC8A 2A5KA 3PMHB 1EP6A 3PV2A 5C67A 2RFKC 4BXSA 1JBUH 1B0EA 1KDQA 1NESE 3PWCA 4O03A 3ZZ6A 4DVAU 3Q76A 3TIUA 1W2KH 1UHBA 4I86A 5DJ7A 1UTMA 1RJXB 2V3MA 1S81A 4A6LA 1C1UH 4Y7BA 2D26C 4OS1A 2ZGHA 1V3XA 1MTSA 2F3CE 3SJOA 1XXFA 1ABIH 9LPRA 1DE7H 5KEDA 3AASA 2NU1E 1FONA 1O2NA 2KZ4A 3Q3KA 1HAXB 2H5DA 3UY9A 1KLTA 1A5GH 2A5IA 1GI7B 1V2NT 1T8MA 2FOMB 2OC0A 5IDKA 1LO6A 1RXPA 1EFRD 5DKMA 2BMGB 3MWIU 7KMEH 8GCHF 8KME2 3BEUA 2Y81A 1HLTH 1DOJA 1NM6A 4UD9H 3ZZAA 1AMHA 2ZGJA 3E6PH 1C9PA 1GG6B 1FIZA 1GDQA 3U9AH 3RP2A 3WW7A 2F9PA 2OLGA 2UWOA 2VVVA 4MVNA 2XBWA 4YLUA 3BG8A 3VEQB 3TH4H 3SW2B 5CHAC 4X6NA 1DY8A 1GDUA 2BDCA 2CMYA 4B2BA 3M7UA 2XWAA 3T29A 2R2MB 2C4FH 3F2HA 1SGYE 2J97A 2P16A 1MBMA 5FPYA 1A46H 1C2FA 4GAWA 3GS9A 1GBEA 3U28C 3OTJE 4Y8XA 1THSH 1GCDA 4ESTE 2GZ8A 1F92A 1UK2A 5E2PA 2F43B 3UR9A 5LPFA 1ELTA 1ELVA 3LONA 3MU8A 1C1OA 1ZHPA 5GNDA 2A45B 1DXPA 1YLCA 2F83A 1F0UA 1MQ5A 1TE0A 2RDEA 2Y5FA 3QX5H 4MDSA 3VB6A 5AF9H 1WQVH 2PSYA 1E1QD 4ABGA 5A0CA 1FY1A 1RTFB 2QF5A 2I6QA 1IQHA 3UNRA 5FPSA 1GJ5H 1P2IA 4FETA 4RN6A 5AVDA 7GCHG 2V3OH 3M5LA 3MNCA 1ZPZA 2FOBA 3D62A 2IN2A 5TCCA 4MNWA 4K5ZA 4UFDH 3UOUA 1T7CA 5DN6D 5HKKD 1O2IA 2LPRA 1AFQC 1S6FA 3U1JB 3RXJA 1C5UA 1C5NH 3GISB 4Z1MD 5DO4H 4TSFD 1C1VH 2ZU4A 1UJ1A 2ZNKH 3PB1E 3HKJB 4CRGA 2WV4A 3A81A 4B1TA 4IMZA 5GWZA 5GIBA 3E90B 4GPGA 3A88A 1O3FA 2BD2A 1DSUA 1INCA 1RD3B 1IQEA 4UEHH 1TPOA 1VGCB 1YP9A 3M5MA 5FXLA 4AFQA 2B8OH 3RMMH 5LGOA 2R3UA 1GMDG 2BX4A 1GBAA 2ZI2H 5C1XA 1BIOA 2FX4A 2ZA5A 3BEIB 1OKXA 1SR5C 1TRMA 4B71A 3M37A 4TPYA 3M3VA 2UUKB 5FL7D 3O8BA 1OP2A 1A4WH 2YNBA 5EIYA 1O5FH 2EC9H 3UAIC 2OTVA 3C1KA 1C2JA 3SHAH 3TJNA 3ZYEA 1NT1A 1XUGA 2THFB 1BMMH 1BTYA 2ZCHP 1JXPA 5IYTA 1TOCB 1ZZZA 1EJMA 1GI5A 4K60A 2R9PA 2NU3E 1JIMA 1AKSB 5F8XA 2OUAA 2WUCA 4OS6A 5FBEA 2G4UA 2STAE 2BOKA 2VU8E 1MTVA 3EDXB 4DURA 1C2HA 1EAIA 1TNJA 1TIOA 2ESTE 2Z9KA 1FI8A 1G2LA 4I32A 1FQ3A 3E8LA 1O2OA 4GCHF 4IC5A 1TGTA 2SGQE 4MLFB 2QXJA 1LMWB 1SGPE 5JBAS 2PUXB 2XWBI 2ZQ1A 4ZKNU 1UTLM 1GPZA 3H09A 2Y5HA 3F9FA 2ZQ2A 1ZGIA 2FOHA 4AYYB 2ODYB 1KXDA 1BBRE 3HKIB 3BTME 2P59A 1PQ5A 1NFWA 1KXAA 3BTKE 1NRQH 4DT7B 3MU4A 2FI4E 1TABE 1QB1A 3LGTA 3SQHE 3UQVA 1UO6A 2FS8A 2HALA 4R0IA 3V13A 3MTYA 4ISNA 3SI3H 1AVWA 3LC5A 1A1RA 1A3BH 5A09A 3WY8A 3P95A 1O3HA 3GCOA 1H9HE 2UWLA 5C1YA 4DIIH 1K1OA 2RDLA 4QT8C 1FY3A 3RXGA 4FUIA 4KTUA 1LKBA 4X1PU 1V2PT 1O3GA 1FDPA 4VGCB 1UCYK 3GYLB 3NK8A 4NIVA 4WH6A 1COWD 1D3DB 2XC0A 3A8DA 1QHRB 1OWIA 3PLPA 1YPEH 1AN1E 2OBOA 3RXFA 2C3SA 1F0RA 1RTKA 4ZKSU 1WYKA 3AVZA 2RCEA 3EE7A 3I29A 1W13U 4J1YA 3BSQA 1P12E 1P03A 3GCTF 1MAXA 1NPMA 4CRAA 1NU7B 1SSXA 1L2EA 1BRAA 1TPAE 6LPRA 2GMTB 1GBBA 3RMOH 2BD5A 3KQDA 1LKAA 1MD7A 1MBQA 4X6PA 3HK6B 1BA8B 1A3EH 2A4OA
chains in the Genus database with same CATH topology
2YNAA 2GCTB 5EU8A 2ANWA 1YPJH 3TH2H 1F5LA 1P9UA 3CP7A 1HJAB 4ABIA 1TA6A 2FI5E 1C5ZB 3NZIA 4KGAA 2WPJS 1D3QB 3QO6A 1CQQA 1GJBB 1ZJDA 4KP0A 4YOIA 5F6MA 3FANA 3SGQE 2QAAA 2QF3A 1ANCA 3LJJA 2JETC 1C2GA 2G4TA 4OS2A 5EPNA 1SGCA 1QL9A 1B7XB 2VWNA 3Q00A 1TPPA 2BVSH 1FMGA 3GY3A 5EOKA 1QB9A 1SGDE 5C5OA 5DP4A 1H1BA 5JB8S 3SV7A 2TGPZ 5EQQA 4Y0ZE 2BM2A 4WJG2 3A8BA 4K2YA 1NFXA 1S84A 2QY0B 1TNHA 1O30A 1QJ7B 1ELBA 3BN9A 4YT7H 2JH6D 1MZAA 1VITH 1YPHC 3GDUA 1P2NA 1YYY1 4UFFH 2ZFTA 2F9BH 1QQUA 5G4BA 1PPCE 1CHOG 1XUFA 1EPTC 2J34A 2VIQA 1O3MA 1WBGB 3MHWU 2Y7ZA 2KAIB 5AFZH 2Q6GA 1YLDA 5EXNA 4Z0KA 1K22H 3B8JA 1OX1A 1TBRH 2A2XH 3M7TA 2BLOA 1ARCA 1YF4A 2TGTA 3ZZ4A 1XUJA 4D7GA 1C1MA 1SL3A 3SU2A 3PYHA 3RU4T 1V2ST 4UFGH 1GBCA 1HJ9A 2HWLB 1GBMA 1YPKH 1EQ9A 2Q6FA 1L1GA 4WXVA 3RM0H 1T8LA 1ZYOA 4HI3A 1BTHH 1GJCB 1XXDA 1ESTA 1G32B 4DJZB 4B76A 2Z94A 5AFYH 3SGAE 4ZAEA 3IG6B 5H4IB 3BEFB 1NS3A 4TY7A 1PYTC 2A7CA 1QA0A 2BXTH 1BTZA 1AE8H 2AMQA 4AB8A 6CHAB 2EA3A 3FP6E 4ASHA 1SGIB 4CRBA 4NSYA 4ABHA 3RU4E 3I77A 2CV3A 1SVPA 1PPZA 1XX9A 3SV6A 1TB6H 5GXPA 3RXAA 3KNXA 1ACBE 1TOMH 1SGEE 4BANB 2H9EH 8LPRA 2ZDNA 4E06H 5EODA 1HIAB 5E2OA 5A0AE 4OGYA 2C8YB 1MU6B 1C5YB 4AFUA 3L33A 1DUAA 4YO9A 3BIVH 4XSKU 1E0FD 2OQUA 2VWLA 3UTUH 3UNSA 1O5AB 3ZZDA 1ETTH 2QXIA 1HYLA 3VXEH 3UIRA 1C4V2 3MO6A 1IQGA 1HXEH 3KF2A 4A1XA 4NIYA 1C1RA 5F8TA 1K1IA 1O5EH 3U8RH 1A5HA 5DGJA 1F0SA 3QGJA 3BTTE 1BJVA 2FI3E 3V7TA 1FV9A 1F0TA 1AGJA 4FUEA 2F9NA 3RXCA 7GCHF 3U8TH 2BY9X 4NIXA 1CHGA 1K2I1 3TU7H 3ZVFA 3PLKA 3A83A 3EQ0H 4B2AA 1AVGH 1UVTH 1Y59T 1Y5AT 2QXGA 5EQSA 1C1NA 4K8YA 4NSVA 2XNIA 1GJ6A 4WWYA 1C5XB 2XBVA 1JIRA 3A7ZA 1KXFA 5A8XA 1PQ8A 1FY8E 1GVLA 1OWJA 4ZXXH 1BRBE 1BBRK 3ATKA 2G81E 5J4SA 3BTDE 1C5TA 2FZZA 1GBLA 3M36A 3HGPA 1V2TT 2GDEH 1RRKA 1QY6A 1GMDF 3ZVGA 2H5CA 3BTQE 3L6PA 3UWIA 1LVYA 4UFEH 1N8OC 1BDAA 1G3CA 5J4QA 1VR1H 1M9UA 3EGKH 4D9RA 2QA9E 3NWUA 1PFXC 1EB1H 2ANKH 4GSOA 1B0FA 1LVBA 1AIXH 1GJAB 3KEEA 2XCNA 2BD4A 1LHDH 4IC6A 1BUIA 2BZAA 2F9VA 4LZ4B 2KAIA 3ZZ7A 1FXYA 5ESBA 4ABDA 2FYRA 1P57B 2V6NA 1RGQA 1W7GH 1HAHH 4X6MA 4AGKA 2AGEX 2PKAA 4IN1A 1FJSA 1Z8IB 2OC1A 1WV7H 1O3KA 2GT8A 2FP7B 2J2UA 1DPOA 1O3DA 3SJIA 4HTCH 3P8OA 2G8TA 1YM0A 3TJOA 3S0NA 1O2KA 3A82A 1L4ZA 2JH5D 1IQKA 3TGKE 1C5SA 3A85A 3NXPA 5JBCS 3ZYDA 1NTPA 1GJ7B 2VVUA 1T32A 3MNBA 4GUXA 1O0DH 1DWBH 2G51A 2ZDAH 2GKVE 3RXVA 3UOPA 2NU4E 2BZ6H 4JMYA 1O2HA 4JZ1A 2FEQH 3EA7A 5E0JA 6GCHG 1YKTA 2SGEE 1UCYE 2BY7X 2GT7A 3PTNA 2PTCE 2ODPA 1O2GH 4K1TA 1J8AA 1ELGA 1QL7A 3UR6A 4JK6A 1C5MD 1D3TB 1IAUA 1GHWH 3UPEA 1EJAA 5FHTA 1HCGA 1TYNA 2VGCC 1O33A 1B5GH 2AFQB 5CHAB 4F4OC 2AIQA 1SG8B 3FZZA 4H42U 1ZHMA 3SNDA 5F03A 4XBDA 2ZGBH 4D9QA 2H6MA 3R3GB 1EKBB 1LHFH 4I31A 2XTTB 1HAVB 4I33A 3A7TA 1SHHB 2WPMS 5ABWA 3RXLA 3E1XB 3F1SB 1ZLRA 3E0NB 3I78A 1YGCH 1GBHA 1XKBC 3MH5A 1QR3E 2V0BA 3TLOA 1CO7E 2FLBH 3O8DA 4ABAA 4AN7A 1K1JA 1FN6A 3ATIA 4BAHB 3T25A 3A7XA 4WMFA 4OS7A 1OSSA 1AHTH 1F5RA 1BZXE 4DY7B 4JYVH 1G2MA 4MPXA 2EI6A 3A7YA 4X1QU 1O2JA 2O8TA 3FP7E 1DVAH 2EEKA 4NA7A 1SGFA 1WU1A 1GGDC 1O2PA 1P2QA 4X1RU 1BHXB 3K6ZA 1O39A 2VH0A 1GJ8B 1OXGA 2VB0A 4JZDH 1AFQB 2A7JA 1DT2A 1P2OA 1ZTKA 2VJ1A 1TPSA 1ZOMA 1TGBA 2NU0E 3IITA 1LQDB 1LHEH 2FTMA 2FIRH 1TRYA 3GY5A 8ESTE 5DG6A 1GBJA 3VB3A 4YT6H 1SFQB 1QGFA 3F9GA 2ZP0H 1GBFA 1O2YA 2A31A 3BTGE 5BRRE 1G3BA 2ZKSA 1ETRH 4TWYA 2R3YA 1C4Y2 3PWBA 1Z8JB 4A7IB 4XBCA 1P0SH 2OCVB 3RXSA 4SGAE 2HNTC 4Q80A 1DICA 3OSYA 3P70B 4Q7ZA 2FESH 1HJ8A 1SOTA 2VIDA 2XC5A 1SMFE 1CHOF 2BLQA 1MTNC 2ZHWH 3P17H 1THRH 1HAZB 4K69A 4NWLA 1O5BB 1HGTH 3MU0A 4IN2A 2PWXA 2LNCA 4X2VA 1TRNA 2GV6A 4FVDA 1AWHB 3STJA 2EI7A 4FUJA 3QWCH 5DP8A 1HFDA 2W7UA 1V6DA 4CRFA 1GBKA 1O3CA 1GWAA 2ZECA 3GYMA 4X8TH 3UNQA 4BAKB 3VGCC 4RKOB 1MTUA 1QBOA 2ZU5A 4MNXA 2ZHQH 4BXWA 2GV7A 3OX7U 2Y5GA 3GY2A 1TQ7B 2ZFRH 1BQYA 1P02A 3SJ8A 3P92A 1KTTB 1SGTA 1ETSH 1S0RA 1NFUA 1O2LA 2QCYA 4BTTB 5A2MH 1UVPA 1YPHE 3MO3A 3KGPA 4O3UA 4WY3A 2BB4A 2I6SA 5JB9S 1V2QT 2BVXH 4O9VA 3QDZB 1C2DA 4BAOB 2FPZA 5GCHG 1GI3A 4JZEH 1TX7A 3LGWA 1QRXA 1RFNA 1ZMNA 2ZFSA 2ZHFH 2J4IA 1BTUA 1Z1JA 4UONA 3ELAH 2B7DH 1GHAG 1ESBA 3LOXA 4Y8ZA 1ELEE 2C8XB 1ZSLA 2UWPA 1O32A 4X8VH 1QNJA 3BV9B 1UTKA 1N6XA 2BDYA 2RG3A 1LTOA 5C3NA 1SHYA 4K3JA 1J14A 2VH6A 3PV4A 3ZVDA 4ISOA 5PTPA 3MO9A 4WF8A 3QZQA 5JBTA 3ENSB 2PW8H 2Q1JA 3LT3A 3QLPH 4UDWH 2XXLA 4ZHLU 1O3JA 5DK1A 3SU3A 3D23A 2M5TA 2ZO3H 3TNSA 3ZVCA 4TWWA 4X1NU 3TH3H 5LPRA 3SNEA 2Z9LA 1O2RA 1TGNA 1C5WB 2J95A 3BTEE 1MKXH 3E3TA 4IMQA 1L4DA 1UCYH 2CGAA 2ZWLH 3RXKA 2VIOA 1O2QA 3RXIA 3A8CA 4LOYH 1C5LH 1FAKH 1BRUP 2FODA 3KHVA 1TBZH 1Z7KA 1EASA 3K9XB 1YPGH 3QN7A 4IBLH 3DT0H 1CGJE 3KN2A 4I8KA 1AB9C 3TNTA 2ZDMA 1DWDH 3H7TA 1EAWA 3T28A 4DW2U 4WVPE 1SQOA 4MQAA 3MH4A 3E16B 2IPHA 1H8DH 1AO5A 2QGRA 1MKXK 3SQEE 4X8SH 2V35A 2HRVA 4CRDA 1O3OA 2JETB 4FVBA 1Y3UA 3LKWA 3S9AA 1GBIA 4XFQA 1VJ9U 2BD7A 3M3TA 1HNEE 1C1WH 1VCQA 3V0XA 2TBSA 2VWMA 1C1PA 1Y3YA 1C5PA 3SUDA 1LHGH 2PUQH 9ESTA 1OWEA 1FPCH 1AU8A 1SB1H 1ZRBA 3BG4C 2G52A 1QA7A 1O3IA 1OWKA 1TA2A 3TK6A 3A8AA 2ZFPH 1DY9A 3RXMA 1TMUH 2C93B 4I8HA 2G00A 1NN6A 3W95A 1EPTB 3QGNB 2XC4A 1AVXA 1D4PB 3T5FH 1GHXH 5I46H 3RC4A 1FIWA 2BD9A 3V12A 3RXEA 3ESTA 1E38B 1O3NA 1ESAA 3ODFA 3AW1A 4AORA 1EATA 2UUYA 1KLJH 2ZU1A 2VIPA 1LQEA 1ARBA 4U01A 4F49A 1MCTA 1DM4B 1W11U 3DHKH 1UVSH 1C5QA 2FOCA 1QURH 3SI4H 1T31A 3K65B 3FP8E 2PFEA 5JPMH 4LK4A 2PGQB 4I7YH 3SJ9A 5EPYA 2ZDVH 1DWEH 4MG3A 3ZZ3A 1GI1A 3PMBB 1J15A 1PPHE 3HGNA 1LPZB 1ID5H 2FO9A 1SPJA 1P2JA 2ALPA 4BOHA 3JZ1B 1CBWC 1SLWB 2O9QA 1HXFH 5C20A 2J94A 3T2NA 3HATH 1S82A 1EAUA 4R8TB 1T4VH 2IOTA 1PQAA 5B6OA 6GCHF 1TGSZ 1V2VT 1BHXF 1W10U 1GCTC 1ZRKA 1ZPBA 5LH8A 3SORA 2VNTA 2AH4X 3LH1A 1TNLA 1P3CA 3ATMA 4AGJA 3MH7A 4XE4A 3CS7A 1GI0A 1AKSA 2DE9A 2GZ9A 1TLDA 2SGDE 2Q6DA 5EGMA 3C27B 2XRCA 1E37B 4KTCA 2UUFB 1BB0B 2FOEA 3A86A 1C5VA 2HPPH 1ELDE 2Z9IA 4CH8B 3Q77A 1NROH 1Y5UT 2WPHS 2H9HA 1DANH 2GP9B 3P8NA 2HOBA 1MKWK 1P09A 1DITH 1O35A 2P8OC 2SGAA 1W12U 3SHCH 1JRSA 2ZTZA 1H4WA 4HZHA 1T4UH 1GI9B 1QRWA 4X1SU 1O3PB 2CJIA 3SV2H 3LJOA 3BF6H 3RXOA 1C2EA 1O3BA 2BY6X 2ZPSA 3SU5A 3VFEA 2A1DB 2AS9A 4E05H 1FPHH 1V2KT 2IJOB 3RM2H 1O2TA 3P8FA 5A8ZA 2VIVA 1CVWH 2ZDKA 1H8IH 3A89A 3SV9A 1O34A 4OGXA 3S9BA 1KDQB 3FZDA 2ZHDA 3UREA 2BQ7B 5T6GA 2Z9JA 1TNGA 1UHBB 2ODQA 2PV9B 3U8OH 1WAYB 3PROA 2RA0A 2PKSC 1TMTH 2W26A 3PLBA 5LPEA 5FPTA 3V3MA 3LU9B 2UUJB 2BQ6B 1YCPK 1BBRH 3TK5A 2ZPQA 1A5IA 4Z6AH 4DG4A 5BPEA 1WSSH 1IQMA 1N8OB 2SFAA 1OYTH 4Y8YA 1AZZA 5JYIA 3TK9A 4X8UH 1F5KU 4X0WU 4GHTA 1SQTA 4NZLA 3RXDA 2BLWA 1LPGB 2FDAA 1YBWA 2GTBA 3AW0A 1TGCA 4M7GA 2FYQA 5C1UA 2B5TB 5T6DA 1TX6A 1EZQA 1W7XH 1V2WT 1FZZA 3P6ZB 4HFPB 4TY6A 4TYDA 4INKA 3LPRA 1Z71A 3ZZCA 5K7RA 1KXCA 2A4GA 1OWHA 4MTBA 3ATLA 4ZXYH 3R0FA 2GX4A 5ESTE 4CH2B 5E0HA 2W3KA 2ZFQH 4GVUA 1CA0C 4CBOA 1WTHD 4KELA 3EA9A 2BX3A 2DE8A 1GJ9B 4J2YB 3ITIA 3PM3A 5JDUB 1BCUH 4MNVA 1P2KA 3SNCA 1IQFA 1T8NA 2GGVB 2Y82A 1GVZA 1DUEA 2EI8A 4JZFH 2FWWA 4DGJA 2W7SA 1D3PB 1K1LA 3TGJE 2BOHB 2JKHA 1IQJA 5K0HA 2HNTE 4THNH 1PJPA 3UFAA 1GHZA 1XUHA 1HRTH 1HDTH 1Y3WA 2NWNA 5GCHF 3VXFH 4Y6DA 2BDBA 2ZU3A 2GCHG 3MNSA 3GCNA 3EYDA 2F91A 1GHAF 5A8YA 3PO1C 3HK3B 1MAYA 1W14U 2XW9A 4Y71A 3RXBA 1SGNE 1V2LT 2XBXA 3GCHC 3VB4A 4FUHA 3KQBA 1UVUH 4CR5A 1P10A 1TMBH 4I8LA 1KYNA 2ZFFH 4E7NA 1QTFA 1E34B 3STIA 4U2WA 1MZDA 4B74A 4RKJB 4OS5A 1XVOA 4I8JA 3RLWH 2VGCB 1FAXA 1SC8U 3H5CB 4ABBA 1E35B 1HUTH 1C5OH 2STBE 1BITA 4FUDA 1K28D 3MH6A 5E0GA 3JZ2B 2BTCE 4O97A 2FS9A 4A1TA 4CREA 1GJ4H 4NCYA 2BXUH 4YZUA 1P06A 3MMGA 1YC0A 1VCPA 1O2SA 5EQRA 1P05A 1Z6EA 1IHTH 4CR9A 2BHGA 3SV8A 1L1NA 1S0QA 5EXMA 2SGPE 2ZEBA 1A0LA 2QIQA 1D9IA 1HPGA 2GDDA 1HAYB 1GL1A 1Y3VA 2OBQA 1TONA 3QTVH 3O8CA 4FUFA 2C8WB 1OOKB 1EUFA 1P3EA 2ANMH 1NU9A 2ZU2A 1GGDB 1HIAA 5EXLA 1C2MA 1Z8RA 3F9EA 3SGBE 4ZUHA 1MCVA 1O2XA 1KXEA 1S85A 1ZHRA 2A2QH 2Z6BD 1V2UT 1WCZA 4H6TA 2ANYA 3M5NA 1UTJA 1LDTT 2K1QA 1HAIH 3A7WA 2WYJA 1XUIA 1QFKH 3NPSA 2XBYA 1P2MA 3KIDU 3VB7A 1ZMJA