1MAXA

Beta-trypsin phosphonate inhibited
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords BETA-TRYPSIN
publication title Inhibition of trypsin and thrombin by amino(4-amidinophenyl)methanephosphonate diphenyl ester derivatives: X-ray structures and molecular models.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1maxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1maxA02
1K1LA 2VB0A 1LVYA 3ODDA 5TCCA 1F5KU 1LVBA 4IW4E 4FUCA 3ZV9A 2YNBA 1EAWA 4XBBA 1DS2E 1C5WB 1CA0B 1FZZA 3RM0H 2PWXA 1GPZA 1BTHH 1V2ST 3STJA 3DUXH 1IQMA 2FTMA 3SU0A 2VU8E 3ZVDA 3U9AH 2J34A 5BPEA 2WYJA 1O5EH 2AGGX 3ITIA 1NRPH 2GCHG 1XVOA 3K65B 1V2RT 4O3TA 1L2EA 3VEQB 2R3YA 7ESTE 1GHBG 3A7WA 4JYUH 2O9QA 4MNVA 1TNJA 3SNAA 1FN6A 3KQBA 3UIRA 2Y7XA 1GL1A 2THFB 1AU8A 4YO9A 1K1JA 2FEQH 1SGNE 4ZHMU 1GI0A 3GCOA 4ZAEA 1BITA 3WY8A 5EU8A 3M37A 2BB4A 1Y8TA 1GI9B 4H6SB 3U1JB 3MOCA 1XKBC 2BX3A 1UTNA 1C5VA 4NIVA 2ILNA 1UJ1A 1RD3B 5E0GA 1SI5H 1O2SA 5L30H 3E90B 3GCTG 4JZDH 1TB6H 2WUCA 1AHTH 2J95A 1BRAA 1FI8A 5JBTA 3A81A 3LC3A 3ATIA 2W7SA 2KAIA 2QY0B 2HNTC 3LGVA 5FX6A 2P59A 2GCTB 3U1IB 1YCPM 3V12A 4X8VH 3A87A 1VR1H 1NU7B 4ZKSU 4K8BA 1XKAC 5E0HA 2G4UA 4WH6A 5K7RA 2A2QH 1L1NA 4OS1A 1DLKB 2GZ8A 1ELBA 1G32B 2M5TA 2TPIZ 4FUFA 3A86A 1C1SA 3MHWU 4I32A 2NU1E 2V0BA 2ZGCA 3HGNA 1O3DA 4GSOA 3M7QA 1O30A 4DCDA 1FAKH 1F5LA 2HVXA 2BD7A 4JYTA 2FOEA 5IDKA 3BG4C 3ATWA 3PMAB 2BD5A 2IJOB 4GUXA 3SGBE 1L4DA 2ZC9H 1AE8H 4OS5A 3S7HB 1HAHH 1A1RA 1ZTJA 4B1TA 5FBEA 2YNAA 2IOTA 1EPTA 3BEUA 2ZFTA 1O2KA 3V13A 4TY6A 3A8BA 4DGJA 1QHRB 2CHAC 3NK8A 1EB2A 1LKBA 2RG3A 1B7XB 1P9UA 1TE0A 1FUJA 3SUFA 3URCA 3LDXH 1ZTKA 3GDUA 3DT0H 1NS3A 1WBGB 1KTTB 3E16B 4BTIB 1UTLM 4RSPA 1W0ZU 1HAGE 4WF8A 3PMBB 2BY5X 4OGYA 1LDTT 2QV1A 4B2AA 1ETTH 2FS9A 3LGUA 1SGRE 4K1SA 7GCHG 1D9IA 4MTBA 5L2ZH 1C4V2 2IN2A 3GCHB 2FDAA 1K1OA 4I8GA 1ZPCA 3W95A 1ANCA 4YLQH 1VJAU 3Q3KA 5DJ7A 1JRTA 2G81E 4INLA 1O34A 4NA9H 1N8OB 2VIQA 4X6PA 3U8OH 2Z94A 1GJCB 1SFQB 1TFXA 1S83A 1O2MA 1O3KA 3AAVA 2RCEA 2J4IA 3VXFH 1GI5A 3ZZDA 1MBQA 2G8TA 1C2HA 1KXCA 2Z6BD 2FOFA 1UCYH 1A7SA 2WPHS 3EDXB 4SGBE 1G30B 1YPMH 1Y59T 1O2QA 5EPNA 4BAOB 1V3XA 4ABHA 1SGPE 1QJ6B 1G2LA 2HNTE 3RXBA 2B9LA 3FP7E 4KGAA 4X6NA 3P17H 1MD8A 1MAXA 3RXUA 2AS9A 4Y6DA 4AFQA 4YOGA 4UFFH 1O3AA 1QA7A 2BVXH 5GJ4B 1B0FA 1C1RA 1Y3WA 5C5NA 1Z1JA 5A2MH 1Z8RA 4NIWA 1ZRKA 2C8ZB 2CXVA 3OSYA 3E3TA 1HAVB 1GJ6A 2ZU3A 1LQEA 1GMCG 3VXEH 1KYNA 4Y11E 4BOHA 1BMAA 4NIYA 2A45B 2ANKH 3GICB 1BIOA 3K9XB 1BT7A 3SQHE 2BY6X 1ZGVA 8GCHF 1K1MA 2C93B 2XC4A 1GI2A 2DE9A 1TBRH 1ELFA 2SNWA 1UHBB 3UPEA 1UTOA 1WQSA 1EOJA 2GVFA 3FANA 2BDYA 4J2YB 1FIZA 2R9PA 1BMNH 3KQCA 3M3TA 5EQQA 3BTFE 1TPPA 4D7GA 1NZQH 3MWIU 5EW1H 2WUBA 4AFUA 3B23B 2SGAA 2F9NA 4GAWA 3TK5A 3TJVA 3B8JA 2OCVB 2BVRH 1JMOH 4B75A 3OU0A 2WPIS 1HJAC 3SN8A 1GMDF 3C27B 1MD7A 1D3DB 1FAXA 1FPHH 2JETC 3MH6A 3RXTA 3U8RH 1YPKH 1J9CH 1NN6A 3NWUA 4FUBA 1W10U 2BY9X 3NKKA 2BDCA 5IYTA 4AGJA 4Q80A 4JZ1A 1GBJA 1DWCH 1FPCH 2A4GA 4H42U 1FXYA 3O8CA 5CMXH 4CRAA 2A7CA 1TNLA 2Y82A 5A0BA 4A1TA 4X6OA 2ZDLA 2ESTE 1CQQA 1E34B 1W0YH 1F0TA 5A0AE 1BTUA 2XTTB 3SU2A 3BG4B 2EA3A 1QL9A 1DITH 3K2UA 3ESTA 3TPIZ 3RUOA 1KDQA 1OOKB 1D3PB 1TIOA 2CGAA 3F9EA 1YPLH 1BJUA 4D8NA 2VIVA 3IWMA 2BX4A 1QCPA 2TGPZ 4X1PU 1QBNA 1SPJA 1LKAA 2CHAB 1GHVH 2UUKB 3DFJA 5C1XA 1T4UH 1GI7B 1A2CH 4RKJB 3ZYDA 1EX3A 1EAIA 2OBQA 4INHA 1K1NA 3BTEE 1GJ9B 5JB9S 3A8CA 4FU9A 1GI3A 1RS0A 4U30A 5AFYH 4AZ2B 1J17T 1LHGH 2FS8A 1FDPA 4ABAA 1DFPA 1UVOA 1XMNB 5ESTE 1A0HB 1TGBA 4FVBA 3RLWH 4CR9A 1KXDA 3SNBA 1KTSB 3QTOH 2TGDA 1E35B 1GBCA 5FX5A 2FTLE 4GLYA 3SZNA 1U6QA 3MO6A 2BTCE 2ZU2A 1LVOA 2Z9GA 1VITF 3SV8A 1LHEH 2NU4E 3EYDA 4IS5A 1EOLA 2NU0E 2STAE 1FMGA 1G3EA 3SGQE 2GD4B 1T32A 3T29A 1TRYA 3OX7U 4ESTE 1C5RA 2F91A 5JPMH 3QDZB 1O2GH 1C2KA 1THPB 2VINA 1DANH 1BMMH 5LH8A 2ZTYA 3AW0A 3Q76A 5DGJA 5TCAA 1GMHG 4HZHA 4Y8ZA 1C2IA 9LPRA 1P2NA 1SHYA 1Y5AT 1SQTA 1SOTA 4E05H 2HWLB 2C3SA 3PTNA 4CHAB 1YKTA 4AG1A 1WQVH 2HRVA 2Z9LA 1FQ3A 4D9RA 5GIBA 2K1QA 2QXIA 4ZHLU 1AI8H 1UCYE 3LH3A 1P05A 2AGEX 5EODA 1TMBH 4D9QA 1ACBE 1YC0A 2BZ6H 1C5QA 3BEFB 1C2DA 1EJNA 1FY8E 3P70B 2ZGXH 1P57B 1MKWH 1HV7A 2AIPA 1YPEH 1QL7A 1FY4A 2G51A 1BMLA 4THNH 1QB6A 1MU6B 4O03A 1P11E 5HGGA 2Z9IA 2ALPA 3P8FA 3N7OA 3M5MA 1S85A 5EOKA 1C1OA 1MTWA 2CN0H 4GCHG 5DK1A 3LIWA 3MFJA 3RXFA 1O39A 4TWYA 2VWOA 3S0NA 2BHGA 4JK6A 1RXPA 4U2WA 1ARBA 1K1IA 1NT1A 2FIRH 1GVZA 5DKMA 1BBRH 4A92A 1P03A 3E1XB 3UWJH 1TQ0B 3TITA 1C5MD 1MTNC 1UCYK 3RMMH 2STBE 1HJAB 3TNSA 2BYAX 1BTPA 3RXRA 4ZHAA 1A5IA 1XUFA 2Y80A 3E0NB 1GCDA 1O2XA 5C2ZA 3M3SA 3ZVBA 2JETB 1IQIA 1T7CA 1ZLRA 1K2I1 1UTQA 1FNIA 3KN2A 3SUEA 4WXVA 3UWIA 1C2GA 1HBTH 1XUKA 4WWYA 3GY8A 2AERH 5DP8A 3SORA 3CP7A 2ASUB 3EA8A 1HJ9A 5FCRA 2FYQA 2FOCA 3RU4T 1Z8GA 1UTPA 2QCYA 3KF2A 3FP6E 4ZROA 1AFQC 3T26A 4ABIA 1W14U 3RC5A 1EP6A 2PUQH 1ZTLA 3M5LA 6LPRA 1GDNA 4DIIH 1K21H 3CENA 1EZXC 1IAUA 1PQ7A 1C5SA 2ZCHP 3AW1A 1TOMH 5CHAC 3FP8E 1ZJDA 4R8TB 3RXIA 3QZQA 1KXFA 1V2UT 2FOHA 3UNQA 2RA0A 1FY1A 3E0PB 3ZZ5A 2A32A 2XBXA 1F5RA 2GGVB 4X1SU 1TNIA 1Z7KA 4NZQA 1BOQA 3UOPA 2SGPE 3P95A 2FLRH 1TWXB 2OQ5A 1HAOH 1O5AB 1P9SA 3Q3YA 4FXGH 2B7DH 1V2WT 3SHAH 1QGFA 1SMFE 2QXGA 2TRMA 4X0WU 1SGYE 1VITH 3I78A 1Y3UA 1XUHA 1QL8A 1CGHA 2O8LA 1KIGH 3A82A 1CHOF 1O5FH 5C1YA 1AWFH 4NSVA 4O9VA 5HM2A 3F9GA 1B0EA 1W7XH 3EA7A 1GJ7B 2Z7FE 1JWTA 2Z3CA 1BHXF 2A4QA 2AEIH 1TNHA 1JIRA 2XBYA 1S5SA 4AB8A 1YPHC 2H2ZA 2J9NA 4KP0A 1WYKA 4UFGH 1ANBA 2SFAA 2D8WA 1NFXA 2JH5D 3LKWA 1F92A 2OQUA 1HAVA 1G3CA 1WOFA 1C9TA 1W12U 2ANYA 1AB9C 2ZEBA 1SG8B 1O3IA 1E36B 5FPSA 4YT6H 1YP9A 3NXPA 2PTNA 4JZEH 2XYAA 1NM6A 5JBCS 3GY3A 2ZDMA 2XNIA 1QRZA 4B74A 3ZZ6A 1Y5UT 1BB0B 1RGQA 2PGQB 2ZDKA 2NU3E 1ZR0A 6CHAC 4B71A 1TPAE 1AVGH 3ATMA 3VB3A 1UHBA 1GBFA 2ZHEH 1SR5C 1L4ZA 2Y81A 5E8EH 3BIVH 3ENSB 1B5GH 5E2OA 3SNCA 2HALA 3U8TH 4AOQA 1GWAA 1S81A 5FPTA 2ZNKH 4Y76A 3RXVA 1C9PA 1SLUB 2FI4E 1DXPA 4YLUA 4RKOB 3B9FH 5F8TA 4ABBA 1ANDA 1H8IH 1O0DH 4MLFB 1C5TA 1IQNA 4QT8C 1NFUA 1XXFA 1ABJH 3M7UA 5BRRE 3JZ1B 1C1WH 1UK2A 2GX4A 2OD3B 2BZAA 5GCHF 3RXQA 1P3CA 1O2UA 2A0QB 3ZZ3A 6GCHG 2Y5HA 1T8NA 4KTCA 3SJIA 1SQOA 1OYTH 4I8JA 2FO9A 1EZQA 4HFPB 3MU0A 1BA8B 1T31A 2FOAA 3FFGA 1O32A 1QJ1B 1MKXK 3GDSA 4MNXA 1O3NA 4X2YA 4BTTB 2AGIX 1O2PA 2C8YB 3RU4E 1AWHB 1TX8A 4H6TA 1EKBB 3SV7A 2ZDVH 1ELCA 2ZU5A 1MTNB 4ABJA 3A88A 1CGJE 1TOCB 4AORA 1VGCC 1K1PA 3GOVB 2QXJA 1UTMA 3MNCA 3SNEA 2ZTZA 1EJMA 2C8XB 1DSUA 2SGEE 3GY7A 2PKAB 1JXPA 1TQ7B 5JBAS 2ZFQH 2VWLA 1Z8IB 1IQLA 1PQ8A 1HAZB 1HYLA 1YPJH 3QZRA 4E7NA 3MNXA 3LJOA 1GL0E 3T5FH 5HM9A 1V2MT 1V2JT 1E37B 1ZHMA 4ISHH 2ULLA 1PFXC 5A0CA 2ZZUH 1PYTD 2VIWA 5GXPA 2XXLA 3OTJE 3HKJB 1O36A 1H9LB 2H9EH 4DVAU 1JRSA 3OY6U 2OLGA 1UTKA 8LPRA 3A8DA 1T8LA 1UVSH 4K3JA 1O3GA 5C1UA 1AFQB 4DG4A 3RU4D 1BRUP 1K28D 2WV5A 1MKWK 4LZ4B 1CO7E 2Q6GA 1AVWA 1ELDE 3UQOA 1C2MA 2ZDNA 2A5AA 4LZ1H 5CHAB 2UWOA 2ZO3H 4ZH8A 3TGKE 2A2XH 3BTKE 1C2JA 4X8TH 2UWLA 1X7AC 2OUAA 4I8HA 2Z3DA 3HK3B 1K22H 2ZCLP 1DICA 1AO5A 1OWKA 3SNDA 1O3FA 1H4WA 1AMHA 2ZU4A 4B76A 2CF8H 1C5PA 3TJOA 4WY3A 1MAYA 1BBRK 3TK6A 1RTLA 4LXBH 3TGIE 1DOJA 5ESBA 3A7YA 1GBLA 4UFEH 5EXMA 4X6MA 1OSSA 3T62A 4NSYA 2BY8X 1GHYH 4DURA 1DPOA 2VVVA 4WMEA 1Y3YA 1QNJA 4CR5A 2H1UA 1TRNA 4UD9H 1WV7H 2G52A 2HGTH 4CRBA 3SOSA 1N6YA 1ABIH 3A83A 3TH2H 4BAQB 4AFZA 3A7TA 3DHKH 1D4PB 3H7TA 2AMPA 3PB1E 4XSKU 5C67A 1RIWC 1CE5A 2PKSC 3GY2A 3T28A 1A0LA 4D7FA 1CA8B 3GCNA 3RXEA 1MCVA 2QN5T 2TIOA 1EAUA 1G36A 4WVPE 3SU4A 1AB9B 2FI3E 1HXFH 3ATLA 1LTOA 3LJJA 3VPKA 1XM1A 4Y71A 4Q7ZA 1QTFA 1Z71A 2GMTC 2OP9A 4X1NU 1MTUA 4OS6A 4OS2A 1TX6A 6CHAB 6ESTA 4MPUA 1O3CA 1P2JA 1UTJA 1UK4A 1RJXB 5EPYA 1TA6A 5EXNA 1IQHA 3F9HA 1C2FA 3HKIB 1UMAH 4MPWA 1GVKB 2BDAA 2GZ7A 3AVZA 4XDEA 1TYNA 4Y0YE 3A89A 3GISB 1ETSH 2FODA 5K0HA 3QLPH 1GI6A 1LHDH 3UREA 2VWMA 1O3JA 1O2OA 1C1MA 1DM4B 3KQDA 1O3BA 2BVSH 4I8KA 3RP2A 1CT0E 4ABFA 1OWJA 1M9UA 1E38B 4CBNA 1GJ4H 2DUCA 3KCGH 4ZKOU 3ZVFA 1C4U2 5FBIA 1C1VH 4PROA 2ZGHA 1CVWH 1QRXA 4I31A 1P09A 5C3NA 2Q6FA 3E8LA 1F0UA 3QGJA 2FI5E 2XWBI 1O2RA 1P02A 1AUTC 3O8DA 3LGYA 3BTGE 1ZRBA 4BXSA 1O2YA 2O8WA 2OC0A 4IN1A 1VGCB 2AH4X 1OS8A 4B2BA 3SUDA 2A4RA 1V2VT 2ZFSA 3A8AA 1ELGA 1DLEA 1GVLA 3SBKA 1Q2WA 1Y5BT 4F4OC 2RA3A 2BMGB 4R0IA 3A80A 2P94A 1DE7H 2AFQB 3P8NA 1W3CA 3VB4A 1ESTA 4ASHA 2QA9E 5HMAA 2FZZA 1QFKH 1DSTA 4BTUB 2VVUA 3MI4A 1T8MA 2LNCA 1GJBB 4YOIA 2PSYA 4X8UH 4JK5A 2BDBA 2G5VA 4DIHH 1IQKA 2GKVE 5C5OA 4J1YA 3RXKA 1TBQH 1HUTH 2ZTXA 2V6NA 4YZUA 3HK6B 3CS0A 4FUEA 2B8OH 1SLWB 5J4SA 1SVPA 3IG6B 4X2XA 3SV6A 4GCHF 2D2DA 2ZI2H 4TY7A 3VGCC 4K69A 2ZHDA 3RXCA 1A61H 1QBOA 4I8LA 2GT7A 1P04A 4Q7YA 1O2IA 3M36A 1BRCE 1DDJA 1ZSKA 3S9AA 3TIUA 4YOJA 1O2NA 3RM2H 2XC0A 2FX6A 1P06A 4IMZA 4NZLA 3A84A 2PGBB 1GJ8B 1HCGA 2QIQA 3A7XA 5L6NH 4IBLH 1N6XA 1Z6EA 4Y0ZE 8GCHG 3FZDA 2GDEH 1RTKA 1QB1A 2G5NA 4ISNA 4Z0KA 1MKXH 4X2WA 3ZZ9A 1EASA 1GBBA 3UNRA 2UWPA 3GYMA 1NC6A 4ISOA 2NWNA 1P2OA 1QIXB 2AIQA 3ZZ8A 1J15A 1W11U 1FLEE 2O8UA 3BEIB 1BRBE 2BM2A 3ODFA 1O2TA 3NCLA 5A09A 1W2KH 1RIWB 1GHAG 4NWLA 2BD3A 2PKSB 1ARCA 4A5TS 4B73A 1BTXA 2GV7A 3NZIA 1TGCA 1TPSA 1A46H 1MU8B 2FOMB 2F3CE 1AIXH 2OTVA 3OYPA 1G2MA 1LVMA 1GMDG 1TABE 1GBTA 2LPRA 5T3HA 3TJUA 4AYVB 2GMTB 4I33A 2ZPQA 3P92A 3RXHA 1NY22 2FXRA 2HLCA 1O5CB 2PV9B 1AZZA 1P2QA 3A7ZA 2F9BH 5DP3A 4ABEA 4UFDH 4O97A 3LONA 3AAUA 1Q31A 2ANMH 1FJSA 3LPRA 3M61U 2GT8A 1QRWA 5LPFA 2Y5FA 3TK9A 2Y7ZA 3EE0B 2J94A 3QWCH 1BTZA 1EZSC 2W7UA 1O2WA 1LPZB 4YM9A 4NG9H 1BTYA 3E6PH 2R0LA 1V2NT 2BQ6B 2Q1JA 1FONA 2VVCA 5A8YA 1ZHPA 2CJIA 1P2KA 5FXLA 4JCNA 3D65E 1YBWA 2FWWA 1TBZH 3S9CA 1YGCH 4Y10E 2PKAA 5DP9A 2XC5A 1LPKB 2ZGJA 1ORFA 2H9TH 2V35A 2VIPA 4A1XA 5HYOA 4CRFA 3MNBA 4DW2U 3R0FA 2PR3A 3PMJA 2QC2A 3QX5H 1WTHD 2ZDAH 4YTAA 2WV4A 3DD2H 2BD9A 2JKHA 1MCTA 3CS7A 2CMYA 1XUJA 1QB9A 2B5TB 2ZQ1A 4X2VA 5CE1A 2FOGA 3ZZCA 4Q7XA 4AG2A 1BHXB 2FPZA 3TLOA 1WCZA 2O8MA 3PMHB 4MNWA 4LOYH 3AASA 3S7KB 3SU5A 1AE5A 1VITG 1YYY1 4IGDA 1SB1H 3GY6A 1NRNH 1Z6JH 1CU1A 2WINI 3LT3A 3JZ2B 2D1JA 3Q77A 3ZYEA 2GCHF 1ESAA 1QQ4A 2BD8A 2TBSA 5LPEA 1E0FD 2BDGA 4XE4A 4ISLA 1D6WA 1TGTA 1LHFH 2VIDA 3BF6H 2Q6DA 2UUJB 4AX9H 3LOXA 1A3EH 2ZP0H 1GHBF 5T6FA 2XCFA 4UONA 2ZFFH 1EQ9A 4X1RU 1QURH 5JDUB 3VFEA 3O8RA 3P6ZB 1SC8U 3SHCH 3T2NA 3RMOH 1OP8A 1GBEA 3ATKA 2QYIA 1YF4A 1GHWH 3VB7A 5A8ZA 2P16A 3S69A 4GVUA 5JYIA 3VGCB 3BV9B 1P0SH 3UFAA 1UVUH 4BANB 4NFEA 4K1EA 3PTBA 2P8OC 1BUIA 3V0XA 1F0RA 1NRRH 3GCTF 1O2LA 3G01A 4K5ZA 1IQGA 1HAYB 5EXLA 5FPYA 4IMQA 3RDZA 1AFEH 4CH2B 1IQEA 1MQ6A 4CRDA 3NUMA 1IOEA 5I25A 5JB8S 2ZHFH 2XW9A 3NPSA 1P10A 2WPLS 2BY7X 1HIAB 1DVAH 1SGIB 1G37A 2BD2A 1QQUA 4M7GA 2H9HA 1C2LA 4JMYA 5DP6A 4E7RG 1XUGA 4NGAH 1SSXA 2J2UA 3TVJB 2BD4A 2H5CA 3LC5A 1S0QA 1DXWA 1O35A 2BOHB 3FVFB 3URDA 3QO6A 4JZFH 3T27A 1AD8H 3RXAA 1AZ8A 1ANEA 1C5OH 1PQAA 1O37A 1HJ8A 2D26C 1MH0A 3K6YA 1FN8A 3SQEE 2GDDA 4MNYA 1WTGH 4RN6A 1TGSZ 1OP2A 1ZSLA 3SGAE 1SGEE 2B0FA 2BXUH 2C90B 3ZZAA 4TPIZ 1EXFA 2BQ7B 5LGOA 1DT2A 1EZUC 4OS7A 2FM2A 4XBDA 5GPIB 1CBWC 2XBVA 3MMGA 2OC7A 4HI3A 1P2IA 1UK3A 2EI8A 1HDTH 1SLXB 1FIWA 2BDHA 1HPGA 4GPGA 1OYQA 3KHVA 5EW2H 1DWBH 1TNKA 4DOQA 3BTWE 1O2VA 4WMDA 7GCHF 2PHBA 3D49H 2CV3A 2HPQH 1O38A 1BDAA 1PQ5A 1G9IE 1MQ5A 1GHZA 1NU9A 2FESH 5ABWA 3STIA 4INKA 4OGXA 1GBAA 2VH6A 1CT2E 3DFLA 2GP9B 3ZZ7A 7KMEH 3MTYA 1C2EA 1NRSH 3W94A 3SU6A 1NTPA 4O3UA 1GI4A 1GCTC 1GI1A 3FAOA 3D23A 3MH4A 2PFEA 3C1KA 1VZQH 2OC8A 1G3DA 2BLOA 3PWBA 2ZF0H 3ZVEA 1GG6C 2G00A 3F9FA 1IQFA 4U32A 3ZVCA 4GHTA 3QGNB 4VGCC 1LCYA 3LU9B 2WPKS 4KTSA 1J14A 3K6ZA 1EJAA 1GDQA 5F8ZA 1G3BA 2EI6A 1BBRE 1CHOG 4UEHH 4Y7AA 1YPHE 3EQ0H 4FUDA 8KME2 1LHCH 2QF3A 4FU8A 2A1DB 1SQAA 2GTBA 2W26A 5DP5A 2SGDE 1J8AA 1ELTA 1TGNA 2BLQA 3BN9A 3F1SB 4FVDA 2J92A 1GBIA 1GMCF 1TAWA 2PW8H 2ANWA 1O3LA 1KY9A 3M5NA 1GGDC 1YCPH 1ZOMA 4JZIA 4Y8YA 2F83A 4CH8B 1A3BH 2FLBH 1O3EA 5DG6A 1SL3A 1O3OA 1RTFB 4MQAA 2PTCE 2ODPA 1L1JA 2WYGA 3GY4A 3A7VA 3MU1A 1O5BB 1O2JA 3UUZA 1OWEA 2P8OB 3QK1A 1P12E 3EAJA 1OX1A 5EQSA 5FCKA 1WU1A 3MYWA 4B2CA 3UR6A 4KKDA 3SJOA 3BTDE 1FY5A 1HFDA 2Y5GA 4NIXA 1EPTC 2NU2E 2ZKSA 2SGQE 1C1QA 1S82A 4FU7A 3RMLH 2TGAA 1SGFG 4TYDA 5AFZH 1JOUB 1EB1H 3SU1A 1UVTH 3UR9A 5GCHG 3QTVH 4X1QU 1IHTH 2XCNA 4K8YA 3RXDA 4WH8A 1V6DA 1L1GA 4HTCH 3LGWA 3I77A 1LPGB 1O33A 2FP7B 3F68H 1AKSB 1ELEE 1GBHA 1O5DH 2BLWA 2H6MA 2ZFRH 5T6GA 4ABDA 1GI8B 1O5GH 4TWWA 1IHSH 2HPPH 4IN2A 3PM3A 1QBVH 5GDSH 4CREA 2GV6A 4YT7H 1GDUA 2FMJA 3HATH 1DUEA 3ZVAA 2AYWA 5DP7A 1A0JA 4CRCA 3P8OA 4BAMB 2FYRA 3L3TA 1NPMA 5FAHA 1KXAA 1ZMJA 1S84A 2XRCA 1Z8JB 1HNEE 3BTME 2ZCKP 1PJPA 1D3QB 3TNTA 2P95A 1SGCA 3DA9B 1OKXA 4E06H 4WMFA 2IPHA 1WUNH 4Q2KA 1EAXA 1CBWB 1Y3XA 4CHAC 5E0JA 2P3TB 3BG8A 4JYVH 1ZYOA 5LPRA 1DUAA 5EG4A 1CSOE 3MU4A 1C5YB 4A7IB 1XVMA 1C5XB 2OXSA 3KNXA 1EUFA 1HGTH 4MPXA 1MTSA 3U98H 1AGJA 4F49A 1W8BH 4BAHB 1O3PB 1Z1IA 5I46H 3L33A 3UNSA 1GBDA 1JBUH 1ZJKA 3OY5U 4LK4A 1TPOA 1NRQH 1VCPA 1ZPBA 1A5GH 3QN7A 1ETRH 4NA8A 2PSXA 2VWNA 3RLYH 2F9UA 3V3MA 2XBWA 5H4IB 8ESTE 3RXSA 2O8TA 4ZXYH 4AFSA 1IQJA 1DY8A 3H5CB 1TMUH 2W3KA 2CF9H 3RXLA 1GCTB 2C4FH 1XXDA 5DPAA 2WPJS 1TMTH 1VCWA 1NESE 4MPVA 4XOJA 1GG6B 1GBKA 1C1PA 1GHAF 4UDWH 2J38A 2P3FH 4ZXXH 1GMHF 3KEEA 3SI4H 4VGCB 2BDIA 3EGKH 5TJXA 4BAKB 1NO9H 1S0RA 5FHTA 1DY9A 2ZIQH 5T6DA 4A1VA 3L6PA 1LMWB 2OINA 1EP5A 4FUIA 1KLTA 2Y6TA 1WAYB 1GJDB 1ZPZA 1SFIA 2AMQA 1SLVB 3RXPA 5AVDA 2BLVA 1TLDA 1EATA 2YOLA 3E91A 2W5EA 3PLPA 1AUJA 1KLIH 1FV9A 3S9BA 3QUMP 2ZG0H 3RC6A 1AY6H 3U69H 1H9HE 1SGFA 3SJ8A 1TNGA 1H9IE 2KAIB 3PLKA 3SV2H 1THRH 1BQYA 1QJ7B 4FUGA 4HGCA 1DWEH 3MO9A 1GGDB 1QA0A 3Q3XA 1PPBH 1P2MA 1AVXA 3SU3A 1J16A 1SBWA 3TH3H 2BOKA 1CHGA 4AGKA 3MH5A 1C1UH 3F6UH 3KGPA 1HB0B 3SI3H 3UQVA 4IC6A 5J4QA 5ETXA 1ELVA 2ZPSA 1HIAA 1V2LT 4MG3A 1TA2A 4NCYA 5G4BA 3VB6A 4BXWA 1ZHRA 1F7ZA 1HAIH 2F9OA 2ODQA 2H5DA 3BTHE 2ZGBH 3HPTB 5AHGH 3T25A 1D6RA 3PV4A 3LH1A 3UOUA 2JH0D 3H7OA 1GHXH 4BNRA 1GBMA 3PO1C 1EPTB 1OWHA 3TGJE 3MU5A 2EEKA 1LO6A 1T8OA 3ELAH 2RDLA 1HAXB 3RC4A 5SGAE 2BQWB 2ZPRA 1SGQE 1V2TT 3GDVA 1PPEE 3MO3A 3MU8A 1BTWA 5DP4A 1Q3XA 1ZMNA 1CT4E 1UVPA 1BCUH 2G55A 1OXGA 2HNTF 1TALA 1NFWA 4H4FA 1CGIE 3PROA 1ELAA 2W3IA 2VGCC 1XUIA 4UE7H 4CRGA 3KL6A 3VB5A 5F8XA 2TGTA 1HXEH 4XBCA 1O3HA 3EA9A 2VJ1A 2A5KA 1C1TA 2OC1A 4K1TA 4AN7A 1MZAA 2ALVA 1ESBA 2R0KA 2G4TA 2C8WB 1YCPK 1TX7A 1KXEA 1D3TB 3RXOA 1CA0C 3IITA 2ZHWH 2A5IA 2F9PA 7LPRA 4X8SH 1C5NH 3I29A 4ISIH 2SGFE 1UO6A 3Q00A 4AYYB 3O8BA 3RXGA 1F0SA 1JIMA 1O31A 1A4WH 1C4Y2 2V3HH 4WJG2 5DO4H 4FUJA 1ZGIA 1C5ZB 2Z3EA 4ZMAH 4GHQA 2A7JA 1P8VC 1A5HA 4SGAE 3RMNH 3UTUH 5AF9H 1SGTA 2P93A 1QR3E 4A6LA 2QXHA 2R3UA 1YM0A 4WXIA 3V7TA 4Y79A 4XFQA 5B6OA 1W13U 3SO3A 3M7TA 3BTTE 3ZVGA 1OWIA 2VH0A 4ZKNU 2WPMS 3M5OA 4FUHA 2JH6D 1HLTH 1SHHB 4KELA 1K9OE 4DJZB 3M35A 1VCQA 1HAPH 1V2QT 1VJ9U 3KIDU 3SUGA 3RXJA 1SOZA 3SW2B 3R3GB 4NA7A 1S6HA 1PPHE 1V2KT 2I6SA 2VNTA 2HOBA 5A8XA 1LQDB 5HXFA 1FY3A 1L0ZA 5JBBS 1NFYA 4MDSA 4ZKRU 4NFFA 1O2ZA 5F6MA 1TRMA 2GCTC 3MH7A 4YESB 5F03A 3BTQE 1H1BA 3PWCA 2UUYA 1DX5M 1MUEB 4CBOA 1Y3VA 3LGTA 3GYLB 1RFNA 1GJAB 2QAAA 1PPGE 2UUFB 4Z6AH 3TU7H 2FOBA 2ZFPH 3PYHA 3TH4H 4D76A 1ZZZA 2EC9H 2OBOA 2SNVA 1TONA 1OP0A 5PTPA 1MTVA 1KLJH 1C1NA 3KQEA 4KTUA 4IC5A 2ZU1A 2ODYB 3ZV8A 1INCA 1QY6A 1BJVA 3SV9A 2DE8A 1C5UA 3ZZBA 2P3UB 5GWZA 1T4VH 4K2YA 1GJ5H 4Y8XA 3HGPA 2AMDA 2XWAA 1RRKA 4OS4A 1KSNA 4DY7B 1H8DH 6GCHF 4NWKA 1ZMLA 4I7YH 1AQ7A 2BXTH 3RXMA 1NROH 5EGMA 3SJ9A 3SJKA 4U01A 2A31A 1AN1E 3A85A 3LGIA 4MVNA 1V2OT 4Y7BA 1HRTH 2ZQ2A 5L2YH 2ZA5A 1O2HA 2ZECA 1PPZA 1W7GH 2R2MB 3BIUH 2Z9JA 1AKSA 2ZWLH 4ZUHA 1KXBA 1KDQB 1PYTC 1WSSH 2PUXB 1MMJN 1MZDA 1XX9A 1F2SE 3PO1B 3M3VA 3P8GA 2A4OA 4DT7B 5C20A 1PPCE 2QGRA 1YLCA 5EQRA 3GCHC 2PLXA 1THSH 2VIOA 1SGDE 1O3MA 2A7HA 1P01A 1ID5H 2QF0A 1N1LA 9ESTA 2GZ9A 1P3EA 2F9VA 3PLBA 3GY5A 3ZZ4A 1MBMA 1N8OC 2ZHQH 1V2PT 1OPHB 2I6QA 3TJNA 3D62A 4TPYA 3UY9A 1YPGH 1YLDA 2V3OH 3FZZA 1DWDH 1S6FA 2R2WU 1OWDA 3BSQA 2FX4A 3MNSA 2VGCB 1PPFE 2Z9KA 5E2PA 1C5LH 4K60A 4ABGA 1ZSJA 1BZXE 4AB9A 2EI7A
chains in the Genus database with same CATH superfamily
1K1LA 2VB0A 1LVYA 3ODDA 5TCCA 1F5KU 1LVBA 4IW4E 4FUCA 3ZV9A 2YNBA 1EAWA 4XBBA 1DS2E 1C5WB 1CA0B 1FZZA 3RM0H 2PWXA 4FETA 1GPZA 1BTHH 1V2ST 3STJA 3DUXH 1IQMA 2FTMA 3SU0A 2VU8E 3ZVDA 3U9AH 2J34A 5BPEA 2WYJA 1O5EH 2AGGX 3ITIA 1NRPH 2GCHG 1XVOA 3K65B 1V2RT 2CK3D 4O3TA 1L2EA 2XNDD 3VEQB 5GNDA 2WPDD 2R3YA 7ESTE 1GHBG 3A7WA 4JYUH 2O9QA 4MNVA 1TNJA 3SNAA 1FN6A 3KQBA 3UIRA 2Y7XA 1GL1A 2THFB 1AU8A 4YO9A 1K1JA 2FEQH 1SGNE 4ZHMU 1GI0A 3GCOA 4ZAEA 1BITA 3WY8A 5EU8A 3M37A 2BB4A 1Y8TA 1GI9B 4H6SB 3U1JB 3MOCA 1XKBC 2BX3A 1UTNA 1C5VA 4NIVA 2ILNA 1UJ1A 1RD3B 5E0GA 1SI5H 5C0TA 1O2SA 5L30H 3E90B 3GCTG 2KCOA 2V3MA 4JZDH 1TB6H 2WUCA 1AHTH 2YMSD 2J95A 1BRAA 1FI8A 5JBTA 3A81A 3LC3A 3ATIA 2W7SA 2KAIA 2QY0B 2VBCA 2HNTC 3LGVA 5FX6A 2GCTB 2P59A 3U1IB 1YCPM 3V12A 4X8VH 3A87A 1VR1H 1NU7B 4ZKSU 4K8BA 1WDIA 1XKAC 5E0HA 2G4UA 4WH6A 2EY4C 5K7RA 2A2QH 1L1NA 4OS1A 1DLKB 2GZ8A 1ELBA 1G32B 2M5TA 2TPIZ 4FUFA 3A86A 1C1SA 3MHWU 4I32A 2NU1E 2V0BA 2ZGCA 1E1RD 3HGNA 4Z1MD 1O3DA 4GSOA 3M7QA 1O30A 4DCDA 1FAKH 1F5LA 2HVXA 2BD7A 4JYTA 2FOEA 5IDKA 3BG4C 3ATWA 3PMAB 2BD5A 2IJOB 4GUXA 3SGBE 1L4DA 2ZC9H 1AE8H 4OS5A 3S7HB 1HAHH 5C94A 1A1RA 1ZTJA 4B1TA 5FBEA 2YNAA 2IOTA 3FOAA 1EPTA 3BEUA 2ZFTA 1O2KA 3V13A 4TY6A 3A8BA 4DGJA 1QHRB 2CHAC 3NK8A 1EB2A 1LKBA 2RG3A 4FOUC 1B7XB 1P9UA 1TE0A 1FUJA 4P00A 3SUFA 3URCA 3LDXH 1ZTKA 3GDUA 3DT0H 1NS3A 1WBGB 1KTTB 3E16B 4BTIB 1UTLM 4RSPA 1W0ZU 1HAGE 4WF8A 3PMBB 2BY5X 4OGYA 1LDTT 2QV1A 4B2AA 1ETTH 2FS9A 3LGUA 1SGRE 4K1SA 7GCHG 1D9IA 4MTBA 5L2ZH 1C4V2 2K8IA 2IN2A 3GCHB 2FDAA 1YWUA 1K1OA 5KGOA 4I8GA 1ZPCA 3W95A 1ANCA 4YLQH 1VJAU 3Q3KA 5DJ7A 1JRTA 2G81E 4INLA 1O34A 4NA9H 1N8OB 2VIQA 4X6PA 3U8OH 2Z94A 1GJCB 1SFQB 1TFXA 1S83A 1O2MA 1O3KA 3AAVA 2RCEA 2J4IA 3VXFH 1GI5A 3ZZDA 1MBQA 2G8TA 1C2HA 1KXCA 2Z6BD 2FOFA 1UCYH 1A7SA 2WPHS 3EDXB 3KYGA 4SGBE 1G30B 1YPMH 1Y59T 1O2QA 5EPNA 4BAOB 1V3XA 4ABHA 1SGPE 1QJ6B 1G2LA 2HNTE 3RXBA 2B9LA 3FP7E 4KGAA 4X6NA 3P17H 1MD8A 1MAXA 3RXUA 2AS9A 4HG6A 4Y6DA 3DSGA 4AFQA 5DSFA 4YOGA 4UFFH 1O3AA 1QA7A 2BVXH 5GJ4B 1B0FA 1C1RA 1Y3WA 5C5NA 2HVYB 4ASUD 1Z1JA 5A2MH 1Z8RA 4NIWA 1ZRKA 2C8ZB 2CXVA 3OSYA 3E3TA 1HAVB 1GJ6A 2ZU3A 1LQEA 1GMCG 3VXEH 1KYNA 4Y11E 4BOHA 1BMAA 4NIYA 2A45B 2ANKH 3GICB 1BIOA 3K9XB 1BT7A 3SQHE 2BY6X 1ZGVA 8GCHF 1K1MA 2C93B 2XC4A 1GI2A 2DE9A 1TBRH 1ELFA 2SNWA 1UHBB 3UPEA 1UTOA 1WQSA 1EOJA 2GVFA 3FANA 2BDYA 2KCAA 4J2YB 1FIZA 2R9PA 1QZ8A 3DSPA 1BMNH 4OM9A 3KQCA 3M3TA 5EQQA 3BTFE 1TPPA 4D7GA 1NZQH 3MWIU 5EW1H 2WUBA 4AFUA 3B23B 2SGAA 2F9NA 4GAWA 3KYFA 3TK5A 3TJVA 4F55A 3B8JA 2KCYA 2OCVB 1H8ED 2BVRH 1JMOH 4B75A 3OU0A 2RFKC 2WPIS 1HJAC 3SN8A 1GMDF 1W0JD 3C27B 1MD7A 1D3DB 1FAXA 1FPHH 2JETC 3MH6A 3RXTA 3U8RH 1YPKH 5IK2D 3FKSD 1J9CH 1NN6A 3NWUA 4FUBA 1W10U 2BY9X 3NKKA 2BDCA 5IYTA 4AGJA 4Q80A 4JZ1A 1GBJA 1DWCH 1FPCH 2A4GA 4H42U 1FXYA 3O8CA 5CMXH 4CRAA 2A7CA 1TNLA 2Y82A 5A0BA 4A1TA 4X6OA 2ZDLA 2ESTE 1CQQA 1E34B 1W0YH 1F0TA 5A0AE 1BTUA 2XTTB 3SU2A 2J97A 2EA3A 3BG4B 1QL9A 1DITH 3K2UA 3ESTA 3TPIZ 3RUOA 1KDQA 1OOKB 1D3PB 1TIOA 2CGAA 3OE7D 3F9EA 1YPLH 1BJUA 4D8NA 2VIVA 3IWMA 2BX4A 1QCPA 2TGPZ 4X1PU 1QBNA 4M9FA 1SPJA 1LKAA 2CHAB 1GHVH 2UUKB 3DFJA 5C1XA 1T4UH 1GI7B 1A2CH 4RKJB 1K0HA 2RDEA 3ZYDA 1EX3A 1EAIA 2OBQA 4INHA 1K1NA 3BTEE 1GJ9B 5JB9S 3A8CA 4FU9A 1GI3A 1RS0A 4U30A 5AFYH 4AZ2B 1J17T 1SKYE 1LHGH 2FS8A 1FDPA 4ABAA 1DFPA 1UVOA 1XMNB 5ESTE 2KFWA 1A0HB 1TGBA 4FVBA 3RLWH 4CR9A 1KXDA 3SNBA 1KTSB 3QTOH 2TGDA 1E35B 1GBCA 5FX5A 2FTLE 4GLYA 3SZNA 1U6QA 3MO6A 2BTCE 2ZU2A 1LVOA 2Z9GA 1VITF 3SV8A 1LHEH 2NU4E 3EYDA 3UAIC 4IS5A 1EOLA 2NU0E 2STAE 1FMGA 1G3EA 1NBMD 3AK5A 3SGQE 2GD4B 1T32A 3T29A 1TRYA 3OX7U 4ESTE 1C5RA 2F91A 5JPMH 3QDZB 1O2GH 1C2KA 1THPB 2VINA 1DANH 1BMMH 5LH8A 2ZTYA 3AW0A 3Q76A 5DGJA 5TCAA 1GMHG 4HZHA 4Y8ZA 1C2IA 9LPRA 1P2NA 1SHYA 3UB0A 1Y5AT 1SQTA 3WWBA 1SOTA 4E05H 2HWLB 2C3SA 3PTNA 4CHAB 1YKTA 4AG1A 1WQVH 2HRVA 2Z9LA 1FQ3A 4D9RA 5GIBA 2K1QA 2QXIA 3SZEA 4ZHLU 1AI8H 1UCYE 3LH3A 1P05A 2AGEX 5EODA 1W0KD 1TMBH 4D9QA 1ACBE 1YC0A 2BZ6H 1C5QA 3BEFB 5HIYA 1C2DA 1EJNA 1FY8E 2AHME 3P70B 1UW7A 2ZGXH 1P57B 1MKWH 1HV7A 2AIPA 2KM0A 1YPEH 1QL7A 1FY4A 2G51A 1BMLA 4THNH 1QB6A 1MU6B 4O03A 1P11E 5HGGA 2Z9IA 2ALPA 3P8FA 3N7OA 3M5MA 1S85A 5EOKA 1C1OA 1MTWA 2CN0H 4GCHG 5DK1A 3LIWA 3MFJA 3RXFA 1O39A 4TWYA 2VWOA 3S0NA 2BHGA 4JK6A 1RXPA 4U2WA 1ARBA 1K1IA 1NT1A 2FIRH 1GVZA 5DKMA 1BBRH 4A92A 1P03A 3E1XB 3UWJH 1TQ0B 3TITA 1C5MD 1MTNC 1UCYK 3RMMH 2STBE 1HJAB 3TNSA 2BYAX 1BTPA 3RXRA 4ZHAA 1A5IA 1XUFA 2Y80A 3E0NB 1GCDA 1O2XA 5C2ZA 3M3SA 3ZVBA 2JETB 1IQIA 1T7CA 1ZLRA 1K2I1 1UTQA 1FNIA 3KN2A 3SUEA 4WXVA 3UWIA 1C2GA 1HBTH 1XUKA 4WWYA 3GY8A 2AERH 5DP8A 1COWD 3SORA 3CP7A 2ASUB 3EA8A 1HJ9A 3OEHD 5FCRA 2FYQA 2FOCA 3RU4T 1Z8GA 1UTPA 2QCYA 3KF2A 3FP6E 4ZROA 1AFQC 3T26A 4ABIA 1W14U 3RC5A 1EP6A 2PUQH 1ZTLA 3M5LA 6LPRA 1GDNA 4DIIH 1K21H 3CENA 1EZXC 1IAUA 1PQ7A 1C5SA 3H09A 2ZCHP 3AW1A 1TOMH 5CHAC 3FP8E 1ZJDA 4R8TB 3RXIA 3QZQA 1KXFA 1V2UT 2FOHA 3UNQA 2RA0A 1FY1A 3E0PB 3ZZ5A 2A32A 2XBXA 1F5RA 2GGVB 4X1SU 1TNIA 1Z7KA 4NZQA 1BOQA 3UOPA 2SGPE 3P95A 2FLRH 1TWXB 2OQ5A 1HAOH 1O5AB 1P9SA 3Q3YA 4FXGH 2B7DH 1V2WT 3SHAH 1QGFA 1SMFE 2QXGA 2TRMA 4X0WU 1SGYE 1VITH 3I78A 1Y3UA 1XUHA 1QL8A 1CGHA 2O8LA 1KIGH 3A82A 1CHOF 1O5FH 5C1YA 1AWFH 4NSVA 4O9VA 5HM2A 3F9GA 1B0EA 1W7XH 3EA7A 1GJ7B 2Z7FE 1JWTA 2Z3CA 1BHXF 2A4QA 2AEIH 1TNHA 1JIRA 2XBYA 1S5SA 4AB8A 1YPHC 2H2ZA 2J9NA 4KP0A 2HLDD 1WYKA 4UFGH 1ANBA 2SFAA 2D8WA 1E79D 1NFXA 2JH5D 3LKWA 1F92A 2OQUA 1HAVA 1G3CA 1WOFA 1C9TA 1W12U 2ANYA 1AB9C 2ZEBA 1SG8B 1O3IA 1E36B 5FPSA 4YT6H 1YP9A 3NXPA 2PTNA 4JZEH 2XYAA 1NM6A 5JBCS 3GY3A 2ZDMA 2XNIA 1QRZA 4B74A 3ZZ6A 1Y5UT 1BB0B 1RGQA 2PGQB 2ZDKA 2NU3E 4B6FA 1ZR0A 6CHAC 4B71A 1TPAE 1AVGH 3ATMA 3VB3A 1UHBA 1GBFA 2ZHEH 1SR5C 1L4ZA 2Y81A 5E8EH 3BIVH 3ENSB 1B5GH 5E2OA 3SNCA 2HALA 5EJZA 3U8TH 1GWAA 4AOQA 1S81A 5FPTA 2ZNKH 3N7EA 4Y76A 3RXVA 1C9PA 1SLUB 2FI4E 1DXPA 4YLUA 4RKOB 3B9FH 5F8TA 4ABBA 1ANDA 1H8IH 1O0DH 2JIZD 4MLFB 1C5TA 1IQNA 4QT8C 1NFUA 1XXFA 5KECA 1ABJH 3M7UA 5BRRE 3JZ1B 1C1WH 1UK2A 2GX4A 2OD3B 2BZAA 5GCHF 3RXQA 3N99A 1P3CA 1O2UA 2A0QB 4ZCNA 3ZZ3A 6GCHG 2Y5HA 1T8NA 4KTCA 3SJIA 1SQOA 1OYTH 4I8JA 2FO9A 1EZQA 4HFPB 3MU0A 1BA8B 1T31A 2FOAA 3FFGA 1O32A 1QJ1B 1MKXK 3GDSA 4MNXA 1O3NA 4X2YA 3F0OA 4BTTB 2AGIX 1O2PA 2C8YB 3RU4E 1AWHB 1TX8A 4H6TA 1EKBB 3SV7A 2ZDVH 1ELCA 2ZU5A 1MTNB 4ABJA 3A88A 1CGJE 1TOCB 4AORA 1VGCC 1K1PA 3GOVB 2QXJA 1UTMA 3MNCA 3SNEA 2ZTZA 1EJMA 2C8XB 1DSUA 2SGEE 3GY7A 2PKAB 1JXPA 1TQ7B 5JBAS 2ZFQH 2VWLA 1Z8IB 1IQLA 1PQ8A 1HAZB 4I86A 1HYLA 1YPJH 3QZRA 1OHHD 4E7NA 3MNXA 3LJOA 1GL0E 3T5FH 5HM9A 1V2MT 1V2JT 1E37B 1ZHMA 4ISHH 2ULLA 1PFXC 5A0CA 2ZZUH 1PYTD 2VIWA 5GXPA 2XXLA 3OTJE 3HKJB 1O36A 1H9LB 2H9EH 2W6JD 1JRSA 3OY6U 4DVAU 2OLGA 1UTKA 8LPRA 3A8DA 1T8LA 1UVSH 4K3JA 1O3GA 5C1UA 1AFQB 2EQNA 4DG4A 3RU4D 1BRUP 1K28D 2WV5A 1MKWK 4LZ4B 1CO7E 2Q6GA 1AVWA 1ELDE 3UQOA 1C2MA 2ZDNA 2A5AA 4LZ1H 5CHAB 2UWOA 2ZO3H 4ZH8A 3TGKE 2A2XH 3BTKE 1C2JA 4X8TH 2JJ2D 2UWLA 1X7AC 2OUAA 4I8HA 2Z3DA 3HK3B 1K22H 2ZCLP 1DICA 1AO5A 1OWKA 3SNDA 1O3FA 5T1VA 1H4WA 3F3BA 1AMHA 2ZU4A 4B76A 2CF8H 1C5PA 3TJOA 4WY3A 1MAYA 1BBRK 4Q4LA 3TK6A 1RTLA 4LXBH 3TGIE 1DOJA 2LP6A 5ESBA 3A7YA 1GBLA 4UFEH 5EXMA 4X6MA 1OSSA 3T62A 4NSYA 2BY8X 1GHYH 3F2HA 4DURA 1DPOA 2VVVA 4WMEA 1Y3YA 1QNJA 4CR5A 2H1UA 1TRNA 4UD9H 1WV7H 2G52A 2HGTH 4CRBA 3SOSA 1N6YA 1ABIH 3A83A 3TH2H 4BAQB 4AFZA 3A7TA 3DHKH 1D4PB 3H7TA 2AMPA 3PB1E 4XSKU 5C67A 1RIWC 1CE5A 2PKSC 3GY2A 3T28A 1A0LA 4D7FA 1CA8B 3GCNA 3RXEA 1MCVA 2QN5T 2TIOA 1EAUA 1G36A 4WVPE 3SU4A 1AB9B 2FI3E 2WSSD 1HXFH 5CHBA 2M2AA 3ATLA 2QF5A 1LTOA 3LJJA 3VPKA 1XM1A 4Y71A 4Q7ZA 1QTFA 1Z71A 2GMTC 2OP9A 4X1NU 1MTUA 4OS6A 4OS2A 1TX6A 6CHAB 6ESTA 4MPUA 1O3CA 1P2JA 1UTJA 1UK4A 1RJXB 5EPYA 1TA6A 4P02A 5EXNA 1IQHA 3F9HA 1C2FA 3HKIB 1UMAH 4MPWA 1GVKB 2BDAA 2GZ7A 3AVZA 4XDEA 1TYNA 4Y0YE 3A89A 3GISB 1ETSH 2FODA 5K0HA 3QLPH 1GI6A 3SYJA 5EIYA 1LHDH 3UREA 2VWMA 1O3JA 1O2OA 1C1MA 1DM4B 3KQDA 1O3BA 2BVSH 4I8KA 3RP2A 1CT0E 4ABFA 1OWJA 1M9UA 1E38B 4CBNA 1GJ4H 2DUCA 3KCGH 4ZKOU 3ZVFA 1C4U2 3ZIAD 5FBIA 1C1VH 4PROA 2ZGHA 1CVWH 1QRXA 4I31A 1P09A 5C3NA 2Q6FA 3E8LA 1F0UA 3QGJA 2FI5E 2JJ1D 2XWBI 1O2RA 1P02A 1AUTC 3O8DA 3LGYA 3BTGE 1ZRBA 4BXSA 1O2YA 2O8WA 2OC0A 4IN1A 1VGCB 2AH4X 1OS8A 4B2BA 3SUDA 2A4RA 1V2VT 2ZFSA 3A8AA 1ELGA 1DLEA 1GVLA 3SBKA 1Q2WA 1Y5BT 4F4OC 2RA3A 2BMGB 4R0IA 3A80A 2P94A 1DE7H 2AFQB 3P8NA 1W3CA 2WHXA 1ESTA 3VB4A 4ASHA 2QA9E 5HMAA 2FZZA 1QFKH 1DSTA 4BTUB 2VVUA 3MI4A 1FX0B 1T8MA 2LNCA 1GJBB 4YOIA 2PSYA 4X8UH 4JK5A 2J98B 2BDBA 2G5VA 4DIHH 1IQKA 2GKVE 5C5OA 4J1YA 3RXKA 1TBQH 1HUTH 2ZTXA 2V6NA 4YZUA 3HK6B 3CS0A 4FUEA 2B8OH 1SLWB 5J4SA 1SVPA 3IG6B 4X2XA 3SV6A 4GCHF 2D2DA 2ZI2H 4TY7A 5DN6D 3VGCC 4K69A 2ZHDA 3RXCA 1A61H 1QBOA 4I8LA 2GT7A 1P04A 4Q7YA 1O2IA 3M36A 1BRCE 1DDJA 1ZSKA 3S9AA 3TIUA 4YOJA 1O2NA 3RM2H 2XC0A 2FX6A 1P06A 4IMZA 4NZLA 3A84A 2PGBB 1GJ8B 1HCGA 2QIQA 2L74A 3A7XA 5L6NH 4IBLH 1N6XA 1Z6EA 4Y0ZE 8GCHG 3FZDA 2GDEH 1RTKA 1QB1A 2G5NA 4ISNA 4Z0KA 1MKXH 4X2WA 3ZZ9A 1EASA 1GBBA 3UNRA 2UWPA 3GYMA 1NC6A 4ISOA 2NWNA 1P2OA 1QIXB 2AIQA 3ZZ8A 1J15A 1W11U 1FLEE 2O8UA 3BEIB 1BRBE 2BM2A 3ODFA 1O2TA 3NCLA 5A09A 1W2KH 1RIWB 1GHAG 4NWLA 2BD3A 2PKSB 1ARCA 4A5TS 4B73A 1BTXA 2GV7A 3DSOA 3NZIA 1TGCA 1TPSA 1A46H 1MU8B 2FOMB 2F3CE 1AIXH 3NRLA 2OTVA 3OYPA 1G2MA 4DT4A 1LVMA 1GMDG 1TABE 1GBTA 2LPRA 5T3HA 3TJUA 4AYVB 2GMTB 4I33A 2ZPQA 3P92A 4RT0A 3RXHA 1NY22 2FXRA 2HLCA 1O5CB 2PV9B 1AZZA 1P2QA 3A7ZA 3CNRA 2F9BH 5DP3A 4ABEA 4UFDH 4O97A 3LONA 3AAUA 1Q31A 2ANMH 1FJSA 3LPRA 3M61U 2GT8A 1QRWA 5LPFA 2Y5FA 3TK9A 2Y7ZA 3EE0B 2J94A 1E1QD 1BTZA 1EZSC 2W7UA 1O2WA 1LPZB 3QWCH 4YM9A 4NG9H 1BTYA 2J5UA 3E6PH 2R0LA 1V2NT 2BQ6B 2Q1JA 1FONA 2VVCA 5A8YA 1ZHPA 2CJIA 1P2KA 5FXLA 4JCNA 3D65E 1YBWA 2FWWA 2KCPA 2LELA 1TBZH 3S9CA 1YGCH 4Y10E 2PKAA 5DP9A 2XC5A 1LPKB 2ZGJA 1ORFA 2H9TH 2V35A 2VIPA 4A1XA 5HYOA 4CRFA 2IJD1 3MNBA 4DW2U 3R0FA 3OTPA 2F4LA 2PR3A 3PMJA 2QC2A 3QX5H 1WTHD 3PRBA 2ZDAH 1MABB 2JDID 4YTAA 2WV4A 3DD2H 4YXWD 2BD9A 2JKHA 1MCTA 3CS7A 2CMYA 1XUJA 1QB9A 2B5TB 2ZQ1A 4X2VA 5CE1A 2FOGA 3ZZCA 5KEDA 4Q7XA 4AG2A 1BHXB 2FPZA 3TLOA 1WCZA 2O8MA 3PMHB 4MNWA 5C0UA 4LOYH 3AASA 3S7KB 3SU5A 1AE5A 1VITG 2F43B 1YYY1 4IGDA 1SB1H 3GY6A 1NRNH 1Z6JH 1CU1A 2WINI 3LT3A 3JZ2B 2D1JA 3Q77A 3ZYEA 2GCHF 1ESAA 1QQ4A 2BD8A 2TBSA 5LPEA 1E0FD 2BDGA 3F2FA 4XE4A 3OEED 4ISLA 1D6WA 1TGTA 1LHFH 2VIDA 3BF6H 2Q6DA 2UUJB 4AX9H 3LOXA 1A3EH 2ZP0H 1GHBF 5T6FA 2YMSC 2XCFA 4UONA 2ZFFH 1EQ9A 4X1RU 1QURH 5JDUB 3VFEA 3O8RA 3P6ZB 1SC8U 3SHCH 3T2NA 3RMOH 2KR7A 1OP8A 1GBEA 3ATKA 2QYIA 3PV2A 1YF4A 1GHWH 3VB7A 5A8ZA 2P16A 3S69A 2XOKD 4GVUA 5JYIA 3VGCB 3BV9B 3MQKC 1P0SH 3EE7A 3UFAA 1UVUH 4BANB 4NFEA 4TT3D 4K1EA 3PTBA 2P8OC 1BUIA 3V0XA 1F0RA 1NRRH 3GCTF 1O2LA 3G01A 4K5ZA 1IQGA 1HAYB 5EXLA 5FPYA 4IMQA 3RDZA 1AFEH 4CH2B 1IQEA 1MQ6A 2KZ4A 4CRDA 3NUMA 1IOEA 5I25A 5JB8S 2ZHFH 2XW9A 3NPSA 1P10A 2WPLS 2BY7X 1HIAB 1DVAH 1SGIB 1G37A 2BD2A 4F48B 1QQUA 4M7GA 2H9HA 1C2LA 4JMYA 5DP6A 4E7RG 1XUGA 4NGAH 1SSXA 2J2UA 2WZQA 3TVJB 2BD4A 2H5CA 3LC5A 1S0QA 1DXWA 1O35A 2BOHB 3FVFB 3URDA 3QO6A 4JZFH 3T27A 1AD8H 3RXAA 1AZ8A 1ANEA 1C5OH 1PQAA 1O37A 1HJ8A 2D26C 1MH0A 3K6YA 1FN8A 3SQEE 2GDDA 4MNYA 1WTGH 3VG8A 4RN6A 1TGSZ 1OP2A 1ZSLA 3SGAE 1SGEE 2B0FA 2BXUH 2C90B 3ZZAA 4TPIZ 1EXFA 2BQ7B 5LGOA 1DT2A 1EZUC 4OS7A 2FM2A 4XBDA 5GPIB 1CBWC 2XBVA 3MMGA 2OC7A 4HI3A 1P2IA 1UK3A 2EI8A 2QE7D 1BMFD 1HDTH 1SLXB 2OK5A 1FIWA 2BDHA 1HPGA 4GPGA 1OYQA 3KHVA 5EW2H 1DWBH 1TNKA 4DOQA 3BTWE 1O2VA 3W1EA 4WMDA 7GCHF 2PHBA 3D49H 2CV3A 2HPQH 1O38A 1BDAA 1PQ5A 1G9IE 1MQ5A 1GHZA 1NU9A 2FESH 5ABWA 1VKYA 3STIA 4INKA 4OGXA 1GBAA 2VH6A 1CT2E 3DFLA 2GP9B 3ZZ7A 7KMEH 3MTYA 1C2EA 1NRSH 3W94A 3SU6A 1NTPA 3FN8A 4O3UA 1GI4A 1GCTC 1GI1A 1SQRA 3FAOA 3D23A 3MH4A 2PFEA 3C1KA 3KQ5A 1VZQH 2OC8A 1G3DA 4TSFD 2BLOA 3PWBA 2ZF0H 3ZVEA 1GG6C 2G00A 2K0QA 3F9FA 1IQFA 4U32A 3ZVCA 5C17A 4GHTA 3QGNB 4VGCC 1LCYA 3LU9B 2WPKS 4KTSA 1J14A 3K6ZA 1EJAA 4ACBA 1GDQA 2J98A 2V7QD 5F8ZA 1G3BA 2EI6A 1BBRE 1CHOG 4UEHH 3WW7A 4Y7AA 1YPHE 3EQ0H 4FUDA 8KME2 1LHCH 2QF3A 4FU8A 2A1DB 1SQAA 3F2GA 2GTBA 2W26A 5DP5A 2SGDE 1J8AA 1ELTA 1TGNA 2BLQA 3BN9A 3F1SB 4FVDA 2J92A 1GBIA 1GMCF 3N7DA 1TAWA 2PW8H 2ANWA 1O3LA 2PP6A 1KY9A 3M5NA 1GGDC 2YMSB 1YCPH 1ZOMA 4JZIA 4Y8YA 2F83A 4CH8B 1A3BH 2FLBH 1O3EA 5DG6A 1SL3A 1O3OA 1RTFB 4MQAA 2PTCE 2ODPA 1L1JA 2WYGA 3GY4A 3A7VA 3MU1A 1O5BB 1O2JA 3UUZA 2IPQX 1OWEA 2P8OB 3GS9A 3QK1A 1P12E 3EAJA 1OX1A 5EQSA 5FCKA 1WU1A 2QF4A 3MYWA 4B2CA 3UR6A 4KKDA 3SJOA 3BTDE 1FY5A 1HFDA 2Y5GA 4NIXA 1EPTC 2NU2E 2ZKSA 2SGQE 1C1QA 1S82A 4FU7A 3RMLH 2TGAA 1SGFG 4TYDA 5AFZH 1JOUB 1EB1H 3SU1A 1UVTH 3UR9A 5GCHG 3QTVH 4X1QU 1IHTH 2XCNA 3U28C 4K8YA 3RXDA 4WH8A 1V6DA 1L1GA 4HTCH 3LGWA 3I77A 1LPGB 1O33A 2FP7B 3F68H 1AKSB 1ELEE 1GBHA 1O5DH 2BLWA 2H6MA 2ZFRH 5T6GA 4ABDA 1GI8B 1O5GH 4TWWA 1IHSH 2HPPH 4IN2A 3PM3A 1QBVH 5GDSH 4CREA 5CDFE 2GV6A 4YT7H 1GDUA 2FMJA 3HATH 1DUEA 3ZVAA 2AYWA 5DP7A 1A0JA 4CRCA 3P8OA 4BAMB 2FYRA 3L3TA 1NPMA 5B6LA 5FAHA 1KXAA 1ZMJA 1S84A 2XRCA 5EJLA 1Z8JB 1HNEE 3BTME 2ZCKP 1PJPA 1D3QB 3TNTA 2P95A 1SGCA 3DA9B 1OKXA 4E06H 4WMFA 2IPHA 1WUNH 4Q2KA 1EAXA 1CBWB 1Y3XA 4CHAC 5E0JA 2P3TB 3BG8A 4JYVH 1ZYOA 5LPRA 2WV9A 1DUAA 5EG4A 1CSOE 3MU4A 1C5YB 4A7IB 1XVMA 1C5XB 2OXSA 3KNXA 1EUFA 1HGTH 4MPXA 1MTSA 3U98H 1AGJA 4F49A 1W8BH 4BAHB 1O3PB 1Z1IA 5I46H 3L33A 3UNSA 3DCLA 1GBDA 1JBUH 1ZJKA 3OY5U 4LK4A 1TPOA 1NRQH 1VCPA 1ZPBA 1A5GH 3QN7A 1ETRH 4NA8A 2PSXA 2VWNA 3RLYH 2F9UA 3V3MA 2XBWA 5H4IB 8ESTE 3RXSA 2O8TA 4ZXYH 4AFSA 1IQJA 1DY8A 3H5CB 1TMUH 2W3KA 2CF9H 3RXLA 1GCTB 2C4FH 1XXDA 5F53A 3F0PA 5DPAA 2WPJS 1TMTH 3OAAD 1VCWA 1NESE 4MPVA 4XOJA 1GG6B 1GBKA 1C1PA 1GHAF 4UDWH 2J38A 2P3FH 4ZXXH 1GMHF 4XD7D 3KEEA 3SI4H 1YLNA 4VGCB 2BDIA 3EGKH 5TJXA 4BAKB 1NO9H 1S0RA 5FHTA 1DY9A 2ZIQH 5T6DA 5FL7D 4A1VA 3L6PA 1LMWB 2OINA 1EP5A 4FUIA 1KLTA 2Y6TA 1WAYB 1GJDB 4RT1A 1ZPZA 1WXRA 1SFIA 2AMQA 1SLVB 3RXPA 5AVDA 2BLVA 1TLDA 1EATA 2YOLA 3E91A 2W5EA 3PLPA 1AUJA 4RI0A 1KLIH 1FV9A 3S9BA 3QUMP 1EFRD 2ZG0H 3RC6A 1AY6H 3U69H 1H9HE 1SGFA 3SJ8A 1TNGA 1H9IE 2KAIB 3PLKA 3SV2H 1THRH 1BQYA 1QJ7B 4FUGA 4HGCA 1DWEH 3MO9A 1GGDB 1QA0A 3Q3XA 1PPBH 3FO8D 1P2MA 1AVXA 3SU3A 1J16A 1SBWA 3TH3H 2BOKA 1CHGA 4AGKA 3MH5A 1C1UH 3F6UH 3KGPA 1HB0B 3SI3H 3UQVA 4IC6A 5J4QA 5ETXA 4XRNA 1ELVA 2ZPSA 1HIAA 1V2LT 4MG3A 1TA2A 4NCYA 1NBME 5G4BA 3VB6A 4BXWA 1ZHRA 1F7ZA 1HAIH 2F9OA 4B6EA 2ODQA 2H5DA 3WWFA 3BTHE 2ZGBH 3HPTB 5AHGH 3T25A 1D6RA 3PV4A 3LH1A 3UOUA 2JH0D 3H7OA 1GHXH 4BNRA 1GBMA 3PO1C 1EPTB 5EJ1A 1OWHA 3TGJE 3MU5A 2EEKA 1LO6A 1T8OA 1YY3A 3ELAH 2RDLA 1HAXB 3RC4A 5SGAE 2BQWB 2ZPRA 1SGQE 1V2TT 3GDVA 1PPEE 3MO3A 3MU8A 1BTWA 5DP4A 1Q3XA 1ZMNA 1CT4E 1UVPA 1BCUH 2G55A 5HIZA 1OXGA 2HNTF 1TALA 1NFWA 4H4FA 1CGIE 3PROA 1ELAA 2W3IA 2VGCC 1XUIA 4UE7H 4CRGA 3KL6A 3VB5A 5F8XA 2TGTA 1HXEH 4XBCA 1O3HA 3EA9A 2VJ1A 2A5KA 1C1TA 2OC1A 4K1TA 4AN7A 1MZAA 2ALVA 1ESBA 2R0KA 2G4TA 2C8WB 1YCPK 1TX7A 1KXEA 1D3TB 3RXOA 1CA0C 3IITA 2ZHWH 2A5IA 2F9PA 7LPRA 4X8SH 5HKKD 1C5NH 3I29A 4ISIH 2SGFE 1UO6A 3Q00A 4AYYB 3O8BA 3RXGA 1F0SA 2KX4A 1JIMA 1O31A 1A4WH 1C4Y2 2V3HH 4WJG2 5DO4H 4FUJA 1ZGIA 1C5ZB 2Z3EA 4ZMAH 4GHQA 2A7JA 1P8VC 1A5HA 4SGAE 3RMNH 3UTUH 5AF9H 1SGTA 2P93A 1QR3E 4A6LA 2QXHA 2R3UA 1YM0A 2L6OA 4WXIA 3V7TA 4Y79A 2W6ID 4XFQA 5B6OA 1W13U 3PV5A 3SO3A 3M7TA 3BTTE 3ZVGA 1OWIA 2VH0A 4ZKNU 2WPMS 3M5OA 4FUHA 2JH6D 1HLTH 1SHHB 4KELA 1K9OE 4DJZB 3M35A 1VCQA 1HAPH 1V2QT 1VJ9U 3KIDU 3SUGA 1S6LA 3RXJA 1SOZA 3SW2B 3R3GB 4NA7A 1S6HA 1PPHE 1V2KT 2I6SA 2VNTA 2HOBA 5A8XA 1LQDB 5HXFA 1FY3A 1L0ZA 5JBBS 1NFYA 4MDSA 4ZKRU 4NFFA 1O2ZA 5F6MA 1TRMA 2GCTC 3MH7A 4YESB 5F03A 3BTQE 1H1BA 3PWCA 2UUYA 1DX5M 1MUEB 4CBOA 1Y3VA 3LGTA 3GYLB 1RFNA 1GJAB 2QAAA 1PPGE 2UUFB 4Z6AH 3TU7H 2FOBA 2ZFPH 3PYHA 3TH4H 4D76A 1ZZZA 2EC9H 2OBOA 2SNVA 1TONA 1OP0A 3OFND 5PTPA 1KMHB 1MTVA 1KLJH 1C1NA 3KQEA 4KTUA 4IC5A 2ZU1A 2GJGA 2ODYB 3ZV8A 1INCA 1QY6A 1BJVA 3SV9A 2DE8A 1C5UA 3ZZBA 2P3UB 5GWZA 1T4VH 4K2YA 1GJ5H 4Y8XA 3HGPA 2AMDA 2XWAA 1RRKA 4OS4A 1KSNA 4DY7B 1H8DH 6GCHF 4NWKA 1ZMLA 4I7YH 1AQ7A 2BXTH 3RXMA 1NROH 5EGMA 3SJ9A 3SJKA 4U01A 2A31A 1AN1E 3A85A 3LGIA 4MVNA 1V2OT 4Y7BA 1HRTH 2ZQ2A 3PRDA 5L2YH 2ZA5A 1O2HA 2ZECA 1PPZA 1W7GH 2R2MB 3BIUH 2Z9JA 1AKSA 2ZWLH 4ZUHA 1KXBA 1KDQB 1H8HD 1PYTC 1WSSH 2PUXB 1MMJN 1MZDA 1XX9A 1F2SE 3PO1B 3M3VA 3P8GA 2A4OA 4DT7B 5C20A 4Q63A 1PPCE 2QGRA 1YLCA 5EQRA 3GCHC 4ACAA 2PLXA 1THSH 2VIOA 1SGDE 1O3MA 2A7HA 1P01A 1ID5H 2QF0A 1N1LA 9ESTA 2GZ9A 1P3EA 2F9VA 3PLBA 3GY5A 3ZZ4A 1MBMA 1N8OC 2ZHQH 1V2PT 1OPHB 2I6QA 3TJNA 3D62A 4TPYA 3UY9A 1YPGH 1YLDA 2V3OH 3FZZA 1DWDH 1S6FA 2R2WU 1OWDA 3BSQA 2FX4A 3MNSA 2VGCB 1PPFE 2Z9KA 5E2PA 1C5LH 4K60A 4ABGA 1ZSJA 1BZXE 4AB9A 2EI7A 4AC9A
chains in the Genus database with same CATH topology
1K1LA 2VB0A 1LVYA 3ODDA 5TCCA 1F5KU 1LVBA 4IW4E 4FUCA 3ZV9A 2YNBA 1EAWA 4XBBA 1DS2E 1C5WB 1CA0B 1FZZA 3RM0H 2PWXA 1GPZA 1BTHH 1V2ST 3STJA 3DUXH 1IQMA 2FTMA 3SU0A 2VU8E 3ZVDA 3U9AH 2J34A 5BPEA 2WYJA 1O5EH 2AGGX 3ITIA 1NRPH 2GCHG 1XVOA 3K65B 1V2RT 4O3TA 1L2EA 3VEQB 2R3YA 7ESTE 1GHBG 3A7WA 4JYUH 2O9QA 4MNVA 1TNJA 3SNAA 1FN6A 3KQBA 3UIRA 2Y7XA 1GL1A 2THFB 1AU8A 4YO9A 1K1JA 2FEQH 1SGNE 4ZHMU 1GI0A 3GCOA 4ZAEA 1BITA 3WY8A 5EU8A 3M37A 2BB4A 1Y8TA 1GI9B 4H6SB 3U1JB 3MOCA 1XKBC 2BX3A 1UTNA 1C5VA 4NIVA 2ILNA 1UJ1A 1RD3B 5E0GA 1SI5H 1O2SA 5L30H 3E90B 3GCTG 4JZDH 1TB6H 2WUCA 1AHTH 2J95A 1BRAA 1FI8A 5JBTA 3A81A 3LC3A 3ATIA 2W7SA 2KAIA 2QY0B 2HNTC 3LGVA 5FX6A 2P59A 2GCTB 3U1IB 1YCPM 3V12A 4X8VH 3A87A 1VR1H 1NU7B 4ZKSU 4K8BA 1XKAC 5E0HA 2G4UA 4WH6A 5K7RA 2A2QH 1L1NA 4OS1A 1DLKB 2GZ8A 1ELBA 1G32B 2M5TA 2TPIZ 4FUFA 3A86A 1C1SA 3MHWU 4I32A 2NU1E 2V0BA 2ZGCA 3HGNA 1O3DA 4GSOA 3M7QA 1O30A 4DCDA 1FAKH 1F5LA 2HVXA 2BD7A 4JYTA 2FOEA 5IDKA 3BG4C 3ATWA 3PMAB 2BD5A 2IJOB 4GUXA 3SGBE 1L4DA 2ZC9H 1AE8H 4OS5A 3S7HB 1HAHH 1A1RA 1ZTJA 4B1TA 5FBEA 2YNAA 2IOTA 1EPTA 3BEUA 2ZFTA 1O2KA 3V13A 4TY6A 3A8BA 4DGJA 1QHRB 2CHAC 3NK8A 1EB2A 1LKBA 2RG3A 1B7XB 1P9UA 1TE0A 1FUJA 3SUFA 3URCA 3LDXH 1ZTKA 3GDUA 3DT0H 1NS3A 1WBGB 1KTTB 3E16B 4BTIB 1UTLM 4RSPA 1W0ZU 1HAGE 4WF8A 3PMBB 2BY5X 4OGYA 1LDTT 2QV1A 4B2AA 1ETTH 2FS9A 3LGUA 1SGRE 4K1SA 7GCHG 1D9IA 4MTBA 5L2ZH 1C4V2 2IN2A 3GCHB 2FDAA 1K1OA 4I8GA 1ZPCA 3W95A 1ANCA 4YLQH 1VJAU 3Q3KA 5DJ7A 1JRTA 2G81E 4INLA 1O34A 4NA9H 1N8OB 2VIQA 4X6PA 3U8OH 2Z94A 1GJCB 1SFQB 1TFXA 1S83A 1O2MA 1O3KA 3AAVA 2RCEA 2J4IA 3VXFH 1GI5A 3ZZDA 1MBQA 2G8TA 1C2HA 1KXCA 2Z6BD 2FOFA 1UCYH 1A7SA 2WPHS 3EDXB 4SGBE 1G30B 1YPMH 1Y59T 1O2QA 5EPNA 4BAOB 1V3XA 4ABHA 1SGPE 1QJ6B 1G2LA 2HNTE 3RXBA 2B9LA 3FP7E 4KGAA 4X6NA 3P17H 1MD8A 1MAXA 3RXUA 2AS9A 4Y6DA 4AFQA 4YOGA 4UFFH 1O3AA 1QA7A 2BVXH 5GJ4B 1B0FA 1C1RA 1Y3WA 5C5NA 1Z1JA 5A2MH 1Z8RA 4NIWA 1ZRKA 2C8ZB 2CXVA 3OSYA 3E3TA 1HAVB 1GJ6A 2ZU3A 1LQEA 1GMCG 3VXEH 1KYNA 4Y11E 4BOHA 1BMAA 4NIYA 2A45B 2ANKH 3GICB 1BIOA 3K9XB 1BT7A 3SQHE 2BY6X 1ZGVA 8GCHF 1K1MA 2C93B 2XC4A 1GI2A 2DE9A 1TBRH 1ELFA 2SNWA 1UHBB 3UPEA 1UTOA 1WQSA 1EOJA 2GVFA 3FANA 2BDYA 4J2YB 1FIZA 2R9PA 1BMNH 3KQCA 3M3TA 5EQQA 3BTFE 1TPPA 4D7GA 1NZQH 3MWIU 5EW1H 2WUBA 4AFUA 3B23B 2SGAA 2F9NA 4GAWA 3TK5A 3TJVA 3B8JA 2OCVB 2BVRH 1JMOH 4B75A 3OU0A 2WPIS 1HJAC 3SN8A 1GMDF 3C27B 1MD7A 1D3DB 1FAXA 1FPHH 2JETC 3MH6A 3RXTA 3U8RH 1YPKH 1J9CH 1NN6A 3NWUA 4FUBA 1W10U 2BY9X 3NKKA 2BDCA 5IYTA 4AGJA 4Q80A 4JZ1A 1GBJA 1DWCH 1FPCH 2A4GA 4H42U 1FXYA 3O8CA 5CMXH 4CRAA 2A7CA 1TNLA 2Y82A 5A0BA 4A1TA 4X6OA 2ZDLA 2ESTE 1CQQA 1E34B 1W0YH 1F0TA 5A0AE 1BTUA 2XTTB 3SU2A 3BG4B 2EA3A 1QL9A 1DITH 3K2UA 3ESTA 3TPIZ 3RUOA 1KDQA 1OOKB 1D3PB 1TIOA 2CGAA 3F9EA 1YPLH 1BJUA 4D8NA 2VIVA 3IWMA 2BX4A 1QCPA 2TGPZ 4X1PU 1QBNA 1SPJA 1LKAA 2CHAB 1GHVH 2UUKB 3DFJA 5C1XA 1T4UH 1GI7B 1A2CH 4RKJB 3ZYDA 1EX3A 1EAIA 2OBQA 4INHA 1K1NA 3BTEE 1GJ9B 5JB9S 3A8CA 4FU9A 1GI3A 1RS0A 4U30A 5AFYH 4AZ2B 1J17T 1LHGH 2FS8A 1FDPA 4ABAA 1DFPA 1UVOA 1XMNB 5ESTE 1A0HB 1TGBA 4FVBA 3RLWH 4CR9A 1KXDA 3SNBA 1KTSB 3QTOH 2TGDA 1E35B 1GBCA 5FX5A 2FTLE 4GLYA 3SZNA 1U6QA 3MO6A 2BTCE 2ZU2A 1LVOA 2Z9GA 1VITF 3SV8A 1LHEH 2NU4E 3EYDA 4IS5A 1EOLA 2NU0E 2STAE 1FMGA 1G3EA 3SGQE 2GD4B 1T32A 3T29A 1TRYA 3OX7U 4ESTE 1C5RA 2F91A 5JPMH 3QDZB 1O2GH 1C2KA 1THPB 2VINA 1DANH 1BMMH 5LH8A 2ZTYA 3AW0A 3Q76A 5DGJA 5TCAA 1GMHG 4HZHA 4Y8ZA 1C2IA 9LPRA 1P2NA 1SHYA 1Y5AT 1SQTA 1SOTA 4E05H 2HWLB 2C3SA 3PTNA 4CHAB 1YKTA 4AG1A 1WQVH 2HRVA 2Z9LA 1FQ3A 4D9RA 5GIBA 2K1QA 2QXIA 4ZHLU 1AI8H 1UCYE 3LH3A 1P05A 2AGEX 5EODA 1TMBH 4D9QA 1ACBE 1YC0A 2BZ6H 1C5QA 3BEFB 1C2DA 1EJNA 1FY8E 3P70B 2ZGXH 1P57B 1MKWH 1HV7A 2AIPA 1YPEH 1QL7A 1FY4A 2G51A 1BMLA 4THNH 1QB6A 1MU6B 4O03A 1P11E 5HGGA 2Z9IA 2ALPA 3P8FA 3N7OA 3M5MA 1S85A 5EOKA 1C1OA 1MTWA 2CN0H 4GCHG 5DK1A 3LIWA 3MFJA 3RXFA 1O39A 4TWYA 2VWOA 3S0NA 2BHGA 4JK6A 1RXPA 4U2WA 1ARBA 1K1IA 1NT1A 2FIRH 1GVZA 5DKMA 1BBRH 4A92A 1P03A 3E1XB 3UWJH 1TQ0B 3TITA 1C5MD 1MTNC 1UCYK 3RMMH 2STBE 1HJAB 3TNSA 2BYAX 1BTPA 3RXRA 4ZHAA 1A5IA 1XUFA 2Y80A 3E0NB 1GCDA 1O2XA 5C2ZA 3M3SA 3ZVBA 2JETB 1IQIA 1T7CA 1ZLRA 1K2I1 1UTQA 1FNIA 3KN2A 3SUEA 4WXVA 3UWIA 1C2GA 1HBTH 1XUKA 4WWYA 3GY8A 2AERH 5DP8A 3SORA 3CP7A 2ASUB 3EA8A 1HJ9A 5FCRA 2FYQA 2FOCA 3RU4T 1Z8GA 1UTPA 2QCYA 3KF2A 3FP6E 4ZROA 1AFQC 3T26A 4ABIA 1W14U 3RC5A 1EP6A 2PUQH 1ZTLA 3M5LA 6LPRA 1GDNA 4DIIH 1K21H 3CENA 1EZXC 1IAUA 1PQ7A 1C5SA 2ZCHP 3AW1A 1TOMH 5CHAC 3FP8E 1ZJDA 4R8TB 3RXIA 3QZQA 1KXFA 1V2UT 2FOHA 3UNQA 2RA0A 1FY1A 3E0PB 3ZZ5A 2A32A 2XBXA 1F5RA 2GGVB 4X1SU 1TNIA 1Z7KA 4NZQA 1BOQA 3UOPA 2SGPE 3P95A 2FLRH 1TWXB 2OQ5A 1HAOH 1O5AB 1P9SA 3Q3YA 4FXGH 2B7DH 1V2WT 3SHAH 1QGFA 1SMFE 2QXGA 2TRMA 4X0WU 1SGYE 1VITH 3I78A 1Y3UA 1XUHA 1QL8A 1CGHA 2O8LA 1KIGH 3A82A 1CHOF 1O5FH 5C1YA 1AWFH 4NSVA 4O9VA 5HM2A 3F9GA 1B0EA 1W7XH 3EA7A 1GJ7B 2Z7FE 1JWTA 2Z3CA 1BHXF 2A4QA 2AEIH 1TNHA 1JIRA 2XBYA 1S5SA 4AB8A 1YPHC 2H2ZA 2J9NA 4KP0A 1WYKA 4UFGH 1ANBA 2SFAA 2D8WA 1NFXA 2JH5D 3LKWA 1F92A 2OQUA 1HAVA 1G3CA 1WOFA 1C9TA 1W12U 2ANYA 1AB9C 2ZEBA 1SG8B 1O3IA 1E36B 5FPSA 4YT6H 1YP9A 3NXPA 2PTNA 4JZEH 2XYAA 1NM6A 5JBCS 3GY3A 2ZDMA 2XNIA 1QRZA 4B74A 3ZZ6A 1Y5UT 1BB0B 1RGQA 2PGQB 2ZDKA 2NU3E 1ZR0A 6CHAC 4B71A 1TPAE 1AVGH 3ATMA 3VB3A 1UHBA 1GBFA 2ZHEH 1SR5C 1L4ZA 2Y81A 5E8EH 3BIVH 3ENSB 1B5GH 5E2OA 3SNCA 2HALA 3U8TH 4AOQA 1GWAA 1S81A 5FPTA 2ZNKH 4Y76A 3RXVA 1C9PA 1SLUB 2FI4E 1DXPA 4YLUA 4RKOB 3B9FH 5F8TA 4ABBA 1ANDA 1H8IH 1O0DH 4MLFB 1C5TA 1IQNA 4QT8C 1NFUA 1XXFA 1ABJH 3M7UA 5BRRE 3JZ1B 1C1WH 1UK2A 2GX4A 2OD3B 2BZAA 5GCHF 3RXQA 1P3CA 1O2UA 2A0QB 3ZZ3A 6GCHG 2Y5HA 1T8NA 4KTCA 3SJIA 1SQOA 1OYTH 4I8JA 2FO9A 1EZQA 4HFPB 3MU0A 1BA8B 1T31A 2FOAA 3FFGA 1O32A 1QJ1B 1MKXK 3GDSA 4MNXA 1O3NA 4X2YA 4BTTB 2AGIX 1O2PA 2C8YB 3RU4E 1AWHB 1TX8A 4H6TA 1EKBB 3SV7A 2ZDVH 1ELCA 2ZU5A 1MTNB 4ABJA 3A88A 1CGJE 1TOCB 4AORA 1VGCC 1K1PA 3GOVB 2QXJA 1UTMA 3MNCA 3SNEA 2ZTZA 1EJMA 2C8XB 1DSUA 2SGEE 3GY7A 2PKAB 1JXPA 1TQ7B 5JBAS 2ZFQH 2VWLA 1Z8IB 1IQLA 1PQ8A 1HAZB 1HYLA 1YPJH 3QZRA 4E7NA 3MNXA 3LJOA 1GL0E 3T5FH 5HM9A 1V2MT 1V2JT 1E37B 1ZHMA 4ISHH 2ULLA 1PFXC 5A0CA 2ZZUH 1PYTD 2VIWA 5GXPA 2XXLA 3OTJE 3HKJB 1O36A 1H9LB 2H9EH 4DVAU 1JRSA 3OY6U 2OLGA 1UTKA 8LPRA 3A8DA 1T8LA 1UVSH 4K3JA 1O3GA 5C1UA 1AFQB 4DG4A 3RU4D 1BRUP 1K28D 2WV5A 1MKWK 4LZ4B 1CO7E 2Q6GA 1AVWA 1ELDE 3UQOA 1C2MA 2ZDNA 2A5AA 4LZ1H 5CHAB 2UWOA 2ZO3H 4ZH8A 3TGKE 2A2XH 3BTKE 1C2JA 4X8TH 2UWLA 1X7AC 2OUAA 4I8HA 2Z3DA 3HK3B 1K22H 2ZCLP 1DICA 1AO5A 1OWKA 3SNDA 1O3FA 1H4WA 1AMHA 2ZU4A 4B76A 2CF8H 1C5PA 3TJOA 4WY3A 1MAYA 1BBRK 3TK6A 1RTLA 4LXBH 3TGIE 1DOJA 5ESBA 3A7YA 1GBLA 4UFEH 5EXMA 4X6MA 1OSSA 3T62A 4NSYA 2BY8X 1GHYH 4DURA 1DPOA 2VVVA 4WMEA 1Y3YA 1QNJA 4CR5A 2H1UA 1TRNA 4UD9H 1WV7H 2G52A 2HGTH 4CRBA 3SOSA 1N6YA 1ABIH 3A83A 3TH2H 4BAQB 4AFZA 3A7TA 3DHKH 1D4PB 3H7TA 2AMPA 3PB1E 4XSKU 5C67A 1RIWC 1CE5A 2PKSC 3GY2A 3T28A 1A0LA 4D7FA 1CA8B 3GCNA 3RXEA 1MCVA 2QN5T 2TIOA 1EAUA 1G36A 4WVPE 3SU4A 1AB9B 2FI3E 1HXFH 3ATLA 1LTOA 3LJJA 3VPKA 1XM1A 4Y71A 4Q7ZA 1QTFA 1Z71A 2GMTC 2OP9A 4X1NU 1MTUA 4OS6A 4OS2A 1TX6A 6CHAB 6ESTA 4MPUA 1O3CA 1P2JA 1UTJA 1UK4A 1RJXB 5EPYA 1TA6A 5EXNA 1IQHA 3F9HA 1C2FA 3HKIB 1UMAH 4MPWA 1GVKB 2BDAA 2GZ7A 3AVZA 4XDEA 1TYNA 4Y0YE 3A89A 3GISB 1ETSH 2FODA 5K0HA 3QLPH 1GI6A 1LHDH 3UREA 2VWMA 1O3JA 1O2OA 1C1MA 1DM4B 3KQDA 1O3BA 2BVSH 4I8KA 3RP2A 1CT0E 4ABFA 1OWJA 1M9UA 1E38B 4CBNA 1GJ4H 2DUCA 3KCGH 4ZKOU 3ZVFA 1C4U2 5FBIA 1C1VH 4PROA 2ZGHA 1CVWH 1QRXA 4I31A 1P09A 5C3NA 2Q6FA 3E8LA 1F0UA 3QGJA 2FI5E 2XWBI 1O2RA 1P02A 1AUTC 3O8DA 3LGYA 3BTGE 1ZRBA 4BXSA 1O2YA 2O8WA 2OC0A 4IN1A 1VGCB 2AH4X 1OS8A 4B2BA 3SUDA 2A4RA 1V2VT 2ZFSA 3A8AA 1ELGA 1DLEA 1GVLA 3SBKA 1Q2WA 1Y5BT 4F4OC 2RA3A 2BMGB 4R0IA 3A80A 2P94A 1DE7H 2AFQB 3P8NA 1W3CA 3VB4A 1ESTA 4ASHA 2QA9E 5HMAA 2FZZA 1QFKH 1DSTA 4BTUB 2VVUA 3MI4A 1T8MA 2LNCA 1GJBB 4YOIA 2PSYA