1MAXA

Beta-trypsin phosphonate inhibited
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Inhibition of trypsin and thrombin by amino(4-amidinophenyl)methanephosphonate diphenyl ester derivatives: X-ray structures and molecular models.
pubmed doi rcsb
molecule tags Hydrolase (serine protease)
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1maxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1maxA02
1LPGB 2VNTA 3SJIA 3P8GA 2A2XH 1AQ7A 1QJ1B 1C5QA 2W3KA 2ZIQH 2WUCA 2ZPSA 3NKKA 1WAYB 1DITH 4U30A 2QXGA 2F9OA 4A6LA 1IQKA 4NIXA 2EI7A 4UFGH 4I8LA 3B9FH 4I33A 2IN2A 3F9GA 2GV6A 1TLDA 3RMMH 2G5VA 1C1PA 1O5DH 1O2HA 5EXNA 2P3UB 3LGIA 1ZMJA 1HJAC 4X1SU 1HB0B 1HAGE 1RTFB 3BTGE 3SJ9A 5DPAA 3DT0H 1YM0A 4FU9A 3GCHC 2ANYA 5L30H 2KAIA 3TVJB 5FPYA 1AUTC 1CA0C 3I77A 4Y10E 1C1WH 2GCTB 3SV8A 4ABBA 5A0CA 1IQGA 2HNTC 2FWWA 5FBEA 5ABWA 1T4VH 2ZDMA 1O33A 1O32A 1L1NA 4AZ2B 1GI7B 3BTKE 4ABFA 4OGYA 5A0AE 1YGCH 3PM3A 1PQ5A 1NY22 4MTBA 2VVUA 2BYAX 2Q6GA 5HMAA 1GBMA 3ESTA 2Y82A 4AX9H 3M3VA 1QGFA 1O2RA 2JH6D 1FQ3A 4F49A 1B7XB 1EKBB 1F0UA 1UK4A 2XBVA 3UWJH 2Q6FA 2SGPE 3UNSA 4D8NA 5FPTA 3BTFE 1EJMA 1MTVA 3SOSA 1C5VA 3O8DA 1AKSB 4NIYA 3PLBA 3SUGA 1EX3A 3SNCA 2OC0A 1EP6A 1GJ8B 1W11U 1ZMLA 1IQFA 1GMHF 6LPRA 1C1UH 2BXTH 4BAKB 2FYQA 3SBKA 2A32A 2OBOA 2G81E 1O3BA 1ZJKA 1V2TT 2ZGXH 4X1NU 2P95A 3TJOA 1A5IA 2F9BH 2FP7B 1SGTA 5EPYA 5FPSA 1GI3A 2JH5D 2P16A 3MU4A 3ATKA 4ISHH 4ABAA 4ZKOU 5EXLA 1GJ5H 3MNSA 1AIXH 4O9VA 4JCNA 1QTFA 3PTNA 4FU7A 5AVDA 1K22H 1QJ6B 3EA8A 2BDIA 4WXVA 2TPIZ 3RC5A 3U1IB 3ZVCA 4KKDA 4I8JA 2P94A 4J2YB 2BY9X 2ZHQH 1WU1A 2ZDVH 3FZDA 3NCLA 4IN1A 4YM9A 1GL1A 1O5BB 1O3AA 5LPEA 5BRRE 1GMCG 4AG2A 2FS9A 1ZSLA 3E91A 5BPEA 1GCTB 3A88A 1ARCA 1FI8A 3ATMA 4TWYA 4AGJA 4DY7B 1GBKA 2BDHA 3LDXH 2W7UA 1MTUA 2BLQA 4CHAC 3GICB 4X8SH 2BDAA 1CE5A 1WUNH 4NG9H 1IHSH 4YT7H 7GCHG 2ZCKP 3LIWA 3RXIA 2BY6X 2QN5T 1SGIB 1SR5C 4YZUA 1V2KT 3BTME 4BTIB 1P2MA 1NT1A 1C1VH 5DP9A 3MO9A 2J4IA 4Y71A 4UFDH 1P03A 1SPJA 2BY5X 1P05A 4HFPB 1G9IE 5AFZH 3BF6H 1CGHA 3TJUA 4AB8A 2ODYB 2QGRA 3PMHB 3SGBE 3F9EA 1ZPBA 1AZ8A 1C2KA 2BZ6H 1D9IA 4ZAEA 1QQ4A 1OS8A 1F2SE 1PPEE 4A1XA 3L33A 1D3TB 3GY8A 3GDSA 3TH2H 2HOBA 2GMTB 3O8RA 1O34A 3UUZA 5DG6A 1S85A 3KGPA 1QBNA 5AHGH 1TNIA 2P3TB 1TOCB 4Y8ZA 5FBIA 4X8VH 1AKSA 3CS0A 3OYPA 3H7TA 4DGJA 1TONA 1Y3VA 3MI4A 3AVZA 1AFQB 1H4WA 2Y6TA 4YO9A 2OQUA 1WTGH 1KYNA 1JBUH 1T31A 3GY2A 3S9CA 4GSOA 3RXJA 2Z9JA 4F4OC 2WPMS 2PUQH 2GT7A 4B2AA 1RTLA 4GCHG 1DVAH 1QY6A 3A7TA 4D7GA 2J95A 2FOGA 1ZLRA 3VFEA 1S6FA 5EQRA 3PMJA 3A89A 4NCYA 2VIPA 5E0GA 3PWBA 1HYLA 4D7FA 2QIQA 1D3PB 3KF2A 2GT8A 1ANDA 4MNYA 2NU2E 1GI2A 1GBFA 2NU0E 4B1TA 2BOHB 2PR3A 1SLWB 3ZZDA 4AGKA 1S82A 4NWKA 4A92A 1EAWA 2EI6A 1O3GA 2AMDA 1ESAA 1LTOA 1O3JA 1BUIA 4BAQB 2VH0A 1S5SA 5H4IB 4ZKRU 1D3QB 3AAUA 1DUAA 1TBQH 2TGTA 3GY7A 5E8EH 1G3EA 1V2UT 4K60A 3SU6A 3GCTF 3D65E 3I78A 1JOUB 1Q3XA 2XYAA 3DA9B 2OQ5A 3D49H 1GVZA 4MLFB 4ZXXH 3K6ZA 3NZIA 1GJ4H 5ESTE 1FN6A 1FXYA 5TCAA 3QN7A 1C2LA 1WSSH 2A4GA 1D4PB 3SU2A 2TGPZ 2VGCC 1C1OA 1LCYA 1OWHA 1BJUA 4JYVH 1XX9A 1ZHMA 3RMNH 2ZDNA 2BLWA 1K1LA 5EW2H 4DJZB 1FAKH 3HPTB 2ODPA 3U1JB 2WPHS 5C2ZA 4AFZA 1Y5AT 2ZFFH 4HGCA 4IC6A 5DP5A 5A8ZA 1EB1H 6GCHF 1GI9B 3UREA 4Q7ZA 2XRCA 3HKIB 7KMEH 2W3IA 1C2JA 2H9EH 2WYGA 1EATA 3CP7A 1QIXB 1V6DA 2ANMH 5F8ZA 1HAOH 1O3LA 3A7XA 4CR9A 3UOPA 3RXVA 1LQEA 1BDAA 1SHYA 3K6YA 1T32A 3PB1E 3HGPA 3A8DA 3EYDA 2J9NA 1RIWB 4MNVA 1AI8H 2BB4A 3UOUA 1BITA 1WOFA 2XCFA 1PFXC 5FHTA 1TX6A 3KHVA 3SHAH 3EA7A 5FCKA 3ZZ3A 4BXSA 4CRDA 3IWMA 1FDPA 1C5YB 1MTWA 2CF9H 2XBWA 4TYDA 1UK2A 3RC4A 3U8RH 3ODFA 2TGAA 2QXHA 2Y7XA 3S7HB 1DWBH 1FIZA 2CHAC 4Q80A 2C8YB 3TNTA 1O37A 1V2VT 1MH0A 3GYMA 4BANB 2XNIA 3ATWA 2UWOA 3RU4E 1SHHB 1ZPCA 3OY6U 5EOKA 1TGTA 1NFYA 2WV4A 1P2OA 4A7IB 3BG4B 4JZFH 4IS5A 2Z9GA 5F8XA 3KN2A 3MOCA 2VVCA 2ZU4A 3LU9B 2HWLB 1FJSA 1AD8H 2B8OH 3S9AA 1AMHA 3GDUA 5EQSA 3ZZCA 5HXFA 4I8GA 3A8BA 1C1TA 4LXBH 4E7RG 3VGCB 4BAHB 1K1PA 2FLBH 1NU7B 1W7GH 4H42U 2JETC 5DK1A 4OGXA 1TGCA 3S69A 2AMQA 1LHGH 2UUYA 3HKJB 2HGTH 3HK6B 1OKXA 1P3CA 1IQHA 1IQMA 1BRAA 3M37A 8LPRA 1MMJN 4Q7XA 1CT2E 1ZRKA 1CGIE 3LH1A 1O3NA 1TX7A 2HVXA 4K1TA 1MKWH 4B76A 1GBAA 1LVBA 4IMZA 2IOTA 5DGJA 1EJAA 4KGAA 3PYHA 2AYWA 4THNH 3MH4A 5T6GA 2GZ8A 1Q31A 4B2BA 3W95A 1WV7H 1BHXB 4D9QA 1THSH 2FOBA 2G51A 3M3SA 2SGDE 2BD8A 2I6SA 1FLEE 4FUFA 1FV9A 1O5AB 2G55A 2VB0A 2PV9B 1F7ZA 3ZVGA 4CREA 1ZPZA 3TGJE 1G3CA 3Q00A 3LJOA 2Z6BD 3AW0A 3T28A 1ANCA 3CS7A 4UD9H 3RU4D 3M5LA 4ZHAA 1BRUP 3M5NA 3MTYA 1D3DB 3TGIE 2ZHDA 2FYRA 3URDA 3ZZBA 2ZTXA 1K28D 1MTNC 1DT2A 5CMXH 1ELAA 1GI6A 3E90B 3LC5A 2BDGA 4Y6DA 2B7DH 1UMAH 1EPTB 4WH6A 1C5TA 2PTNA 4ABIA 4AOQA 2BM2A 2ZI2H 3SGAE 1G32B 4YOIA 1LDTT 4JYUH 1TPPA 1AE5A 1GHBG 3Q3YA 4NA9H 1DXWA 2VIVA 1PYTD 2OXSA 1P04A 4OS2A 4CRFA 3BTDE 3LPRA 4D76A 2FXRA 4WJG2 3MU8A 2VH6A 3D62A 4H6SB 4MNWA 1O3DA 4Y79A 2GGVB 4ISOA 3V7TA 2ULLA 2XWBI 1UVSH 1KDQA 9ESTA 4YLUA 1C5OH 1VGCB 3MWIU 1TYNA 3ZZ8A 2NU3E 1W2KH 1GVLA 2ZEBA 1QR3E 2ZHWH 1O35A 2WPLS 1DX5M 5HM9A 1IQEA 1TWXB 3E0NB 1DY9A 2ASUB 4OS7A 1ZYOA 1PPCE 4FVBA 4ABJA 1N6YA 4AN7A 1CU1A 5CHAC 1G3DA 2BY7X 4X2VA 5JB8S 2FOHA 2FI5E 1XUIA 3V12A 4MPUA 2FS8A 2J2UA 4UE7H 1GBBA 1ETRH 4RN6A 4FU8A 3Q3KA 3SN8A 2VIWA 5HGGA 2OLGA 1AU8A 1ZHPA 1P0SH 1HBTH 3BTHE 4RKJB 1NRRH 4OS1A 4NA8A 2ZECA 3GISB 4A5TS 1NTPA 2QCYA 4R0IA 3PLKA 1VITH 3UFAA 2C4FH 1ABIH 2ZGBH 3A8AA 1ZTJA 1WYKA 3RM2H 2H5CA 3A80A 1DPOA 1SOTA 2F9NA 3TU7H 3Q77A 1C2DA 1O2MA 5HM2A 1UTOA 1NM6A 1GDNA 3A85A 1C5WB 3NPSA 1TALA 3SQEE 1QRZA 3NWUA 1EPTA 1C5NH 2XC4A 3SU3A 1O2UA 5HYOA 1UHBB 2AERH 2VJ1A 2FMJA 2GCTC 1QL9A 3EDXB 1JRTA 1J8AA 1Z6EA 2BDYA 3EQ0H 4ISIH 2ANWA 3KQEA 2F9UA 2A4QA 2A5KA 2IPHA 2QV1A 1ABJH 2XWAA 2ZDKA 2VWMA 1GMDG 1ESBA 1SG8B 2GP9B 1Y59T 4ABGA 1PQ8A 1YLCA 4SGAE 1BJVA 1NRQH 2BXUH 1FN8A 1YP9A 4DURA 5F8TA 1G36A 4XBBA 3TK6A 4CBNA 1O5GH 5DJ7A 5DKMA 1W0ZU 1SL3A 1K2I1 3E8LA 3UPEA 2ZP0H 1QHRB 2FOMB 2STAE 2V3HH 1HAVB 2VIQA 1SGCA 5C20A 3A84A 1H8IH 1IQLA 3PO1C 1GI1A 2V35A 5EW1H 5E0HA 3VEQB 1B0EA 1F0TA 4B71A 1SGEE 2ZPQA 4LZ4B 2Y5GA 2ZCHP 1V2OT 3UR6A 3ZZ6A 4AYVB 3KNXA 1OP8A 1GJDB 3LC3A 1MTSA 3M35A 1AVGH 4JZDH 5I46H 1DOJA 4K69A 2QY0B 4DOQA 3GY5A 1TQ7B 2ZKSA 2QYIA 5DP7A 3P70B 2Z7FE 2R3UA 1A7SA 1A5GH 3MNCA 1ZGVA 3A7YA 3LONA 3UWIA 4Y76A 1V2LT 2OBQA 5EPNA 1P09A 2ZDAH 5J4QA 4MDSA 1UCYH 1HJAB 2WINI 4FUGA 4CBOA 4JZ1A 4X8TH 4ZKSU 2D8WA 2P59A 3GCHB 1CA8B 4R8TB 3SU0A 1HDTH 1CA0B 1G37A 3RXMA 1Z6JH 3UTUH 1SLUB 1GCTC 1RD3B 1EOJA 2F3CE 1TRYA 3V13A 3VXFH 1GMCF 5SGAE 1MUEB 1ESTA 2D2DA 1BBRH 1GG6B 1Y5BT 3U98H 5G4BA 5PTPA 2C90B 3K65B 2AIPA 1QBVH 4INLA 4YT6H 2QXJA 1KSNA 3SI3H 4K2YA 2AFQB 7GCHF 2GDDA 1ANBA 4X2WA 2YOLA 3SJKA 1TNHA 4CR5A 1IQJA 4AB9A 1GPZA 1YPHE 1ELGA 4XE4A 1W13U 1AB9B 5F03A 3HGNA 1L1JA 1YPEH 1Z8RA 1DUEA 1CHOG 2RA0A 2LNCA 1GGDC 2A45B 2OC8A 1XVMA 2ZGHA 1FMGA 2FM2A 1GJ6A 3MNXA 3BEFB 1BTHH 4GHQA 1THPB 5K7RA 1ELFA 2ZZUH 1BMAA 2Z3EA 1K21H 4AG1A 4WVPE 5A2MH 1ACBE 3ITIA 2QAAA 1PPGE 2VVVA 2VIOA 1TAWA 1H8DH 1DFPA 1ELVA 1NC6A 1YCPK 3N7OA 3ZYEA 3E1XB 5AFYH 1C2MA 1JRSA 5L2YH 2ZFQH 3V0XA 2DUCA 1BRBE 1QB1A 1PPZA 3LKWA 3T26A 4B74A 1C1MA 4BTUB 1A61H 1BRCE 7ESTE 1UK3A 4AFUA 5A8XA 4GCHF 1ETSH 1HPGA 2ALVA 3FP7E 4JK5A 4VGCC 1O3CA 1Y3XA 3PMAB 1HJ8A 1XUFA 4JMYA 5I25A 2VWNA 3VB4A 4WMDA 1GBLA 3EAJA 2Z9IA 2HRVA 4MQAA 5GDSH 4FUBA 1T8OA 1O3PB 3RLWH 1ZSKA 1ELTA 2ZC9H 2FI4E 4IBLH 2D26C 1HV7A 3L6PA 1TFXA 4I8KA 3RXQA 2PTCE 4O3TA 5JPMH 2A5IA 3K2UA 4FUJA 1L2EA 3V3MA 1W14U 3ZVDA 1Y3YA 1A0JA 3RXBA 4Q2KA 1P01A 1E37B 1PPFE 3RMOH 1XXFA 1O3HA 1W10U 5A09A 3TJNA 1Z7KA 1MQ6A 5LH8A 3BIVH 1K1MA 3QK1A 3T2NA 1C1RA 5A0BA 1OYTH 1XKAC 3ZZ9A 1NRNH 1K1JA 1SB1H 1NRPH 1GJCB 1EAIA 1AO5A 3BV9B 1OSSA 1F0SA 1OWEA 4BXWA 1GDQA 3SUEA 1SLXB 1EZSC 1BCUH 4NGAH 1T8MA 2BOKA 4QT8C 2W7SA 1W12U 1MU8B 2ZGJA 1P10A 4UFEH 2PKAB 9LPRA 4LOYH 1F5LA 5ESBA 1HFDA 2GZ7A 2OC1A 1HAYB 1EXFA 1TGNA 2IJOB 1DLEA 1K1IA 3QUMP 3LJJA 3BTTE 1P3EA 3STJA 4HI3A 2OD3B 1ZGIA 2UUJB 2A5AA 2PSYA 1C9TA 1SFQB 5GCHG 2C8WB 2ZNKH 1DICA 1RGQA 3SORA 3VPKA 1RIWC 4FVDA 5DP8A 3RDZA 1BIOA 1MZDA 3I29A 3QDZB 1W7XH 2P93A 4K1EA 3GY3A 1NPMA 6CHAB 3RXHA 1ELDE 2R9PA 1RTKA 1GBTA 1T7CA 2PUXB 3TGKE 1UTQA 2TIOA 4ISLA 4CRAA 4O97A 5C5OA 1WQVH 4IMQA 2HPPH 1AWHB 2ZWLH 1DWCH 3AW1A 1GHZA 2V6NA 1C2GA 3DFJA 4NZQA 2CGAA 1GBCA 1KLJH 4IC5A 3BG4C 4ZXYH 3MH6A 1MD8A 1MCVA 1N8OB 5TJXA 4CH2B 5F6MA 4X6OA 1KLTA 2H1UA 2THFB 4U32A 3D23A 3M3TA 2CJIA 1SOZA 2WV5A 1Q2WA 5EXMA 1GCDA 3SGQE 4OS5A 1O2XA 3VGCC 3ZV9A 2B5TB 1DSTA 1ZSJA 3GDVA 5A8YA 5B6OA 2HALA 1MBQA 2XC0A 5EG4A 3QX5H 1SSXA 2B0FA 4X2YA 3H7OA 3SO3A 2RDLA 4NFEA 1CBWB 1SMFE 2Q1JA 2HNTE 3NXPA 4RKOB 1BTPA 1O2LA 1B0FA 2NWNA 3TJVA 3U8OH 2QF0A 2Y81A 2BD5A 3KL6A 4ZMAH 1CGJE 1O3KA 1SGNE 2H5DA 1O2OA 1XUGA 1AN1E 1F5RA 1IQIA 1EAXA 1GVKB 1O5EH 1MAXA 1YF4A 3A7VA 3RXUA 2FOCA 1JIRA 3TK9A 1FY1A 1ARBA 1GJ7B 5C5NA 2V3OH 2EC9H 4YOJA 1TMUH 3KQDA 1CHGA 4OS4A 4ABDA 4JZEH 2F9VA 2BD2A 2Z3DA 2ZO3H 1KTSB 1VCPA 1C4Y2 2A7JA 1TX8A 1GHAG 3TH3H 1CT0E 1GJAB 3FAOA 1Y3UA 4XBCA 1LVMA 3GCNA 4YTAA 3MH5A 4K5ZA 1YPHC 2Y80A 2OTVA 1V3XA 1GBJA 1A5HA 1J16A 1YPKH 1EPTC 1O2KA 3T27A 2ZFPH 3SNEA 3H5CB 2R0KA 1C1NA 2FOAA 2SFAA 2A7HA 2ZPRA 1ELBA 1T8LA 3RXSA 3LGTA 1CSOE 1GHBF 1EOLA 1UVTH 1DY8A 1O31A 3Q3XA 5LPFA 3A81A 2STBE 1OYQA 2XBXA 1YPGH 2ZTYA 3ZVBA 1P2NA 2JETB 3HATH 1C5XB 3AASA 1KXAA 1QB9A 2R2WU 3BSQA 1VGCC 1ORFA 2BDCA 4I7YH 4NSVA 3PROA 1G3BA 3SU4A 3K9XB 1SFIA 1GI8B 1SGFG 2NU4E 1O0DH 3A86A 1ZOMA 4ZROA 4AORA 4X0WU 3UIRA 1V2ST 2O8TA 4E05H 1P2JA 4BNRA 2B9LA 2GCHG 5FX6A 1TPAE 1BHXF 4CRGA 4XSKU 1RFNA 1BTWA 1OWJA 1PQ7A 2PSXA 2UWLA 1QCPA 4XBDA 4B2CA 1FZZA 1SGRE 2BY8X 5K0HA 1AVXA 1HAXB 4FUCA 1WQSA 1NRSH 1FY8E 1D6RA 1ANEA 3T25A 1HIAB 2GD4B 1MD7A 3TH4H 2PGBB 3FANA 1N6XA 2ZCLP 1KLIH 1P12E 3OSYA 4DW2U 2FO9A 5C3NA 3F68H 2P8OC 4X1QU 1C2FA 1IOEA 1BMMH 2PKSC 3HK3B 3R0FA 1DS2E 1A0HB 1QRXA 2BD9A 1C2EA 4MPWA 4Y8YA 5L6NH 1VITG 4M7GA 8GCHG 1O2SA 4XOJA 1YCPM 2SGEE 1LVYA 1L4ZA 1A46H 2AEIH 3SNBA 1UTPA 2JKHA 1BMNH 2FX6A 3MYWA 2BVXH 3LGVA 2KAIB 1C2IA 1L1GA 3ELAH 1TNKA 3PV4A 1KXCA 1A4WH 1LPKB 2J38A 1JIMA 3ZV8A 1GHVH 4NIWA 1GWAA 1A3EH 2A31A 4WWYA 1C9PA 3UQOA 3RXGA 1GI4A 1RXPA 2AGGX 1P2QA 4GHTA 1KXEA 3FP8E 1KIGH 4E06H 5JBBS 2SNVA 2ANKH 1Y5UT 1UVOA 1V2MT 1RJXB 2BD3A 3SUDA 3E0PB 4YLQH 1VR1H 2TGDA 5FX5A 2O9QA 2V0BA 3GCOA 1O2IA 3TPIZ 1ZMNA 3FVFB 4UONA 1GMDF 2VIDA 3RXAA 4CRCA 4ASHA 1O2YA 3GYLB 1GJ9B 1XM1A 1GL0E 3A8CA 4DIIH 1QL7A 1UTNA 4FUIA 4WY3A 4E7NA 2G5NA 2Y5FA 4ESTE 1LHDH 1TA2A 4ISNA 2JH0D 1A1RA 1TIOA 1MCTA 2J34A 3SV6A 1V2JT 2SGQE 3SUFA 1QRWA 5E2OA 1G2MA 1Z1JA 4NIVA 2PFEA 1O3FA 3QZRA 1HIAA 2PW8H 3KCGH 1FY4A 4B75A 3SV9A 3RLYH 1YBWA 1GBHA 2OCVB 3P8OA 1HJ9A 1YCPH 3P17H 2CV3A 2BQ7B 1EZXC 8ESTE 5IDKA 3BTQE 1DSUA 1P9SA 4HTCH 2GV7A 4X6PA 3BTWE 4ZKNU 1Y8TA 4OS6A 1ZHRA 1GDUA 1DANH 1DDJA 4JYTA 3TNSA 2BMGB 1P9UA 1KTTB 4RSPA 3RXKA 2K1QA 2FTMA 2ZU3A 1P57B 2ZQ2A 5JBTA 1UVPA 1KXFA 1NO9H 2FTLE 4FUEA 4B73A 1P2KA 1RRKA 3GY4A 1QBOA 2A7CA 3E6PH 1F92A 1NFXA 3MU0A 3E3TA 2GVFA 4U01A 2BX4A 5GPIB 1AE8H 3EA9A 5TCCA 5GJ4B 1TPSA 3SU5A 4ABEA 4TPYA 3F9FA 1YKTA 4INKA 1DXPA 3O8CA 8KME2 1MKXK 1P06A 2FOFA 2O8LA 1HAHH 2WPIS 2H6MA 1JWTA 1L4DA 1EZUC 1GG6C 1GHYH 2BQWB 2ZG0H 3U9AH 1OWIA 4KP0A 2ZU1A 2W5EA 2HLCA 3SHCH 3A87A 3PLPA 4GPGA 4WF8A 4DG4A 1C5PA 2Z3CA 2FODA 2XW9A 3DD2H 3LGYA 1ELEE 2CF8H 3ZVFA 5DO4H 1AB9C 2G52A 4K3JA 3MO6A 1UTKA 1PYTC 2H9HA 2GX4A 4A1VA 2YNBA 1ZRBA 4MVNA 1EB2A 1CVWH 1CHOF 1CQQA 1FY3A 4KTCA 5EQQA 1UHBA 2VU8E 3PO1B 3IG6B 2ZHFH 1W0YH 3RP2A 1O2PA 1S84A 1TBZH 5FCRA 2ZF0H 4I32A 1O30A 1QL8A 2C93B 7LPRA 1YPMH 4Y0YE 3SNDA 5C1YA 3GY6A 2PHBA 2TRMA 1O2ZA 2M5TA 1J9CH 2SGAA 4TWWA 2GKVE 2ALPA 4IN2A 2WPKS 3BN9A 1L0ZA 3NK8A 3U8TH 1O2NA 1EAUA 3ZVEA 1K1NA 3TK5A 1ZTKA 2A1DB 3G01A 5DP6A 4Q7YA 1TNGA 1O2GH 2WUBA 5C67A 1BTZA 4LK4A 2Y5HA 1TQ0B 2GMTC 3BG8A 1BTYA 1HAVA 1V2WT 1X7AC 1TOMH 1UTJA 4YESB 4NFFA 1RS0A 3MH7A 4ZHLU 1H9LB 1GMHG 2BDBA 4GUXA 3KEEA 3LOXA 1W8BH 2XBYA 1HXEH 5E2PA 1O39A 4WXIA 1BTXA 2GDEH 1AFQC 1YC0A 1AY6H 2ILNA 1PPBH 2C8XB 1O2WA 4GAWA 2HNTF 4WMFA 1LKAA 3P6ZB 1HXFH 3S7KB 2QF3A 2FX4A 2Z9KA 4GVUA 2FI3E 4I8HA 1VCWA 1AFEH 1NN6A 1O3OA 2AGEX 1QJ7B 4JZIA 4MNXA 4MPVA 2CMYA 3SV7A 2AH4X 1TNJA 2R0LA 1AVWA 1T4UH 3M7QA 3MU5A 3RXTA 5DP4A 2R3YA 3SU1A 3Q76A 2FESH 1DM4B 2F9PA 1AWFH 3A82A 2ZU5A 3MNBA 3QTVH 4NZLA 1MZAA 4Z6AH 1U6QA 1MU6B 1NROH 4UFFH 1O3IA 1GBIA 3JZ1B 3S0NA 5DP3A 1V2QT 1O5CB 4ZUHA 1EQ9A 4GLYA 4BOHA 1FUJA 3BIUH 1EZQA 4DCDA 1GGDB 2G4UA 2XXLA 1FPCH 2A4RA 1ZR0A 3BEIB 2QA9E 5AF9H 1VJAU 4Y0ZE 4BTTB 1IHTH 3M61U 2VWLA 1BQYA 1UCYE 3SNAA 1LHFH 1YLDA 1NS3A 1SI5H 1S83A 4CHAB 2FDAA 2Z94A 4O3UA 1C5UA 4FUDA 3ZZ7A 2BTCE 3RUOA 3ODDA 2WPJS 1LHCH 1NU9A 2BX3A 1HNEE 5JBAS 2PLXA 4DIHH 1SBWA 2BZAA 1BB0B 5JB9S 2FZZA 4YOGA 2QXIA 1BBRE 1E36B 5T6FA 3S9BA 2G8TA 3A7WA 1UCYK 4ZH8A 1VZQH 3PTBA 3A83A 2H9TH 4VGCB 2O8UA 3F6UH 4JK6A 5GCHF 1YPJH 3FFGA 4X1PU 1C5RA 1THRH 1J17T 4X6MA 1PJPA 3EGKH 1ID5H 6CHAC 2VWOA 2H2ZA 3ENSB 1P8VC 3QWCH 4CRBA 3STIA 1O2JA 3B23B 1P2IA 3DHKH 2ZTZA 2ODQA 3ZZ5A 3VXEH 3RMLH 2Z9LA 1BBRK 1QA7A 1B5GH 3T29A 3E16B 1QA0A 3URCA 1HGTH 2FPZA 3UQVA 1OXGA 4X8UH 2BLOA 2DE9A 3C27B 3SJ8A 3VB6A 1NFUA 5T3HA 4J1YA 1QQUA 1N8OC 4UDWH 1CO7E 1PQAA 2CXVA 2HPQH 3M7TA 3KQBA 3RXPA 3P95A 1PPHE 2OP9A 1O38A 2EA3A 3T5FH 2ZHEH 3C1KA 3ZVAA 2RA3A 1J15A 3OU0A 1S0RA 3CENA 1K9OE 1AHTH 3RU4T 4IGDA 4PROA 1SGDE 1GJBB 1OP0A 1S0QA 1UJ1A 1QURH 3DUXH 3OX7U 1ETTH 3TLOA 3BEUA 3SV2H 5EODA 1SQAA 5JDUB 3VB3A 2DE8A 4A1TA 4LZ1H 1CBWC 2I6QA 1WBGB 2C8ZB 2ZQ1A 3GCTG 1C5SA 1O2VA 4K1SA 1O3EA 3QZQA 4FXGH 3A7ZA 1IQNA 2FLRH 4O03A 1KXDA 3KIDU 1GI0A 1OPHB 2GTBA 3T62A 1AZZA 3JZ2B 1H9HE 5EGMA 1C5ZB 1HRTH 4KELA 1SC8U 1SQTA 1Z8JB 2RG3A 2J92A 1WCZA 1SGPE 2BVSH 2ZA5A 1HAIH 3M5MA 4BAMB 1DLKB 4K8YA 1C4V2 3MO3A 2VGCB 1FY5A 4Y7AA 5C1UA 1VCQA 3LGUA 1W3CA 1F5KU 5GXPA 1KXBA 1LO6A 1WTHD 5CE1A 2AS9A 5L2ZH 1ZTLA 1NESE 5LGOA 3FP6E 1FIWA 2O8WA 1M9UA 2AIQA 1TE0A 2OC7A 6GCHG 1N1LA 3RC6A 2AMPA 4ABHA 1UVUH 4ZHMU 1J14A 1TPOA 3RXFA 1TMBH 1TGSZ 2PKAA 1O36A 1OWDA 1SGQE 2ZU2A 1C5LH 3QGJA 3UNQA 1XMNB 1HLTH 1GHAF 1A2CH 1XUKA 2XCNA 4Y8XA 3AAVA 2BLVA 1MAYA 3M7UA 1E38B 3WY8A 3SZNA 3SW2B 1Y3WA 3OTJE 1TRMA 2PGQB 3RXOA 1FONA 2ZDLA 1Z71A 4NA7A 1BTUA 3SQHE 3RXDA 1G30B 4Y7BA 1SGYE 2O8MA 1GI5A 2Q6DA 5FAHA 1BZXE 1V2NT 4SGBE 2Y7ZA 2W26A 2BD4A 1KDQB 1CT4E 2FOEA 2VINA 3LGWA 1FPHH 2CHAB 1T8NA 4CH8B 1C2HA 4MPXA 2BHGA 4UEHH 2G00A 4XFQA 1K1OA 3FZZA 5IYTA 1HAPH 3P8NA 4Y11E 4TY6A 1OWKA 1TMTH 2G4TA 1H1BA 4IW4E 2OUAA 1S6HA 3ATIA 3UNRA 4WMEA 4AFSA 2GCHF 1TRNA 1BMLA 2XC5A 3R3GB 4U2WA 3SJOA 1O2TA 4XDEA 4BAOB 1Z8IB 2A4OA 5GIBA 4WH8A 1KY9A 1F0RA 4TPIZ 3ZZ4A 3F1SB 3KQCA 5T6DA 2F91A 3QO6A 2UUKB 1UTMA 1O3MA 2ZFTA 2BVRH 2EEKA 1EJNA 2GZ9A 2ZFSA 3OY5U 1TABE 1P02A 2UWPA 1P11E 3LH3A 3M5OA 2RCEA 2QC2A 1A0LA 3VB7A 2CN0H 1JMOH 1HCGA 1EP5A 1JXPA 2ZGCA 1TNLA 1GBEA 3M36A 2OINA 5JYIA 1C1SA 2A2QH 2TBSA 1SLVB 1SGFA 1A3BH 1XUJA 3NUMA 5JBCS 1VITF 1Z8GA 5ETXA 8GCHF 3ATLA 1D6WA 4HZHA 1SVPA 1DWEH 1GBDA 2SGFE 2P3FH 1UO6A 1GHWH 1DWDH 1LMWB 3MFJA 2SNWA 3P92A 4X6NA 2LPRA 1NZQH 1LVOA 4X2XA 2FEQH 1OX1A 1C1QA 1V2PT 1MQ5A 3O8BA 4H4FA 2D1JA 4KTUA 3RXRA 4DT7B 1S81A 3W94A 1AUJA 2F83A 2A0QB 3U69H 2EI8A 1IAUA 1FAXA 2YNAA 4DVAU 3RM0H 4MG3A 3MMGA 5LPRA 1YPLH 1MKXH 1MTNB 3SI4H 2FIRH 1ELCA 1TGBA 2AGIX 6ESTA 4I31A 1XUHA 3ZZAA 1O5FH 3F9HA 4AFQA 1HAZB 3RXLA 3P8FA 1LKBA 4KTSA 1E34B 1E0FD 1LQDB 1V2RT 2BD7A 3LT3A 3UY9A 1TA6A 1TB6H 4D9RA 1OP2A 3QTOH 4AYYB 1LHEH 1XKBC 1HUTH 2NU1E 1H9IE 1AGJA 1C5MD 5FXLA 2BQ6B 2XTTB 1XXDA 1SQOA 1MBMA 4H6TA 3TIUA 1FNIA 4X1RU 2ESTE 1TBRH 1QB6A 4NSYA 4FUHA 1XVOA 1EUFA 1O2QA 3MHWU 1MKWK 4K8BA 1GHXH 1ZZZA 3IITA 2R2MB 2P8OB 4Z0KA 3RXCA 1G2LA 2PKSB 1VJ9U 3UR9A 1YYY1 3TITA 1DE7H 1INCA 5EU8A 5GWZA 4NWLA 2PWXA 2WYJA 3VB5A 3ZYDA 3L3TA 4INHA 2C3SA 1Z1IA 1BOQA 1C4U2 2UUFB 3RXEA 1OOKB 1UTLM 5E0JA 4TY7A 3DFLA 5CHAB 3MU1A 5J4SA 1BT7A 1EASA 1QFKH 2ZFRH 3PMBB 1LPZB 5C1XA 3QLPH 3BTEE 3B8JA 3GOVB 1E35B 1ZJDA 3QGNB 3PWCA 3EE0B 1QNJA 1NFWA 2J94A 1BA8B
chains in the Genus database with same CATH superfamily
1LPGB 2VNTA 3SJIA 3P8GA 2A2XH 1YY3A 1AQ7A 5HIZA 1QJ1B 1C5QA 2W3KA 2ZIQH 2WUCA 2ZPSA 3NKKA 1WAYB 1DITH 4U30A 2QXGA 2F9OA 4A6LA 1IQKA 4NIXA 2EI7A 4UFGH 4I8LA 3B9FH 4I33A 2IN2A 3F9GA 2GV6A 1TLDA 3RMMH 2G5VA 1C1PA 1O5DH 1O2HA 5EXNA 2P3UB 3LGIA 1ZMJA 1HJAC 4X1SU 1HB0B 1HAGE 1RTFB 3BTGE 3SJ9A 5DPAA 4RT1A 3DT0H 1YM0A 4FU9A 3GCHC 5EJLA 2ANYA 5L30H 2KAIA 3TVJB 5FPYA 1AUTC 1MABB 1CA0C 3I77A 4Y10E 1C1WH 2GCTB 3SV8A 4ABBA 5A0CA 1IQGA 2HNTC 2FWWA 5FBEA 5ABWA 1T4VH 5HKKD 2ZDMA 1O33A 1O32A 1VKYA 1L1NA 4AZ2B 1GI7B 3BTKE 4ABFA 4OGYA 5A0AE 1YGCH 3F2GA 3PM3A 1PQ5A 1NY22 4MTBA 2VVUA 2BYAX 2Q6GA 5HMAA 1GBMA 3ESTA 2Y82A 4AX9H 3M3VA 4ACBA 1QGFA 1O2RA 2JH6D 1FQ3A 4F49A 1B7XB 1EKBB 1F0UA 1UK4A 2XBVA 3UWJH 2Q6FA 2SGPE 3UNSA 4D8NA 5FPTA 3BTFE 1EJMA 1MTVA 3OAAD 3SOSA 1C5VA 3O8DA 1AKSB 4NIYA 3PLBA 3SUGA 1EX3A 3SNCA 2OC0A 4I86A 1EP6A 1GJ8B 1W11U 1ZMLA 1IQFA 1GMHF 6LPRA 1C1UH 1S6LA 2BXTH 2FYQA 3SBKA 4BAKB 2A32A 2OBOA 2G81E 1O3BA 1ZJKA 1V2TT 2ZGXH 4X1NU 2P95A 3TJOA 1A5IA 2F9BH 2FP7B 1SGTA 5EPYA 2KCYA 5FPSA 1GI3A 2JH5D 2P16A 3MU4A 3ATKA 4ISHH 4ABAA 4ZKOU 5EXLA 1GJ5H 3MNSA 1AIXH 4O9VA 4JCNA 1QTFA 3PTNA 4FU7A 5AVDA 1K22H 1QJ6B 3EA8A 5KECA 2BDIA 4WXVA 2TPIZ 3RC5A 3U1IB 3ZVCA 4KKDA 4I8JA 2P94A 4J2YB 2BY9X 2ZHQH 1WU1A 2ZDVH 3FZDA 3NCLA 4IN1A 4YM9A 1GL1A 1O5BB 1O3AA 5LPEA 2IJD1 1GMCG 3KQ5A 4AG2A 4B6EA 5BRRE 2KM0A 2FS9A 1ZSLA 3E91A 5BPEA 1GCTB 3A88A 1ARCA 1FI8A 1SKYE 3ATMA 4TWYA 4AGJA 3H09A 4DY7B 1GBKA 2BDHA 3LDXH 2W7UA 1MTUA 2BLQA 4CHAC 3GICB 4X8SH 2BDAA 1CE5A 1WUNH 4NG9H 1IHSH 4YT7H 7GCHG 2ZCKP 3LIWA 3RXIA 2BY6X 2QN5T 1SGIB 1SR5C 4YZUA 5KEDA 1V2KT 3BTME 4BTIB 1P2MA 1NT1A 1C1VH 5DP9A 3MO9A 2J4IA 4Y71A 4UFDH 5EIYA 1P03A 1SPJA 2BY5X 1P05A 4HFPB 1G9IE 5AFZH 3BF6H 1CGHA 3TJUA 4AB8A 2ODYB 2QGRA 3PMHB 3SGBE 3F9EA 1ZPBA 1AZ8A 1C2KA 2BZ6H 1D9IA 4ZAEA 3MQKC 1QQ4A 1OS8A 1F2SE 1PPEE 4A1XA 3L33A 1D3TB 3GY8A 3GDSA 3TH2H 2HOBA 2GMTB 3O8RA 1O34A 3UUZA 5DG6A 1S85A 3KGPA 1QBNA 5AHGH 1TNIA 2P3TB 1TOCB 4Y8ZA 5FBIA 4X8VH 1AKSA 3CS0A 3OYPA 3H7TA 4DGJA 5C0TA 1TONA 1Y3VA 3MI4A 3AVZA 1AFQB 1H4WA 2Y6TA 4YO9A 2OQUA 1WTGH 1KYNA 1JBUH 1T31A 3GY2A 3S9CA 4GSOA 3RXJA 2Z9JA 4F4OC 2WPMS 2PUQH 2GT7A 4B2AA 1RTLA 4GCHG 1DVAH 1QY6A 3A7TA 4D7GA 2J95A 2FOGA 1ZLRA 3VFEA 1S6FA 5EQRA 3PMJA 3A89A 4NCYA 2VIPA 5E0GA 3PWBA 1HYLA 4D7FA 2QIQA 1D3PB 3KF2A 2GT8A 1ANDA 4MNYA 2NU2E 1GI2A 1GBFA 2NU0E 4B1TA 2BOHB 2PR3A 1SLWB 3ZZDA 5C94A 4AGKA 1S82A 4NWKA 4A92A 5B6LA 1EAWA 2EI6A 1O3GA 2AMDA 1ESAA 1LTOA 1O3JA 1BUIA 4BAQB 2VH0A 4F55A 1S5SA 5H4IB 4ZKRU 1D3QB 3AAUA 1DUAA 1TBQH 2TGTA 3GY7A 5E8EH 1G3EA 1V2UT 4K60A 3SU6A 3GCTF 3D65E 3I78A 1JOUB 1Q3XA 2XYAA 3DA9B 2OQ5A 3D49H 1GVZA 4MLFB 4ZXXH 3K6ZA 3NZIA 1GJ4H 5ESTE 1FN6A 1FXYA 2CK3D 5TCAA 4ZCNA 3QN7A 1C2LA 1WSSH 2A4GA 1D4PB 3SU2A 2TGPZ 2VGCC 1C1OA 1LCYA 1OWHA 1BJUA 4JYVH 1XX9A 1ZHMA 3RMNH 2ZDNA 2BLWA 1K1LA 5EW2H 4DJZB 1FAKH 3HPTB 2ODPA 3U1JB 2WPHS 5C2ZA 4AFZA 1Y5AT 2ZFFH 4HGCA 4IC6A 5DP5A 5A8ZA 1EB1H 6GCHF 1GI9B 3UREA 4Q7ZA 2XRCA 2GJGA 3N99A 3HKIB 7KMEH 2W3IA 1C2JA 2H9EH 2WYGA 1EATA 3ZIAD 3CP7A 1QIXB 1V6DA 2ANMH 5F8ZA 1HAOH 1O3LA 3A7XA 4CR9A 3UOPA 3RXVA 1LQEA 1BDAA 1SHYA 3K6YA 1T32A 3PB1E 3HGPA 3A8DA 3EYDA 2J9NA 1RIWB 4MNVA 1AI8H 2BB4A 3UOUA 4FOUC 1BITA 1WOFA 2XCFA 1PFXC 5FHTA 1TX6A 3KHVA 3SHAH 3EA7A 5FCKA 3ZZ3A 4BXSA 4CRDA 3IWMA 1FDPA 1C5YB 1MTWA 2CF9H 2XBWA 4TYDA 1UK2A 3RC4A 3U8RH 3ODFA 2TGAA 2QXHA 2Y7XA 3S7HB 1DWBH 1FIZA 2CHAC 4Q80A 2C8YB 3TNTA 1O37A 1V2VT 1MH0A 3GYMA 4BANB 2XNIA 3ATWA 2UWOA 3RU4E 1SHHB 1ZPCA 2HVYB 3OY6U 2RFKC 5EOKA 1TGTA 1NFYA 2WV4A 1P2OA 4A7IB 3BG4B 4JZFH 4IS5A 2Z9GA 5F8XA 3KN2A 3MOCA 2VVCA 2ZU4A 3LU9B 2HWLB 3PV2A 1FJSA 1AD8H 2B8OH 3S9AA 1AMHA 3GDUA 5EQSA 3ZZCA 5HXFA 2KZ4A 4I8GA 3A8BA 1C1TA 4LXBH 4E7RG 3VGCB 4BAHB 1K1PA 2FLBH 1NU7B 1W7GH 4H42U 2JETC 2PP6A 5DK1A 4OGXA 1TGCA 1H8ED 3S69A 2AMQA 1LHGH 2UUYA 3HKJB 2HGTH 3HK6B 1OKXA 1P3CA 1IQHA 1IQMA 1BRAA 3M37A 8LPRA 1MMJN 4Q7XA 1CT2E 1ZRKA 1CGIE 3LH1A 1O3NA 1TX7A 2HVXA 4K1TA 1MKWH 4B76A 1GBAA 1LVBA 4IMZA 2IOTA 5DGJA 1EJAA 4KGAA 3PYHA 2AYWA 4THNH 3MH4A 5T6GA 2GZ8A 1Q31A 4B2BA 3W95A 1WV7H 1BHXB 4D9QA 1THSH 2FOBA 2G51A 3M3SA 2SGDE 2BD8A 2I6SA 5KGOA 1FLEE 4FUFA 1FV9A 1O5AB 2G55A 2VB0A 3F0OA 2PV9B 4P00A 1F7ZA 3ZVGA 4CREA 1ZPZA 3TGJE 1G3CA 3Q00A 3LJOA 2Z6BD 3AW0A 3T28A 1ANCA 3CS7A 4UD9H 2K8IA 3RU4D 3M5LA 3N7DA 4ZHAA 1BRUP 3M5NA 2F43B 3MTYA 1D3DB 3TGIE 2ZHDA 2FYRA 3URDA 3ZZBA 2ZTXA 1K28D 1MTNC 1DT2A 5CMXH 1ELAA 1GI6A 3E90B 3LC5A 2BDGA 4Y6DA 2B7DH 1UMAH 1EPTB 4WH6A 1C5TA 2PTNA 4ABIA 4AOQA 2BM2A 2ZI2H 3SGAE 1G32B 4YOIA 1LDTT 4JYUH 3F2HA 1TPPA 1AE5A 1GHBG 3Q3YA 4NA9H 1DXWA 2VIVA 1PYTD 2OXSA 1P04A 4OS2A 4CRFA 3BTDE 3LPRA 4D76A 2FXRA 4WJG2 2JDID 3MU8A 2VH6A 3D62A 2EY4C 4H6SB 4MNWA 1O3DA 4Y79A 2GGVB 4ISOA 3V7TA 2ULLA 2XWBI 1UVSH 1KDQA 9ESTA 4YLUA 1C5OH 1VGCB 3MWIU 1TYNA 3ZZ8A 4XRNA 4ASUD 2NU3E 1W2KH 1GVLA 2ZEBA 3U28C 1QR3E 2ZHWH 1O35A 2WPLS 1DX5M 5HM9A 1IQEA 1TWXB 3E0NB 1DY9A 2ASUB 4OS7A 3OE7D 1ZYOA 1PPCE 4FVBA 4ABJA 1N6YA 4AN7A 1CU1A 5CHAC 1G3DA 2BY7X 4X2VA 5JB8S 2FOHA 2FI5E 1XUIA 3OTPA 3V12A 4MPUA 2FS8A 2J2UA 4UE7H 1GBBA 1ETRH 4RN6A 4FU8A 3Q3KA 3SN8A 2VIWA 5HGGA 2OLGA 1AU8A 1ZHPA 1P0SH 1HBTH 3BTHE 4RKJB 1NRRH 4OS1A 2WZQA 2L74A 4NA8A 3FN8A 2ZECA 3GISB 4A5TS 1NTPA 2QCYA 4R0IA 3PLKA 1VITH 3UFAA 2C4FH 1ABIH 2ZGBH 3A8AA 1ZTJA 1WYKA 3RM2H 2H5CA 3A80A 1DPOA 1SOTA 2F9NA 3TU7H 3Q77A 1C2DA 1O2MA 5HM2A 1UTOA 1NM6A 1GDNA 3A85A 1E79D 1C5WB 3NPSA 1TALA 3SQEE 1QRZA 3NWUA 1EPTA 1C5NH 2XC4A 3SU3A 1O2UA 5HYOA 1UHBB 2AERH 3WWBA 2VJ1A 2FMJA 2GCTC 1QL9A 3EDXB 1JRTA 2RDEA 3OEHD 1J8AA 1Z6EA 2BDYA 3EQ0H 4ISIH 2ANWA 3KQEA 3N7EA 2F9UA 2A4QA 2A5KA 2IPHA 2QV1A 1ABJH 2XWAA 2ZDKA 2VWMA 1GMDG 1ESBA 1SG8B 2GP9B 1Y59T 4ABGA 1PQ8A 1YLCA 4SGAE 1BJVA 1NRQH 2K0QA 2BXUH 1FN8A 1YP9A 4DURA 5F8TA 1G36A 4XBBA 3TK6A 4CBNA 1O5GH 5DJ7A 5DKMA 1W0ZU 1SL3A 1K2I1 3E8LA 3UPEA 2ZP0H 1QHRB 2FOMB 2STAE 2V3HH 1HAVB 2VIQA 1SGCA 5C20A 3A84A 1H8IH 1IQLA 3PO1C 1GI1A 2V35A 5EW1H 5E0HA 3VEQB 1B0EA 1F0TA 2J97A 1SGEE 2V7QD 2ZPQA 4B71A 4LZ4B 2Y5GA 2ZCHP 1V2OT 3UR6A 3F0PA 3ZZ6A 4AYVB 3KNXA 1OP8A 1GJDB 3LC3A 1MTSA 3M35A 1AVGH 4JZDH 5I46H 1DOJA 4K69A 2QY0B 4DOQA 3GY5A 1TQ7B 2ZKSA 3PV5A 2QYIA 5DP7A 3P70B 2Z7FE 2R3UA 1A7SA 1A5GH 3MNCA 4Q4LA 1ZGVA 3A7YA 3LONA 3UWIA 4Y76A 1V2LT 2OBQA 5EPNA 3SYJA 1P09A 2ZDAH 5J4QA 4MDSA 1UCYH 1HJAB 2WINI 4FUGA 4CBOA 4JZ1A 4X8TH 4ZKSU 2D8WA 2P59A 3GCHB 1CA8B 4R8TB 3SU0A 1HDTH 1CA0B 1G37A 3RXMA 1Z6JH 3UTUH 1SLUB 1GCTC 1RD3B 1EOJA 2F3CE 1TRYA 3V13A 3VXFH 1GMCF 5SGAE 1MUEB 1ESTA 2D2DA 4B6FA 1BBRH 1GG6B 1Y5BT 3U98H 5G4BA 5PTPA 2QF5A 2C90B 3K65B 2AIPA 1QBVH 4INLA 4YT6H 2QXJA 1KSNA 3SI3H 3DSGA 4K2YA 2AFQB 7GCHF 2GDDA 1ANBA 4X2WA 1QZ8A 2YOLA 3SJKA 1TNHA 4CR5A 1IQJA 4AB9A 1GPZA 1YPHE 1K0HA 1ELGA 4XE4A 1W13U 1AB9B 5F03A 3HGNA 1L1JA 1YPEH 1Z8RA 1DUEA 1CHOG 2RA0A 2LNCA 1GGDC 2A45B 2OC8A 1XVMA 2ZGHA 1FMGA 2FM2A 1GJ6A 3MNXA 3BEFB 1BTHH 4GHQA 1THPB 5K7RA 1ELFA 2ZZUH 1BMAA 2Z3EA 1K21H 2YMSC 4AG1A 4WVPE 5A2MH 1ACBE 3ITIA 2QAAA 1PPGE 2VVVA 2VIOA 1TAWA 1H8DH 1DFPA 3EE7A 4AC9A 1ELVA 1NC6A 5FL7D 1YCPK 3N7OA 3ZYEA 3E1XB 5AFYH 1C2MA 1JRSA 5L2YH 2ZFQH 3V0XA 2DUCA 1BRBE 1QB1A 1PPZA 3LKWA 3T26A 4B74A 1C1MA 4BTUB 1A61H 1BRCE 7ESTE 1UK3A 4AFUA 5A8XA 4GCHF 1ETSH 1HPGA 2ALVA 3FP7E 4JK5A 4VGCC 1O3CA 1Y3XA 2LP6A 1HJ8A 1XUFA 3PMAB 4JMYA 5I25A 2VWNA 3VB4A 4WMDA 1GBLA 3EAJA 2Z9IA 2HRVA 4MQAA 5GDSH 4FUBA 1T8OA 1O3PB 3RLWH 1ZSKA 1ELTA 2ZC9H 2FI4E 4IBLH 2D26C 1HV7A 3L6PA 1TFXA 4I8KA 3RXQA 2PTCE 4O3TA 5JPMH 2A5IA 3K2UA 4FUJA 1L2EA 3V3MA 1W14U 3ZVDA 1Y3YA 1A0JA 3RXBA 4Q2KA 1P01A 1E37B 1PPFE 3RMOH 1XXFA 1O3HA 1W10U 5A09A 3TJNA 1Z7KA 3FOAA 1MQ6A 5LH8A 3BIVH 1K1MA 1E1QD 3QK1A 3T2NA 1C1RA 5A0BA 1OYTH 1XKAC 3ZZ9A 1NRNH 1K1JA 1SB1H 1NRPH 1GJCB 1EAIA 1AO5A 2QF4A 3BV9B 4RI0A 1OSSA 1F0SA 1OWEA 4BXWA 1GDQA 3SUEA 1SLXB 1EZSC 2WV9A 1BCUH 4NGAH 1T8MA 2BOKA 4QT8C 2W7SA 1W12U 1W0JD 1MU8B 2ZGJA 1P10A 4UFEH 2PKAB 9LPRA 4LOYH 1F5LA 5ESBA 1HFDA 2GZ7A 2OC1A 1HAYB 1EXFA 1TGNA 2IJOB 1DLEA 1K1IA 3QUMP 4RT0A 3LJJA 3BTTE 1P3EA 3STJA 4HI3A 2OD3B 1ZGIA 2KX4A 2UUJB 4XD7D 2A5AA 2PSYA 1C9TA 1SFQB 5GCHG 2C8WB 2ZNKH 1DICA 1RGQA 3SORA 3VPKA 1RIWC 2WPDD 4FVDA 5DP8A 3RDZA 1BIOA 1MZDA 3I29A 3QDZB 1W7XH 2P93A 4K1EA 3GY3A 1NPMA 6CHAB 3RXHA 1ELDE 2R9PA 1RTKA 1GBTA 1T7CA 2PUXB 3TGKE 1UTQA 2TIOA 4ISLA 4CRAA 4O97A 5C5OA 1WQVH 4IMQA 2XNDD 2HPPH 1AWHB 2ZWLH 1DWCH 3AW1A 1GHZA 2V6NA 1C2GA 3DFJA 4NZQA 2CGAA 1GBCA 1KLJH 4IC5A 3BG4C 4ZXYH 3MH6A 1MD8A 1MCVA 1N8OB 5TJXA 4CH2B 5F6MA 4X6OA 1KLTA 2H1UA 2THFB 4U32A 3D23A 3M3TA 2CJIA 1SOZA 4ACAA 2WV5A 1Q2WA 5EXMA 1GCDA 3SGQE 4OS5A 1O2XA 3VGCC 3ZV9A 2B5TB 1DSTA 1ZSJA 3GDVA 5A8YA 5B6OA 5IK2D 2HALA 1MBQA 2XC0A 5EG4A 3QX5H 1SSXA 2B0FA 4X2YA 3H7OA 3SO3A 2RDLA 4NFEA 1CBWB 1SMFE 3FO8D 2Q1JA 2HNTE 3NXPA 4RKOB 1BTPA 1O2LA 1B0FA 5CDFE 2NWNA 3TJVA 3U8OH 2QF0A 2Y81A 2BD5A 3KL6A 4ZMAH 1CGJE 1O3KA 1SGNE 2H5DA 1O2OA 1XUGA 1AN1E 1F5RA 1IQIA 1EAXA 1GVKB 1O5EH 1MAXA 1YF4A 3A7VA 3RXUA 2FOCA 1JIRA 3TK9A 1FY1A 1ARBA 1W0KD 1GJ7B 5C5NA 2V3OH 2EC9H 4YOJA 1TMUH 3KQDA 1CHGA 4OS4A 4ABDA 4JZEH 2F9VA 2BD2A 2Z3DA 2ZO3H 1KTSB 1VCPA 1C4Y2 2A7JA 1TX8A 5EJ1A 1GHAG 3TH3H 1CT0E 1GJAB 3FAOA 1Y3UA 4XBCA 1LVMA 3GCNA 4YTAA 3MH5A 4K5ZA 1YPHC 1FX0B 2Y80A 2OTVA 1V3XA 1SQRA 4OM9A 1GBJA 1A5HA 1J16A 1YPKH 1EPTC 1O2KA 3T27A 2ZFPH 3SNEA 3H5CB 2R0KA 1C1NA 2FOAA 2SFAA 5F53A 2A7HA 2ZPRA 1ELBA 1T8LA 3RXSA 3LGTA 1CSOE 1GHBF 1EOLA 1UVTH 4Q63A 1DY8A 1O31A 3KYGA 3KYFA 3Q3XA 5LPFA 3A81A 2STBE 1OYQA 2XBXA 1YPGH 1WDIA 2ZTYA 3ZVBA 1P2NA 2JETB 3HATH 1C5XB 3AASA 1KXAA 1QB9A 2R2WU 3BSQA 1VGCC 1ORFA 2BDCA 4I7YH 4NSVA 3PROA 1G3BA 3SU4A 3K9XB 1SFIA 1GI8B 1SGFG 2NU4E 1O0DH 3A86A 1ZOMA 4ZROA 4AORA 4X0WU 3UIRA 1V2ST 2O8TA 4E05H 1P2JA 4BNRA 2B9LA 2GCHG 5FX6A 1TPAE 1BHXF 4CRGA 4XSKU 1RFNA 1BTWA 1OWJA 1PQ7A 1EFRD 2PSXA 1QCPA 2UWLA 4XBDA 4B2CA 1FZZA 1SGRE 2BY8X 5K0HA 1AVXA 1HAXB 4FUCA 1WQSA 1NRSH 3PRBA 1FY8E 1D6RA 2KCAA 1ANEA 3T25A 1HIAB 2GD4B 1MD7A 3TH4H 2PGBB 3FANA 1N6XA 2ZCLP 1KLIH 1P12E 3OSYA 4DW2U 2FO9A 5C3NA 3F68H 2P8OC 4X1QU 1C2FA 1IOEA 1BMMH 2PKSC 3HK3B 3R0FA 1DS2E 1A0HB 1QRXA 2BD9A 1C2EA 4MPWA 4Y8YA 5L6NH 1VITG 4M7GA 8GCHG 1O2SA 4XOJA 1YCPM 3DCLA 2SGEE 1LVYA 1L4ZA 1A46H 2AEIH 3SNBA 3PRDA 1UTPA 2JKHA 1BMNH 2FX6A 3MYWA 2BVXH 3LGVA 2KAIB 1C2IA 1L1GA 3ELAH 3DSOA 3WW7A 1TNKA 3PV4A 1KXCA 1A4WH 1LPKB 2J38A 1JIMA 3ZV8A 1GHVH 4NIWA 1GWAA 1A3EH 2A31A 4WWYA 1C9PA 3UQOA 3RXGA 1GI4A 1RXPA 2AGGX 1P2QA 4GHTA 1KXEA 4FETA 3FP8E 1KIGH 4E06H 5JBBS 2SNVA 2ANKH 2KFWA 1Y5UT 1UVOA 1V2MT 1RJXB 2BD3A 3SUDA 3E0PB 4YLQH 1VR1H 2TGDA 5FX5A 2O9QA 2V0BA 3GCOA 1O2IA 3TPIZ 5DN6D 1ZMNA 3FVFB 4UONA 1GMDF 2VIDA 3RXAA 4CRCA 4ASHA 1O2YA 3GYLB 1GJ9B 1XM1A 1GL0E 3A8CA 4DIIH 1QL7A 1UTNA 4FUIA 4WY3A 3NRLA 4E7NA 2G5NA 2Y5FA 4ESTE 3WWFA 1LHDH 1TA2A 4ISNA 2JH0D 1A1RA 1TIOA 1MCTA 2J34A 3SV6A 1V2JT 2SGQE 2LELA 1QRWA 5E2OA 3SUFA 1G2MA 1Z1JA 4NIVA 2PFEA 1O3FA 3QZRA 1HIAA 2PW8H 3KCGH 1FY4A 4B75A 3SV9A 3RLYH 1YBWA 1GBHA 2OCVB 3P8OA 1HJ9A 1YCPH 3P17H 1KMHB 2CV3A 2BQ7B 1EZXC 8ESTE 5IDKA 3BTQE 1DSUA 1P9SA 5CHBA 5EJZA 4HTCH 2GV7A 4X6PA 3BTWE 4ZKNU 1Y8TA 4OS6A 1ZHRA 1GDUA 1DANH 1DDJA 4JYTA 3TNSA 2BMGB 1P9UA 1KTTB 4RSPA 3RXKA 2K1QA 2FTMA 2ZU3A 1P57B 2ZQ2A 5JBTA 1UVPA 1KXFA 1NO9H 2FTLE 1NBME 4FUEA 1P2KA 4B73A 1RRKA 3GY4A 1QBOA 2A7CA 3E6PH 1F92A 1NFXA 3MU0A 3E3TA 2GVFA 4U01A 2BX4A 5GPIB 1AE8H 3EA9A 5TCCA 5GJ4B 1TPSA 3SU5A 4ABEA 4TPYA 3F9FA 1YKTA 4INKA 1DXPA 3O8CA 8KME2 1MKXK 1P06A 2FOFA 2QE7D 2O8LA 1HAHH 2WPIS 2H6MA 1JWTA 1L4DA 1EZUC 1GG6C 1GHYH 2BQWB 2ZG0H 3U9AH 1OWIA 4KP0A 2ZU1A 2W5EA 2HLCA 3SHCH 3A87A 3PLPA 4GPGA 4WF8A 4DG4A 1C5PA 2Z3CA 2FODA 2XW9A 3DD2H 3LGYA 1ELEE 2CF8H 3ZVFA 5DO4H 1AB9C 2G52A 4K3JA 3MO6A 1UTKA 1PYTC 2H9HA 3F3BA 3AK5A 2GX4A 4A1VA 2YNBA 1ZRBA 4MVNA 1EB2A 1CVWH 1CHOF 1CQQA 1FY3A 4KTCA 5EQQA 1UHBA 2VU8E 3PO1B 3IG6B 2ZHFH 1W0YH 3RP2A 1O2PA 1S84A 1TBZH 5FCRA 2ZF0H 4I32A 1O30A 1QL8A 2F4LA 2C93B 7LPRA 1YPMH 4Y0YE 3SNDA 5C1YA 3SZEA 3GY6A 2PHBA 2TRMA 1O2ZA 2M5TA 1J9CH 2SGAA 4TWWA 2GKVE 2ALPA 4IN2A 2WPKS 3BN9A 1L0ZA 3NK8A 3U8TH 1O2NA 1EAUA 3ZVEA 1K1NA 1NBMD 4F48B 3TK5A 1ZTKA 2A1DB 3G01A 5DP6A 4Q7YA 1TNGA 1O2GH 2WSSD 2WUBA 5C67A 1BTZA 4LK4A 2Y5HA 1TQ0B 2GMTC 3BG8A 1BTYA 1HAVA 1V2WT 1X7AC 1TOMH 1UTJA 4YESB 4NFFA 1RS0A 3MH7A 4ZHLU 1H9LB 1GMHG 2BDBA 4GUXA 3KEEA 3LOXA 1W8BH 2XBYA 1HXEH 5E2PA 1O39A 4WXIA 1BTXA 2GDEH 1AFQC 1YC0A 1AY6H 2ILNA 1WXRA 1PPBH 2C8XB 1O2WA 4GAWA 2HNTF 4WMFA 1LKAA 3P6ZB 1HXFH 3S7KB 2QF3A 2FX4A 2Z9KA 4GVUA 2FI3E 4I8HA 1VCWA 1AFEH 1NN6A 1O3OA 2AGEX 2JJ2D 1QJ7B 4JZIA 4MNXA 4MPVA 2CMYA 3SV7A 2AH4X 1TNJA 2R0LA 1AVWA 1T4UH 3M7QA 3MU5A 3RXTA 5DP4A 2R3YA 3SU1A 4M9FA 3Q76A 2FESH 1DM4B 2F9PA 1AWFH 2OK5A 3A82A 2ZU5A 3MNBA 3QTVH 4NZLA 1MZAA 4Z6AH 1U6QA 1MU6B 1NROH 4UFFH 1O3IA 1GBIA 3JZ1B 3S0NA 5DP3A 1V2QT 1O5CB 4ZUHA 1EQ9A 4GLYA 4BOHA 1FUJA 3BIUH 1EZQA 4DCDA 1GGDB 2G4UA 2XXLA 1FPCH 2A4RA 1ZR0A 3BEIB 3FKSD 2QA9E 5AF9H 1VJAU 4Y0ZE 4BTTB 1IHTH 3M61U 2VWLA 1BQYA 1UCYE 3SNAA 1LHFH 2YMSB 1YLDA 1NS3A 1SI5H 1S83A 4CHAB 2FDAA 2W6JD 2Z94A 4O3UA 1C5UA 4FUDA 3ZZ7A 2BTCE 3RUOA 3ODDA 2WPJS 1LHCH 1NU9A 2BX3A 5C17A 1HNEE 5T1VA 5JBAS 2PLXA 4DIHH 1SBWA 2BZAA 2JIZD 1BB0B 5JB9S 2FZZA 4YOGA 2IPQX 2QXIA 1BBRE 1E36B 5T6FA 3S9BA 2G8TA 3A7WA 1UCYK 4ZH8A 1VZQH 3PTBA 3A83A 2H9TH 4VGCB 2O8UA 3F6UH 4JK6A 5GCHF 1YPJH 3FFGA 4X1PU 1C5RA 1THRH 1J17T 4X6MA 1PJPA 3EGKH 1ID5H 6CHAC 2VWOA 2H2ZA 3ENSB 1P8VC 3QWCH 4CRBA 3STIA 1O2JA 3B23B 1P2IA 3DHKH 2ZTZA 2ODQA 3ZZ5A 3VXEH 3RMLH 2Z9LA 1BBRK 1QA7A 1H8HD 1B5GH 3T29A 3E16B 1QA0A 3URCA 1HGTH 2FPZA 3UQVA 1OXGA 4X8UH 2BLOA 2DE9A 3C27B 3SJ8A 3VB6A 1NFUA 5T3HA 4J1YA 1QQUA 1N8OC 4UDWH 1CO7E 1PQAA 2CXVA 2HPQH 3M7TA 3KQBA 3RXPA 3P95A 1PPHE 2OP9A 1O38A 2EA3A 3T5FH 2ZHEH 3C1KA 3ZVAA 2RA3A 1J15A 3OU0A 1S0RA 3CENA 1K9OE 1AHTH 3RU4T 4IGDA 4PROA 1SGDE 1GJBB 3UAIC 1OP0A 1S0QA 1UJ1A 1QURH 3DUXH 3OX7U 1ETTH 3TLOA 3BEUA 3SV2H 5EODA 1SQAA 5JDUB 3VB3A 2DE8A 4A1TA 4LZ1H 1CBWC 2I6QA 1WBGB 2C8ZB 2ZQ1A 3GCTG 1C5SA 1O2VA 4K1SA 1O3EA 3F2FA 3QZQA 4FXGH 3A7ZA 1IQNA 2W6ID 2FLRH 4O03A 1KXDA 3OFND 3KIDU 1GI0A 1OPHB 2GTBA 3T62A 1AZZA 3JZ2B 1H9HE 5EGMA 1C5ZB 2J98B 1HRTH 4YXWD 4KELA 1SC8U 1SQTA 1Z8JB 2RG3A 2J92A 1WCZA 1SGPE 2BVSH 2ZA5A 1HAIH 2KCOA 3M5MA 4BAMB 1DLKB 4K8YA 1C4V2 3MO3A 2VGCB 1FY5A 4Y7AA 5C1UA 1VCQA 2VBCA 3LGUA 1W3CA 1F5KU 5GXPA 1KXBA 4P02A 1LO6A 1WTHD 5CE1A 2AS9A 5L2ZH 1ZTLA 1NESE 5LGOA 3FP6E 1FIWA 2O8WA 1M9UA 2AIQA 1TE0A 2OC7A 6GCHG 5DSFA 1N1LA 3RC6A 2AMPA 4ABHA 1UVUH 4ZHMU 2JJ1D 1J14A 1TPOA 3RXFA 1TMBH 1TGSZ 2PKAA 1O36A 1OWDA 1SGQE 2ZU2A 1C5LH 3QGJA 3UNQA 1XMNB 1HLTH 1GHAF 3W1EA 1A2CH 1XUKA 2XCNA 4Y8XA 3AAVA 2BLVA 1MAYA 3M7UA 1E38B 3WY8A 3SZNA 3SW2B 1Y3WA 3OTJE 1TRMA 2PGQB 3RXOA 1FONA 2ZDLA 1Z71A 4NA7A 1BTUA 3SQHE 3RXDA 1G30B 4Y7BA 1SGYE 2O8MA 1GI5A 2Q6DA 4HG6A 5FAHA 1BZXE 1V2NT 4TSFD 4SGBE 4DT4A 2Y7ZA 2W26A 2BD4A 1KDQB 1YWUA 1CT4E 2FOEA 2VINA 3LGWA 1FPHH 2CHAB 1T8NA 4CH8B 1C2HA 2EQNA 4MPXA 1UW7A 2BHGA 4UEHH 3GS9A 2G00A 4XFQA 1K1OA 3FZZA 5IYTA 1HAPH 3P8NA 4Y11E 4TY6A 1OWKA 2L6OA 1TMTH 2WHXA 2G4TA 1H1BA 4IW4E 2OUAA 1S6HA 3ATIA 3UNRA 4WMEA 4AFSA 2GCHF 1YLNA 1TRNA 1BMLA 2XC5A 3R3GB 4U2WA 3SJOA 1O2TA 4XDEA 4BAOB 1Z8IB 2A4OA 5GIBA 4WH8A 2J98A 1KY9A 1F0RA 4TPIZ 3ZZ4A 5C0UA 3F1SB 3KQCA 5T6DA 2F91A 5GNDA 3QO6A 2UUKB 1UTMA 1O3MA 1OHHD 2ZFTA 2BVRH 2EEKA 1EJNA 2GZ9A 2ZFSA 3OY5U 1TABE 5HIYA 1P02A 2UWPA 1P11E 3LH3A 3M5OA 2RCEA 2QC2A 1A0LA 3VB7A 2CN0H 1JMOH 1HCGA 1EP5A 1JXPA 2ZGCA 1TNLA 3OEED 1GBEA 3M36A 2OINA 3UB0A 4Z1MD 5JYIA 1C1SA 2A2QH 2TBSA 1BMFD 1SLVB 1SGFA 1A3BH 1XUJA 3NUMA 5JBCS 1VITF 1Z8GA 2V3MA 5ETXA 8GCHF 3ATLA 1D6WA 4HZHA 1SVPA 1DWEH 1GBDA 2SGFE 2P3FH 1UO6A 1GHWH 1DWDH 1LMWB 3MFJA 2SNWA 3P92A 4X6NA 2LPRA 1NZQH 1LVOA 4X2XA 2FEQH 1OX1A 2KR7A 1C1QA 1V2PT 3CNRA 1MQ5A 3O8BA 4H4FA 2D1JA 4KTUA 3RXRA 4DT7B 2M2AA 1S81A 3W94A 1AUJA 2F83A 2A0QB 3U69H 2EI8A 1IAUA 1FAXA 2YNAA 4DVAU 3RM0H 4MG3A 3MMGA 5LPRA 1YPLH 4TT3D 1MKXH 1MTNB 3SI4H 2FIRH 2HLDD 1ELCA 1TGBA 2AGIX 6ESTA 4I31A 1XUHA 3ZZAA 1O5FH 3F9HA 4AFQA 1HAZB 3RXLA 3P8FA 1LKBA 4KTSA 1E34B 1E0FD 1LQDB 1V2RT 2BD7A 3LT3A 3UY9A 1COWD 1TA6A 1TB6H 4D9RA 1OP2A 3QTOH 4AYYB 1LHEH 1XKBC 1HUTH 2NU1E 3VG8A 1H9IE 1E1RD 1AGJA 1C5MD 2AHME 5FXLA 2BQ6B 2XTTB 1XXDA 1SQOA 1MBMA 2KCPA 4H6TA 3TIUA 1FNIA 4X1RU 2ESTE 1TBRH 1QB6A 4NSYA 4FUHA 1XVOA 2YMSD 1EUFA 1O2QA 3MHWU 1MKWK 4K8BA 1GHXH 1ZZZA 3IITA 2R2MB 2P8OB 4Z0KA 3RXCA 1G2LA 2PKSB 1VJ9U 3UR9A 1YYY1 3TITA 1DE7H 1INCA 5EU8A 5GWZA 4NWLA 2PWXA 2WYJA 3VB5A 3ZYDA 3L3TA 4INHA 2C3SA 1Z1IA 1BOQA 1C4U2 2UUFB 3RXEA 1OOKB 1UTLM 2J5UA 2XOKD 5E0JA 4TY7A 3DFLA 5CHAB 3MU1A 5J4SA 1BT7A 1EASA 1QFKH 2ZFRH 3PMBB 1LPZB 5C1XA 3QLPH 3BTEE 3B8JA 3DSPA 3GOVB 1E35B 1ZJDA 3QGNB 3PWCA 3EE0B 1QNJA 1NFWA 2J94A 1BA8B
chains in the Genus database with same CATH topology
1LPGB 2VNTA 3SJIA 3P8GA 2A2XH 1AQ7A 1QJ1B 1C5QA 2W3KA 2ZIQH 2WUCA 2ZPSA 3NKKA 1WAYB 1DITH 4U30A 2QXGA 2F9OA 4A6LA 1IQKA 4NIXA 2EI7A 4UFGH 4I8LA 3B9FH 4I33A 2IN2A 3F9GA 2GV6A 1TLDA 3RMMH 2G5VA 1C1PA 1O5DH 1O2HA 5EXNA 2P3UB 3LGIA 1ZMJA 1HJAC 4X1SU 1HB0B 1HAGE 1RTFB 3BTGE 3SJ9A 5DPAA 3DT0H 1YM0A 4FU9A 3GCHC 2ANYA 5L30H 2KAIA 3TVJB 5FPYA 1AUTC 1CA0C 3I77A 4Y10E 1C1WH 2GCTB 3SV8A 4ABBA 5A0CA 1IQGA 2HNTC 2FWWA 5FBEA 5ABWA 1T4VH 2ZDMA 1O33A 1O32A 1L1NA 4AZ2B 1GI7B 3BTKE 4ABFA 4OGYA 5A0AE 1YGCH 3PM3A 1PQ5A 1NY22 4MTBA 2VVUA 2BYAX 2Q6GA 5HMAA 1GBMA 3ESTA 2Y82A 4AX9H 3M3VA 1QGFA 1O2RA 2JH6D 1FQ3A 4F49A 1B7XB 1EKBB 1F0UA 1UK4A 2XBVA 3UWJH 2Q6FA 2SGPE 3UNSA 4D8NA 5FPTA 3BTFE 1EJMA 1MTVA 3SOSA 1C5VA 3O8DA 1AKSB 4NIYA 3PLBA 3SUGA 1EX3A 3SNCA 2OC0A 1EP6A 1GJ8B 1W11U 1ZMLA 1IQFA 1GMHF 6LPRA 1C1UH 2BXTH 4BAKB 2FYQA 3SBKA 2A32A 2OBOA 2G81E 1O3BA 1ZJKA 1V2TT 2ZGXH 4X1NU 2P95A 3TJOA 1A5IA 2F9BH 2FP7B 1SGTA 5EPYA 5FPSA 1GI3A 2JH5D 2P16A 3MU4A 3ATKA 4ISHH 4ABAA 4ZKOU 5EXLA 1GJ5H 3MNSA 1AIXH 4O9VA 4JCNA 1QTFA 3PTNA 4FU7A 5AVDA 1K22H 1QJ6B 3EA8A 2BDIA 4WXVA 2TPIZ 3RC5A 3U1IB 3ZVCA 4KKDA 4I8JA 2P94A 4J2YB 2BY9X 2ZHQH 1WU1A 2ZDVH 3FZDA 3NCLA 4IN1A 4YM9A 1GL1A 1O5BB 1O3AA 5LPEA 5BRRE 1GMCG 4AG2A 2FS9A 1ZSLA 3E91A 5BPEA 1GCTB 3A88A 1ARCA 1FI8A 3ATMA 4TWYA 4AGJA 4DY7B 1GBKA 2BDHA 3LDXH 2W7UA 1MTUA 2BLQA 4CHAC 3GICB 4X8SH 2BDAA 1CE5A 1WUNH 4NG9H 1IHSH 4YT7H 7GCHG 2ZCKP 3LIWA 3RXIA 2BY6X 2QN5T 1SGIB 1SR5C 4YZUA 1V2KT 3BTME 4BTIB 1P2MA 1NT1A 1C1VH 5DP9A 3MO9A 2J4IA 4Y71A 4UFDH 1P03A 1SPJA 2BY5X 1P05A 4HFPB 1G9IE 5AFZH 3BF6H 1CGHA 3TJUA 4AB8A 2ODYB 2QGRA 3PMHB 3SGBE 3F9EA 1ZPBA 1AZ8A 1C2KA 2BZ6H 1D9IA 4ZAEA 1QQ4A 1OS8A 1F2SE 1PPEE 4A1XA 3L33A 1D3TB 3GY8A 3GDSA 3TH2H 2HOBA 2GMTB 3O8RA 1O34A 3UUZA 5DG6A 1S85A 3KGPA 1QBNA 5AHGH 1TNIA 2P3TB 1TOCB 4Y8ZA 5FBIA 4X8VH 1AKSA 3CS0A 3OYPA 3H7TA 4DGJA 1TONA 1Y3VA 3MI4A 3AVZA 1AFQB 1H4WA 2Y6TA 4YO9A 2OQUA 1WTGH 1KYNA 1JBUH 1T31A 3GY2A 3S9CA 4GSOA 3RXJA 2Z9JA 4F4OC 2WPMS 2PUQH 2GT7A 4B2AA 1RTLA 4GCHG 1DVAH 1QY6A 3A7TA 4D7GA 2J95A 2FOGA 1ZLRA 3VFEA 1S6FA 5EQRA 3PMJA 3A89A 4NCYA 2VIPA 5E0GA 3PWBA 1HYLA 4D7FA 2QIQA 1D3PB 3KF2A 2GT8A 1ANDA 4MNYA 2NU2E 1GI2A 1GBFA 2NU0E 4B1TA 2BOHB 2PR3A 1SLWB 3ZZDA 4AGKA 1S82A 4NWKA 4A92A 1EAWA 2EI6A 1O3GA 2AMDA 1ESAA 1LTOA 1O3JA 1BUIA 4BAQB 2VH0A 1S5SA 5H4IB 4ZKRU 1D3QB 3AAUA 1DUAA 1TBQH 2TGTA 3GY7A 5E8EH 1G3EA 1V2UT 4K60A 3SU6A 3GCTF 3D65E 3I78A 1JOUB 1Q3XA 2XYAA 3DA9B 2OQ5A 3D49H 1GVZA 4MLFB 4ZXXH 3K6ZA 3NZIA 1GJ4H 5ESTE 1FN6A 1FXYA 5TCAA 3QN7A 1C2LA 1WSSH 2A4GA 1D4PB 3SU2A 2TGPZ 2VGCC 1C1OA 1LCYA 1OWHA 1BJUA 4JYVH 1XX9A 1ZHMA 3RMNH 2ZDNA 2BLWA 1K1LA 5EW2H 4DJZB 1FAKH 3HPTB 2ODPA 3U1JB 2WPHS 5C2ZA 4AFZA 1Y5AT 2ZFFH 4HGCA 4IC6A 5DP5A 5A8ZA 1EB1H 6GCHF 1GI9B 3UREA 4Q7ZA 2XRCA 3HKIB 7KMEH 2W3IA 1C2JA 2H9EH 2WYGA 1EATA 3CP7A 1QIXB 1V6DA 2ANMH 5F8ZA 1HAOH 1O3LA 3A7XA 4CR9A 3UOPA 3RXVA 1LQEA 1BDAA 1SHYA 3K6YA 1T32A 3PB1E 3HGPA 3A8DA 3EYDA 2J9NA 1RIWB 4MNVA 1AI8H 2BB4A 3UOUA 1BITA 1WOFA 2XCFA 1PFXC 5FHTA 1TX6A 3KHVA 3SHAH 3EA7A 5FCKA 3ZZ3A 4BXSA 4CRDA 3IWMA 1FDPA 1C5YB 1MTWA 2CF9H 2XBWA 4TYDA 1UK2A 3RC4A 3U8RH 3ODFA 2TGAA 2QXHA 2Y7XA 3S7HB 1DWBH 1FIZA 2CHAC 4Q80A 2C8YB 3TNTA 1O37A 1V2VT 1MH0A 3GYMA 4BANB 2XNIA 3ATWA 2UWOA 3RU4E 1SHHB 1ZPCA 3OY6U 5EOKA 1TGTA 1NFYA 2WV4A 1P2OA 4A7IB 3BG4B 4JZFH 4IS5A 2Z9GA 5F8XA 3KN2A 3MOCA 2VVCA 2ZU4A 3LU9B 2HWLB 1FJSA 1AD8H 2B8OH 3S9AA 1AMHA 3GDUA 5EQSA 3ZZCA 5HXFA 4I8GA 3A8BA 1C1TA 4LXBH 4E7RG 3VGCB 4BAHB 1K1PA 2FLBH 1NU7B 1W7GH 4H42U 2JETC 5DK1A 4OGXA 1TGCA 3S69A 2AMQA 1LHGH 2UUYA 3HKJB 2HGTH 3HK6B 1OKXA 1P3CA 1IQHA 1IQMA 1BRAA 3M37A 8LPRA 1MMJN 4Q7XA 1CT2E 1ZRKA 1CGIE 3LH1A 1O3NA 1TX7A 2HVXA 4K1TA 1MKWH 4B76A 1GBAA 1LVBA 4IMZA 2IOTA 5DGJA 1EJAA 4KGAA 3PYHA 2AYWA 4THNH 3MH4A 5T6GA 2GZ8A 1Q31A 4B2BA 3W95A 1WV7H 1BHXB 4D9QA 1THSH 2FOBA 2G51A 3M3SA 2SGDE 2BD8A 2I6SA 1FLEE 4FUFA 1FV9A 1O5AB 2G55A 2VB0A 2PV9B 1F7ZA 3ZVGA 4CREA 1ZPZA 3TGJE 1G3CA 3Q00A 3LJOA 2Z6BD 3AW0A 3T28A 1ANCA 3CS7A 4UD9H 3RU4D 3M5LA 4ZHAA 1BRUP 3M5NA 3MTYA 1D3DB 3TGIE 2ZHDA 2FYRA 3URDA 3ZZBA 2ZTXA 1K28D 1MTNC 1DT2A 5CMXH 1ELAA 1GI6A 3E90B 3LC5A 2BDGA 4Y6DA 2B7DH 1UMAH 1EPTB 4WH6A 1C5TA 2PTNA 4ABIA 4AOQA 2BM2A 2ZI2H 3SGAE 1G32B 4YOIA 1LDTT 4JYUH 1TPPA 1AE5A 1GHBG 3Q3YA 4NA9H 1DXWA 2VIVA 1PYTD 2OXSA 1P04A 4OS2A 4CRFA 3BTDE 3LPRA 4D76A 2FXRA 4WJG2 3MU8A 2VH6A 3D62A 4H6SB 4MNWA 1O3DA 4Y79A 2GGVB 4ISOA 3V7TA 2ULLA 2XWBI 1UVSH 1KDQA 9ESTA 4YLUA 1C5OH 1VGCB 3MWIU 1TYNA 3ZZ8A 2NU3E 1W2KH 1GVLA 2ZEBA 1QR3E 2ZHWH 1O35A 2WPLS 1DX5M 5HM9A 1IQEA 1TWXB 3E0NB 1DY9A 2ASUB 4OS7A 1ZYOA 1PPCE 4FVBA 4ABJA 1N6YA 4AN7A 1CU1A 5CHAC 1G3DA 2BY7X 4X2VA 5JB8S 2FOHA 2FI5E 1XUIA 3V12A 4MPUA 2FS8A 2J2UA 4UE7H 1GBBA 1ETRH 4RN6A 4FU8A 3Q3KA 3SN8A 2VIWA 5HGGA 2OLGA 1AU8A 1ZHPA 1P0SH 1HBTH 3BTHE 4RKJB 1NRRH 4OS1A 4NA8A 2ZECA 3GISB 4A5TS 1NTPA 2QCYA 4R0IA 3PLKA 1VITH 3UFAA 2C4FH 1ABIH 2ZGBH 3A8AA 1ZTJA 1WYKA 3RM2H 2H5CA 3A80A 1DPOA 1SOTA 2F9NA 3TU7H 3Q77A 1C2DA 1O2MA 5HM2A 1UTOA 1NM6A 1GDNA 3A85A 1C5WB 3NPSA 1TALA 3SQEE 1QRZA 3NWUA 1EPTA 1C5NH 2XC4A 3SU3A 1O2UA 5HYOA 1UHBB 2AERH 2VJ1A 2FMJA 2GCTC 1QL9A 3EDXB 1JRTA 1J8AA 1Z6EA 2BDYA 3EQ0H 4ISIH 2ANWA 3KQEA 2F9UA 2A4QA 2A5KA 2IPHA 2QV1A 1ABJH 2XWAA 2ZDKA 2VWMA 1GMDG 1ESBA 1SG8B 2GP9B 1Y59T 4ABGA 1PQ8A 1YLCA 4SGAE 1BJVA 1NRQH 2BXUH 1FN8A 1YP9A 4DURA 5F8TA 1G36A 4XBBA 3TK6A 4CBNA 1O5GH 5DJ7A 5DKMA 1W0ZU 1SL3A 1K2I1 3E8LA 3UPEA 2ZP0H 1QHRB 2FOMB 2STAE 2V3HH 1HAVB 2VIQA 1SGCA 5C20A 3A84A 1H8IH 1IQLA 3PO1C 1GI1A 2V35A 5EW1H 5E0HA 3VEQB 1B0EA 1F0TA 4B71A 1SGEE 2ZPQA 4LZ4B 2Y5GA 2ZCHP 1V2OT 3UR6A 3ZZ6A 4AYVB 3KNXA 1OP8A 1GJDB 3LC3A 1MTSA 3M35A 1AVGH 4JZDH 5I46H 1DOJA 4K69A 2QY0B 4DOQA 3GY5A 1TQ7B 2ZKSA 2QYIA 5DP7A 3P70B 2Z7FE 2R3UA 1A7SA 1A5GH 3MNCA 1ZGVA 3A7YA 3LONA 3UWIA 4Y76A 1V2LT 2OBQA 5EPNA 1P09A 2ZDAH 5J4QA 4MDSA 1UCYH 1HJAB 2WINI 4FUGA 4CBOA 4JZ1A 4X8TH 4ZKSU 2D8WA 2P59A 3GCHB 1CA8B 4R8TB 3SU0A 1HDTH 1CA0B 1G37A 3RXMA 1Z6JH 3UTUH 1SLUB 1GCTC 1RD3B 1EOJA 2F3CE 1TRYA 3V13A 3VXFH 1GMCF 5SGAE 1MUEB 1ESTA 2D2DA 1BBRH 1GG6B 1Y5BT 3U98H 5G4BA 5PTPA 2C90B 3K65B 2AIPA 1QBVH 4INLA 4YT6H 2QXJA 1KSNA 3SI3H 4K2YA 2AFQB 7GCHF 2GDDA 1ANBA 4X2WA 2YOLA 3SJKA 1TNHA 4CR5A 1IQJA 4AB9A 1GPZA 1YPHE 1ELGA 4XE4A 1W13U 1AB9B 5F03A 3HGNA 1L1JA 1YPEH 1Z8RA 1DUEA 1CHOG 2RA0A 2LNCA 1GGDC 2A45B 2OC8A 1XVMA 2ZGHA 1FMGA 2FM2A 1GJ6A 3MNXA 3BEFB 1BTHH 4GHQA 1THPB 5K7RA 1ELFA 2ZZUH 1BMAA 2Z3EA 1K21H 4AG1A 4WVPE 5A2MH 1ACBE 3ITIA 2QAAA 1PPGE 2VVVA 2VIOA 1TAWA 1H8DH 1DFPA 1ELVA 1NC6A 1YCPK 3N7OA 3ZYEA 3E1XB 5AFYH 1C2MA 1JRSA 5L2YH 2ZFQH 3V0XA 2DUCA 1BRBE 1QB1A 1PPZA 3LKWA 3T26A 4B74A 1C1MA 4BTUB 1A61H 1BRCE 7ESTE 1UK3A 4AFUA 5A8XA 4GCHF 1ETSH 1HPGA 2ALVA 3FP7E 4JK5A 4VGCC 1O3CA 1Y3XA 3PMAB 1HJ8A 1XUFA 4JMYA 5I25A 2VWNA 3VB4A 4WMDA 1GBLA 3EAJA 2Z9IA 2HRVA 4MQAA 5GDSH 4FUBA 1T8OA 1O3PB 3RLWH 1ZSKA 1ELTA 2ZC9H 2FI4E 4IBLH 2D26C 1HV7A 3L6PA 1TFXA 4I8KA 3RXQA 2PTCE 4O3TA 5JPMH 2A5IA 3K2UA 4FUJA 1L2EA 3V3MA 1W14U 3ZVDA 1Y3YA 1A0JA 3RXBA 4Q2KA 1P01A 1E37B 1PPFE 3RMOH 1XXFA 1O3HA 1W10U 5A09A 3TJNA 1Z7KA 1MQ6A 5LH8A 3BIVH 1K1MA 3QK1A 3T2NA 1C1RA 5A0BA 1OYTH 1XKAC 3ZZ9A 1NRNH 1K1JA 1SB1H 1NRPH 1GJCB 1EAIA 1AO5A 3BV9B 1OSSA 1F0SA 1OWEA 4BXWA 1GDQA 3SUEA 1SLXB 1EZSC 1BCUH 4NGAH 1T8MA 2BOKA 4QT8C 2W7SA 1W12U 1MU8B 2ZGJA 1P10A 4UFEH 2PKAB 9LPRA 4LOYH 1F5LA 5ESBA 1HFDA 2GZ7A 2OC1A 1HAYB 1EXFA 1TGNA 2IJOB 1DLEA 1K1IA 3QUMP 3LJJA 3BTTE 1P3EA 3STJA 4HI3A 2OD3B 1ZGIA 2UUJB 2A5AA 2PSYA 1C9TA 1SFQB 5GCHG 2C8WB 2ZNKH 1DICA 1RGQA 3SORA 3VPKA 1RIWC 4FVDA 5DP8A 3RDZA 1BIOA 1MZDA 3I29A 3QDZB 1W7XH 2P93A 4K1EA 3GY3A 1NPMA 6CHAB 3RXHA 1ELDE 2R9PA 1RTKA 1GBTA 1T7CA 2PUXB 3TGKE 1UTQA 2TIOA 4ISLA 4CRAA 4O97A 5C5OA 1WQVH 4IMQA 2HPPH 1AWHB 2ZWLH 1DWCH 3AW1A 1GHZA 2V6NA 1C2GA 3DFJA 4NZQA 2CGAA 1GBCA 1KLJH 4IC5A 3BG4C 4ZXYH 3MH6A 1MD8A 1MCVA 1N8OB 5TJXA 4CH2B 5F6MA 4X6OA 1KLTA 2H1UA 2THFB