3A89A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 4 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a89A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a89A02
4ISIH 3MFJA 1JBUH 1B0FA 2BDCA 1BDAA 1Z8JB 3U98H 1C5RA 3GY8A 2SGPE 1SGYE 4NFEA 1RD3B 3UQOA 1OYTH 1ESTA 1OP8A 1C2KA 4A1VA 3MNBA 4Y10E 3BTTE 4K3JA 1GI1A 1WUNH 4FUGA 1EUFA 2ZC9H 4UDWH 2H5DA 1PQ8A 4BANB 5HM9A 3ZZCA 4B1TA 3MO3A 1ANCA 1K28D 4AN7A 1TOCB 3SNEA 1SHHB 2F9VA 3Q77A 2BD2A 4R8TB 1O3HA 1BTZA 1YBWA 4WVPE 4XFQA 2PUQH 3ZYDA 4KTCA 4KELA 2W3KA 2C3SA 5A0CA 2JKHA 1V2TT 1ETTH 1SSXA 4TY7A 3TK5A 1P2MA 3ZVCA 2OLGA 3VFEA 4ASHA 2H9HA 1YPKH 2CXVA 1GI0A 1BRAA 3LOXA 2R0LA 5C5NA 1G9IE 1LVBA 1P0SH 2PSXA 3SU5A 1MKXK 2XBWA 5C2ZA 1O37A 1KDQB 2ZIQH 2ZFSA 4YM9A 3SO3A 2SNVA 1H9HE 1GWAA 1FLEE 1GI8B 3Q76A 1AKSA 1UTPA 1ID5H 4Q7ZA 3M3TA 2RDLA 5A2MH 1G37A 3OU0A 2ZGCA 1GVKB 4BAOB 3U1JB 1XUFA 3SU3A 1LHFH 1VCWA 1ELEE 1QTFA 1D6RA 2KAIA 1NRPH 1NT1A 1CA8B 3BN9A 1DANH 2Q1JA 4H42U 1AVWA 2A32A 6ESTA 1EB2A 4RN6A 1XUJA 2ZHQH 1XKBC 2D1JA 1TMTH 4TPIZ 4TYDA 1UJ1A 4FUCA 3SOSA 3PMAB 5LGOA 4U32A 3KQBA 1T7CA 1P04A 2ZDMA 6GCHF 1TGCA 4CRCA 2GZ8A 5GCHF 1GBKA 3SUFA 1V2PT 4UFFH 1BQYA 2YNBA 3OTJE 2VINA 3L6PA 2XC0A 4INLA 2BX4A 2PUXB 3GY7A 3E91A 3QN7A 4OGXA 1YPLH 1U6QA 1T8LA 2ZFTA 3LC5A 3NK8A 1MQ6A 3QX5H 5FCRA 2BDHA 5EQQA 1AE5A 2WV4A 1E37B 2DE8A 4BAHB 2O8MA 2JH6D 1GG6B 1O2QA 2ANYA 3O8DA 1PJPA 2PHBA 1GHZA 1O3PB 3PROA 1O2SA 1S6FA 2FZZA 3EE0B 3VGCB 4NG9H 3IITA 3RXHA 1QIXB 2ANWA 2XXLA 1S0RA 1DOJA 1O2VA 4X1QU 1XVOA 4HFPB 2AMDA 1GMDF 4KKDA 2BDBA 2G5VA 3BG4B 3MHWU 4R0IA 3SUGA 1MKWH 4IN1A 1GL1A 3SQHE 1DPOA 3C27B 4CH2B 5EXMA 2C4FH 1TALA 4CR5A 1EASA 5EPNA 1AIXH 5SGAE 3PO1C 3HK6B 1A0HB 1ZGVA 1VGCC 3EA8A 1DXWA 1V2RT 4YLUA 3GCNA 1J16A 2WYJA 1CA0B 1Y3WA 4ISNA 2KAIB 4JCNA 4D9RA 5A0BA 1F0RA 2ZCKP 3RXIA 2O8TA 1VZQH 4JZEH 3LH3A 4YT7H 1TAWA 2ZQ2A 3SJKA 4ZKRU 3DFJA 1NFXA 1TNGA 1MZAA 2AMQA 3FP8E 3UOPA 2HPPH 3S7HB 1ZPCA 1BOQA 1HDTH 1PPFE 4DGJA 1J9CH 1P10A 1JRTA 5FBIA 4ESTE 2TGAA 1JXPA 3RXRA 1TX6A 2BOKA 2GT8A 1W8BH 3RM0H 2JH0D 1D3DB 1P05A 4U30A 2VIQA 2O8LA 3A7WA 1DXPA 4WMFA 1BTYA 1SLXB 4B2CA 1HJAB 1EP5A 1RGQA 3AW0A 3QGNB 1MZDA 1HAVA 1BBRK 1EX3A 1QB6A 1LPZB 1NRNH 3RU4T 4ZH8A 5DO4H 2CHAC 2FPZA 1HAHH 2R2MB 2ZTZA 1TE0A 2SNWA 3RXKA 2A45B 2HPQH 2WPHS 3RXMA 2R3UA 3MWIU 2AH4X 3C1KA 1SQOA 3K9XB 1C1NA 4XSKU 1GHXH 4ZXXH 4BAQB 1ZTJA 2BD5A 4AX9H 1CBWC 1GBIA 1J8AA 2B0FA 2G4TA 3V13A 1MKXH 3U8RH 4X6OA 5HMAA 3S9AA 3RLWH 1W13U 4GHTA 2PKAA 5C67A 3S9BA 1CE5A 4BNRA 4FVBA 1EZSC 2D26C 1D3PB 2Y7XA 2ZP0H 2Z9GA 1AWHB 3NUMA 1VJ9U 3SZNA 3SJ9A 1NTPA 1QNJA 2B5TB 1A61H 2FEQH 3O8CA 4X2WA 5A8XA 4Y8ZA 3ATKA 1O3FA 1O3GA 4UFEH 5C5OA 1JIMA 2QC2A 4K1TA 1V3XA 2BY5X 1SGIB 2PV9B 5E0JA 3Q3KA 4MG3A 1ZHRA 2VU8E 1O2PA 2QYIA 1TX8A 2TGTA 1AMHA 1WSSH 1C5UA 1XXDA 4FUEA 4GCHG 5DJ7A 2BLQA 2OCVB 1GHYH 3BTHE 5TCAA 1SGFG 4NGAH 1Y3XA 1SC8U 1NN6A 1GJ8B 1DWEH 1ZHPA 3PV4A 1BCUH 1ELGA 2BZ6H 1TGBA 5CHAB 1ZSKA 2TPIZ 1HAZB 1Y59T 2G4UA 1FNIA 1KSNA 2SFAA 1C2MA 4HI3A 3ZZ4A 2Y81A 1NM6A 1ETRH 3ZVFA 3VB6A 2ZHWH 1LQEA 3SI3H 3VXFH 1LVOA 3NXPA 2AGGX 4O97A 3BEUA 2FWWA 2ZDVH 2F9UA 3RXAA 1DLKB 1AZ8A 3A8AA 4Y7AA 3BTME 4WMEA 5L2YH 1NY22 1P9UA 1XKAC 1CGIE 1C5XB 1GDNA 3SJIA 3UOUA 4FU9A 3V12A 1MTNC 4ZKOU 5EW2H 1FUJA 1VITF 2FMJA 4X0WU 2PKAB 1XXFA 1P11E 3ZVGA 4SGBE 1XUIA 3VB3A 3ODFA 2G52A 3MI4A 4FUHA 2SGFE 5A8ZA 3QUMP 1O39A 2FDAA 3QWCH 4Q2KA 3VB5A 1WYKA 1LCYA 2Z9KA 3EA9A 2A31A 1HUTH 1NS3A 3URCA 1DFPA 3BG8A 1NU7B 5E0HA 1EPTB 5DG6A 2AS9A 1GPZA 2IN2A 3RC6A 3T29A 2HWLB 1L4ZA 3I29A 1C2EA 4FUJA 4UFGH 2DUCA 2UWOA 2AIPA 3I77A 3RXOA 1H9IE 1WOFA 2XBYA 1MAYA 2OQUA 3RXQA 4JK6A 1T8MA 3VPKA 3KQEA 1EJAA 7KMEH 2R3YA 2K1QA 4KP0A 1D3QB 1NZQH 4FUIA 3MTYA 5HYOA 2VIWA 3GCHC 1TBRH 3TJUA 1A3BH 2FIRH 2GZ7A 4NZLA 5PTPA 1UCYK 3LJJA 1H4WA 2RA0A 8LPRA 1EATA 3M5NA 2ZI2H 3FZDA 3K2UA 1OWDA 5FBEA 1K1LA 3ELAH 1WV7H 1V6DA 1SLVB 4ZAEA 1P2NA 1BTWA 1UTNA 1QRXA 1GI7B 4AYYB 1TONA 2PKSB 3LPRA 2IJOB 4ABIA 4X2YA 2VWLA 9ESTA 4Z6AH 1P2OA 2AFQB 5E0GA 5GCHG 1HBTH 1O2XA 5FHTA 1AO5A 5GPIB 5AFYH 3ZZDA 5FX6A 2Z9LA 4DY7B 1UVSH 1T31A 4GAWA 1XM1A 1G3CA 1GHBG 1B0EA 2XWBI 2ZU1A 5DP9A 1QA7A 1S6HA 5EXNA 2BLOA 1GI6A 4CR9A 1K1MA 1ANEA 3F1SB 4XE4A 1KXDA 3KHVA 1THSH 2LNCA 1KXFA 3P95A 2NU4E 2Q6FA 4NFFA 2D8WA 1DX5M 3BTGE 1FPCH 4I8KA 1PYTC 1A7SA 2BQ7B 5B6OA 3UPEA 2F9BH 1O31A 5DP5A 1O5DH 3UNSA 3K6YA 2ZG0H 2WINI 2B7DH 2PTNA 2TGPZ 1O30A 1UHBA 4K69A 2XYAA 2BX3A 3GICB 1DWCH 1UTOA 1GBJA 1N8OB 2P3FH 4ISOA 4BOHA 3TNTA 4AGJA 3KIDU 1YCPK 2PFEA 4OGYA 4X2XA 4WMDA 1V2UT 1EJMA 2ZTXA 4DURA 1P3CA 3SU4A 1INCA 1Z71A 1K1NA 3A8BA 2UUFB 4D9QA 1WTHD 3ZZBA 2FOFA 4NWKA 2P8OB 1NROH 3TVJB 2FLBH 3KL6A 3AAUA 1JOUB 2UWLA 2YNAA 1C2JA 4DOQA 3LKWA 3PMJA 3TNSA 2CN0H 3QO6A 1MH0A 2ULLA 1HAXB 1GJ9B 1L1JA 3QZRA 5EU8A 5FX5A 3HKIB 3M7UA 1C5WB 2THFB 3MU4A 1YF4A 2GMTC 1OWEA 1W7XH 2BZAA 3V7TA 1GBEA 1K9OE 2QIQA 3O8BA 2Z7FE 2BLWA 1DITH 5C20A 1BTUA 1P02A 2VIVA 1BTHH 2V0BA 3OY5U 5E2PA 3PWBA 3TJVA 1QGFA 3UUZA 4GVUA 5L6NH 3GY4A 3SHCH 2CJIA 1K1OA 1PPGE 5TJXA 1IOEA 2WPIS 1HAGE 2EI6A 3P8OA 3LGWA 2WYGA 1O2HA 1GL0E 2F83A 1WQVH 1TABE 3BF6H 2XRCA 1FAXA 2FLRH 1CHOG 3M3VA 1EAUA 1LO6A 3UQVA 1FV9A 1XUKA 1Z8RA 5DP8A 3VXEH 3SHAH 3BIVH 4CHAB 1P8VC 1G3DA 1ELVA 1MUEB 3GY6A 1EKBB 2EEKA 3PLKA 3RXBA 2GCHG 4X6NA 3STJA 2ODPA 1UTJA 4H6SB 1AB9B 2CGAA 5ESTE 1ANDA 3UREA 2XTTB 2HALA 3SJ8A 1WAYB 2J38A 1SG8B 3FP7E 5E8EH 1OSSA 1UK3A 3RXDA 1TA2A 1BT7A 3V3MA 2C8XB 4AZ2B 1TGNA 4NSYA 3EDXB 5J4QA 1YCPM 1O2GH 4GCHF 2XC5A 2OD3B 1SFIA 1ZPZA 4B2BA 5EGMA 1P06A 1MCVA 1THRH 3PTNA 3BTQE 1TOMH 2G81E 5I46H 2F9OA 1C1RA 4I8JA 4NIWA 1EAXA 4LXBH 1V2KT 1ELDE 2FYRA 1ZMNA 1BA8B 1EZXC 3S0NA 8ESTE 3PYHA 4YOJA 2VIDA 2IOTA 2P3TB 4I33A 1TPPA 1C4U2 1SGQE 2OC1A 1OWJA 1SGCA 1TYNA 1YPGH 2OBQA 1C1PA 3HGPA 1C1WH 2F3CE 2AYWA 4ZUHA 2GCTB 1ARBA 3ZVDA 1EXFA 1SPJA 1F5RA 1PPEE 1A0LA 3RC5A 3OYPA 2ZCLP 1HXFH 1BRCE 2BMGB 4WXVA 5A0AE 2A0QB 3F9FA 3T2NA 1T8NA 4K8YA 1K1JA 3RXSA 1NO9H 1YPEH 2BY6X 5K7RA 3TJNA 1HIAB 4O03A 1C9PA 4CH8B 4E7RG 1BJVA 4UEHH 2XBXA 1DSTA 3KF2A 4QT8C 3SGBE 1HRTH 3ZZ5A 1TRMA 4TWYA 1VITG 1SOZA 2XC4A 3SI4H 2FTMA 1FN6A 3ATLA 4D76A 2F9PA 1AVXA 1IHSH 1O35A 1EOLA 1B7XB 3BTEE 1TPOA 2STBE 1BBRE 1P9SA 2VWNA 1FIZA 1QHRB 2WPKS 1HLTH 4AOQA 2BHGA 1TWXB 3MH4A 3E3TA 2A4RA 5GIBA 1S82A 3GY5A 7LPRA 1O38A 2FOHA 1THPB 4RKOB 5AFZH 4AB9A 1DDJA 3B23B 3RXPA 4B76A 1GCDA 5FPTA 3SORA 1O3CA 2VVUA 1LDTT 3SV2H 2BDAA 1NRSH 1UK2A 4XDEA 1QBNA 1K22H 1KLIH 2VWMA 1YPHE 2P94A 2ZEBA 2PSYA 5FPSA 4D8NA 2FOMB 1C2HA 1C1SA 1SB1H 3TK6A 3VGCC 1Z7KA 1YKTA 1O2RA 3A87A 1GBMA 1NFYA 1NPMA 2WPJS 1JIRA 4CBNA 2A7JA 1RIWB 3BG4C 3MU0A 1GHBF 2O8UA 3A88A 4BTIB 3GDVA 1V2NT 2ZU5A 1ZZZA 1UVTH 2QXJA 5A09A 1DICA 3SW2B 1C5YB 3H7TA 1TNKA 1ZJKA 1GJBB 1SI5H 2Z3DA 2H1UA 1QRZA 4MLFB 2VIPA 1D9IA 1PQ7A 4MDSA 2ZCHP 3U8OH 2A5KA 1GI3A 5ETXA 3K6ZA 1C5LH 1VITH 4YZUA 4J2YB 9LPRA 3RUOA 2ZKSA 1PYTD 2HOBA 7ESTE 1F5KU 1C5TA 3H5CB 4GLYA 4I7YH 2ZZUH 2Y80A 1E0FD 3D49H 5T6GA 3RDZA 1EQ9A 3AVZA 2Z3EA 3F6UH 5F8XA 3SV7A 3A7XA 1ZRBA 5EQSA 3NPSA 2HRVA 1TGTA 1BHXF 5HXFA 1AKSB 1ORFA 1LMWB 1BITA 3FANA 3SUEA 2C90B 4MPXA 1KTTB 3I78A 3BTWE 4BXSA 2VH6A 1RS0A 1TX7A 1TNHA 3SU6A 4ISHH 4WH6A 1SOTA 4J1YA 1T8OA 3B9FH 3MNXA 4X8SH 2G51A 1S84A 3GCTG 4X8VH 4Y71A 5C3NA 2QXIA 4XOJA 3TGJE 4CRGA 2A5AA 1HAYB 2ODQA 1EP6A 1ZOMA 2STAE 1QJ1B 3SV6A 4FU7A 4O9VA 1P2KA 4I8GA 1C1VH 5AF9H 4XBDA 4KTUA 3ZYEA 2AIQA 4YTAA 2B9LA 4ZKSU 1BMMH 2FYQA 4B71A 2AMPA 1F92A 1O2OA 3UNQA 1BRBE 3RXTA 2GX4A 1V2MT 2VGCB 1AN1E 4JYVH 2PR3A 2QN5T 2FX6A 5JBBS 3LJOA 1VR1H 2GDEH 1EOJA 2PGQB 1SHYA 1C5VA 1GJAB 1UCYE 1C5OH 1FAKH 1VGCB 1CHOF 3NZIA 2ZDKA 3MOCA 3MYWA 4F4OC 1SGFA 1O3BA 2FODA 1UO6A 1D3TB 4CRDA 2AERH 1BJUA 2GCHF 1DT2A 1GJ7B 2V6NA 1B5GH 2XCNA 1UTMA 3PLBA 3S7KB 3UWIA 1O3KA 2ZDLA 1QFKH 2NU1E 2FTLE 1GVZA 1BTXA 1TA6A 3A86A 4Y11E 5T6FA 1AY6H 1Y5AT 3RMLH 5LPRA 1CGHA 1ZMJA 1P09A 2CV3A 3GYMA 1E38B 4MNVA 3LDXH 1IQMA 1TPSA 3EYDA 2ZGJA 4KTSA 3RMOH 1O5FH 1FY3A 2GKVE 4CRFA 2UUKB 1O2ZA 2BXTH 2Z3CA 4WWYA 4DCDA 5F6MA 1L0ZA 1BIOA 2GT7A 5L30H 2V35A 3M36A 3RMMH 3Q3XA 1W0YH 1KYNA 6CHAB 1SMFE 2QF3A 1NRQH 2W26A 3KN2A 1EZUC 4YOIA 3A8CA 4HTCH 3PLPA 1MD8A 2A7CA 3UR6A 3AW1A 1O2MA 4OS1A 1O5CB 2Z9IA 4NA7A 3LONA 4INKA 1FN8A 1SGNE 2VWOA 5J4SA 3ZZ9A 5K0HA 1JMOH 1A3EH 4DIIH 3AASA 3URDA 1CBWB 1GJDB 1XUGA 4VGCC 1C2DA 3MNSA 5C1XA 2GV6A 2J9NA 1HAVB 1YPHC 3ATIA 2FOEA 1TQ0B 3OX7U 2H9EH 1S81A 2H9TH 3TGIE 4ABGA 3TH2H 5GDSH 4AG1A 1O2IA 5DPAA 5JBAS 3LH1A 7GCHF 3M5OA 1EPTC 5FXLA 3V0XA 2OTVA 3ZZ6A 1TLDA 3BEFB 1H8DH 5ESBA 5AVDA 1Z1IA 1C4Y2 1CHGA 3SU2A 2CF9H 2CMYA 5JYIA 2P93A 2BQWB 3LT3A 1Y5UT 3CS0A 5DP6A 2ZTYA 3VEQB 1MU6B 1XX9A 1J15A 1RTFB 4Y0YE 4Y0ZE 2RCEA 1P12E 3BTDE 2XCFA 2UUYA 5GJ4B 1A4WH 2ZPSA 3TK9A 3JZ1B 3FVFB 3SJOA 1ESBA 1Y8TA 3T62A 2XBVA 1ARCA 3BTFE 4B74A 4OS4A 3IWMA 4LOYH 1MBQA 2BTCE 3SNAA 4Y79A 1PPHE 3TLOA 3E16B 1ZTKA 4B2AA 2Z6BD 3E90B 4NIVA 3RXVA 4AFUA 4RKJB 1YGCH 1A5GH 3U69H 1GBDA 3E6PH 3U8TH 4AB8A 4ZHAA 2ZFRH 3U1IB 2ZGHA 1S5SA 2ZQ1A 5EOKA 3A85A 1QA0A 1G36A 1FI8A 1TNJA 2O9QA 1GI9B 1QCPA 3BSQA 3K65B 1MTNB 1BBRH 1ELAA 4E7NA 3UWJH 3ITIA 1ZSJA 1SVPA 3P8GA 1C1TA 3FZZA 3JZ2B 1DVAH 4X1PU 2C8WB 3UFAA 1HJ8A 2I6SA 3GISB 2Z9JA 2G00A 2OC8A 1RTLA 2BM2A 1N8OC 4X8TH 1O3AA 2V3HH 1FY5A 3GDUA 1AFEH 4NA9H 4NZQA 1T4VH 4ABHA 1MTVA 1AI8H 2Z94A 1K1IA 1C5ZB 1ESAA 1D4PB 2J92A 2VB0A 3ZZ3A 2G8TA 4NSVA 1ZRKA 1ZGIA 1DLEA 2PGBB 2TIOA 4E06H 2G55A 4YT6H 8KME2 1MTWA 1C1QA 2ZFQH 1GMCF 1O3JA 1QL8A 1PPBH 2P8OC 4WY3A 3RXJA 3GCHB 1F7ZA 4FXGH 1UVPA 1GGDC 1GJ4H 2B8OH 1BTPA 3KQDA 3LGIA 3T5FH 3CENA 5LH8A 2ZA5A 1CT0E 1AFQB 1ABJH 3STIA 1E35B 1ZHMA 1F0TA 1HV7A 2JETC 3MH7A 3A83A 1T32A 1H1BA 1VCQA 3SNCA 3RLYH 3P6ZB 4KGAA 3ESTA 3SQEE 1K1PA 2Y6TA 3GCTF 3R3GB 1IQFA 2ZO3H 4LZ1H 1GCTC 4K1EA 2QXHA 3BIUH 1LVYA 3RP2A 1P2JA 2G5NA 1FZZA 1HPGA 1N6XA 2EC9H 4WJG2 1NFUA 4D7GA 2BB4A 5DGJA 4ABFA 1TFXA 1CSOE 1QJ7B 1GMHG 3ODDA 2QA9E 4CHAC 1EB1H 5H4IB 3PMHB 1PFXC 1QBOA 2FOCA 3SNBA 2BVSH 3UR9A 2ZECA 1AE8H 1AB9C 3R0FA 1FIWA 1GHVH 2ZHFH 3SU0A 4WXIA 1TNLA 3KGPA 1LKAA 1H9LB 4MQAA 3P92A 2FESH 1QJ6B 1QB1A 1AUJA 4DG4A 4IBLH 1OX1A 4O3UA 1W11U 2R2WU 1ELCA 5I25A 1UHBB 1UTKA 2SGQE 2OXSA 1L4DA 4ZKNU 5EODA 3RXUA 1AGJA 1H8IH 2FS8A 1O5GH 4X1RU 2ZDNA 1SLWB 4UFDH 2NU0E 1DY9A 1ETSH 3B8JA 2Y82A 4MNYA 5BPEA 4ZROA 1N1LA 2WUBA 1GI5A 2VH0A 1GBCA 1BMLA 4H6TA 2ILNA 2QF0A 3PMBB 3LC3A 2ZNKH 4CBOA 4BAMB 1YC0A 4DT7B 1K2I1 1O2UA 3TITA 1UCYH 4SGAE 4YESB 6LPRA 2GCTC 4Q7XA 4IN2A 4Q80A 2AGIX 3ZZ7A 3NCLA 2ZDAH 1L1NA 1IQKA 1GVLA 3SV9A 2WPMS 3N7OA 1HJ9A 1GBLA 1LVMA 1ZR0A 4YO9A 2CF8H 1O0DH 1O3EA 2FX4A 3SUDA 3Q3YA 1V2VT 4TWWA 2ZGBH 4FUBA 1P2IA 3KCGH 1OWIA 3SV8A 1MKWK 8GCHG 1QQUA 2QV1A 2BDYA 2BDGA 1V2OT 1KDQA 1OXGA 1AWFH 1T4UH 1ELTA 3D23A 2SGDE 3TJOA 3MNCA 5A8YA 2GDDA 1C2FA 1ACBE 4JZDH 2M5TA 2ALVA 2J2UA 4AFQA 4E05H 5T3HA 4IC6A 1UVOA 1MMJN 1W10U 1SL3A 1M9UA 1S0QA 7GCHG 4K60A 2XW9A 1WU1A 1W3CA 4GSOA 3HK3B 4AFZA 1AVGH 1DS2E 2BVXH 5IDKA 1IQHA 2ANMH 1DWDH 3QLPH 1OWKA 1SGRE 1YCPH 1YP9A 2GD4B 2OBOA 1LTOA 1N6YA 4JYTA 3E0NB 4A7IB 1O33A 2P95A 1O2TA 3P70B 3QTOH 2XNIA 1FONA 2A1DB 1S83A 1MQ5A 1O2YA 3S9CA 1O5AB 4BAKB 5BRRE 1A5IA 1IQEA 3M35A 4GPGA 3EAJA 5GXPA 1RIWC 2C8ZB 1HAIH 1LPKB 3RXEA 1TMBH 5JDUB 1CGJE 3HPTB 3D65E 1AUTC 2QY0B 2Q6DA 3DHKH 2FP7B 2HLCA 3RC4A 3P17H 1EAIA 1O2LA 3MU1A 1GG6C 2UUJB 1SGEE 1O2NA 2R0KA 3TH3H 2FM2A 1TMUH 4Y6DA 1GJCB 3RXGA 3TPIZ 2FI4E 3ZVEA 3T28A 2ANKH 2BD9A 1GBTA 3ATMA 4ABDA 4HZHA 5G4BA 3ZZAA 1NC6A 2GVFA 1FMGA 3FAOA 3T25A 3TH4H 1FPHH 2ZWLH 1TIOA 1NU9A 4DJZB 4TY6A 1EAWA 1GDQA 2BY8X 2Y5HA 3M3SA 4LZ4B 3ENSB 1MCTA 4K1SA 2TRMA 2ZHEH 1HYLA 1C2LA 3H7OA 2NWNA 3OSYA 3ZZ8A 2ASUB 5IYTA 1CA0C 3A80A 4X6MA 1G30B 1TGSZ 1BMAA 4K2YA 2FOBA 1L1GA 1UTLM 3SNDA 1ZYOA 2FI3E 2FO9A 2GTBA 3RXLA 4MTBA 1A5HA 1GMCG 4PROA 1XMNB 4CRBA 2J95A 1WBGB 1EZQA 2HVXA 2BYAX 2NU3E 1LHCH 5F8TA 3ZVBA 1KTSB 4I8LA 2W7SA 3F9EA 1W14U 2TGDA 1MTSA 1BB0B 3E1XB 4BXWA 1Z8IB 1DWBH 4U2WA 1HFDA 3A7YA 4ABJA 2VGCC 1IQGA 1WCZA 2Y5GA 3SBKA 2BD4A 1HJAC 4M7GA 1QL7A 2NU2E 4FVDA 2V3OH 2IPHA 3MU5A 3UTUH 1F0SA 4B75A 3ZV9A 1SLUB 1ABIH 3TGKE 1CQQA 3QGJA 3RMNH 3KNXA 5FPYA 5LPFA 3HGNA 4WH8A 1HXEH 3BEIB 2A7HA 1GMHF 1KLTA 1QBVH 1P2QA 3CP7A 4LK4A 1BUIA 2ZU2A 1Y3VA 3L33A 1OP0A 4IW4E 1G32B 1ZMLA 1QL9A 3PM3A 3M61U 3GOVB 1OYQA 1MBMA 1OKXA 3M7QA 2AEIH 1P01A 1Q2WA 1P3EA 4ZXYH 4MPUA 2BY9X 1O2KA 5EW1H 4AG2A 2ZU4A 3DA9B 4NA8A 3LGUA 2P3UB 3ZVAA 1HAPH 3DUXH 2QXGA 4DW2U 1W12U 3PO1B 4JYUH 2P59A 2VNTA 4GHQA 1TPAE 3A82A 2JH5D 1Y3UA 1DY8A 1HCGA 1A46H 4AFSA 2ZU3A 1ELFA 1V2ST 1ZJDA 6CHAC 1Y5BT 1GBHA 5DKMA 1GI4A 1PQ5A 2FXRA 4ZMAH 1KXAA 4TPYA 3GY2A 1WQSA 1A0JA 1Y3YA 4Y8YA 1BRUP 2A2QH 4JK5A 1MD7A 2VIOA 1C2IA 2FI5E 2OC0A 1RJXB 2Q6GA 5EG4A 3LGYA 1C5QA 1QQ4A 1AHTH 3DD2H 1F5LA 5CHAC 1O3OA 3D62A 1W0ZU 4BTTB 1LHEH 1LQDB 1Q3XA 4WF8A 2O8WA 3NWUA 4ABBA 1OPHB 1Z8GA 3KQCA 4I8HA 4NWLA 1Z1JA 1SGTA 1GHAG 2EI8A 4MNXA 3EA7A 1PQAA 2SGAA 4ZHLU 4OS6A 3A81A 2HNTF 3A7ZA 1J14A 1IAUA 2ESTE 4AORA 2CHAB 1O3LA 2PTCE 2QAAA 5EPYA 3MH5A 4AYVB 4OS2A 2VVCA 1GHWH 2BD8A 5DP7A 1HAOH 1UK4A 2OC7A 2XWAA 4X1SU 8GCHF 3F9GA 1EPTA 1AD8H 1GBBA 1S85A 1OS8A 1CU1A 2W5EA 1KXCA 4Y76A 5C1YA 5CE1A 5HM2A 1O3IA 3EQ0H 1O2WA 1FDPA 1TBZH 3GYLB 1CT2E 1FXYA 1BMNH 4CREA 1FY4A 2A4OA 3QTVH 4I31A 1SFQB 1G2MA 1C5SA 4BTUB 1MAXA 3FFGA 1JWTA 1HNEE 1O5EH 4UONA 2ZF0H 3UY9A 2EA3A 3FP6E 2BDIA 1TQ7B 1DSUA 1JRSA 3Q00A 1IQJA 2DE9A 3GY3A 2F9NA 1G2LA 1C2GA 3PB1E 4GUXA 4IC5A 4K8BA 3A7TA 2HNTE 1SGDE 1DUAA 2PWXA 1C9TA 1UVUH 2QCYA 5TCCA 5DP4A 3SN8A 3W94A 3CS7A 1Q31A 1MU8B 2AGEX 3DT0H 2BY7X 1OOKB 1Z6EA 4VGCB 3UNRA 1ANBA 4B73A 4A1XA 1ZPBA 5JB8S 3P8FA 1V2WT 4IMQA 5JBTA 3QDZB 3ATWA 2PKSC 4O3TA 2FOGA 2BLVA 4A5TS 5DK1A 1QRWA 2BXUH 3PWCA 1YLDA 3QZQA 1W7GH 3NKKA 4IGDA 2D2DA 5E2OA 1O3DA 2ODYB 5FAHA 1GJ5H 1HB0B 2F91A 4A6LA 1KXBA 1YYY1 1P03A 1CVWH 5LPEA 1D6WA 3RXFA 3L3TA 5F03A 1GBFA 5CMXH 3W95A 1FY1A 1ZSLA 1CO7E 1J17T 1L2EA 3MMGA 1TRNA 2GZ9A 2FS9A 1ZTLA 1X7AC 1YPMH 4NCYA 2OINA 4U01A 4ABAA 4FUDA 3MO9A 4THNH 4OS5A 1AFQC 1P57B 5F8ZA 3UIRA 1LPGB 1F0UA 4IS5A 3LGTA 5JB9S 1C1OA 1C1MA 1LHGH 1F2SE 2ZPRA 3LU9B 3LIWA 3MH6A 3T27A 4D7FA 3VB4A 2A2XH 2TBSA 4X6PA 6GCHG 1BZXE 3F9HA 1TRYA 2A5IA 2ZGXH 5GWZA 1E36B 1YPJH 3M37A 1EJNA 2R9PA 1AU8A 2W3IA 1FJSA 1O34A 1C1UH 4MPVA 2BD7A 1FY8E 2PLXA 4IMZA 4Z0KA 4YLQH 1CT4E 2C93B 1IQIA 3TIUA 2QGRA 3HKJB 2BVRH 1NESE 2J4IA 1RFNA 1C5NH 1O32A 3PTBA 1OP2A 4K5ZA 2VJ1A 4A92A 2H6MA 3RU4D 1VCPA 5JPMH 1GMDG 4XBBA 1QURH 3EGKH 1RTKA 2EI7A 2I6QA 1QR3E 2PW8H 3SGAE 1XUHA 3A84A 3M7TA 3RXCA 2OUAA 1DE7H 1E34B 4XBCA 2SGEE 4ZHMU 4X8UH 5T6DA 1K21H 3G01A 2VVVA 2P16A 1BHXB 1KY9A 5C1UA 1NRRH 2J94A 4NIXA 2J34A 1V2QT 3F68H 1GGDB 5ABWA 3MU8A 5DP3A 3A89A 2BQ6B 5EXLA 1O3NA 1GDUA 2JETB 3HATH 3E0PB 3S69A 4X2VA 4ISLA 3SU1A 1WTGH 1NFWA 1V2JT 1PPCE 1Z6JH 2W7UA 1A1RA 3RM2H 1DM4B 1W2KH 4DIHH 3DFLA 1GI2A 1HGTH 1RXPA 5HGGA 3TU7H 1GCTB 1GJ6A 2A4GA 3ZV8A 3WY8A 4I32A 2H5CA 4H4FA 1UMAH 1LHDH 2Y7ZA 3LGVA 2GP9B 1IHTH 1YM0A 4Y7BA 2ZHDA 2WPLS 4RSPA 4Y8XA 4F49A 4FU8A 1TBQH 1PPZA 1C5PA 2FOAA 2Y5FA 3M5MA 3RU4E 2RG3A 1V2LT 2UWPA 1XVMA 1GBAA 3AAVA 3QK1A 1AQ7A 1MTUA 4OS7A 4HGCA 4DVAU 3SGQE 2HNTC 1SR5C 4JZ1A 1LKBA 4FUFA 1IQNA 1YLCA 3P8NA 1ZLRA 2GMTB 2ZFFH 1HIAA 2RA3A 3KEEA 2BD3A 2LPRA 1GHAF 4MPWA 1TB6H 3IG6B 1SQAA 4A1TA 1KXEA 1OWHA 4CRAA 3MO6A 3E8LA 1C5MD 2A4QA 1FQ3A 2BOHB 2ZFPH 3O8RA 2GGVB 1O3MA 2OQ5A 1QY6A 2GV7A 4JMYA 1TNIA 1SGPE 4MNWA 2ALPA 2WV5A 2C8YB 3A8DA 1IQLA 2WUCA 5FCKA 1G3BA 4NIYA 5AHGH 3OY6U 1RRKA 4INHA 3U9AH 2HGTH 1KLJH 4JZIA 4Q7YA 4AGKA 1C4V2 1A2CH 1ELBA 3GCOA 3A7VA 1O36A 3BTKE 3BV9B 1O2JA 5L2ZH 4UE7H 4MVNA 3T26A 1VJAU 4UD9H 4YOGA 5JBCS 4JZFH 1QB9A 1SQTA 1G3EA 1O5BB 2ZPQA 1KIGH 1AZZA 2H2ZA 2YOLA 4X1NU 2OP9A 1DUEA 4ABEA 3M5LA 5EQRA 3VB7A 1UTQA 1SBWA 3GDSA
chains in the Genus database with same CATH superfamily
4ISIH 3MFJA 1JBUH 1B0FA 2BDCA 1BDAA 1Z8JB 3U98H 5DSFA 1C5RA 3GY8A 2SGPE 1SGYE 4NFEA 2KZ4A 1RD3B 3UQOA 1OYTH 1ESTA 1OP8A 1C2KA 4A1VA 3MNBA 4Y10E 3BTTE 4I86A 4K3JA 1GI1A 1WUNH 4FUGA 1EUFA 2ZC9H 4UDWH 2H5DA 3UB0A 1PQ8A 4BANB 5HM9A 3ZZCA 4B1TA 2KCAA 3MO3A 1ANCA 1K28D 4AN7A 1TOCB 3SNEA 1SHHB 2F9VA 3Q77A 2BD2A 4R8TB 1O3HA 1BTZA 1YBWA 4WVPE 4XFQA 2PUQH 3ZYDA 4KTCA 4KELA 2W3KA 5HKKD 2C3SA 5A0CA 2JKHA 1V2TT 1ETTH 1COWD 1SSXA 4TY7A 1P2MA 3TK5A 2OLGA 3ZVCA 3VFEA 4ASHA 2H9HA 1YPKH 2CXVA 1GI0A 1BRAA 3LOXA 2R0LA 5C5NA 1G9IE 1LVBA 1P0SH 2PSXA 3SU5A 1MKXK 2XBWA 2GJGA 5C2ZA 1O37A 1KDQB 2ZIQH 2ZFSA 4YM9A 3SO3A 2SNVA 1H9HE 1GWAA 1FLEE 1GI8B 3Q76A 1AKSA 1UTPA 1ID5H 4Q7ZA 3M3TA 2RDLA 5A2MH 1G37A 4ZCNA 3OU0A 2ZGCA 1GVKB 4BAOB 3U1JB 1XUFA 3SU3A 1LHFH 1VCWA 1ELEE 1QTFA 1D6RA 2KAIA 1NRPH 1NT1A 1CA8B 3BN9A 1VKYA 1DANH 2Q1JA 4H42U 1AVWA 2A32A 6ESTA 2HVYB 1EB2A 4RN6A 1XUJA 2ZHQH 1XKBC 2D1JA 1TMTH 4TPIZ 4TYDA 1UJ1A 4FUCA 3SOSA 3PMAB 5LGOA 4U32A 3KQBA 4Q4LA 1T7CA 1P04A 2ZDMA 6GCHF 1TGCA 4CRCA 2GZ8A 5GCHF 1GBKA 3SUFA 1V2PT 4UFFH 1BQYA 2YNBA 3OTJE 2VINA 3L6PA 2XC0A 4INLA 2BX4A 2PUXB 3GY7A 3E91A 3QN7A 4XRNA 4OGXA 1YPLH 1U6QA 3EE7A 1T8LA 2ZFTA 3LC5A 3NK8A 5EIYA 1MQ6A 3QX5H 5FCRA 2BDHA 5EQQA 4AC9A 1AE5A 2WV4A 1E37B 2DE8A 4BAHB 2O8MA 2JH6D 1GG6B 1O2QA 2ANYA 3O8DA 1PJPA 2PHBA 1GHZA 1O3PB 3PROA 1O2SA 1S6FA 2FZZA 3EE0B 3VGCB 4NG9H 3IITA 3RXHA 1QIXB 2ANWA 2XXLA 4DT4A 1S0RA 1DOJA 1O2VA 4X1QU 1XVOA 4HFPB 2AMDA 1GMDF 4KKDA 2BDBA 2G5VA 3BG4B 3MHWU 4R0IA 3SUGA 1MKWH 4IN1A 1GL1A 5EJZA 3SQHE 1DPOA 3C27B 4CH2B 5EXMA 2C4FH 1TALA 4CR5A 3PRBA 1EASA 5EPNA 1AIXH 5SGAE 3PO1C 3HK6B 1A0HB 1ZGVA 3FO8D 1VGCC 3EA8A 1DXWA 1V2RT 4YLUA 3GCNA 1J16A 2WYJA 1CA0B 1Y3WA 4ISNA 2KAIB 4JCNA 5HIZA 4D9RA 1F0RA 2ZCKP 3RXIA 2O8TA 1VZQH 4JZEH 3LH3A 4YT7H 1TAWA 2ZQ2A 3SJKA 4ZKRU 3DFJA 1NFXA 1TNGA 1MZAA 2AMQA 3FP8E 3UOPA 2HPPH 3S7HB 1ZPCA 1BOQA 1HDTH 1PPFE 4DGJA 1J9CH 1P10A 1JRTA 5FBIA 4ESTE 1W0JD 2TGAA 1JXPA 3RXRA 1TX6A 2BOKA 2GT8A 1W8BH 3RM0H 2JH0D 1D3DB 1P05A 4U30A 5KECA 2VIQA 2O8LA 3A7WA 1DXPA 4WMFA 1BTYA 1SLXB 4B2CA 1HJAB 1EP5A 1RGQA 3AW0A 3QGNB 1MZDA 1HAVA 1BBRK 1EX3A 1QB6A 1LPZB 1NRNH 3RU4T 4ZH8A 2CK3D 5DO4H 2CHAC 2FPZA 1HAHH 2R2MB 2ZTZA 3WWBA 1TE0A 2SNWA 3RXKA 2A45B 2HPQH 2WPHS 3RXMA 2R3UA 3MWIU 2AH4X 3C1KA 1SQOA 3K9XB 1C1NA 4XSKU 1GHXH 4ZXXH 4BAQB 1ZTJA 2BD5A 4AX9H 1CBWC 1GBIA 1J8AA 2B0FA 2G4TA 3V13A 4F55A 1MKXH 4HG6A 3U8RH 4X6OA 5HMAA 3S9AA 3RLWH 1W13U 4GHTA 2PKAA 5C67A 3S9BA 3DSGA 1CE5A 4BNRA 4FVBA 1EZSC 2D26C 5DN6D 1D3PB 2Y7XA 2ZP0H 2Z9GA 1AWHB 3NUMA 1VJ9U 3SZNA 3SJ9A 1NTPA 1QNJA 1MABB 1A61H 2B5TB 2FEQH 3O8CA 4X2WA 5A8XA 4Y8ZA 3ATKA 1O3FA 1O3GA 4UFEH 5C5OA 1JIMA 2QC2A 4K1TA 1V3XA 2BY5X 1SGIB 2PV9B 4TT3D 5E0JA 3Q3KA 4MG3A 1ZHRA 2VU8E 1O2PA 2QYIA 1TX8A 2TGTA 1AMHA 1WSSH 1C5UA 1XXDA 4FUEA 4GCHG 5DJ7A 2BLQA 2OCVB 1GHYH 3BTHE 5TCAA 1SGFG 4NGAH 1Y3XA 1SC8U 1NN6A 1GJ8B 2JDID 1DWEH 2YMSD 1ZHPA 3PV4A 1BCUH 1ELGA 2BZ6H 1TGBA 5CHAB 2EQNA 1ZSKA 2TPIZ 1HAZB 1Y59T 2G4UA 1FNIA 1KSNA 2SFAA 1C2MA 4HI3A 3ZZ4A 2Y81A 1NM6A 1ETRH 3ZVFA 3VB6A 2V7QD 2ZHWH 1LQEA 3SI3H 3VXFH 1LVOA 3NXPA 2AGGX 4O97A 3BEUA 2FWWA 2ZDVH 2F9UA 3RXAA 1DLKB 1AZ8A 3A8AA 4Y7AA 3BTME 4WMEA 5L2YH 1NY22 1P9UA 1XKAC 1CGIE 1C5XB 1GDNA 3SJIA 3UOUA 5EJ1A 4FU9A 3V12A 1MTNC 4ZKOU 5EW2H 1FUJA 1VITF 2FMJA 4X0WU 2PKAB 1XXFA 2KR7A 1P11E 3ZVGA 4SGBE 1XUIA 3VB3A 3ODFA 2G52A 3MI4A 4FUHA 2SGFE 5A8ZA 2WZQA 3QUMP 1O39A 2FDAA 3QWCH 4Q2KA 3VB5A 1WYKA 1LCYA 2Z9KA 3EA9A 2A31A 1HUTH 1NS3A 3URCA 1DFPA 3BG8A 1NU7B 5E0HA 1EPTB 5DG6A 2AS9A 1GPZA 2IN2A 3RC6A 3T29A 2HWLB 1L4ZA 3I29A 1C2EA 4FUJA 4UFGH 2DUCA 2UWOA 2AIPA 3I77A 3RXOA 1H9IE 1WOFA 2XBYA 1MAYA 2OQUA 3RXQA 4JK6A 1T8MA 3VPKA 3KQEA 1EJAA 7KMEH 2R3YA 2K1QA 4KP0A 1D3QB 1NZQH 4FUIA 3MTYA 5HYOA 2VIWA 3GCHC 1TBRH 3TJUA 1A3BH 2FIRH 2GZ7A 4NZLA 5PTPA 1UCYK 3LJJA 1H4WA 2RA0A 8LPRA 1EATA 3M5NA 2ZI2H 3FZDA 3K2UA 1OWDA 5FBEA 1KMHB 1K1LA 3ELAH 1WV7H 1V6DA 1SLVB 4ZAEA 1P2NA 1BTWA 1UTNA 1QRXA 1GI7B 4AYYB 1TONA 2PKSB 3LPRA 2IJOB 4ABIA 4X2YA 2VWLA 9ESTA 4Z6AH 1P2OA 2AFQB 5E0GA 5GCHG 1HBTH 1O2XA 5FHTA 1AO5A 5GPIB 5AFYH 3ZZDA 5FX6A 2Z9LA 4DY7B 1UVSH 1T31A 4GAWA 1XM1A 1G3CA 1GHBG 1B0EA 2XWBI 2ZU1A 5DP9A 1QA7A 1S6HA 5EXNA 2BLOA 1GI6A 4CR9A 1K1MA 1ANEA 3F1SB 4XE4A 1KXDA 3KHVA 1THSH 2LNCA 4FETA 1KXFA 3P95A 2NU4E 2Q6FA 4NFFA 2D8WA 1DX5M 3BTGE 5FL7D 1FPCH 4I8KA 1PYTC 1A7SA 2BQ7B 5B6OA 3UPEA 2F9BH 1O31A 5DP5A 1O5DH 3UNSA 3K6YA 2ZG0H 2L74A 2WINI 2B7DH 2PTNA 2TGPZ 1O30A 1UHBA 4XD7D 4K69A 2XYAA 2BX3A 3GICB 1DWCH 1UTOA 1GBJA 1N8OB 2P3FH 4ISOA 4BOHA 3TNTA 4AGJA 3KIDU 1YCPK 2PFEA 4OGYA 4X2XA 4WMDA 2L6OA 1V2UT 1EJMA 2ZTXA 4DURA 5C17A 1P3CA 3SU4A 1INCA 1Z71A 1K1NA 3A8BA 2UUFB 4D9QA 1WTHD 3ZZBA 2FOFA 4NWKA 2P8OB 2V3MA 1NROH 3TVJB 2FLBH 3KL6A 3AAUA 3N7EA 1JOUB 2UWLA 2YNAA 1C2JA 4DOQA 3LKWA 3PMJA 3TNSA 2CN0H 3QO6A 1MH0A 2ULLA 1HAXB 1GJ9B 1L1JA 3QZRA 5EU8A 5FX5A 3HKIB 3M7UA 1C5WB 2THFB 3MU4A 1YF4A 2GMTC 1OWEA 1E1QD 1W7XH 2BZAA 3V7TA 1GBEA 1K9OE 2QIQA 3O8BA 2Z7FE 2BLWA 1DITH 5C20A 1BTUA 1P02A 2VIVA 1BTHH 2V0BA 3OY5U 5E2PA 3PWBA 3TJVA 1QGFA 3UUZA 4GVUA 5L6NH 3GY4A 3SHCH 2CJIA 1K1OA 1PPGE 5TJXA 1IOEA 2WHXA 2WPIS 1HAGE 2EI6A 3P8OA 3LGWA 2WYGA 1O2HA 1GL0E 2F83A 1WQVH 1TABE 3BF6H 2XRCA 1FAXA 3KQ5A 2FLRH 1CHOG 3M3VA 1EAUA 1LO6A 3UQVA 1FV9A 1XUKA 1Z8RA 5DP8A 3VXEH 3SHAH 3BIVH 4CHAB 1P8VC 1G3DA 1ELVA 1MUEB 3GY6A 1EKBB 2EEKA 3PLKA 3RXBA 2GCHG 4X6NA 3PV2A 3SYJA 3STJA 2ODPA 4ACAA 1UTJA 2JJ2D 4H6SB 1UW7A 1AB9B 2CGAA 2QE7D 5ESTE 1ANDA 3UREA 3F2HA 2XTTB 2HALA 3SJ8A 1WAYB 2J38A 1SG8B 3FP7E 5E8EH 1OSSA 1UK3A 3RXDA 1TA2A 1BT7A 3V3MA 2C8XB 4AZ2B 1TGNA 4NSYA 3EDXB 5J4QA 1YCPM 1O2GH 4GCHF 2XC5A 2OD3B 1SFIA 1ZPZA 4B2BA 5EGMA 1P06A 1MCVA 1THRH 3PTNA 3BTQE 1TOMH 2G81E 5I46H 2F9OA 1C1RA 4I8JA 4NIWA 1EAXA 4LXBH 1V2KT 1ELDE 2FYRA 1ZMNA 1BA8B 1EZXC 3S0NA 8ESTE 3PYHA 4YOJA 2VIDA 3GS9A 2IOTA 2P3TB 4I33A 1TPPA 1C4U2 1SGQE 2OC1A 1OWJA 1SGCA 1TYNA 1YPGH 2OBQA 1C1PA 3HGPA 1C1WH 2F3CE 2AYWA 4ZUHA 1FX0B 1ARBA 2GCTB 3ZVDA 1EXFA 1SPJA 1F5RA 1PPEE 1A0LA 3RC5A 2HLDD 3OYPA 2ZCLP 1HXFH 1BRCE 2BMGB 4WXVA 5A0AE 2A0QB 3F9FA 3T2NA 1T8NA 4K8YA 1K1JA 3RXSA 1NO9H 1YPEH 2BY6X 3VG8A 5K7RA 3TJNA 1HIAB 4O03A 1C9PA 4CH8B 4E7RG 1BJVA 4UEHH 2XBXA 1DSTA 3KF2A 4QT8C 3SGBE 1HRTH 3ZZ5A 1TRMA 4TWYA 1VITG 1E1RD 1SOZA 2XC4A 3SI4H 2FTMA 1FN6A 2YMSB 3ATLA 4D76A 2F9PA 1AVXA 1IHSH 1O35A 2LELA 1EOLA 1B7XB 3BTEE 1TPOA 2STBE 1BBRE 1P9SA 2VWNA 1FIZA 1QHRB 2WPKS 1HLTH 4AOQA 2BHGA 1TWXB 3F3BA 3MH4A 3F0OA 3OEHD 3E3TA 2A4RA 5GIBA 3N7DA 1S82A 3GY5A 7LPRA 1O38A 2FOHA 1THPB 4RKOB 5AFZH 4AB9A 1DDJA 3B23B 3RXPA 4B76A 1GCDA 5FPTA 4M9FA 3SORA 1O3CA 2VVUA 1LDTT 3SV2H 2BDAA 1NRSH 1UK2A 4XDEA 1QBNA 1K22H 1KLIH 2VWMA 1YPHE 2P94A 2ZEBA 2PSYA 2PP6A 5FPSA 4D8NA 3PRDA 2K0QA 2WV9A 2FOMB 1C2HA 1C1SA 1SB1H 3TK6A 3VGCC 3ZIAD 3DSPA 1Z7KA 1YKTA 1O2RA 3A87A 1GBMA 1NFYA 1NPMA 2WPJS 1JIRA 4CBNA 2A7JA 1RIWB 3BG4C 3MU0A 1GHBF 2O8UA 3A88A 4BTIB 3GDVA 1V2NT 2ZU5A 1ZZZA 4RT1A 1UVTH 2QXJA 5A09A 1DICA 3SW2B 1C5YB 3H7TA 4ACBA 1TNKA 1ZJKA 3H09A 1GJBB 1SI5H 2Z3DA 2H1UA 2W6JD 1QRZA 4MLFB 2VIPA 1D9IA 1PQ7A 4MDSA 2ZCHP 3U8OH 2A5KA 1GI3A 5CDFE 5ETXA 3K6ZA 1C5LH 1VITH 4YZUA 4J2YB 9LPRA 3RUOA 2ZKSA 1PYTD 2HOBA 7ESTE 1F5KU 1C5TA 3H5CB 4GLYA 4I7YH 2ZZUH 2Y80A 1E0FD 3D49H 5T6GA 3RDZA 1EQ9A 3AVZA 2Z3EA 3F6UH 5F8XA 3SV7A 3A7XA 1ZRBA 5EQSA 3NPSA 2HRVA 1TGTA 1BHXF 5HXFA 1AKSB 1ORFA 1LMWB 1BITA 3FANA 3SUEA 2KX4A 2QF4A 2C90B 4MPXA 1KTTB 3I78A 3BTWE 4BXSA 2VH6A 1RS0A 1TX7A 1TNHA 3SU6A 4ISHH 2KCYA 4WH6A 1SOTA 4J1YA 1T8OA 3B9FH 3MNXA 4X8SH 1SKYE 2G51A 1S84A 3GCTG 4X8VH 4Y71A 5C3NA 2QXIA 4XOJA 3TGJE 4CRGA 2A5AA 1HAYB 2ODQA 3FKSD 1EP6A 1ZOMA 2STAE 1QJ1B 3SV6A 5C94A 4FU7A 4O9VA 1P2KA 4I8GA 1C1VH 5AF9H 4XBDA 4KTUA 3ZYEA 3NRLA 2AIQA 4YTAA 2B9LA 4ZKSU 2IPQX 1BMMH 2FYQA 4B71A 2AMPA 1F92A 1O2OA 3UNQA 1YLNA 1BRBE 3RXTA 2GX4A 1V2MT 2VGCB 1AN1E 4JYVH 2PR3A 2QN5T 2FX6A 2OK5A 5JBBS 3LJOA 3PV5A 1VR1H 2GDEH 1EOJA 2PGQB 1SHYA 1C5VA 1GJAB 2XOKD 1UCYE 1C5OH 1FAKH 1VGCB 1CHOF 3NZIA 2ZDKA 3MOCA 3MYWA 4F4OC 1SGFA 1O3BA 2FODA 1UO6A 1D3TB 4CRDA 2AERH 1BJUA 2GCHF 1DT2A 1GJ7B 2V6NA 1B5GH 2XCNA 1UTMA 3PLBA 3S7KB 3OAAD 3UWIA 1O3KA 2ZDLA 1QFKH 2NU1E 2FTLE 1GVZA 1BTXA 1TA6A 3A86A 4Y11E 5T6FA 1AY6H 1Y5AT 3RMLH 5LPRA 1CGHA 1ZMJA 1P09A 2CV3A 3GYMA 1E38B 4MNVA 3LDXH 1IQMA 1TPSA 3EYDA 2ZGJA 4KTSA 3RMOH 1O5FH 1FY3A 2GKVE 4CRFA 2UUKB 1O2ZA 2BXTH 2Z3CA 4WWYA 4DCDA 5F6MA 1L0ZA 1BIOA 2GT7A 5L30H 2V35A 3M36A 3RMMH 3Q3XA 1W0YH 1KYNA 6CHAB 1SMFE 2QF3A 4F48B 1NRQH 2W26A 3KN2A 1EZUC 4YOIA 3A8CA 4HTCH 3PLPA 1MD8A 2A7CA 3UR6A 3AW1A 1O2MA 4OS1A 1O5CB 2Z9IA 4NA7A 3LONA 4INKA 1FN8A 1SGNE 2VWOA 5J4SA 3ZZ9A 5K0HA 1JMOH 1A3EH 4DIIH 3AASA 3URDA 1CBWB 1GJDB 1XUGA 4B6EA 4VGCC 1C2DA 3MNSA 2QF5A 5C1XA 2GV6A 2J9NA 1HAVB 1YPHC 3ATIA 2FOEA 1TQ0B 3OX7U 5T1VA 2H9EH 1S81A 2H9TH 3TGIE 4ABGA 3TH2H 5GDSH 4AG1A 1O2IA 5DPAA 5JBAS 3LH1A 7GCHF 3M5OA 1EPTC 5FXLA 3V0XA 2OTVA 3ZZ6A 1TLDA 3BEFB 1H8DH 5ESBA 5AVDA 1Z1IA 1C4Y2 1CHGA 3SU2A 2CF9H 2CMYA 5JYIA 2P93A 2BQWB 3LT3A 1Y5UT 3CS0A 2J5UA 5DP6A 2ZTYA 3VEQB 1MU6B 1XX9A 1J15A 1RTFB 1YY3A 4Y0YE 4Y0ZE 1QZ8A 2RCEA 1P12E 3BTDE 2XCFA 2UUYA 5GJ4B 1A4WH 2ZPSA 3TK9A 3JZ1B 3FVFB 3SJOA 1ESBA 1Y8TA 4P00A 2XBVA 3T62A 1ARCA 3BTFE 4B74A 4OS4A 3IWMA 4LOYH 1MBQA 2BTCE 3SNAA 4Y79A 1PPHE 3TLOA 3E16B 1ZTKA 4B2AA 2Z6BD 3E90B 4NIVA 3RXVA 4AFUA 4RKJB 1YGCH 1A5GH 3U69H 1GBDA 3E6PH 3U8TH 4AB8A 4ZHAA 2ZFRH 3U1IB 2ZGHA 1S5SA 2ZQ1A 5EOKA 3A85A 1QA0A 1G36A 1FI8A 1TNJA 2O9QA 1GI9B 4ASUD 1QCPA 3BSQA 3K65B 1MTNB 1BBRH 1ELAA 4E7NA 3UWJH 3ITIA 1ZSJA 1SVPA 3P8GA 1C1TA 3FOAA 3FZZA 3JZ2B 1H8ED 1DVAH 4X1PU 2C8WB 3UFAA 1HJ8A 2I6SA 3GISB 2Z9JA 2G00A 2OC8A 1RTLA 2BM2A 1N8OC 4X8TH 1O3AA 2V3HH 1FY5A 3GDUA 3N99A 1AFEH 4NA9H 4NZQA 1T4VH 4ABHA 1MTVA 1AI8H 2Z94A 1K1IA 1C5ZB 1ESAA 1D4PB 2J92A 2VB0A 3ZZ3A 2G8TA 4NSVA 1ZRKA 1ZGIA 1DLEA 2PGBB 2TIOA 4E06H 2G55A 4YT6H 8KME2 3WWFA 1MTWA 1C1QA 2ZFQH 1GMCF 1O3JA 1QL8A 1PPBH 2P8OC 4WY3A 3RXJA 3GCHB 1F7ZA 4FXGH 1UVPA 1GGDC 1GJ4H 2B8OH 1BTPA 3KQDA 3LGIA 3T5FH 3CENA 5LH8A 2ZA5A 1CT0E 1AFQB 1ABJH 2F4LA 3STIA 1E35B 1ZHMA 1F0TA 1HV7A 2JETC 3MH7A 3A83A 1T32A 1H1BA 1VCQA 3SNCA 3RLYH 4RI0A 3P6ZB 4KGAA 3ESTA 3SQEE 1BMFD 1K1PA 2Y6TA 3GCTF 3R3GB 1IQFA 2ZO3H 4LZ1H 1GCTC 4K1EA 2QXHA 3BIUH 1LVYA 3RP2A 1P2JA 2G5NA 1FZZA 1HPGA 1N6XA 2EC9H 4WJG2 1NFUA 4D7GA 2BB4A 2VBCA 5F53A 5DGJA 4ABFA 1TFXA 1CSOE 1QJ7B 2KFWA 1GMHG 3ODDA 2QA9E 4CHAC 1EB1H 5H4IB 3PMHB 1PFXC 1QBOA 2FOCA 3SNBA 2BVSH 3UR9A 2ZECA 1AE8H 1AB9C 3R0FA 1FIWA 1GHVH 2ZHFH 3SU0A 4WXIA 1TNLA 3KGPA 1LKAA 1H9LB 4MQAA 3P92A 3F2FA 2FESH 1QJ6B 1QB1A 5EJLA 1AUJA 4DG4A 4IBLH 1OX1A 4O3UA 1W11U 2R2WU 1ELCA 5I25A 1UHBB 1UTKA 2SGQE 2OXSA 1L4DA 3AK5A 4ZKNU 5EODA 3RXUA 1AGJA 1H8IH 2FS8A 1K0HA 1O5GH 4X1RU 2ZDNA 1SLWB 4UFDH 2NU0E 1DY9A 1ETSH 3B8JA 2Y82A 4MNYA 5BPEA 4ZROA 1N1LA 2WUBA 1GI5A 2VH0A 1GBCA 1BMLA 4H6TA 2ILNA 2QF0A 1S6LA 3PMBB 3LC3A 2ZNKH 4CBOA 4BAMB 1YC0A 4DT7B 1K2I1 1O2UA 3TITA 1UCYH 4SGAE 4YESB 6LPRA 2GCTC 4Q7XA 4IN2A 4Q80A 2AGIX 3ZZ7A 3NCLA 2ZDAH 1L1NA 1IQKA 1GVLA 3SV9A 2WPMS 3N7OA 1HJ9A 1GBLA 1LVMA 1ZR0A 4YO9A 2CF8H 1O0DH 1O3EA 2FX4A 3SUDA 3Q3YA 1V2VT 3SZEA 4TWWA 2ZGBH 4FUBA 1P2IA 1OHHD 3KCGH 1OWIA 3SV8A 1MKWK 8GCHG 1QQUA 2QV1A 2BDYA 2BDGA 1V2OT 3KYFA 1KDQA 1OXGA 4FOUC 1AWFH 1T4UH 1ELTA 3D23A 2SGDE 3TJOA 3MNCA 5A8YA 2GDDA 1C2FA 1ACBE 4JZDH 2M5TA 2ALVA 2J2UA 4AFQA 4E05H 5T3HA 4IC6A 1UVOA 1MMJN 1W10U 1SL3A 1M9UA 1S0QA 7GCHG 4K60A 2XW9A 1WU1A 1W3CA 4Q63A 4GSOA 1SQRA 3HK3B 4AFZA 1AVGH 1DS2E 5C0TA 5IK2D 2BVXH 5IDKA 1IQHA 2ANMH 1DWDH 3OTPA 3QLPH 1OWKA 1SGRE 1YCPH 1YP9A 2GD4B 2OBOA 1LTOA 1N6YA 4JYTA 3E0NB 4A7IB 2WPDD 1O33A 2P95A 1O2TA 3P70B 3UAIC 3QTOH 2XNIA 1FONA 2A1DB 1S83A 1MQ5A 1O2YA 3S9CA 1O5AB 4BAKB 5BRRE 1A5IA 1IQEA 3M35A 4GPGA 3EAJA 5GXPA 1RIWC 2C8ZB 1HAIH 1LPKB 3RXEA 1TMBH 2J97A 5JDUB 1CGJE 3HPTB 3D65E 1AUTC 2QY0B 2Q6DA 3DHKH 2FP7B 2HLCA 3RC4A 3P17H 1EAIA 1O2LA 3MU1A 1GG6C 2UUJB 1SGEE 1O2NA 2R0KA 3TH3H 2FM2A 1TMUH 4Y6DA 1GJCB 3RXGA 3TPIZ 2FI4E 3ZVEA 3T28A 2ANKH 2BD9A 1GBTA 3ATMA 4ABDA 4HZHA 5G4BA 3ZZAA 1NC6A 2GVFA 1FMGA 3FAOA 3T25A 3TH4H 1FPHH 2ZWLH 1TIOA 3F0PA 1NU9A 4DJZB 3FN8A 4TY6A 1EAWA 1GDQA 2F43B 2BY8X 2Y5HA 3M3SA 4LZ4B 3ENSB 1MCTA 4K1SA 2TRMA 2ZHEH 1HYLA 1C2LA 3H7OA 2NWNA 3OSYA 3ZZ8A 2ASUB 5IYTA 4B6FA 1CA0C 3A80A 4X6MA 1G30B 1TGSZ 1BMAA 4K2YA 2FOBA 1L1GA 1UTLM 3SNDA 1ZYOA 2FI3E 2FO9A 2GTBA 3RXLA 4MTBA 1A5HA 1GMCG 4PROA 1XMNB 4CRBA 2J95A 1WBGB 1EZQA 2HVXA 2BYAX 2NU3E 1LHCH 5F8TA 3ZVBA 1KTSB 4I8LA 5GNDA 2W7SA 3F9EA 1W14U 3W1EA 2TGDA 1MTSA 1BB0B 3E1XB 4BXWA 3MQKC 1Z8IB 1DWBH 4U2WA 1HFDA 3A7YA 4ABJA 2VGCC 1IQGA 1WCZA 2Y5GA 3SBKA 2BD4A 1HJAC 4M7GA 1QL7A 2NU2E 4FVDA 2V3OH 2IPHA 3MU5A 3UTUH 1E79D 1F0SA 4B75A 3ZV9A 1SLUB 1ABIH 3TGKE 1CQQA 3QGJA 3RMNH 3KNXA 5FPYA 5LPFA 3HGNA 4WH8A 1HXEH 3BEIB 2A7HA 1GMHF 1KLTA 1QBVH 1P2QA 3CP7A 4LK4A 1BUIA 2ZU2A 1Y3VA 3L33A 1OP0A 2KCOA 4IW4E 1G32B 1ZMLA 1QL9A 3PM3A 3M61U 3GOVB 1OYQA 2K8IA 1MBMA 1OKXA 3M7QA 2AEIH 1P01A 1Q2WA 1P3EA 4ZXYH 4MPUA 2BY9X 1O2KA 5EW1H 4AG2A 2ZU4A 3DA9B 4NA8A 3LGUA 2P3UB 3ZVAA 1HAPH 3DUXH 2QXGA 4DW2U 1W12U 3PO1B 4JYUH 2P59A 2VNTA 4GHQA 1TPAE 3A82A 2JH5D 2AHME 3OE7D 2KM0A 1Y3UA 1DY8A 1HCGA 1A46H 4AFSA 2ZU3A 1ELFA 1V2ST 1ZJDA 6CHAC 1Y5BT 1GBHA 4RT0A 5DKMA 1GI4A 1PQ5A 1YWUA 2FXRA 4ZMAH 1KXAA 4TPYA 3GY2A 1WQSA 2XNDD 1A0JA 1Y3YA 4Y8YA 1BRUP 2A2QH 4JK5A 1MD7A 2VIOA 1C2IA 2FI5E 2OC0A 1RJXB 2Q6GA 5EG4A 3LGYA 1C5QA 1QQ4A 1AHTH 3DD2H 1F5LA 5CHAC 1O3OA 3D62A 1W0ZU 4BTTB 1LHEH 1LQDB 1Q3XA 4WF8A 2O8WA 3NWUA 4ABBA 1OPHB 1Z8GA 3KQCA 4I8HA 4NWLA 1Z1JA 1SGTA 1GHAG 2EI8A 4MNXA 3EA7A 1PQAA 2SGAA 4ZHLU 4OS6A 3A81A 2HNTF 3A7ZA 3U28C 1J14A 1IAUA 2ESTE 4AORA 2CHAB 1O3LA 2PTCE 2QAAA 5EPYA 3MH5A 4AYVB 4OS2A 2VVCA 1GHWH 2BD8A 5DP7A 1HAOH 1UK4A 2OC7A 2XWAA 4X1SU 8GCHF 3F9GA 1EPTA 2JIZD 1NBMD 1AD8H 1GBBA 1S85A 1OS8A 1CU1A 2W5EA 1KXCA 4Y76A 5C1YA 5CE1A 5HM2A 1O3IA 3EQ0H 1O2WA 1FDPA 1TBZH 3GYLB 1CT2E 1FXYA 1BMNH 4CREA 1FY4A 2A4OA 3QTVH 4I31A 1SFQB 1G2MA 1C5SA 4BTUB 1MAXA 3FFGA 1JWTA 1HNEE 1O5EH 4UONA 2ZF0H 3UY9A 2EA3A 3FP6E 2BDIA 3KYGA 1TQ7B 1DSUA 1JRSA 3Q00A 1IQJA 2DE9A 3GY3A 2F9NA 1G2LA 1C2GA 3PB1E 4GUXA 4IC5A 4K8BA 3A7TA 2HNTE 1SGDE 1DUAA 2PWXA 3DSOA 1C9TA 1UVUH 2QCYA 5TCCA 5DP4A 3SN8A 3W94A 3CS7A 1Q31A 1MU8B 2AGEX 2IJD1 3DT0H 2BY7X 1OOKB 1Z6EA 4VGCB 3UNRA 1ANBA 4B73A 4A1XA 1ZPBA 5JB8S 3P8FA 1V2WT 4IMQA 5JBTA 1EFRD 3QDZB 3ATWA 2PKSC 4O3TA 2FOGA 1NBME 2BLVA 4A5TS 5DK1A 1QRWA 2BXUH 2RDEA 3PWCA 1YLDA 3QZQA 1W7GH 3NKKA 4IGDA 2D2DA 5E2OA 2EY4C 1O3DA 2ODYB 5FAHA 1GJ5H 1HB0B 2F91A 4A6LA 1KXBA 1YYY1 1P03A 1CVWH 5LPEA 1D6WA 3RXFA 3L3TA 5F03A 1GBFA 2M2AA 5CMXH 3W95A 1FY1A 1ZSLA 1CO7E 1J17T 1L2EA 3MMGA 1TRNA 2GZ9A 2FS9A 1ZTLA 2LP6A 1X7AC 1YPMH 4NCYA 2OINA 4U01A 4ABAA 4FUDA 3MO9A 4THNH 4OS5A 1AFQC 1P57B 5F8ZA 3UIRA 1LPGB 1F0UA 4IS5A 1H8HD 3LGTA 4P02A 2J98A 5JB9S 1C1OA 1C1MA 1LHGH 1F2SE 4YXWD 2ZPRA 3LU9B 3LIWA 3MH6A 4TSFD 3T27A 3VB4A 2A2XH 2TBSA 4D7FA 4X6PA 3OFND 6GCHG 5KEDA 1BZXE 3F9HA 1TRYA 2A5IA 2ZGXH 4Z1MD 5GWZA 1E36B 1YPJH 3M37A 1EJNA 2R9PA 1AU8A 2W3IA 1FJSA 1O34A 1C1UH 4MPVA 2BD7A 1FY8E 2PLXA 4IMZA 4Z0KA 4YLQH 1CT4E 2C93B 1IQIA 3TIUA 2QGRA 5KGOA 3HKJB 2BVRH 1NESE 2J4IA 1RFNA 1C5NH 1O32A 3PTBA 1OP2A 4K5ZA 5HIYA 5A0BA 2VJ1A 4A92A 2H6MA 3RU4D 1VCPA 5JPMH 1GMDG 4XBBA 1QURH 3EGKH 1RTKA 2EI7A 2I6QA 1QR3E 2W6ID 2PW8H 3SGAE 1XUHA 3A84A 3M7TA 3RXCA 2OUAA 1DE7H 1E34B 4XBCA 2SGEE 4ZHMU 4X8UH 5B6LA 5T6DA 1K21H 3G01A 2VVVA 2P16A 1BHXB 1KY9A 5C1UA 1NRRH 2J94A 4NIXA 2J34A 1V2QT 3F68H 1GGDB 5ABWA 2J98B 3MU8A 5DP3A 3A89A 2BQ6B 5EXLA 1O3NA 1GDUA 2JETB 3HATH 3E0PB 3S69A 4X2VA 4ISLA 3SU1A 1WTGH 1NFWA 1V2JT 1PPCE 1Z6JH 2W7UA 1A1RA 3RM2H 1DM4B 1W2KH 4DIHH 3DFLA 1GI2A 1HGTH 1RXPA 5HGGA 3TU7H 1GCTB 1GJ6A 2A4GA 3ZV8A 3WY8A 4I32A 2H5CA 4H4FA 3DCLA 1UMAH 1LHDH 2Y7ZA 3LGVA 2GP9B 1IHTH 1YM0A 4Y7BA 2ZHDA 2WPLS 2JJ1D 4RSPA 4Y8XA 4F49A 4FU8A 1TBQH 1PPZA 1C5PA 2FOAA 2Y5FA 3M5MA 3RU4E 2RG3A 1V2LT 2UWPA 3F2GA 1XVMA 1GBAA 3AAVA 3QK1A 1AQ7A 1MTUA 1W0KD 4OS7A 4HGCA 4DVAU 3SGQE 2HNTC 1SR5C 4OM9A 4JZ1A 1LKBA 4FUFA 1IQNA 1YLCA 3P8NA 1ZLRA 2GMTB 2RFKC 2ZFFH 1HIAA 2RA3A 2WSSD 3KEEA 2BD3A 2LPRA 1GHAF 4MPWA 1TB6H 3IG6B 1SQAA 4A1TA 1KXEA 1OWHA 4CRAA 3MO6A 3E8LA 1C5MD 2A4QA 1FQ3A 2BOHB 2ZFPH 3O8RA 2GGVB 5CHBA 1O3MA 2OQ5A 3CNRA 1QY6A 1WDIA 2GV7A 4JMYA 1TNIA 1SGPE 4MNWA 2ALPA 2WV5A 3OEED 2C8YB 3A8DA 1IQLA 2WUCA 1WXRA 5FCKA 1G3BA 4NIYA 5AHGH 3OY6U 3WW7A 1RRKA 4INHA 3U9AH 2HGTH 1KLJH 4JZIA 4Q7YA 4AGKA 1C4V2 2KCPA 1A2CH 1ELBA 3GCOA 3A7VA 1O36A 3BTKE 3BV9B 1O2JA 5L2ZH 4UE7H 4MVNA 3T26A 1VJAU 4UD9H 4YOGA 5JBCS 2YMSC 4JZFH 1QB9A 5C0UA 1SQTA 1G3EA 1O5BB 2ZPQA 1KIGH 1AZZA 2H2ZA 2YOLA 4X1NU 2OP9A 1DUEA 4ABEA 3M5LA 5EQRA 3VB7A 1UTQA 1SBWA 3GDSA
chains in the Genus database with same CATH topology
4ISIH 3MFJA 1JBUH 1B0FA 2BDCA 1BDAA 1Z8JB 3U98H 1C5RA 3GY8A 2SGPE 1SGYE 4NFEA 1RD3B 3UQOA 1OYTH 1ESTA 1OP8A 1C2KA 4A1VA 3MNBA 4Y10E 3BTTE 4K3JA 1GI1A 1WUNH 4FUGA 1EUFA 2ZC9H 4UDWH 2H5DA 1PQ8A 4BANB 5HM9A 3ZZCA 4B1TA 3MO3A 1ANCA 1K28D 4AN7A 1TOCB 3SNEA 1SHHB 2F9VA 3Q77A 2BD2A 4R8TB 1O3HA 1BTZA 1YBWA 4WVPE 4XFQA 2PUQH 3ZYDA 4KTCA 4KELA 2W3KA 2C3SA 5A0CA 2JKHA 1V2TT 1ETTH 1SSXA 4TY7A 3TK5A 1P2MA 3ZVCA 2OLGA 3VFEA 4ASHA 2H9HA 1YPKH 2CXVA 1GI0A 1BRAA 3LOXA 2R0LA 5C5NA 1G9IE 1LVBA 1P0SH 2PSXA 3SU5A 1MKXK 2XBWA 5C2ZA 1O37A 1KDQB 2ZIQH 2ZFSA 4YM9A 3SO3A 2SNVA 1H9HE 1GWAA 1FLEE 1GI8B 3Q76A 1AKSA 1UTPA 1ID5H 4Q7ZA 3M3TA 2RDLA 5A2MH 1G37A 3OU0A 2ZGCA 1GVKB 4BAOB 3U1JB 1XUFA 3SU3A 1LHFH 1VCWA 1ELEE 1QTFA 1D6RA 2KAIA 1NRPH 1NT1A 1CA8B 3BN9A 1DANH 2Q1JA 4H42U 1AVWA 2A32A 6ESTA 1EB2A 4RN6A 1XUJA 2ZHQH 1XKBC 2D1JA 1TMTH 4TPIZ 4TYDA 1UJ1A 4FUCA 3SOSA 3PMAB 5LGOA 4U32A 3KQBA 1T7CA 1P04A 2ZDMA 6GCHF 1TGCA 4CRCA 2GZ8A 5GCHF 1GBKA 3SUFA 1V2PT 4UFFH 1BQYA 2YNBA 3OTJE 2VINA 3L6PA 2XC0A 4INLA 2BX4A 2PUXB 3GY7A 3E91A 3QN7A 4OGXA 1YPLH 1U6QA 1T8LA 2ZFTA 3LC5A 3NK8A 1MQ6A 3QX5H 5FCRA 2BDHA 5EQQA 1AE5A 2WV4A 1E37B 2DE8A 4BAHB 2O8MA 2JH6D 1GG6B 1O2QA 2ANYA 3O8DA 1PJPA 2PHBA 1GHZA 1O3PB 3PROA 1O2SA 1S6FA 2FZZA 3EE0B 3VGCB 4NG9H 3IITA 3RXHA 1QIXB 2ANWA 2XXLA 1S0RA 1DOJA 1O2VA 4X1QU 1XVOA 4HFPB 2AMDA 1GMDF 4KKDA 2BDBA 2G5VA 3BG4B 3MHWU 4R0IA 3SUGA 1MKWH 4IN1A 1GL1A 3SQHE 1DPOA 3C27B 4CH2B 5EXMA 2C4FH 1TALA 4CR5A 1EASA 5EPNA 1AIXH 5SGAE 3PO1C 3HK6B 1A0HB 1ZGVA 1VGCC 3EA8A 1DXWA 1V2RT 4YLUA 3GCNA 1J16A 2WYJA 1CA0B 1Y3WA 4ISNA 2KAIB 4JCNA 4D9RA 5A0BA 1F0RA 2ZCKP 3RXIA 2O8TA 1VZQH 4JZEH 3LH3A 4YT7H 1TAWA 2ZQ2A 3SJKA 4ZKRU 3DFJA 1NFXA 1TNGA 1MZAA 2AMQA 3FP8E 3UOPA 2HPPH 3S7HB 1ZPCA 1BOQA 1HDTH 1PPFE 4DGJA 1J9CH 1P10A 1JRTA 5FBIA 4ESTE 2TGAA 1JXPA 3RXRA 1TX6A 2BOKA 2GT8A 1W8BH 3RM0H 2JH0D 1D3DB 1P05A 4U30A 2VIQA 2O8LA 3A7WA 1DXPA 4WMFA 1BTYA 1SLXB 4B2CA 1HJAB 1EP5A 1RGQA 3AW0A 3QGNB 1MZDA 1HAVA 1BBRK 1EX3A 1QB6A 1LPZB 1NRNH 3RU4T 4ZH8A 5DO4H 2CHAC 2FPZA 1HAHH 2R2MB 2ZTZA 1TE0A 2SNWA 3RXKA 2A45B 2HPQH 2WPHS 3RXMA 2R3UA 3MWIU 2AH4X 3C1KA 1SQOA 3K9XB 1C1NA 4XSKU 1GHXH 4ZXXH 4BAQB 1ZTJA 2BD5A 4AX9H 1CBWC 1GBIA 1J8AA 2B0FA 2G4TA 3V13A 1MKXH 3U8RH 4X6OA 5HMAA 3S9AA 3RLWH 1W13U 4GHTA 2PKAA 5C67A 3S9BA 1CE5A 4BNRA 4FVBA 1EZSC 2D26C 1D3PB 2Y7XA 2ZP0H 2Z9GA 1AWHB 3NUMA 1VJ9U 3SZNA 3SJ9A 1NTPA 1QNJA 2B5TB 1A61H 2FEQH 3O8CA 4X2WA 5A8XA 4Y8ZA 3ATKA 1O3FA 1O3GA 4UFEH 5C5OA 1JIMA 2QC2A 4K1TA 1V3XA 2BY5X 1SGIB 2PV9B 5E0JA 3Q3KA 4MG3A 1ZHRA 2VU8E 1O2PA 2QYIA 1TX8A 2TGTA 1AMHA 1WSSH 1C5UA 1XXDA 4FUEA 4GCHG 5DJ7A 2BLQA 2OCVB 1GHYH 3BTHE 5TCAA 1SGFG 4NGAH 1Y3XA 1SC8U 1NN6A 1GJ8B 1DWEH 1ZHPA 3PV4A 1BCUH 1ELGA 2BZ6H 1TGBA 5CHAB 1ZSKA 2TPIZ 1HAZB 1Y59T 2G4UA 1FNIA 1KSNA 2SFAA 1C2MA 4HI3A 3ZZ4A 2Y81A 1NM6A 1ETRH 3ZVFA 3VB6A 2ZHWH 1LQEA 3SI3H 3VXFH 1LVOA 3NXPA 2AGGX 4O97A 3BEUA 2FWWA 2ZDVH 2F9UA 3RXAA 1DLKB 1AZ8A 3A8AA 4Y7AA 3BTME 4WMEA 5L2YH 1NY22 1P9UA 1XKAC 1CGIE 1C5XB 1GDNA 3SJIA 3UOUA 4FU9A 3V12A 1MTNC 4ZKOU 5EW2H 1FUJA 1VITF 2FMJA 4X0WU 2PKAB 1XXFA 1P11E 3ZVGA 4SGBE 1XUIA 3VB3A 3ODFA 2G52A 3MI4A 4FUHA 2SGFE 5A8ZA 3QUMP 1O39A 2FDAA 3QWCH 4Q2KA 3VB5A 1WYKA 1LCYA 2Z9KA 3EA9A 2A31A 1HUTH 1NS3A 3URCA 1DFPA 3BG8A 1NU7B 5E0HA 1EPTB 5DG6A 2AS9A 1GPZA 2IN2A 3RC6A 3T29A 2HWLB 1L4ZA 3I29A 1C2EA 4FUJA 4UFGH 2DUCA 2UWOA 2AIPA 3I77A 3RXOA 1H9IE 1WOFA 2XBYA 1MAYA 2OQUA 3RXQA 4JK6A 1T8MA 3VPKA 3KQEA 1EJAA 7KMEH 2R3YA 2K1QA 4KP0A 1D3QB 1NZQH 4FUIA 3MTYA 5HYOA 2VIWA 3GCHC 1TBRH 3TJUA 1A3BH 2FIRH 2GZ7A 4NZLA 5PTPA 1UCYK 3LJJA 1H4WA 2RA0A 8LPRA 1EATA 3M5NA 2ZI2H 3FZDA 3K2UA 1OWDA 5FBEA 1K1LA 3ELAH 1WV7H 1V6DA 1SLVB 4ZAEA 1P2NA 1BTWA 1UTNA 1QRXA 1GI7B 4AYYB 1TONA 2PKSB 3LPRA 2IJOB 4ABIA 4X2YA 2VWLA 9ESTA 4Z6AH 1P2OA 2AFQB 5E0GA 5GCHG 1HBTH 1O2XA 5FHTA 1AO5A 5GPIB 5AFYH 3ZZDA 5FX6A 2Z9LA 4DY7B 1UVSH 1T31A 4GAWA 1XM1A 1G3CA 1GHBG 1B0EA 2XWBI 2ZU1A 5DP9A 1QA7A 1S6HA 5EXNA 2BLOA 1GI6A 4CR9A 1K1MA 1ANEA 3F1SB 4XE4A 1KXDA 3KHVA 1THSH 2LNCA 1KXFA 3P95A 2NU4E 2Q6FA 4NFFA 2D8WA 1DX5M 3BTGE 1FPCH 4I8KA 1PYTC 1A7SA 2BQ7B 5B6OA 3UPEA 2F9BH 1O31A 5DP5A 1O5DH 3UNSA 3K6YA 2ZG0H 2WINI 2B7DH 2PTNA 2TGPZ 1O30A 1UHBA 4K69A 2XYAA 2BX3A 3GICB 1DWCH 1UTOA 1GBJA 1N8OB 2P3FH 4ISOA 4BOHA 3TNTA 4AGJA 3KIDU 1YCPK 2PFEA 4OGYA 4X2XA 4WMDA 1V2UT 1EJMA 2ZTXA 4DURA 1P3CA 3SU4A 1INCA 1Z71A 1K1NA 3A8BA 2UUFB 4D9QA 1WTHD 3ZZBA 2FOFA 4NWKA 2P8OB 1NROH 3TVJB 2FLBH 3KL6A 3AAUA 1JOUB 2UWLA 2YNAA 1C2JA 4DOQA 3LKWA 3PMJA 3TNSA 2CN0H 3QO6A 1MH0A 2ULLA 1HAXB 1GJ9B 1L1JA 3QZRA 5EU8A 5FX5A 3HKIB 3M7UA 1C5WB 2THFB 3MU4A 1YF4A 2GMTC 1OWEA 1W7XH 2BZAA 3V7TA 1GBEA 1K9OE 2QIQA 3O8BA 2Z7FE 2BLWA 1DITH 5C20A 1BTUA 1P02A 2VIVA 1BTHH 2V0BA 3OY5U 5E2PA 3PWBA 3TJVA 1QGFA 3UUZA 4GVUA 5L6NH 3GY4A 3SHCH 2CJIA 1K1OA 1PPGE 5TJXA 1IOEA 2WPIS 1HAGE 2EI6A 3P8OA 3LGWA 2WYGA 1O2HA 1GL0E 2F83A 1WQVH 1TABE 3BF6H 2XRCA 1FAXA 2FLRH 1CHOG 3M3VA 1EAUA 1LO6A 3UQVA 1FV9A 1XUKA 1Z8RA 5DP8A 3VXEH 3SHAH 3BIVH 4CHAB 1P8VC 1G3DA 1ELVA 1MUEB 3GY6A 1EKBB 2EEKA 3PLKA 3RXBA 2GCHG 4X6NA 3STJA 2ODPA 1UTJA 4H6SB 1AB9B 2CGAA 5ESTE 1ANDA 3UREA 2XTTB 2HALA 3SJ8A 1WAYB 2J38A 1SG8B 3FP7E 5E8EH 1OSSA 1UK3A 3RXDA 1TA2A 1BT7A 3V3MA 2C8XB 4AZ2B 1TGNA 4NSYA 3EDXB 5J4QA 1YCPM 1O2GH 4GCHF 2XC5A 2OD3B 1SFIA 1ZPZA 4B2BA 5EGMA 1P06A 1MCVA 1THRH 3PTNA 3BTQE 1TOMH 2G81E 5I46H 2F9OA 1C1RA 4I8JA 4NIWA 1EAXA 4LXBH 1V2KT 1ELDE 2FYRA 1ZMNA 1BA8B 1EZXC 3S0NA 8ESTE 3PYHA 4YOJA 2VIDA 2IOTA 2P3TB 4I33A 1TPPA 1C4U2 1SGQE 2OC1A 1OWJA 1SGCA 1TYNA 1YPGH 2OBQA 1C1PA 3HGPA 1C1WH 2F3CE 2AYWA 4ZUHA 2GCTB 1ARBA 3ZVDA 1EXFA 1SPJA 1F5RA 1PPEE 1A0LA 3RC5A 3OYPA 2ZCLP 1HXFH 1BRCE 2BMGB 4WXVA 5A0AE 2A0QB 3F9FA 3T2NA 1T8NA 4K8YA 1K1JA 3RXSA 1NO9H 1YPEH 2BY6X 5K7RA 3TJNA 1HIAB 4O03A 1C9PA 4CH8B 4E7RG 1BJVA 4UEHH 2XBXA 1DSTA 3KF2A 4QT8C 3SGBE 1HRTH 3ZZ5A 1TRMA 4TWYA 1VITG 1SOZA 2XC4A 3SI4H 2FTMA 1FN6A 3ATLA 4D76A 2F9PA 1AVXA 1IHSH 1O35A 1EOLA 1B7XB 3BTEE 1TPOA 2STBE 1BBRE 1P9SA 2VWNA 1FIZA 1QHRB 2WPKS 1HLTH 4AOQA 2BHGA 1TWXB 3MH4A 3E3TA 2A4RA 5GIBA 1S82A 3GY5A 7LPRA 1O38A 2FOHA 1THPB 4RKOB 5AFZH 4AB9A 1DDJA 3B23B 3RXPA 4B76A 1GCDA 5FPTA 3SORA 1O3CA 2VVUA 1LDTT 3SV2H 2BDAA 1NRSH 1UK2A 4XDEA 1QBNA 1K22H 1KLIH 2VWMA 1YPHE 2P94A 2ZEBA 2PSYA 5FPSA 4D8NA 2FOMB 1C2HA 1C1SA 1SB1H 3TK6A 3VGCC 1Z7KA 1YKTA 1O2RA 3A87A 1GBMA 1NFYA 1NPMA 2WPJS 1JIRA 4CBNA 2A7JA 1RIWB 3BG4C 3MU0A 1GHBF 2O8UA 3A88A 4BTIB 3GDVA 1V2NT 2ZU5A 1ZZZA 1UVTH 2QXJA 5A09A 1DICA 3SW2B 1C5YB 3H7TA 1TNKA 1ZJKA 1GJBB 1SI5H 2Z3DA 2H1UA 1QRZA 4MLFB 2VIPA 1D9IA 1PQ7A 4MDSA 2ZCHP 3U8OH 2A5KA 1GI3A 5ETXA 3K6ZA 1C5LH 1VITH 4YZUA 4J2YB 9LPRA 3RUOA 2ZKSA 1PYTD 2HOBA 7ESTE 1F5KU 1C5TA 3H5CB 4GLYA 4I7YH 2ZZUH 2Y80A 1E0FD 3D49H 5T6GA 3RDZA 1EQ9A 3AVZA 2Z3EA 3F6UH 5F8XA 3SV7A 3A7XA 1ZRBA 5EQSA 3NPSA 2HRVA 1TGTA 1BHXF 5HXFA 1AKSB 1ORFA 1LMWB 1BITA 3FANA 3SUEA 2C90B 4MPXA 1KTTB 3I78A 3BTWE 4BXSA 2VH6A 1RS0A 1TX7A 1TNHA 3SU6A 4ISHH 4WH6A 1SOTA 4J1YA 1T8OA 3B9FH 3MNXA 4X8SH 2G51A 1S84A 3GCTG 4X8VH 4Y71A 5C3NA 2QXIA 4XOJA 3TGJE 4CRGA 2A5AA 1HAYB 2ODQA 1EP6A 1ZOMA 2STAE 1QJ1B 3SV6A 4FU7A 4O9VA 1P2KA 4I8GA 1C1VH 5AF9H 4XBDA 4KTUA 3ZYEA 2AIQA 4YTAA 2B9LA 4ZKSU 1BMMH 2FYQA 4B71A 2AMPA 1F92A 1O2OA 3UNQA 1BRBE 3RXTA 2GX4A 1V2MT 2VGCB 1AN1E 4JYVH 2PR3A 2QN5T 2FX6A 5JBBS 3LJOA 1VR1H 2GDEH 1EOJA 2PGQB 1SHYA 1C5VA 1GJAB 1UCYE 1C5OH 1FAKH 1VGCB 1CHOF 3NZIA 2ZDKA 3MOCA 3MYWA 4F4OC 1SGFA 1O3BA 2FODA 1UO6A 1D3TB 4CRDA 2AERH 1BJUA 2GCHF 1DT2A 1GJ7B 2V6NA 1B5GH 2XCNA 1UTMA 3PLBA 3S7KB 3UWIA 1O3KA 2ZDLA 1QFKH 2NU1E 2FTLE 1GVZA 1BTXA 1TA6A 3A86A 4Y11E 5T6FA 1AY6H 1Y5AT 3RMLH 5LPRA 1CGHA 1ZMJA 1P09A 2CV3A 3GYMA 1E38B 4MNVA 3LDXH 1IQMA 1TPSA 3EYDA 2ZGJA 4KTSA 3RMOH 1O5FH 1FY3A 2GKVE 4CRFA 2UUKB 1O2ZA 2BXTH 2Z3CA 4WWYA 4DCDA 5F6MA 1L0ZA 1BIOA 2GT7A 5L30H 2V35A 3M36A 3RMMH 3Q3XA 1W0YH 1KYNA 6CHAB 1SMFE 2QF3A 1NRQH 2W26A 3KN2A 1EZUC 4YOIA 3A8CA 4HTCH 3PLPA 1MD8A 2A7CA