3A89A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 4 hours)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a89A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a89A02
1FJSA 3A8AA 1Q31A 1P8VC 2R9PA 3ODFA 1SBWA 2VIVA 5A8YA 2GX4A 1P3EA 1OYQA 1E38B 1AE5A 1GBKA 4XBBA 1ZSLA 1LPKB 4X8SH 1TLDA 8LPRA 1UCYE 5A2MH 4D8NA 3S69A 1GI1A 1GHWH 1HV7A 3O8CA 1WQVH 4FU9A 2D2DA 1O3GA 2BDCA 3LIWA 2OTVA 2PKAA 4KP0A 1UTNA 4YOJA 4CRFA 2QF3A 1O2PA 2FEQH 1A7SA 5GDSH 3KQBA 2YNBA 4CH8B 2A5KA 1G3BA 1HCGA 6ESTA 2VGCB 1GDNA 4NCYA 1D6RA 1EP6A 2QIQA 4AORA 1GJDB 1AWHB 4Y7AA 2F91A 3M7QA 3NXPA 1GHVH 4NA8A 4UFFH 2GKVE 3TNSA 4I8LA 2KAIA 2PUXB 1C5YB 3MU1A 3U8OH 3I29A 3GYMA 4O97A 1SGTA 1G2LA 2FI3E 3HKIB 2GCTB 2Z9GA 2P3FH 1QL9A 1FY5A 3A7ZA 5E0HA 2EEKA 3ZZBA 1EATA 1GHAG 3T28A 4B2BA 2A32A 2BD7A 3SZNA 1BITA 2XCFA 3I78A 1O2TA 1CBWC 1AZZA 3ZVFA 1O3DA 3U98H 2FYRA 2Y6TA 1LTOA 1P10A 4A5TS 1SB1H 4FUGA 1C5SA 2FOMB 3URDA 4B73A 3VPKA 1ETSH 2AMPA 4AFUA 1T4VH 1ZJDA 3A89A 2Y81A 1OYTH 2OBQA 2TRMA 2G00A 2G52A 4RSPA 1UTJA 1D3QB 1SPJA 3KL6A 3AVZA 4X6MA 2H9TH 1XVMA 4WVPE 3GY3A 2BDAA 4GVUA 4J2YB 4CRBA 2W7SA 1E35B 1VITH 3V7TA 3PMBB 4INLA 1J9CH 1O3IA 1O5BB 2FOGA 2ILNA 1CT2E 5DKMA 1A5IA 1EB2A 4B2CA 2JETB 5JBBS 4R0IA 3EA8A 1P05A 2BQWB 1O3CA 1GJAB 1IQKA 1XMNB 2GV7A 1P3CA 3MH4A 2BHGA 3OSYA 4K5ZA 2J95A 1AVWA 4TY7A 1SOTA 1GI9B 2QAAA 4B74A 1CA0B 3SQEE 3IG6B 3U9AH 1IQIA 2UWLA 1UVSH 2LPRA 4AG2A 1KLJH 1L4ZA 7GCHF 2UWPA 3KQCA 1WOFA 1AVXA 1S82A 3LKWA 1EB1H 1K22H 1O38A 2VH0A 1LVBA 3O8RA 2HNTF 4DW2U 3ZZAA 3K65B 1O2NA 4X8VH 1GBDA 1QBNA 2BLQA 1RS0A 2G81E 3BTTE 3BF6H 4KELA 2P8OC 1ETRH 4BXWA 1EASA 2UUYA 1INCA 2ZU4A 5A09A 1XX9A 1PPGE 1O3EA 1BTPA 2OC1A 4SGAE 3KQEA 2ZQ2A 1E37B 2NU2E 2PV9B 1CU1A 2VIQA 1SMFE 1LHEH 1BOQA 2C8ZB 3F1SB 1MZDA 4HZHA 4Y76A 3TJNA 3AASA 4ZKSU 1HNEE 3SUEA 1ETTH 1WUNH 1V2UT 2FESH 4ABAA 3P8GA 2OD3B 1KY9A 4GHQA 2ZGXH 1QRZA 3SV9A 1TPPA 1VR1H 1TB6H 2D26C 2HGTH 3L33A 1G3EA 4ABHA 1QB9A 2A4GA 2XRCA 1EPTC 1MBMA 3LJJA 4INKA 3QGNB 2QF0A 1UHBA 1Y3VA 1CO7E 1ZSJA 4MNWA 4BOHA 2RA3A 3SNEA 7GCHG 1F0UA 1ELTA 5LPRA 4I8GA 5GPIB 2XBVA 4JK6A 3RU4T 1GDUA 1GJ7B 4ABBA 3KIDU 6CHAC 1THPB 4GHTA 4OS1A 4NWKA 5DP9A 1TMBH 2TGPZ 4ASHA 4WMEA 1GMHF 3A7YA 1OP0A 4KGAA 5BRRE 1O3AA 2ZFTA 1O2VA 3CS7A 1SFIA 3GCHB 1BTZA 2CN0H 4KTUA 1TX7A 2CGAA 3BSQA 1BTYA 1A0JA 1O5DH 2CHAB 1GBCA 2ZECA 1P09A 2J92A 1D4PB 1M9UA 1MMJN 2P59A 2Q6FA 5FPSA 3GDVA 1C1VH 1F0SA 1ELBA 2QCYA 2ZPSA 3D49H 4MNXA 4FUFA 1TNHA 5FX6A 5LPFA 1MTNB 5C2ZA 1D9IA 1YCPH 4ABEA 3RXGA 2QGRA 5EODA 3M3SA 2B9LA 1BTXA 4WJG2 3CS0A 5GWZA 4AN7A 1GL1A 3PMJA 5JYIA 1A1RA 3HK3B 1QA0A 2ZI2H 1YPHC 1UMAH 1SGQE 1ZYOA 3GICB 4FVBA 4NFEA 4BTUB 1IQFA 5EU8A 3SU1A 3QUMP 2W3IA 1C2KA 1P2QA 2H1UA 2BXUH 4YO9A 2OP9A 2NU4E 3LH3A 1H8IH 1O2YA 1W7XH 4AOQA 1L2EA 1BMLA 1MTUA 4MDSA 3ELAH 1G37A 1TA2A 1O3OA 3UWIA 1GI2A 1O2MA 3KEEA 1NFUA 2FOHA 1K1NA 5E0GA 1D3TB 5TCCA 1TRNA 4ISIH 1YPJH 1XUHA 4X2YA 1G9IE 1PPCE 1O5GH 2RG3A 1C4V2 1RGQA 3A7TA 1ZMLA 4I31A 3FVFB 1TRMA 1JWTA 6CHAB 2ZEBA 1HYLA 5LGOA 4ZHAA 3P6ZB 3CENA 1C2EA 3BTFE 1T31A 1AB9C 2H9HA 1DUEA 3E6PH 4MG3A 4ZXXH 3LGWA 1CA8B 1GI0A 1YP9A 2J9NA 1GVLA 1YGCH 2HRVA 2PFEA 4VGCC 1W10U 1IQNA 1BRAA 1TPOA 1GVZA 3SHAH 2P93A 2OINA 2QXGA 1TGBA 3M36A 4DIHH 1DS2E 4UONA 4MVNA 4WH6A 4XBDA 1DUAA 4WMFA 2Y5HA 1RTFB 3VXFH 1Z6EA 3PWBA 4MLFB 3O8BA 3ZVCA 3RXSA 5SGAE 2Q6GA 5EXMA 3OTJE 2W5EA 2BX3A 4AGJA 1C1NA 1C1QA 4WWYA 2ZU1A 2F9NA 1DDJA 1C5ZB 1ZGIA 4NIVA 3CP7A 2YNAA 2BDHA 4WY3A 1MKXH 3U1JB 1ELGA 3ITIA 1GBEA 2TPIZ 3RXVA 1TA6A 2G8TA 1MCVA 1RIWC 1ZOMA 1RFNA 1YCPM 3RXEA 5EW1H 4KTCA 2QXJA 1W7GH 1GGDB 3ZZCA 5E0JA 3T62A 3U8RH 3EDXB 5EG4A 2FLRH 2OBOA 4DURA 2R0KA 3FANA 4HGCA 3MYWA 3HATH 4Y6DA 1AI8H 3HK6B 4UEHH 4XDEA 2C93B 3DFJA 2ZDLA 5E8EH 2ZHFH 1SQTA 1F5KU 2C8YB 5AHGH 1FAXA 3KGPA 5FX5A 1ZTLA 1C5MD 1ESBA 1BHXF 3BTWE 2HPPH 3TITA 2B8OH 1NS3A 1QQUA 2FOFA 4XSKU 3PTNA 2G4UA 1IQEA 3ZV9A 1AIXH 3SGQE 5LPEA 1FAKH 4X8UH 4Q80A 3TGJE 1DM4B 1VCPA 2ZKSA 5HGGA 1TYNA 2ZFPH 1PQ7A 1C2MA 1HIAB 2BY8X 1EX3A 3TK5A 3PWCA 2C4FH 3S9BA 1OP8A 2BDBA 1S5SA 1GMDF 2WV4A 3RC6A 3IITA 5F8ZA 4X1PU 1O32A 1QA7A 5EGMA 2BLWA 3P95A 1LQDB 5AFYH 1LDTT 3FP6E 4TWWA 3B23B 1TBRH 1NFWA 2BTCE 2VVUA 4R8TB 5JBTA 3HGPA 2BOHB 1V2RT 4KTSA 2BQ7B 3FAOA 1O2XA 3PV4A 3SV2H 2BD3A 1B0EA 1HJAB 1V2JT 3QX5H 4OS4A 3A87A 2SGEE 3MFJA 4IW4E 3SV8A 2ZDKA 1F92A 3A82A 1SLUB 4GCHG 1NU7B 1PPHE 2BX4A 1TAWA 1ZTKA 3H5CB 3QK1A 1UK4A 2VGCC 1YBWA 1EZSC 1V2PT 1O30A 3PLKA 1GMCG 3UQOA 4X6PA 2JH0D 2R2WU 5G4BA 3H7OA 1GHBG 3TVJB 1C4U2 3ZZ4A 2BY5X 2UUKB 2C8WB 1NZQH 2GGVB 3M35A 3SU4A 2FX6A 3K9XB 4AX9H 3ATIA 1GHZA 3DT0H 2ANYA 2F9OA 2ZTXA 1TONA 1GJ8B 1TWXB 2GCTC 2ZGJA 1GJCB 3S9CA 4MPXA 4X2WA 1O3JA 3SNCA 2BDYA 3UUZA 3F68H 3M5LA 3GY7A 1ZR0A 3SU2A 1DVAH 1LHDH 1O39A 3TGKE 1AKSA 1MQ6A 1HAYB 1OWKA 1S83A 1V2ST 1IQHA 3EQ0H 4FUHA 1XM1A 1BTUA 1VITF 5L6NH 1GMDG 1N1LA 3DA9B 2THFB 4LXBH 3TK6A 3MU5A 1TOCB 2GZ9A 4U2WA 1QRWA 1GHAF 1S84A 3KN2A 3ZVBA 5FCKA 5EW2H 1AE8H 1F0RA 4OS6A 1KXCA 3ZYDA 1GJ9B 1HGTH 1QQ4A 1W14U 3ZZ6A 8KME2 3MO3A 3TJVA 2VINA 1CT4E 1AVGH 1K1OA 1YKTA 2W3KA 2Z9IA 3AW0A 5E2PA 2XBYA 1G30B 1TBQH 2V35A 3BTGE 2ZDAH 3SJIA 2JETC 1HJ8A 3G01A 2ASUB 4OS7A 3B9FH 1C5TA 2FI5E 1ZGVA 1GJ4H 2BD9A 2BLVA 2WPJS 4X2VA 1FPHH 3RXUA 5GXPA 1OX1A 2A0QB 2A4OA 1C1SA 1S0QA 1QCPA 1Y5AT 1CA0C 4BAQB 1SGDE 1G2MA 3UNSA 1QRXA 1AFEH 2J94A 2CV3A 3A80A 2RDLA 2OC8A 1DPOA 2ZNKH 2ANWA 4Q7YA 1NFYA 1NRSH 3LONA 2F9BH 3TU7H 1Q3XA 3SHCH 1BJVA 1O31A 1OWIA 3SU6A 1KXBA 3MH5A 1W2KH 1C1WH 2Q1JA 1SGEE 1A46H 2WPIS 2VVCA 1FDPA 1VITG 1LPZB 1C2FA 1LO6A 1ZPBA 4ISNA 9ESTA 4HI3A 2W26A 2RA0A 4IGDA 2I6QA 2OC0A 3R0FA 4ZHMU 3LGTA 3UNQA 4X1QU 1CSOE 3GDUA 4X0WU 2QXIA 5A0BA 5EOKA 1UTPA 1WSSH 2VIWA 4CRGA 1KTSB 4UFEH 1TGCA 1PQ5A 1S85A 4TPYA 1CT0E 5C20A 2H6MA 1S0RA 5TJXA 4Y8ZA 3UTUH 1T32A 1A4WH 3F9FA 4OS5A 4X6OA 3BIUH 2F3CE 2Z9KA 1HAGE 3MNXA 1O3LA 1EAIA 1P04A 3KNXA 3RU4D 2G55A 3RXLA 4YT7H 1TNJA 2J2UA 2Y5FA 5LH8A 3SU5A 3QO6A 2HPQH 1EP5A 4BAOB 1EOJA 5EPYA 1XXFA 2R3UA 1HLTH 4CRCA 2EC9H 2ZTZA 1EUFA 1O3FA 1V2NT 2A2XH 3U69H 5JPMH 3EE0B 2SGDE 3C1KA 2ANKH 3ZVDA 3M7UA 3GCTG 1O2QA 1TGSZ 4DJZB 1YCPK 1Q2WA 1QJ7B 1GHYH 4CHAB 3BTME 1BMNH 3BTHE 2ALVA 3T5FH 1P9UA 2BVSH 5JBCS 2A31A 1SLWB 2TGDA 2NU0E 4H4FA 1JIRA 3UQVA 2IN2A 4AYVB 4K2YA 1Z1IA 3RLWH 2PHBA 3UREA 3RXKA 1ID5H 1RJXB 5T6DA 2Y82A 3SN8A 3DD2H 3M5NA 1UTLM 4ZKOU 3GY5A 2H9EH 2Z6BD 4QT8C 4X1RU 4BTIB 1BQYA 1P01A 4Q7ZA 1ZJKA 1WBGB 1AN1E 1L0ZA 2YOLA 3EA7A 2Y7XA 5IDKA 2FO9A 2FXRA 2B0FA 1JRTA 3ENSB 1Z8IB 2FOCA 1DXWA 1IQMA 1L1JA 1GI6A 9LPRA 3GCHC 1NT1A 4YM9A 3SORA 3ATWA 1FMGA 1VJAU 2C3SA 2TGTA 5A0CA 2CHAC 1HDTH 1HAPH 1NY22 4ZAEA 3GISB 1V3XA 1QIXB 1MUEB 2TIOA 1HAVA 4H42U 4JZEH 4DG4A 2HVXA 3S0NA 1G36A 3EYDA 4JYUH 2IPHA 3A7XA 1UVOA 5ABWA 1K1PA 1A5HA 1MTNC 2XC5A 5FCRA 3BV9B 3S7KB 4AFSA 2RCEA 1ELCA 2V0BA 4JYTA 3MH6A 5C67A 4I7YH 5DK1A 5F6MA 2B7DH 2XWAA 4K1EA 5EPNA 3PLPA 1GBBA 3D62A 3T27A 3VXEH 1D6WA 1B7XB 1OS8A 3E8LA 1UHBB 3P17H 2AIQA 2PGQB 4X8TH 2Z3CA 4NGAH 3RXBA 2XCNA 1SLXB 3VFEA 1QB6A 1LPGB 4ISOA 3FZDA 4FUJA 2VU8E 3FFGA 1C5VA 5PTPA 1O3NA 3RXFA 1AO5A 3ODDA 4FUIA 4BAKB 2ZWLH 1HFDA 3P8OA 3ZV8A 1P02A 1KLTA 1SI5H 1HXFH 4X1SU 2WPLS 4X6NA 1S81A 1TNIA 2ESTE 1ELVA 4U01A 3FP7E 1NRQH 1O33A 2VJ1A 3E0PB 4JMYA 2BZAA 4AFQA 1O2UA 2EI8A 2XBXA 1P2MA 1MKXK 2CF9H 1DT2A 2FODA 1ELFA 1NC6A 3LGVA 1PPZA 2ZG0H 2BB4A 1YC0A 4FUBA 1LHCH 4K8YA 1FZZA 1ZHPA 3F9HA 3MHWU 5C5OA 1P0SH 5EXLA 4TYDA 5ESTE 1FY8E 1O36A 4YLUA 3A85A 3RMMH 2BY9X 3FP8E 3LDXH 2EI6A 1AGJA 1HAHH 2NU1E 4BNRA 1BMMH 2O9QA 3AW1A 3M37A 1SR5C 2QXHA 1DWDH 2FOBA 3QGJA 1GJ6A 1MD7A 5JB9S 1MAYA 3MU8A 1Z71A 4Y71A 1BZXE 1QL8A 1UVPA 4FUDA 4FXGH 8ESTE 3SQHE 2ZU2A 1G3DA 1O2IA 4TPIZ 1SGYE 1SVPA 3P92A 4AG1A 3MTYA 1SGRE 4X2XA 2C90B 5T3HA 3VB6A 5HMAA 1QJ1B 2PUQH 3M7TA 2XC0A 4J1YA 3GY4A 5AF9H 1BMAA 1MCTA 3SUFA 1Z8GA 2BD8A 1OWHA 3Q00A 1EOLA 2GMTB 3BG4B 3LJOA 6GCHG 2Z3DA 3BTEE 2ZPRA 3VGCB 1LCYA 1XUGA 4BTTB 1O37A 4LOYH 2ZTYA 2TGAA 3UFAA 1VGCB 1BTHH 1Y3XA 3BEIB 3RXDA 3MO6A 2UUFB 4F49A 2A4RA 5E2OA 1ZLRA 1GGDC 1BHXB 1P2IA 1C2JA 1PFXC 2XWBI 1GI7B 2UUJB 1IQGA 1IQJA 1A2CH 4DT7B 1T4UH 2XW9A 2OQ5A 1S6HA 2OCVB 4M7GA 4ZXYH 1GL0E 3MNBA 1NN6A 3RXHA 2FLBH 2WV5A 3W94A 2ALPA 1W11U 1KIGH 2GT8A 2SNWA 4ABDA 1GI8B 2BVRH 1MBQA 1FUJA 1S6FA 3V13A 4HTCH 1ABIH 3W95A 1QHRB 5A8XA 2QY0B 1TBZH 2AGIX 3MOCA 1J15A 1SGFA 1J14A 2WUBA 4A6LA 4I8JA 1PPFE 1UK2A 1P2KA 2V6NA 2VIOA 2FOAA 3R3GB 5I46H 2F9UA 4D7GA 1EPTA 3V0XA 3PB1E 3TJUA 1H9HE 4CRAA 3TH3H 3UNRA 3E90B 1ANCA 3ZZ8A 1SHHB 3A8BA 3RC5A 3RXPA 4B71A 3QZQA 1N6YA 3OY5U 3P70B 1P03A 3QWCH 3SI3H 5DPAA 2V3HH 3UWJH 1EJMA 2ULLA 3ZZ3A 1LVMA 4ABIA 3L6PA 1B0FA 2ZHWH 4NZLA 2BXTH 3TH2H 2ZFSA 4YESB 3RXIA 1HJAC 2XYAA 1L1NA 1O2HA 2DE8A 3E3TA 1GVKB 3VEQB 2AYWA 1GJ5H 2BY7X 1P2OA 4Y10E 1HB0B 1NU9A 1PYTC 1FV9A 2XNIA 3JZ2B 3MI4A 4CRDA 4DOQA 3NK8A 3A83A 2BLOA 1O2ZA 3OX7U 4UDWH 1YPKH 1TX6A 3SU0A 5T6GA 2ZZUH 1O2OA 1MTWA 1PJPA 4ZUHA 4CR5A 1T7CA 5DJ7A 3GDSA 2ZCHP 3SNBA 1X7AC 3Q3KA 2FYQA 3MU0A 4GCHF 4ISLA 4A7IB 4H6SB 1FPCH 2FIRH 5A0AE 1BUIA 1C5XB 1LVYA 1MD8A 3SJ8A 5FAHA 1CGIE 3QTOH 4ZHLU 1DICA 2R2MB 4XBCA 3GY6A 4ZROA 1DOJA 1GMCF 7KMEH 4NZQA 2ODYB 1GHBF 1ZPZA 2O8UA 4Z6AH 2WYGA 1F5RA 4HFPB 3L3TA 2H2ZA 4RKJB 4JZ1A 4GAWA 1C5OH 2ANMH 4Y79A 3RC4A 1KTTB 1SC8U 5DP3A 2F9PA 5CHAB 2VNTA 1FY1A 3RXOA 1F0TA 1BIOA 1XUIA 2PSXA 2Y7ZA 2SNVA 2A5AA 1AHTH 3QDZB 5HM9A 4Q7XA 1NFXA 1TQ0B 1PQAA 4NA7A 1DLEA 2A4QA 3JZ1B 1IAUA 1Y8TA 3DUXH 3D65E 4YOIA 1HAXB 1HBTH 1DWEH 4B75A 7LPRA 1H9IE 2Z9JA 3S9AA 4B76A 1ABJH 1H4WA 4AZ2B 3RMLH 2ZQ1A 1ZHRA 4K1TA 4Y7BA 2A7JA 3MH7A 4NIWA 1JIMA 2O8LA 1UTKA 1VZQH 5F8XA 1LQEA 1RTLA 1CE5A 3K6YA 1AUTC 3LC5A 2ZA5A 2SGAA 1SGCA 3V12A 3RP2A 2AFQB 4NFFA 4BXSA 1W8BH 3ATMA 2Q6DA 2LNCA 2BM2A 3UIRA 3ZZ7A 2Z9LA 2FM2A 4NIXA 5DP8A 1ZRBA 5HYOA 1JRSA 2BD2A 2HNTC 1TFXA 5DG6A 2ZCKP 2GV6A 1C9PA 1ESTA 5ESBA 4CH2B 3MNCA 4OGXA 1PPBH 1V2LT 1V2MT 1IHSH 1HIAA 4FU8A 1ANDA 4YTAA 1EAWA 1OP2A 2AIPA 1ORFA 2GD4B 1AU8A 4OS2A 1CVWH 1AUJA 3GY2A 1T8MA 4O03A 1BA8B 3SGAE 1THSH 5J4QA 3LGYA 2VWLA 2QC2A 1C1MA 1XUFA 3KHVA 1N6XA 4YOGA 1EAUA 1SGFG 2VWMA 1EAXA 2ZHDA 1NROH 2O8WA 5EQQA 3UR9A 4AB8A 1QTFA 1KDQB 1O2LA 1QBVH 5FPYA 3PO1B 1GDQA 2VVVA 1SGIB 3ZZ9A 2A2QH 1VCQA 5J4SA 4JZIA 3OY6U 2J4IA 1DY9A 3SNAA 1KXEA 3EA9A 2GTBA 2I6SA 3SU3A 3SUDA 1ELDE 3QTVH 3ZVGA 4BANB 1KXFA 1MU6B 3LPRA 4CBNA 3DFLA 1SG8B 3SO3A 2STBE 4DVAU 1C2LA 1IHTH 4LK4A 2PKAB 3D23A 4K1SA 1GI4A 1V6DA 4JCNA 3KQDA 2ODQA 1E0FD 5BPEA 3ZYEA 2BDGA 4KKDA 4WXVA 3T2NA 3QN7A 1XUKA 1GI3A 1Y5UT 4O9VA 4ZMAH 2WUCA 5EQSA 1O2RA 1ZTJA 1SOZA 4ABJA 1BBRK 4ESTE 1GPZA 1GBAA 1Y59T 5GCHG 3GYLB 3OU0A 4CHAC 5HM2A 4GLYA 1Y5BT 1Z6JH 1DITH 4CREA 1YPHE 2A7HA 2XC4A 3ATLA 1RTKA 3RXMA 4Q2KA 1CGHA 2KAIB 3GCNA 2ZHEH 4DGJA 3TLOA 5DO4H 1ESAA 3GCTF 1TGNA 2ZHQH 3SV6A 4O3UA 2NU3E 1BRUP 1GBLA 1L1GA 2IJOB 1A0HB 1O5FH 2ZF0H 2G5NA 1QNJA 2BD5A 2VIDA 1QY6A 3RXTA 1W12U 2EA3A 4DY7B 3RM2H 3F9GA 3KF2A 1C4Y2 3P8NA 3IWMA 3ZZ5A 2PSYA 3UPEA 3RXJA 4IC6A 1IQLA 1A3EH 2FP7B 2HOBA 2P94A 2QA9E 1PPEE 4JK5A 2FWWA 2V3OH 3V3MA 1SGNE 2AS9A 1V2OT 3FZZA 4UD9H 1MTVA 5K0HA 3N7OA 1W0YH 4NWLA 1ZPCA 4A1TA 1GCDA 3LT3A 3NCLA 1GBJA 3RM0H 5AVDA 3LOXA 4OGYA 2VB0A 4ZKRU 1PQ8A 1KSNA 1EZUC 2ZC9H 1DWCH 1HUTH 2UWOA 2A5IA 1MKWK 3VB3A 1EJAA 1PYTD 1V2WT 5L2YH 4A1VA 4D9QA 4ZH8A 3RLYH 1BBRE 1ELAA 1N8OC 1TNGA 2ZO3H 2SGQE 2WPHS 1C5NH 2QN5T 3RUOA 2FOEA 5B6OA 1KLIH 5ETXA 1FY4A 4YLQH 1O2SA 4E7RG 3VB5A 3GOVB 2WPKS 1AFQB 1Y3YA 5FPTA 1C5QA 4Y11E 1AD8H 2GVFA 1OPHB 1QBOA 1AZ8A 5C5NA 1CQQA 1K1IA 2C8XB 3A7VA 3PM3A 4ISHH 1UCYH 2ZGBH 1YM0A 2FI4E 1O2WA 1DY8A 4NA9H 4NIYA 4CR9A 1XXDA 3GCOA 3STJA 1RD3B 1LHGH 1KXDA 3PMAB 3PLBA 1GJBB 3ATKA 1K28D 2GDDA 3RMOH 3RU4E 1Z8RA 1C2IA 3A88A 2FDAA 3NUMA 4Y0YE 4GSOA 1TPSA 1QFKH 1O5CB 1DSTA 1AMHA 1A3BH 1HAVB 1OSSA 5I25A 2BYAX 1ZSKA 1J16A 1SSXA 2CJIA 1HRTH 3TH4H 3A84A 3I77A 3MWIU 2FTLE 3HPTB 4UFGH 3ZVEA 2WPMS 2G51A 4IMQA 2D8WA 2PW8H 1NRRH 3TIUA 1F5LA 2AMQA 2J38A 2AERH 3P8FA 3UOUA 2OQUA 2GP9B 4ZKNU 3K2UA 1C1TA 3EGKH 3PYHA 3BN9A 5DP7A 2AEIH 1LVOA 1TIOA 2SGPE 2VWOA 1BBRH 1YLDA 3A8DA 4Y0ZE 5AFZH 5JDUB 2H5DA 3MO9A 1NTPA 5DP6A 4NSVA 4BAMB 1O3MA 2OUAA 2O8MA 2P3TB 1HAIH 3Q76A 1GBIA 4NSYA 2HLCA 1LMWB 1YYY1 3PMHB 4ABFA 1V2VT 2F9VA 1W13U 1N8OB 2GMTC 3BG4C 4B1TA 1CBWB 4I8HA 3VGCC 2XTTB 2VWNA 1THRH 3SJ9A 4X1NU 4ABGA 5C1UA 1VGCC 1DWBH 1P2JA 3HGNA 2A1DB 2OC7A 1FY3A 1XUJA 1HXEH 4NG9H 1ZZZA 4JZDH 5DGJA 1ZHMA 3MNSA 2G4TA 2ZFQH 5HXFA 1TNLA 6GCHF 1OOKB 4LZ1H 1GHXH 1G3CA 4YZUA 3GY8A 2VH6A 2HALA 5C1YA 2HNTE 4XFQA 4TWYA 5TCAA 2PGBB 2OLGA 1NM6A 2R0LA 1NESE 2Y5GA 5EXNA 3A81A 1C5LH 5JB8S 1O3HA 1LHFH 1BB0B 2G5VA 1C2HA 1K1JA 1SL3A 3K6ZA 1C2GA 1K1LA 1EZXC 1U6QA 1TALA 1WTGH 2BMGB 3BTDE 4I33A 2STAE 1ARCA 2K1QA 5DP5A 4WF8A 1QGFA 2EI7A 1WCZA 3BEUA 1MKWH 1C1RA 2BQ6B 2FPZA 1OWEA 1T8LA 1K1MA 1YPGH 1XVOA 1SQOA 2AH4X 1DX5M 1O34A 1FLEE 2BD4A 2FZZA 1WQSA 3UOPA 4LZ4B 1IOEA 2SFAA 2FMJA 3PTBA 2PWXA 3Q3YA 1H1BA 1LKAA 4UFDH 1C5PA 2OXSA 1RRKA 1O3BA 2PKSC 1DSUA 2J34A 2M5TA 3E0NB 4D76A 1JMOH 2TBSA 1GCTC 2P8OB 1C5WB 1DFPA 2GT7A 1SQAA 1MH0A 4D9RA 4MTBA 1YPEH 1NRNH 3UY9A 1C2DA 1Z7KA 4AB9A 1EXFA 2F83A 4MPVA 3BTQE 1MAXA 1J8AA 4JZFH 3URCA 1UTQA 3F9EA 1E36B 1GBHA 1NPMA 2GZ7A 1TMTH 4A1XA 3Q3XA 1ACBE 4WH8A 5A8ZA 1W3CA 4GPGA 3LC3A 4I32A 1HAOH 2HWLB 2PLXA 2H5CA 4FUCA 4E05H 1RXPA 2XBWA 2AMDA 4WMDA 1C1OA 3TPIZ 5GIBA 2JH5D 2Z3EA 4MPWA 4B2AA 4RN6A 3SI4H 1EPTB 1BJUA 3RXAA 2AGEX 2A45B 2CMYA 3ZVAA 2P95A 2BY6X 1P2NA 1HJ9A 3DHKH 4O3TA 1FN6A 3LU9B 1HPGA 5CHAC 3C27B 3SV7A 3T25A 4E06H 3SOSA 4U32A 3NWUA 1GMHG 5DP4A 1A61H 1UJ1A 5T6FA 3RXRA 3AAUA 3M5MA 2PTNA 1TX8A 5FBEA 2B5TB 3LGIA 1EKBB 1WV7H 4CBOA 1FXYA 2GDEH 4JYVH 4F4OC 3SW2B 2BVXH 1SGPE 4Z0KA 1TABE 5CE1A 2ZGHA 1MU8B 3SNDA 1Y3UA 1A5GH 3F6UH 1O5EH 2Z7FE 2P3UB 3B8JA 1BTWA 1ZMJA 1ANBA 1YPLH 5C3NA 2PKSB 1D3DB 1GG6C 1O2GH 1O2JA 1GBTA 2ZP0H 2ZPQA 4IS5A 4MNYA 3TK9A 4SGBE 1GCTB 3SGBE 3H7TA 4FVDA 4I8KA 4RKOB 2WYJA 4FUEA 2CF8H 1P12E 2ZDMA 1V2KT 2A7CA 3A8CA 5FBIA 3WY8A 1H9LB 3NZIA 5L2ZH 1DXPA 3SBKA 3KCGH 3M3VA 1YPMH 6LPRA 4K60A 2FS8A 1WYKA 1FI8A 3OYPA 2BDIA 3MU4A 1C1UH 1GBFA 1MZAA 2P16A 4THNH 2ZIQH 5EQRA 1DE7H 1TPAE 2GZ8A 4U30A 1P57B 1TNKA 3TNTA 3ZZDA 1F7ZA 3QZRA 3QLPH 2PR3A 1BT7A 4IMZA 1O2KA 1O5AB 3VB7A 1FQ3A 2DE9A 1BCUH 2ZGCA 2W7UA 1C5UA 5IYTA 1W0ZU 1WU1A 1L4DA 3VB4A 3MMGA 8GCHF 1SFQB 2D1JA 5F03A 3PO1C 2ZFRH 2ZU5A 3BTKE 3EAJA 1P11E 4PROA 1TGTA 1TMUH 1EQ9A 1T8OA 2BZ6H 3T26A 1V2TT 3LH1A 4WXIA 1TQ7B 1YF4A 2R3YA 3RDZA 1XKBC 1TOMH 1C5RA 4IC5A 1KYNA 4XOJA 1XKAC 5K7RA 1FN8A 1AB9B 2JKHA 1UVUH 1Z8JB 1G32B 1WTHD 1JOUB 1ELEE 2IOTA 2FX4A 4IN1A 1AQ7A 1P9SA 2ODPA 1D3PB 4IBLH 3NPSA 1DANH 4K69A 2XXLA 3UR6A 5C1XA 1MQ5A 1TE0A 5FHTA 4VGCB 1DLKB 3BEFB 1CHOF 1FNIA 1K21H 1KXAA 4A92A 3PROA 5GJ4B 4D7FA 1GG6B 2WINI 3E16B 2PTCE 1K9OE 3LGUA 2GCHF 3E1XB 1GBMA 1O3PB 4DIIH 1TRYA 1ANEA 1T8NA 3A7WA 1BRCE 1P06A 3STIA 1CGJE 1FIWA 1NO9H 3RMNH 3SUGA 2QYIA 4FU7A 3NKKA 3S7HB 5GCHF 4DCDA 1Z1JA 2O8TA 1GI5A 4H6TA 1UVTH 4INHA 1JXPA 4AYYB 1WAYB 1C1PA 3T29A 1V2QT 3SJOA 1QURH 2BOKA 8GCHG 3M5OA 1EZQA 2ZFFH 3AAVA 2SGFE 2VIPA 3Q77A 1YLCA 4GUXA 4XE4A 3O8DA 1AKSB 4MQAA 3BIVH 1QJ6B 1UCYK 1FONA 1AY6H 3ESTA 5L30H 1RIWB 1Y3WA 4AFZA 2NWNA 4K3JA 4UE7H 1SHYA 5H4IB 1FIZA 4BAHB 1ZMNA 2QV1A 1E34B 1QR3E 2ZU3A 1BRBE 2Z94A 4AGKA 2AGGX 1JBUH 2FS9A 2DUCA 4MNVA 5CMXH 5FXLA 1K2I1 1A0LA 1EJNA 1UK3A 1UTMA 3U8TH 1GWAA 1HAZB 1OWJA 2CXVA 4K8BA 4IN2A 1VCWA 2FTMA 3A86A 3E91A 3M61U 4YT6H 3TGIE 4Y8XA 3TJOA 1SLVB 1ARBA 1CHOG 2Y80A 1MTSA 2ZDNA 1VJ9U 1H8DH 4TY6A 1BDAA 2ZDVH 3BG8A 1ZRKA 2JH6D 3SJKA 1UTOA 4MPUA 1QB1A 1NRPH 2ZCLP 1UO6A 3M3TA 3HKJB 1OWDA 3RXCA 1OXGA 2GCHG 1CHGA 5F8TA 1O3KA 4Y8YA 1C9TA 1AWFH 1B5GH 1OKXA 5JBAS 1AFQC 1QL7A 1O35A 4E7NA 1J17T 7ESTE 1KDQA 1F2SE 1O0DH 1LKBA 3U1IB 3RXQA
chains in the Genus database with same CATH superfamily
1FJSA 3A8AA 1Q31A 1P8VC 2R9PA 3ODFA 1SBWA 2VIVA 5A8YA 2GX4A 1P3EA 1OYQA 1E38B 1AE5A 1GBKA 2F43B 4XBBA 1ZSLA 1LPKB 4X8SH 1TLDA 3DSPA 8LPRA 4RI0A 1UCYE 5A2MH 4D8NA 3S69A 1GI1A 1GHWH 1HV7A 3O8CA 1WQVH 4FU9A 2D2DA 1O3GA 2BDCA 3LIWA 2OTVA 2PKAA 4KP0A 1UTNA 4YOJA 4CRFA 2QF3A 1O2PA 2FEQH 1A7SA 5GDSH 3KQBA 2YNBA 4CH8B 2A5KA 1G3BA 1HCGA 6ESTA 2VGCB 1GDNA 4NCYA 1D6RA 1EP6A 2QIQA 4AORA 1GJDB 1AWHB 4Y7AA 2F91A 3M7QA 3NXPA 1GHVH 4NA8A 4UFFH 2GKVE 3TNSA 4I8LA 2KAIA 2PUXB 1C5YB 3MU1A 3U8OH 3I29A 3GYMA 4O97A 1SGTA 1G2LA 2FI3E 3HKIB 2GCTB 2Z9GA 4ACBA 2P3FH 1QL9A 1FY5A 3A7ZA 5E0HA 2EEKA 3ZZBA 1EATA 1GHAG 3T28A 4B2BA 2A32A 2BD7A 3SZNA 1BITA 2XCFA 3I78A 1O2TA 1CBWC 1AZZA 3ZVFA 1O3DA 3PRDA 3U98H 2FYRA 2Y6TA 1LTOA 1P10A 4A5TS 1SB1H 4FUGA 1C5SA 2FOMB 3URDA 4B73A 3VPKA 1ETSH 2AMPA 4AFUA 1T4VH 1ZJDA 3A89A 2Y81A 1OYTH 2OBQA 2TRMA 2KCYA 2G00A 2G52A 4RSPA 1UTJA 1D3QB 1SPJA 3KL6A 3AVZA 4X6MA 2H9TH 1XVMA 4WVPE 3GY3A 2BDAA 4GVUA 4J2YB 4CRBA 2W7SA 1E35B 2QE7D 1VITH 3V7TA 3PMBB 4INLA 1J9CH 1O3IA 1O5BB 2FOGA 2ILNA 1CT2E 5DKMA 1A5IA 1EB2A 4B2CA 2JETB 3FN8A 3F2HA 3UAIC 5JBBS 4R0IA 3EA8A 1P05A 2BQWB 2KR7A 1O3CA 1GJAB 1IQKA 1XMNB 2GV7A 1P3CA 3MH4A 2BHGA 3OSYA 4K5ZA 4Q63A 2J95A 1AVWA 4TY7A 1SOTA 1GI9B 2QAAA 4B74A 1CA0B 3SQEE 3IG6B 3U9AH 1IQIA 5IK2D 2UWLA 1UVSH 2LPRA 4AG2A 1KLJH 1L4ZA 7GCHF 1E1QD 4TT3D 2UWPA 3KQCA 1WOFA 1AVXA 1S82A 3LKWA 1EB1H 1K22H 1O38A 2VH0A 1LVBA 3O8RA 2HNTF 4DW2U 3ZZAA 3K65B 1O2NA 4X8VH 1GBDA 1QBNA 2BLQA 1RS0A 1VKYA 2G81E 3BTTE 3BF6H 4KELA 2P8OC 1ETRH 3DCLA 4BXWA 1EASA 2UUYA 1INCA 2ZU4A 5A09A 1XX9A 1PPGE 1O3EA 1BTPA 2OC1A 2IPQX 4SGAE 3KQEA 2ZQ2A 3AK5A 1E37B 2NU2E 2PV9B 1CU1A 2VIQA 1SMFE 1LHEH 3OFND 1BOQA 2C8ZB 3F1SB 1MZDA 4HZHA 4Y76A 3TJNA 3AASA 4ZKSU 1HNEE 3SUEA 1ETTH 1WUNH 3FKSD 1V2UT 2FESH 4ABAA 3P8GA 4XD7D 5B6LA 2OD3B 1KY9A 2KZ4A 2ZGXH 1QRZA 4GHQA 3SV9A 1QZ8A 1TPPA 1TB6H 1VR1H 2D26C 2HGTH 3L33A 1G3EA 4ABHA 1QB9A 2A4GA 2XRCA 1EPTC 1MBMA 3LJJA 4INKA 3QGNB 2QF0A 1UHBA 1Y3VA 1CO7E 1ZSJA 4MNWA 2LP6A 4BOHA 2RA3A 3SNEA 7GCHG 1F0UA 1ELTA 5LPRA 4I8GA 5GPIB 2XBVA 4JK6A 3RU4T 1GDUA 1GJ7B 4ABBA 3KIDU 6CHAC 1THPB 4GHTA 4OS1A 4NWKA 5DP9A 1TMBH 2TGPZ 4ASHA 4WMEA 1GMHF 3A7YA 1OP0A 4KGAA 5BRRE 1O3AA 2ZFTA 1O2VA 3CS7A 1SFIA 3GCHB 1BTZA 2CN0H 4KTUA 1TX7A 3N99A 2CGAA 2GJGA 3BSQA 1BTYA 1KMHB 1A0JA 1O5DH 2CHAB 1GBCA 2ZECA 1P09A 2J92A 1D4PB 1M9UA 1MMJN 2P59A 2Q6FA 5FPSA 3GDVA 1C1VH 1F0SA 1ELBA 2QCYA 2ZPSA 3D49H 4MNXA 5GNDA 4FUFA 3VG8A 2V7QD 1TNHA 5FX6A 5LPFA 1MTNB 5C2ZA 1D9IA 4DT4A 1YCPH 4ABEA 3RXGA 2QGRA 5EODA 3M3SA 2B9LA 1BTXA 4WJG2 3CS0A 5GWZA 4AN7A 1GL1A 3PMJA 5JYIA 1A1RA 3HK3B 1QA0A 2ZI2H 2YMSC 1YPHC 1UMAH 1SGQE 1ZYOA 3GICB 4FVBA 4NFEA 4BTUB 1IQFA 5EU8A 3SU1A 3QUMP 2W3IA 1C2KA 1P2QA 1WXRA 2H1UA 2BXUH 4YO9A 2OP9A 2NU4E 3LH3A 1H8IH 1O2YA 1W7XH 4AOQA 1L2EA 1BMLA 1MTUA 4MDSA 3ELAH 1G37A 1TA2A 1O3OA 3UWIA 1GI2A 1O2MA 3KEEA 1NFUA 2FOHA 1K1NA 5E0GA 1D3TB 5TCCA 1TRNA 1E79D 4ISIH 1YPJH 1XUHA 4X2YA 1G9IE 1PPCE 1O5GH 1COWD 2RG3A 1C4V2 1RGQA 3OAAD 3A7TA 1ZMLA 2WZQA 4I31A 3FVFB 1TRMA 1JWTA 6CHAB 2ZEBA 1HYLA 5LGOA 4ZHAA 3P6ZB 3CENA 2J5UA 2KCAA 1C2EA 3BTFE 1T31A 1AB9C 2H9HA 1DUEA 3E6PH 4MG3A 4ZXXH 3LGWA 1CA8B 1GI0A 1YP9A 2J9NA 1GVLA 1YGCH 2HRVA 2PFEA 4VGCC 1W10U 1IQNA 1BRAA 1TPOA 1GVZA 3SHAH 2P93A 2OINA 2QXGA 1TGBA 3M36A 4DIHH 1DS2E 4UONA 3UB0A 4MVNA 2PP6A 3SYJA 4WH6A 4XBDA 1DUAA 4WMFA 2Y5HA 1RTFB 2HVYB 1FX0B 3VXFH 1Z6EA 5KGOA 3PWBA 4MLFB 3O8BA 3ZVCA 3RXSA 5SGAE 2Q6GA 5EXMA 3OTJE 2W5EA 2BX3A 4AGJA 1C1NA 1C1QA 4WWYA 2ZU1A 2F9NA 1DDJA 1C5ZB 1ZGIA 4NIVA 3CP7A 2YNAA 2BDHA 4WY3A 1MKXH 3U1JB 1ELGA 3ITIA 1GBEA 2TPIZ 3RXVA 1TA6A 2G8TA 1MCVA 1RIWC 5KEDA 1ZOMA 1RFNA 1YCPM 4RT0A 3RXEA 5EW1H 4KTCA 2QXJA 1W7GH 1GGDB 3ZZCA 5E0JA 3T62A 3U8RH 3KQ5A 3EDXB 5EG4A 2FLRH 2XOKD 2OBOA 4DURA 2R0KA 3FANA 4HGCA 3MYWA 3HATH 2WPDD 4Y6DA 1AI8H 3HK6B 4UEHH 4XDEA 2C93B 3DFJA 2ZDLA 5E8EH 2ZHFH 1SQTA 1F5KU 2C8YB 5AHGH 1FAXA 3KGPA 5FX5A 1ZTLA 1C5MD 1ESBA 1BHXF 3BTWE 3ZIAD 2HPPH 3TITA 2B8OH 1NS3A 1QQUA 2FOFA 4XSKU 3PTNA 2G4UA 1IQEA 3ZV9A 1AIXH 3SGQE 5LPEA 1FAKH 4X8UH 4Q80A 3TGJE 1DM4B 1VCPA 2ZKSA 5HGGA 2J98B 1TYNA 2ZFPH 3U28C 1PQ7A 1C2MA 1HIAB 2BY8X 1EX3A 3TK5A 1MABB 3PWCA 2C4FH 3S9BA 1OP8A 2BDBA 1S5SA 1GMDF 2WV4A 3RC6A 1YWUA 3IITA 5F8ZA 4X1PU 1O32A 1QA7A 5EGMA 2BLWA 3P95A 1LQDB 5AFYH 1LDTT 3FP6E 4TWWA 3B23B 1TBRH 1NFWA 2BTCE 2VVUA 4R8TB 5JBTA 3HGPA 2BOHB 1V2RT 4KTSA 2BQ7B 3FAOA 1O2XA 3PV4A 3SV2H 2BD3A 1B0EA 1HJAB 1V2JT 3QX5H 4OS4A 3A87A 2SGEE 3MFJA 4IW4E 3F0PA 3SV8A 3F2GA 2ZDKA 4TSFD 1F92A 3A82A 1SLUB 4GCHG 1NU7B 1PPHE 2BX4A 1TAWA 1ZTKA 3H5CB 3QK1A 1UK4A 2VGCC 1YBWA 1EZSC 1V2PT 1O30A 3PLKA 1GMCG 3UQOA 4X6PA 2JH0D 2R2WU 5G4BA 3H7OA 1GHBG 3TVJB 1C4U2 3ZZ4A 2BY5X 2UUKB 2C8WB 1NZQH 2GGVB 3M35A 3SU4A 2FX6A 3K9XB 4AX9H 3ATIA 1GHZA 3DT0H 2ANYA 2F9OA 2ZTXA 1TONA 1GJ8B 1TWXB 2GCTC 2ZGJA 1GJCB 3S9CA 4MPXA 4X2WA 1O3JA 3SNCA 2BDYA 3UUZA 3F68H 3M5LA 3GY7A 5EJLA 1ZR0A 3SU2A 2L74A 1DVAH 1LHDH 1O39A 3TGKE 1AKSA 1MQ6A 1HAYB 1OWKA 1S83A 1V2ST 1IQHA 3EQ0H 4FUHA 4F48B 1XM1A 1BTUA 1VITF 5L6NH 1GMDG 3PRBA 2YMSD 1N1LA 3DA9B 2THFB 4LXBH 3TK6A 1W0KD 3MU5A 1TOCB 2GZ9A 1H8HD 1QRWA 4U2WA 1GHAF 1S84A 3KN2A 3ZVBA 5FCKA 5EW2H 1AE8H 1F0RA 4OS6A 1KXCA 3ZYDA 1GJ9B 1HGTH 1QQ4A 1W14U 3ZZ6A 8KME2 3MO3A 3TJVA 2VINA 1CT4E 1AVGH 1K1OA 1YKTA 2W3KA 2Z9IA 3AW0A 5E2PA 2XBYA 1G30B 1TBQH 2V35A 3BTGE 2ZDAH 3SJIA 2JETC 1HJ8A 3G01A 2ASUB 4OS7A 3B9FH 1C5TA 2FI5E 1ZGVA 1GJ4H 2BD9A 2BLVA 2WPJS 4X2VA 1FPHH 3RXUA 5GXPA 1OX1A 2A0QB 2A4OA 1C1SA 1S0QA 1QCPA 1Y5AT 1CA0C 4BAQB 1SGDE 1G2MA 3UNSA 1QRXA 1AFEH 2J94A 2CV3A 3A80A 2RDLA 2OC8A 1DPOA 2ZNKH 2ANWA 4Q7YA 1NFYA 1NRSH 3LONA 2F9BH 3TU7H 1Q3XA 3SHCH 1BJVA 1O31A 1OWIA 3SU6A 1KXBA 3MH5A 1W2KH 1C1WH 2Q1JA 1SGEE 1A46H 2WPIS 2VVCA 1FDPA 5HIYA 1VITG 1LPZB 1C2FA 1LO6A 1ZPBA 4ISNA 9ESTA 4HI3A 2W26A 2RA0A 4IGDA 2I6QA 2OC0A 3R0FA 4ZHMU 3LGTA 3UNQA 4X1QU 1CSOE 3GDUA 4X0WU 2QXIA 5A0BA 5EOKA 1UTPA 1WSSH 2VIWA 2WSSD 4CRGA 1KTSB 4UFEH 1TGCA 1PQ5A 1S85A 4TPYA 1CT0E 5C20A 2H6MA 1S0RA 5TJXA 4Y8ZA 3UTUH 1S6LA 1T32A 1A4WH 3F9FA 4OS5A 4X6OA 3BIUH 2F3CE 2Z9KA 1HAGE 3MNXA 1O3LA 1EAIA 1P04A 3KNXA 3RU4D 2G55A 3RXLA 2KCOA 4YT7H 1TNJA 2J2UA 2Y5FA 5LH8A 3SU5A 3QO6A 2HPQH 1EP5A 4BAOB 1EOJA 5EPYA 1XXFA 2R3UA 1HLTH 4CRCA 2EC9H 2ZTZA 1EUFA 1O3FA 1V2NT 2A2XH 3U69H 5C0UA 5JPMH 3EE0B 2SGDE 3C1KA 2ANKH 3ZVDA 3M7UA 3GCTG 1O2QA 1TGSZ 4DJZB 1YCPK 1Q2WA 3FOAA 1QJ7B 1GHYH 1UW7A 4CHAB 3BTME 1BMNH 3BTHE 2ALVA 3T5FH 1P9UA 2BVSH 5JBCS 2A31A 1SLWB 2TGDA 2NU0E 4H4FA 1JIRA 3UQVA 2IN2A 4AYVB 4K2YA 1Z1IA 3RLWH 2PHBA 3UREA 3RXKA 1ID5H 2VBCA 1RJXB 5T6DA 2Y82A 3SN8A 3DD2H 3M5NA 1UTLM 4ZKOU 3GY5A 2H9EH 2Z6BD 4QT8C 4X1RU 4BTIB 1BQYA 1P01A 4Q7ZA 1ZJKA 1WBGB 3OTPA 1AN1E 1L0ZA 2YOLA 3EA7A 2Y7XA 5IDKA 2FO9A 2FXRA 2B0FA 1JRTA 3ENSB 1Z8IB 2FOCA 2JDID 1DXWA 1IQMA 1BMFD 1L1JA 1GI6A 9LPRA 3GCHC 1NT1A 4YM9A 3SORA 5HKKD 3ATWA 1FMGA 1VJAU 4P02A 2C3SA 2TGTA 5A0CA 2CHAC 1HDTH 1HAPH 1NY22 4ZAEA 3GISB 1V3XA 5FL7D 1QIXB 1MUEB 2TIOA 1HAVA 4H42U 4JZEH 4DG4A 2HVXA 3S0NA 1G36A 3EYDA 4JYUH 2IPHA 3A7XA 1UVOA 5ABWA 1K1PA 1A5HA 1MTNC 2XC5A 5FCRA 3BV9B 3S7KB 4AFSA 2RCEA 1ELCA 2V0BA 4JYTA 3MH6A 5C67A 4I7YH 5DK1A 5F6MA 2B7DH 2XWAA 4K1EA 5EPNA 3PLPA 1GBBA 3D62A 2EY4C 3T27A 3VXEH 1D6WA 1B7XB 1OS8A 3E8LA 1UHBB 3P17H 2AIQA 2PGQB 4X8TH 2Z3CA 4NGAH 3RXBA 2XCNA 1SLXB 3VFEA 1QB6A 1LPGB 4ISOA 3FZDA 4FUJA 2VU8E 3FFGA 1C5VA 5PTPA 1O3NA 3RXFA 1AO5A 3ODDA 4FUIA 4BAKB 5DSFA 2ZWLH 1HFDA 3P8OA 3ZV8A 1P02A 1KLTA 1SI5H 1HXFH 4X1SU 2WPLS 4X6NA 1S81A 1TNIA 2ESTE 1ELVA 4U01A 3FP7E 1NRQH 1OHHD 1O33A 2VJ1A 3E0PB 3CNRA 4JMYA 2BZAA 4AFQA 1O2UA 2EI8A 4FETA 4XRNA 2XBXA 1P2MA 1MKXK 2CF9H 1DT2A 2FODA 1ELFA 1NC6A 3LGVA 1PPZA 2ZG0H 2BB4A 1YC0A 4FUBA 1LHCH 4K8YA 1FZZA 1ZHPA 3F9HA 3MHWU 5C5OA 1P0SH 5EXLA 4TYDA 5ESTE 1FY8E 1O36A 4YLUA 3A85A 3RMMH 2BY9X 3FP8E 3LDXH 2EI6A 1AGJA 1HAHH 2NU1E 4BNRA 1BMMH 2O9QA 3AW1A 3M37A 3PV5A 1SR5C 2QXHA 1W0JD 1DWDH 2FOBA 3QGJA 1GJ6A 1MD7A 5JB9S 1MAYA 3MU8A 4ACAA 1Z71A 4Y71A 1BZXE 1QL8A 1UVPA 4FUDA 4FXGH 8ESTE 3SQHE 4Z1MD 2ZU2A 1G3DA 1O2IA 4TPIZ 3N7DA 1SGYE 1SVPA 3P92A 4AG1A 2V3MA 3MTYA 1SGRE 4X2XA 4F55A 2C90B 5T3HA 3VB6A 5HMAA 1QJ1B 2PUQH 3M7TA 2XC0A 4J1YA 3GY4A 5AF9H 1BMAA 1MCTA 3SUFA 1Z8GA 2BD8A 1OWHA 3Q00A 1EOLA 2GMTB 3BG4B 3LJOA 2M2AA 6GCHG 2Z3DA 3BTEE 2ZPRA 3VGCB 1LCYA 1XUGA 4BTTB 1O37A 4LOYH 2ZTYA 2TGAA 3UFAA 1VGCB 3F3BA 1BTHH 1Y3XA 3BEIB 3RXDA 3MO6A 2UUFB 4F49A 2A4RA 5E2OA 1ZLRA 1GGDC 1BHXB 1P2IA 1C2JA 1PFXC 2JIZD 2XWBI 1GI7B 2UUJB 1IQGA 1IQJA 1A2CH 4DT7B 1T4UH 2XW9A 2OQ5A 3N7EA 1S6HA 2OCVB 4M7GA 4ZXYH 1GL0E 3MNBA 1NN6A 3RXHA 2FLBH 2WV5A 3W94A 2ALPA 1W11U 1KIGH 2GT8A 2SNWA 4ABDA 1GI8B 2BVRH 1MBQA 1FUJA 1S6FA 3V13A 4HTCH 1ABIH 3W95A 1QHRB 5A8XA 3DSOA 2QY0B 1TBZH 2AGIX 3MOCA 1J15A 1SGFA 1J14A 2WUBA 4A6LA 4I8JA 1PPFE 1UK2A 1P2KA 2V6NA 2VIOA 2FOAA 3R3GB 5I46H 2F9UA 4D7GA 1EPTA 3V0XA 3PB1E 3TJUA 1H9HE 4CRAA 3TH3H 3UNRA 3E90B 1ANCA 3ZZ8A 1SHHB 3A8BA 2KCPA 3RC5A 2HLDD 3RXPA 4B71A 3QZQA 1N6YA 3OY5U 3P70B 1P03A 3QWCH 3SI3H 5DPAA 2V3HH 3UWJH 1EJMA 2ULLA 3ZZ3A 1LVMA 4ABIA 3L6PA 1B0FA 2ZHWH 4NZLA 2BXTH 3TH2H 2ZFSA 4YESB 3RXIA 1HJAC 2XYAA 1L1NA 1O2HA 1YLNA 2DE8A 3E3TA 1GVKB 3VEQB 2AYWA 1GJ5H 2BY7X 1P2OA 4Y10E 1HB0B 1NU9A 1PYTC 1FV9A 2XNIA 3JZ2B 3MI4A 4CRDA 4DOQA 3NK8A 3A83A 2BLOA 1O2ZA 3OX7U 4UDWH 1YPKH 1TX6A 3SU0A 5T6GA 2ZZUH 1O2OA 1MTWA 1PJPA 4ZUHA 4CR5A 1T7CA 5DJ7A 3GDSA 2ZCHP 3SNBA 1X7AC 4I86A 3Q3KA 2FYQA 3MU0A 4GCHF 4ISLA 4A7IB 4H6SB 1FPCH 2FIRH 1H8ED 5A0AE 1BUIA 1C5XB 1LVYA 1MD8A 3SJ8A 5FAHA 1CGIE 3QTOH 4ZHLU 1DICA 2R2MB 4XBCA 3GY6A 4ZROA 1DOJA 1GMCF 7KMEH 1K0HA 4NZQA 2ODYB 1GHBF 1ZPZA 2O8UA 4Z6AH 2WYGA 1F5RA 3KYFA 4HFPB 3L3TA 2H2ZA 4RKJB 4JZ1A 4GAWA 1C5OH 2ANMH 4Y79A 3RC4A 1KTTB 1SC8U 5DP3A 2F9PA 5CHAB 2VNTA 1FY1A 3RXOA 1F0TA 1BIOA 1XUIA 2PSXA 2Y7ZA 2SNVA 2A5AA 1AHTH 3QDZB 5HM9A 4Q7XA 1NFXA 1TQ0B 1PQAA 4NA7A 1DLEA 2A4QA 3JZ1B 1IAUA 1Y8TA 3DUXH 3D65E 4YOIA 1HAXB 1HBTH 1DWEH 4B75A 7LPRA 1H9IE 2Z9JA 3S9AA 4OM9A 4B76A 1ABJH 1H4WA 1SKYE 3RMLH 4AZ2B 2ZQ1A 1ZHRA 4K1TA 4Y7BA 2A7JA 3MH7A 4NIWA 1JIMA 2O8LA 2KX4A 1UTKA 1VZQH 5F8XA 1LQEA 1RTLA 1CE5A 5F53A 3K6YA 1AUTC 2CK3D 3LC5A 2ZA5A 2SGAA 1SGCA 3V12A 3RP2A 2AFQB 4NFFA 4BXSA 1W8BH 3ATMA 2Q6DA 2LNCA 2BM2A 3UIRA 3ZZ7A 2Z9LA 2FM2A 4NIXA 5DP8A 1ZRBA 5HYOA 1JRSA 2BD2A 2HNTC 1TFXA 5DG6A 2ZCKP 2GV6A 1C9PA 1ESTA 5ESBA 4CH2B 3MNCA 4OGXA 1PPBH 1V2LT 1V2MT 1IHSH 1HIAA 4FU8A 1ANDA 4YTAA 1EAWA 1OP2A 2AIPA 1ORFA 2GD4B 1AU8A 4OS2A 1CVWH 1AUJA 3GY2A 1T8MA 4O03A 1BA8B 3SGAE 1THSH 5J4QA 3LGYA 2VWLA 2QC2A 1C1MA 1XUFA 3KHVA 1N6XA 5T1VA 4YOGA 1EAUA 1SGFG 2VWMA 1EAXA 2ZHDA 1NROH 2O8WA 5EQQA 3UR9A 4AB8A 1QTFA 1KDQB 1O2LA 1QBVH 1YY3A 5FPYA 3PO1B 1GDQA 2VVVA 1SGIB 4Q4LA 3ZZ9A 2A2QH 1VCQA 5J4SA 4JZIA 3OY6U 2J4IA 1DY9A 3SNAA 1KXEA 3EA9A 2GTBA 2I6SA 3SU3A 3SUDA 2KM0A 1ELDE 3QTVH 3ZVGA 4BANB 1KXFA 1MU6B 3LPRA 4CBNA 3DFLA 1SG8B 3SO3A 2STBE 4DVAU 1C2LA 2K8IA 1IHTH 4LK4A 2PKAB 3D23A 4K1SA 1GI4A 1V6DA 4JCNA 2W6JD 3KQDA 2ODQA 1E0FD 5BPEA 3ZYEA 2BDGA 4KKDA 4WXVA 3T2NA 3QN7A 1XUKA 1GI3A 1Y5UT 4O9VA 4ZMAH 2WUCA 5EQSA 1O2RA 1E1RD 1ZTJA 1SOZA 2QF5A 4ABJA 1BBRK 4ESTE 1GPZA 1GBAA 1Y59T 5GCHG 3GYLB 3OU0A 4CHAC 5HM2A 4GLYA 1Y5BT 1Z6JH 1DITH 4CREA 1YPHE 2A7HA 2XC4A 3ATLA 1RTKA 3RXMA 4Q2KA 1CGHA 2KAIB 3GCNA 2ZHEH 4DGJA 3TLOA 5DO4H 1ESAA 3GCTF 1TGNA 2ZHQH 3SV6A 4O3UA 2NU3E 1BRUP 1GBLA 1L1GA 2IJOB 1A0HB 1O5FH 2ZF0H 2G5NA 1QNJA 2BD5A 4HG6A 2VIDA 3W1EA 1QY6A 3RXTA 5EIYA 1W12U 2QF4A 2EA3A 4DY7B 3RM2H 3F9GA 3KF2A 1C4Y2 3P8NA 3IWMA 3ZZ5A 2PSYA 3UPEA 3RXJA 4IC6A 1IQLA 1A3EH 2FP7B 2HOBA 2P94A 2QA9E 1PPEE 4JK5A 2FWWA 2V3OH 3V3MA 1SGNE 2AS9A 1V2OT 3FZZA 4UD9H 1MTVA 5K0HA 3N7OA 2KFWA 1W0YH 4NWLA 1ZPCA 3WW7A 4A1TA 1GCDA 3LT3A 3NCLA 1GBJA 3RM0H 5AVDA 4FOUC 3LOXA 4OGYA 2VB0A 4ZKRU 1PQ8A 1KSNA 1EZUC 2ZC9H 1DWCH 1HUTH 2UWOA 2A5IA 1MKWK 4M9FA 1EJAA 1PYTD 3VB3A 1V2WT 5L2YH 4A1VA 4D9QA 4ZH8A 2WV9A 3RLYH 1BBRE 1ELAA 1N8OC 1TNGA 2ZO3H 2SGQE 2WPHS 1C5NH 3SZEA 2QN5T 3RUOA 2FOEA 5B6OA 1KLIH 5ETXA 1FY4A 4YLQH 1O2SA 4E7RG 3VB5A 3GOVB 2WPKS 4P00A 4B6EA 1AFQB 1Y3YA 5FPTA 1C5QA 4Y11E 1AD8H 2GVFA 1OPHB 1QBOA 1AZ8A 5C5NA 1CQQA 3F0OA 1K1IA 2C8XB 3A7VA 3PM3A 4ISHH 1UCYH 2ZGBH 1YM0A 2FI4E 1O2WA 1DY8A 4NA9H 4NIYA 4CR9A 1XXDA 3GCOA 3STJA 1RD3B 1LHGH 1KXDA 3GS9A 3PMAB 3PLBA 1GJBB 3ATKA 1K28D 2GDDA 3RMOH 3RU4E 1Z8RA 1C2IA 3A88A 2FDAA 3NUMA 4Y0YE 4GSOA 1TPSA 1QFKH 1O5CB 1DSTA 4AC9A 1AMHA 1A3BH 1HAVB 1OSSA 5I25A 2BYAX 1ZSKA 1J16A 1SSXA 2CJIA 1HRTH 3TH4H 3A84A 3I77A 3MWIU 2FTLE 3HPTB 4UFGH 3ZVEA 2LELA 2WPMS 2G51A 4IMQA 2D8WA 2PW8H 1NRRH 3TIUA 1F5LA 2AMQA 2J38A 5CDFE 2AERH 3P8FA 3UOUA 2OQUA 2GP9B 4ZKNU 3K2UA 1C1TA 3EGKH 1SQRA 3PYHA 3BN9A 5DP7A 3MQKC 2AEIH 1LVOA 1TIOA 3KYGA 2SGPE 2VWOA 1BBRH 1YLDA 3A8DA 4Y0ZE 5AFZH 5JDUB 2H5DA 3MO9A 1NTPA 5DP6A 4NSVA 4BAMB 1O3MA 2OUAA 2O8MA 2P3TB 1HAIH 3Q76A 1GBIA 4NSYA 2HLCA 1LMWB 1YYY1 3FO8D 3PMHB 4ABFA 1V2VT 2F9VA 3WWBA 1W13U 1N8OB 2GMTC 3BG4C 5C0TA 4B1TA 1CBWB 4I8HA 3VGCC 2XTTB 2VWNA 1THRH 3SJ9A 4X1NU 4ABGA 5C1UA 1VGCC 1DWBH 1P2JA 3HGNA 2A1DB 2OC7A 5DN6D 1FY3A 1XUJA 1HXEH 4NG9H 1ZZZA 4JZDH 5DGJA 1ZHMA 3MNSA 2G4TA 2ZFQH 5HXFA 1TNLA 2AHME 6GCHF 1OOKB 4LZ1H 1GHXH 1G3CA 4YZUA 3GY8A 2VH6A 2HALA 5C1YA 2HNTE 4XFQA 4TWYA 5TCAA 2PGBB 2OLGA 1NM6A 2R0LA 1NESE 2Y5GA 5EXNA 3A81A 1C5LH 5JB8S 1O3HA 1LHFH 1BB0B 2G5VA 1C2HA 1K1JA 1SL3A 3K6ZA 1C2GA 1K1LA 1EZXC 1U6QA 5EJZA 1TALA 1WTGH 2BMGB 3BTDE 4I33A 2STAE 1ARCA 2K1QA 5DP5A 4WF8A 1QGFA 2EI7A 1WCZA 3BEUA 1MKWH 1C1RA 2BQ6B 2FPZA 1OWEA 1T8LA 1K1MA 1YPGH 1XVOA 1SQOA 2AH4X 1DX5M 1O34A 1FLEE 2BD4A 2FZZA 1WQSA 3OE7D 3UOPA 4ASUD 4LZ4B 1IOEA 2SFAA 2FMJA 3PTBA 2PWXA 3Q3YA 1H1BA 1LKAA 4UFDH 1C5PA 2OXSA 1RRKA 1O3BA 3NRLA 4RT1A 2PKSC 1DSUA 2J34A 2M5TA 3E0NB 4D76A 1JMOH 2TBSA 1GCTC 2P8OB 1C5WB 1DFPA 2GT7A 1SQAA 1MH0A 4D9RA 4MTBA 1YPEH 1NRNH 3UY9A 1C2DA 1Z7KA 4AB9A 1EXFA 2F83A 4MPVA 3BTQE 1MAXA 1J8AA 4JZFH 3URCA 1UTQA 2XNDD 3F9EA 1E36B 1GBHA 1NPMA 2GZ7A 1TMTH 4A1XA 3Q3XA 1ACBE 4WH8A 2RDEA 5A8ZA 1W3CA 4GPGA 3LC3A 4I32A 1HAOH 2HWLB 2PLXA 2H5CA 4FUCA 4E05H 1RXPA 2XBWA 2AMDA 4WMDA 1C1OA 3TPIZ 5GIBA 2JH5D 2Z3EA 4MPWA 4B2AA 4RN6A 3SI4H 1EPTB 1BJUA 3RXAA 2AGEX 2A45B 2CMYA 3ZVAA 2P95A 2BY6X 1P2NA 1HJ9A 2L6OA 3DHKH 4O3TA 1FN6A 3LU9B 1HPGA 5CHAC 3C27B 3SV7A 3T25A 4E06H 3SOSA 4U32A 3NWUA 1GMHG 5DP4A 1A61H 1UJ1A 5T6FA 3RXRA 3AAUA 3M5MA 2PTNA 1TX8A 5FBEA 2B5TB 3LGIA 1EKBB 1WV7H 4CBOA 1FXYA 2GDEH 4JYVH 4F4OC 2JJ1D 3SW2B 2BVXH 1SGPE 4Z0KA 1TABE 3EE7A 5CE1A 4YXWD 2ZGHA 1MU8B 3SNDA 1Y3UA 1A5GH 3F6UH 1NBMD 1O5EH 2JJ2D 2Z7FE 2P3UB 3B8JA 1BTWA 1ZMJA 1ANBA 1YPLH 5C3NA 2PKSB 1D3DB 1GG6C 1O2GH 1O2JA 1GBTA 2ZP0H 2ZPQA 4IS5A 4MNYA 3TK9A 4SGBE 1GCTB 3SGBE 3H7TA 4FVDA 4I8KA 2J97A 4RKOB 2WYJA 4FUEA 2CF8H 1P12E 2IJD1 2ZDMA 1V2KT 2A7CA 3A8CA 5FBIA 3WY8A 1H9LB 3NZIA 5L2ZH 1DXPA 3SBKA 3KCGH 3M3VA 1YPMH 6LPRA 4K60A 2FS8A 1WYKA 1FI8A 3OYPA 2BDIA 3MU4A 1C1UH 1NBME 1GBFA 1MZAA 2P16A 2YMSB 4THNH 2ZIQH 5EQRA 1DE7H 1TPAE 2GZ8A 3F2FA 4U30A 1P57B 3RXQA 1TNKA 3TNTA 3ZZDA 1F7ZA 3QZRA 3QLPH 2PR3A 1BT7A 4IMZA 1O2KA 1O5AB 3VB7A 1FQ3A 2DE9A 1BCUH 2ZGCA 1WDIA 2W7UA 1C5UA 5IYTA 1W0ZU 1WU1A 2WHXA 1L4DA 3VB4A 3MMGA 8GCHF 1SFQB 2D1JA 4B6FA 5F03A 3PO1C 2ZFRH 3DSGA 3PV2A 2ZU5A 3BTKE 3EAJA 1P11E 4PROA 1TGTA 1TMUH 1EQ9A 1T8OA 2BZ6H 2F4LA 3T26A 2K0QA 1V2TT 5C94A 1EFRD 3LH1A 4WXIA 2W6ID 1TQ7B 1YF4A 2R3YA 3RDZA 1XKBC 5KECA 1TOMH 1C5RA 4IC5A 1KYNA 4XOJA 5HIZA 1XKAC 5K7RA 1FN8A 1AB9B 2JKHA 1UVUH 1Z8JB 1G32B 1WTHD 1JOUB 1ELEE 2IOTA 2FX4A 4IN1A 1AQ7A 1P9SA 2ODPA 1D3PB 4IBLH 3NPSA 1DANH 4K69A 2XXLA 3UR6A 5C1XA 1MQ5A 1TE0A 5FHTA 4VGCB 1DLKB 3BEFB 1CHOF 1FNIA 1K21H 1KXAA 4A92A 3PROA 5GJ4B 4D7FA 1GG6B 2WINI 3E16B 2PTCE 1K9OE 3LGUA 2GCHF 3E1XB 1GBMA 1O3PB 4DIIH 1TRYA 1ANEA 1T8NA 3A7WA 1BRCE 1P06A 3STIA 1CGJE 1FIWA 2J98A 1NO9H 3RMNH 3SUGA 3WWFA 2QYIA 4FU7A 3NKKA 2EQNA 3OEHD 4ZCNA 5GCHF 4DCDA 3S7HB 1Z1JA 2O8TA 1GI5A 4H6TA 1UVTH 4INHA 1JXPA 4AYYB 1WAYB 1C1PA 3T29A 1V2QT 3SJOA 1QURH 2BOKA 8GCHG 3M5OA 1EZQA 2ZFFH 3AAVA 2SGFE 2VIPA 3Q77A 1YLCA 4GUXA 4XE4A 3O8DA 1AKSB 4MQAA 3BIVH 1QJ6B 1UCYK 1FONA 3H09A 1AY6H 3ESTA 5L30H 1RIWB 1Y3WA 4AFZA 2NWNA 4K3JA 4UE7H 1SHYA 5H4IB 1FIZA 4BAHB 1ZMNA 2QV1A 1E34B 1QR3E 2ZU3A 1BRBE 2Z94A 4AGKA 2AGGX 1JBUH 2FS9A 2DUCA 4MNVA 5CMXH 5FXLA 1K2I1 1A0LA 1EJNA 1UK3A 1UTMA 3U8TH 2OK5A 1GWAA 1HAZB 1OWJA 2CXVA 4K8BA 4IN2A 1VCWA 2FTMA 3A86A 3E91A 3M61U 4YT6H 3TGIE 5C17A 4Y8XA 3TJOA 1SLVB 1ARBA 1CHOG 2Y80A 1MTSA 2ZDNA 1VJ9U 1H8DH 4TY6A 1BDAA 2ZDVH 3BG8A 1ZRKA 2JH6D 3SJKA 1UTOA 4MPUA 1QB1A 1NRPH 2ZCLP 1UO6A 3M3TA 3HKJB 1OWDA 2RFKC 3RXCA 5CHBA 1OXGA 2GCHG 1CHGA 5F8TA 1O3KA 4Y8YA 1C9TA 1AWFH 1B5GH 1OKXA 5EJ1A 5JBAS 1AFQC 1QL7A 1O35A 4E7NA 1J17T 7ESTE 1KDQA 1F2SE 1O0DH 1LKBA 3U1IB 3OEED
chains in the Genus database with same CATH topology
1FJSA 3A8AA 1Q31A 1P8VC 2R9PA 3ODFA 1SBWA 2VIVA 5A8YA 2GX4A 1P3EA 1OYQA 1E38B 1AE5A 1GBKA 4XBBA 1ZSLA 1LPKB 4X8SH 1TLDA 8LPRA 1UCYE 5A2MH 4D8NA 3S69A 1GI1A 1GHWH 1HV7A 3O8CA 1WQVH 4FU9A 2D2DA 1O3GA 2BDCA 3LIWA 2OTVA 2PKAA 4KP0A 1UTNA 4YOJA 4CRFA 2QF3A 1O2PA 2FEQH 1A7SA 5GDSH 3KQBA 2YNBA 4CH8B 2A5KA 1G3BA 1HCGA 6ESTA 2VGCB 1GDNA 4NCYA 1D6RA 1EP6A 2QIQA 4AORA 1GJDB 1AWHB 4Y7AA 2F91A 3M7QA 3NXPA 1GHVH 4NA8A 4UFFH 2GKVE 3TNSA 4I8LA 2KAIA 2PUXB 1C5YB 3MU1A 3U8OH 3I29A 3GYMA 4O97A 1SGTA 1G2LA 2FI3E 3HKIB 2GCTB 2Z9GA 2P3FH 1QL9A 1FY5A 3A7ZA 5E0HA 2EEKA 3ZZBA 1EATA 1GHAG 3T28A 4B2BA 2A32A 2BD7A 3SZNA 1BITA 2XCFA 3I78A 1O2TA 1CBWC 1AZZA 3ZVFA 1O3DA 3U98H 2FYRA 2Y6TA 1LTOA 1P10A 4A5TS 1SB1H 4FUGA 1C5SA 2FOMB 3URDA 4B73A 3VPKA 1ETSH 2AMPA 4AFUA 1T4VH 1ZJDA 3A89A 2Y81A 1OYTH 2OBQA 2TRMA 2G00A 2G52A 4RSPA 1UTJA 1D3QB 1SPJA 3KL6A 3AVZA 4X6MA 2H9TH 1XVMA 4WVPE 3GY3A 2BDAA 4GVUA 4J2YB 4CRBA 2W7SA 1E35B 1VITH 3V7TA 3PMBB 4INLA 1J9CH 1O3IA 1O5BB 2FOGA 2ILNA 1CT2E 5DKMA 1A5IA 1EB2A 4B2CA 2JETB 5JBBS 4R0IA 3EA8A 1P05A 2BQWB 1O3CA 1GJAB 1IQKA 1XMNB 2GV7A 1P3CA 3MH4A 2BHGA 3OSYA 4K5ZA 2J95A 1AVWA 4TY7A 1SOTA 1GI9B 2QAAA 4B74A 1CA0B 3SQEE 3IG6B 3U9AH 1IQIA 2UWLA 1UVSH 2LPRA 4AG2A 1KLJH 1L4ZA 7GCHF 2UWPA 3KQCA 1WOFA 1AVXA 1S82A 3LKWA 1EB1H 1K22H 1O38A 2VH0A 1LVBA 3O8RA 2HNTF 4DW2U 3ZZAA 3K65B 1O2NA 4X8VH 1GBDA 1QBNA 2BLQA 1RS0A 2G81E 3BTTE 3BF6H 4KELA 2P8OC 1ETRH 4BXWA 1EASA 2UUYA 1INCA 2ZU4A 5A09A 1XX9A 1PPGE 1O3EA 1BTPA 2OC1A 4SGAE 3KQEA 2ZQ2A 1E37B 2NU2E 2PV9B 1CU1A 2VIQA 1SMFE 1LHEH 1BOQA 2C8ZB 3F1SB 1MZDA 4HZHA 4Y76A 3TJNA 3AASA 4ZKSU 1HNEE 3SUEA 1ETTH 1WUNH 1V2UT 2FESH 4ABAA 3P8GA 2OD3B 1KY9A 4GHQA 2ZGXH 1QRZA 3SV9A 1TPPA 1VR1H 1TB6H 2D26C 2HGTH 3L33A 1G3EA 4ABHA 1QB9A 2A4GA 2XRCA 1EPTC 1MBMA 3LJJA 4INKA 3QGNB 2QF0A 1UHBA 1Y3VA 1CO7E 1ZSJA 4MNWA 4BOHA 2RA3A 3SNEA 7GCHG 1F0UA 1ELTA 5LPRA 4I8GA 5GPIB 2XBVA 4JK6A 3RU4T 1GDUA 1GJ7B 4ABBA 3KIDU 6CHAC 1THPB 4GHTA 4OS1A 4NWKA 5DP9A 1TMBH 2TGPZ 4ASHA 4WMEA 1GMHF 3A7YA 1OP0A 4KGAA 5BRRE 1O3AA 2ZFTA 1O2VA 3CS7A 1SFIA 3GCHB 1BTZA 2CN0H 4KTUA 1TX7A 2CGAA 3BSQA 1BTYA 1A0JA 1O5DH 2CHAB 1GBCA 2ZECA 1P09A 2J92A 1D4PB 1M9UA 1MMJN 2P59A 2Q6FA 5FPSA 3GDVA 1C1VH 1F0SA 1ELBA 2QCYA 2ZPSA 3D49H 4MNXA 4FUFA 1TNHA 5FX6A 5LPFA 1MTNB 5C2ZA 1D9IA 1YCPH 4ABEA 3RXGA 2QGRA 5EODA 3M3SA 2B9LA 1BTXA 4WJG2 3CS0A 5GWZA 4AN7A 1GL1A 3PMJA 5JYIA 1A1RA 3HK3B 1QA0A 2ZI2H 1YPHC 1UMAH 1SGQE 1ZYOA 3GICB 4FVBA 4NFEA 4BTUB 1IQFA 5EU8A 3SU1A 3QUMP 2W3IA 1C2KA 1P2QA 2H1UA 2BXUH 4YO9A 2OP9A 2NU4E 3LH3A 1H8IH 1O2YA 1W7XH 4AOQA 1L2EA 1BMLA 1MTUA 4MDSA 3ELAH 1G37A 1TA2A 1O3OA 3UWIA 1GI2A 1O2MA 3KEEA 1NFUA 2FOHA 1K1NA 5E0GA 1D3TB 5TCCA 1TRNA 4ISIH 1YPJH 1XUHA 4X2YA 1G9IE 1PPCE 1O5GH 2RG3A 1C4V2 1RGQA 3A7TA 1ZMLA 4I31A 3FVFB 1TRMA 1JWTA 6CHAB 2ZEBA 1HYLA 5LGOA 4ZHAA 3P6ZB 3CENA 1C2EA 3BTFE 1T31A 1AB9C 2H9HA 1DUEA 3E6PH 4MG3A 4ZXXH 3LGWA 1CA8B 1GI0A 1YP9A 2J9NA 1GVLA 1YGCH 2HRVA 2PFEA 4VGCC 1W10U 1IQNA 1BRAA 1TPOA 1GVZA 3SHAH 2P93A 2OINA 2QXGA 1TGBA 3M36A 4DIHH 1DS2E 4UONA 4MVNA 4WH6A 4XBDA 1DUAA 4WMFA 2Y5HA 1RTFB 3VXFH 1Z6EA 3PWBA 4MLFB 3O8BA 3ZVCA 3RXSA 5SGAE 2Q6GA 5EXMA 3OTJE 2W5EA 2BX3A 4AGJA 1C1NA 1C1QA 4WWYA 2ZU1A 2F9NA 1DDJA 1C5ZB 1ZGIA 4NIVA 3CP7A 2YNAA 2BDHA 4WY3A 1MKXH 3U1JB 1ELGA 3ITIA 1GBEA 2TPIZ 3RXVA 1TA6A 2G8TA 1MCVA 1RIWC 1ZOMA 1RFNA 1YCPM 3RXEA 5EW1H 4KTCA 2QXJA 1W7GH 1GGDB 3ZZCA 5E0JA 3T62A 3U8RH 3EDXB 5EG4A 2FLRH 2OBOA 4DURA 2R0KA 3FANA 4HGCA 3MYWA 3HATH 4Y6DA 1AI8H 3HK6B 4UEHH 4XDEA 2C93B 3DFJA 2ZDLA 5E8EH 2ZHFH 1SQTA 1F5KU 2C8YB 5AHGH 1FAXA 3KGPA 5FX5A 1ZTLA 1C5MD 1ESBA 1BHXF 3BTWE 2HPPH 3TITA 2B8OH 1NS3A 1QQUA 2FOFA 4XSKU 3PTNA 2G4UA 1IQEA 3ZV9A 1AIXH 3SGQE 5LPEA 1FAKH 4X8UH 4Q80A 3TGJE 1DM4B 1VCPA 2ZKSA 5HGGA 1TYNA 2ZFPH 1PQ7A 1C2MA 1HIAB 2BY8X 1EX3A 3TK5A 3PWCA 2C4FH 3S9BA 1OP8A 2BDBA 1S5SA 1GMDF 2WV4A 3RC6A 3IITA 5F8ZA 4X1PU 1O32A 1QA7A 5EGMA 2BLWA 3P95A 1LQDB 5AFYH 1LDTT 3FP6E 4TWWA 3B23B 1TBRH 1NFWA 2BTCE 2VVUA 4R8TB 5JBTA 3HGPA 2BOHB 1V2RT 4KTSA 2BQ7B 3FAOA 1O2XA 3PV4A 3SV2H 2BD3A 1B0EA 1HJAB 1V2JT 3QX5H 4OS4A 3A87A 2SGEE 3MFJA 4IW4E 3SV8A 2ZDKA 1F92A 3A82A 1SLUB 4GCHG 1NU7B 1PPHE 2BX4A 1TAWA 1ZTKA 3H5CB 3QK1A 1UK4A 2VGCC 1YBWA 1EZSC 1V2PT 1O30A 3PLKA 1GMCG 3UQOA 4X6PA 2JH0D 2R2WU 5G4BA 3H7OA 1GHBG 3TVJB 1C4U2 3ZZ4A 2BY5X 2UUKB 2C8WB 1NZQH 2GGVB 3M35A 3SU4A 2FX6A 3K9XB 4AX9H 3ATIA 1GHZA 3DT0H 2ANYA 2F9OA 2ZTXA 1TONA 1GJ8B 1TWXB 2GCTC 2ZGJA 1GJCB 3S9CA 4MPXA 4X2WA 1O3JA 3SNCA 2BDYA 3UUZA 3F68H 3M5LA 3GY7A 1ZR0A 3SU2A 1DVAH 1LHDH 1O39A 3TGKE 1AKSA 1MQ6A 1HAYB 1OWKA 1S83A 1V2ST 1IQHA 3EQ0H 4FUHA 1XM1A 1BTUA 1VITF 5L6NH 1GMDG 1N1LA 3DA9B 2THFB 4LXBH 3TK6A 3MU5A 1TOCB 2GZ9A 4U2WA 1QRWA 1GHAF 1S84A 3KN2A 3ZVBA 5FCKA 5EW2H 1AE8H 1F0RA 4OS6A 1KXCA 3ZYDA 1GJ9B 1HGTH 1QQ4A 1W14U 3ZZ6A 8KME2 3MO3A 3TJVA 2VINA 1CT4E 1AVGH 1K1OA 1YKTA 2W3KA 2Z9IA 3AW0A 5E2PA 2XBYA 1G30B 1TBQH 2V35A 3BTGE 2ZDAH 3SJIA 2JETC 1HJ8A 3G01A 2ASUB 4OS7A 3B9FH 1C5TA 2FI5E 1ZGVA 1GJ4H 2BD9A 2BLVA 2WPJS 4X2VA 1FPHH 3RXUA 5GXPA 1OX1A 2A0QB 2A4OA 1C1SA 1S0QA 1QCPA 1Y5AT 1CA0C 4BAQB 1SGDE 1G2MA 3UNSA 1QRXA 1AFEH 2J94A 2CV3A 3A80A 2RDLA 2OC8A 1DPOA 2ZNKH 2ANWA 4Q7YA 1NFYA 1NRSH 3LONA 2F9BH 3TU7H 1Q3XA 3SHCH 1BJVA 1O31A 1OWIA 3SU6A 1KXBA 3MH5A 1W2KH 1C1WH 2Q1JA 1SGEE 1A46H 2WPIS 2VVCA 1FDPA 1VITG 1LPZB 1C2FA 1LO6A 1ZPBA 4ISNA 9ESTA 4HI3A 2W26A 2RA0A 4IGDA 2I6QA 2OC0A 3R0FA 4ZHMU 3LGTA 3UNQA 4X1QU 1CSOE 3GDUA 4X0WU 2QXIA 5A0BA 5EOKA 1UTPA 1WSSH 2VIWA 4CRGA 1KTSB 4UFEH 1TGCA 1PQ5A 1S85A 4TPYA 1CT0E 5C20A 2H6MA 1S0RA 5TJXA 4Y8ZA 3UTUH 1T32A 1A4WH 3F9FA 4OS5A 4X6OA 3BIUH 2F3CE 2Z9KA 1HAGE 3MNXA 1O3LA 1EAIA 1P04A 3KNXA 3RU4D 2G55A 3RXLA 4YT7H 1TNJA 2J2UA 2Y5FA 5LH8A 3SU5A 3QO6A 2HPQH 1EP5A 4BAOB 1EOJA 5EPYA 1XXFA 2R3UA 1HLTH 4CRCA 2EC9H 2ZTZA 1EUFA 1O3FA 1V2NT 2A2XH 3U69H 5JPMH 3EE0B 2SGDE 3C1KA 2ANKH 3ZVDA 3M7UA 3GCTG 1O2QA 1TGSZ 4DJZB 1YCPK 1Q2WA 1QJ7B 1GHYH 4CHAB 3BTME 1BMNH 3BTHE 2ALVA 3T5FH 1P9UA 2BVSH 5JBCS 2A31A 1SLWB 2TGDA 2NU0E 4H4FA 1JIRA 3UQVA 2IN2A 4AYVB 4K2YA 1Z1IA 3RLWH 2PHBA 3UREA 3RXKA 1ID5H 1RJXB 5T6DA 2Y82A 3SN8A 3DD2H 3M5NA 1UTLM 4ZKOU 3GY5A 2H9EH 2Z6BD 4QT8C 4X1RU 4BTIB 1BQYA 1P01A 4Q7ZA 1ZJKA 1WBGB 1AN1E 1L0ZA 2YOLA 3EA7A 2Y7XA 5IDKA 2FO9A 2FXRA 2B0FA 1JRTA 3ENSB 1Z8IB 2FOCA 1DXWA 1IQMA 1L1JA 1GI6A 9LPRA 3GCHC 1NT1A 4YM9A 3SORA 3ATWA 1FMGA 1VJAU 2C3SA 2TGTA 5A0CA 2CHAC 1HDTH 1HAPH 1NY22 4ZAEA 3GISB 1V3XA 1QIXB 1MUEB 2TIOA 1HAVA 4H42U 4JZEH 4DG4A 2HVXA 3S0NA 1G36A 3EYDA 4JYUH 2IPHA 3A7XA 1UVOA 5ABWA 1K1PA 1A5HA 1MTNC 2XC5A 5FCRA 3BV9B 3S7KB 4AFSA 2RCEA 1ELCA 2V0BA 4JYTA 3MH6A 5C67A 4I7YH 5DK1A 5F6MA 2B7DH 2XWAA 4K1EA 5EPNA 3PLPA 1GBBA 3D62A 3T27A 3VXEH 1D6WA 1B7XB 1OS8A 3E8LA 1UHBB 3P17H 2AIQA 2PGQB 4X8TH 2Z3CA 4NGAH 3RXBA 2XCNA 1SLXB 3VFEA 1QB6A 1LPGB 4ISOA 3FZDA 4FUJA 2VU8E 3FFGA 1C5VA 5PTPA 1O3NA 3RXFA 1AO5A 3ODDA 4FUIA 4BAKB 2ZWLH 1HFDA 3P8OA 3ZV8A 1P02A 1KLTA 1SI5H 1HXFH 4X1SU 2WPLS 4X6NA 1S81A 1TNIA 2ESTE 1ELVA 4U01A 3FP7E 1NRQH 1O33A 2VJ1A 3E0PB 4JMYA 2BZAA 4AFQA 1O2UA 2EI8A 2XBXA 1P2MA 1MKXK 2CF9H 1DT2A 2FODA 1ELFA 1NC6A 3LGVA 1PPZA 2ZG0H 2BB4A 1YC0A 4FUBA 1LHCH 4K8YA 1FZZA 1ZHPA 3F9HA 3MHWU 5C5OA 1P0SH 5EXLA 4TYDA 5ESTE 1FY8E 1O36A 4YLUA 3A85A 3RMMH 2BY9X 3FP8E 3LDXH 2EI6A 1AGJA 1HAHH 2NU1E 4BNRA 1BMMH 2O9QA 3AW1A 3M37A 1SR5C 2QXHA 1DWDH 2FOBA 3QGJA 1GJ6A 1MD7A 5JB9S 1MAYA 3MU8A 1Z71A 4Y71A 1BZXE 1QL8A 1UVPA 4FUDA 4FXGH 8ESTE 3SQHE 2ZU2A 1G3DA 1O2IA 4TPIZ 1SGYE 1SVPA 3P92A 4AG1A 3MTYA 1SGRE 4X2XA 2C90B 5T3HA 3VB6A 5HMAA 1QJ1B 2PUQH 3M7TA 2XC0A 4J1YA 3GY4A 5AF9H 1BMAA 1MCTA 3SUFA 1Z8GA 2BD8A 1OWHA 3Q00A 1EOLA 2GMTB 3BG4B 3LJOA 6GCHG 2Z3DA 3BTEE 2ZPRA 3VGCB 1LCYA 1XUGA 4BTTB 1O37A 4LOYH 2ZTYA 2TGAA 3UFAA 1VGCB 1BTHH 1Y3XA 3BEIB 3RXDA 3MO6A 2UUFB 4F49A 2A4RA 5E2OA 1ZLRA 1GGDC 1BHXB 1P2IA 1C2JA 1PFXC 2XWBI 1GI7B 2UUJB 1IQGA 1IQJA 1A2CH 4DT7B 1T4UH 2XW9A 2OQ5A 1S6HA 2OCVB 4M7GA 4ZXYH 1GL0E 3MNBA 1NN6A