5HIZA

The structure of pedv nsp9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
96
Chain Sequence
GKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWGGCNTIELEPPRKFLVDSPNGAQIKYLYFVRNLNTLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PEDV NSP9
rcsb
source organism Porcine epidemic diarrhea virus cv777
molecule tags Rna binding protein
molecule keywords Non-structural protein 9
total genus 14
structure length 96
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5hizA01
2J98A 2J97A 5HIYA 5HIZA 3EE7A 2J98B 1UW7A 5C94A 1QZ8A
chains in the Genus database with same CATH superfamily
1E79D 1GHAF 3N7DA 2R0KA 2TGDA 1E1QD 2J94A 1N8OC 1NRPH 2VINA 3AK5A 1RIWC 1EASA 2ANMH 1GG6C 1TX6A 4I31A 5DK1A 5C20A 2W6ID 5H4IB 2VVUA 1HLTH 2XWAA 1VITF 3LGIA 1SG8B 5HM2A 1QB6A 1KIGH 3MQKC 1NY22 1PQ5A 4BAOB 2A2XH 3M61U 1EZXC 4ABIA 2G00A 3P70B 5C3NA 2ZU3A 1UTJA 4B75A 3SN8A 3ODFA 1J9CH 1CHOF 1F7ZA 4ABGA 2RA0A 4JK6A 2RCEA 4WMDA 2WPLS 3L3TA 1V2VT 1F0RA 1QFKH 2QC2A 5L30H 3BEUA 1GJAB 3SGAE 2P3TB 4FVBA 1VGCB 1OSSA 2GMTB 4JK5A 1ZSLA 2ZA5A 2J92A 3TNSA 3MFJA 2I6SA 3GYLB 2TGTA 3BN9A 3M5LA 4HZHA 1EUFA 1O2HA 2WV9A 1A3BH 4LXBH 3OEHD 4O9VA 2FOEA 4X2VA 1NZQH 2FXRA 1A0HB 2FZZA 1QB9A 1S0QA 3PTNA 4OS2A 4MNVA 1EOJA 1SB1H 1MH0A 2W6JD 3VGCC 4D8NA 2WYJA 4BAQB 2NU4E 1S6HA 1ELCA 3L33A 3TU7H 1V2JT 1W0ZU 1DWBH 1MBMA 2GT8A 2FO9A 2ZU1A 3M35A 2OLGA 1LVBA 2YNBA 8KME2 4UD9H 1CBWB 4XFQA 3MH4A 1E37B 4D9RA 3U8OH 1UHBA 2ZTYA 1GVKB 3SU3A 1HAVB 2GZ9A 1KMHB 1TABE 2WUBA 3QGJA 1RD3B 1CSOE 2ZU2A 3SV8A 1SFQB 1T32A 1ID5H 1ANDA 3SV6A 3DUXH 3PWCA 1GBJA 3F9HA 1C5QA 2BZ6H 1HRTH 3ZVEA 3SNAA 1TA2A 3OEED 2BDAA 1C5NH 1F5LA 1A5GH 2Y82A 2FODA 4J1YA 4OS5A 1EAXA 1HJAB 2HPPH 1Z8GA 5T6GA 1ELFA 1O5BB 4ZKRU 3VXEH 1SGYE 1ZYOA 5HMAA 5A09A 4RT1A 2CGAA 5DPAA 2BD5A 3PRBA 1U6QA 5LGOA 5A0CA 2PGBB 1GHBF 2XOKD 1C1PA 2ZHDA 1EPTB 1TRYA 5F53A 1O2KA 1BZXE 4X8VH 1HAXB 3PWBA 4NGAH 4FUBA 5EW1H 1NU7B 1O2PA 3RXHA 3M3TA 1ZPZA 3SU6A 2VU8E 1VCQA 4ZXYH 3SQHE 1TPPA 1HIAB 3BG4B 3P95A 1C1VH 3FAOA 1ZZZA 2C90B 1EX3A 4YESB 1C1UH 2BDIA 1ETRH 2PP6A 4X6PA 2JH6D 3A87A 1BUIA 1YPLH 4I8KA 1LKAA 1SLUB 3PM3A 1FZZA 1C5WB 1K1OA 1A4WH 1RTFB 1HB0B 3GY4A 1QBVH 1T7CA 2EEKA 3N7EA 4OS6A 5HIYA 4XE4A 3RXDA 2A0QB 2BDCA 3AAVA 1BMFD 2K1QA 1W13U 4FUJA 1GMCG 4UFDH 4GCHG 2H1UA 3GY7A 5DJ7A 5SGAE 3AW0A 2QGRA 1P3CA 4KKDA 4U32A 2J97A 1NRQH 1TBQH 2P16A 1YKTA 1GWAA 1AI8H 1NM6A 3EAJA 5C1XA 1WU1A 2TGPZ 2A7JA 3KQDA 4ZHLU 4MNYA 2OUAA 1B7XB 3TJUA 2WUCA 1ELBA 3I78A 5I25A 1TB6H 2FI3E 1FX0B 2PWXA 1XVOA 5DP4A 3P8FA 1ZJDA 1FAKH 1GPZA 3R0FA 1SL3A 4CREA 4RKJB 2KCPA 1UK4A 4A5TS 3DA9B 1LDTT 2ZCKP 1GBDA 4RKOB 1C1RA 4K8YA 3SNDA 2THFB 1Z71A 5CMXH 3PV2A 5EQSA 3SU2A 1OWIA 8GCHF 6ESTA 1S6LA 3UUZA 1TYNA 1G2MA 4X6OA 4MPWA 1SR5C 1XXFA 3RLWH 2EA3A 2IN2A 1IQNA 2L6OA 3KEEA 3GY3A 4Y11E 2FESH 2C8WB 2AHME 1K9OE 1HDTH 2BY5X 1QQUA 2JIZD 1FY5A 5F8XA 1QTFA 2Z6BD 1SBWA 4U30A 3RU4D 2R0LA 4K69A 3EE0B 4Q63A 4MTBA 1H9IE 5IK2D 3VPKA 2K8IA 2OC1A 1FONA 4AORA 1WTHD 1G3BA 4B71A 1GJ4H 3MO9A 3UR6A 4DIHH 5C5OA 1YBWA 1H8IH 3OE7D 4O3TA 2HNTC 3S9CA 2ZCLP 1C2LA 2XBWA 1GGDC 2RA3A 3Q77A 3T62A 4UEHH 1Q3XA 1OYTH 1FPHH 2KFWA 2ZFRH 1AKSB 1HAPH 5HYOA 1B0FA 1ANCA 1D3QB 1ACBE 3UNRA 1EATA 1Z6JH 2ZKSA 3E16B 2R2WU 5GDSH 1MAXA 2UUJB 4P00A 1MZDA 1W10U 2O8UA 1CU1A 1AVGH 2FYRA 3PB1E 4DCDA 1LMWB 2F9OA 3TGKE 2Z3EA 1TMUH 4E7NA 5AVDA 3S69A 1YCPK 1BTZA 3GCTG 1P2IA 3ZV8A 5IYTA 1ELGA 3LKWA 1EZSC 1O3BA 2FWWA 3A7WA 3H7TA 1C1QA 1GG6B 2B5TB 1P06A 4BTTB 1BBRE 4B73A 2FIRH 1S5SA 3I77A 4WJG2 3PV4A 4FOUC 3F9EA 4NIXA 4ZKSU 1T8OA 2QN5T 1EJAA 1TRNA 1UTOA 2KM0A 4DW2U 2STAE 2XRCA 4JZIA 2ZHEH 2FP7B 1GJ8B 2CXVA 3ZZ8A 1C5RA 2F9VA 1O3IA 4ASHA 3GCHC 1UTPA 1V6DA 1Y3XA 1AQ7A 1ZTLA 2ZFTA 2XXLA 4MDSA 1VKYA 2FTLE 4YOJA 1BRBE 1EPTA 2VWOA 2JH5D 3RXBA 4MVNA 1KLIH 1DVAH 1JXPA 3SU4A 1YPKH 1JOUB 3MNXA 1EZUC 1NROH 1TBZH 4YXWD 3M3VA 4YM9A 3RP2A 6CHAC 3SV9A 2YMSB 1TWXB 3Q3YA 5T3HA 1UK3A 1NS3A 3FP8E 3G01A 2ALVA 2UWLA 2F9BH 3RMMH 3UFAA 1E36B 2PKSC 2Z9GA 1GDQA 1YPHC 2WV4A 3TK6A 3V3MA 5BRRE 1BHXB 3MO3A 3TK9A 4R0IA 1NO9H 2BD3A 4TY7A 2AGEX 1C4Y2 4F49A 1G36A 1COWD 2M5TA 4J2YB 3CENA 5A8XA 5BPEA 1A46H 1FXYA 2H5CA 1FIZA 1JRSA 2GCHF 2HPQH 1GHAG 1VJ9U 5DGJA 3ZVAA 1HAGE 2Y80A 2BVXH 2QV1A 1BTHH 1E38B 5C94A 1Z8JB 5DP3A 2WV5A 1PPCE 1ZTKA 2F3CE 1NFUA 2KZ4A 3GICB 4FUFA 3ZZ9A 1NTPA 2CMYA 2WSSD 1MCTA 4K1EA 2CJIA 2PKAB 3P6ZB 3VB3A 4A1VA 4AG1A 1WYKA 2W26A 2AYWA 1BTUA 1O39A 1FV9A 4X2XA 4XBCA 1UMAH 4KTUA 3A85A 2BX4A 1HAHH 1O2WA 4FUIA 3VB7A 1AUTC 1O5CB 4Y8XA 1Z1IA 1LHCH 2FDAA 3BTTE 1QY6A 4ZHMU 5TCAA 1P10A 3SGBE 1IQLA 1BTWA 4K5ZA 3VG8A 4NIWA 1J14A 4IMQA 4Q7XA 1GBEA 1ZRKA 1O2GH 1O2ZA 1TOMH 1P0SH 2RG3A 4NWLA 3MI4A 1ELVA 1LVOA 2A2QH 5F03A 3T25A 3MTYA 3WW7A 1TNJA 1P01A 3EA9A 1TNLA 1TGBA 1ABJH 3CS7A 1T8LA 1ESTA 3GS9A 4IN2A 4Q7YA 1GI9B 2BQ6B 2Z7FE 4OGXA 2A4QA 2ZGHA 1SOTA 2ZGJA 1KLJH 1P05A 3SW2B 2C8ZB 1PQ7A 1NRSH 3KF2A 2VIWA 4CRCA 3M7TA 1HNEE 1XUFA 3TIUA 2QXHA 2D8WA 2OINA 1F5RA 5EQQA 3SJ9A 2PR3A 2A5AA 1YLDA 1XUKA 2F9PA 3U28C 4LZ4B 5E2PA 1SFIA 5C5NA 5JYIA 1QRWA 2FOAA 3MNSA 4KGAA 4K1SA 2WZQA 1PJPA 1TMBH 3FFGA 1HV7A 3V13A 2EI8A 1G32B 2PSXA 1TBRH 2ZO3H 2BY9X 1GBTA 3ZZDA 1LO6A 3FP7E 3SJOA 3RXRA 1G30B 1V2ST 2IPHA 1V2KT 1G9IE 2B0FA 1P11E 1K1PA 1EAIA 2ZG0H 2AMPA 1ESBA 2QF5A 2P94A 3FZZA 4IGDA 2V3OH 1K28D 1ZMNA 3LJOA 1SHHB 3LH3A 2Y81A 2BD7A 2P8OC 4TY6A 3IWMA 1GHBG 1Y5AT 1O2XA 1BHXF 1SGCA 2GCTB 1ETSH 1AHTH 2Q6DA 3CS0A 3WWFA 1EOLA 1SGFG 3OSYA 4DY7B 2VGCB 3BTGE 2GTBA 1KTTB 1YC0A 2BM2A 4FUDA 4CR5A 3GISB 1TMTH 2TPIZ 4B74A 1SGEE 4WH6A 1ORFA 2O8WA 1AE8H 2H6MA 3EA8A 3ZZ5A 3S9BA 2A4GA 1TFXA 1EP5A 4WWYA 1O3AA 1N6XA 1CBWC 1C5PA 4O3UA 1P2OA 3T27A 5K0HA 4X2WA 2UUYA 1GL0E 4BNRA 1V2UT 1HAOH 2TGAA 1KSNA 1GJ7B 2LELA 1KXEA 1O3HA 1UW7A 2VIOA 2NU1E 1Y8TA 4WVPE 4CRBA 4ZCNA 1AU8A 3GY6A 4B2BA 1INCA 3RXCA 1BITA 2KAIA 1CO7E 2B9LA 1ELTA 4RSPA 3SHCH 4I33A 3KQCA 1QJ7B 1RJXB 1TLDA 1DLEA 2PHBA 4NZQA 4RN6A 2DUCA 2ZTXA 2FOFA 4DJZB 2A4RA 4X0WU 1V2TT 3VFEA 1DX5M 1W14U 3HKJB 3R3GB 1SQAA 2Z9LA 3ZZ7A 5AFYH 1CGJE 1GMDG 3RXOA 1BBRK 4NA7A 2AGIX 7KMEH 1DXPA 2OD3B 2ZHQH 1D4PB 2ZU5A 1OS8A 1DE7H 1EJMA 4AFQA 3TH4H 4GVUA 4B2AA 2BLOA 1ESAA 4ZKNU 1H9HE 3A7ZA 3GDUA 3QWCH 3M37A 1UHBB 3VB4A 4I8LA 2PSYA 2OQ5A 3NK8A 1EKBB 3QTVH 1SGFA 3RUOA 4Q80A 4XDEA 1P9UA 3UY9A 2EI7A 2Z94A 1DUEA 1FMGA 1PPHE 1KDQB 3OTJE 1GCTC 3RXVA 4Y76A 5LH8A 3URCA 4ZUHA 5PTPA 3OAAD 2J98B 1OWJA 1BRAA 3A83A 1GBLA 2FOHA 1SQOA 3PTBA 1SLXB 2B7DH 6GCHG 5GJ4B 1C2EA 1SGTA 4O03A 3RXTA 1TIOA 1W0YH 2H2ZA 3EQ0H 4IMZA 1IQEA 3T28A 1SGNE 3RC5A 3ITIA 3DT0H 4YLUA 4ZROA 1WQVH 1QJ1B 1IQMA 4JZDH 1MTNB 2C8YB 3A82A 5FCKA 3ATIA 1DDJA 2RDLA 3B23B 4X1RU 3E0PB 4TWWA 5A2MH 3UB0A 4XSKU 3KYGA 3SUDA 1JRTA 4AN7A 1MD8A 5IDKA 4INKA 1XUJA 1MZAA 1AWHB 5FCRA 1THRH 3E3TA 4CH8B 2ZDNA 3VB6A 1O3LA 2A45B 3DD2H 1G3EA 1FY8E 2Z3CA 1WSSH 4MQAA 1HJAC 3BTFE 4CHAC 1O37A 2P59A 3RXKA 1OOKB 2ZDKA 4KTCA 4YLQH 1O2VA 3DHKH 1P9SA 4UONA 5LPRA 1ZHPA 3VGCB 5EXLA 2GT7A 4CRAA 1QRZA 1RXPA 4CRDA 4AOQA 3S9AA 3D49H 1VZQH 3RXMA 1WBGB 5CHAB 1TPOA 1O2JA 1C2JA 3H5CB 1E1RD 1CE5A 3F68H 2QCYA 5DP5A 2FPZA 2ZWLH 1IAUA 4I8GA 1C9TA 4A1XA 2ZNKH 2BQ7B 2UWPA 1LCYA 4IC5A 2UWOA 4F48B 4MPUA 2FS9A 3MNCA 1NFWA 3E91A 2TRMA 1O30A 2STBE 1HYLA 3NRLA 4IS5A 1DLKB 3UOUA 1YWUA 3F0PA 4ISHH 2CHAC 3MNBA 2F9UA 3A80A 5FXLA 1UJ1A 3RXJA 2WPKS 1HJ9A 3WWBA 2C8XB 2W7UA 4PROA 1QGFA 2SGAA 1UTQA 1BOQA 1DICA 5DKMA 5B6LA 1AMHA 4AB9A 1BDAA 1QA7A 3SU1A 1FIWA 1EB1H 1SOZA 2QIQA 3BTWE 2TIOA 3T2NA 1N8OB 2B8OH 1KXDA 3KQEA 2I6QA 1QRXA 2OC8A 1GI1A 1UVSH 1DUAA 1ZHMA 4ZHAA 1O2QA 3D62A 4VGCB 3V0XA 4KP0A 1C2IA 1BMAA 1XX9A 5GCHG 2BXTH 3GY5A 1IQKA 3NUMA 1HAYB 1YLNA 1FDPA 1ANEA 4GHQA 4NSVA 1P2JA 4OGYA 1GI3A 4OS1A 3ZVGA 1BT7A 3ZVBA 3UR9A 1Z7KA 1QNJA 3TJOA 3U8RH 3KQ5A 2RDEA 1ZJKA 1IQHA 3O8DA 4FETA 2ZF0H 2BLVA 2GV6A 3SV7A 1AIXH 4ZMAH 2PW8H 4E06H 2VIDA 3GCHB 3W95A 1GHXH 2JETC 3SJIA 6LPRA 1KDQA 1MCVA 1NT1A 2AERH 1EP6A 2GVFA 3IITA 2AGGX 4I32A 2R3UA 3PRDA 1HXFH 2HNTE 1A3EH 2G51A 3TJNA 5A0AE 1MKWK 3H7OA 1CGIE 1CHGA 2GV7A 3ZZAA 1GJCB 1ABIH 5DP6A 1ETTH 3CP7A 4AX9H 3O8CA 2CF9H 4AYVB 3OU0A 3AW1A 3GYMA 3LJJA 5EGMA 3HATH 2PKSB 2ANKH 1P04A 1C5ZB 3LDXH 5HM9A 3RXPA 2F83A 4TWYA 1C4U2 3UIRA 2FX6A 3RU4E 2BB4A 4Q7ZA 3URDA 4F4OC 1GGDB 3KGPA 4JMYA 4ABJA 1UTNA 1HFDA 5JPMH 3T26A 1QJ6B 4YZUA 9LPRA 2ODQA 5JBAS 3MU5A 3MU4A 2OC7A 4JYTA 1LPGB 1GDNA 4SGAE 4Z1MD 4DURA 1JWTA 1Y3WA 2VIPA 1YYY1 3PMHB 3LC5A 5ETXA 3MU0A 4I8JA 1DXWA 3VEQB 1F2SE 2GD4B 4WY3A 2A7HA 1MBQA 1A0LA 1QIXB 4NCYA 2Z9KA 1GBIA 5AHGH 4ZH8A 2ZDLA 2ZPQA 3SOSA 2ZFQH 2BXUH 3Q00A 3ZZ6A 3KQBA 1GHWH 1O2OA 3ELAH 5EU8A 1KYNA 3SJKA 2OC0A 3PO1C 4CR9A 1OXGA 2ZQ1A 1CT4E 3LGYA 2Y5HA 4X2YA 2NU2E 1C2DA 4JZ1A 2ANYA 1IHTH 2P3UB 2A4OA 5DO4H 1O3NA 6GCHF 1VITG 1SLVB 5JDUB 4WXIA 4AGKA 2LPRA 1BMMH 2H9HA 4H6TA 1ZPBA 1OPHB 5EXNA 1O2YA 4ABHA 1NBME 3RLYH 1G3CA 2AMDA 2F91A 1K1NA 2HWLB 2PGQB 2GKVE 4DOQA 5T6FA 1LKBA 2G5NA 1O5DH 1Q2WA 1T8NA 2ANWA 2BDBA 2WPHS 1LHFH 4FU9A 3ZV9A 3T5FH 4FUHA 1AB9B 2SNVA 3Q3XA 1RIWB 1L4DA 1P2QA 3MH6A 4ISNA 2G55A 2OBOA 4X1SU 3NXPA 5TCCA 1P2KA 2ZHFH 1D6WA 1QHRB 2ZDVH 1K1IA 3MYWA 3PLKA 2Y7ZA 1GBFA 1H4WA 1HBTH 1WQSA 1AZ8A 5FBIA 2SGFE 4TYDA 2P3FH 1XKAC 5E8EH 3BG4C 1SGDE 1VCPA 1JBUH 2FTMA 5JBTA 4Y10E 1O3JA 2KX4A 3SI4H 2KCAA 1SKYE 1XM1A 1AFEH 2QXJA 1UTMA 1O32A 1P3EA 1ELAA 1O5EH 5EJZA 5EJ1A 3HK6B 3RXIA 3ZZBA 1CA0B 4WXVA 2ODPA 5F6MA 5DN6D 3MH5A 1BB0B 2QXGA 2F9NA 4IN1A 4U01A 4HGCA 4Y79A 1D3TB 3OTPA 2C3SA 3HGPA 3FANA 5I46H 1AVXA 2HVXA 3BSQA 2HOBA 2GDEH 2FYQA 2SGEE 3DFJA 4HFPB 1YPMH 2RFKC 3RXFA 1RGQA 1P12E 1TE0A 4X6MA 1NRRH 3OY6U 4BOHA 2ZQ2A 1MKWH 3RM2H 1VR1H 1DSUA 4ZKOU 4U2WA 3RMNH 4BTUB 2NU3E 2GZ7A 1QBOA 1KXCA 4ABFA 5HKKD 3A8DA 3HK3B 1C2GA 1WUNH 2BY8X 1O34A 4GUXA 2A7CA 4E7RG 1GBHA 5EOKA 1EB2A 3EE7A 2QY0B 3BTME 4IC6A 1KXBA 5DG6A 1QB1A 1DS2E 2XNIA 1W11U 1MKXK 1GI8B 4UFEH 3SJ8A 1YPJH 2W3KA 3QK1A 4O97A 2PKAA 2C93B 2GZ8A 3BTHE 1O2RA 4ZXXH 1VJAU 3A7XA 3AAUA 1NN6A 3A8CA 1G2LA 4NZLA 3UWIA 1F92A 2VWLA 3RXEA 3FP6E 1O2TA 1WCZA 3U98H 3A8AA 2J2UA 1O38A 2V3HH 2QE7D 3RMOH 1FY3A 3PMAB 1AY6H 4GAWA 1LQEA 1X7AC 1D6RA 2A5IA 1C5MD 4I86A 2WINI 4CBNA 1W0KD 1FPCH 4MLFB 1GHYH 5C1YA 3UTUH 2R9PA 2XC4A 2BMGB 3SYJA 2KAIB 1QR3E 3SUGA 8ESTE 1O2IA 2XYAA 1VITH 4NA9H 4K60A 4CH2B 1HCGA 1TNIA 2CF8H 5FHTA 1C4V2 3F2HA 2FOBA 3OX7U 3DFLA 1TNHA 3F1SB 1YPGH 1BTXA 1C1NA 1NC6A 4E05H 2O8LA 5CE1A 3A89A 1PPZA 1N6YA 5JBBS 4OS7A 1UVPA 3RXQA 1W3CA 3NZIA 4BXSA 1G3DA 1XVMA 2YMSC 5HGGA 1O3CA 1ZGVA 3ATMA 3F0OA 2JJ2D 1BA8B 1IQIA 4WMFA 1AUJA 1C2KA 1A0JA 1GI2A 4FUEA 3F9FA 4HI3A 1ZMJA 3K6YA 1CQQA 1LHGH 3ATKA 4D7GA 3TJVA 2G8TA 2R2MB 3GY2A 4NWKA 3KIDU 1MU8B 1F0TA 1MTVA 1SPJA 2BY7X 1DT2A 4GSOA 4BANB 1OYQA 2ILNA 1BMLA 2KR7A 3BEIB 3OY5U 3VXFH 4I8HA 1ZPCA 1OWEA 3OYPA 3C27B 5AFZH 4YT6H 5FL7D 1L1JA 1S0RA 4D9QA 3LIWA 4NG9H 4Y0YE 4H42U 1ARCA 1FY1A 2WPDD 5FX5A 2DE9A 5DP9A 2ZFFH 2JKHA 3SQEE 2P8OB 1L1GA 2ZGCA 1DANH 3E6PH 3UAIC 1V2QT 4TPYA 2VH0A 3SNEA 1M9UA 5T6DA 1P57B 1AFQB 4P02A 1O3EA 1Y59T 2VB0A 1YCPH 1C9PA 1NU9A 3MMGA 2H5DA 1MD7A 1UVOA 1L2EA 3STIA 1NFYA 1Z8RA 2Y5GA 2JJ1D 3CNRA 1NFXA 3TGJE 1FLEE 3A86A 3M7QA 4LZ1H 1DY8A 1SGPE 3RMLH 3UPEA 2OP9A 1O5FH 1CVWH 2ZHWH 4NIYA 2BD2A 3ENSB 3QZRA 4Y8YA 2FMJA 3KCGH 1GBCA 3GCTF 1ARBA 3RC6A 1THSH 1AWFH 1V2OT 1O3FA 2P93A 3PYHA 2AEIH 9ESTA 5E0JA 1W7GH 1V2PT 1NBMD 1C5LH 3GCNA 1LVMA 2V3MA 1Z8IB 2ODYB 2FI4E 1DWEH 2SGDE 1YPEH 4Y7AA 1FUJA 1SGQE 1A61H 4B6EA 4BAHB 4K8BA 1GBBA 2OTVA 4X6NA 2J4IA 3A81A 4K3JA 1TGTA 4THNH 1UK2A 2XCNA 1MU6B 2ZIQH 1YPHE 2BQWB 1SLWB 1TONA 3S0NA 3ZIAD 4LOYH 1TOCB 3KN2A 2Y5FA 5L2YH 2BD8A 3SORA 1O0DH 4ISIH 4XBBA 1XMNB 3DSPA 1S6FA 1OP8A 3ZYDA 4D76A 1GDUA 3P8OA 2XCFA 2HNTF 1GMHF 1DWDH 2WYGA 2KCOA 1FAXA 3Q76A 1EPTC 4NFEA 3PLBA 3MHWU 1SI5H 2CN0H 5G4BA 4RT0A 2YMSD 3GY8A 3RXGA 7GCHG 1WXRA 1C1TA 1HAIH 3MU8A 3UQVA 1TALA 1W2KH 2H9TH 3F6UH 3JZ2B 1PQAA 1H9LB 3PLPA 1GMDF 2QAAA 1LPZB 3PMBB 4A7IB 4UFGH 1FQ3A 2BTCE 1SVPA 1F5KU 1W7XH 3C1KA 1QL7A 5FPTA 5C0TA 1V2NT 1TX8A 2V0BA 2OK5A 1HUTH 2PTNA 1O5GH 2BY6X 2Z9IA 1C2HA 1DPOA 3SHAH 1PFXC 3U1IB 3PV5A 2O8MA 4NFFA 4B6FA 4UFFH 4XD7D 1EJNA 1FN8A 2GJGA 3LGUA 1H8HD 5ESTE 4ABAA 1BJVA 1F0SA 3LPRA 1TX7A 2BD9A 2WPJS 1RFNA 4DIIH 1V2LT 2HRVA 3U69H 4TT3D 1RRKA 4GPGA 1YP9A 5FBEA 3EDXB 1SSXA 1ELDE 1C5UA 2ZFSA 3ZZ3A 1O3PB 1SQRA 4B1TA 3BTKE 1GVLA 4A1TA 1CT0E 3M5OA 1BCUH 1AD8H 1GI4A 1N1LA 3P92A 1O2MA 2JH0D 2W5EA 1AVWA 2ZDMA 2KCYA 5K7RA 2ZGBH 5JB8S 5EPNA 3SNBA 2XTTB 3GDVA 1ZMLA 1C5TA 1EXFA 1XUIA 1SMFE 5KGOA 1Z1JA 2FI5E 2WHXA 5GPIB 4HTCH 1K21H 2YNAA 2ZPSA 3UNQA 3N7OA 1A5IA 4ISOA 5EJLA 2EC9H 2UUKB 1BIOA 1ZLRA 2IOTA 3GOVB 1YGCH 1WOFA 3ZVFA 3D23A 3JZ1B 2G52A 4INHA 4X1QU 1TRMA 1V2MT 1XXDA 5JBCS 1O36A 1MTWA 1TGSZ 3HKIB 4Y71A 1K1MA 3SBKA 3LT3A 3B8JA 2O9QA 3E90B 4M9FA 2GX4A 4CBOA 3SU0A 2QF4A 2FS8A 1YM0A 2HLDD 1JMOH 1HPGA 5C1UA 2D26C 3GCOA 1CGHA 3E8LA 3HGNA 4ABDA 1S81A 2BOKA 1GJ9B 1TAWA 1V3XA 1L1NA 4Z6AH 3A7TA 5EW2H 5KEDA 2IJD1 2ZEBA 3QX5H 1C1SA 4RI0A 2WPMS 2G5VA 4UDWH 1P2MA 1BBRH 2IPQX 1A1RA 1K1JA 4X1PU 2QA9E 1S84A 3RU4T 1QL8A 4GLYA 2FLRH 2J9NA 2AMQA 2V6NA 2YOLA 8LPRA 1B5GH 1GJ5H 2AFQB 1BRCE 1HJ8A 4ISLA 1B0EA 3W94A 2SGQE 1TNGA 2HVYB 3UREA 1TA6A 4K1TA 2Z3DA 3F3BA 5E0HA 4FXGH 1D3PB 3N99A 1MABB 3LGWA 3SGQE 2BVRH 4TPIZ 3QN7A 2W7SA 2Y7XA 1EAWA 2PUQH 1IQJA 3TLOA 3SV2H 2L74A 4AGJA 4WH8A 1QURH 3BIVH 3BF6H 3FOAA 1MAYA 2H9EH 5HIZA 4MNXA 5LPFA 2V7QD 2GMTC 4M7GA 1LPKB 1T8MA 1LVYA 3DSGA 3DSOA 2GCHG 1C2MA 4X8UH 1PQ8A 1MUEB 4YOGA 5GCHF 3LGVA 3MU1A 3SZNA 4LK4A 2NU0E 1CA0C 1GHZA 1O5AB 3T29A 5HXFA 2A5KA 1NESE 1P2NA 2BD4A 1QCPA 2FM2A 1RTLA 2ZECA 1LQDB 1GI7B 2WPIS 2XW9A 1W12U 2PUXB 1NPMA 1KXAA 1VCWA 5EQRA 4AFSA 3NKKA 1OX1A 8GCHG 1XKBC 1SGIB 2OXSA 2PTCE 1OWHA 1UTLM 3RXLA 1YCPM 4ESTE 4BTIB 1AZZA 2ULLA 1J17T 1JIMA 1T4UH 1TNKA 2IJOB 1XUHA 3ZVCA 5JB9S 1MQ5A 3P8NA 4F55A 1MTNC 4FUCA 2GP9B 1K0HA 1SGRE 1K22H 5EPYA 1AGJA 1O2NA 3E1XB 4XRNA 2ZPRA 1WV7H 1OHHD 4JZFH 2ZP0H 1E34B 4HG6A 2R3YA 2ZCHP 2PV9B 1S82A 3H09A 1JIRA 4D7FA 5J4QA 1LHDH 1C5YB 3FKSD 5E0GA 3KL6A 1BTYA 1E0FD 1O3DA 2ZGXH 3ATLA 5GIBA 1MTUA 1QQ4A 1S85A 3BTQE 1O3OA 1PPGE 5GXPA 2C4FH 1GI5A 3ZVDA 1ZSKA 5FX6A 3A88A 2K0QA 1DSTA 4DVAU 2J5UA 1HIAA 2J38A 3PMJA 4QT8C 1TPAE 1YLCA 5DP7A 3I29A 2G4UA 4IBLH 4CHAB 2VIQA 4Y6DA 4A92A 1BTPA 3RM0H 3LONA 1UCYH 1GBMA 1BRUP 1H8ED 3BTDE 1QBNA 2ASUB 1C1OA 2BDGA 4IW4E 2EI6A 2A32A 1FI8A 3U9AH 5J4SA 5C2ZA 3B9FH 4YT7H 4VGCC 2A1DB 1Y5UT 4A6LA 1YF4A 1GL1A 2XC5A 1SHYA 2Q1JA 4AFUA 4JYVH 3M36A 2BDYA 3UQOA 3TH2H 1QA0A 2XBXA 5EODA 3LGTA 1F0UA 2FOGA 2BHGA 3ZZCA 4ACBA 2BLWA 1L0ZA 2JDID 1ZTJA 1GMHG 1DY9A 2BYAX 4CRFA 1SC8U 2VWNA 2G4TA 1P03A 2J34A 1O35A 3FN8A 1OP0A 3VB5A 5B6OA 3KYFA 7GCHF 1GHVH 2CHAB 4CRGA 2BVSH 2FEQH 1EQ9A 4NIVA 2ZZUH 1PPBH 1O2SA 1QL9A 2VH6A 2J95A 3DCLA 3M7UA 4AYYB 2FLBH 3TNTA 2XWBI 3K65B 5FAHA 3BV9B 3SZEA 1UO6A 1EZQA 2GGVB 2VIVA 4FVDA 2PFEA 2ZDAH 3SI3H 1AN1E 2CK3D 3QZQA 4GCHF 2DE8A 1BQYA 2D1JA 3WY8A 3LC3A 3EYDA 1V2WT 1Y3YA 2QF0A 3RXSA 4Q4LA 1AKSA 1O2UA 2XNDD 4OM9A 1E35B 5FPYA 1KXFA 1QZ8A 1FN6A 1IHSH 4YOIA 5A8YA 1GJBB 4Y8ZA 1GI0A 1GVZA 3GDSA 3P8GA 3RDZA 1L4ZA 2AS9A 1VGCC 3SNCA 3KNXA 1O3MA 1T31A 2VNTA 3MO6A 4UE7H 4NSYA 1H8DH 1OP2A 1TQ7B 3M3SA 4MPVA 4KELA 2OCVB 3EA7A 4I7YH 4XOJA 5GNDA 4Y7BA 2JETB 1YY3A 1TQ0B 2P95A 1J15A 1P8VC 3U1JB 1MQ6A 3NPSA 1GJ6A 3LH1A 5C0UA 3O8BA 4INLA 3RC4A 2ALPA 2O8TA 2VGCC 3E0NB 2GDDA 2SNWA 1LHEH 3HPTB 4WF8A 1Y3UA 1DOJA 4ABBA 2VVVA 3TPIZ 1C5VA 3SO3A 2BX3A 1D9IA 1NRNH 1C5XB 3ZZ4A 1OWKA 1GMCF 3QLPH 4AG2A 1Z6EA 3ZYEA 1UVTH 3PO1B 1THPB 7ESTE 3U8TH 5F8TA 1HGTH 1S83A 3IG6B 4MG3A 3QO6A 1GI6A 1ZGIA 2W3IA 2XBVA 1CT2E 3NWUA 1PYTC 1BJUA 4GHTA 4K2YA 2HALA 1C5OH 5T1VA 1XUGA 2F43B 2BOHB 3A84A 3K6ZA 1GCTB 5A0BA 2BZAA 2ZFPH 2HLCA 3FZDA 1LTOA 3M5MA 1T4VH 1OWDA 1GBAA 2BLQA 3D65E 3SUFA 4R8TB 1O31A 5DP8A 5EXMA 2SGPE 3PROA 3V7TA 3TH3H 3QDZB 3QGNB 4WMEA 1AB9C 4BAMB 4SGBE 1GJDB 1SQTA 2V35A 1MMJN 3SU5A 1HAVA 4AFZA 2VWMA 4FUGA 2J98A 3A7YA 4MPXA 4DGJA 2BDHA 4ABEA 1ZHRA 4TSFD 2D2DA 1G37A 1H1BA 2AH4X 7LPRA 5CHBA 2ZU4A 1CA8B 3ESTA 1ZOMA 4ACAA 2FOCA 3EGKH 1FJSA 4Q2KA 4DT4A 5L2ZH 4XBDA 3TITA 4AZ2B 3V12A 1TGNA 1IOEA 4OS4A 1IQFA 1HAZB 2Z9JA 3A7VA 5TJXA 3UOPA 3LU9B 2VVCA 2QF3A 3BEFB 3BTEE 4FU7A 3OFND 1DWCH 3M5NA 3RXAA 2GCTC 3MWIU 3BG8A 4JYUH 1ZR0A 1TPSA 3FO8D 4Y0ZE 3AASA 2XC0A 4AC9A 4MNWA 4B76A 6CHAB 1O3GA 1DM4B 1C5SA 2AIQA 1EAUA 2LNCA 5F8ZA 2ZC9H 1PPEE 4ZAEA 1Q31A 1C1WH 2FOMB 3TK5A 3ODDA 1DITH 5A8ZA 3TVJB 3K2UA 2XBYA 3F9GA 4YTAA 3QUMP 1UTKA 3KHVA 3W1EA 1Y5BT 4YO9A 1HXEH 1A7SA 1D3DB 1MKXH 1ZSJA 4FU8A 2VBCA 3LOXA 1WAYB 3F2GA 3STJA 2Y6TA 2A31A 3QTOH 1FNIA 3NCLA 1AO5A 2Q6FA 4H6SB 4X8TH 5GWZA 2EQNA 1CHOG 5E2OA 1RS0A 1C2FA 1RTKA 2G81E 3MH7A 3P17H 5KECA 2QYIA 2HGTH 2EY4C 5AF9H 3BIUH 1P02A 3TGIE 1K1LA 2CV3A 1W8BH 2NWNA 3F2FA 1KLTA 2TBSA 1P09A 1BMNH 3UNSA 5ABWA 4DT7B 3K9XB 1A2CH 2ZTZA 3FVFB 5C17A 4X8SH 1UCYK 1WDIA 4Z0KA 2M2AA 1KTSB 5ESBA 4ASUD 1AFQC 3SUEA 3RXUA 1V2RT 2AIPA 1J8AA 3O8RA 4JCNA 2F4LA 1W0JD 5EIYA 3S7HB 1MTSA 1O33A 1ZRBA 4DG4A 1O3KA 1KY9A 2FX4A 3MOCA 2QXIA 5CHAC 4BXWA 1O2LA 2ESTE 4BAKB 3UWJH 5CDFE 3S7KB 1WTGH 5EG4A 4X1NU 3A8BA 3ATWA 1ANBA 4AB8A 1J16A 1OKXA 2ZI2H 1PYTD 4JZEH 1GBKA 2UUFB 1C1MA 1GCDA 5DSFA 2OBQA 2PLXA 4KTSA 2VJ1A 3L6PA 5C67A 4H4FA 1Y3VA 2OQUA 4B2CA 3Q3KA 1UCYE 1PPFE 5FPSA 3AVZA 1AE5A 2LP6A 2Q6GA 1TGCA 1UVUH 2SFAA 5L6NH 5LPEA 1IQGA 1ELEE 1A5HA 1EFRD 1DFPA 4NA8A 1FY4A 1K2I1
chains in the Genus database with same CATH topology
2J98A 2J97A 5HIYA 5HIZA 3EE7A 2J98B 1UW7A 5C94A 1QZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 A;  2J97 A;  5HIY A;  5HIZ A;  3EE7 A;  2J98 B;  1UW7 A;  5C94 A;  1QZ8 A; 
#chains in the Genus database with same CATH topology
 1E79 D;  1GHA F;  3N7D A;  2R0K A;  2TGD A;  1E1Q D;  2J94 A;  1N8O C;  1NRP H;  2VIN A;  3AK5 A;  1RIW C;  1EAS A;  2ANM H;  1GG6 C;  1TX6 A;  4I31 A;  5DK1 A;  5C20 A;  2W6I D;  5H4I B;  2VVU A;  1HLT H;  2XWA A;  1VIT F;  3LGI A;  1SG8 B;  5HM2 A;  1QB6 A;  1KIG H;  3MQK C;  1NY2 2;  1PQ5 A;  4BAO B;  2A2X H;  3M61 U;  1EZX C;  4ABI A;  2G00 A;  3P70 B;  5C3N A;  2ZU3 A;  1UTJ A;  4B75 A;  3SN8 A;  3ODF A;  1J9C H;  1CHO F;  1F7Z A;  4ABG A;  2RA0 A;  4JK6 A;  2RCE A;  4WMD A;  2WPL S;  3L3T A;  1V2V T;  1F0R A;  1QFK H;  2QC2 A;  5L30 H;  3BEU A;  1GJA B;  3SGA E;  2P3T B;  4FVB A;  1VGC B;  1OSS A;  2GMT B;  4JK5 A;  1ZSL A;  2ZA5 A;  2J92 A;  3TNS A;  3MFJ A;  2I6S A;  3GYL B;  2TGT A;  3BN9 A;  3M5L A;  4HZH A;  1EUF A;  1O2H A;  2WV9 A;  1A3B H;  4LXB H;  3OEH D;  4O9V A;  2FOE A;  4X2V A;  1NZQ H;  2FXR A;  1A0H B;  2FZZ A;  1QB9 A;  1S0Q A;  3PTN A;  4OS2 A;  4MNV A;  1EOJ A;  1SB1 H;  1MH0 A;  2W6J D;  3VGC C;  4D8N A;  2WYJ A;  4BAQ B;  2NU4 E;  1S6H A;  1ELC A;  3L33 A;  3TU7 H;  1V2J T;  1W0Z U;  1DWB H;  1MBM A;  2GT8 A;  2FO9 A;  2ZU1 A;  3M35 A;  2OLG A;  1LVB A;  2YNB A;  8KME 2;  4UD9 H;  1CBW B;  4XFQ A;  3MH4 A;  1E37 B;  4D9R A;  3U8O H;  1UHB A;  2ZTY A;  1GVK B;  3SU3 A;  1HAV B;  2GZ9 A;  1KMH B;  1TAB E;  2WUB A;  3QGJ A;  1RD3 B;  1CSO E;  2ZU2 A;  3SV8 A;  1SFQ B;  1T32 A;  1ID5 H;  1AND A;  3SV6 A;  3DUX H;  3PWC A;  1GBJ A;  3F9H A;  1C5Q A;  2BZ6 H;  1HRT H;  3ZVE A;  3SNA A;  1TA2 A;  3OEE D;  2BDA A;  1C5N H;  1F5L A;  1A5G H;  2Y82 A;  2FOD A;  4J1Y A;  4OS5 A;  1EAX A;  1HJA B;  2HPP H;  1Z8G A;  5T6G A;  1ELF A;  1O5B B;  4ZKR U;  3VXE H;  1SGY E;  1ZYO A;  5HMA A;  5A09 A;  4RT1 A;  2CGA A;  5DPA A;  2BD5 A;  3PRB A;  1U6Q A;  5LGO A;  5A0C A;  2PGB B;  1GHB F;  2XOK D;  1C1P A;  2ZHD A;  1EPT B;  1TRY A;  5F53 A;  1O2K A;  1BZX E;  4X8V H;  1HAX B;  3PWB A;  4NGA H;  4FUB A;  5EW1 H;  1NU7 B;  1O2P A;  3RXH A;  3M3T A;  1ZPZ A;  3SU6 A;  2VU8 E;  1VCQ A;  4ZXY H;  3SQH E;  1TPP A;  1HIA B;  3BG4 B;  3P95 A;  1C1V H;  3FAO A;  1ZZZ A;  2C90 B;  1EX3 A;  4YES B;  1C1U H;  2BDI A;  1ETR H;  2PP6 A;  4X6P A;  2JH6 D;  3A87 A;  1BUI A;  1YPL H;  4I8K A;  1LKA A;  1SLU B;  3PM3 A;  1FZZ A;  1C5W B;  1K1O A;  1A4W H;  1RTF B;  1HB0 B;  3GY4 A;  1QBV H;  1T7C A;  2EEK A;  3N7E A;  4OS6 A;  5HIY A;  4XE4 A;  3RXD A;  2A0Q B;  2BDC A;  3AAV A;  1BMF D;  2K1Q A;  1W13 U;  4FUJ A;  1GMC G;  4UFD H;  4GCH G;  2H1U A;  3GY7 A;  5DJ7 A;  5SGA E;  3AW0 A;  2QGR A;  1P3C A;  4KKD A;  4U32 A;  2J97 A;  1NRQ H;  1TBQ H;  2P16 A;  1YKT A;  1GWA A;  1AI8 H;  1NM6 A;  3EAJ A;  5C1X A;  1WU1 A;  2TGP Z;  2A7J A;  3KQD A;  4ZHL U;  4MNY A;  2OUA A;  1B7X B;  3TJU A;  2WUC A;  1ELB A;  3I78 A;  5I25 A;  1TB6 H;  2FI3 E;  1FX0 B;  2PWX A;  1XVO A;  5DP4 A;  3P8F A;  1ZJD A;  1FAK H;  1GPZ A;  3R0F A;  1SL3 A;  4CRE A;  4RKJ B;  2KCP A;  1UK4 A;  4A5T S;  3DA9 B;  1LDT T;  2ZCK P;  1GBD A;  4RKO B;  1C1R A;  4K8Y A;  3SND A;  2THF B;  1Z71 A;  5CMX H;  3PV2 A;  5EQS A;  3SU2 A;  1OWI A;  8GCH F;  6EST A;  1S6L A;  3UUZ A;  1TYN A;  1G2M A;  4X6O A;  4MPW A;  1SR5 C;  1XXF A;  3RLW H;  2EA3 A;  2IN2 A;  1IQN A;  2L6O A;  3KEE A;  3GY3 A;  4Y11 E;  2FES H;  2C8W B;  2AHM E;  1K9O E;  1HDT H;  2BY5 X;  1QQU A;  2JIZ D;  1FY5 A;  5F8X A;  1QTF A;  2Z6B D;  1SBW A;  4U30 A;  3RU4 D;  2R0L A;  4K69 A;  3EE0 B;  4Q63 A;  4MTB A;  1H9I E;  5IK2 D;  3VPK A;  2K8I A;  2OC1 A;  1FON A;  4AOR A;  1WTH D;  1G3B A;  4B71 A;  1GJ4 H;  3MO9 A;  3UR6 A;  4DIH H;  5C5O A;  1YBW A;  1H8I H;  3OE7 D;  4O3T A;  2HNT C;  3S9C A;  2ZCL P;  1C2L A;  2XBW A;  1GGD C;  2RA3 A;  3Q77 A;  3T62 A;  4UEH H;  1Q3X A;  1OYT H;  1FPH H;  2KFW A;  2ZFR H;  1AKS B;  1HAP H;  5HYO A;  1B0F A;  1ANC A;  1D3Q B;  1ACB E;  3UNR A;  1EAT A;  1Z6J H;  2ZKS A;  3E16 B;  2R2W U;  5GDS H;  1MAX A;  2UUJ B;  4P00 A;  1MZD A;  1W10 U;  2O8U A;  1CU1 A;  1AVG H;  2FYR A;  3PB1 E;  4DCD A;  1LMW B;  2F9O A;  3TGK E;  2Z3E A;  1TMU H;  4E7N A;  5AVD A;  3S69 A;  1YCP K;  1BTZ A;  3GCT G;  1P2I A;  3ZV8 A;  5IYT A;  1ELG A;  3LKW A;  1EZS C;  1O3B A;  2FWW A;  3A7W A;  3H7T A;  1C1Q A;  1GG6 B;  2B5T B;  1P06 A;  4BTT B;  1BBR E;  4B73 A;  2FIR H;  1S5S A;  3I77 A;  4WJG 2;  3PV4 A;  4FOU C;  3F9E A;  4NIX A;  4ZKS U;  1T8O A;  2QN5 T;  1EJA A;  1TRN A;  1UTO A;  2KM0 A;  4DW2 U;  2STA E;  2XRC A;  4JZI A;  2ZHE H;  2FP7 B;  1GJ8 B;  2CXV A;  3ZZ8 A;  1C5R A;  2F9V A;  1O3I A;  4ASH A;  3GCH C;  1UTP A;  1V6D A;  1Y3X A;  1AQ7 A;  1ZTL A;  2ZFT A;  2XXL A;  4MDS A;  1VKY A;  2FTL E;  4YOJ A;  1BRB E;  1EPT A;  2VWO A;  2JH5 D;  3RXB A;  4MVN A;  1KLI H;  1DVA H;  1JXP A;  3SU4 A;  1YPK H;  1JOU B;  3MNX A;  1EZU C;  1NRO H;  1TBZ H;  4YXW D;  3M3V A;  4YM9 A;  3RP2 A;  6CHA C;  3SV9 A;  2YMS B;  1TWX B;  3Q3Y A;  5T3H A;  1UK3 A;  1NS3 A;  3FP8 E;  3G01 A;  2ALV A;  2UWL A;  2F9B H;  3RMM H;  3UFA A;  1E36 B;  2PKS C;  2Z9G A;  1GDQ A;  1YPH C;  2WV4 A;  3TK6 A;  3V3M A;  5BRR E;  1BHX B;  3MO3 A;  3TK9 A;  4R0I A;  1NO9 H;  2BD3 A;  4TY7 A;  2AGE X;  1C4Y 2;  4F49 A;  1G36 A;  1COW D;  2M5T A;  4J2Y B;  3CEN A;  5A8X A;  5BPE A;  1A46 H;  1FXY A;  2H5C A;  1FIZ A;  1JRS A;  2GCH F;  2HPQ H;  1GHA G;  1VJ9 U;  5DGJ A;  3ZVA A;  1HAG E;  2Y80 A;  2BVX H;  2QV1 A;  1BTH H;  1E38 B;  5C94 A;  1Z8J B;  5DP3 A;  2WV5 A;  1PPC E;  1ZTK A;  2F3C E;  1NFU A;  2KZ4 A;  3GIC B;  4FUF A;  3ZZ9 A;  1NTP A;  2CMY A;  2WSS D;  1MCT A;  4K1E A;  2CJI A;  2PKA B;  3P6Z B;  3VB3 A;  4A1V A;  4AG1 A;  1WYK A;  2W26 A;  2AYW A;  1BTU A;  1O39 A;  1FV9 A;  4X2X A;  4XBC A;  1UMA H;  4KTU A;  3A85 A;  2BX4 A;  1HAH H;  1O2W A;  4FUI A;  3VB7 A;  1AUT C;  1O5C B;  4Y8X A;  1Z1I A;  1LHC H;  2FDA A;  3BTT E;  1QY6 A;  4ZHM U;  5TCA A;  1P10 A;  3SGB E;  1IQL A;  1BTW A;  4K5Z A;  3VG8 A;  4NIW A;  1J14 A;  4IMQ A;  4Q7X A;  1GBE A;  1ZRK A;  1O2G H;  1O2Z A;  1TOM H;  1P0S H;  2RG3 A;  4NWL A;  3MI4 A;  1ELV A;  1LVO A;  2A2Q H;  5F03 A;  3T25 A;  3MTY A;  3WW7 A;  1TNJ A;  1P01 A;  3EA9 A;  1TNL A;  1TGB A;  1ABJ H;  3CS7 A;  1T8L A;  1EST A;  3GS9 A;  4IN2 A;  4Q7Y A;  1GI9 B;  2BQ6 B;  2Z7F E;  4OGX A;  2A4Q A;  2ZGH A;  1SOT A;  2ZGJ A;  1KLJ H;  1P05 A;  3SW2 B;  2C8Z B;  1PQ7 A;  1NRS H;  3KF2 A;  2VIW A;  4CRC A;  3M7T A;  1HNE E;  1XUF A;  3TIU A;  2QXH A;  2D8W A;  2OIN A;  1F5R A;  5EQQ A;  3SJ9 A;  2PR3 A;  2A5A A;  1YLD A;  1XUK A;  2F9P A;  3U28 C;  4LZ4 B;  5E2P A;  1SFI A;  5C5N A;  5JYI A;  1QRW A;  2FOA A;  3MNS A;  4KGA A;  4K1S A;  2WZQ A;  1PJP A;  1TMB H;  3FFG A;  1HV7 A;  3V13 A;  2EI8 A;  1G32 B;  2PSX A;  1TBR H;  2ZO3 H;  2BY9 X;  1GBT A;  3ZZD A;  1LO6 A;  3FP7 E;  3SJO A;  3RXR A;  1G30 B;  1V2S T;  2IPH A;  1V2K T;  1G9I E;  2B0F A;  1P11 E;  1K1P A;  1EAI A;  2ZG0 H;  2AMP A;  1ESB A;  2QF5 A;  2P94 A;  3FZZ A;  4IGD A;  2V3O H;  1K28 D;  1ZMN A;  3LJO A;  1SHH B;  3LH3 A;  2Y81 A;  2BD7 A;  2P8O C;  4TY6 A;  3IWM A;  1GHB G;  1Y5A T;  1O2X A;  1BHX F;  1SGC A;  2GCT B;  1ETS H;  1AHT H;  2Q6D A;  3CS0 A;  3WWF A;  1EOL A;  1SGF G;  3OSY A;  4DY7 B;  2VGC B;  3BTG E;  2GTB A;  1KTT B;  1YC0 A;  2BM2 A;  4FUD A;  4CR5 A;  3GIS B;  1TMT H;  2TPI Z;  4B74 A;  1SGE E;  4WH6 A;  1ORF A;  2O8W A;  1AE8 H;  2H6M A;  3EA8 A;  3ZZ5 A;  3S9B A;  2A4G A;  1TFX A;  1EP5 A;  4WWY A;  1O3A A;  1N6X A;  1CBW C;  1C5P A;  4O3U A;  1P2O A;  3T27 A;  5K0H A;  4X2W A;  2UUY A;  1GL0 E;  4BNR A;  1V2U T;  1HAO H;  2TGA A;  1KSN A;  1GJ7 B;  2LEL A;  1KXE A;  1O3H A;  1UW7 A;  2VIO A;  2NU1 E;  1Y8T A;  4WVP E;  4CRB A;  4ZCN A;  1AU8 A;  3GY6 A;  4B2B A;  1INC A;  3RXC A;  1BIT A;  2KAI A;  1CO7 E;  2B9L A;  1ELT A;  4RSP A;  3SHC H;  4I33 A;  3KQC A;  1QJ7 B;  1RJX B;  1TLD A;  1DLE A;  2PHB A;  4NZQ A;  4RN6 A;  2DUC A;  2ZTX A;  2FOF A;  4DJZ B;  2A4R A;  4X0W U;  1V2T T;  3VFE A;  1DX5 M;  1W14 U;  3HKJ B;  3R3G B;  1SQA A;  2Z9L A;  3ZZ7 A;  5AFY H;  1CGJ E;  1GMD G;  3RXO A;  1BBR K;  4NA7 A;  2AGI X;  7KME H;  1DXP A;  2OD3 B;  2ZHQ H;  1D4P B;  2ZU5 A;  1OS8 A;  1DE7 H;  1EJM A;  4AFQ A;  3TH4 H;  4GVU A;  4B2A A;  2BLO A;  1ESA A;  4ZKN U;  1H9H E;  3A7Z A;  3GDU A;  3QWC H;  3M37 A;  1UHB B;  3VB4 A;  4I8L A;  2PSY A;  2OQ5 A;  3NK8 A;  1EKB B;  3QTV H;  1SGF A;  3RUO A;  4Q80 A;  4XDE A;  1P9U A;  3UY9 A;  2EI7 A;  2Z94 A;  1DUE A;  1FMG A;  1PPH E;  1KDQ B;  3OTJ E;  1GCT C;  3RXV A;  4Y76 A;  5LH8 A;  3URC A;  4ZUH A;  5PTP A;  3OAA D;  2J98 B;  1OWJ A;  1BRA A;  3A83 A;  1GBL A;  2FOH A;  1SQO A;  3PTB A;  1SLX B;  2B7D H;  6GCH G;  5GJ4 B;  1C2E A;  1SGT A;  4O03 A;  3RXT A;  1TIO A;  1W0Y H;  2H2Z A;  3EQ0 H;  4IMZ A;  1IQE A;  3T28 A;  1SGN E;  3RC5 A;  3ITI A;  3DT0 H;  4YLU A;  4ZRO A;  1WQV H;  1QJ1 B;  1IQM A;  4JZD H;  1MTN B;  2C8Y B;  3A82 A;  5FCK A;  3ATI A;  1DDJ A;  2RDL A;  3B23 B;  4X1R U;  3E0P B;  4TWW A;  5A2M H;  3UB0 A;  4XSK U;  3KYG A;  3SUD A;  1JRT A;  4AN7 A;  1MD8 A;  5IDK A;  4INK A;  1XUJ A;  1MZA A;  1AWH B;  5FCR A;  1THR H;  3E3T A;  4CH8 B;  2ZDN A;  3VB6 A;  1O3L A;  2A45 B;  3DD2 H;  1G3E A;  1FY8 E;  2Z3C A;  1WSS H;  4MQA A;  1HJA C;  3BTF E;  4CHA C;  1O37 A;  2P59 A;  3RXK A;  1OOK B;  2ZDK A;  4KTC A;  4YLQ H;  1O2V A;  3DHK H;  1P9S A;  4UON A;  5LPR A;  1ZHP A;  3VGC B;  5EXL A;  2GT7 A;  4CRA A;  1QRZ A;  1RXP A;  4CRD A;  4AOQ A;  3S9A A;  3D49 H;  1VZQ H;  3RXM A;  1WBG B;  5CHA B;  1TPO A;  1O2J A;  1C2J A;  3H5C B;  1E1R D;  1CE5 A;  3F68 H;  2QCY A;  5DP5 A;  2FPZ A;  2ZWL H;  1IAU A;  4I8G A;  1C9T A;  4A1X A;  2ZNK H;  2BQ7 B;  2UWP A;  1LCY A;  4IC5 A;  2UWO A;  4F48 B;  4MPU A;  2FS9 A;  3MNC A;  1NFW A;  3E91 A;  2TRM A;  1O30 A;  2STB E;  1HYL A;  3NRL A;  4IS5 A;  1DLK B;  3UOU A;  1YWU A;  3F0P A;  4ISH H;  2CHA C;  3MNB A;  2F9U A;  3A80 A;  5FXL A;  1UJ1 A;  3RXJ A;  2WPK S;  1HJ9 A;  3WWB A;  2C8X B;  2W7U A;  4PRO A;  1QGF A;  2SGA A;  1UTQ A;  1BOQ A;  1DIC A;  5DKM A;  5B6L A;  1AMH A;  4AB9 A;  1BDA A;  1QA7 A;  3SU1 A;  1FIW A;  1EB1 H;  1SOZ A;  2QIQ A;  3BTW E;  2TIO A;  3T2N A;  1N8O B;  2B8O H;  1KXD A;  3KQE A;  2I6Q A;  1QRX A;  2OC8 A;  1GI1 A;  1UVS H;  1DUA A;  1ZHM A;  4ZHA A;  1O2Q A;  3D62 A;  4VGC B;  3V0X A;  4KP0 A;  1C2I A;  1BMA A;  1XX9 A;  5GCH G;  2BXT H;  3GY5 A;  1IQK A;  3NUM A;  1HAY B;  1YLN A;  1FDP A;  1ANE A;  4GHQ A;  4NSV A;  1P2J A;  4OGY A;  1GI3 A;  4OS1 A;  3ZVG A;  1BT7 A;  3ZVB A;  3UR9 A;  1Z7K A;  1QNJ A;  3TJO A;  3U8R H;  3KQ5 A;  2RDE A;  1ZJK A;  1IQH A;  3O8D A;  4FET A;  2ZF0 H;  2BLV A;  2GV6 A;  3SV7 A;  1AIX H;  4ZMA H;  2PW8 H;  4E06 H;  2VID A;  3GCH B;  3W95 A;  1GHX H;  2JET C;  3SJI A;  6LPR A;  1KDQ A;  1MCV A;  1NT1 A;  2AER H;  1EP6 A;  2GVF A;  3IIT A;  2AGG X;  4I32 A;  2R3U A;  3PRD A;  1HXF H;  2HNT E;  1A3E H;  2G51 A;  3TJN A;  5A0A E;  1MKW K;  3H7O A;  1CGI E;  1CHG A;  2GV7 A;  3ZZA A;  1GJC B;  1ABI H;  5DP6 A;  1ETT H;  3CP7 A;  4AX9 H;  3O8C A;  2CF9 H;  4AYV B;  3OU0 A;  3AW1 A;  3GYM A;  3LJJ A;  5EGM A;  3HAT H;  2PKS B;  2ANK H;  1P04 A;  1C5Z B;  3LDX H;  5HM9 A;  3RXP A;  2F83 A;  4TWY A;  1C4U 2;  3UIR A;  2FX6 A;  3RU4 E;  2BB4 A;  4Q7Z A;  3URD A;  4F4O C;  1GGD B;  3KGP A;  4JMY A;  4ABJ A;  1UTN A;  1HFD A;  5JPM H;  3T26 A;  1QJ6 B;  4YZU A;  9LPR A;  2ODQ A;  5JBA S;  3MU5 A;  3MU4 A;  2OC7 A;  4JYT A;  1LPG B;  1GDN A;  4SGA E;  4Z1M D;  4DUR A;  1JWT A;  1Y3W A;  2VIP A;  1YYY 1;  3PMH B;  3LC5 A;  5ETX A;  3MU0 A;  4I8J A;  1DXW A;  3VEQ B;  1F2S E;  2GD4 B;  4WY3 A;  2A7H A;  1MBQ A;  1A0L A;  1QIX B;  4NCY A;  2Z9K A;  1GBI A;  5AHG H;  4ZH8 A;  2ZDL A;  2ZPQ A;  3SOS A;  2ZFQ H;  2BXU H;  3Q00 A;  3ZZ6 A;  3KQB A;  1GHW H;  1O2O A;  3ELA H;  5EU8 A;  1KYN A;  3SJK A;  2OC0 A;  3PO1 C;  4CR9 A;  1OXG A;  2ZQ1 A;  1CT4 E;  3LGY A;  2Y5H A;  4X2Y A;  2NU2 E;  1C2D A;  4JZ1 A;  2ANY A;  1IHT H;  2P3U B;  2A4O A;  5DO4 H;  1O3N A;  6GCH F;  1VIT G;  1SLV B;  5JDU B;  4WXI A;  4AGK A;  2LPR A;  1BMM H;  2H9H A;  4H6T A;  1ZPB A;  1OPH B;  5EXN A;  1O2Y A;  4ABH A;  1NBM E;  3RLY H;  1G3C A;  2AMD A;  2F91 A;  1K1N A;  2HWL B;  2PGQ B;  2GKV E;  4DOQ A;  5T6F A;  1LKB A;  2G5N A;  1O5D H;  1Q2W A;  1T8N A;  2ANW A;  2BDB A;  2WPH S;  1LHF H;  4FU9 A;  3ZV9 A;  3T5F H;  4FUH A;  1AB9 B;  2SNV A;  3Q3X A;  1RIW B;  1L4D A;  1P2Q A;  3MH6 A;  4ISN A;  2G55 A;  2OBO A;  4X1S U;  3NXP A;  5TCC A;  1P2K A;  2ZHF H;  1D6W A;  1QHR B;  2ZDV H;  1K1I A;  3MYW A;  3PLK A;  2Y7Z A;  1GBF A;  1H4W A;  1HBT H;  1WQS A;  1AZ8 A;  5FBI A;  2SGF E;  4TYD A;  2P3F H;  1XKA C;  5E8E H;  3BG4 C;  1SGD E;  1VCP A;  1JBU H;  2FTM A;  5JBT A;  4Y10 E;  1O3J A;  2KX4 A;  3SI4 H;  2KCA A;  1SKY E;  1XM1 A;  1AFE H;  2QXJ A;  1UTM A;  1O32 A;  1P3E A;  1ELA A;  1O5E H;  5EJZ A;  5EJ1 A;  3HK6 B;  3RXI A;  3ZZB A;  1CA0 B;  4WXV A;  2ODP A;  5F6M A;  5DN6 D;  3MH5 A;  1BB0 B;  2QXG A;  2F9N A;  4IN1 A;  4U01 A;  4HGC A;  4Y79 A;  1D3T B;  3OTP A;  2C3S A;  3HGP A;  3FAN A;  5I46 H;  1AVX A;  2HVX A;  3BSQ A;  2HOB A;  2GDE H;  2FYQ A;  2SGE E;  3DFJ A;  4HFP B;  1YPM H;  2RFK C;  3RXF A;  1RGQ A;  1P12 E;  1TE0 A;  4X6M A;  1NRR H;  3OY6 U;  4BOH A;  2ZQ2 A;  1MKW H;  3RM2 H;  1VR1 H;  1DSU A;  4ZKO U;  4U2W A;  3RMN H;  4BTU B;  2NU3 E;  2GZ7 A;  1QBO A;  1KXC A;  4ABF A;  5HKK D;  3A8D A;  3HK3 B;  1C2G A;  1WUN H;  2BY8 X;  1O34 A;  4GUX A;  2A7C A;  4E7R G;  1GBH A;  5EOK A;  1EB2 A;  3EE7 A;  2QY0 B;  3BTM E;  4IC6 A;  1KXB A;  5DG6 A;  1QB1 A;  1DS2 E;  2XNI A;  1W11 U;  1MKX K;  1GI8 B;  4UFE H;  3SJ8 A;  1YPJ H;  2W3K A;  3QK1 A;  4O97 A;  2PKA A;  2C93 B;  2GZ8 A;  3BTH E;  1O2R A;  4ZXX H;  1VJA U;  3A7X A;  3AAU A;  1NN6 A;  3A8C A;  1G2L A;  4NZL A;  3UWI A;  1F92 A;  2VWL A;  3RXE A;  3FP6 E;  1O2T A;  1WCZ A;  3U98 H;  3A8A A;  2J2U A;  1O38 A;  2V3H H;  2QE7 D;  3RMO H;  1FY3 A;  3PMA B;  1AY6 H;  4GAW A;  1LQE A;  1X7A C;  1D6R A;  2A5I A;  1C5M D;  4I86 A;  2WIN I;  4CBN A;  1W0K D;  1FPC H;  4MLF B;  1GHY H;  5C1Y A;  3UTU H;  2R9P A;  2XC4 A;  2BMG B;  3SYJ A;  2KAI B;  1QR3 E;  3SUG A;  8EST E;  1O2I A;  2XYA A;  1VIT H;  4NA9 H;  4K60 A;  4CH2 B;  1HCG A;  1TNI A;  2CF8 H;  5FHT A;  1C4V 2;  3F2H A;  2FOB A;  3OX7 U;  3DFL A;  1TNH A;  3F1S B;  1YPG H;  1BTX A;  1C1N A;  1NC6 A;  4E05 H;  2O8L A;  5CE1 A;  3A89 A;  1PPZ A;  1N6Y A;  5JBB S;  4OS7 A;  1UVP A;  3RXQ A;  1W3C A;  3NZI A;  4BXS A;  1G3D A;  1XVM A;  2YMS C;  5HGG A;  1O3C A;  1ZGV A;  3ATM A;  3F0O A;  2JJ2 D;  1BA8 B;  1IQI A;  4WMF A;  1AUJ A;  1C2K A;  1A0J A;  1GI2 A;  4FUE A;  3F9F A;  4HI3 A;  1ZMJ A;  3K6Y A;  1CQQ A;  1LHG H;  3ATK A;  4D7G A;  3TJV A;  2G8T A;  2R2M B;  3GY2 A;  4NWK A;  3KID U;  1MU8 B;  1F0T A;  1MTV A;  1SPJ A;  2BY7 X;  1DT2 A;  4GSO A;  4BAN B;  1OYQ A;  2ILN A;  1BML A;  2KR7 A;  3BEI B;  3OY5 U;  3VXF H;  4I8H A;  1ZPC A;  1OWE A;  3OYP A;  3C27 B;  5AFZ H;  4YT6 H;  5FL7 D;  1L1J A;  1S0R A;  4D9Q A;  3LIW A;  4NG9 H;  4Y0Y E;  4H42 U;  1ARC A;  1FY1 A;  2WPD D;  5FX5 A;  2DE9 A;  5DP9 A;  2ZFF H;  2JKH A;  3SQE E;  2P8O B;  1L1G A;  2ZGC A;  1DAN H;  3E6P H;  3UAI C;  1V2Q T;  4TPY A;  2VH0 A;  3SNE A;  1M9U A;  5T6D A;  1P57 B;  1AFQ B;  4P02 A;  1O3E A;  1Y59 T;  2VB0 A;  1YCP H;  1C9P A;  1NU9 A;  3MMG A;  2H5D A;  1MD7 A;  1UVO A;  1L2E A;  3STI A;  1NFY A;  1Z8R A;  2Y5G A;  2JJ1 D;  3CNR A;  1NFX A;  3TGJ E;  1FLE E;  3A86 A;  3M7Q A;  4LZ1 H;  1DY8 A;  1SGP E;  3RML H;  3UPE A;  2OP9 A;  1O5F H;  1CVW H;  2ZHW H;  4NIY A;  2BD2 A;  3ENS B;  3QZR A;  4Y8Y A;  2FMJ A;  3KCG H;  1GBC A;  3GCT F;  1ARB A;  3RC6 A;  1THS H;  1AWF H;  1V2O T;  1O3F A;  2P93 A;  3PYH A;  2AEI H;  9EST A;  5E0J A;  1W7G H;  1V2P T;  1NBM D;  1C5L H;  3GCN A;  1LVM A;  2V3M A;  1Z8I B;  2ODY B;  2FI4 E;  1DWE H;  2SGD E;  1YPE H;  4Y7A A;  1FUJ A;  1SGQ E;  1A61 H;  4B6E A;  4BAH B;  4K8B A;  1GBB A;  2OTV A;  4X6N A;  2J4I A;  3A81 A;  4K3J A;  1TGT A;  4THN H;  1UK2 A;  2XCN A;  1MU6 B;  2ZIQ H;  1YPH E;  2BQW B;  1SLW B;  1TON A;  3S0N A;  3ZIA D;  4LOY H;  1TOC B;  3KN2 A;  2Y5F A;  5L2Y H;  2BD8 A;  3SOR A;  1O0D H;  4ISI H;  4XBB A;  1XMN B;  3DSP A;  1S6F A;  1OP8 A;  3ZYD A;  4D76 A;  1GDU A;  3P8O A;  2XCF A;  2HNT F;  1GMH F;  1DWD H;  2WYG A;  2KCO A;  1FAX A;  3Q76 A;  1EPT C;  4NFE A;  3PLB A;  3MHW U;  1SI5 H;  2CN0 H;  5G4B A;  4RT0 A;  2YMS D;  3GY8 A;  3RXG A;  7GCH G;  1WXR A;  1C1T A;  1HAI H;  3MU8 A;  3UQV A;  1TAL A;  1W2K H;  2H9T H;  3F6U H;  3JZ2 B;  1PQA A;  1H9L B;  3PLP A;  1GMD F;  2QAA A;  1LPZ B;  3PMB B;  4A7I B;  4UFG H;  1FQ3 A;  2BTC E;  1SVP A;  1F5K U;  1W7X H;  3C1K A;  1QL7 A;  5FPT A;  5C0T A;  1V2N T;  1TX8 A;  2V0B A;  2OK5 A;  1HUT H;  2PTN A;  1O5G H;  2BY6 X;  2Z9I A;  1C2H A;  1DPO A;  3SHA H;  1PFX C;  3U1I B;  3PV5 A;  2O8M A;  4NFF A;  4B6F A;  4UFF H;  4XD7 D;  1EJN A;  1FN8 A;  2GJG A;  3LGU A;  1H8H D;  5EST E;  4ABA A;  1BJV A;  1F0S A;  3LPR A;  1TX7 A;  2BD9 A;  2WPJ S;  1RFN A;  4DII H;  1V2L T;  2HRV A;  3U69 H;  4TT3 D;  1RRK A;  4GPG A;  1YP9 A;  5FBE A;  3EDX B;  1SSX A;  1ELD E;  1C5U A;  2ZFS A;  3ZZ3 A;  1O3P B;  1SQR A;  4B1T A;  3BTK E;  1GVL A;  4A1T A;  1CT0 E;  3M5O A;  1BCU H;  1AD8 H;  1GI4 A;  1N1L A;  3P92 A;  1O2M A;  2JH0 D;  2W5E A;  1AVW A;  2ZDM A;  2KCY A;  5K7R A;  2ZGB H;  5JB8 S;  5EPN A;  3SNB A;  2XTT B;  3GDV A;  1ZML A;  1C5T A;  1EXF A;  1XUI A;  1SMF E;  5KGO A;  1Z1J A;  2FI5 E;  2WHX A;  5GPI B;  4HTC H;  1K21 H;  2YNA A;  2ZPS A;  3UNQ A;  3N7O A;  1A5I A;  4ISO A;  5EJL A;  2EC9 H;  2UUK B;  1BIO A;  1ZLR A;  2IOT A;  3GOV B;  1YGC H;  1WOF A;  3ZVF A;  3D23 A;  3JZ1 B;  2G52 A;  4INH A;  4X1Q U;  1TRM A;  1V2M T;  1XXD A;  5JBC S;  1O36 A;  1MTW A;  1TGS Z;  3HKI B;  4Y71 A;  1K1M A;  3SBK A;  3LT3 A;  3B8J A;  2O9Q A;  3E90 B;  4M9F A;  2GX4 A;  4CBO A;  3SU0 A;  2QF4 A;  2FS8 A;  1YM0 A;  2HLD D;  1JMO H;  1HPG A;  5C1U A;  2D26 C;  3GCO A;  1CGH A;  3E8L A;  3HGN A;  4ABD A;  1S81 A;  2BOK A;  1GJ9 B;  1TAW A;  1V3X A;  1L1N A;  4Z6A H;  3A7T A;  5EW2 H;  5KED A;  2IJD 1;  2ZEB A;  3QX5 H;  1C1S A;  4RI0 A;  2WPM S;  2G5V A;  4UDW H;  1P2M A;  1BBR H;  2IPQ X;  1A1R A;  1K1J A;  4X1P U;  2QA9 E;  1S84 A;  3RU4 T;  1QL8 A;  4GLY A;  2FLR H;  2J9N A;  2AMQ A;  2V6N A;  2YOL A;  8LPR A;  1B5G H;  1GJ5 H;  2AFQ B;  1BRC E;  1HJ8 A;  4ISL A;  1B0E A;  3W94 A;  2SGQ E;  1TNG A;  2HVY B;  3URE A;  1TA6 A;  4K1T A;  2Z3D A;  3F3B A;  5E0H A;  4FXG H;  1D3P B;  3N99 A;  1MAB B;  3LGW A;  3SGQ E;  2BVR H;  4TPI Z;  3QN7 A;  2W7S A;  2Y7X A;  1EAW A;  2PUQ H;  1IQJ A;  3TLO A;  3SV2 H;  2L74 A;  4AGJ A;  4WH8 A;  1QUR H;  3BIV H;  3BF6 H;  3FOA A;  1MAY A;  2H9E H;  5HIZ A;  4MNX A;  5LPF A;  2V7Q D;  2GMT C;  4M7G A;  1LPK B;  1T8M A;  1LVY A;  3DSG A;  3DSO A;  2GCH G;  1C2M A;  4X8U H;  1PQ8 A;  1MUE B;  4YOG A;  5GCH F;  3LGV A;  3MU1 A;  3SZN A;  4LK4 A;  2NU0 E;  1CA0 C;  1GHZ A;  1O5A B;  3T29 A;  5HXF A;  2A5K A;  1NES E;  1P2N A;  2BD4 A;  1QCP A;  2FM2 A;  1RTL A;  2ZEC A;  1LQD B;  1GI7 B;  2WPI S;  2XW9 A;  1W12 U;  2PUX B;  1NPM A;  1KXA A;  1VCW A;  5EQR A;  4AFS A;  3NKK A;  1OX1 A;  8GCH G;  1XKB C;  1SGI B;  2OXS A;  2PTC E;  1OWH A;  1UTL M;  3RXL A;  1YCP M;  4EST E;  4BTI B;  1AZZ A;  2ULL A;  1J17 T;  1JIM A;  1T4U H;  1TNK A;  2IJO B;  1XUH A;  3ZVC A;  5JB9 S;  1MQ5 A;  3P8N A;  4F55 A;  1MTN C;  4FUC A;  2GP9 B;  1K0H A;  1SGR E;  1K22 H;  5EPY A;  1AGJ A;  1O2N A;  3E1X B;  4XRN A;  2ZPR A;  1WV7 H;  1OHH D;  4JZF H;  2ZP0 H;  1E34 B;  4HG6 A;  2R3Y A;  2ZCH P;  2PV9 B;  1S82 A;  3H09 A;  1JIR A;  4D7F A;  5J4Q A;  1LHD H;  1C5Y B;  3FKS D;  5E0G A;  3KL6 A;  1BTY A;  1E0F D;  1O3D A;  2ZGX H;  3ATL A;  5GIB A;  1MTU A;  1QQ4 A;  1S85 A;  3BTQ E;  1O3O A;  1PPG E;  5GXP A;  2C4F H;  1GI5 A;  3ZVD A;  1ZSK A;  5FX6 A;  3A88 A;  2K0Q A;  1DST A;  4DVA U;  2J5U A;  1HIA A;  2J38 A;  3PMJ A;  4QT8 C;  1TPA E;  1YLC A;  5DP7 A;  3I29 A;  2G4U A;  4IBL H;  4CHA B;  2VIQ A;  4Y6D A;  4A92 A;  1BTP A;  3RM0 H;  3LON A;  1UCY H;  1GBM A;  1BRU P;  1H8E D;  3BTD E;  1QBN A;  2ASU B;  1C1O A;  2BDG A;  4IW4 E;  2EI6 A;  2A32 A;  1FI8 A;  3U9A H;  5J4S A;  5C2Z A;  3B9F H;  4YT7 H;  4VGC C;  2A1D B;  1Y5U T;  4A6L A;  1YF4 A;  1GL1 A;  2XC5 A;  1SHY A;  2Q1J A;  4AFU A;  4JYV H;  3M36 A;  2BDY A;  3UQO A;  3TH2 H;  1QA0 A;  2XBX A;  5EOD A;  3LGT A;  1F0U A;  2FOG A;  2BHG A;  3ZZC A;  4ACB A;  2BLW A;  1L0Z A;  2JDI D;  1ZTJ A;  1GMH G;  1DY9 A;  2BYA X;  4CRF A;  1SC8 U;  2VWN A;  2G4T A;  1P03 A;  2J34 A;  1O35 A;  3FN8 A;  1OP0 A;  3VB5 A;  5B6O A;  3KYF A;  7GCH F;  1GHV H;  2CHA B;  4CRG A;  2BVS H;  2FEQ H;  1EQ9 A;  4NIV A;  2ZZU H;  1PPB H;  1O2S A;  1QL9 A;  2VH6 A;  2J95 A;  3DCL A;  3M7U A;  4AYY B;  2FLB H;  3TNT A;  2XWB I;  3K65 B;  5FAH A;  3BV9 B;  3SZE A;  1UO6 A;  1EZQ A;  2GGV B;  2VIV A;  4FVD A;  2PFE A;  2ZDA H;  3SI3 H;  1AN1 E;  2CK3 D;  3QZQ A;  4GCH F;  2DE8 A;  1BQY A;  2D1J A;  3WY8 A;  3LC3 A;  3EYD A;  1V2W T;  1Y3Y A;  2QF0 A;  3RXS A;  4Q4L A;  1AKS A;  1O2U A;  2XND D;  4OM9 A;  1E35 B;  5FPY A;  1KXF A;  1QZ8 A;  1FN6 A;  1IHS H;  4YOI A;  5A8Y A;  1GJB B;  4Y8Z A;  1GI0 A;  1GVZ A;  3GDS A;  3P8G A;  3RDZ A;  1L4Z A;  2AS9 A;  1VGC C;  3SNC A;  3KNX A;  1O3M A;  1T31 A;  2VNT A;  3MO6 A;  4UE7 H;  4NSY A;  1H8D H;  1OP2 A;  1TQ7 B;  3M3S A;  4MPV A;  4KEL A;  2OCV B;  3EA7 A;  4I7Y H;  4XOJ A;  5GND A;  4Y7B A;  2JET B;  1YY3 A;  1TQ0 B;  2P95 A;  1J15 A;  1P8V C;  3U1J B;  1MQ6 A;  3NPS A;  1GJ6 A;  3LH1 A;  5C0U A;  3O8B A;  4INL A;  3RC4 A;  2ALP A;  2O8T A;  2VGC C;  3E0N B;  2GDD A;  2SNW A;  1LHE H;  3HPT B;  4WF8 A;  1Y3U A;  1DOJ A;  4ABB A;  2VVV A;  3TPI Z;  1C5V A;  3SO3 A;  2BX3 A;  1D9I A;  1NRN H;  1C5X B;  3ZZ4 A;  1OWK A;  1GMC F;  3QLP H;  4AG2 A;  1Z6E A;  3ZYE A;  1UVT H;  3PO1 B;  1THP B;  7EST E;  3U8T H;  5F8T A;  1HGT H;  1S83 A;  3IG6 B;  4MG3 A;  3QO6 A;  1GI6 A;  1ZGI A;  2W3I A;  2XBV A;  1CT2 E;  3NWU A;  1PYT C;  1BJU A;  4GHT A;  4K2Y A;  2HAL A;  1C5O H;  5T1V A;  1XUG A;  2F43 B;  2BOH B;  3A84 A;  3K6Z A;  1GCT B;  5A0B A;  2BZA A;  2ZFP H;  2HLC A;  3FZD A;  1LTO A;  3M5M A;  1T4V H;  1OWD A;  1GBA A;  2BLQ A;  3D65 E;  3SUF A;  4R8T B;  1O31 A;  5DP8 A;  5EXM A;  2SGP E;  3PRO A;  3V7T A;  3TH3 H;  3QDZ B;  3QGN B;  4WME A;  1AB9 C;  4BAM B;  4SGB E;  1GJD B;  1SQT A;  2V35 A;  1MMJ N;  3SU5 A;  1HAV A;  4AFZ A;  2VWM A;  4FUG A;  2J98 A;  3A7Y A;  4MPX A;  4DGJ A;  2BDH A;  4ABE A;  1ZHR A;  4TSF D;  2D2D A;  1G37 A;  1H1B A;  2AH4 X;  7LPR A;  5CHB A;  2ZU4 A;  1CA8 B;  3EST A;  1ZOM A;  4ACA A;  2FOC A;  3EGK H;  1FJS A;  4Q2K A;  4DT4 A;  5L2Z H;  4XBD A;  3TIT A;  4AZ2 B;  3V12 A;  1TGN A;  1IOE A;  4OS4 A;  1IQF A;  1HAZ B;  2Z9J A;  3A7V A;  5TJX A;  3UOP A;  3LU9 B;  2VVC A;  2QF3 A;  3BEF B;  3BTE E;  4FU7 A;  3OFN D;  1DWC H;  3M5N A;  3RXA A;  2GCT C;  3MWI U;  3BG8 A;  4JYU H;  1ZR0 A;  1TPS A;  3FO8 D;  4Y0Z E;  3AAS A;  2XC0 A;  4AC9 A;  4MNW A;  4B76 A;  6CHA B;  1O3G A;  1DM4 B;  1C5S A;  2AIQ A;  1EAU A;  2LNC A;  5F8Z A;  2ZC9 H;  1PPE E;  4ZAE A;  1Q31 A;  1C1W H;  2FOM B;  3TK5 A;  3ODD A;  1DIT H;  5A8Z A;  3TVJ B;  3K2U A;  2XBY A;  3F9G A;  4YTA A;  3QUM P;  1UTK A;  3KHV A;  3W1E A;  1Y5B T;  4YO9 A;  1HXE H;  1A7S A;  1D3D B;  1MKX H;  1ZSJ A;  4FU8 A;  2VBC A;  3LOX A;  1WAY B;  3F2G A;  3STJ A;  2Y6T A;  2A31 A;  3QTO H;  1FNI A;  3NCL A;  1AO5 A;  2Q6F A;  4H6S B;  4X8T H;  5GWZ A;  2EQN A;  1CHO G;  5E2O A;  1RS0 A;  1C2F A;  1RTK A;  2G81 E;  3MH7 A;  3P17 H;  5KEC A;  2QYI A;  2HGT H;  2EY4 C;  5AF9 H;  3BIU H;  1P02 A;  3TGI E;  1K1L A;  2CV3 A;  1W8B H;  2NWN A;  3F2F A;  1KLT A;  2TBS A;  1P09 A;  1BMN H;  3UNS A;  5ABW A;  4DT7 B;  3K9X B;  1A2C H;  2ZTZ A;  3FVF B;  5C17 A;  4X8S H;  1UCY K;  1WDI A;  4Z0K A;  2M2A A;  1KTS B;  5ESB A;  4ASU D;  1AFQ C;  3SUE A;  3RXU A;  1V2R T;  2AIP A;  1J8A A;  3O8R A;  4JCN A;  2F4L A;  1W0J D;  5EIY A;  3S7H B;  1MTS A;  1O33 A;  1ZRB A;  4DG4 A;  1O3K A;  1KY9 A;  2FX4 A;  3MOC A;  2QXI A;  5CHA C;  4BXW A;  1O2L A;  2EST E;  4BAK B;  3UWJ H;  5CDF E;  3S7K B;  1WTG H;  5EG4 A;  4X1N U;  3A8B A;  3ATW A;  1ANB A;  4AB8 A;  1J16 A;  1OKX A;  2ZI2 H;  1PYT D;  4JZE H;  1GBK A;  2UUF B;  1C1M A;  1GCD A;  5DSF A;  2OBQ A;  2PLX A;  4KTS A;  2VJ1 A;  3L6P A;  5C67 A;  4H4F A;  1Y3V A;  2OQU A;  4B2C A;  3Q3K A;  1UCY E;  1PPF E;  5FPS A;  3AVZ A;  1AE5 A;  2LP6 A;  2Q6G A;  1TGC A;  1UVU H;  2SFA A;  5L6N H;  5LPE A;  1IQG A;  1ELE E;  1A5H A;  1EFR D;  1DFP A;  4NA8 A;  1FY4 A;  1K2I 1; 
#chains in the Genus database with same CATH homology
 2J98 A;  2J97 A;  5HIY A;  5HIZ A;  3EE7 A;  2J98 B;  1UW7 A;  5C94 A;  1QZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...