5HIZA

The structure of pedv nsp9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
96
Chain Sequence
GKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWGGCNTIELEPPRKFLVDSPNGAQIKYLYFVRNLNTLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Non-structural protein 9
publication title Structure of PEDV NSP9
rcsb
source organism Porcine epidemic diarrhea virus cv777
total genus 14
structure length 96
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5hizA01
1UW7A 2J98A 2J98B 5HIZA 5HIYA 3EE7A 5C94A 1QZ8A 2J97A
chains in the Genus database with same CATH superfamily
1ANCA 1C1UH 1CGHA 2ZQ2A 1O34A 1KXFA 5EPNA 1GJ7B 2BDIA 4LXBH 1LPZB 3NXPA 2GZ7A 3QTVH 3V3MA 3EDXB 2KFWA 4X1SU 1N8OC 3MO6A 1ZLRA 2XRCA 1SQTA 4ZKNU 4GHQA 3RMOH 3M7QA 4JYUH 3CP7A 3UFAA 4F48B 3FFGA 4K3JA 5GWZA 2ZFSA 1VCPA 1MU8B 2P3FH 2ZFFH 1E1QD 5G4BA 1O3FA 1C2HA 1SR5C 2P8OC 2JH0D 4A7IB 3GCTG 1WSSH 1GBJA 1NC6A 1H8DH 2SFAA 1NTPA 4R0IA 1EATA 1GI9B 3FP8E 2XBYA 1HRTH 1BMFD 2KR7A 4H42U 3ZVBA 2ZPRA 1TRNA 2VVCA 4UFFH 4AYYB 1SPJA 1VGCC 1ZSJA 1KYNA 3HGPA 5T1VA 1PQAA 2F9OA 3M3SA 2WPJS 1AKSA 1BMLA 3BIVH 3PV5A 4JZFH 4X0WU 3TH4H 2J97A 5JB8S 1KIGH 2B7DH 1ZSLA 3SHCH 4KP0A 4XDEA 2XWBI 3A88A 1SL3A 2QF5A 1D3QB 1DICA 3BG4C 4B6EA 4X2VA 4TYDA 3OAAD 4I8KA 1MZDA 3O8CA 3Q77A 1GDQA 1K1JA 4UDWH 2WPMS 1P2JA 1NFXA 1GVKB 3BTDE 1O35A 4RSPA 1LVOA 3H7TA 8KME2 1YPKH 1ANBA 2PTNA 1GMDF 2P94A 4AGKA 3U28C 2A7CA 1WOFA 4TY6A 3STJA 1O3OA 1ELVA 3I77A 1C5LH 5JPMH 2DE8A 2XXLA 5I46H 1CA0C 3VGCC 1UTMA 4WY3A 1CBWB 1GVLA 1ETRH 2ZTXA 2PSYA 4RN6A 1ARBA 2Y5HA 1O3EA 1A3EH 1NRSH 2RCEA 3P8FA 5PTPA 3DSPA 3ZZCA 1YCPM 1OOKB 2XW9A 3RMNH 1MBMA 1NO9H 1DT2A 4TPYA 2OQUA 2GVFA 4ACBA 1K28D 5EPYA 2OTVA 4P02A 5EXNA 3FZDA 3MNCA 1MQ6A 4MPWA 1FN6A 5DN6D 1QJ7B 1GI8B 3SN8A 1EOLA 1AD8H 3LU9B 2ZIQH 4P00A 1E38B 1QIXB 2XBVA 2VWMA 2BOHB 5KECA 2BX4A 2VIPA 4YOGA 4ZHLU 3FP7E 3SI4H 1FN8A 1W2KH 4J2YB 3ZZ7A 1GDUA 1OPHB 5C1YA 1O3MA 3VB7A 2CHAC 2FOAA 1WU1A 1TA2A 1V2JT 1KXDA 2ZI2H 3MFJA 1LHDH 2A7JA 1Y5BT 1AUJA 1WTHD 5GCHF 2A5IA 1BCUH 1OXGA 4ABGA 1AHTH 3PO1B 5EOKA 1HAHH 1SQOA 1HJAC 2FESH 2IN2A 4ZKRU 3AAVA 4O9VA 4CHAC 1P01A 3RXIA 1GVZA 3TGIE 1BTUA 1VITH 4IGDA 3EE7A 1MKWH 1TOCB 1TALA 3F6UH 1V2VT 4X6MA 1VKYA 2GGVB 1LHFH 1L1NA 4AFUA 5GDSH 4UE7H 1LO6A 1GJBB 3QWCH 4KELA 2JETB 1G9IE 1V2LT 5HGGA 4ZKSU 1GHBG 2GTBA 2QC2A 3MH4A 5A09A 5K0HA 3VB3A 4OS5A 1P2OA 1C1TA 1O33A 4ABDA 2SGAA 2SGPE 2ANWA 1NFUA 1EAUA 1GHAF 1ZTLA 3ATIA 4Y11E 4Y6DA 1SFIA 5T6DA 8GCHG 4Y8XA 2ZNKH 1ID5H 1CA8B 1GBKA 2ULLA 3GISB 4NIWA 3UOUA 1YPGH 1LDTT 4ABBA 1A0HB 2OD3B 2OBQA 3E90B 3QGJA 3QZRA 5IYTA 3ZZ6A 3GDUA 2ZU2A 5DP7A 1UHBB 2EI7A 5SGAE 3SJIA 1FIWA 2PR3A 1C5OH 3MO9A 5C3NA 1E1RD 4RT0A 2BVSH 1XKAC 3K6YA 1COWD 2VWNA 5T6FA 2FOBA 3GDVA 2PUXB 1GCTC 1DPOA 2G5NA 1H4WA 1RIWC 3DUXH 3P8GA 2GP9B 1EASA 3GY8A 5DPAA 3BIUH 5GPIB 2ZGCA 1EAWA 1LCYA 5E0GA 2JDID 1NPMA 1NRRH 3LGWA 1O2GH 3MOCA 1G3BA 1AFQC 2EC9H 2C8ZB 3A8AA 1THSH 1S5SA 1Z7KA 2Z9IA 5FBEA 1GHWH 1UMAH 4MNXA 3RU4T 3SV8A 1UVTH 1WXRA 1BHXB 2V0BA 1EQ9A 2PKAB 1EJMA 3E6PH 4MQAA 4D8NA 3D65E 3NUMA 1KMHB 3RUOA 1JXPA 3RC5A 3B8JA 5H4IB 1NFYA 4FU9A 4XOJA 3D23A 5CHBA 4AZ2B 1O31A 3KQEA 4Y79A 2VJ1A 3CS0A 4YLQH 2ANYA 2ZHDA 1JWTA 2BDHA 2L74A 2AGEX 3E91A 1HAGE 5HM9A 1SLXB 1MD7A 2PWXA 3VFEA 4BAHB 1DS2E 1GI4A 3UWIA 5C2ZA 3D49H 1XKBC 1FNIA 3K65B 3LONA 2K0QA 1MQ5A 4F4OC 2NU3E 2HRVA 1CHGA 3RLYH 4A1XA 3EGKH 1HAXB 1OHHD 1V2PT 3RXFA 1G30B 2VWLA 4LK4A 2O8TA 2PUQH 2EY4C 5C20A 3ZVEA 2D1JA 1O2WA 1Z6EA 3A7TA 1WDIA 2FO9A 4GVUA 4YOIA 1QQ4A 3STIA 3RC6A 1AB9C 1BMNH 1C1SA 2OBOA 3SORA 1TX8A 1OWEA 2THFB 1SGYE 1ZHRA 2SGFE 3Q00A 4AFSA 1SOTA 4Y7BA 2CF8H 3KQ5A 1L1GA 2HNTE 2Y7XA 3BEIB 4FUIA 3HK3B 3OYPA 3SV7A 1G37A 1MTVA 2HPPH 3TNSA 2PKSC 2J34A 1S6LA 4HFPB 2F9UA 3A8DA 1AFEH 1FY3A 3T2NA 1P57B 2YMSC 3O8BA 2J9NA 1QB9A 1WBGB 4BAOB 3SNCA 2F83A 1BRUP 4ZKOU 1P9SA 1V2QT 1C5WB 1NBME 3P8NA 2QY0B 4E06H 4NFEA 1P05A 1TMBH 2Y7ZA 2UUJB 4IMZA 3NRLA 1RD3B 4MNYA 1BT7A 1QCPA 1C2EA 2ZTYA 2QN5T 1QBNA 1O2LA 2FOMB 1XXDA 1O0DH 1ELBA 2C8YB 3WW7A 4ABIA 1TQ0B 2J98B 1N6YA 5EW2H 5LH8A 3BEFB 1C5MD 1ZR0A 1SGQE 1FPHH 4X1PU 1GMHF 3RU4D 5FX6A 4Q80A 1YYY1 4JCNA 2SNWA 1MAXA 2KCPA 7ESTE 3BTHE 2H5CA 2V3MA 5F53A 3UB0A 2C4FH 1FY8E 2I6SA 3F9GA 1PQ8A 2UUYA 4IS5A 2XC0A 1Z8IB 4Y71A 1GJDB 3KQDA 1HYLA 4FU7A 3JZ2B 1MTUA 1YM0A 4A92A 1HAIH 2BQ6B 5E2PA 3LJJA 5LPEA 1A1RA 4CBOA 3QO6A 1Y5UT 2HPQH 1ZRKA 1PPGE 4NIVA 1VGCB 2GX4A 1BJVA 1O5EH 4B75A 3TK9A 2PFEA 1QFKH 1FAKH 2BOKA 2W6JD 2NU1E 3VPKA 4YM9A 1YCPK 3BTQE 1T8MA 3ZZ3A 4E05H 3MU1A 2XBXA 2AERH 1XUJA 2XWAA 1GGDB 5DP5A 1AZ8A 1AZZA 4FUDA 2FS9A 1UCYH 2LP6A 1FDPA 2IOTA 2WPKS 3SNAA 5DP8A 3RXCA 3RXQA 1MMJN 3K2UA 3KYGA 2BQ7B 3GYLB 1ELCA 4VGCC 4WXVA 3A82A 3HKIB 1Z8RA 5HMAA 1IHSH 3F0PA 4NA8A 1P03A 3SNEA 1TAWA 3E3TA 5EXMA 4E7RG 1XVMA 1S85A 1NS3A 1FY4A 2OINA 3DHKH 1ELGA 3SU3A 1J8AA 3UIRA 3AK5A 1DITH 3RXOA 1J17T 1O3CA 2CMYA 1F7ZA 3Q3YA 3F3BA 4DVAU 2Y5FA 1CA0B 3VGCB 2ZP0H 4OGXA 1IQLA 2QXIA 4B1TA 3OEED 1BJUA 1AIXH 1V2UT 2A7HA 2F43B 1O2NA 1C1RA 4FVBA 3S9CA 1LQDB 4MTBA 2ODPA 2GV7A 3HKJB 3HGNA 1KLJH 3SBKA 1GI7B 2FX4A 3EQ0H 1P2QA 2LELA 4FUFA 1NROH 2FWWA 1BZXE 1O2UA 2VIWA 3H09A 5J4SA 1UO6A 3UQVA 1V2NT 3UNSA 4B2CA 3N7OA 3E0PB 4NFFA 2WPDD 4THNH 3RXVA 1FONA 4ISLA 1A5HA 4NSVA 3U9AH 4WMFA 4A1TA 2J4IA 1PQ7A 1RTLA 1TYNA 2G52A 3GCHC 4B76A 2NU2E 4RT1A 2WHXA 4D7FA 4XSKU 2OQ5A 3RXAA 4NZQA 2TRMA 1IQJA 1S6FA 4I8LA 1MKXK 4DT7B 3LH1A 1HAZB 2YOLA 2CHAB 2WINI 3WWBA 3A83A 1OWJA 4A6LA 4GPGA 4FUJA 4DT4A 5GJ4B 3E1XB 2Z7FE 5C0UA 1BA8B 1QJ1B 3O8RA 1P06A 3ATWA 3N7EA 1EZXC 3QUMP 4X1RU 3KHVA 1TABE 1P0SH 5JYIA 7GCHF 1IHTH 4IW4E 1GJCB 1EPTB 2K8IA 1EB2A 1O2ZA 1FXYA 2C90B 3QLPH 1HGTH 4CRFA 1O3BA 2B0FA 4WXIA 3V13A 2GCTC 1NU7B 1HAVB 1UTOA 2ZU1A 5F8TA 4AFQA 1JBUH 5FAHA 1DANH 2FIRH 5EGMA 3DT0H 2FI5E 2WSSD 3UWJH 5EIYA 4CRAA 3PMHB 3PROA 1WV7H 1RFNA 2AYWA 2GT7A 1AMHA 2GDEH 3KQCA 4YOJA 5E8EH 2RA3A 1MABB 1OWIA 3ZV8A 3UAIC 4KKDA 3NWUA 5A8ZA 1GMCF 2HWLB 1Z6JH 3TH2H 1TGBA 3KIDU 1YPHC 1W14U 2GCHF 4O3UA 3GY6A 1K9OE 3IG6B 1G2MA 1W7XH 3BTGE 3EE0B 4Y0ZE 1H9HE 1SC8U 2ZHWH 1C4Y2 1KLIH 2LPRA 1QRZA 3VB4A 2XCNA 2XC5A 1A7SA 5DKMA 3VXFH 1CU1A 1O3GA 1RIWB 1AGJA 1ELTA 1SQRA 1AO5A 5CHAB 2ZU4A 4NSYA 1VITF 2ZA5A 1TRYA 2ZF0H 2C93B 5LPRA 1O3PB 1T4UH 1RTFB 2GDDA 1GJ9B 1BITA 2EQNA 5L6NH 1CSOE 1GJ4H 3KQBA 1S81A 1RGQA 4CH8B 5E0HA 2BLVA 4FOUC 2FPZA 3RXLA 3LT3A 1SVPA 2ZQ1A 1RJXB 1QTFA 3DFJA 4Q7XA 1S83A 4K2YA 1AKSB 2PGQB 1H8HD 2KX4A 4CREA 6ESTA 1GI0A 1DUAA 1LHGH 5I25A 3A86A 2ODQA 4I8HA 1BTYA 1SKYE 6LPRA 1YPEH 4O3TA 1ESBA 2ASUB 3RP2A 4MVNA 2OC7A 2Z3CA 3LGVA 1K21H 1C2GA 1ZPBA 2VIQA 4TT3D 1MAYA 1UTQA 4KGAA 1UTLM 3LGUA 3SU2A 5A2MH 2P3UB 4I33A 3UUZA 1P3EA 3UR9A 1IQFA 2VH0A 4CRGA 1TNKA 4YESB 4YTAA 4ABEA 4AB9A 9LPRA 1JRTA 2BD4A 1UCYK 2CK3D 3ZVGA 2OUAA 2YMSD 4ZXXH 3GY7A 1LVBA 4AB8A 4H6SB 4YLUA 1AB9B 1MCTA 1SGCA 1SQAA 3RMMH 1XUIA 3D62A 4GHTA 1QB6A 4HTCH 5C1XA 1WYKA 1PYTD 3O8DA 1A3BH 1T8OA 1C1PA 1NY22 1D3PB 2QA9E 1O5FH 1V2MT 2UUKB 3QTOH 1O30A 4FUBA 1HAYB 3SNBA 3Q76A 2FLRH 3MH7A 3P17H 3GY4A 1CT0E 3LIWA 4YXWD 1MTWA 3TJUA 3LJOA 4I7YH 2CXVA 3OY5U 2FZZA 3ZIAD 2BXUH 3MH6A 1QNJA 3GCTF 2PSXA 5DK1A 2JH5D 2AIPA 2BTCE 2AMDA 5ABWA 1GWAA 1F5RA 1OYQA 2BDCA 1O2HA 3S0NA 3MH5A 1F0TA 2BDYA 1RXPA 3V0XA 2EA3A 2TGDA 5FXLA 4MNWA 2BY6X 1IQMA 3M36A 3PLKA 2FTMA 1GCDA 2OK5A 3TJOA 2HGTH 3GY2A 3UY9A 2B9LA 3A7WA 5GNDA 2Z94A 2BLQA 2VNTA 4OS4A 4FUHA 1OWDA 3ZZ9A 2KAIA 3SJKA 3S69A 4DCDA 4UFDH 1NN6A 3A8BA 3LC3A 1ELEE 1ACBE 1C2DA 2ZPQA 1VZQH 4BXWA 3ESTA 4MDSA 1TONA 1ZOMA 1C5UA 2G8TA 1O5CB 1QJ6B 5EXLA 3T27A 1ZGVA 3PWCA 4DOQA 1EZSC 4Q4LA 2ZDLA 3L33A 5EQQA 4CH2B 2Q1JA 2KZ4A 3QDZB 1TB6H 1ARCA 3VG8A 5TJXA 2IJOB 3GS9A 4MNVA 3TVJB 2XNIA 1EP5A 2XTTB 2A32A 2SNVA 1GDNA 3UR6A 1MTNC 5F8XA 1DY8A 1GI1A 4K60A 4GUXA 1OP2A 3LGYA 3LPRA 3N99A 5DP4A 3BV9B 4Y8YA 5IK2D 1HDTH 6GCHG 4PROA 1EX3A 1YPJH 1C4U2 3RXPA 1AU8A 3UREA 1UJ1A 4AX9H 1HJ9A 4D9RA 1BDAA 2Z9GA 1CGJE 4ZH8A 4BOHA 1FUJA 5JBBS 1TE0A 1K1LA 1H1BA 4JYTA 1V2KT 1ZTJA 3SO3A 2BVXH 1QZ8A 1GL0E 1HAOH 4JK5A 1RS0A 4D9QA 4UEHH 4VGCB 2ZCKP 2GZ8A 1BBRK 1TPOA 3FP6E 4Q7ZA 2EEKA 1JRSA 1O5DH 2QCYA 3ZZ8A 2P95A 2AMQA 2ZPSA 1P2IA 1GBEA 3BN9A 4XBCA 1G3EA 3P70B 1SGFA 1GI6A 1SFQB 1BMAA 3ZVCA 1NT1A 4Z1MD 1N1LA 3I78A 1EAIA 1BBRE 4WH6A 5FBIA 5AVDA 4AG2A 2FOGA 1NZQH 2R0LA 5C67A 2G4UA 5T3HA 2FMJA 1O2RA 1MU6B 2HVYB 1D6RA 1O39A 1EOJA 3L3TA 2HLDD 2ZGXH 3SNDA 4YO9A 2DUCA 1Z8JB 4CRBA 2ZECA 1G3CA 1XUFA 4X8TH 3RXKA 1WTGH 2WV5A 1TPPA 4JZEH 2BD2A 2M5TA 3MTYA 3GOVB 4ISOA 1YWUA 1ZSKA 2A5AA 1L4ZA 3BTFE 2C8WB 2OXSA 2GMTB 1UTPA 2VGCB 4BTIB 1BIOA 4I8GA 5ETXA 1Z71A 2KCYA 1G32B 2OP9A 1A0JA 3RXSA 2FP7B 1SGIB 3QZQA 4X1NU 4U30A 1HJ8A 5FCRA 1C2FA 3SJOA 1AWHB 3DSOA 1GHBF 1FPCH 4R8TB 1FY1A 4X2WA 1C5ZB 1WUNH 1HB0B 1CHOG 1A4WH 1Q2WA 5TCCA 5EJ1A 1AN1E 1ZPCA 2Q6DA 1FX0B 3QK1A 1FLEE 1F0SA 3SU4A 1IAUA 8GCHF 1C2IA 1F92A 2QF4A 4CR9A 2H6MA 1HLTH 1S0QA 1SLWB 1XM1A 1K2I1 4CR5A 3LH3A 1DSTA 3RXTA 1YBWA 3SOSA 1KDQB 2VIDA 1OWKA 3I29A 1HV7A 4NA7A 1BTZA 5BRRE 2GCTB 1BUIA 1C5SA 1ZMNA 3KYFA 4XBBA 1E37B 1TNHA 4Y10E 2IPHA 2YNAA 1GHVH 2STBE 4OS7A 1O3HA 1DVAH 3MHWU 1DOJA 1GHZA 2PP6A 4BAKB 1MH0A 2G5VA 1SGRE 1OKXA 1QL7A 2FOHA 1XUKA 1PPZA 3GY3A 2QXHA 3A84A 1YPLH 1GG6C 3B23B 1ZPZA 5LPFA 1A61H 1CT2E 6CHAB 1V2OT 2H1UA 1BOQA 3HATH 5JB9S 3MO3A 1BTHH 5E2OA 4ABJA 2C8XB 3T5FH 3MQKC 1A5GH 1G3DA 3ZZ4A 5CDFE 1AVGH 1P12E 1D4PB 4FETA 1P9UA 3SQEE 3PTBA 1V2TT 1C1OA 1QBVH 5F03A 5AHGH 1PYTC 2ILNA 1O5AB 2FOEA 3GICB 2VIOA 1AE5A 1GBLA 2A4GA 1DFPA 3FO8D 3BTTE 5TCAA 1AVXA 1TBZH 5HXFA 3JZ1B 2W5EA 5C17A 1AY6H 1N8OB 1NESE 3E16B 2PLXA 3M35A 4IN1A 4JYVH 2J2UA 1MBQA 4GAWA 1UVSH 4FVDA 1W13U 2P8OB 3MI4A 3U8OH 1TBQH 4INKA 5FL7D 2BYAX 2Y5GA 2V35A 3RXEA 2JH6D 4AN7A 1HAPH 1THRH 1Y3YA 4A5TS 1SGNE 1G36A 1GBMA 3U1JB 2VVVA 2LNCA 2Z9LA 2SGQE 4GCHG 2FYRA 2V3HH 4DGJA 1SGTA 3M37A 1XX9A 4YT7H 4KTUA 1C5TA 5FPTA 2FXRA 3TLOA 3CNRA 2KM0A 3L6PA 1K1IA 4JMYA 2ZDVH 1XVOA 1DWDH 3VB6A 1LVYA 4TPIZ 2AS9A 1C5QA 4OS6A 1DXPA 1MKWK 3KEEA 3RXGA 1TOMH 2PV9B 3RXHA 1D6WA 5JDUB 4MLFB 5DO4H 5LGOA 3A80A 1O2SA 1NRNH 3BG4B 3MNSA 1O2IA 3PV2A 2FEQH 5C1UA 3F2GA 4M7GA 2RA0A 2XOKD 4XBDA 1E35B 1FMGA 3PMJA 3CS7A 2BY9X 2HNTC 2Y82A 3P6ZB 4HG6A 2M2AA 1W12U 1A46H 1P09A 2Z6BD 4B2BA 3RXMA 2UWOA 2GKVE 2ALVA 1QB1A 3PMAB 2A4RA 1EUFA 2JETC 1FQ3A 1P2KA 2CF9H 2GJGA 4OGYA 1O3AA 1CO7E 1C5NH 3OTPA 1MTSA 3M5MA 4ZHAA 2ZU3A 1BRAA 4I32A 3SGBE 5EJLA 3BF6H 1GL1A 3MWIU 5E0JA 5EQSA 2HVXA 3CENA 2BD5A 1W3CA 3SU6A 3UOPA 2ALPA 1W0YH 3M5NA 1E79D 2TPIZ 3GYMA 4IN2A 2CN0H 3ATKA 1K22H 1DX5M 1KSNA 3F0OA 1L2EA 2L6OA 1O3IA 1S82A 4FUCA 4I31A 1H8ED 4WWYA 1SB1H 4XE4A 4NGAH 5DSFA 3ZZDA 2XC4A 1AI8H 1GBDA 5EG4A 1XXFA 4XRNA 3OTJE 1KLTA 1TGNA 3A7VA 1C2LA 1YPHE 1MUEB 4K5ZA 1C5RA 4HGCA 1JMOH 3ODFA 1ABJH 1W0ZU 3ZVDA 4D76A 5FPYA 1SMFE 1EP6A 1Y5AT 3RMLH 3AVZA 3URCA 3OEHD 2YNBA 3PLBA 5DP9A 2RG3A 1C1QA 4H6TA 1FV9A 4LOYH 3SGAE 1VJAU 3M3TA 5EJZA 2FDAA 5C0TA 3SV9A 4ISNA 4TSFD 4ACAA 1YGCH 1IOEA 4LZ4B 3PYHA 1SHHB 2BB4A 1HJAB 2G51A 2HNTF 2HALA 3TK5A 1HIAA 3W94A 4CHAB 4K1TA 2F9BH 3SUDA 2W7SA 2QV1A 4WH8A 3TGKE 2XBWA 2HOBA 4JZDH 2ESTE 4X2YA 4AG1A 2FTLE 2BDBA 3NK8A 1WCZA 2QYIA 5HKKD 1DE7H 3SUGA 4LZ1H 4JZ1A 2QXJA 4IBLH 2ZFQH 1VITG 2EI6A 1PJPA 1TMUH 2G4TA 2TGAA 2ZGBH 2VWOA 5A0BA 5DP3A 2SGDE 3TIUA 3RU4E 2WZQA 4DURA 1RTKA 1QBOA 1SI5H 1V2WT 4U32A 1DUEA 4I86A 1O32A 1YKTA 4Y7AA 3RXJA 2A2QH 4UFGH 2ZFTA 1O36A 2P16A 3P8OA 1XMNB 3TGJE 2FM2A 3G01A 3PWBA 2D26C 4BNRA 3KF2A 3S9AA 2RDLA 4HI3A 3HK6B 3AASA 3FAOA 1VCQA 1W8BH 2JIZD 3A87A 4GSOA 2CV3A 3KL6A 1K1OA 4WVPE 1PFXC 1HBTH 2IJD1 2AFQB 2J92A 5FX5A 3TJNA 1P3CA 3TITA 2ZDMA 5GXPA 1ESAA 1D3DB 1QURH 1FJSA 3ITIA 2BY7X 1D3TB 1GCTB 3UNQA 1PPFE 2A4OA 1SGPE 1LQEA 1LMWB 1ANDA 3SUFA 4O97A 1W10U 1UVPA 3FVFB 1ZTKA 1TA6A 1GBBA 4ABHA 1BHXF 2CJIA 2RFKC 4YT6H 1RRKA 1V3XA 2PTCE 2A4QA 1BTWA 1AFQB 4NG9H 1P10A 3SHAH 1WQSA 3SW2B 1EJAA 1L0ZA 2ZCLP 1CQQA 1C1WH 1GMDG 8LPRA 2BHGA 5CE1A 5AFZH 3NZIA 2GZ9A 2Y80A 3PLPA 2FODA 1JOUB 4ZMAH 4B2AA 1PPHE 4YZUA 4SGAE 3A85A 5EQRA 2AH4X 2H9EH 1C2MA 3GCNA 1GBAA 1SGEE 4ZAEA 2F91A 3P92A 1GBTA 2PGBB 1T31A 4M9FA 3RXUA 3BTEE 3A7XA 2W26A 4AORA 3SQHE 2F9NA 3F9EA 2GD4B 4ZROA 1HFDA 1TX7A 2Q6FA 4UD9H 1DWBH 1GPZA 2Z9JA 2ZHQH 3SU0A 1QRWA 4RKJB 2WV9A 4K69A 2FX6A 1HXEH 1V6DA 4ESTE 1AWFH 1ZJKA 5AF9H 5L2YH 1YLDA 5C94A 1ZJDA 1LPGB 4X8UH 4CRDA 3PTNA 3AAUA 3PRDA 3N7DA 5HYOA 1O2PA 4INLA 1Y3XA 3U69H 2R3YA 2G00A 5IDKA 1KTTB 4DW2U 3LGTA 1OYTH 1O2MA 4IC6A 3ZZ5A 1EAXA 2FS8A 1GGDC 3RM2H 2FI3E 2Z9KA 1B7XB 1GG6B 2GT8A 1UK2A 1C2JA 1T32A 1QA7A 2J95A 1CVWH 1UCYE 2WYJA 3WWFA 5DGJA 1O2OA 2Q6GA 2PKSB 2CGAA 1ZYOA 5GCHG 1IQHA 3AW1A 1TGCA 2AIQA 1TMTH 2YMSB 4AC9A 1QHRB 2TIOA 1K1MA 1BTPA 3E0NB 2H9TH 2JKHA 1K1NA 2BVRH 3EA8A 3ZZBA 2ZG0H 2C3SA 1OP0A 1F0UA 4BANB 4NA9H 4Y8ZA 1HUTH 1KXBA 3F1SB 4WJG2 1HNEE 1IQNA 5B6LA 1LKBA 1OX1A 4GLYA 4TWYA 2KAIB 3TNTA 1IQEA 1LTOA 2OLGA 4ISHH 1IQGA 2O9QA 3R0FA 1O5GH 4AOQA 3DFLA 1ELDE 2A2XH 3ELAH 2BD7A 2XNDD 1EJNA 1PPBH 5CMXH 4UFEH 1FY5A 4ABAA 1ABIH 1JIRA 4D7GA 1GHAG 1O3NA 1VCWA 3TU7H 4MPXA 4ZHMU 3TJVA 1GJ5H 4FXGH 5FCKA 2P93A 1O37A 3U8TH 1F0RA 3FN8A 2ZO3H 2D2DA 1AVWA 1Y3UA 2ZTZA 1A2CH 4Q63A 1Y59T 1KXCA 1TNGA 1O38A 1H8IH 3UNRA 3MU4A 3IWMA 3RXDA 1ELAA 2ZHEH 3RLWH 2ANKH 2WPLS 2PHBA 4K8YA 1S6HA 2P59A 2BD9A 3F9FA 5T6GA 1UK4A 3NKKA 2H5DA 1VR1H 4CRCA 1NRPH 1NBMD 4SGBE 1V2ST 5GIBA 1O2KA 2ZZUH 4X2XA 2ODYB 4KTCA 1NM6A 1EPTC 1L1JA 1TRMA 1V2RT 4I8JA 4X6OA 1YCPH 2A5KA 4B74A 4K8BA 4H4FA 5AFYH 1O2QA 1XUHA 4INHA 2BD8A 1P11E 1YLNA 1YLCA 1LVMA 2BQWB 4FUGA 1TGTA 1ZHPA 2NWNA 1O2TA 3OE7D 3BEUA 1ZHMA 5DP6A 1O2XA 3KNXA 2STAE 1C5YB 2A31A 4NIXA 3FKSD 5F8ZA 4HZHA 5FPSA 3VEQB 4Y0YE 1L4DA 2AHME 1THPB 2HLCA 2IPQX 2OCVB 3NCLA 4WMDA 1CT4E 3VB5A 2BY5X 1TGSZ 3IITA 1B5GH 4XD7D 1DWEH 3MU8A 1O5BB 2A1DB 2ZGJA 3AW0A 1HXFH 3H5CB 3SZEA 1MD8A 1ZRBA 2G81E 2QGRA 3DA9B 3M7UA 4WF8A 5C5OA 1FAXA 2Y6TA 1M9UA 3M5LA 1LHEH 5EODA 3S9BA 2I6QA 3F2FA 3T29A 1U6QA 2WPIS 2VU8E 1T8LA 5JBAS 1WQVH 2ZEBA 3OSYA 3A89A 3MMGA 3SUEA 4NIYA 3BTKE 5A0CA 1K0HA 2ANMH 3SJ9A 3PMBB 1SHYA 4Y76A 4F49A 1O2VA 3NPSA 1BQYA 1TNIA 1UHBA 1TWXB 3H7OA 3GCHB 4NWKA 3E8LA 6GCHF 4A1VA 1C4V2 1C5PA 1T7CA 1GBHA 3BSQA 5CHAC 2R9PA 1UVUH 7LPRA 5A8XA 1SLUB 1GI2A 2Z3EA 2QE7D 2W7UA 4Z0KA 3OY6U 3P95A 2QAAA 5F6MA 1C9TA 3RDZA 1UK3A 1EXFA 3LOXA 1C5VA 2WV4A 2R2WU 4K1SA 4JZIA 1TFXA 1CE5A 4F55A 1C2KA 2GV6A 5A0AE 1O3LA 5B6OA 3DCLA 1P04A 2JJ1D 2QXGA 3F9HA 3Q3XA 1TLDA 4DJZB 2BDAA 1P02A 1E36B 4X1QU 5DG6A 3T28A 4K1EA 1D9IA 1MKXH 1A5IA 1LPKB 2F9VA 4OS1A 1QGFA 4IMQA 4BTUB 1OSSA 2BZ6H 1O3JA 5L30H 3UPEA 1QRXA 1ETSH 2B8OH 2PKAA 1C5XB 2ZC9H 3OFND 1TX6A 3SZNA 4B73A 3T62A 2QF0A 2ZDKA 4AYVB 1GMHG 4DG4A 2WYGA 1E34B 2ZHFH 1XUGA 2O8UA 3LC5A 1TQ7B 4ISIH 1BMMH 1DY9A 3MNXA 2Z3DA 1IQKA 1GJ6A 1HPGA 1GHYH 1O2JA 3F68H 1SOZA 4RI0A 2AMPA 4CBNA 3U1IB 3A7ZA 4QT8C 2O8LA 3QGNB 1LKAA 4UONA 1KDQA 1ZMLA 4B6FA 4ZXYH 2BMGB 1G2LA 3HPTB 4OM9A 4ASHA 9ESTA 3RXBA 3DD2H 2OC1A 4ZCNA 2BXTH 3BG8A 1SLVB 1B0FA 2R2MB 3FANA 1QR3E 3EYDA 5C5NA 5L2ZH 1YPMH 5EU8A 1E0FD 3ZVAA 3MYWA 4MPVA 1DM4B 1CBWC 2B5TB 3KCGH 1CHOF 4JK6A 3LKWA 2J38A 2J5UA 4BXSA 3MNBA 4OS2A 1EFRD 4BAMB 1A0LA 1EB1H 1QL9A 3M5OA 1OWHA 1TIOA 2J94A 3M61U 1EKBB 3FZZA 1NRQH 1ANEA 2QIQA 2VH6A 4FU8A 3PRBA 2BZAA 3OU0A 3SI3H 1ZZZA 2R3UA 2F4LA 3A8CA 5EW1H 4BTTB 5JBCS 2DE9A 1DWCH 4DY7B 2BM2A 1PQ5A 4IC5A 1YY3A 1YP9A 1J9CH 3K6ZA 3ZVFA 4AGJA 2VINA 2V7QD 4ABFA 1BB0B 2H9HA 2VIVA 1FIZA 1EZQA 3GCOA 3U98H 3RC4A 3SGQE 2J98A 3PB1E 2AEIH 2FYQA 2RDEA 3GDSA 4Q7YA 4ASUD 1T8NA 1HCGA 2G55A 2VVUA 2WPHS 5KEDA 3DSGA 3S7KB 2ZGHA 2BY8X 4B71A 1GJAB 1S84A 1TBRH 1Q3XA 2UWPA 1DSUA 3SU1A 1YC0A 3PO1C 5J4QA 4KTSA 3PV4A 2FI4E 4DIHH 2BX3A 1C1VH 1O2YA 1W0JD 2TBSA 1UTNA 3LGIA 3ZV9A 1MCVA 2FOCA 3SV6A 2XYAA 4NWLA 5FHTA 1SSXA 1Y3VA 1WAYB 3SU5A 1TPSA 3FOAA 3OX7U 4U2WA 2XCFA 3V7TA 4AFZA 5KGOA 1KTSB 4X8SH 2ZDAH 2W3IA 1QA0A 3LDXH 3KGPA 2A45B 1J14A 1TPAE 5HIZA 1OS8A 1UVOA 2BLWA 1DXWA 2NU0E 7KMEH 1DLEA 1F5KU 5JBTA 1TNJA 2VBCA 3ODDA 1BRCE 1GBIA 1ELFA 3BTWE 3ZZAA 1KXEA 2FLBH 1UTJA 1TNLA 2O8WA 1AE8H 1SGFG 3Q3KA 2F9PA 7GCHG 3MU5A 1Z1IA 1Y8TA 2KCAA 3EAJA 3SV2H 1QL8A 1VJ9U 4O03A 2WUBA 4DIIH 2TGPZ 2Y81A 3F2HA 4Q2KA 1PPEE 2ZFRH 4GCHF 1ZMJA 2TGTA 5A8YA 5K7RA 3TK6A 1SGDE 1KY9A 3GY5A 3C27B 3T26A 3UTUH 1AUTC 1NFWA 1FZZA 2VB0A 2ZWLH 1GHXH 2AGIX 1IQIA 1O3DA 1BRBE 2ZKSA 1F5LA 2F3CE 3TPIZ 1H9LB 1OP8A 2V3OH 1AQ7A 4BAQB 3KN2A 1JIMA 1HIAB 2UUFB 3B9FH 5HM2A 4E7NA 2V6NA 3V12A 1GMCG 1S0RA 2GMTC 2R0KA 1DLKB 2VGCC 1GI5A 3W1EA 1KXAA 1QY6A 4X8VH 3VXEH 2GCHG 1DDJA 3EA7A 3S7HB 4XFQA 3C1KA 2UWLA 1GJ8B 3UQOA 3ZYEA 3A7YA 5ESBA 3RXRA 2K1QA 3SYJA 1MTNB 1N6XA 1CGIE 4MPUA 1P8VC 4WMEA 1MZAA 3ATLA 3QX5H 1C1NA 4ZUHA 5HIYA 2ZFPH 1SBWA 1W7GH 1PPCE 1ZGIA 5DJ7A 1FI8A 4RKOB 2PW8H 1Y3WA 1B0EA 1EZUC 2W6ID 2P3TB 4FUEA 2NU4E 1F2SE 3R3GB 2OC8A 2SGEE 3ATMA 2ZDNA 1O3KA 2JJ2D 1UW7A 1SG8B 5ESTE 1ESTA 1GBCA 1Z8GA 3QN7A 4Z6AH 1INCA 2QF3A 4J1YA 3URDA 3WY8A 1ORFA 1J16A 2EI8A 2A0QB 2FOFA 1C1MA 4MG3A 1C9PA 1P2NA 1EPTA 1QQUA 1W11U 1UTKA 2BD3A 1GI3A 1K1PA 3BTME 1H9IE 3M3VA 2W3KA 2OC0A 1YF4A 1HAVA 1Q31A 3TH3H 8ESTE 4X6NA 1GBFA 1BBRH 2WUCA 2ZCHP 2ZU5A 2KCOA 4TY7A 3U8RH 2AGGX 1NU9A 2BLOA 2D8WA 6CHAC 2BDGA 1J15A 3SJ8A 1P2MA 2O8MA 4TWWA 3A81A 1W0KD 1X7AC 4NCYA 4U01A 5BPEA 3W95A 3ENSB 2H2ZA 1LHCH 3EA9A 4X6PA 3M7TA 1T4VH 3MU0A 4NZLA 3K9XB 1Z1JA 1BTXA 1ETTH 3ZYDA 3PM3A 3T25A 3RM0H
chains in the Genus database with same CATH topology
1UW7A 2J98A 2J98B 5HIZA 5HIYA 3EE7A 5C94A 1QZ8A 2J97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW7 A;  2J98 A;  2J98 B;  5HIZ A;  5HIY A;  3EE7 A;  5C94 A;  1QZ8 A;  2J97 A; 
#chains in the Genus database with same CATH topology
 1ANC A;  1C1U H;  1CGH A;  2ZQ2 A;  1O34 A;  1KXF A;  5EPN A;  1GJ7 B;  2BDI A;  4LXB H;  1LPZ B;  3NXP A;  2GZ7 A;  3QTV H;  3V3M A;  3EDX B;  2KFW A;  4X1S U;  1N8O C;  3MO6 A;  1ZLR A;  2XRC A;  1SQT A;  4ZKN U;  4GHQ A;  3RMO H;  3M7Q A;  4JYU H;  3CP7 A;  3UFA A;  4F48 B;  3FFG A;  4K3J A;  5GWZ A;  2ZFS A;  1VCP A;  1MU8 B;  2P3F H;  2ZFF H;  1E1Q D;  5G4B A;  1O3F A;  1C2H A;  1SR5 C;  2P8O C;  2JH0 D;  4A7I B;  3GCT G;  1WSS H;  1GBJ A;  1NC6 A;  1H8D H;  2SFA A;  1NTP A;  4R0I A;  1EAT A;  1GI9 B;  3FP8 E;  2XBY A;  1HRT H;  1BMF D;  2KR7 A;  4H42 U;  3ZVB A;  2ZPR A;  1TRN A;  2VVC A;  4UFF H;  4AYY B;  1SPJ A;  1VGC C;  1ZSJ A;  1KYN A;  3HGP A;  5T1V A;  1PQA A;  2F9O A;  3M3S A;  2WPJ S;  1AKS A;  1BML A;  3BIV H;  3PV5 A;  4JZF H;  4X0W U;  3TH4 H;  2J97 A;  5JB8 S;  1KIG H;  2B7D H;  1ZSL A;  3SHC H;  4KP0 A;  4XDE A;  2XWB I;  3A88 A;  1SL3 A;  2QF5 A;  1D3Q B;  1DIC A;  3BG4 C;  4B6E A;  4X2V A;  4TYD A;  3OAA D;  4I8K A;  1MZD A;  3O8C A;  3Q77 A;  1GDQ A;  1K1J A;  4UDW H;  2WPM S;  1P2J A;  1NFX A;  1GVK B;  3BTD E;  1O35 A;  4RSP A;  1LVO A;  3H7T A;  8KME 2;  1YPK H;  1ANB A;  2PTN A;  1GMD F;  2P94 A;  4AGK A;  3U28 C;  2A7C A;  1WOF A;  4TY6 A;  3STJ A;  1O3O A;  1ELV A;  3I77 A;  1C5L H;  5JPM H;  2DE8 A;  2XXL A;  5I46 H;  1CA0 C;  3VGC C;  1UTM A;  4WY3 A;  1CBW B;  1GVL A;  1ETR H;  2ZTX A;  2PSY A;  4RN6 A;  1ARB A;  2Y5H A;  1O3E A;  1A3E H;  1NRS H;  2RCE A;  3P8F A;  5PTP A;  3DSP A;  3ZZC A;  1YCP M;  1OOK B;  2XW9 A;  3RMN H;  1MBM A;  1NO9 H;  1DT2 A;  4TPY A;  2OQU A;  2GVF A;  4ACB A;  1K28 D;  5EPY A;  2OTV A;  4P02 A;  5EXN A;  3FZD A;  3MNC A;  1MQ6 A;  4MPW A;  1FN6 A;  5DN6 D;  1QJ7 B;  1GI8 B;  3SN8 A;  1EOL A;  1AD8 H;  3LU9 B;  2ZIQ H;  4P00 A;  1E38 B;  1QIX B;  2XBV A;  2VWM A;  2BOH B;  5KEC A;  2BX4 A;  2VIP A;  4YOG A;  4ZHL U;  3FP7 E;  3SI4 H;  1FN8 A;  1W2K H;  4J2Y B;  3ZZ7 A;  1GDU A;  1OPH B;  5C1Y A;  1O3M A;  3VB7 A;  2CHA C;  2FOA A;  1WU1 A;  1TA2 A;  1V2J T;  1KXD A;  2ZI2 H;  3MFJ A;  1LHD H;  2A7J A;  1Y5B T;  1AUJ A;  1WTH D;  5GCH F;  2A5I A;  1BCU H;  1OXG A;  4ABG A;  1AHT H;  3PO1 B;  5EOK A;  1HAH H;  1SQO A;  1HJA C;  2FES H;  2IN2 A;  4ZKR U;  3AAV A;  4O9V A;  4CHA C;  1P01 A;  3RXI A;  1GVZ A;  3TGI E;  1BTU A;  1VIT H;  4IGD A;  3EE7 A;  1MKW H;  1TOC B;  1TAL A;  3F6U H;  1V2V T;  4X6M A;  1VKY A;  2GGV B;  1LHF H;  1L1N A;  4AFU A;  5GDS H;  4UE7 H;  1LO6 A;  1GJB B;  3QWC H;  4KEL A;  2JET B;  1G9I E;  1V2L T;  5HGG A;  4ZKS U;  1GHB G;  2GTB A;  2QC2 A;  3MH4 A;  5A09 A;  5K0H A;  3VB3 A;  4OS5 A;  1P2O A;  1C1T A;  1O33 A;  4ABD A;  2SGA A;  2SGP E;  2ANW A;  1NFU A;  1EAU A;  1GHA F;  1ZTL A;  3ATI A;  4Y11 E;  4Y6D A;  1SFI A;  5T6D A;  8GCH G;  4Y8X A;  2ZNK H;  1ID5 H;  1CA8 B;  1GBK A;  2ULL A;  3GIS B;  4NIW A;  3UOU A;  1YPG H;  1LDT T;  4ABB A;  1A0H B;  2OD3 B;  2OBQ A;  3E90 B;  3QGJ A;  3QZR A;  5IYT A;  3ZZ6 A;  3GDU A;  2ZU2 A;  5DP7 A;  1UHB B;  2EI7 A;  5SGA E;  3SJI A;  1FIW A;  2PR3 A;  1C5O H;  3MO9 A;  5C3N A;  1E1R D;  4RT0 A;  2BVS H;  1XKA C;  3K6Y A;  1COW D;  2VWN A;  5T6F A;  2FOB A;  3GDV A;  2PUX B;  1GCT C;  1DPO A;  2G5N A;  1H4W A;  1RIW C;  3DUX H;  3P8G A;  2GP9 B;  1EAS A;  3GY8 A;  5DPA A;  3BIU H;  5GPI B;  2ZGC A;  1EAW A;  1LCY A;  5E0G A;  2JDI D;  1NPM A;  1NRR H;  3LGW A;  1O2G H;  3MOC A;  1G3B A;  1AFQ C;  2EC9 H;  2C8Z B;  3A8A A;  1THS H;  1S5S A;  1Z7K A;  2Z9I A;  5FBE A;  1GHW H;  1UMA H;  4MNX A;  3RU4 T;  3SV8 A;  1UVT H;  1WXR A;  1BHX B;  2V0B A;  1EQ9 A;  2PKA B;  1EJM A;  3E6P H;  4MQA A;  4D8N A;  3D65 E;  3NUM A;  1KMH B;  3RUO A;  1JXP A;  3RC5 A;  3B8J A;  5H4I B;  1NFY A;  4FU9 A;  4XOJ A;  3D23 A;  5CHB A;  4AZ2 B;  1O31 A;  3KQE A;  4Y79 A;  2VJ1 A;  3CS0 A;  4YLQ H;  2ANY A;  2ZHD A;  1JWT A;  2BDH A;  2L74 A;  2AGE X;  3E91 A;  1HAG E;  5HM9 A;  1SLX B;  1MD7 A;  2PWX A;  3VFE A;  4BAH B;  1DS2 E;  1GI4 A;  3UWI A;  5C2Z A;  3D49 H;  1XKB C;  1FNI A;  3K65 B;  3LON A;  2K0Q A;  1MQ5 A;  4F4O C;  2NU3 E;  2HRV A;  1CHG A;  3RLY H;  4A1X A;  3EGK H;  1HAX B;  1OHH D;  1V2P T;  3RXF A;  1G30 B;  2VWL A;  4LK4 A;  2O8T A;  2PUQ H;  2EY4 C;  5C20 A;  3ZVE A;  2D1J A;  1O2W A;  1Z6E A;  3A7T A;  1WDI A;  2FO9 A;  4GVU A;  4YOI A;  1QQ4 A;  3STI A;  3RC6 A;  1AB9 C;  1BMN H;  1C1S A;  2OBO A;  3SOR A;  1TX8 A;  1OWE A;  2THF B;  1SGY E;  1ZHR A;  2SGF E;  3Q00 A;  4AFS A;  1SOT A;  4Y7B A;  2CF8 H;  3KQ5 A;  1L1G A;  2HNT E;  2Y7X A;  3BEI B;  4FUI A;  3HK3 B;  3OYP A;  3SV7 A;  1G37 A;  1MTV A;  2HPP H;  3TNS A;  2PKS C;  2J34 A;  1S6L A;  4HFP B;  2F9U A;  3A8D A;  1AFE H;  1FY3 A;  3T2N A;  1P57 B;  2YMS C;  3O8B A;  2J9N A;  1QB9 A;  1WBG B;  4BAO B;  3SNC A;  2F83 A;  1BRU P;  4ZKO U;  1P9S A;  1V2Q T;  1C5W B;  1NBM E;  3P8N A;  2QY0 B;  4E06 H;  4NFE A;  1P05 A;  1TMB H;  2Y7Z A;  2UUJ B;  4IMZ A;  3NRL A;  1RD3 B;  4MNY A;  1BT7 A;  1QCP A;  1C2E A;  2ZTY A;  2QN5 T;  1QBN A;  1O2L A;  2FOM B;  1XXD A;  1O0D H;  1ELB A;  2C8Y B;  3WW7 A;  4ABI A;  1TQ0 B;  2J98 B;  1N6Y A;  5EW2 H;  5LH8 A;  3BEF B;  1C5M D;  1ZR0 A;  1SGQ E;  1FPH H;  4X1P U;  1GMH F;  3RU4 D;  5FX6 A;  4Q80 A;  1YYY 1;  4JCN A;  2SNW A;  1MAX A;  2KCP A;  7EST E;  3BTH E;  2H5C A;  2V3M A;  5F53 A;  3UB0 A;  2C4F H;  1FY8 E;  2I6S A;  3F9G A;  1PQ8 A;  2UUY A;  4IS5 A;  2XC0 A;  1Z8I B;  4Y71 A;  1GJD B;  3KQD A;  1HYL A;  4FU7 A;  3JZ2 B;  1MTU A;  1YM0 A;  4A92 A;  1HAI H;  2BQ6 B;  5E2P A;  3LJJ A;  5LPE A;  1A1R A;  4CBO A;  3QO6 A;  1Y5U T;  2HPQ H;  1ZRK A;  1PPG E;  4NIV A;  1VGC B;  2GX4 A;  1BJV A;  1O5E H;  4B75 A;  3TK9 A;  2PFE A;  1QFK H;  1FAK H;  2BOK A;  2W6J D;  2NU1 E;  3VPK A;  4YM9 A;  1YCP K;  3BTQ E;  1T8M A;  3ZZ3 A;  4E05 H;  3MU1 A;  2XBX A;  2AER H;  1XUJ A;  2XWA A;  1GGD B;  5DP5 A;  1AZ8 A;  1AZZ A;  4FUD A;  2FS9 A;  1UCY H;  2LP6 A;  1FDP A;  2IOT A;  2WPK S;  3SNA A;  5DP8 A;  3RXC A;  3RXQ A;  1MMJ N;  3K2U A;  3KYG A;  2BQ7 B;  3GYL B;  1ELC A;  4VGC C;  4WXV A;  3A82 A;  3HKI B;  1Z8R A;  5HMA A;  1IHS H;  3F0P A;  4NA8 A;  1P03 A;  3SNE A;  1TAW A;  3E3T A;  5EXM A;  4E7R G;  1XVM A;  1S85 A;  1NS3 A;  1FY4 A;  2OIN A;  3DHK H;  1ELG A;  3SU3 A;  1J8A A;  3UIR A;  3AK5 A;  1DIT H;  3RXO A;  1J17 T;  1O3C A;  2CMY A;  1F7Z A;  3Q3Y A;  3F3B A;  4DVA U;  2Y5F A;  1CA0 B;  3VGC B;  2ZP0 H;  4OGX A;  1IQL A;  2QXI A;  4B1T A;  3OEE D;  1BJU A;  1AIX H;  1V2U T;  2A7H A;  2F43 B;  1O2N A;  1C1R A;  4FVB A;  3S9C A;  1LQD B;  4MTB A;  2ODP A;  2GV7 A;  3HKJ B;  3HGN A;  1KLJ H;  3SBK A;  1GI7 B;  2FX4 A;  3EQ0 H;  1P2Q A;  2LEL A;  4FUF A;  1NRO H;  2FWW A;  1BZX E;  1O2U A;  2VIW A;  3H09 A;  5J4S A;  1UO6 A;  3UQV A;  1V2N T;  3UNS A;  4B2C A;  3N7O A;  3E0P B;  4NFF A;  2WPD D;  4THN H;  3RXV A;  1FON A;  4ISL A;  1A5H A;  4NSV A;  3U9A H;  4WMF A;  4A1T A;  2J4I A;  1PQ7 A;  1RTL A;  1TYN A;  2G52 A;  3GCH C;  4B76 A;  2NU2 E;  4RT1 A;  2WHX A;  4D7F A;  4XSK U;  2OQ5 A;  3RXA A;  4NZQ A;  2TRM A;  1IQJ A;  1S6F A;  4I8L A;  1MKX K;  4DT7 B;  3LH1 A;  1HAZ B;  2YOL A;  2CHA B;  2WIN I;  3WWB A;  3A83 A;  1OWJ A;  4A6L A;  4GPG A;  4FUJ A;  4DT4 A;  5GJ4 B;  3E1X B;  2Z7F E;  5C0U A;  1BA8 B;  1QJ1 B;  3O8R A;  1P06 A;  3ATW A;  3N7E A;  1EZX C;  3QUM P;  4X1R U;  3KHV A;  1TAB E;  1P0S H;  5JYI A;  7GCH F;  1IHT H;  4IW4 E;  1GJC B;  1EPT B;  2K8I A;  1EB2 A;  1O2Z A;  1FXY A;  2C90 B;  3QLP H;  1HGT H;  4CRF A;  1O3B A;  2B0F A;  4WXI A;  3V13 A;  2GCT C;  1NU7 B;  1HAV B;  1UTO A;  2ZU1 A;  5F8T A;  4AFQ A;  1JBU H;  5FAH A;  1DAN H;  2FIR H;  5EGM A;  3DT0 H;  2FI5 E;  2WSS D;  3UWJ H;  5EIY A;  4CRA A;  3PMH B;  3PRO A;  1WV7 H;  1RFN A;  2AYW A;  2GT7 A;  1AMH A;  2GDE H;  3KQC A;  4YOJ A;  5E8E H;  2RA3 A;  1MAB B;  1OWI A;  3ZV8 A;  3UAI C;  4KKD A;  3NWU A;  5A8Z A;  1GMC F;  2HWL B;  1Z6J H;  3TH2 H;  1TGB A;  3KID U;  1YPH C;  1W14 U;  2GCH F;  4O3U A;  3GY6 A;  1K9O E;  3IG6 B;  1G2M A;  1W7X H;  3BTG E;  3EE0 B;  4Y0Z E;  1H9H E;  1SC8 U;  2ZHW H;  1C4Y 2;  1KLI H;  2LPR A;  1QRZ A;  3VB4 A;  2XCN A;  2XC5 A;  1A7S A;  5DKM A;  3VXF H;  1CU1 A;  1O3G A;  1RIW B;  1AGJ A;  1ELT A;  1SQR A;  1AO5 A;  5CHA B;  2ZU4 A;  4NSY A;  1VIT F;  2ZA5 A;  1TRY A;  2ZF0 H;  2C93 B;  5LPR A;  1O3P B;  1T4U H;  1RTF B;  2GDD A;  1GJ9 B;  1BIT A;  2EQN A;  5L6N H;  1CSO E;  1GJ4 H;  3KQB A;  1S81 A;  1RGQ A;  4CH8 B;  5E0H A;  2BLV A;  4FOU C;  2FPZ A;  3RXL A;  3LT3 A;  1SVP A;  2ZQ1 A;  1RJX B;  1QTF A;  3DFJ A;  4Q7X A;  1S83 A;  4K2Y A;  1AKS B;  2PGQ B;  1H8H D;  2KX4 A;  4CRE A;  6EST A;  1GI0 A;  1DUA A;  1LHG H;  5I25 A;  3A86 A;  2ODQ A;  4I8H A;  1BTY A;  1SKY E;  6LPR A;  1YPE H;  4O3T A;  1ESB A;  2ASU B;  3RP2 A;  4MVN A;  2OC7 A;  2Z3C A;  3LGV A;  1K21 H;  1C2G A;  1ZPB A;  2VIQ A;  4TT3 D;  1MAY A;  1UTQ A;  4KGA A;  1UTL M;  3LGU A;  3SU2 A;  5A2M H;  2P3U B;  4I33 A;  3UUZ A;  1P3E A;  3UR9 A;  1IQF A;  2VH0 A;  4CRG A;  1TNK A;  4YES B;  4YTA A;  4ABE A;  4AB9 A;  9LPR A;  1JRT A;  2BD4 A;  1UCY K;  2CK3 D;  3ZVG A;  2OUA A;  2YMS D;  4ZXX H;  3GY7 A;  1LVB A;  4AB8 A;  4H6S B;  4YLU A;  1AB9 B;  1MCT A;  1SGC A;  1SQA A;  3RMM H;  1XUI A;  3D62 A;  4GHT A;  1QB6 A;  4HTC H;  5C1X A;  1WYK A;  1PYT D;  3O8D A;  1A3B H;  1T8O A;  1C1P A;  1NY2 2;  1D3P B;  2QA9 E;  1O5F H;  1V2M T;  2UUK B;  3QTO H;  1O30 A;  4FUB A;  1HAY B;  3SNB A;  3Q76 A;  2FLR H;  3MH7 A;  3P17 H;  3GY4 A;  1CT0 E;  3LIW A;  4YXW D;  1MTW A;  3TJU A;  3LJO A;  4I7Y H;  2CXV A;  3OY5 U;  2FZZ A;  3ZIA D;  2BXU H;  3MH6 A;  1QNJ A;  3GCT F;  2PSX A;  5DK1 A;  2JH5 D;  2AIP A;  2BTC E;  2AMD A;  5ABW A;  1GWA A;  1F5R A;  1OYQ A;  2BDC A;  1O2H A;  3S0N A;  3MH5 A;  1F0T A;  2BDY A;  1RXP A;  3V0X A;  2EA3 A;  2TGD A;  5FXL A;  4MNW A;  2BY6 X;  1IQM A;  3M36 A;  3PLK A;  2FTM A;  1GCD A;  2OK5 A;  3TJO A;  2HGT H;  3GY2 A;  3UY9 A;  2B9L A;  3A7W A;  5GND A;  2Z94 A;  2BLQ A;  2VNT A;  4OS4 A;  4FUH A;  1OWD A;  3ZZ9 A;  2KAI A;  3SJK A;  3S69 A;  4DCD A;  4UFD H;  1NN6 A;  3A8B A;  3LC3 A;  1ELE E;  1ACB E;  1C2D A;  2ZPQ A;  1VZQ H;  4BXW A;  3EST A;  4MDS A;  1TON A;  1ZOM A;  1C5U A;  2G8T A;  1O5C B;  1QJ6 B;  5EXL A;  3T27 A;  1ZGV A;  3PWC A;  4DOQ A;  1EZS C;  4Q4L A;  2ZDL A;  3L33 A;  5EQQ A;  4CH2 B;  2Q1J A;  2KZ4 A;  3QDZ B;  1TB6 H;  1ARC A;  3VG8 A;  5TJX A;  2IJO B;  3GS9 A;  4MNV A;  3TVJ B;  2XNI A;  1EP5 A;  2XTT B;  2A32 A;  2SNV A;  1GDN A;  3UR6 A;  1MTN C;  5F8X A;  1DY8 A;  1GI1 A;  4K60 A;  4GUX A;  1OP2 A;  3LGY A;  3LPR A;  3N99 A;  5DP4 A;  3BV9 B;  4Y8Y A;  5IK2 D;  1HDT H;  6GCH G;  4PRO A;  1EX3 A;  1YPJ H;  1C4U 2;  3RXP A;  1AU8 A;  3URE A;  1UJ1 A;  4AX9 H;  1HJ9 A;  4D9R A;  1BDA A;  2Z9G A;  1CGJ E;  4ZH8 A;  4BOH A;  1FUJ A;  5JBB S;  1TE0 A;  1K1L A;  1H1B A;  4JYT A;  1V2K T;  1ZTJ A;  3SO3 A;  2BVX H;  1QZ8 A;  1GL0 E;  1HAO H;  4JK5 A;  1RS0 A;  4D9Q A;  4UEH H;  4VGC B;  2ZCK P;  2GZ8 A;  1BBR K;  1TPO A;  3FP6 E;  4Q7Z A;  2EEK A;  1JRS A;  1O5D H;  2QCY A;  3ZZ8 A;  2P95 A;  2AMQ A;  2ZPS A;  1P2I A;  1GBE A;  3BN9 A;  4XBC A;  1G3E A;  3P70 B;  1SGF A;  1GI6 A;  1SFQ B;  1BMA A;  3ZVC A;  1NT1 A;  4Z1M D;  1N1L A;  3I78 A;  1EAI A;  1BBR E;  4WH6 A;  5FBI A;  5AVD A;  4AG2 A;  2FOG A;  1NZQ H;  2R0L A;  5C67 A;  2G4U A;  5T3H A;  2FMJ A;  1O2R A;  1MU6 B;  2HVY B;  1D6R A;  1O39 A;  1EOJ A;  3L3T A;  2HLD D;  2ZGX H;  3SND A;  4YO9 A;  2DUC A;  1Z8J B;  4CRB A;  2ZEC A;  1G3C A;  1XUF A;  4X8T H;  3RXK A;  1WTG H;  2WV5 A;  1TPP A;  4JZE H;  2BD2 A;  2M5T A;  3MTY A;  3GOV B;  4ISO A;  1YWU A;  1ZSK A;  2A5A A;  1L4Z A;  3BTF E;  2C8W B;  2OXS A;  2GMT B;  1UTP A;  2VGC B;  4BTI B;  1BIO A;  4I8G A;  5ETX A;  1Z71 A;  2KCY A;  1G32 B;  2OP9 A;  1A0J A;  3RXS A;  2FP7 B;  1SGI B;  3QZQ A;  4X1N U;  4U30 A;  1HJ8 A;  5FCR A;  1C2F A;  3SJO A;  1AWH B;  3DSO A;  1GHB F;  1FPC H;  4R8T B;  1FY1 A;  4X2W A;  1C5Z B;  1WUN H;  1HB0 B;  1CHO G;  1A4W H;  1Q2W A;  5TCC A;  5EJ1 A;  1AN1 E;  1ZPC A;  2Q6D A;  1FX0 B;  3QK1 A;  1FLE E;  1F0S A;  3SU4 A;  1IAU A;  8GCH F;  1C2I A;  1F92 A;  2QF4 A;  4CR9 A;  2H6M A;  1HLT H;  1S0Q A;  1SLW B;  1XM1 A;  1K2I 1;  4CR5 A;  3LH3 A;  1DST A;  3RXT A;  1YBW A;  3SOS A;  1KDQ B;  2VID A;  1OWK A;  3I29 A;  1HV7 A;  4NA7 A;  1BTZ A;  5BRR E;  2GCT B;  1BUI A;  1C5S A;  1ZMN A;  3KYF A;  4XBB A;  1E37 B;  1TNH A;  4Y10 E;  2IPH A;  2YNA A;  1GHV H;  2STB E;  4OS7 A;  1O3H A;  1DVA H;  3MHW U;  1DOJ A;  1GHZ A;  2PP6 A;  4BAK B;  1MH0 A;  2G5V A;  1SGR E;  1OKX A;  1QL7 A;  2FOH A;  1XUK A;  1PPZ A;  3GY3 A;  2QXH A;  3A84 A;  1YPL H;  1GG6 C;  3B23 B;  1ZPZ A;  5LPF A;  1A61 H;  1CT2 E;  6CHA B;  1V2O T;  2H1U A;  1BOQ A;  3HAT H;  5JB9 S;  3MO3 A;  1BTH H;  5E2O A;  4ABJ A;  2C8X B;  3T5F H;  3MQK C;  1A5G H;  1G3D A;  3ZZ4 A;  5CDF E;  1AVG H;  1P12 E;  1D4P B;  4FET A;  1P9U A;  3SQE E;  3PTB A;  1V2T T;  1C1O A;  1QBV H;  5F03 A;  5AHG H;  1PYT C;  2ILN A;  1O5A B;  2FOE A;  3GIC B;  2VIO A;  1AE5 A;  1GBL A;  2A4G A;  1DFP A;  3FO8 D;  3BTT E;  5TCA A;  1AVX A;  1TBZ H;  5HXF A;  3JZ1 B;  2W5E A;  5C17 A;  1AY6 H;  1N8O B;  1NES E;  3E16 B;  2PLX A;  3M35 A;  4IN1 A;  4JYV H;  2J2U A;  1MBQ A;  4GAW A;  1UVS H;  4FVD A;  1W13 U;  2P8O B;  3MI4 A;  3U8O H;  1TBQ H;  4INK A;  5FL7 D;  2BYA X;  2Y5G A;  2V35 A;  3RXE A;  2JH6 D;  4AN7 A;  1HAP H;  1THR H;  1Y3Y A;  4A5T S;  1SGN E;  1G36 A;  1GBM A;  3U1J B;  2VVV A;  2LNC A;  2Z9L A;  2SGQ E;  4GCH G;  2FYR A;  2V3H H;  4DGJ A;  1SGT A;  3M37 A;  1XX9 A;  4YT7 H;  4KTU A;  1C5T A;  5FPT A;  2FXR A;  3TLO A;  3CNR A;  2KM0 A;  3L6P A;  1K1I A;  4JMY A;  2ZDV H;  1XVO A;  1DWD H;  3VB6 A;  1LVY A;  4TPI Z;  2AS9 A;  1C5Q A;  4OS6 A;  1DXP A;  1MKW K;  3KEE A;  3RXG A;  1TOM H;  2PV9 B;  3RXH A;  1D6W A;  5JDU B;  4MLF B;  5DO4 H;  5LGO A;  3A80 A;  1O2S A;  1NRN H;  3BG4 B;  3MNS A;  1O2I A;  3PV2 A;  2FEQ H;  5C1U A;  3F2G A;  4M7G A;  2RA0 A;  2XOK D;  4XBD A;  1E35 B;  1FMG A;  3PMJ A;  3CS7 A;  2BY9 X;  2HNT C;  2Y82 A;  3P6Z B;  4HG6 A;  2M2A A;  1W12 U;  1A46 H;  1P09 A;  2Z6B D;  4B2B A;  3RXM A;  2UWO A;  2GKV E;  2ALV A;  1QB1 A;  3PMA B;  2A4R A;  1EUF A;  2JET C;  1FQ3 A;  1P2K A;  2CF9 H;  2GJG A;  4OGY A;  1O3A A;  1CO7 E;  1C5N H;  3OTP A;  1MTS A;  3M5M A;  4ZHA A;  2ZU3 A;  1BRA A;  4I32 A;  3SGB E;  5EJL A;  3BF6 H;  1GL1 A;  3MWI U;  5E0J A;  5EQS A;  2HVX A;  3CEN A;  2BD5 A;  1W3C A;  3SU6 A;  3UOP A;  2ALP A;  1W0Y H;  3M5N A;  1E79 D;  2TPI Z;  3GYM A;  4IN2 A;  2CN0 H;  3ATK A;  1K22 H;  1DX5 M;  1KSN A;  3F0O A;  1L2E A;  2L6O A;  1O3I A;  1S82 A;  4FUC A;  4I31 A;  1H8E D;  4WWY A;  1SB1 H;  4XE4 A;  4NGA H;  5DSF A;  3ZZD A;  2XC4 A;  1AI8 H;  1GBD A;  5EG4 A;  1XXF A;  4XRN A;  3OTJ E;  1KLT A;  1TGN A;  3A7V A;  1C2L A;  1YPH E;  1MUE B;  4K5Z A;  1C5R A;  4HGC A;  1JMO H;  3ODF A;  1ABJ H;  1W0Z U;  3ZVD A;  4D76 A;  5FPY A;  1SMF E;  1EP6 A;  1Y5A T;  3RML H;  3AVZ A;  3URC A;  3OEH D;  2YNB A;  3PLB A;  5DP9 A;  2RG3 A;  1C1Q A;  4H6T A;  1FV9 A;  4LOY H;  3SGA E;  1VJA U;  3M3T A;  5EJZ A;  2FDA A;  5C0T A;  3SV9 A;  4ISN A;  4TSF D;  4ACA A;  1YGC H;  1IOE A;  4LZ4 B;  3PYH A;  1SHH B;  2BB4 A;  1HJA B;  2G51 A;  2HNT F;  2HAL A;  3TK5 A;  1HIA A;  3W94 A;  4CHA B;  4K1T A;  2F9B H;  3SUD A;  2W7S A;  2QV1 A;  4WH8 A;  3TGK E;  2XBW A;  2HOB A;  4JZD H;  2EST E;  4X2Y A;  4AG1 A;  2FTL E;  2BDB A;  3NK8 A;  1WCZ A;  2QYI A;  5HKK D;  1DE7 H;  3SUG A;  4LZ1 H;  4JZ1 A;  2QXJ A;  4IBL H;  2ZFQ H;  1VIT G;  2EI6 A;  1PJP A;  1TMU H;  2G4T A;  2TGA A;  2ZGB H;  2VWO A;  5A0B A;  5DP3 A;  2SGD E;  3TIU A;  3RU4 E;  2WZQ A;  4DUR A;  1RTK A;  1QBO A;  1SI5 H;  1V2W T;  4U32 A;  1DUE A;  4I86 A;  1O32 A;  1YKT A;  4Y7A A;  3RXJ A;  2A2Q H;  4UFG H;  2ZFT A;  1O36 A;  2P16 A;  3P8O A;  1XMN B;  3TGJ E;  2FM2 A;  3G01 A;  3PWB A;  2D26 C;  4BNR A;  3KF2 A;  3S9A A;  2RDL A;  4HI3 A;  3HK6 B;  3AAS A;  3FAO A;  1VCQ A;  1W8B H;  2JIZ D;  3A87 A;  4GSO A;  2CV3 A;  3KL6 A;  1K1O A;  4WVP E;  1PFX C;  1HBT H;  2IJD 1;  2AFQ B;  2J92 A;  5FX5 A;  3TJN A;  1P3C A;  3TIT A;  2ZDM A;  5GXP A;  1ESA A;  1D3D B;  1QUR H;  1FJS A;  3ITI A;  2BY7 X;  1D3T B;  1GCT B;  3UNQ A;  1PPF E;  2A4O A;  1SGP E;  1LQE A;  1LMW B;  1AND A;  3SUF A;  4O97 A;  1W10 U;  1UVP A;  3FVF B;  1ZTK A;  1TA6 A;  1GBB A;  4ABH A;  1BHX F;  2CJI A;  2RFK C;  4YT6 H;  1RRK A;  1V3X A;  2PTC E;  2A4Q A;  1BTW A;  1AFQ B;  4NG9 H;  1P10 A;  3SHA H;  1WQS A;  3SW2 B;  1EJA A;  1L0Z A;  2ZCL P;  1CQQ A;  1C1W H;  1GMD G;  8LPR A;  2BHG A;  5CE1 A;  5AFZ H;  3NZI A;  2GZ9 A;  2Y80 A;  3PLP A;  2FOD A;  1JOU B;  4ZMA H;  4B2A A;  1PPH E;  4YZU A;  4SGA E;  3A85 A;  5EQR A;  2AH4 X;  2H9E H;  1C2M A;  3GCN A;  1GBA A;  1SGE E;  4ZAE A;  2F91 A;  3P92 A;  1GBT A;  2PGB B;  1T31 A;  4M9F A;  3RXU A;  3BTE E;  3A7X A;  2W26 A;  4AOR A;  3SQH E;  2F9N A;  3F9E A;  2GD4 B;  4ZRO A;  1HFD A;  1TX7 A;  2Q6F A;  4UD9 H;  1DWB H;  1GPZ A;  2Z9J A;  2ZHQ H;  3SU0 A;  1QRW A;  4RKJ B;  2WV9 A;  4K69 A;  2FX6 A;  1HXE H;  1V6D A;  4EST E;  1AWF H;  1ZJK A;  5AF9 H;  5L2Y H;  1YLD A;  5C94 A;  1ZJD A;  1LPG B;  4X8U H;  4CRD A;  3PTN A;  3AAU A;  3PRD A;  3N7D A;  5HYO A;  1O2P A;  4INL A;  1Y3X A;  3U69 H;  2R3Y A;  2G00 A;  5IDK A;  1KTT B;  4DW2 U;  3LGT A;  1OYT H;  1O2M A;  4IC6 A;  3ZZ5 A;  1EAX A;  2FS8 A;  1GGD C;  3RM2 H;  2FI3 E;  2Z9K A;  1B7X B;  1GG6 B;  2GT8 A;  1UK2 A;  1C2J A;  1T32 A;  1QA7 A;  2J95 A;  1CVW H;  1UCY E;  2WYJ A;  3WWF A;  5DGJ A;  1O2O A;  2Q6G A;  2PKS B;  2CGA A;  1ZYO A;  5GCH G;  1IQH A;  3AW1 A;  1TGC A;  2AIQ A;  1TMT H;  2YMS B;  4AC9 A;  1QHR B;  2TIO A;  1K1M A;  1BTP A;  3E0N B;  2H9T H;  2JKH A;  1K1N A;  2BVR H;  3EA8 A;  3ZZB A;  2ZG0 H;  2C3S A;  1OP0 A;  1F0U A;  4BAN B;  4NA9 H;  4Y8Z A;  1HUT H;  1KXB A;  3F1S B;  4WJG 2;  1HNE E;  1IQN A;  5B6L A;  1LKB A;  1OX1 A;  4GLY A;  4TWY A;  2KAI B;  3TNT A;  1IQE A;  1LTO A;  2OLG A;  4ISH H;  1IQG A;  2O9Q A;  3R0F A;  1O5G H;  4AOQ A;  3DFL A;  1ELD E;  2A2X H;  3ELA H;  2BD7 A;  2XND D;  1EJN A;  1PPB H;  5CMX H;  4UFE H;  1FY5 A;  4ABA A;  1ABI H;  1JIR A;  4D7G A;  1GHA G;  1O3N A;  1VCW A;  3TU7 H;  4MPX A;  4ZHM U;  3TJV A;  1GJ5 H;  4FXG H;  5FCK A;  2P93 A;  1O37 A;  3U8T H;  1F0R A;  3FN8 A;  2ZO3 H;  2D2D A;  1AVW A;  1Y3U A;  2ZTZ A;  1A2C H;  4Q63 A;  1Y59 T;  1KXC A;  1TNG A;  1O38 A;  1H8I H;  3UNR A;  3MU4 A;  3IWM A;  3RXD A;  1ELA A;  2ZHE H;  3RLW H;  2ANK H;  2WPL S;  2PHB A;  4K8Y A;  1S6H A;  2P59 A;  2BD9 A;  3F9F A;  5T6G A;  1UK4 A;  3NKK A;  2H5D A;  1VR1 H;  4CRC A;  1NRP H;  1NBM D;  4SGB E;  1V2S T;  5GIB A;  1O2K A;  2ZZU H;  4X2X A;  2ODY B;  4KTC A;  1NM6 A;  1EPT C;  1L1J A;  1TRM A;  1V2R T;  4I8J A;  4X6O A;  1YCP H;  2A5K A;  4B74 A;  4K8B A;  4H4F A;  5AFY H;  1O2Q A;  1XUH A;  4INH A;  2BD8 A;  1P11 E;  1YLN A;  1YLC A;  1LVM A;  2BQW B;  4FUG A;  1TGT A;  1ZHP A;  2NWN A;  1O2T A;  3OE7 D;  3BEU A;  1ZHM A;  5DP6 A;  1O2X A;  3KNX A;  2STA E;  1C5Y B;  2A31 A;  4NIX A;  3FKS D;  5F8Z A;  4HZH A;  5FPS A;  3VEQ B;  4Y0Y E;  1L4D A;  2AHM E;  1THP B;  2HLC A;  2IPQ X;  2OCV B;  3NCL A;  4WMD A;  1CT4 E;  3VB5 A;  2BY5 X;  1TGS Z;  3IIT A;  1B5G H;  4XD7 D;  1DWE H;  3MU8 A;  1O5B B;  2A1D B;  2ZGJ A;  3AW0 A;  1HXF H;  3H5C B;  3SZE A;  1MD8 A;  1ZRB A;  2G81 E;  2QGR A;  3DA9 B;  3M7U A;  4WF8 A;  5C5O A;  1FAX A;  2Y6T A;  1M9U A;  3M5L A;  1LHE H;  5EOD A;  3S9B A;  2I6Q A;  3F2F A;  3T29 A;  1U6Q A;  2WPI S;  2VU8 E;  1T8L A;  5JBA S;  1WQV H;  2ZEB A;  3OSY A;  3A89 A;  3MMG A;  3SUE A;  4NIY A;  3BTK E;  5A0C A;  1K0H A;  2ANM H;  3SJ9 A;  3PMB B;  1SHY A;  4Y76 A;  4F49 A;  1O2V A;  3NPS A;  1BQY A;  1TNI A;  1UHB A;  1TWX B;  3H7O A;  3GCH B;  4NWK A;  3E8L A;  6GCH F;  4A1V A;  1C4V 2;  1C5P A;  1T7C A;  1GBH A;  3BSQ A;  5CHA C;  2R9P A;  1UVU H;  7LPR A;  5A8X A;  1SLU B;  1GI2 A;  2Z3E A;  2QE7 D;  2W7U A;  4Z0K A;  3OY6 U;  3P95 A;  2QAA A;  5F6M A;  1C9T A;  3RDZ A;  1UK3 A;  1EXF A;  3LOX A;  1C5V A;  2WV4 A;  2R2W U;  4K1S A;  4JZI A;  1TFX A;  1CE5 A;  4F55 A;  1C2K A;  2GV6 A;  5A0A E;  1O3L A;  5B6O A;  3DCL A;  1P04 A;  2JJ1 D;  2QXG A;  3F9H A;  3Q3X A;  1TLD A;  4DJZ B;  2BDA A;  1P02 A;  1E36 B;  4X1Q U;  5DG6 A;  3T28 A;  4K1E A;  1D9I A;  1MKX H;  1A5I A;  1LPK B;  2F9V A;  4OS1 A;  1QGF A;  4IMQ A;  4BTU B;  1OSS A;  2BZ6 H;  1O3J A;  5L30 H;  3UPE A;  1QRX A;  1ETS H;  2B8O H;  2PKA A;  1C5X B;  2ZC9 H;  3OFN D;  1TX6 A;  3SZN A;  4B73 A;  3T62 A;  2QF0 A;  2ZDK A;  4AYV B;  1GMH G;  4DG4 A;  2WYG A;  1E34 B;  2ZHF H;  1XUG A;  2O8U A;  3LC5 A;  1TQ7 B;  4ISI H;  1BMM H;  1DY9 A;  3MNX A;  2Z3D A;  1IQK A;  1GJ6 A;  1HPG A;  1GHY H;  1O2J A;  3F68 H;  1SOZ A;  4RI0 A;  2AMP A;  4CBN A;  3U1I B;  3A7Z A;  4QT8 C;  2O8L A;  3QGN B;  1LKA A;  4UON A;  1KDQ A;  1ZML A;  4B6F A;  4ZXY H;  2BMG B;  1G2L A;  3HPT B;  4OM9 A;  4ASH A;  9EST A;  3RXB A;  3DD2 H;  2OC1 A;  4ZCN A;  2BXT H;  3BG8 A;  1SLV B;  1B0F A;  2R2M B;  3FAN A;  1QR3 E;  3EYD A;  5C5N A;  5L2Z H;  1YPM H;  5EU8 A;  1E0F D;  3ZVA A;  3MYW A;  4MPV A;  1DM4 B;  1CBW C;  2B5T B;  3KCG H;  1CHO F;  4JK6 A;  3LKW A;  2J38 A;  2J5U A;  4BXS A;  3MNB A;  4OS2 A;  1EFR D;  4BAM B;  1A0L A;  1EB1 H;  1QL9 A;  3M5O A;  1OWH A;  1TIO A;  2J94 A;  3M61 U;  1EKB B;  3FZZ A;  1NRQ H;  1ANE A;  2QIQ A;  2VH6 A;  4FU8 A;  3PRB A;  2BZA A;  3OU0 A;  3SI3 H;  1ZZZ A;  2R3U A;  2F4L A;  3A8C A;  5EW1 H;  4BTT B;  5JBC S;  2DE9 A;  1DWC H;  4DY7 B;  2BM2 A;  1PQ5 A;  4IC5 A;  1YY3 A;  1YP9 A;  1J9C H;  3K6Z A;  3ZVF A;  4AGJ A;  2VIN A;  2V7Q D;  4ABF A;  1BB0 B;  2H9H A;  2VIV A;  1FIZ A;  1EZQ A;  3GCO A;  3U98 H;  3RC4 A;  3SGQ E;  2J98 A;  3PB1 E;  2AEI H;  2FYQ A;  2RDE A;  3GDS A;  4Q7Y A;  4ASU D;  1T8N A;  1HCG A;  2G55 A;  2VVU A;  2WPH S;  5KED A;  3DSG A;  3S7K B;  2ZGH A;  2BY8 X;  4B71 A;  1GJA B;  1S84 A;  1TBR H;  1Q3X A;  2UWP A;  1DSU A;  3SU1 A;  1YC0 A;  3PO1 C;  5J4Q A;  4KTS A;  3PV4 A;  2FI4 E;  4DIH H;  2BX3 A;  1C1V H;  1O2Y A;  1W0J D;  2TBS A;  1UTN A;  3LGI A;  3ZV9 A;  1MCV A;  2FOC A;  3SV6 A;  2XYA A;  4NWL A;  5FHT A;  1SSX A;  1Y3V A;  1WAY B;  3SU5 A;  1TPS A;  3FOA A;  3OX7 U;  4U2W A;  2XCF A;  3V7T A;  4AFZ A;  5KGO A;  1KTS B;  4X8S H;  2ZDA H;  2W3I A;  1QA0 A;  3LDX H;  3KGP A;  2A45 B;  1J14 A;  1TPA E;  5HIZ A;  1OS8 A;  1UVO A;  2BLW A;  1DXW A;  2NU0 E;  7KME H;  1DLE A;  1F5K U;  5JBT A;  1TNJ A;  2VBC A;  3ODD A;  1BRC E;  1GBI A;  1ELF A;  3BTW E;  3ZZA A;  1KXE A;  2FLB H;  1UTJ A;  1TNL A;  2O8W A;  1AE8 H;  1SGF G;  3Q3K A;  2F9P A;  7GCH G;  3MU5 A;  1Z1I A;  1Y8T A;  2KCA A;  3EAJ A;  3SV2 H;  1QL8 A;  1VJ9 U;  4O03 A;  2WUB A;  4DII H;  2TGP Z;  2Y81 A;  3F2H A;  4Q2K A;  1PPE E;  2ZFR H;  4GCH F;  1ZMJ A;  2TGT A;  5A8Y A;  5K7R A;  3TK6 A;  1SGD E;  1KY9 A;  3GY5 A;  3C27 B;  3T26 A;  3UTU H;  1AUT C;  1NFW A;  1FZZ A;  2VB0 A;  2ZWL H;  1GHX H;  2AGI X;  1IQI A;  1O3D A;  1BRB E;  2ZKS A;  1F5L A;  2F3C E;  3TPI Z;  1H9L B;  1OP8 A;  2V3O H;  1AQ7 A;  4BAQ B;  3KN2 A;  1JIM A;  1HIA B;  2UUF B;  3B9F H;  5HM2 A;  4E7N A;  2V6N A;  3V12 A;  1GMC G;  1S0R A;  2GMT C;  2R0K A;  1DLK B;  2VGC C;  1GI5 A;  3W1E A;  1KXA A;  1QY6 A;  4X8V H;  3VXE H;  2GCH G;  1DDJ A;  3EA7 A;  3S7H B;  4XFQ A;  3C1K A;  2UWL A;  1GJ8 B;  3UQO A;  3ZYE A;  3A7Y A;  5ESB A;  3RXR A;  2K1Q A;  3SYJ A;  1MTN B;  1N6X A;  1CGI E;  4MPU A;  1P8V C;  4WME A;  1MZA A;  3ATL A;  3QX5 H;  1C1N A;  4ZUH A;  5HIY A;  2ZFP H;  1SBW A;  1W7G H;  1PPC E;  1ZGI A;  5DJ7 A;  1FI8 A;  4RKO B;  2PW8 H;  1Y3W A;  1B0E A;  1EZU C;  2W6I D;  2P3T B;  4FUE A;  2NU4 E;  1F2S E;  3R3G B;  2OC8 A;  2SGE E;  3ATM A;  2ZDN A;  1O3K A;  2JJ2 D;  1UW7 A;  1SG8 B;  5EST E;  1EST A;  1GBC A;  1Z8G A;  3QN7 A;  4Z6A H;  1INC A;  2QF3 A;  4J1Y A;  3URD A;  3WY8 A;  1ORF A;  1J16 A;  2EI8 A;  2A0Q B;  2FOF A;  1C1M A;  4MG3 A;  1C9P A;  1P2N A;  1EPT A;  1QQU A;  1W11 U;  1UTK A;  2BD3 A;  1GI3 A;  1K1P A;  3BTM E;  1H9I E;  3M3V A;  2W3K A;  2OC0 A;  1YF4 A;  1HAV A;  1Q31 A;  3TH3 H;  8EST E;  4X6N A;  1GBF A;  1BBR H;  2WUC A;  2ZCH P;  2ZU5 A;  2KCO A;  4TY7 A;  3U8R H;  2AGG X;  1NU9 A;  2BLO A;  2D8W A;  6CHA C;  2BDG A;  1J15 A;  3SJ8 A;  1P2M A;  2O8M A;  4TWW A;  3A81 A;  1W0K D;  1X7A C;  4NCY A;  4U01 A;  5BPE A;  3W95 A;  3ENS B;  2H2Z A;  1LHC H;  3EA9 A;  4X6P A;  3M7T A;  1T4V H;  3MU0 A;  4NZL A;  3K9X B;  1Z1J A;  1BTX A;  1ETT H;  3ZYD A;  3PM3 A;  3T25 A;  3RM0 H; 
#chains in the Genus database with same CATH homology
 1UW7 A;  2J98 A;  2J98 B;  5HIZ A;  5HIY A;  3EE7 A;  5C94 A;  1QZ8 A;  2J97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...