5HIZA

The structure of pedv nsp9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
96
Chain Sequence
GKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWGGCNTIELEPPRKFLVDSPNGAQIKYLYFVRNLNTLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PEDV NSP9
rcsb
source organism Porcine epidemic diarrhea virus cv777
molecule tags Rna binding protein
molecule keywords Non-structural protein 9
total genus 14
structure length 96
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5hizA01
2J97A 1QZ8A 5HIZA 2J98B 3EE7A 5HIYA 5C94A 2J98A 1UW7A
chains in the Genus database with same CATH superfamily
4Y10E 3ZZAA 1L4ZA 1Z8IB 2QXIA 1TMUH 1TALA 1FDPA 2ZEBA 1QR3E 2W3KA 3SUEA 2VNTA 1EZQA 1CA8B 3N7DA 1RIWC 3ZZ5A 2C8WB 5B6LA 1L4DA 4E7RG 1H9HE 4HGCA 1C5MD 2J38A 4ASUD 2CMYA 4UDWH 1GMCG 1IQEA 1P9SA 2HNTE 1ZHPA 1UK2A 1GBLA 4DOQA 4BOHA 1HB0B 1OWKA 1CSOE 2XCNA 3M35A 1GPZA 4I32A 2OCVB 3MO6A 1WOFA 2BDBA 4ABJA 1BBRK 2FI5E 1YPLH 4CH8B 1DWDH 3DSGA 3V0XA 2KCOA 3LH1A 1RXPA 4D76A 1GGDC 1HNEE 1TMBH 4FVBA 2O9QA 2FS9A 3LGVA 1GI6A 1RGQA 1TX8A 1HIAA 3RDZA 2AFQB 3U8RH 3KNXA 3LGIA 2CJIA 1KIGH 4Y79A 4CR5A 1CBWC 2CV3A 3GCHB 2ZTZA 5C1YA 3DSOA 1K1IA 1JRTA 2WV4A 2F9PA 1H8HD 3BN9A 2HWLB 1VJ9U 4X0WU 1A0LA 1SBWA 3ZVBA 2Y7ZA 1AIXH 2VIPA 1PQ8A 1O3NA 1CGHA 2ZDMA 4K8BA 5ESTE 1LVBA 3SJIA 5PTPA 1LHDH 2FOFA 3K2UA 1AI8H 2FI3E 1QRZA 1GMDF 1UK3A 3RXOA 5C67A 1SGYE 1IQKA 3OTJE 2Q1JA 3C1KA 2Q6DA 1C5VA 3EA7A 2ANWA 4O9VA 3F6UH 1LHCH 3SU0A 2GGVB 4ISOA 2EI6A 2ZDNA 1H9IE 2O8LA 3A8DA 1QA7A 1Z6EA 2PWXA 1ELCA 2O8WA 2VWNA 3VGCC 1P2MA 2OLGA 1DXWA 1KDQA 2FMJA 2HPQH 1O3MA 4B76A 2J5UA 1QY6A 1W0JD 3UR6A 3GY4A 3KYFA 1IQLA 1DX5M 5CMXH 5ABWA 1GBTA 3ITIA 2QYIA 1XUGA 1O2LA 3E16B 3SNDA 1AMHA 1HLTH 1O0DH 2KX4A 2FX4A 1T7CA 1DM4B 4KTCA 5HYOA 1YKTA 3KGPA 1WQSA 1DY9A 4IC6A 4LZ1H 1UCYE 5T6GA 1P04A 3GY8A 1NBMD 2F83A 3KQBA 4YOIA 1ZRBA 2PSYA 2V0BA 4RN6A 1FXYA 1T8MA 1Y8TA 4AYYB 3VB4A 1KMHB 3SHCH 4B73A 3FO8D 3OY5U 4DJZB 1DOJA 3RXRA 3NK8A 2J92A 3F0PA 3SJ9A 3UOUA 1GJ7B 2BY7X 4JCNA 1LVOA 2B9LA 4NWLA 1ABJH 2OQ5A 5GDSH 5EXNA 2Z9GA 2VH0A 3P8GA 1C2FA 1OP8A 1BTXA 5E2PA 5F6MA 4GHQA 1UTJA 2AYWA 4GHTA 1C2EA 3V3MA 3Q3KA 2VBCA 1UTPA 4BTUB 4DGJA 1Y3XA 1DUAA 2J97A 3ODDA 2KCYA 3GCTF 2KZ4A 1OWJA 6GCHG 3P92A 3TK5A 2A5KA 3E90B 3TH2H 1ELVA 1SGCA 3AW1A 3E1XB 2AMQA 1A61H 5J4QA 4B2CA 2ODPA 2ZQ1A 1HAHH 3ZYDA 4LZ4B 1T8NA 2G52A 3R0FA 5DP8A 1G30B 1O2TA 1UW7A 1W0ZU 2A5AA 2TBSA 1Z1JA 1C9TA 1ELAA 5DGJA 2BLOA 3IITA 1O3FA 2QA9E 5FBIA 1NRSH 5HM2A 1UVTH 2A4RA 2PKSB 2ZTXA 2P8OC 2V35A 1SFIA 1O5FH 3A88A 5JB9S 3S9CA 1ZMLA 1F0RA 1NTPA 4LK4A 1EJNA 1COWD 1GHBG 1FJSA 4NA8A 3F2HA 1OWIA 4MDSA 5ESBA 2ZA5A 3EDXB 1NBME 1AFQC 4I31A 3EE7A 5JBBS 4NIYA 3VB3A 3PROA 8LPRA 1PPHE 3EA8A 4XSKU 1ZPZA 3LGYA 1DITH 3SUGA 1DFPA 2ZCLP 2PR3A 3LU9B 2Q6FA 1WSSH 3RXAA 1LPZB 1V2MT 3SGBE 2B8OH 3SU4A 2GP9B 1ARCA 1TQ0B 1FY5A 4AX9H 4CHAB 9LPRA 2ZIQH 1VCQA 3BTKE 3GCNA 3QZQA 3ATIA 3TGKE 1AKSA 2J95A 3OYPA 5E0HA 3GYMA 2TRMA 4MNWA 4ISLA 1PPEE 2GDEH 1GCTC 3M5OA 4RT1A 2A2XH 2SNWA 4M9FA 5F8TA 1CGJE 1P2KA 3MU5A 1P0SH 1ETRH 4MPWA 2A7HA 3A86A 5L2YH 4WMFA 1BT7A 2BDGA 2L6OA 2XW9A 3PLBA 3A8AA 1W8BH 1V3XA 2K1QA 3S7HB 1LVYA 4X2XA 1O2QA 2G4TA 3VG8A 3U69H 2QY0B 3M7UA 1JIRA 2VGCB 4YZUA 1G3EA 1MKXH 1MABB 1GI0A 4FETA 2A2QH 4X2WA 1SR5C 4K3JA 1BMFD 2YMSB 3RU4T 1O2ZA 2FYRA 3KQCA 3T5FH 4FUGA 4D8NA 1W11U 5F8XA 1HJAC 4F49A 1YM0A 1AUJA 2FPZA 1TNGA 3MH5A 1EP6A 2A4OA 1DICA 4KELA 1FY8E 1MZDA 3KF2A 2JETC 5CHAC 2FLBH 1MTNC 3U8OH 1SQOA 3H09A 1KTSB 4NWKA 4YLQH 1FAKH 3TGIE 4JZIA 1XUHA 2GCHF 1O30A 4ZH8A 5CHBA 2Z94A 4IMQA 1BBRE 1TAWA 3RMOH 4CH2B 1OYTH 5IDKA 3HK3B 4YO9A 2VIQA 1FPHH 2KAIB 1DY8A 1WAYB 1K1MA 2AGEX 4ZAEA 3P8NA 4A1VA 2GTBA 2UUFB 3M3VA 4ZMAH 3WWBA 1A3EH 4BTTB 1WCZA 1IHTH 1BRBE 2ZGXH 3G01A 1FMGA 5FCKA 2FDAA 3V13A 5JBCS 4O3UA 3RM0H 2EY4C 1P03A 1MUEB 1SGFG 3BSQA 3M36A 5E0JA 3FZDA 1OSSA 2C4FH 2DE8A 2BTCE 1NS3A 2XBYA 5DP5A 3RMLH 1O5CB 3LC5A 1O36A 3BF6H 2ZGCA 1LVMA 3LDXH 2H5DA 3ZZ6A 1C5RA 2TGPZ 4Z1MD 4TWYA 1HAYB 1ZJDA 1EUFA 1QJ7B 3D49H 1XM1A 1NU9A 1FONA 2O8UA 1M9UA 1L1GA 4GVUA 1FN8A 2FOEA 4R0IA 3VPKA 2WPJS 3FP8E 4Y8YA 3TGJE 2WYGA 2J98B 4TSFD 3BIUH 3QZRA 2NU4E 4X1QU 4HG6A 1O2OA 5LPEA 1PQ7A 2H1UA 1GMCF 2JH5D 1AUTC 1NRRH 3GICB 4I8GA 4Y7BA 3DFLA 4J2YB 5EW1H 1L1NA 1L1JA 4ZKNU 3F2FA 5DG6A 1CGIE 2STBE 1VJAU 3L33A 1KXAA 2YMSC 4OS5A 1AB9B 1EJAA 1XXFA 3BEIB 1HAXB 1OX1A 1UVUH 2AMPA 3CP7A 3HGPA 2RA3A 1J14A 1NESE 3U1IB 1ABIH 1F0TA 1PYTD 1C5YB 1THRH 1QTFA 2ZHWH 2KFWA 5DPAA 3D23A 1G32B 3URCA 2ANMH 1PQ5A 4YT7H 3BIVH 2W7SA 1J17T 1UTNA 4DT7B 3ZVAA 3SN8A 1O2XA 4I8KA 1T8LA 2WPHS 1KLJH 2Y82A 2YOLA 4NIVA 5LPFA 1SOZA 1ZLRA 1W7GH 2QF5A 1O2VA 1RJXB 1ZPBA 3K6ZA 3T62A 2Z7FE 3P95A 1SQRA 1O2SA 1PPZA 1MZAA 2J34A 4TWWA 1L0ZA 3U8TH 1SLXB 1P2NA 2FESH 1N6YA 3LJOA 3NWUA 3SV7A 1G36A 1EFRD 2BHGA 1A0HB 1E1QD 2BOHB 1P2OA 3MO3A 3TH3H 3STJA 1F5KU 1OP2A 2ZKSA 5EPYA 3LOXA 1P06A 3FKSD 1MTUA 9ESTA 1K21H 1PJPA 4ZXXH 1YPHC 1YPEH 1ZRKA 1AFQB 3GYLB 1O2MA 2ZDVH 1G3CA 1P8VC 2OINA 2ZPSA 4ZXYH 1C2GA 5KGOA 4TPIZ 5AFZH 2F43B 1NROH 2NU2E 3BG8A 2ZHFH 1ZHRA 2ZFFH 3EQ0H 2OC7A 1GVKB 3GY3A 1UTQA 1S5SA 4ISHH 1JBUH 2GZ7A 1O35A 1SC8U 3UREA 1E34B 4ABEA 1TX7A 3SORA 1GMHG 1SGFA 1GI1A 1S6LA 1S83A 2CXVA 4H6SB 3ZV8A 1O5BB 4E05H 1E1RD 1E38B 1TWXB 3MU8A 2Q6GA 1C2LA 3I78A 2H6MA 1ACBE 3UUZA 3UWIA 4O3TA 3SJOA 4OS7A 1QL8A 1NT1A 4Z0KA 1GBMA 2HOBA 2Y80A 1O3LA 1FIZA 1O3GA 4BAKB 1E35B 4ABBA 1QJ1B 1SI5H 2QCYA 2HVXA 3TLOA 5GXPA 1SGDE 2ZFRH 3OX7U 3RU4D 1W13U 2L74A 3SW2B 1LPGB 5C94A 1D9IA 2TGAA 3QLPH 3UNRA 3TNSA 6ESTA 1TYNA 3WW7A 4UFGH 1LHFH 3FP6E 4FU8A 1ELDE 1NZQH 2GCTC 1TB6H 3SZEA 1UHBB 4TT3D 1G2LA 1QGFA 4X1SU 3ESTA 3B8JA 2BDAA 2BD5A 1W2KH 2GCHG 1FQ3A 4Y0ZE 4HTCH 1AD8H 2ZFTA 2ZECA 4MPXA 2ALVA 1O3IA 2ODYB 1EPTA 1ELEE 4FUFA 1YY3A 1P2QA 2G4UA 1DUEA 2AIQA 4MLFB 5A8XA 3M3SA 1V2TT 4ABIA 3ZZCA 3PLKA 2G81E 2BY6X 2QXHA 1YCPM 3F68H 3QGJA 3PMHB 1C5SA 2V3OH 5C0UA 1AY6H 3K6YA 1YCPK 2WPMS 1YCPH 3RXBA 1TBQH 1D4PB 1FPCH 3HGNA 5E2OA 3ZZ3A 2Z3EA 1BRUP 3RM2H 1P09A 1CBWB 4LXBH 1XUIA 1B7XB 3KYGA 1BB0B 4DVAU 1HXFH 5FPSA 2FOBA 3HATH 3SNEA 1GDUA 3STIA 4Y11E 3RXEA 1RTKA 1K1OA 4UEHH 3ZVGA 4K60A 3EAJA 1C2IA 5TCAA 3RXPA 4BTIB 1GBJA 3A80A 4MNVA 2ULLA 4BXWA 5CDFE 2PP6A 1PPCE 3TK9A 1C1VH 1C2DA 1UMAH 1A7SA 3PB1E 6CHAC 1GBBA 2K8IA 2D26C 2BD3A 2VJ1A 8KME2 2Z9LA 1V2RT 2FOCA 5C0TA 2PW8H 4Q2KA 1MTWA 4XOJA 1GG6C 2VVCA 4AFQA 1V2LT 3SU1A 1EZSC 2FOGA 3HK6B 3FN8A 1TNLA 5EJ1A 1UK4A 1AKSB 1GI9B 5C5NA 4AGKA 3ATKA 3L6PA 7ESTE 4WY3A 1SL3A 3BEFB 4JZFH 1IQMA 3S7KB 4ZHAA 3ZZ9A 4BAMB 4B1TA 1MKXK 1OYQA 1DXPA 2WV5A 1P3EA 2XWAA 2AGIX 3GCHC 5IYTA 2FI4E 3OEHD 3KHVA 3IWMA 1ANEA 1YPMH 4MG3A 1K1JA 1FY3A 3ZZDA 1G2MA 1AE8H 3EYDA 5SGAE 3GISB 4AG2A 3SQHE 1GHXH 4F48B 2BD7A 3BTHE 4AFZA 2C8XB 2UWOA 3TU7H 1ANDA 4AN7A 4U2WA 1V2KT 2XWBI 4TY7A 2ZPRA 1EAIA 1G37A 4JZEH 2C90B 2PTNA 1ZGIA 2CF8H 1FV9A 2G8TA 2ZPQA 1NRPH 2BVRH 5BPEA 4AZ2B 2C8ZB 1HJ9A 1GHYH 1W3CA 2FOAA 2OBQA 4A6LA 3UNSA 1YGCH 1FNIA 2HRVA 2ZTYA 4X6PA 4HI3A 2D8WA 1DE7H 2V7QD 1YC0A 3TNTA 3KQ5A 1EQ9A 5DO4H 1SHHB 1WUNH 5FCRA 2UUJB 8GCHG 1DWBH 1SGQE 3DCLA 4XDEA 1C4V2 2BDYA 3MO9A 1A46H 1Y5BT 1D3QB 3M5NA 1W14U 1GBCA 3UQVA 1Y59T 3S9BA 1Y3UA 3SNCA 3RXVA 2FIRH 1ZPCA 1W7XH 4K2YA 1TRNA 2TPIZ 3ATMA 3RMNH 1S82A 4UFEH 4X8SH 5A0BA 1P11E 1FY4A 1N1LA 4YESB 2Y81A 1S81A 1EB2A 5DKMA 1F5RA 1FX0B 3FVFB 3FANA 1QL9A 1KXCA 4H6TA 5JDUB 5A8YA 1LDTT 1NFXA 3AVZA 3P8FA 2FP7B 4AORA 2OXSA 1XKAC 4SGAE 4DG4A 1A0JA 2CHAB 2R2MB 2XBVA 1O5EH 4BAHB 1D3DB 1TFXA 4FXGH 1SG8B 1ESBA 1TRYA 2VB0A 4GSOA 1QJ6B 5DK1A 3FOAA 4CRCA 1GI5A 1P01A 4I33A 2LNCA 4MPVA 2ZDAH 2CGAA 2ODQA 2G5VA 1GJAB 4TY6A 2WV9A 1A3BH 3DHKH 5LH8A 4MVNA 3PMAB 2G51A 1BTYA 1OXGA 1TPAE 2HLCA 2R0LA 4NGAH 4AFSA 3UFAA 1GCTB 4AFUA 3MNSA 2FTLE 5TCCA 1C2HA 6GCHF 2ESTE 4E7NA 1NFUA 1F2SE 3UOPA 1V2ST 4F55A 3KCGH 2F4LA 1HAVB 1OOKB 2GKVE 2W6JD 1UO6A 2AS9A 5C1XA 3MH7A 1OWEA 3OU0A 1J9CH 3D65E 1PPBH 1A2CH 1O3KA 1OP0A 5DP4A 1D3TB 1NFYA 2I6QA 1D3PB 2W3IA 1TPSA 1AZZA 4O97A 3UWJH 3O8CA 1BTPA 1Z6JH 2GJGA 1C5XB 2ZG0H 3F9FA 2A45B 3SI4H 3BEUA 1LCYA 1RIWB 4X1PU 2IJD1 5E8EH 1P10A 4XBDA 3TIUA 1A5HA 2AEIH 3JZ2B 1AB9C 1IQIA 3BV9B 1BJVA 4Y71A 2BM2A 4FUDA 5H4IB 4A1TA 1OKXA 2ZU2A 3LT3A 4JYTA 3DA9B 2YNBA 1T4UH 1TPPA 1NN6A 2Y5HA 2KCAA 2ZU5A 1XX9A 2FEQH 1C1RA 1C5NH 2RG3A 4K1TA 3W1EA 3ATLA 1TNKA 1GI2A 2XBWA 3U1JB 1SFQB 5HIYA 3PMJA 3BTME 1ELFA 1GCDA 1O3DA 3PTBA 4Q7ZA 3RXHA 5FL7D 5GCHG 3SI3H 4D7GA 1CQQA 4WWYA 1Z1IA 1FZZA 1KXEA 1P12E 5EQRA 1CHGA 1TOCB 5L30H 2VWLA 1TOMH 1MU8B 3QN7A 4K8YA 1W10U 1F5LA 5GJ4B 2C93B 3C27B 3GDUA 1KLTA 3QO6A 1FIWA 4Y8ZA 3Q76A 1KLIH 1WTHD 4HFPB 3SU6A 2ZO3H 4I86A 2FYQA 2ZWLH 4RKJB 1TGTA 2C3SA 4I8JA 3ZZ7A 3VXFH 1HUTH 1O2KA 3SU5A 1KDQB 1IQFA 2ZCHP 1GI4A 3TK6A 1TGSZ 2BD9A 1GBIA 1W12U 5A0AE 1EASA 1GBHA 3RXTA 3WY8A 3RC5A 5EJZA 4K69A 1YPGH 3P70B 2P95A 3HKJB 2W26A 1Y3YA 1CO7E 2BD2A 1O3PB 4ABFA 4RKOB 4B6EA 2VGCC 1TE0A 1QRWA 3RLYH 2EA3A 4GAWA 2HPPH 1AVGH 1NRNH 6LPRA 1GMDG 2ZFSA 3NRLA 1BTHH 2OC8A 1GJ6A 4NIXA 4WMDA 3LKWA 5I25A 1O2IA 4ZKSU 3MFJA 1C5OH 1FLEE 2ALPA 4MQAA 1O2PA 2Z6BD 5DP9A 1BRCE 5EXLA 1HRTH 1CHOF 5KEDA 1ZR0A 1S84A 1A1RA 2SGDE 1MTNB 1SGNE 2BDIA 2F91A 3UTUH 1TIOA 1Q31A 2RDLA 5J4SA 2JJ1D 1JRSA 4F4OC 2PKAB 5F03A 2BXUH 2ZGHA 3SBKA 1ARBA 1C1PA 1RTLA 4OS4A 4IS5A 1O3CA 4DIIH 1GHBF 3W94A 1F7ZA 1GDQA 1ZOMA 1O39A 3SJ8A 2VU8E 4U30A 5G4BA 2BLWA 3SNBA 1INCA 1FN6A 3SV6A 1QB9A 1DDJA 1KY9A 2HLDD 1GGDB 1RRKA 3V12A 3BTDE 2RDEA 4X8TH 1C5UA 4BAOB 1PQAA 1CA0B 2R2WU 3LGWA 2ZU1A 1DLKB 1GHVH 1EXFA 4XBBA 1HYLA 2WSSD 2WPLS 1N8OB 1N6XA 2ZU4A 4X2VA 2EQNA 1GJCB 1KXFA 3HKIB 3SV8A 3SUDA 2BX3A 2R9PA 2XNIA 1LQDB 2ASUB 3PM3A 1T8OA 2VWOA 1KTTB 3E91A 1IQNA 1SB1H 3VB5A 2M5TA 2QIQA 2ILNA 2VH6A 3E6PH 3E8LA 2P3UB 1UCYH 1O2JA 4DW2U 1GI7B 5HXFA 1MTVA 5T3HA 3MYWA 2H9TH 1WTGH 1ZSLA 1MBMA 3D62A 3RXLA 1C1NA 1C4Y2 1QNJA 1UJ1A 4D9RA 4AG1A 1S6HA 1XKBC 3CENA 3S9AA 5HMAA 1E79D 3ELAH 4J1YA 1TNHA 2JJ2D 1ELBA 1SGRE 3SJKA 1J15A 1O31A 1MKWH 1ZTLA 3RXKA 3ZZ8A 1XUKA 1C1OA 1NM6A 1V2UT 5FX6A 4VGCB 4X2YA 1BOQA 4GLYA 2SGQE 2ZFPH 4UFFH 1GHAF 1EB1H 4K1EA 2ZF0H 3BG4B 3SUFA 4NA9H 3GY2A 1LHEH 4K5ZA 5C17A 5HIZA 3KL6A 2BQ7B 1O3EA 1BIOA 2OUAA 3MQKC 1YYY1 5DJ7A 2GV6A 3DD2H 3WWFA 1TMTH 1Z8RA 4E06H 2LPRA 4FU9A 4GCHF 5FPYA 3AAUA 3RP2A 1GL0E 3L3TA 4KP0A 1BDAA 1MCTA 2JDID 2P94A 1C1QA 3RC4A 1ZZZA 1EOLA 3ZVDA 3QWCH 4ABDA 4I7YH 2UWPA 4OS1A 5AFYH 3ZV9A 4UONA 3QK1A 1MQ6A 2FOMB 1WDIA 2AHME 1D6RA 1VGCB 4R8TB 2OTVA 1Y3WA 1O32A 2WYJA 3H5CB 2EI7A 3F9HA 1ORFA 5C1UA 1EZUC 2BD4A 3PWCA 1HJ8A 5KECA 3VEQB 1LO6A 4INKA 3QDZB 5GPIB 3TJNA 1X7AC 5HKKD 3OAAD 2ZC9H 2QXJA 2A1DB 2XNDD 3A83A 3V7TA 2HNTF 1MD7A 1RD3B 3A7VA 3BTEE 3RLWH 4AYVB 4XBCA 1DVAH 2BVSH 2OC1A 3BTGE 3RXQA 1SLWB 2QXGA 3ODFA 1JXPA 1NFWA 2Y5GA 4UFDH 1A5GH 1GL1A 1YP9A 1WU1A 1NRQH 4JYVH 1V2QT 3Q77A 4YXWD 3FFGA 5L6NH 1Y3VA 4P00A 1BJUA 4IGDA 1K2I1 4NCYA 4ASHA 4JYUH 1VITH 3BTFE 4JZDH 3A7WA 2F9VA 2HGTH 3F9EA 1K0HA 3A81A 3RXFA 5A8ZA 2QF3A 2Z3CA 2WZQA 2VIVA 1FAXA 4MNXA 1TGBA 1BCUH 5DP6A 5ETXA 5T1VA 3T29A 2BLVA 4A5TS 1G9IE 5LPRA 1V2PT 2XBXA 1PFXC 2NWNA 3GCOA 2O8MA 4GUXA 4ACAA 1QFKH 4WXIA 3S0NA 2A7JA 2XC5A 2EC9H 3OEED 3PO1B 1BMLA 1O2HA 3A8BA 4FUIA 5EG4A 2R3YA 2F9BH 2AMDA 1GBDA 1HGTH 1SGIB 4CR9A 3DUXH 1T4VH 1QQUA 5EW2H 4U32A 3UB0A 3OY6U 2OC0A 3E3TA 4ZHMU 3M37A 1HAPH 2RA0A 4VGCC 5EQSA 1IOEA 1ZMJA 2K0QA 4OM9A 5EU8A 1T32A 3EE0B 4B71A 1IAUA 1OPHB 2F3CE 2GD4B 1YF4A 1BMAA 4BAQB 3U9AH 1D6WA 2G55A 1IQHA 2VVUA 3FAOA 5T6FA 1WBGB 1P3CA 4I8LA 1KXBA 3U28C 1AHTH 3NCLA 4X1RU 1TLDA 1UTOA 3TJOA 2G5NA 3MI4A 3GS9A 4X6MA 4GPGA 4AB9A 2YNAA 7GCHG 1BTWA 2CN0H 3F2GA 2TIOA 1ZYOA 5LGOA 3GDVA 2R3UA 1H9LB 3N99A 4Y7AA 4IBLH 3T2NA 3O8BA 3KN2A 3PV4A 1THSH 2B7DH 1QB1A 1SQAA 1Q3XA 3MNCA 3MOCA 1DWCH 3SU3A 2Z9JA 2Y7XA 2QN5T 3FZZA 4IC5A 4MNYA 1C5TA 2Y5FA 3ENSB 4H42U 4NZLA 1KSNA 1B0FA 2BXTH 3DFJA 1YLDA 1O38A 1AWFH 1SLVB 4YM9A 5A09A 2PUXB 3EA9A 1QB6A 4Q63A 4UD9H 2A7CA 4X6OA 2FOHA 3B9FH 2BOKA 4ZKRU 4RT0A 2SGAA 1MTSA 4BANB 4KTSA 1GDNA 1VKYA 1GG6B 1C2JA 4NZQA 1YLNA 3TPIZ 2SGPE 1ELTA 2OP9A 1O3BA 2JH6D 3M5LA 3VFEA 5GNDA 3MU1A 3TH4H 1VITF 2DE9A 3PRBA 1B0EA 4INHA 4JZ1A 4Z6AH 2RFKC 1GI8B 3DSPA 5IK2D 5JYIA 1GHZA 1IHSH 1BRAA 1T31A 1V2WT 2J9NA 3SO3A 1J8AA 1FI8A 2JIZD 3MHWU 1C1TA 2HNTC 3Q3XA 3T28A 1VCPA 4INLA 4AGJA 3A8CA 2UWLA 2QV1A 4IMZA 1LPKB 1KYNA 1AFEH 1AN1E 1QQ4A 1ETSH 3KIDU 3CS0A 4D9QA 3MH4A 4ZHLU 3UR9A 1AU8A 2JH0D 1MD8A 3LGTA 3PRDA 1SPJA 2FODA 3O8DA 5JBAS 3U98H 1SHYA 1EJMA 2XCFA 5EXMA 1MH0A 3LPRA 3RXSA 1SOTA 1K28D 2BY5X 3SV9A 1EKBB 1HAGE 1AGJA 3SYJA 1W0KD 5FAHA 1GHWH 1WQVH 2W5EA 2ZFQH 3CNRA 4WMEA 1V2OT 3GOVB 3RUOA 1GBAA 2R0KA 2BDHA 2H9EH 2BDCA 1GWAA 1G3BA 1MAYA 4HZHA 1C1WH 1EPTB 1P2IA 1GJ5H 2VVVA 1THPB 1HV7A 1A5IA 3A89A 3RXGA 4WF8A 2DUCA 4FOUC 1DS2E 2I6SA 3H7OA 2GCTB 1TRMA 1AWHB 1H8IH 2P93A 2WHXA 2P8OB 2GMTC 3PMBB 4Y8XA 3ZVFA 1UTMA 2PV9B 2FXRA 4YOGA 1A4WH 1ANBA 1QHRB 4Q7XA 5EQQA 1HDTH 1XVMA 1RFNA 1C4U2 2IN2A 3A84A 1Z8JB 3VXEH 4THNH 1AQ7A 5I46H 1GBKA 1SGTA 1F0SA 1VCWA 2ZHEH 4WH8A 3RMMH 1SMFE 1TBZH 4FUEA 4B6FA 1O2NA 1HIAB 1QIXB 1NO9H 3P6ZB 1TGCA 3PYHA 4O03A 5A2MH 2GT8A 1C1SA 3RXJA 2HALA 4YLUA 1EAUA 4Q7YA 1MQ5A 2IOTA 4WJG2 5EGMA 1WV7H 5FBEA 2Z3DA 2SGFE 3N7EA 1TNJA 3GY7A 2BD8A 4WVPE 3BG4C 1IQGA 1HCGA 1E36B 1HPGA 1LHGH 2JKHA 5EOKA 5AHGH 3UIRA 2A4GA 2CK3D 2FS8A 2PKAA 3IG6B 4IN2A 1SKYE 2Z9KA 3RXIA 2G00A 3GCTG 2Y6TA 3UPEA 1EAWA 7GCHF 2PTCE 1VR1H 1CT2E 2WPKS 5HGGA 1DANH 1C5ZB 2BQ6B 3Q3YA 1O34A 4ISNA 3LONA 2WUCA 1U6QA 4YTAA 3TITA 4I8HA 2VIWA 2P3FH 3UNQA 4A7IB 1Z7KA 4DCDA 4DY7B 4RI0A 1CU1A 1ESAA 3OE7D 4A92A 4ZCNA 3F1SB 3PO1C 4MTBA 1XVOA 3FP7E 1E37B 2BQWB 2OBOA 2BMGB 2V3HH 3E0NB 1JMOH 3RXUA 1QURH 1P02A 2B0FA 4H4FA 3VB7A 1QBVH 4FUCA 2JETB 5CHAB 1E0FD 1TONA 5C5OA 2BX4A 2C8YB 1HXEH 3TJUA 3UAIC 8GCHF 3ATWA 2ZNKH 3QTOH 2FWWA 4B2AA 4M7GA 2V3MA 1IQJA 3F3BA 1SGEE 1ZJKA 1JWTA 2QE7D 2WUBA 2ZI2H 2ZQ2A 3NPSA 4BNRA 5JB8S 1BBRH 1NU7B 3NZIA 2IPHA 3QGNB 4CRBA 1K22H 1S0QA 1XUJA 2SNVA 1LKBA 1GI3A 2ANKH 1BITA 1GVLA 5DSFA 1GVZA 5K0HA 1BMMH 1PPFE 1RS0A 1V2NT 3P8OA 2ZHDA 3LH3A 2WINI 3MMGA 4XD7D 1O2GH 1PYTC 2FM2A 4DT4A 1LQEA 2BZAA 4CRGA 2PUQH 1FY1A 4CBOA 1SSXA 3SU2A 3RU4E 5EPNA 3A7TA 2STAE 1F92A 3QX5H 4B74A 2GMTB 2YMSD 2AIPA 1ZSKA 1EX3A 4IN1A 4OGXA 1DSUA 2W7UA 1UVSH 3MU4A 4IW4E 3T25A 3LC3A 2XRCA 1G3DA 1ZHMA 2ZGBH 3SOSA 1H8ED 1O3HA 2OQUA 1SLUB 1C5QA 1TGNA 3OTPA 1WXRA 4FUJA 1RTFB 5TJXA 3CS7A 2H5CA 3KEEA 3LGUA 2AH4X 1NC6A 2P59A 3A7YA 5JPMH 2CF9H 4FVDA 3VGCB 5FPTA 1SQTA 3N7OA 4TPYA 1H1BA 2H9HA 3AW0A 5DP7A 1BUIA 1TBRH 1CT4E 1ID5H 1O2RA 1C9PA 1JIMA 3LJJA 4XFQA 1ESTA 5JBTA 3QUMP 2VINA 4JK6A 5EIYA 2FO9A 1QA0A 1AE5A 1GMHF 2IJOB 4NG9H 1XMNB 2LP6A 4DURA 2A31A 4WH6A 3ZIAD 2XC4A 1GJDB 1ELGA 3SHAH 1UVPA 3GY5A 3MWIU 3W95A 1GJBB 1Y5UT 2XOKD 3JZ1B 3NXPA 1P2JA 3HPTB 1BTZA 3A85A 1QRXA 2P16A 3B23B 3F0OA 1CA0C 3OFND 1MAXA 2A5IA 2ZP0H 3URDA 1LTOA 1NY22 2WPIS 2ANYA 1MKWK 2OK5A 2ZDLA 4RSPA 3SQEE 1BTUA 3TJVA 2A32A 4B75A 1OS8A 3BTTE 2O8TA 1O5GH 1O2YA 4FUHA 1GJ8B 4MPUA 3ZYEA 1EAXA 2FZZA 2GZ9A 2J94A 3PV5A 3Q00A 4JK5A 4Y0YE 3NUMA 1O2WA 2ZZUH 2HVYB 4NSYA 2J4IA 3ZZ4A 1QL7A 2ZU3A 1GJ4H 2A4QA 1ETTH 2PHBA 1C5WB 3MNXA 1AVWA 1K9OE 5AF9H 3A7ZA 3KQDA 3EGKH 3SZNA 2D1JA 3AAVA 3SV2H 1L2EA 3S69A 5DN6D 1S85A 4UE7H 3KQEA 3MU0A 3AASA 1BHXF 3I77A 3BTQE 4AB8A 2THFB 1VITG 1HAIH 1QBNA 4CRDA 2PLXA 2QF4A 4YOJA 1YBWA 4JMYA 1MBQA 1BZXE 1B5GH 2FLRH 4FUBA 1AO5A 5GIBA 1UVOA 3F9GA 1AVXA 1HAVA 1EZXC 1YPHE 1FUJA 1Z71A 3QTVH 2ZDKA 1Z8GA 5FHTA 2B5TB 4P02A 4DIHH 1AZ8A 2GX4A 1CHOG 4YT6H 2PFEA 1XXDA 1TA6A 1F0UA 1J16A 4Y76A 1O33A 2GZ8A 4ABGA 7LPRA 3A82A 1K1LA 2PKSC 1TPOA 3RXMA 2ZGJA 4A1XA 1DLEA 2AGGX 1W0YH 2P3TB 3UQOA 5AVDA 1XUFA 4FU7A 2XYAA 5C3NA 2EEKA 1Y5AT 1HAZB 1TQ7B 2J2UA 1P05A 3R3GB 5T6DA 1TABE 1GHAG 2NU1E 4OGYA 3K65B 2OD3B 3A87A 5HM9A 1V2VT 5C2ZA 1HAOH 4NSVA 1ZMNA 1QCPA 5CE1A 3MNBA 3I29A 4ABHA 1O3OA 2BY8X 1YPJH 2NU3E 2BYAX 1BQYA 2ZHQH 4ZUHA 1PPGE 5F53A 5E0GA 5FXLA 4KTUA 1YWUA 4GCHG 3GDSA 2BY9X 5GCHF 2BZ6H 2ZCKP 3SGAE 2GDDA 3A7XA 1ZSJA 1C2KA 2RCEA 3MH6A 3BTWE 1O5AB 3OSYA 1TA2A 2V6NA 3ZVEA 1O3JA 1C5PA 4ABAA 1C1MA 2KAIA 6CHAB 2UUKB 4LOYH 1O5DH 3GY6A 1QBOA 4X8VH 4QT8C 3PWBA 2PGBB 5B6OA 2QGRA 1CVWH 4KGAA 8ESTE 3E0PB 1TNIA 2D2DA 1ZTJA 4X8UH 3M3TA 1EPTC 2W6ID 4B2BA 3RC6A 4SGBE 5FX5A 2LELA 2A0QB 2WPDD 5EODA 1HJAB 1O37A 3K9XB 3RXDA 3RXCA 1C1UH 4OS2A 2SFAA 1V2JT 2VWMA 2XC0A 1OHHD 4ISIH 4OS6A 2FTMA 3T26A 2SGEE 1ZGVA 2IPQX 2KCPA 1DT2A 1KXDA 2UUYA 4NIWA 1P9UA 1ANCA 1HFDA 3UY9A 4CBNA 1OWDA 2TGDA 3MTYA 1S6FA 1H4WA 4X6NA 1ZTKA 5A0CA 1YLCA 3AK5A 1BHXB 4NFEA 1C5LH 4ZROA 3SNAA 2GVFA 2BVXH 2CHAC 1TX6A 1QZ8A 2PSXA 1DPOA 1HBTH 4U01A 2GT7A 1SGPE 1VZQH 2QC2A 1N8OC 1BA8B 5DP3A 1WYKA 3O8RA 2QF0A 3PTNA 4ZKOU 4CHAC 3DT0H 1S0RA 3M7QA 1O3AA 1GBFA 1H8DH 2KR7A 5GWZA 2XXLA 4AC9A 5K7RA 1GBEA 1CT0E 1UTLM 3ZVCA 2VIOA 3ZZBA 1K1PA 2BB4A 7KMEH 1DSTA 1MCVA 4ESTE 4Q4LA 4K1SA 2AERH 3LIWA 2FX6A 2BLQA 4WXVA 1Q2WA 5C20A 4Y6DA 1EOJA 2F9NA 3SGQE 4NA7A 2F9OA 1UTKA 2Z9IA 3M7TA 4NFFA 1CE5A 1V6DA 1C2MA 1JOUB 1LKAA 1EATA 1BMNH 3T27A 2F9UA 1UHBA 5EJLA 2EI8A 1LMWB 5BRRE 2XTTB 2H2ZA 3NKKA 4CRFA 4PROA 2NU0E 3M61U 3H7TA 1VGCC 1NPMA 2TGTA 4XRNA 4CRAA 4Q80A 1SVPA 1DWEH 1K1NA 2QAAA 4CREA 1MU6B 1OWHA 3PV2A 3M5MA 2PGQB 4TYDA 3P17H 4XE4A 3PLPA 2M2AA 1EP5A 2J98A 2VIDA 4BXSA 4ACBA 5L2ZH 5F8ZA 1YPKH 3VB6A 3TVJB 2GV7A 4X1NU 1MMJN 4AOQA 1O2UA 4D7FA 1GJ9B 1P57B 1UCYK 4KKDA 2KM0A
chains in the Genus database with same CATH topology
2J97A 1QZ8A 5HIZA 2J98B 3EE7A 5HIYA 5C94A 2J98A 1UW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J97 A;  1QZ8 A;  5HIZ A;  2J98 B;  3EE7 A;  5HIY A;  5C94 A;  2J98 A;  1UW7 A; 
#chains in the Genus database with same CATH topology
 4Y10 E;  3ZZA A;  1L4Z A;  1Z8I B;  2QXI A;  1TMU H;  1TAL A;  1FDP A;  2ZEB A;  1QR3 E;  2W3K A;  3SUE A;  2VNT A;  1EZQ A;  1CA8 B;  3N7D A;  1RIW C;  3ZZ5 A;  2C8W B;  5B6L A;  1L4D A;  4E7R G;  1H9H E;  4HGC A;  1C5M D;  2J38 A;  4ASU D;  2CMY A;  4UDW H;  1GMC G;  1IQE A;  1P9S A;  2HNT E;  1ZHP A;  1UK2 A;  1GBL A;  4DOQ A;  4BOH A;  1HB0 B;  1OWK A;  1CSO E;  2XCN A;  3M35 A;  1GPZ A;  4I32 A;  2OCV B;  3MO6 A;  1WOF A;  2BDB A;  4ABJ A;  1BBR K;  2FI5 E;  1YPL H;  4CH8 B;  1DWD H;  3DSG A;  3V0X A;  2KCO A;  3LH1 A;  1RXP A;  4D76 A;  1GGD C;  1HNE E;  1TMB H;  4FVB A;  2O9Q A;  2FS9 A;  3LGV A;  1GI6 A;  1RGQ A;  1TX8 A;  1HIA A;  3RDZ A;  2AFQ B;  3U8R H;  3KNX A;  3LGI A;  2CJI A;  1KIG H;  4Y79 A;  4CR5 A;  1CBW C;  2CV3 A;  3GCH B;  2ZTZ A;  5C1Y A;  3DSO A;  1K1I A;  1JRT A;  2WV4 A;  2F9P A;  1H8H D;  3BN9 A;  2HWL B;  1VJ9 U;  4X0W U;  1A0L A;  1SBW A;  3ZVB A;  2Y7Z A;  1AIX H;  2VIP A;  1PQ8 A;  1O3N A;  1CGH A;  2ZDM A;  4K8B A;  5EST E;  1LVB A;  3SJI A;  5PTP A;  1LHD H;  2FOF A;  3K2U A;  1AI8 H;  2FI3 E;  1QRZ A;  1GMD F;  1UK3 A;  3RXO A;  5C67 A;  1SGY E;  1IQK A;  3OTJ E;  2Q1J A;  3C1K A;  2Q6D A;  1C5V A;  3EA7 A;  2ANW A;  4O9V A;  3F6U H;  1LHC H;  3SU0 A;  2GGV B;  4ISO A;  2EI6 A;  2ZDN A;  1H9I E;  2O8L A;  3A8D A;  1QA7 A;  1Z6E A;  2PWX A;  1ELC A;  2O8W A;  2VWN A;  3VGC C;  1P2M A;  2OLG A;  1DXW A;  1KDQ A;  2FMJ A;  2HPQ H;  1O3M A;  4B76 A;  2J5U A;  1QY6 A;  1W0J D;  3UR6 A;  3GY4 A;  3KYF A;  1IQL A;  1DX5 M;  5CMX H;  5ABW A;  1GBT A;  3ITI A;  2QYI A;  1XUG A;  1O2L A;  3E16 B;  3SND A;  1AMH A;  1HLT H;  1O0D H;  2KX4 A;  2FX4 A;  1T7C A;  1DM4 B;  4KTC A;  5HYO A;  1YKT A;  3KGP A;  1WQS A;  1DY9 A;  4IC6 A;  4LZ1 H;  1UCY E;  5T6G A;  1P04 A;  3GY8 A;  1NBM D;  2F83 A;  3KQB A;  4YOI A;  1ZRB A;  2PSY A;  2V0B A;  4RN6 A;  1FXY A;  1T8M A;  1Y8T A;  4AYY B;  3VB4 A;  1KMH B;  3SHC H;  4B73 A;  3FO8 D;  3OY5 U;  4DJZ B;  1DOJ A;  3RXR A;  3NK8 A;  2J92 A;  3F0P A;  3SJ9 A;  3UOU A;  1GJ7 B;  2BY7 X;  4JCN A;  1LVO A;  2B9L A;  4NWL A;  1ABJ H;  2OQ5 A;  5GDS H;  5EXN A;  2Z9G A;  2VH0 A;  3P8G A;  1C2F A;  1OP8 A;  1BTX A;  5E2P A;  5F6M A;  4GHQ A;  1UTJ A;  2AYW A;  4GHT A;  1C2E A;  3V3M A;  3Q3K A;  2VBC A;  1UTP A;  4BTU B;  4DGJ A;  1Y3X A;  1DUA A;  2J97 A;  3ODD A;  2KCY A;  3GCT F;  2KZ4 A;  1OWJ A;  6GCH G;  3P92 A;  3TK5 A;  2A5K A;  3E90 B;  3TH2 H;  1ELV A;  1SGC A;  3AW1 A;  3E1X B;  2AMQ A;  1A61 H;  5J4Q A;  4B2C A;  2ODP A;  2ZQ1 A;  1HAH H;  3ZYD A;  4LZ4 B;  1T8N A;  2G52 A;  3R0F A;  5DP8 A;  1G30 B;  1O2T A;  1UW7 A;  1W0Z U;  2A5A A;  2TBS A;  1Z1J A;  1C9T A;  1ELA A;  5DGJ A;  2BLO A;  3IIT A;  1O3F A;  2QA9 E;  5FBI A;  1NRS H;  5HM2 A;  1UVT H;  2A4R A;  2PKS B;  2ZTX A;  2P8O C;  2V35 A;  1SFI A;  1O5F H;  3A88 A;  5JB9 S;  3S9C A;  1ZML A;  1F0R A;  1NTP A;  4LK4 A;  1EJN A;  1COW D;  1GHB G;  1FJS A;  4NA8 A;  3F2H A;  1OWI A;  4MDS A;  5ESB A;  2ZA5 A;  3EDX B;  1NBM E;  1AFQ C;  4I31 A;  3EE7 A;  5JBB S;  4NIY A;  3VB3 A;  3PRO A;  8LPR A;  1PPH E;  3EA8 A;  4XSK U;  1ZPZ A;  3LGY A;  1DIT H;  3SUG A;  1DFP A;  2ZCL P;  2PR3 A;  3LU9 B;  2Q6F A;  1WSS H;  3RXA A;  1LPZ B;  1V2M T;  3SGB E;  2B8O H;  3SU4 A;  2GP9 B;  1ARC A;  1TQ0 B;  1FY5 A;  4AX9 H;  4CHA B;  9LPR A;  2ZIQ H;  1VCQ A;  3BTK E;  3GCN A;  3QZQ A;  3ATI A;  3TGK E;  1AKS A;  2J95 A;  3OYP A;  5E0H A;  3GYM A;  2TRM A;  4MNW A;  4ISL A;  1PPE E;  2GDE H;  1GCT C;  3M5O A;  4RT1 A;  2A2X H;  2SNW A;  4M9F A;  5F8T A;  1CGJ E;  1P2K A;  3MU5 A;  1P0S H;  1ETR H;  4MPW A;  2A7H A;  3A86 A;  5L2Y H;  4WMF A;  1BT7 A;  2BDG A;  2L6O A;  2XW9 A;  3PLB A;  3A8A A;  1W8B H;  1V3X A;  2K1Q A;  3S7H B;  1LVY A;  4X2X A;  1O2Q A;  2G4T A;  3VG8 A;  3U69 H;  2QY0 B;  3M7U A;  1JIR A;  2VGC B;  4YZU A;  1G3E A;  1MKX H;  1MAB B;  1GI0 A;  4FET A;  2A2Q H;  4X2W A;  1SR5 C;  4K3J A;  1BMF D;  2YMS B;  3RU4 T;  1O2Z A;  2FYR A;  3KQC A;  3T5F H;  4FUG A;  4D8N A;  1W11 U;  5F8X A;  1HJA C;  4F49 A;  1YM0 A;  1AUJ A;  2FPZ A;  1TNG A;  3MH5 A;  1EP6 A;  2A4O A;  1DIC A;  4KEL A;  1FY8 E;  1MZD A;  3KF2 A;  2JET C;  5CHA C;  2FLB H;  1MTN C;  3U8O H;  1SQO A;  3H09 A;  1KTS B;  4NWK A;  4YLQ H;  1FAK H;  3TGI E;  4JZI A;  1XUH A;  2GCH F;  1O30 A;  4ZH8 A;  5CHB A;  2Z94 A;  4IMQ A;  1BBR E;  1TAW A;  3RMO H;  4CH2 B;  1OYT H;  5IDK A;  3HK3 B;  4YO9 A;  2VIQ A;  1FPH H;  2KAI B;  1DY8 A;  1WAY B;  1K1M A;  2AGE X;  4ZAE A;  3P8N A;  4A1V A;  2GTB A;  2UUF B;  3M3V A;  4ZMA H;  3WWB A;  1A3E H;  4BTT B;  1WCZ A;  1IHT H;  1BRB E;  2ZGX H;  3G01 A;  1FMG A;  5FCK A;  2FDA A;  3V13 A;  5JBC S;  4O3U A;  3RM0 H;  2EY4 C;  1P03 A;  1MUE B;  1SGF G;  3BSQ A;  3M36 A;  5E0J A;  3FZD A;  1OSS A;  2C4F H;  2DE8 A;  2BTC E;  1NS3 A;  2XBY A;  5DP5 A;  3RML H;  1O5C B;  3LC5 A;  1O36 A;  3BF6 H;  2ZGC A;  1LVM A;  3LDX H;  2H5D A;  3ZZ6 A;  1C5R A;  2TGP Z;  4Z1M D;  4TWY A;  1HAY B;  1ZJD A;  1EUF A;  1QJ7 B;  3D49 H;  1XM1 A;  1NU9 A;  1FON A;  2O8U A;  1M9U A;  1L1G A;  4GVU A;  1FN8 A;  2FOE A;  4R0I A;  3VPK A;  2WPJ S;  3FP8 E;  4Y8Y A;  3TGJ E;  2WYG A;  2J98 B;  4TSF D;  3BIU H;  3QZR A;  2NU4 E;  4X1Q U;  4HG6 A;  1O2O A;  5LPE A;  1PQ7 A;  2H1U A;  1GMC F;  2JH5 D;  1AUT C;  1NRR H;  3GIC B;  4I8G A;  4Y7B A;  3DFL A;  4J2Y B;  5EW1 H;  1L1N A;  1L1J A;  4ZKN U;  3F2F A;  5DG6 A;  1CGI E;  2STB E;  1VJA U;  3L33 A;  1KXA A;  2YMS C;  4OS5 A;  1AB9 B;  1EJA A;  1XXF A;  3BEI B;  1HAX B;  1OX1 A;  1UVU H;  2AMP A;  3CP7 A;  3HGP A;  2RA3 A;  1J14 A;  1NES E;  3U1I B;  1ABI H;  1F0T A;  1PYT D;  1C5Y B;  1THR H;  1QTF A;  2ZHW H;  2KFW A;  5DPA A;  3D23 A;  1G32 B;  3URC A;  2ANM H;  1PQ5 A;  4YT7 H;  3BIV H;  2W7S A;  1J17 T;  1UTN A;  4DT7 B;  3ZVA A;  3SN8 A;  1O2X A;  4I8K A;  1T8L A;  2WPH S;  1KLJ H;  2Y82 A;  2YOL A;  4NIV A;  5LPF A;  1SOZ A;  1ZLR A;  1W7G H;  2QF5 A;  1O2V A;  1RJX B;  1ZPB A;  3K6Z A;  3T62 A;  2Z7F E;  3P95 A;  1SQR A;  1O2S A;  1PPZ A;  1MZA A;  2J34 A;  4TWW A;  1L0Z A;  3U8T H;  1SLX B;  1P2N A;  2FES H;  1N6Y A;  3LJO A;  3NWU A;  3SV7 A;  1G36 A;  1EFR D;  2BHG A;  1A0H B;  1E1Q D;  2BOH B;  1P2O A;  3MO3 A;  3TH3 H;  3STJ A;  1F5K U;  1OP2 A;  2ZKS A;  5EPY A;  3LOX A;  1P06 A;  3FKS D;  1MTU A;  9EST A;  1K21 H;  1PJP A;  4ZXX H;  1YPH C;  1YPE H;  1ZRK A;  1AFQ B;  3GYL B;  1O2M A;  2ZDV H;  1G3C A;  1P8V C;  2OIN A;  2ZPS A;  4ZXY H;  1C2G A;  5KGO A;  4TPI Z;  5AFZ H;  2F43 B;  1NRO H;  2NU2 E;  3BG8 A;  2ZHF H;  1ZHR A;  2ZFF H;  3EQ0 H;  2OC7 A;  1GVK B;  3GY3 A;  1UTQ A;  1S5S A;  4ISH H;  1JBU H;  2GZ7 A;  1O35 A;  1SC8 U;  3URE A;  1E34 B;  4ABE A;  1TX7 A;  3SOR A;  1GMH G;  1SGF A;  1GI1 A;  1S6L A;  1S83 A;  2CXV A;  4H6S B;  3ZV8 A;  1O5B B;  4E05 H;  1E1R D;  1E38 B;  1TWX B;  3MU8 A;  2Q6G A;  1C2L A;  3I78 A;  2H6M A;  1ACB E;  3UUZ A;  3UWI A;  4O3T A;  3SJO A;  4OS7 A;  1QL8 A;  1NT1 A;  4Z0K A;  1GBM A;  2HOB A;  2Y80 A;  1O3L A;  1FIZ A;  1O3G A;  4BAK B;  1E35 B;  4ABB A;  1QJ1 B;  1SI5 H;  2QCY A;  2HVX A;  3TLO A;  5GXP A;  1SGD E;  2ZFR H;  3OX7 U;  3RU4 D;  1W13 U;  2L74 A;  3SW2 B;  1LPG B;  5C94 A;  1D9I A;  2TGA A;  3QLP H;  3UNR A;  3TNS A;  6EST A;  1TYN A;  3WW7 A;  4UFG H;  1LHF H;  3FP6 E;  4FU8 A;  1ELD E;  1NZQ H;  2GCT C;  1TB6 H;  3SZE A;  1UHB B;  4TT3 D;  1G2L A;  1QGF A;  4X1S U;  3EST A;  3B8J A;  2BDA A;  2BD5 A;  1W2K H;  2GCH G;  1FQ3 A;  4Y0Z E;  4HTC H;  1AD8 H;  2ZFT A;  2ZEC A;  4MPX A;  2ALV A;  1O3I A;  2ODY B;  1EPT A;  1ELE E;  4FUF A;  1YY3 A;  1P2Q A;  2G4U A;  1DUE A;  2AIQ A;  4MLF B;  5A8X A;  3M3S A;  1V2T T;  4ABI A;  3ZZC A;  3PLK A;  2G81 E;  2BY6 X;  2QXH A;  1YCP M;  3F68 H;  3QGJ A;  3PMH B;  1C5S A;  2V3O H;  5C0U A;  1AY6 H;  3K6Y A;  1YCP K;  2WPM S;  1YCP H;  3RXB A;  1TBQ H;  1D4P B;  1FPC H;  3HGN A;  5E2O A;  3ZZ3 A;  2Z3E A;  1BRU P;  3RM2 H;  1P09 A;  1CBW B;  4LXB H;  1XUI A;  1B7X B;  3KYG A;  1BB0 B;  4DVA U;  1HXF H;  5FPS A;  2FOB A;  3HAT H;  3SNE A;  1GDU A;  3STI A;  4Y11 E;  3RXE A;  1RTK A;  1K1O A;  4UEH H;  3ZVG A;  4K60 A;  3EAJ A;  1C2I A;  5TCA A;  3RXP A;  4BTI B;  1GBJ A;  3A80 A;  4MNV A;  2ULL A;  4BXW A;  5CDF E;  2PP6 A;  1PPC E;  3TK9 A;  1C1V H;  1C2D A;  1UMA H;  1A7S A;  3PB1 E;  6CHA C;  1GBB A;  2K8I A;  2D26 C;  2BD3 A;  2VJ1 A;  8KME 2;  2Z9L A;  1V2R T;  2FOC A;  5C0T A;  2PW8 H;  4Q2K A;  1MTW A;  4XOJ A;  1GG6 C;  2VVC A;  4AFQ A;  1V2L T;  3SU1 A;  1EZS C;  2FOG A;  3HK6 B;  3FN8 A;  1TNL A;  5EJ1 A;  1UK4 A;  1AKS B;  1GI9 B;  5C5N A;  4AGK A;  3ATK A;  3L6P A;  7EST E;  4WY3 A;  1SL3 A;  3BEF B;  4JZF H;  1IQM A;  3S7K B;  4ZHA A;  3ZZ9 A;  4BAM B;  4B1T A;  1MKX K;  1OYQ A;  1DXP A;  2WV5 A;  1P3E A;  2XWA A;  2AGI X;  3GCH C;  5IYT A;  2FI4 E;  3OEH D;  3KHV A;  3IWM A;  1ANE A;  1YPM H;  4MG3 A;  1K1J A;  1FY3 A;  3ZZD A;  1G2M A;  1AE8 H;  3EYD A;  5SGA E;  3GIS B;  4AG2 A;  3SQH E;  1GHX H;  4F48 B;  2BD7 A;  3BTH E;  4AFZ A;  2C8X B;  2UWO A;  3TU7 H;  1AND A;  4AN7 A;  4U2W A;  1V2K T;  2XWB I;  4TY7 A;  2ZPR A;  1EAI A;  1G37 A;  4JZE H;  2C90 B;  2PTN A;  1ZGI A;  2CF8 H;  1FV9 A;  2G8T A;  2ZPQ A;  1NRP H;  2BVR H;  5BPE A;  4AZ2 B;  2C8Z B;  1HJ9 A;  1GHY H;  1W3C A;  2FOA A;  2OBQ A;  4A6L A;  3UNS A;  1YGC H;  1FNI A;  2HRV A;  2ZTY A;  4X6P A;  4HI3 A;  2D8W A;  1DE7 H;  2V7Q D;  1YC0 A;  3TNT A;  3KQ5 A;  1EQ9 A;  5DO4 H;  1SHH B;  1WUN H;  5FCR A;  2UUJ B;  8GCH G;  1DWB H;  1SGQ E;  3DCL A;  4XDE A;  1C4V 2;  2BDY A;  3MO9 A;  1A46 H;  1Y5B T;  1D3Q B;  3M5N A;  1W14 U;  1GBC A;  3UQV A;  1Y59 T;  3S9B A;  1Y3U A;  3SNC A;  3RXV A;  2FIR H;  1ZPC A;  1W7X H;  4K2Y A;  1TRN A;  2TPI Z;  3ATM A;  3RMN H;  1S82 A;  4UFE H;  4X8S H;  5A0B A;  1P11 E;  1FY4 A;  1N1L A;  4YES B;  2Y81 A;  1S81 A;  1EB2 A;  5DKM A;  1F5R A;  1FX0 B;  3FVF B;  3FAN A;  1QL9 A;  1KXC A;  4H6T A;  5JDU B;  5A8Y A;  1LDT T;  1NFX A;  3AVZ A;  3P8F A;  2FP7 B;  4AOR A;  2OXS A;  1XKA C;  4SGA E;  4DG4 A;  1A0J A;  2CHA B;  2R2M B;  2XBV A;  1O5E H;  4BAH B;  1D3D B;  1TFX A;  4FXG H;  1SG8 B;  1ESB A;  1TRY A;  2VB0 A;  4GSO A;  1QJ6 B;  5DK1 A;  3FOA A;  4CRC A;  1GI5 A;  1P01 A;  4I33 A;  2LNC A;  4MPV A;  2ZDA H;  2CGA A;  2ODQ A;  2G5V A;  1GJA B;  4TY6 A;  2WV9 A;  1A3B H;  3DHK H;  5LH8 A;  4MVN A;  3PMA B;  2G51 A;  1BTY A;  1OXG A;  1TPA E;  2HLC A;  2R0L A;  4NGA H;  4AFS A;  3UFA A;  1GCT B;  4AFU A;  3MNS A;  2FTL E;  5TCC A;  1C2H A;  6GCH F;  2EST E;  4E7N A;  1NFU A;  1F2S E;  3UOP A;  1V2S T;  4F55 A;  3KCG H;  2F4L A;  1HAV B;  1OOK B;  2GKV E;  2W6J D;  1UO6 A;  2AS9 A;  5C1X A;  3MH7 A;  1OWE A;  3OU0 A;  1J9C H;  3D65 E;  1PPB H;  1A2C H;  1O3K A;  1OP0 A;  5DP4 A;  1D3T B;  1NFY A;  2I6Q A;  1D3P B;  2W3I A;  1TPS A;  1AZZ A;  4O97 A;  3UWJ H;  3O8C A;  1BTP A;  1Z6J H;  2GJG A;  1C5X B;  2ZG0 H;  3F9F A;  2A45 B;  3SI4 H;  3BEU A;  1LCY A;  1RIW B;  4X1P U;  2IJD 1;  5E8E H;  1P10 A;  4XBD A;  3TIU A;  1A5H A;  2AEI H;  3JZ2 B;  1AB9 C;  1IQI A;  3BV9 B;  1BJV A;  4Y71 A;  2BM2 A;  4FUD A;  5H4I B;  4A1T A;  1OKX A;  2ZU2 A;  3LT3 A;  4JYT A;  3DA9 B;  2YNB A;  1T4U H;  1TPP A;  1NN6 A;  2Y5H A;  2KCA A;  2ZU5 A;  1XX9 A;  2FEQ H;  1C1R A;  1C5N H;  2RG3 A;  4K1T A;  3W1E A;  3ATL A;  1TNK A;  1GI2 A;  2XBW A;  3U1J B;  1SFQ B;  5HIY A;  3PMJ A;  3BTM E;  1ELF A;  1GCD A;  1O3D A;  3PTB A;  4Q7Z A;  3RXH A;  5FL7 D;  5GCH G;  3SI3 H;  4D7G A;  1CQQ A;  4WWY A;  1Z1I A;  1FZZ A;  1KXE A;  1P12 E;  5EQR A;  1CHG A;  1TOC B;  5L30 H;  2VWL A;  1TOM H;  1MU8 B;  3QN7 A;  4K8Y A;  1W10 U;  1F5L A;  5GJ4 B;  2C93 B;  3C27 B;  3GDU A;  1KLT A;  3QO6 A;  1FIW A;  4Y8Z A;  3Q76 A;  1KLI H;  1WTH D;  4HFP B;  3SU6 A;  2ZO3 H;  4I86 A;  2FYQ A;  2ZWL H;  4RKJ B;  1TGT A;  2C3S A;  4I8J A;  3ZZ7 A;  3VXF H;  1HUT H;  1O2K A;  3SU5 A;  1KDQ B;  1IQF A;  2ZCH P;  1GI4 A;  3TK6 A;  1TGS Z;  2BD9 A;  1GBI A;  1W12 U;  5A0A E;  1EAS A;  1GBH A;  3RXT A;  3WY8 A;  3RC5 A;  5EJZ A;  4K69 A;  1YPG H;  3P70 B;  2P95 A;  3HKJ B;  2W26 A;  1Y3Y A;  1CO7 E;  2BD2 A;  1O3P B;  4ABF A;  4RKO B;  4B6E A;  2VGC C;  1TE0 A;  1QRW A;  3RLY H;  2EA3 A;  4GAW A;  2HPP H;  1AVG H;  1NRN H;  6LPR A;  1GMD G;  2ZFS A;  3NRL A;  1BTH H;  2OC8 A;  1GJ6 A;  4NIX A;  4WMD A;  3LKW A;  5I25 A;  1O2I A;  4ZKS U;  3MFJ A;  1C5O H;  1FLE E;  2ALP A;  4MQA A;  1O2P A;  2Z6B D;  5DP9 A;  1BRC E;  5EXL A;  1HRT H;  1CHO F;  5KED A;  1ZR0 A;  1S84 A;  1A1R A;  2SGD E;  1MTN B;  1SGN E;  2BDI A;  2F91 A;  3UTU H;  1TIO A;  1Q31 A;  2RDL A;  5J4S A;  2JJ1 D;  1JRS A;  4F4O C;  2PKA B;  5F03 A;  2BXU H;  2ZGH A;  3SBK A;  1ARB A;  1C1P A;  1RTL A;  4OS4 A;  4IS5 A;  1O3C A;  4DII H;  1GHB F;  3W94 A;  1F7Z A;  1GDQ A;  1ZOM A;  1O39 A;  3SJ8 A;  2VU8 E;  4U30 A;  5G4B A;  2BLW A;  3SNB A;  1INC A;  1FN6 A;  3SV6 A;  1QB9 A;  1DDJ A;  1KY9 A;  2HLD D;  1GGD B;  1RRK A;  3V12 A;  3BTD E;  2RDE A;  4X8T H;  1C5U A;  4BAO B;  1PQA A;  1CA0 B;  2R2W U;  3LGW A;  2ZU1 A;  1DLK B;  1GHV H;  1EXF A;  4XBB A;  1HYL A;  2WSS D;  2WPL S;  1N8O B;  1N6X A;  2ZU4 A;  4X2V A;  2EQN A;  1GJC B;  1KXF A;  3HKI B;  3SV8 A;  3SUD A;  2BX3 A;  2R9P A;  2XNI A;  1LQD B;  2ASU B;  3PM3 A;  1T8O A;  2VWO A;  1KTT B;  3E91 A;  1IQN A;  1SB1 H;  3VB5 A;  2M5T A;  2QIQ A;  2ILN A;  2VH6 A;  3E6P H;  3E8L A;  2P3U B;  1UCY H;  1O2J A;  4DW2 U;  1GI7 B;  5HXF A;  1MTV A;  5T3H A;  3MYW A;  2H9T H;  1WTG H;  1ZSL A;  1MBM A;  3D62 A;  3RXL A;  1C1N A;  1C4Y 2;  1QNJ A;  1UJ1 A;  4D9R A;  4AG1 A;  1S6H A;  1XKB C;  3CEN A;  3S9A A;  5HMA A;  1E79 D;  3ELA H;  4J1Y A;  1TNH A;  2JJ2 D;  1ELB A;  1SGR E;  3SJK A;  1J15 A;  1O31 A;  1MKW H;  1ZTL A;  3RXK A;  3ZZ8 A;  1XUK A;  1C1O A;  1NM6 A;  1V2U T;  5FX6 A;  4VGC B;  4X2Y A;  1BOQ A;  4GLY A;  2SGQ E;  2ZFP H;  4UFF H;  1GHA F;  1EB1 H;  4K1E A;  2ZF0 H;  3BG4 B;  3SUF A;  4NA9 H;  3GY2 A;  1LHE H;  4K5Z A;  5C17 A;  5HIZ A;  3KL6 A;  2BQ7 B;  1O3E A;  1BIO A;  2OUA A;  3MQK C;  1YYY 1;  5DJ7 A;  2GV6 A;  3DD2 H;  3WWF A;  1TMT H;  1Z8R A;  4E06 H;  2LPR A;  4FU9 A;  4GCH F;  5FPY A;  3AAU A;  3RP2 A;  1GL0 E;  3L3T A;  4KP0 A;  1BDA A;  1MCT A;  2JDI D;  2P94 A;  1C1Q A;  3RC4 A;  1ZZZ A;  1EOL A;  3ZVD A;  3QWC H;  4ABD A;  4I7Y H;  2UWP A;  4OS1 A;  5AFY H;  3ZV9 A;  4UON A;  3QK1 A;  1MQ6 A;  2FOM B;  1WDI A;  2AHM E;  1D6R A;  1VGC B;  4R8T B;  2OTV A;  1Y3W A;  1O32 A;  2WYJ A;  3H5C B;  2EI7 A;  3F9H A;  1ORF A;  5C1U A;  1EZU C;  2BD4 A;  3PWC A;  1HJ8 A;  5KEC A;  3VEQ B;  1LO6 A;  4INK A;  3QDZ B;  5GPI B;  3TJN A;  1X7A C;  5HKK D;  3OAA D;  2ZC9 H;  2QXJ A;  2A1D B;  2XND D;  3A83 A;  3V7T A;  2HNT F;  1MD7 A;  1RD3 B;  3A7V A;  3BTE E;  3RLW H;  4AYV B;  4XBC A;  1DVA H;  2BVS H;  2OC1 A;  3BTG E;  3RXQ A;  1SLW B;  2QXG A;  3ODF A;  1JXP A;  1NFW A;  2Y5G A;  4UFD H;  1A5G H;  1GL1 A;  1YP9 A;  1WU1 A;  1NRQ H;  4JYV H;  1V2Q T;  3Q77 A;  4YXW D;  3FFG A;  5L6N H;  1Y3V A;  4P00 A;  1BJU A;  4IGD A;  1K2I 1;  4NCY A;  4ASH A;  4JYU H;  1VIT H;  3BTF E;  4JZD H;  3A7W A;  2F9V A;  2HGT H;  3F9E A;  1K0H A;  3A81 A;  3RXF A;  5A8Z A;  2QF3 A;  2Z3C A;  2WZQ A;  2VIV A;  1FAX A;  4MNX A;  1TGB A;  1BCU H;  5DP6 A;  5ETX A;  5T1V A;  3T29 A;  2BLV A;  4A5T S;  1G9I E;  5LPR A;  1V2P T;  2XBX A;  1PFX C;  2NWN A;  3GCO A;  2O8M A;  4GUX A;  4ACA A;  1QFK H;  4WXI A;  3S0N A;  2A7J A;  2XC5 A;  2EC9 H;  3OEE D;  3PO1 B;  1BML A;  1O2H A;  3A8B A;  4FUI A;  5EG4 A;  2R3Y A;  2F9B H;  2AMD A;  1GBD A;  1HGT H;  1SGI B;  4CR9 A;  3DUX H;  1T4V H;  1QQU A;  5EW2 H;  4U32 A;  3UB0 A;  3OY6 U;  2OC0 A;  3E3T A;  4ZHM U;  3M37 A;  1HAP H;  2RA0 A;  4VGC C;  5EQS A;  1IOE A;  1ZMJ A;  2K0Q A;  4OM9 A;  5EU8 A;  1T32 A;  3EE0 B;  4B71 A;  1IAU A;  1OPH B;  2F3C E;  2GD4 B;  1YF4 A;  1BMA A;  4BAQ B;  3U9A H;  1D6W A;  2G55 A;  1IQH A;  2VVU A;  3FAO A;  5T6F A;  1WBG B;  1P3C A;  4I8L A;  1KXB A;  3U28 C;  1AHT H;  3NCL A;  4X1R U;  1TLD A;  1UTO A;  3TJO A;  2G5N A;  3MI4 A;  3GS9 A;  4X6M A;  4GPG A;  4AB9 A;  2YNA A;  7GCH G;  1BTW A;  2CN0 H;  3F2G A;  2TIO A;  1ZYO A;  5LGO A;  3GDV A;  2R3U A;  1H9L B;  3N99 A;  4Y7A A;  4IBL H;  3T2N A;  3O8B A;  3KN2 A;  3PV4 A;  1THS H;  2B7D H;  1QB1 A;  1SQA A;  1Q3X A;  3MNC A;  3MOC A;  1DWC H;  3SU3 A;  2Z9J A;  2Y7X A;  2QN5 T;  3FZZ A;  4IC5 A;  4MNY A;  1C5T A;  2Y5F A;  3ENS B;  4H42 U;  4NZL A;  1KSN A;  1B0F A;  2BXT H;  3DFJ A;  1YLD A;  1O38 A;  1AWF H;  1SLV B;  4YM9 A;  5A09 A;  2PUX B;  3EA9 A;  1QB6 A;  4Q63 A;  4UD9 H;  2A7C A;  4X6O A;  2FOH A;  3B9F H;  2BOK A;  4ZKR U;  4RT0 A;  2SGA A;  1MTS A;  4BAN B;  4KTS A;  1GDN A;  1VKY A;  1GG6 B;  1C2J A;  4NZQ A;  1YLN A;  3TPI Z;  2SGP E;  1ELT A;  2OP9 A;  1O3B A;  2JH6 D;  3M5L A;  3VFE A;  5GND A;  3MU1 A;  3TH4 H;  1VIT F;  2DE9 A;  3PRB A;  1B0E A;  4INH A;  4JZ1 A;  4Z6A H;  2RFK C;  1GI8 B;  3DSP A;  5IK2 D;  5JYI A;  1GHZ A;  1IHS H;  1BRA A;  1T31 A;  1V2W T;  2J9N A;  3SO3 A;  1J8A A;  1FI8 A;  2JIZ D;  3MHW U;  1C1T A;  2HNT C;  3Q3X A;  3T28 A;  1VCP A;  4INL A;  4AGJ A;  3A8C A;  2UWL A;  2QV1 A;  4IMZ A;  1LPK B;  1KYN A;  1AFE H;  1AN1 E;  1QQ4 A;  1ETS H;  3KID U;  3CS0 A;  4D9Q A;  3MH4 A;  4ZHL U;  3UR9 A;  1AU8 A;  2JH0 D;  1MD8 A;  3LGT A;  3PRD A;  1SPJ A;  2FOD A;  3O8D A;  5JBA S;  3U98 H;  1SHY A;  1EJM A;  2XCF A;  5EXM A;  1MH0 A;  3LPR A;  3RXS A;  1SOT A;  1K28 D;  2BY5 X;  3SV9 A;  1EKB B;  1HAG E;  1AGJ A;  3SYJ A;  1W0K D;  5FAH A;  1GHW H;  1WQV H;  2W5E A;  2ZFQ H;  3CNR A;  4WME A;  1V2O T;  3GOV B;  3RUO A;  1GBA A;  2R0K A;  2BDH A;  2H9E H;  2BDC A;  1GWA A;  1G3B A;  1MAY A;  4HZH A;  1C1W H;  1EPT B;  1P2I A;  1GJ5 H;  2VVV A;  1THP B;  1HV7 A;  1A5I A;  3A89 A;  3RXG A;  4WF8 A;  2DUC A;  4FOU C;  1DS2 E;  2I6S A;  3H7O A;  2GCT B;  1TRM A;  1AWH B;  1H8I H;  2P93 A;  2WHX A;  2P8O B;  2GMT C;  3PMB B;  4Y8X A;  3ZVF A;  1UTM A;  2PV9 B;  2FXR A;  4YOG A;  1A4W H;  1ANB A;  1QHR B;  4Q7X A;  5EQQ A;  1HDT H;  1XVM A;  1RFN A;  1C4U 2;  2IN2 A;  3A84 A;  1Z8J B;  3VXE H;  4THN H;  1AQ7 A;  5I46 H;  1GBK A;  1SGT A;  1F0S A;  1VCW A;  2ZHE H;  4WH8 A;  3RMM H;  1SMF E;  1TBZ H;  4FUE A;  4B6F A;  1O2N A;  1HIA B;  1QIX B;  1NO9 H;  3P6Z B;  1TGC A;  3PYH A;  4O03 A;  5A2M H;  2GT8 A;  1C1S A;  3RXJ A;  2HAL A;  4YLU A;  1EAU A;  4Q7Y A;  1MQ5 A;  2IOT A;  4WJG 2;  5EGM A;  1WV7 H;  5FBE A;  2Z3D A;  2SGF E;  3N7E A;  1TNJ A;  3GY7 A;  2BD8 A;  4WVP E;  3BG4 C;  1IQG A;  1HCG A;  1E36 B;  1HPG A;  1LHG H;  2JKH A;  5EOK A;  5AHG H;  3UIR A;  2A4G A;  2CK3 D;  2FS8 A;  2PKA A;  3IG6 B;  4IN2 A;  1SKY E;  2Z9K A;  3RXI A;  2G00 A;  3GCT G;  2Y6T A;  3UPE A;  1EAW A;  7GCH F;  2PTC E;  1VR1 H;  1CT2 E;  2WPK S;  5HGG A;  1DAN H;  1C5Z B;  2BQ6 B;  3Q3Y A;  1O34 A;  4ISN A;  3LON A;  2WUC A;  1U6Q A;  4YTA A;  3TIT A;  4I8H A;  2VIW A;  2P3F H;  3UNQ A;  4A7I B;  1Z7K A;  4DCD A;  4DY7 B;  4RI0 A;  1CU1 A;  1ESA A;  3OE7 D;  4A92 A;  4ZCN A;  3F1S B;  3PO1 C;  4MTB A;  1XVO A;  3FP7 E;  1E37 B;  2BQW B;  2OBO A;  2BMG B;  2V3H H;  3E0N B;  1JMO H;  3RXU A;  1QUR H;  1P02 A;  2B0F A;  4H4F A;  3VB7 A;  1QBV H;  4FUC A;  2JET B;  5CHA B;  1E0F D;  1TON A;  5C5O A;  2BX4 A;  2C8Y B;  1HXE H;  3TJU A;  3UAI C;  8GCH F;  3ATW A;  2ZNK H;  3QTO H;  2FWW A;  4B2A A;  4M7G A;  2V3M A;  1IQJ A;  3F3B A;  1SGE E;  1ZJK A;  1JWT A;  2QE7 D;  2WUB A;  2ZI2 H;  2ZQ2 A;  3NPS A;  4BNR A;  5JB8 S;  1BBR H;  1NU7 B;  3NZI A;  2IPH A;  3QGN B;  4CRB A;  1K22 H;  1S0Q A;  1XUJ A;  2SNV A;  1LKB A;  1GI3 A;  2ANK H;  1BIT A;  1GVL A;  5DSF A;  1GVZ A;  5K0H A;  1BMM H;  1PPF E;  1RS0 A;  1V2N T;  3P8O A;  2ZHD A;  3LH3 A;  2WIN I;  3MMG A;  4XD7 D;  1O2G H;  1PYT C;  2FM2 A;  4DT4 A;  1LQE A;  2BZA A;  4CRG A;  2PUQ H;  1FY1 A;  4CBO A;  1SSX A;  3SU2 A;  3RU4 E;  5EPN A;  3A7T A;  2STA E;  1F92 A;  3QX5 H;  4B74 A;  2GMT B;  2YMS D;  2AIP A;  1ZSK A;  1EX3 A;  4IN1 A;  4OGX A;  1DSU A;  2W7U A;  1UVS H;  3MU4 A;  4IW4 E;  3T25 A;  3LC3 A;  2XRC A;  1G3D A;  1ZHM A;  2ZGB H;  3SOS A;  1H8E D;  1O3H A;  2OQU A;  1SLU B;  1C5Q A;  1TGN A;  3OTP A;  1WXR A;  4FUJ A;  1RTF B;  5TJX A;  3CS7 A;  2H5C A;  3KEE A;  3LGU A;  2AH4 X;  1NC6 A;  2P59 A;  3A7Y A;  5JPM H;  2CF9 H;  4FVD A;  3VGC B;  5FPT A;  1SQT A;  3N7O A;  4TPY A;  1H1B A;  2H9H A;  3AW0 A;  5DP7 A;  1BUI A;  1TBR H;  1CT4 E;  1ID5 H;  1O2R A;  1C9P A;  1JIM A;  3LJJ A;  4XFQ A;  1EST A;  5JBT A;  3QUM P;  2VIN A;  4JK6 A;  5EIY A;  2FO9 A;  1QA0 A;  1AE5 A;  1GMH F;  2IJO B;  4NG9 H;  1XMN B;  2LP6 A;  4DUR A;  2A31 A;  4WH6 A;  3ZIA D;  2XC4 A;  1GJD B;  1ELG A;  3SHA H;  1UVP A;  3GY5 A;  3MWI U;  3W95 A;  1GJB B;  1Y5U T;  2XOK D;  3JZ1 B;  3NXP A;  1P2J A;  3HPT B;  1BTZ A;  3A85 A;  1QRX A;  2P16 A;  3B23 B;  3F0O A;  1CA0 C;  3OFN D;  1MAX A;  2A5I A;  2ZP0 H;  3URD A;  1LTO A;  1NY2 2;  2WPI S;  2ANY A;  1MKW K;  2OK5 A;  2ZDL A;  4RSP A;  3SQE E;  1BTU A;  3TJV A;  2A32 A;  4B75 A;  1OS8 A;  3BTT E;  2O8T A;  1O5G H;  1O2Y A;  4FUH A;  1GJ8 B;  4MPU A;  3ZYE A;  1EAX A;  2FZZ A;  2GZ9 A;  2J94 A;  3PV5 A;  3Q00 A;  4JK5 A;  4Y0Y E;  3NUM A;  1O2W A;  2ZZU H;  2HVY B;  4NSY A;  2J4I A;  3ZZ4 A;  1QL7 A;  2ZU3 A;  1GJ4 H;  2A4Q A;  1ETT H;  2PHB A;  1C5W B;  3MNX A;  1AVW A;  1K9O E;  5AF9 H;  3A7Z A;  3KQD A;  3EGK H;  3SZN A;  2D1J A;  3AAV A;  3SV2 H;  1L2E A;  3S69 A;  5DN6 D;  1S85 A;  4UE7 H;  3KQE A;  3MU0 A;  3AAS A;  1BHX F;  3I77 A;  3BTQ E;  4AB8 A;  2THF B;  1VIT G;  1HAI H;  1QBN A;  4CRD A;  2PLX A;  2QF4 A;  4YOJ A;  1YBW A;  4JMY A;  1MBQ A;  1BZX E;  1B5G H;  2FLR H;  4FUB A;  1AO5 A;  5GIB A;  1UVO A;  3F9G A;  1AVX A;  1HAV A;  1EZX C;  1YPH E;  1FUJ A;  1Z71 A;  3QTV H;  2ZDK A;  1Z8G A;  5FHT A;  2B5T B;  4P02 A;  4DIH H;  1AZ8 A;  2GX4 A;  1CHO G;  4YT6 H;  2PFE A;  1XXD A;  1TA6 A;  1F0U A;  1J16 A;  4Y76 A;  1O33 A;  2GZ8 A;  4ABG A;  7LPR A;  3A82 A;  1K1L A;  2PKS C;  1TPO A;  3RXM A;  2ZGJ A;  4A1X A;  1DLE A;  2AGG X;  1W0Y H;  2P3T B;  3UQO A;  5AVD A;  1XUF A;  4FU7 A;  2XYA A;  5C3N A;  2EEK A;  1Y5A T;  1HAZ B;  1TQ7 B;  2J2U A;  1P05 A;  3R3G B;  5T6D A;  1TAB E;  1GHA G;  2NU1 E;  4OGY A;  3K65 B;  2OD3 B;  3A87 A;  5HM9 A;  1V2V T;  5C2Z A;  1HAO H;  4NSV A;  1ZMN A;  1QCP A;  5CE1 A;  3MNB A;  3I29 A;  4ABH A;  1O3O A;  2BY8 X;  1YPJ H;  2NU3 E;  2BYA X;  1BQY A;  2ZHQ H;  4ZUH A;  1PPG E;  5F53 A;  5E0G A;  5FXL A;  4KTU A;  1YWU A;  4GCH G;  3GDS A;  2BY9 X;  5GCH F;  2BZ6 H;  2ZCK P;  3SGA E;  2GDD A;  3A7X A;  1ZSJ A;  1C2K A;  2RCE A;  3MH6 A;  3BTW E;  1O5A B;  3OSY A;  1TA2 A;  2V6N A;  3ZVE A;  1O3J A;  1C5P A;  4ABA A;  1C1M A;  2KAI A;  6CHA B;  2UUK B;  4LOY H;  1O5D H;  3GY6 A;  1QBO A;  4X8V H;  4QT8 C;  3PWB A;  2PGB B;  5B6O A;  2QGR A;  1CVW H;  4KGA A;  8EST E;  3E0P B;  1TNI A;  2D2D A;  1ZTJ A;  4X8U H;  3M3T A;  1EPT C;  2W6I D;  4B2B A;  3RC6 A;  4SGB E;  5FX5 A;  2LEL A;  2A0Q B;  2WPD D;  5EOD A;  1HJA B;  1O37 A;  3K9X B;  3RXD A;  3RXC A;  1C1U H;  4OS2 A;  2SFA A;  1V2J T;  2VWM A;  2XC0 A;  1OHH D;  4ISI H;  4OS6 A;  2FTM A;  3T26 A;  2SGE E;  1ZGV A;  2IPQ X;  2KCP A;  1DT2 A;  1KXD A;  2UUY A;  4NIW A;  1P9U A;  1ANC A;  1HFD A;  3UY9 A;  4CBN A;  1OWD A;  2TGD A;  3MTY A;  1S6F A;  1H4W A;  4X6N A;  1ZTK A;  5A0C A;  1YLC A;  3AK5 A;  1BHX B;  4NFE A;  1C5L H;  4ZRO A;  3SNA A;  2GVF A;  2BVX H;  2CHA C;  1TX6 A;  1QZ8 A;  2PSX A;  1DPO A;  1HBT H;  4U01 A;  2GT7 A;  1SGP E;  1VZQ H;  2QC2 A;  1N8O C;  1BA8 B;  5DP3 A;  1WYK A;  3O8R A;  2QF0 A;  3PTN A;  4ZKO U;  4CHA C;  3DT0 H;  1S0R A;  3M7Q A;  1O3A A;  1GBF A;  1H8D H;  2KR7 A;  5GWZ A;  2XXL A;  4AC9 A;  5K7R A;  1GBE A;  1CT0 E;  1UTL M;  3ZVC A;  2VIO A;  3ZZB A;  1K1P A;  2BB4 A;  7KME H;  1DST A;  1MCV A;  4EST E;  4Q4L A;  4K1S A;  2AER H;  3LIW A;  2FX6 A;  2BLQ A;  4WXV A;  1Q2W A;  5C20 A;  4Y6D A;  1EOJ A;  2F9N A;  3SGQ E;  4NA7 A;  2F9O A;  1UTK A;  2Z9I A;  3M7T A;  4NFF A;  1CE5 A;  1V6D A;  1C2M A;  1JOU B;  1LKA A;  1EAT A;  1BMN H;  3T27 A;  2F9U A;  1UHB A;  5EJL A;  2EI8 A;  1LMW B;  5BRR E;  2XTT B;  2H2Z A;  3NKK A;  4CRF A;  4PRO A;  2NU0 E;  3M61 U;  3H7T A;  1VGC C;  1NPM A;  2TGT A;  4XRN A;  4CRA A;  4Q80 A;  1SVP A;  1DWE H;  1K1N A;  2QAA A;  4CRE A;  1MU6 B;  1OWH A;  3PV2 A;  3M5M A;  2PGQ B;  4TYD A;  3P17 H;  4XE4 A;  3PLP A;  2M2A A;  1EP5 A;  2J98 A;  2VID A;  4BXS A;  4ACB A;  5L2Z H;  5F8Z A;  1YPK H;  3VB6 A;  3TVJ B;  2GV7 A;  4X1N U;  1MMJ N;  4AOQ A;  1O2U A;  4D7F A;  1GJ9 B;  1P57 B;  1UCY K;  4KKD A;  2KM0 A; 
#chains in the Genus database with same CATH homology
 2J97 A;  1QZ8 A;  5HIZ A;  2J98 B;  3EE7 A;  5HIY A;  5C94 A;  2J98 A;  1UW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...