5HIZA

The structure of pedv nsp9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
96
Chain Sequence
GKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWGGCNTIELEPPRKFLVDSPNGAQIKYLYFVRNLNTLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 9
publication title Structure of PEDV NSP9
rcsb
source organism Porcine epidemic diarrhea virus cv777
molecule tags Rna binding protein
total genus 14
structure length 96
sequence length 99
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5hizA01
5HIYA 5HIZA 2J98A 2J97A 1UW7A 5C94A 2J98B 3EE7A 1QZ8A
chains in the Genus database with same CATH superfamily
2QYIA 3PO1C 4ZROA 3EA7A 4NA9H 1MKXH 4CH8B 2ZFQH 1BTYA 3PB1E 3RXKA 4LK4A 3ZZ4A 4A5TS 3RXMA 3OY6U 1EZQA 1MD7A 3U1IB 3T27A 3P92A 1SKYE 2ZFFH 5A8ZA 3P95A 4WXIA 3PMAB 3L33A 2GMTB 1WU1A 2ZDVH 3STJA 1ARBA 1O3MA 3SU4A 2GD4B 1EQ9A 4ZKSU 2ZKSA 4Q80A 2PSXA 4CRCA 3GYLB 3E6PH 5EQRA 2VWLA 3DUXH 5FHTA 2CHAB 1CBWC 1BRBE 2VB0A 1YPHC 3O8BA 3EE7A 4MQAA 2O8LA 1EZXC 1GBCA 1ZOMA 3MU0A 5TCAA 3EGKH 3MHWU 4JZEH 2PUQH 2ZHDA 2HWLB 1IAUA 3ATWA 1HAZB 1DY8A 4PROA 1HAVA 4GCHG 3SO3A 5CDFE 1BRCE 1ZMNA 1TAWA 2YNBA 4JCNA 1YPMH 4OS4A 1EPTA 3PROA 1HPGA 4CRBA 2JH0D 5A09A 2AYWA 1HAXB 5PTPA 2GT8A 1O39A 3RXBA 1GDUA 2RCEA 1GI2A 2K1QA 3UNSA 1AY6H 1KXFA 4JZFH 6LPRA 2VGCB 5HIZA 2C93B 5AFZH 2Z3EA 4ASUD 1NRSH 3EA8A 3KQBA 4XDEA 2EI8A 5JBBS 2XCNA 2GV7A 1CHOF 2ALVA 1HJ9A 1JWTA 1DDJA 3GISB 4NIVA 3SU2A 4ZAEA 3EAJA 2ZTXA 2A4RA 1T4UH 4TYDA 2QIQA 1GMHG 3SOSA 2FTMA 2BZ6H 2IPHA 2ODPA 3UWJH 1A0HB 1C5SA 2BX3A 1O2ZA 5ETXA 2G51A 8KME2 5F6MA 3M5MA 5GCHF 2KR7A 1SFIA 3RC5A 4HG6A 3A81A 1O2UA 1THRH 1RGQA 1SGQE 1VZQH 1FAXA 1Q3XA 4XE4A 2V3OH 1LHCH 1RD3B 1W0KD 2ZFSA 3SGQE 4E7RG 1MCVA 3P6ZB 1P2QA 1W3CA 2P93A 1KXCA 3UOPA 2SGQE 1FUJA 2WHXA 3T25A 5J4SA 2P94A 1K1OA 3MNBA 1C5NH 4XBBA 1XVMA 3LOXA 4ABFA 4ZMAH 1XXFA 4FU8A 1FY4A 1O3KA 1DWEH 3M35A 3KQ5A 4MNXA 4UONA 2HVYB 4H6SB 2ZTZA 1O35A 1XUFA 3TNTA 1UCYK 3GS9A 5EU8A 3LDXH 1C1TA 3KGPA 1O2XA 3PWBA 2Y5GA 1EJNA 2ZU2A 5T6FA 4WJG2 2AMPA 1O5CB 5GPIB 1Y5BT 2ZWLH 1RIWB 4X8VH 2RG3A 1BB0B 1E36B 3MU8A 1ZGVA 1F0RA 4X8UH 9LPRA 7KMEH 1BTZA 4WXVA 2ZDMA 5IDKA 1L1NA 5E0JA 1FLEE 2FI3E 3KNXA 3ZZ3A 1BT7A 1O2SA 1HAIH 1P10A 5T6DA 2JH5D 2PV9B 1HCGA 1V2QT 3GY5A 1ELFA 2I6QA 3RXRA 5C1UA 3CNRA 4B71A 1GVLA 4K1TA 2ZFPH 1WCZA 5H4IB 1C5MD 1YPJH 2XC0A 1G9IE 1GL1A 5I25A 4YESB 3O8CA 1Z7KA 3SN8A 2BY8X 3AW0A 4GHQA 2ALPA 3KEEA 2BXTH 3K6ZA 1HJAB 4AB8A 3UNQA 2CHAC 4GVUA 2JJ2D 1ZTJA 1THSH 1BMNH 2TGTA 1UVTH 4I8LA 2AIPA 1BTXA 2QY0B 3A8DA 3GY8A 4RKJB 5DG6A 2BLQA 2QC2A 3PV2A 1QTFA 1L4ZA 1OWEA 2YOLA 5HM9A 1LVBA 1EPTB 1SLUB 1D6WA 3KQDA 1XUHA 1C4Y2 1WDIA 1UVSH 3ZIAD 3LH3A 1GHXH 2VVUA 2OXSA 1ZHRA 2ZZUH 1T8OA 3U8TH 3F1SB 3RDZA 3ZVDA 4A1XA 1SSXA 1MMJN 1K22H 4E05H 5GWZA 1UK2A 3PLKA 3Q77A 4Y8XA 4GHTA 4IMZA 1LCYA 5K0HA 1TPOA 2O9QA 3S9AA 2FS8A 3M37A 1D3DB 4Y8YA 1O3GA 4TWWA 1P02A 1A5HA 1SGPE 4WY3A 3KQCA 2WYGA 1UK4A 2V3MA 3DFJA 4ABGA 1AGJA 3ZZBA 1AKSB 4BANB 2CN0H 7ESTE 1P2IA 5CHBA 2IPQX 1ELBA 3CS7A 2HNTF 4SGAE 2J97A 1UTPA 3SBKA 3SQEE 2VWMA 1U6QA 3E8LA 3EYDA 3BTKE 4DVAU 1AVXA 2ZI2H 2F3CE 2A5AA 3OX7U 4OM9A 3SGBE 2GVFA 2A7HA 1C2EA 2L74A 2G55A 4K60A 5EIYA 1H8ED 1S84A 1EAUA 2CV3A 1B0EA 5DO4H 1BTPA 2H5CA 2PFEA 1ZRBA 3N7OA 4D9QA 1GMDF 2ZA5A 1CSOE 2P3FH 3GCHB 3KF2A 1IHSH 1O2YA 1MTUA 1NN6A 1K1MA 3AW1A 3VGCC 5BPEA 4RT1A 4ABDA 1H9HE 1RTKA 1F0UA 1F92A 1JMOH 1NFWA 3U8OH 2UUFB 1P9UA 3NWUA 4FVBA 4I33A 2BLVA 1AQ7A 2NU3E 2SGEE 1GJ8B 3QGJA 3RXLA 1K9OE 3H09A 1SGRE 2A2QH 3MMGA 3ELAH 1INCA 1DUAA 1EASA 2ZC9H 1FZZA 1LKBA 3B9FH 1CGJE 4AB9A 2ANWA 1NY22 2STBE 2PTCE 3MWIU 1SMFE 3W1EA 2P8OB 4HGCA 5DP3A 3P17H 1C2HA 1A5IA 1MAXA 1OP2A 2VVCA 1Z8RA 2L6OA 1ESBA 4YLQH 1T8MA 5T6GA 1O2VA 2C4FH 1FXYA 3ATIA 1TGNA 2GP9B 1OYQA 1GBJA 1V2LT 1BTHH 1C2JA 2BQWB 3MI4A 3BEUA 2EA3A 2VIQA 3DSPA 2WPLS 1ANCA 4DY7B 2BHGA 2PR3A 4RI0A 1C5UA 1QB9A 1E79D 5DN6D 1TOCB 4AGKA 2XC4A 1E0FD 3ZZCA 4ZKNU 2H6MA 3SU1A 2O8MA 3IWMA 2XCFA 2O8WA 1DANH 3HGPA 3NZIA 2BDGA 2FOGA 1QL9A 2CF9H 3PV4A 4AC9A 1BBRE 3QGNB 1GI8B 3JZ1B 1QNJA 1J14A 2RA3A 1WXRA 4ACAA 3A7YA 3GYMA 4D7FA 2FODA 1WTHD 2JKHA 3BTQE 3P8GA 3FZDA 1HJAC 1ELCA 5EGMA 1K2I1 3U1JB 1LDTT 2ZGJA 3KL6A 3QO6A 3P8OA 2J92A 4DJZB 1KLTA 1OP0A 1QFKH 1GJDB 3E16B 2B5TB 1J8AA 2XBVA 3OEED 1C1PA 2HVXA 4FUGA 5AVDA 1TGSZ 1EPTC 1DOJA 3PYHA 5IK2D 1C5RA 2F9OA 2ZDLA 4MLFB 1GHAG 3A89A 1G36A 2ZFTA 4DURA 4YOGA 1TPAE 1AE8H 4NWKA 2NU2E 1SVPA 2GTBA 5C67A 2WV5A 1W0JD 1HB0B 1K0HA 1AFEH 1D4PB 4NWLA 3SJ8A 2A5KA 3F0PA 4YTAA 1T4VH 1J16A 2HGTH 1GCTC 1KDQA 3VEQB 6GCHG 4Q4LA 1AVWA 2GT7A 1WAYB 1UHBA 1KSNA 1TA2A 2R2WU 3BF6H 4O3UA 4AFZA 1DY9A 4CR9A 1QHRB 4ISOA 1F0SA 4K8BA 1IQLA 2W5EA 2Z9JA 4LOYH 1Y59T 2QF5A 2ZG0H 1WQSA 1Z6EA 2BD8A 5FXLA 1ESAA 1O3JA 3U9AH 3UNRA 2KCOA 3A84A 4I32A 3DHKH 3OSYA 3Q00A 3TGIE 2GZ8A 1W12U 1BTUA 1EZUC 1UK3A 1NRNH 1TGBA 1O3LA 4J1YA 4TY6A 5J4QA 1HAYB 3A83A 1COWD 3M36A 1SLVB 3ATMA 2W3KA 3F68H 2WUBA 1V2TT 1ZSJA 2BOKA 2BXUH 2P59A 3EE0B 3M3TA 4ZH8A 3SHAH 3GCHC 3V13A 1W0ZU 2I6SA 1T7CA 1YCPK 1TBQH 1BMAA 3SJ9A 1TNKA 2XW9A 1PQ5A 2AS9A 2Y7ZA 1NRPH 1C2FA 2ZF0H 1O3IA 1YLDA 3A8BA 1O3HA 1DWCH 4X8SH 1BOQA 1GBLA 2TRMA 4IN2A 3MH4A 3B8JA 1H9LB 2BD7A 2Z94A 1THPB 1TNJA 2J95A 3T26A 3ZVGA 4B2CA 1V2NT 4TPIZ 3TK6A 1ZYOA 1TPSA 3VB6A 1C4U2 4XOJA 3TLOA 2CXVA 4AFQA 2KCYA 2HNTC 2ZQ2A 1GBMA 4H42U 1HFDA 2FOFA 2P8OC 3UIRA 4NFFA 1TIOA 2VH6A 2R3UA 3SNBA 3VB3A 3AAUA 5GXPA 1GHBF 1SHYA 2XRCA 4XBDA 1EFRD 4UDWH 3LONA 1SGFA 2FOBA 3WWBA 1A0JA 1O3AA 3UAIC 5FPTA 3QX5H 4MTBA 3VFEA 2PUXB 5EQSA 1N8OB 4WH6A 4ZKOU 3RC6A 1MZAA 2ANKH 3H7OA 3SUDA 4J2YB 3N7DA 1YCPM 4CHAB 1F0TA 1ZJKA 3JZ2B 1X7AC 3M7TA 4MPVA 1G3CA 3QTOH 5HM2A 5C2ZA 3S7KB 1O2OA 3BTEE 1W7GH 3SORA 4IW4E 1V2JT 5L30H 1JOUB 2FOHA 1V3XA 3GY2A 3NRLA 2QF4A 4O3TA 2ZFRH 3RXSA 1MABB 3ZZDA 3D65E 2BQ7B 1V2WT 1E34B 1QURH 1LHFH 2VINA 4FUHA 4OS7A 1SOTA 4FUEA 2IOTA 3STIA 1TE0A 3NPSA 4DGJA 1V2OT 4X1SU 3W95A 4IGDA 2C8ZB 2OQ5A 4OS5A 1F2SE 3MTYA 3CENA 5AF9H 1AB9B 5A0AE 1WUNH 1Z71A 3HK6B 1DSTA 4FVDA 7GCHG 3SUGA 2Z3DA 4P02A 1BJUA 1AZZA 1AD8H 3TK5A 3KHVA 5F8ZA 3RXPA 3RXFA 1KDQB 1GJ5H 1SGYE 3PRDA 3SUEA 3E90B 4FUFA 1UHBB 2CK3D 2GJGA 2GDEH 1L1GA 2OINA 3SJIA 3UREA 4AGJA 1XVOA 3RC4A 1HBTH 1UTQA 2ZTYA 1O2MA 1ZTLA 4K2YA 3MO3A 2PKSB 3SUFA 1LVOA 2QN5T 1TB6H 3P8NA 2XNIA 4ABEA 1TOMH 3GY6A 4CRGA 1BDAA 1AWFH 1XM1A 3LU9B 4Z0KA 4XSKU 1UTLM 3MNSA 1BBRH 1GHZA 4X6MA 2HRVA 3LGTA 4Q7YA 1VITF 1P05A 3BN9A 2VIOA 1H1BA 4JYUH 1WTGH 1CVWH 4TY7A 5JB8S 2A32A 1YBWA 1QRXA 3AAVA 1GHYH 1H9IE 2GCHG 2P16A 2VIVA 3FO8D 4INHA 2R0LA 3A7TA 8GCHF 1P09A 3RLWH 2JH6D 2B9LA 2OD3B 4BAKB 4UFDH 4JMYA 2AGIX 4Y7AA 1MH0A 3GY3A 5C1YA 1P0SH 4K8YA 3HATH 3QK1A 1W0YH 3PMJA 1CT0E 3GY7A 2UWLA 1O5EH 1GI1A 2LNCA 3I78A 2JDID 2UUKB 4WH8A 1P3EA 4TSFD 1UJ1A 2C3SA 2Y80A 1O3DA 2WPKS 1GMCG 1O38A 1V2MT 1DWDH 4D9RA 1S6FA 1O31A 1TFXA 2XWBI 4RKOB 2BDHA 9ESTA 3QZRA 1W14U 1N6YA 3I29A 5EODA 2J2UA 3MYWA 5FCRA 2D26C 2A1DB 1S5SA 1A3EH 4GLYA 2QXJA 4AFSA 1C2DA 1S6HA 3UTUH 1V2KT 1EB1H 3ZYDA 1EOLA 1GBHA 1JBUH 3TH4H 4X6PA 5HKKD 2ZU5A 1PYTD 1O2LA 4THNH 1GI0A 5AHGH 4FUDA 1TABE 6ESTA 1NS3A 4DIIH 3RM2H 1A0LA 4D76A 3URDA 2Y5HA 2HPQH 1OHHD 1BRUP 2OLGA 1ZHPA 2F9NA 1WOFA 1GDQA 1XUIA 2F9BH 3MNCA 4BTTB 1QR3E 2F9PA 1KXEA 4U01A 4CHAC 1W8BH 1ANDA 4X2XA 3RMNH 4YZUA 1QRZA 1O3EA 4MNVA 4BNRA 3PTBA 4BTIB 4B2BA 3QLPH 4U30A 4A1TA 4D7GA 1EX3A 2J94A 1ZR0A 1RXPA 2UUJB 4KGAA 1AI8H 2VBCA 4NIWA 1KXBA 1QCPA 1G32B 3TJUA 2H9EH 3GCTG 1A3BH 1GHVH 4DT4A 1O34A 1Y3XA 1GG6B 1ZPZA 4BAOB 5EJLA 3EQ0H 1W13U 1MQ5A 2FM2A 3FZZA 1W11U 1YPLH 2BTCE 1HXFH 5A2MH 1AB9C 1FJSA 5LGOA 3BTHE 4BAHB 4LXBH 8ESTE 4IC6A 7LPRA 5SGAE 4B73A 4R0IA 1C5WB 1Y3YA 2HOBA 3SV9A 1XUJA 2QXIA 3RXVA 3SNDA 1P12E 1GVKB 2FP7B 5CHAB 2PSYA 3IITA 1YLNA 4P00A 1CO7E 1HIAA 1E1RD 2G8TA 4KTUA 2GMTC 3RU4E 1V2VT 2P3UB 2BD4A 1CU1A 2QF3A 2BLOA 1SLXB 2R0KA 2QCYA 1C5XB 1CA0B 4Z6AH 1A1RA 2PKSC 1ETTH 1K1PA 3A88A 5F8TA 2OCVB 3RMMH 2HPPH 1YPHE 4IBLH 3R0FA 2J9NA 3KQEA 3UB0A 2ZNKH 2AEIH 2SGPE 4I7YH 3VPKA 1HAVB 3F2GA 2FI4E 2ZHQH 3BEIB 1FY1A 5ABWA 1GGDB 1FN8A 4GCHF 1TMUH 3LJOA 1LPKB 1NZQH 4X1RU 1GI5A 2XYAA 1NU7B 1G3BA 2GDDA 1P57B 4FU7A 2WYJA 1YPKH 1MKXK 1VCQA 4X8TH 1XKAC 1CGHA 1Y3WA 1SQOA 5L2YH 1EKBB 3MU5A 3S9CA 1LVMA 3A7VA 1WSSH 1O2HA 2G5VA 3S0NA 1O32A 2KCAA 3UPEA 2FX4A 4DW2U 2ZDNA 3ATLA 1G2LA 5A8XA 1GHWH 2F4LA 4FXGH 2PHBA 2VIPA 2D1JA 1KXAA 1A46H 2FLBH 1QBVH 2W26A 2Z9IA 2WPHS 2V7QD 1W2KH 2VGCC 3GCOA 5B6LA 1IQGA 8LPRA 1S83A 4NSVA 5TCCA 3M5LA 1NESE 5G4BA 1ZJDA 5ESTE 4TWYA 2BVXH 2VH0A 2M5TA 1GMHF 4MPUA 5A8YA 3TIUA 3LGIA 4JK5A 3K9XB 5DP7A 5EPNA 2Z7FE 1ELTA 2Y7XA 1AN1E 3CS0A 3K6YA 1UCYE 3TNSA 4ABHA 1TNGA 1O2GH 5DGJA 1H8DH 1PPCE 1Q2WA 2Z6BD 4CBNA 2W7SA 2QAAA 1FX0B 2ANYA 2CMYA 1P06A 2FZZA 3TPIZ 2A4QA 1CQQA 1EJAA 1LHDH 1MKWH 2Y82A 3RXCA 4VGCB 3F9EA 4YXWD 1C2MA 1EP6A 4X2WA 5EOKA 4Y11E 3VB5A 1S0RA 2FYRA 4CRFA 3RUOA 2OTVA 2V6NA 1NPMA 1YPGH 1QB1A 1UO6A 3BIUH 3LH1A 3GCNA 1SHHB 1ZHMA 4CREA 4X1QU 1TRMA 1G3EA 2K0QA 3A80A 2FOAA 6CHAB 1OPHB 2Y6TA 4IC5A 1TNHA 3BTFE 3LGVA 3RMOH 1V2ST 1VCPA 1ZSLA 3AVZA 3ZZAA 4BXWA 2PLXA 2BD9A 3ZZ8A 1HAHH 2BDCA 1FV9A 1MZDA 2HLCA 1AMHA 1C2KA 2HLDD 4Y71A 3E0NB 3RXHA 2FESH 1YGCH 3FP8E 1Y8TA 5C94A 1DXWA 2Z9KA 1MUEB 4ZHLU 2QXHA 2IJD1 1EZSC 3UQVA 2BM2A 4NCYA 1UVOA 2FO9A 2IJOB 1F5RA 5E2PA 1GG6C 1NT1A 1S6LA 2C8XB 2OUAA 1V2UT 5JBCS 1O5GH 4MPWA 1ARCA 4WWYA 1PPBH 1RIWC 2NU4E 3F6UH 1HIAB 1GBKA 1VCWA 4NZLA 3RXGA 5JDUB 4YT6H 2VJ1A 3BV9B 5I46H 1D3PB 3PMBB 3V3MA 1SGIB 2F91A 4YO9A 1O2QA 1P03A 2BY6X 4FOUC 3M7QA 1OX1A 3S69A 2NU0E 4BAMB 2FDAA 2EI7A 2WSSD 3RXAA 3D49H 1BUIA 4R8TB 1KYNA 5T1VA 4WF8A 1OP8A 3L6PA 2F43B 4X0WU 2KAIA 5CHAC 1TMTH 1Z1JA 5JPMH 3VB7A 4K69A 4RT0A 4ZHAA 3F2FA 1AIXH 1NM6A 4DIHH 2UUYA 1O2NA 3TGJE 1CA0C 1W10U 4B75A 3SGAE 1O5BB 3G01A 4ISLA 4ZKRU 1O5DH 1TMBH 3WY8A 1XMNB 4JYVH 1GPZA 4K3JA 1ZMJA 4OS2A 5DJ7A 1AZ8A 2O8TA 1OYTH 1SOZA 1E37B 1VGCB 2OC1A 4O97A 1AWHB 4BTUB 4MVNA 1GGDC 2FOMB 2RFKC 2AH4X 2F83A 3PLBA 3ZVBA 2KX4A 4UFFH 2JIZD 1TLDA 5HMAA 4ISNA 3RXQA 1FMGA 1CT4E 3OU0A 4H6TA 3SI3H 3LJJA 2ZU1A 3UQOA 5C20A 1Y3UA 3U8RH 3E0PB 5FL7D 3I77A 2ZDKA 3SQHE 2W6ID 2BOHB 1C5TA 4INLA 3ZZ9A 1Z8GA 2DE8A 1GJ9B 1Y5AT 4F49A 3NK8A 1PPGE 3LPRA 5C3NA 1ZPBA 1QQ4A 2H9HA 2AGEX 1P2JA 4MNWA 3LGYA 1D3QB 4A1VA 4NIXA 1XXDA 2WPJS 1TRYA 1QL7A 2VIWA 1TQ7B 1BMFD 1PPFE 1GI9B 1NTPA 2WPMS 4Y0ZE 1J15A 2A7CA 1IQFA 2CF8H 1QB6A 3F9HA 3LGWA 1GI6A 1EUFA 1KY9A 1SGFG 1FPCH 3L3TA 3OE7D 1GI3A 1SFQB 5LPFA 1MQ6A 1XUKA 2FXRA 1ELVA 1NFYA 1C2LA 1ABJH 1G37A 1ORFA 5TJXA 4M7GA 4VGCC 2A0QB 2G4TA 3TGKE 5K7RA 2C8YB 2JETB 4DOQA 1IQIA 1QJ7B 1TBRH 4NFEA 2W3IA 1C5PA 1GJBB 4B74A 4Q63A 1Z8JB 1FY8E 1QA0A 1HRTH 1ZPCA 4B6FA 2XBWA 3LT3A 3MO9A 2RA0A 2FOEA 3RXEA 1YKTA 4ABIA 3OAAD 5DP9A 6CHAC 5EW1H 4LZ1H 1LHGH 2EC9H 1FI8A 2Z9GA 1YF4A 3SU6A 2XXLA 3GDSA 3SNEA 1KIGH 2ILNA 1EATA 2RDLA 1RTLA 5E0GA 4YLUA 5E8EH 3W94A 2R3YA 1OKXA 1EB2A 1QL8A 1L2EA 3M3SA 1L4DA 4JZ1A 4ABAA 1HYLA 2VWNA 2GV6A 3RXIA 1BIOA 1J17T 1DICA 1A4WH 1BHXB 3H7TA 1T8LA 4D8NA 3O8DA 1HJ8A 1ZLRA 1Y3VA 1G2MA 1OWIA 1ABIH 1SGCA 1SG8B 1UTJA 1O3OA 1UCYH 1D3TB 1O2KA 2BDAA 4AOQA 1N6XA 1P3CA 2KAIB 2CJIA 1CHOG 1GJAB 2ODQA 4ACBA 1TGCA 1W7XH 1DWBH 2AERH 3DD2H 1IQMA 1QJ6B 3F0OA 1B5GH 2J4IA 4AFUA 1AUJA 3NUMA 3MO6A 1UVUH 4AYYB 1S85A 1O2WA 4SGBE 1C1OA 2G52A 1TNLA 3SU5A 1K1IA 2ULLA 3V7TA 4K5ZA 3A85A 1UW7A 2TGDA 3NKKA 5GCHG 3SNCA 3EA9A 1IQJA 2M2AA 1DFPA 5FPYA 1LPGB 1HAGE 2FIRH 2UWOA 1G3DA 2J5UA 1WQVH 2LP6A 1SQAA 1VKYA 1DT2A 1ELEE 1JIMA 2ESTE 2Q6FA 1DS2E 5GDSH 3QDZB 2WZQA 4HI3A 3MNXA 2A31A 1S82A 1C1NA 3GDUA 1VGCC 1KTSB 1L0ZA 4XD7D 1JXPA 1GHAF 1C5VA 1H8HD 1VJ9U 5LPEA 1D9IA 4Q2KA 2TBSA 3FP7E 4JZDH 1SB1H 3MOCA 2BX4A 2EEKA 2P3TB 1P01A 3ZV8A 1LPZB 2YMSD 4JYTA 5EW2H 1VR1H 2FEQH 1ETSH 2THFB 2BMGB 2WPIS 5FBIA 1GBBA 5EJZA 6GCHF 2BDIA 4ZXYH 2ZCKP 1O3FA 4WMEA 1ETRH 4Y76A 3URCA 1XKBC 1Z6JH 1P8VC 4AX9H 1MTNB 1PPEE 5C5NA 1KXDA 3MH5A 1BZXE 1G30B 1O3NA 1O30A 2PGQB 1PPZA 1TWXB 3QUMP 4NSYA 4H4FA 2G4UA 2OQUA 5B6OA 2PTNA 5JB9S 1C1MA 2BD3A 1A2CH 1UTKA 3KYFA 1SQTA 3A7ZA 5GIBA 2B8OH 1DXPA 1EJMA 1O3CA 1GJ7B 1UTMA 2YMSB 4KKDA 5L6NH 1LKAA 5EXLA 1O2PA 2RDEA 4OS6A 1L1JA 3BIVH 1P2KA 1DSUA 1JRTA 1C5ZB 1TBZH 4UFEH 3PV5A 2O8UA 4ZXXH 1AO5A 1IQNA 2PWXA 1C5QA 2EY4C 3KCGH 2H1UA 2K8IA 2Z9LA 2ZQ1A 3ODFA 1NFUA 5KECA 1O0DH 4Y7BA 5FX5A 2A2XH 3WWFA 2OC0A 1DVAH 2W7UA 3BTWE 1RFNA 4BAQB 1GBIA 2JETC 2Y5FA 3ZYEA 4XRNA 1SL3A 2OP9A 1NU9A 3SV8A 1CT2E 2OBOA 4I86A 1NRRH 5FAHA 5EXNA 2KCPA 1MU8B 3MFJA 1PQ8A 2YNAA 1Q31A 4TPYA 4IN1A 1BMMH 1KTTB 1SGTA 4ISHH 5DK1A 1QBNA 1HGTH 2A45B 5DP8A 4NIYA 2KM0A 1YLCA 3PTNA 4JK6A 1EOJA 1BJVA 5FCKA 2BYAX 1GVZA 1KLJH 1GCDA 2HNTE 1XX9A 3F9FA 1Y5UT 3PLPA 1YWUA 5IYTA 1OSSA 3OTPA 1ESTA 2LPRA 1GDNA 1YP9A 3QTVH 3UOUA 3GY4A 1JRSA 4NGAH 1MD8A 1BTWA 1TRNA 2C90B 2BVRH 2Y81A 4F55A 2LELA 3M3VA 1ZTKA 2D2DA 1TPPA 3MH7A 1GJCB 2ODYB 1O2TA 1H4WA 1OWHA 2FS9A 5C0TA 4HTCH 2DUCA 4FETA 2V3HH 1QY6A 2VIDA 1AKSA 1GJ6A 2TPIZ 2ZO3H 3QWCH 3H5CB 2QV1A 2ZEBA 1VITH 3KN2A 1OWKA 1N8OC 1TA6A 1OXGA 3Q3XA 5F53A 2ZU3A 2QXGA 1VJAU 2D8WA 3CP7A 1C1UH 3ODDA 1K21H 1GBDA 2G81E 3VG8A 1LO6A 1SGDE 2ZDAH 1HLTH 3RXDA 2AIQA 3OY5U 5LPRA 3OEHD 3RXTA 3BG4B 1AUTC 1S81A 1A61H 3MU4A 1SGNE 4B76A 1T32A 1F7ZA 3BTME 1FIZA 1GMDG 3VGCB 4A7IB 1FAKH 3R3GB 3KIDU 1C9TA 1RRKA 3SV2H 1WYKA 3E3TA 3RMLH 1GWAA 1AE5A 2BDBA 4NA8A 3OTJE 3FFGA 3S7HB 1CA8B 2B0FA 1O2JA 3F2HA 3BEFB 1GBTA 2BB4A 2BY5X 7GCHF 1C5LH 2AHME 2ZP0H 2A7JA 5DSFA 3SJKA 4KP0A 2BY9X 1QGFA 5HYOA 3SZNA 2F9UA 4AORA 2OK5A 2SNWA 4GPGA 1QIXB 1MTVA 2GGVB 1PQ7A 3Q76A 3T28A 4YM9A 3BTDE 2AMDA 4AN7A 4HFPB 3NCLA 2DE9A 1O2RA 3VXEH 3BTGE 4XBCA 1NBME 3PRBA 1C9PA 3HGNA 3TH2H 1EAXA 1MTNC 1SC8U 3A8CA 1HAPH 1FN6A 2BDYA 1C1QA 3SV7A 4LZ4B 1LTOA 4X6NA 2SGFE 4GSOA 3F9GA 2V0BA 3EDXB 1SPJA 3MU1A 3U28C 2GX4A 4OS1A 4F48B 3HK3B 4F4OC 1KLIH 2YMSC 2STAE 2BD5A 3P70B 3T2NA 2FI5E 1F5LA 2FTLE 5C5OA 2GCTB 2GCHF 1SQRA 2V35A 1C1SA 3RU4T 3HKJB 2IN2A 2ASUB 3VXFH 1RTFB 3C1KA 2EQNA 1CHGA 2WPDD 1ELDE 1SR5C 1B0FA 2WUCA 2FOCA 2R9PA 1O36A 3GICB 1ZGIA 4KELA 2WINI 3B23B 3HKIB 1AFQB 2C8WB 1E38B 2Z3CA 4AG1A 3SU3A 4YOJA 1ANBA 1P9SA 1ZSKA 2AMQA 4FUBA 1TX8A 3M5OA 3A7WA 1OWDA 2ZPQA 1B7XB 1RJXB 3SV6A 2PW8H 1GMCF 4UFGH 3FVFB 1MTWA 5F03A 4ISIH 4JZIA 3ITIA 1AVGH 1JIRA 1T8NA 1Z1IA 5C1XA 4WMFA 1YCPH 5AFYH 4CH2B 2G5NA 2TIOA 3A87A 2SGDE 1OOKB 3OYPA 4K1EA 3D62A 1BQYA 1UTNA 3ZVEA 3FANA 3V12A 2VWOA 1DPOA 1GCTB 1C1RA 3IG6B 5F8XA 4CRDA 1TX6A 3LGUA 4X1PU 2KFWA 1BBRK 1OS8A 1UVPA 1WV7H 2ZIQH 2P95A 1YM0A 3E1XB 3DFLA 5GJ4B 1AHTH 1S0QA 2PKAA 3ZV9A 1SGEE 1DLEA 3LIWA 4I8HA 5LH8A 1IHTH 1P2MA 4X6OA 2EI6A 2QA9E 1GJ4H 1O2IA 1EXFA 1YPEH 1V6DA 3TITA 4Z1MD 5C17A 1N1LA 3RXUA 4CBOA 3T62A 5EXMA 5JBTA 1SBWA 3D23A 5EPYA 3UWIA 1K1LA 5E2OA 1IQKA 1BA8B 4O9VA 1C2GA 3MQKC 1FDPA 1FPHH 1EP5A 1F5KU 2SNVA 1D6RA 2FYQA 2BY7X 2AGGX 3PM3A 3ATKA 4CR5A 2ZGXH 2XTTB 3BG4C 1LQEA 4B1TA 3TJNA 2ZGHA 1K1JA 3LKWA 4OGXA 5JYIA 3T29A 3GCTF 2TGPZ 4FUCA 4ABBA 2VU8E 3WW7A 2ANMH 4NG9H 4O03A 3Q3YA 4AZ2B 1MTSA 2OBQA 1FY5A 1PYTC 4YOIA 2ZPSA 1KMHB 4BOHA 1BRAA 3TVJB 3FAOA 1M9UA 1H8IH 3TH3H 3BTTE 1FNIA 2NU1E 1OWJA 4MDSA 4Q7ZA 1QQUA 2GZ7A 5JBAS 3A82A 3O8RA 4Y10E 1V2RT 1DLKB 4MPXA 1TX7A 2BD2A 2VNTA 4RN6A 1XUGA 5T3HA 3VB4A 2AFQB 4Q7XA 3P8FA 3K65B 1DX5M 4X2VA 3ZZ7A 2J98A 3SJOA 1LVYA 3DSOA 3SZEA 4DT7B 4FUIA 3TJVA 4E7NA 3QN7A 4U32A 3TU7H 3DT0H 1C5OH 3SYJA 3M5NA 1DITH 1GHBG 3N99A 1O3PB 1RS0A 2Q6GA 4OGYA 1DM4B 2ZHEH 1ZRKA 1TQ0B 1EAWA 4KTCA 1HNEE 1TYNA 4RSPA 2A4OA 1C1VH 4UD9H 3SHCH 4ASHA 3FOAA 1GL0E 4CRAA 1FONA 2XOKD 1HDTH 1V2PT 1ELGA 4ZUHA 3DCLA 3RP2A 4K1SA 1QRWA 1UMAH 1HAOH 1EAIA 3ZVFA 4Y79A 1MBMA 4INKA 4ABJA 2GCTC 3HPTB 1IQHA 1HUTH 3DSGA 3LC3A 2XWAA 1E35B 1GBEA 2JJ1D 2VVVA 3LC5A 4U2WA 3TJOA 3BG8A 4ESTE 1ZMLA 2TGAA 1BCUH 4MNYA 4GAWA 3RU4D 1MBQA 2SFAA 1NBMD 3ZVAA 2J38A 3U69H 5KEDA 2HALA 1AFQC 4A92A 3RXJA 1SLWB 2PGBB 2A4GA 2FLRH 3UFAA 1K1NA 3S9BA 3A8AA 3PO1B 2FPZA 1FIWA 4NA7A 3ENSB 5DKMA 4E06H 3E91A 2H5DA 3GOVB 4IS5A 1IOEA 1ELAA 2H2ZA 1MAYA 3A7XA 3KYGA 4X1NU 2BLWA 1O5AB 3ESTA 3RLYH 2GKVE 1DE7H 2A5IA 3ZVCA 5L2ZH 2GZ9A 2PKAB 4A6LA 1C1WH 5E0HA 4I8KA 5DPAA 1PQAA 1O3BA 1BHXF 2WV9A 2XC5A 3U98H 3SI4H 2QE7D 5A0CA 3TK9A 3FKSD 1AU8A 4MG3A 3K2UA 4M9FA 1TONA 4ZCNA 1CBWB 1A7SA 4I8GA 2ZHFH 1QJ1B 1HV7A 1BITA 1YYY1 1CE5A 4ZHMU 5ESBA 1PFXC 1A5GH 4FUJA 1K28D 1MCTA 2UWPA 4KTSA 1J9CH 5BRRE 1IQEA 4X2YA 4GUXA 2XNDD 5A0BA 2ZU4A 5CMXH 2W6JD 4HZHA 1TALA 4B2AA 1C2IA 1VITG 2NWNA 1LMWB 2BZAA 4QT8C 1O33A 1GBFA 1TNIA 2SGAA 2FWWA 1NO9H 5EQQA 1BMLA 3RM0H 3UUZA 3M7UA 2ZCLP 5FBEA 4DG4A 8GCHG 2FX6A 3AASA 3UR6A 1P2NA 2H9TH 2ZECA 5GNDA 5KGOA 2Q1JA 5CE1A 1SI5H 2BVSH 1NROH 2WV4A 4IMQA 1FY3A 1Z8IB 1DUEA 1PJPA 4I8JA 4I31A 1WBGB 2PP6A 1HXEH 3N7EA 3QZQA 3SNAA 2CGAA 3OFND 3ZZ6A 5DP4A 1ZZZA 2BQ6B 3Q3KA 3RXOA 1P11E 1MKWK 2F9VA 5C0UA 1O37A 3MH6A 2J98B 1CGIE 3SU0A 3UY9A 2XBXA 1P04A 4FU9A 2XBYA 3T5FH 1LHEH 1UTOA 1NFXA 1FQ3A 4AG2A 1GI4A 3BSQA 5HXFA 3V0XA 4Y6DA 1LQDB 4B6EA 3ZZ5A 3M61U 4WVPE 3C27B 2KZ4A 3PWCA 4WMDA 5DP5A 4UEHH 5HIYA 4NZQA 1C5YB 1NC6A 4AYVB 5DP6A 5EJ1A 1GBAA 1QZ8A 2OC7A 4Y0YE 1YY3A 2ZGBH 4XFQA 1ACBE 1T31A 1YC0A 3FN8A 2R2MB 3SW2B 5EG4A 2G00A 2ZCHP 4YT7H 1ANEA 1ID5H 3UR9A 2FMJA 3A86A 3GDVA 1P2OA 1TGTA 5HGGA 2B7DH 1NRQH 2QGRA 3F3BA 2QF0A 1O5FH 4UE7H 1QA7A 3FP6E 3AK5A 2ZGCA 2ZPRA 2OC8A 4Y8ZA 3NXPA 4DCDA 1MU6B 2Q6DA 3PMHB 1GI7B 2J34A 1QBOA 4BXSA 1C4V2 4TT3D 1PPHE 1E1QD 5FPSA 2ZHWH 3DA9B 5FX6A
chains in the Genus database with same CATH topology
5HIYA 5HIZA 2J98A 2J97A 1UW7A 5C94A 2J98B 3EE7A 1QZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIY A;  5HIZ A;  2J98 A;  2J97 A;  1UW7 A;  5C94 A;  2J98 B;  3EE7 A;  1QZ8 A; 
#chains in the Genus database with same CATH topology
 2QYI A;  3PO1 C;  4ZRO A;  3EA7 A;  4NA9 H;  1MKX H;  4CH8 B;  2ZFQ H;  1BTY A;  3PB1 E;  3RXK A;  4LK4 A;  3ZZ4 A;  4A5T S;  3RXM A;  3OY6 U;  1EZQ A;  1MD7 A;  3U1I B;  3T27 A;  3P92 A;  1SKY E;  2ZFF H;  5A8Z A;  3P95 A;  4WXI A;  3PMA B;  3L33 A;  2GMT B;  1WU1 A;  2ZDV H;  3STJ A;  1ARB A;  1O3M A;  3SU4 A;  2GD4 B;  1EQ9 A;  4ZKS U;  2ZKS A;  4Q80 A;  2PSX A;  4CRC A;  3GYL B;  3E6P H;  5EQR A;  2VWL A;  3DUX H;  5FHT A;  2CHA B;  1CBW C;  1BRB E;  2VB0 A;  1YPH C;  3O8B A;  3EE7 A;  4MQA A;  2O8L A;  1EZX C;  1GBC A;  1ZOM A;  3MU0 A;  5TCA A;  3EGK H;  3MHW U;  4JZE H;  2PUQ H;  2ZHD A;  2HWL B;  1IAU A;  3ATW A;  1HAZ B;  1DY8 A;  4PRO A;  1HAV A;  4GCH G;  3SO3 A;  5CDF E;  1BRC E;  1ZMN A;  1TAW A;  2YNB A;  4JCN A;  1YPM H;  4OS4 A;  1EPT A;  3PRO A;  1HPG A;  4CRB A;  2JH0 D;  5A09 A;  2AYW A;  1HAX B;  5PTP A;  2GT8 A;  1O39 A;  3RXB A;  1GDU A;  2RCE A;  1GI2 A;  2K1Q A;  3UNS A;  1AY6 H;  1KXF A;  4JZF H;  6LPR A;  2VGC B;  5HIZ A;  2C93 B;  5AFZ H;  2Z3E A;  4ASU D;  1NRS H;  3EA8 A;  3KQB A;  4XDE A;  2EI8 A;  5JBB S;  2XCN A;  2GV7 A;  1CHO F;  2ALV A;  1HJ9 A;  1JWT A;  1DDJ A;  3GIS B;  4NIV A;  3SU2 A;  4ZAE A;  3EAJ A;  2ZTX A;  2A4R A;  1T4U H;  4TYD A;  2QIQ A;  1GMH G;  3SOS A;  2FTM A;  2BZ6 H;  2IPH A;  2ODP A;  3UWJ H;  1A0H B;  1C5S A;  2BX3 A;  1O2Z A;  5ETX A;  2G51 A;  8KME 2;  5F6M A;  3M5M A;  5GCH F;  2KR7 A;  1SFI A;  3RC5 A;  4HG6 A;  3A81 A;  1O2U A;  1THR H;  1RGQ A;  1SGQ E;  1VZQ H;  1FAX A;  1Q3X A;  4XE4 A;  2V3O H;  1LHC H;  1RD3 B;  1W0K D;  2ZFS A;  3SGQ E;  4E7R G;  1MCV A;  3P6Z B;  1P2Q A;  1W3C A;  2P93 A;  1KXC A;  3UOP A;  2SGQ E;  1FUJ A;  2WHX A;  3T25 A;  5J4S A;  2P94 A;  1K1O A;  3MNB A;  1C5N H;  4XBB A;  1XVM A;  3LOX A;  4ABF A;  4ZMA H;  1XXF A;  4FU8 A;  1FY4 A;  1O3K A;  1DWE H;  3M35 A;  3KQ5 A;  4MNX A;  4UON A;  2HVY B;  4H6S B;  2ZTZ A;  1O35 A;  1XUF A;  3TNT A;  1UCY K;  3GS9 A;  5EU8 A;  3LDX H;  1C1T A;  3KGP A;  1O2X A;  3PWB A;  2Y5G A;  1EJN A;  2ZU2 A;  5T6F A;  4WJG 2;  2AMP A;  1O5C B;  5GPI B;  1Y5B T;  2ZWL H;  1RIW B;  4X8V H;  2RG3 A;  1BB0 B;  1E36 B;  3MU8 A;  1ZGV A;  1F0R A;  4X8U H;  9LPR A;  7KME H;  1BTZ A;  4WXV A;  2ZDM A;  5IDK A;  1L1N A;  5E0J A;  1FLE E;  2FI3 E;  3KNX A;  3ZZ3 A;  1BT7 A;  1O2S A;  1HAI H;  1P10 A;  5T6D A;  2JH5 D;  2PV9 B;  1HCG A;  1V2Q T;  3GY5 A;  1ELF A;  2I6Q A;  3RXR A;  5C1U A;  3CNR A;  4B71 A;  1GVL A;  4K1T A;  2ZFP H;  1WCZ A;  5H4I B;  1C5M D;  1YPJ H;  2XC0 A;  1G9I E;  1GL1 A;  5I25 A;  4YES B;  3O8C A;  1Z7K A;  3SN8 A;  2BY8 X;  3AW0 A;  4GHQ A;  2ALP A;  3KEE A;  2BXT H;  3K6Z A;  1HJA B;  4AB8 A;  3UNQ A;  2CHA C;  4GVU A;  2JJ2 D;  1ZTJ A;  1THS H;  1BMN H;  2TGT A;  1UVT H;  4I8L A;  2AIP A;  1BTX A;  2QY0 B;  3A8D A;  3GY8 A;  4RKJ B;  5DG6 A;  2BLQ A;  2QC2 A;  3PV2 A;  1QTF A;  1L4Z A;  1OWE A;  2YOL A;  5HM9 A;  1LVB A;  1EPT B;  1SLU B;  1D6W A;  3KQD A;  1XUH A;  1C4Y 2;  1WDI A;  1UVS H;  3ZIA D;  3LH3 A;  1GHX H;  2VVU A;  2OXS A;  1ZHR A;  2ZZU H;  1T8O A;  3U8T H;  3F1S B;  3RDZ A;  3ZVD A;  4A1X A;  1SSX A;  1MMJ N;  1K22 H;  4E05 H;  5GWZ A;  1UK2 A;  3PLK A;  3Q77 A;  4Y8X A;  4GHT A;  4IMZ A;  1LCY A;  5K0H A;  1TPO A;  2O9Q A;  3S9A A;  2FS8 A;  3M37 A;  1D3D B;  4Y8Y A;  1O3G A;  4TWW A;  1P02 A;  1A5H A;  1SGP E;  4WY3 A;  3KQC A;  2WYG A;  1UK4 A;  2V3M A;  3DFJ A;  4ABG A;  1AGJ A;  3ZZB A;  1AKS B;  4BAN B;  2CN0 H;  7EST E;  1P2I A;  5CHB A;  2IPQ X;  1ELB A;  3CS7 A;  2HNT F;  4SGA E;  2J97 A;  1UTP A;  3SBK A;  3SQE E;  2VWM A;  1U6Q A;  3E8L A;  3EYD A;  3BTK E;  4DVA U;  1AVX A;  2ZI2 H;  2F3C E;  2A5A A;  3OX7 U;  4OM9 A;  3SGB E;  2GVF A;  2A7H A;  1C2E A;  2L74 A;  2G55 A;  4K60 A;  5EIY A;  1H8E D;  1S84 A;  1EAU A;  2CV3 A;  1B0E A;  5DO4 H;  1BTP A;  2H5C A;  2PFE A;  1ZRB A;  3N7O A;  4D9Q A;  1GMD F;  2ZA5 A;  1CSO E;  2P3F H;  3GCH B;  3KF2 A;  1IHS H;  1O2Y A;  1MTU A;  1NN6 A;  1K1M A;  3AW1 A;  3VGC C;  5BPE A;  4RT1 A;  4ABD A;  1H9H E;  1RTK A;  1F0U A;  1F92 A;  1JMO H;  1NFW A;  3U8O H;  2UUF B;  1P9U A;  3NWU A;  4FVB A;  4I33 A;  2BLV A;  1AQ7 A;  2NU3 E;  2SGE E;  1GJ8 B;  3QGJ A;  3RXL A;  1K9O E;  3H09 A;  1SGR E;  2A2Q H;  3MMG A;  3ELA H;  1INC A;  1DUA A;  1EAS A;  2ZC9 H;  1FZZ A;  1LKB A;  3B9F H;  1CGJ E;  4AB9 A;  2ANW A;  1NY2 2;  2STB E;  2PTC E;  3MWI U;  1SMF E;  3W1E A;  2P8O B;  4HGC A;  5DP3 A;  3P17 H;  1C2H A;  1A5I A;  1MAX A;  1OP2 A;  2VVC A;  1Z8R A;  2L6O A;  1ESB A;  4YLQ H;  1T8M A;  5T6G A;  1O2V A;  2C4F H;  1FXY A;  3ATI A;  1TGN A;  2GP9 B;  1OYQ A;  1GBJ A;  1V2L T;  1BTH H;  1C2J A;  2BQW B;  3MI4 A;  3BEU A;  2EA3 A;  2VIQ A;  3DSP A;  2WPL S;  1ANC A;  4DY7 B;  2BHG A;  2PR3 A;  4RI0 A;  1C5U A;  1QB9 A;  1E79 D;  5DN6 D;  1TOC B;  4AGK A;  2XC4 A;  1E0F D;  3ZZC A;  4ZKN U;  2H6M A;  3SU1 A;  2O8M A;  3IWM A;  2XCF A;  2O8W A;  1DAN H;  3HGP A;  3NZI A;  2BDG A;  2FOG A;  1QL9 A;  2CF9 H;  3PV4 A;  4AC9 A;  1BBR E;  3QGN B;  1GI8 B;  3JZ1 B;  1QNJ A;  1J14 A;  2RA3 A;  1WXR A;  4ACA A;  3A7Y A;  3GYM A;  4D7F A;  2FOD A;  1WTH D;  2JKH A;  3BTQ E;  3P8G A;  3FZD A;  1HJA C;  1ELC A;  5EGM A;  1K2I 1;  3U1J B;  1LDT T;  2ZGJ A;  3KL6 A;  3QO6 A;  3P8O A;  2J92 A;  4DJZ B;  1KLT A;  1OP0 A;  1QFK H;  1GJD B;  3E16 B;  2B5T B;  1J8A A;  2XBV A;  3OEE D;  1C1P A;  2HVX A;  4FUG A;  5AVD A;  1TGS Z;  1EPT C;  1DOJ A;  3PYH A;  5IK2 D;  1C5R A;  2F9O A;  2ZDL A;  4MLF B;  1GHA G;  3A89 A;  1G36 A;  2ZFT A;  4DUR A;  4YOG A;  1TPA E;  1AE8 H;  4NWK A;  2NU2 E;  1SVP A;  2GTB A;  5C67 A;  2WV5 A;  1W0J D;  1HB0 B;  1K0H A;  1AFE H;  1D4P B;  4NWL A;  3SJ8 A;  2A5K A;  3F0P A;  4YTA A;  1T4V H;  1J16 A;  2HGT H;  1GCT C;  1KDQ A;  3VEQ B;  6GCH G;  4Q4L A;  1AVW A;  2GT7 A;  1WAY B;  1UHB A;  1KSN A;  1TA2 A;  2R2W U;  3BF6 H;  4O3U A;  4AFZ A;  1DY9 A;  4CR9 A;  1QHR B;  4ISO A;  1F0S A;  4K8B A;  1IQL A;  2W5E A;  2Z9J A;  4LOY H;  1Y59 T;  2QF5 A;  2ZG0 H;  1WQS A;  1Z6E A;  2BD8 A;  5FXL A;  1ESA A;  1O3J A;  3U9A H;  3UNR A;  2KCO A;  3A84 A;  4I32 A;  3DHK H;  3OSY A;  3Q00 A;  3TGI E;  2GZ8 A;  1W12 U;  1BTU A;  1EZU C;  1UK3 A;  1NRN H;  1TGB A;  1O3L A;  4J1Y A;  4TY6 A;  5J4Q A;  1HAY B;  3A83 A;  1COW D;  3M36 A;  1SLV B;  3ATM A;  2W3K A;  3F68 H;  2WUB A;  1V2T T;  1ZSJ A;  2BOK A;  2BXU H;  2P59 A;  3EE0 B;  3M3T A;  4ZH8 A;  3SHA H;  3GCH C;  3V13 A;  1W0Z U;  2I6S A;  1T7C A;  1YCP K;  1TBQ H;  1BMA A;  3SJ9 A;  1TNK A;  2XW9 A;  1PQ5 A;  2AS9 A;  2Y7Z A;  1NRP H;  1C2F A;  2ZF0 H;  1O3I A;  1YLD A;  3A8B A;  1O3H A;  1DWC H;  4X8S H;  1BOQ A;  1GBL A;  2TRM A;  4IN2 A;  3MH4 A;  3B8J A;  1H9L B;  2BD7 A;  2Z94 A;  1THP B;  1TNJ A;  2J95 A;  3T26 A;  3ZVG A;  4B2C A;  1V2N T;  4TPI Z;  3TK6 A;  1ZYO A;  1TPS A;  3VB6 A;  1C4U 2;  4XOJ A;  3TLO A;  2CXV A;  4AFQ A;  2KCY A;  2HNT C;  2ZQ2 A;  1GBM A;  4H42 U;  1HFD A;  2FOF A;  2P8O C;  3UIR A;  4NFF A;  1TIO A;  2VH6 A;  2R3U A;  3SNB A;  3VB3 A;  3AAU A;  5GXP A;  1GHB F;  1SHY A;  2XRC A;  4XBD A;  1EFR D;  4UDW H;  3LON A;  1SGF A;  2FOB A;  3WWB A;  1A0J A;  1O3A A;  3UAI C;  5FPT A;  3QX5 H;  4MTB A;  3VFE A;  2PUX B;  5EQS A;  1N8O B;  4WH6 A;  4ZKO U;  3RC6 A;  1MZA A;  2ANK H;  3H7O A;  3SUD A;  4J2Y B;  3N7D A;  1YCP M;  4CHA B;  1F0T A;  1ZJK A;  3JZ2 B;  1X7A C;  3M7T A;  4MPV A;  1G3C A;  3QTO H;  5HM2 A;  5C2Z A;  3S7K B;  1O2O A;  3BTE E;  1W7G H;  3SOR A;  4IW4 E;  1V2J T;  5L30 H;  1JOU B;  2FOH A;  1V3X A;  3GY2 A;  3NRL A;  2QF4 A;  4O3T A;  2ZFR H;  3RXS A;  1MAB B;  3ZZD A;  3D65 E;  2BQ7 B;  1V2W T;  1E34 B;  1QUR H;  1LHF H;  2VIN A;  4FUH A;  4OS7 A;  1SOT A;  4FUE A;  2IOT A;  3STI A;  1TE0 A;  3NPS A;  4DGJ A;  1V2O T;  4X1S U;  3W95 A;  4IGD A;  2C8Z B;  2OQ5 A;  4OS5 A;  1F2S E;  3MTY A;  3CEN A;  5AF9 H;  1AB9 B;  5A0A E;  1WUN H;  1Z71 A;  3HK6 B;  1DST A;  4FVD A;  7GCH G;  3SUG A;  2Z3D A;  4P02 A;  1BJU A;  1AZZ A;  1AD8 H;  3TK5 A;  3KHV A;  5F8Z A;  3RXP A;  3RXF A;  1KDQ B;  1GJ5 H;  1SGY E;  3PRD A;  3SUE A;  3E90 B;  4FUF A;  1UHB B;  2CK3 D;  2GJG A;  2GDE H;  1L1G A;  2OIN A;  3SJI A;  3URE A;  4AGJ A;  1XVO A;  3RC4 A;  1HBT H;  1UTQ A;  2ZTY A;  1O2M A;  1ZTL A;  4K2Y A;  3MO3 A;  2PKS B;  3SUF A;  1LVO A;  2QN5 T;  1TB6 H;  3P8N A;  2XNI A;  4ABE A;  1TOM H;  3GY6 A;  4CRG A;  1BDA A;  1AWF H;  1XM1 A;  3LU9 B;  4Z0K A;  4XSK U;  1UTL M;  3MNS A;  1BBR H;  1GHZ A;  4X6M A;  2HRV A;  3LGT A;  4Q7Y A;  1VIT F;  1P05 A;  3BN9 A;  2VIO A;  1H1B A;  4JYU H;  1WTG H;  1CVW H;  4TY7 A;  5JB8 S;  2A32 A;  1YBW A;  1QRX A;  3AAV A;  1GHY H;  1H9I E;  2GCH G;  2P16 A;  2VIV A;  3FO8 D;  4INH A;  2R0L A;  3A7T A;  8GCH F;  1P09 A;  3RLW H;  2JH6 D;  2B9L A;  2OD3 B;  4BAK B;  4UFD H;  4JMY A;  2AGI X;  4Y7A A;  1MH0 A;  3GY3 A;  5C1Y A;  1P0S H;  4K8Y A;  3HAT H;  3QK1 A;  1W0Y H;  3PMJ A;  1CT0 E;  3GY7 A;  2UWL A;  1O5E H;  1GI1 A;  2LNC A;  3I78 A;  2JDI D;  2UUK B;  4WH8 A;  1P3E A;  4TSF D;  1UJ1 A;  2C3S A;  2Y80 A;  1O3D A;  2WPK S;  1GMC G;  1O38 A;  1V2M T;  1DWD H;  4D9R A;  1S6F A;  1O31 A;  1TFX A;  2XWB I;  4RKO B;  2BDH A;  9EST A;  3QZR A;  1W14 U;  1N6Y A;  3I29 A;  5EOD A;  2J2U A;  3MYW A;  5FCR A;  2D26 C;  2A1D B;  1S5S A;  1A3E H;  4GLY A;  2QXJ A;  4AFS A;  1C2D A;  1S6H A;  3UTU H;  1V2K T;  1EB1 H;  3ZYD A;  1EOL A;  1GBH A;  1JBU H;  3TH4 H;  4X6P A;  5HKK D;  2ZU5 A;  1PYT D;  1O2L A;  4THN H;  1GI0 A;  5AHG H;  4FUD A;  1TAB E;  6EST A;  1NS3 A;  4DII H;  3RM2 H;  1A0L A;  4D76 A;  3URD A;  2Y5H A;  2HPQ H;  1OHH D;  1BRU P;  2OLG A;  1ZHP A;  2F9N A;  1WOF A;  1GDQ A;  1XUI A;  2F9B H;  3MNC A;  4BTT B;  1QR3 E;  2F9P A;  1KXE A;  4U01 A;  4CHA C;  1W8B H;  1AND A;  4X2X A;  3RMN H;  4YZU A;  1QRZ A;  1O3E A;  4MNV A;  4BNR A;  3PTB A;  4BTI B;  4B2B A;  3QLP H;  4U30 A;  4A1T A;  4D7G A;  1EX3 A;  2J94 A;  1ZR0 A;  1RXP A;  2UUJ B;  4KGA A;  1AI8 H;  2VBC A;  4NIW A;  1KXB A;  1QCP A;  1G32 B;  3TJU A;  2H9E H;  3GCT G;  1A3B H;  1GHV H;  4DT4 A;  1O34 A;  1Y3X A;  1GG6 B;  1ZPZ A;  4BAO B;  5EJL A;  3EQ0 H;  1W13 U;  1MQ5 A;  2FM2 A;  3FZZ A;  1W11 U;  1YPL H;  2BTC E;  1HXF H;  5A2M H;  1AB9 C;  1FJS A;  5LGO A;  3BTH E;  4BAH B;  4LXB H;  8EST E;  4IC6 A;  7LPR A;  5SGA E;  4B73 A;  4R0I A;  1C5W B;  1Y3Y A;  2HOB A;  3SV9 A;  1XUJ A;  2QXI A;  3RXV A;  3SND A;  1P12 E;  1GVK B;  2FP7 B;  5CHA B;  2PSY A;  3IIT A;  1YLN A;  4P00 A;  1CO7 E;  1HIA A;  1E1R D;  2G8T A;  4KTU A;  2GMT C;  3RU4 E;  1V2V T;  2P3U B;  2BD4 A;  1CU1 A;  2QF3 A;  2BLO A;  1SLX B;  2R0K A;  2QCY A;  1C5X B;  1CA0 B;  4Z6A H;  1A1R A;  2PKS C;  1ETT H;  1K1P A;  3A88 A;  5F8T A;  2OCV B;  3RMM H;  2HPP H;  1YPH E;  4IBL H;  3R0F A;  2J9N A;  3KQE A;  3UB0 A;  2ZNK H;  2AEI H;  2SGP E;  4I7Y H;  3VPK A;  1HAV B;  3F2G A;  2FI4 E;  2ZHQ H;  3BEI B;  1FY1 A;  5ABW A;  1GGD B;  1FN8 A;  4GCH F;  1TMU H;  3LJO A;  1LPK B;  1NZQ H;  4X1R U;  1GI5 A;  2XYA A;  1NU7 B;  1G3B A;  2GDD A;  1P57 B;  4FU7 A;  2WYJ A;  1YPK H;  1MKX K;  1VCQ A;  4X8T H;  1XKA C;  1CGH A;  1Y3W A;  1SQO A;  5L2Y H;  1EKB B;  3MU5 A;  3S9C A;  1LVM A;  3A7V A;  1WSS H;  1O2H A;  2G5V A;  3S0N A;  1O32 A;  2KCA A;  3UPE A;  2FX4 A;  4DW2 U;  2ZDN A;  3ATL A;  1G2L A;  5A8X A;  1GHW H;  2F4L A;  4FXG H;  2PHB A;  2VIP A;  2D1J A;  1KXA A;  1A46 H;  2FLB H;  1QBV H;  2W26 A;  2Z9I A;  2WPH S;  2V7Q D;  1W2K H;  2VGC C;  3GCO A;  5B6L A;  1IQG A;  8LPR A;  1S83 A;  4NSV A;  5TCC A;  3M5L A;  1NES E;  5G4B A;  1ZJD A;  5EST E;  4TWY A;  2BVX H;  2VH0 A;  2M5T A;  1GMH F;  4MPU A;  5A8Y A;  3TIU A;  3LGI A;  4JK5 A;  3K9X B;  5DP7 A;  5EPN A;  2Z7F E;  1ELT A;  2Y7X A;  1AN1 E;  3CS0 A;  3K6Y A;  1UCY E;  3TNS A;  4ABH A;  1TNG A;  1O2G H;  5DGJ A;  1H8D H;  1PPC E;  1Q2W A;  2Z6B D;  4CBN A;  2W7S A;  2QAA A;  1FX0 B;  2ANY A;  2CMY A;  1P06 A;  2FZZ A;  3TPI Z;  2A4Q A;  1CQQ A;  1EJA A;  1LHD H;  1MKW H;  2Y82 A;  3RXC A;  4VGC B;  3F9E A;  4YXW D;  1C2M A;  1EP6 A;  4X2W A;  5EOK A;  4Y11 E;  3VB5 A;  1S0R A;  2FYR A;  4CRF A;  3RUO A;  2OTV A;  2V6N A;  1NPM A;  1YPG H;  1QB1 A;  1UO6 A;  3BIU H;  3LH1 A;  3GCN A;  1SHH B;  1ZHM A;  4CRE A;  4X1Q U;  1TRM A;  1G3E A;  2K0Q A;  3A80 A;  2FOA A;  6CHA B;  1OPH B;  2Y6T A;  4IC5 A;  1TNH A;  3BTF E;  3LGV A;  3RMO H;  1V2S T;  1VCP A;  1ZSL A;  3AVZ A;  3ZZA A;  4BXW A;  2PLX A;  2BD9 A;  3ZZ8 A;  1HAH H;  2BDC A;  1FV9 A;  1MZD A;  2HLC A;  1AMH A;  1C2K A;  2HLD D;  4Y71 A;  3E0N B;  3RXH A;  2FES H;  1YGC H;  3FP8 E;  1Y8T A;  5C94 A;  1DXW A;  2Z9K A;  1MUE B;  4ZHL U;  2QXH A;  2IJD 1;  1EZS C;  3UQV A;  2BM2 A;  4NCY A;  1UVO A;  2FO9 A;  2IJO B;  1F5R A;  5E2P A;  1GG6 C;  1NT1 A;  1S6L A;  2C8X B;  2OUA A;  1V2U T;  5JBC S;  1O5G H;  4MPW A;  1ARC A;  4WWY A;  1PPB H;  1RIW C;  2NU4 E;  3F6U H;  1HIA B;  1GBK A;  1VCW A;  4NZL A;  3RXG A;  5JDU B;  4YT6 H;  2VJ1 A;  3BV9 B;  5I46 H;  1D3P B;  3PMB B;  3V3M A;  1SGI B;  2F91 A;  4YO9 A;  1O2Q A;  1P03 A;  2BY6 X;  4FOU C;  3M7Q A;  1OX1 A;  3S69 A;  2NU0 E;  4BAM B;  2FDA A;  2EI7 A;  2WSS D;  3RXA A;  3D49 H;  1BUI A;  4R8T B;  1KYN A;  5T1V A;  4WF8 A;  1OP8 A;  3L6P A;  2F43 B;  4X0W U;  2KAI A;  5CHA C;  1TMT H;  1Z1J A;  5JPM H;  3VB7 A;  4K69 A;  4RT0 A;  4ZHA A;  3F2F A;  1AIX H;  1NM6 A;  4DIH H;  2UUY A;  1O2N A;  3TGJ E;  1CA0 C;  1W10 U;  4B75 A;  3SGA E;  1O5B B;  3G01 A;  4ISL A;  4ZKR U;  1O5D H;  1TMB H;  3WY8 A;  1XMN B;  4JYV H;  1GPZ A;  4K3J A;  1ZMJ A;  4OS2 A;  5DJ7 A;  1AZ8 A;  2O8T A;  1OYT H;  1SOZ A;  1E37 B;  1VGC B;  2OC1 A;  4O97 A;  1AWH B;  4BTU B;  4MVN A;  1GGD C;  2FOM B;  2RFK C;  2AH4 X;  2F83 A;  3PLB A;  3ZVB A;  2KX4 A;  4UFF H;  2JIZ D;  1TLD A;  5HMA A;  4ISN A;  3RXQ A;  1FMG A;  1CT4 E;  3OU0 A;  4H6T A;  3SI3 H;  3LJJ A;  2ZU1 A;  3UQO A;  5C20 A;  1Y3U A;  3U8R H;  3E0P B;  5FL7 D;  3I77 A;  2ZDK A;  3SQH E;  2W6I D;  2BOH B;  1C5T A;  4INL A;  3ZZ9 A;  1Z8G A;  2DE8 A;  1GJ9 B;  1Y5A T;  4F49 A;  3NK8 A;  1PPG E;  3LPR A;  5C3N A;  1ZPB A;  1QQ4 A;  2H9H A;  2AGE X;  1P2J A;  4MNW A;  3LGY A;  1D3Q B;  4A1V A;  4NIX A;  1XXD A;  2WPJ S;  1TRY A;  1QL7 A;  2VIW A;  1TQ7 B;  1BMF D;  1PPF E;  1GI9 B;  1NTP A;  2WPM S;  4Y0Z E;  1J15 A;  2A7C A;  1IQF A;  2CF8 H;  1QB6 A;  3F9H A;  3LGW A;  1GI6 A;  1EUF A;  1KY9 A;  1SGF G;  1FPC H;  3L3T A;  3OE7 D;  1GI3 A;  1SFQ B;  5LPF A;  1MQ6 A;  1XUK A;  2FXR A;  1ELV A;  1NFY A;  1C2L A;  1ABJ H;  1G37 A;  1ORF A;  5TJX A;  4M7G A;  4VGC C;  2A0Q B;  2G4T A;  3TGK E;  5K7R A;  2C8Y B;  2JET B;  4DOQ A;  1IQI A;  1QJ7 B;  1TBR H;  4NFE A;  2W3I A;  1C5P A;  1GJB B;  4B74 A;  4Q63 A;  1Z8J B;  1FY8 E;  1QA0 A;  1HRT H;  1ZPC A;  4B6F A;  2XBW A;  3LT3 A;  3MO9 A;  2RA0 A;  2FOE A;  3RXE A;  1YKT A;  4ABI A;  3OAA D;  5DP9 A;  6CHA C;  5EW1 H;  4LZ1 H;  1LHG H;  2EC9 H;  1FI8 A;  2Z9G A;  1YF4 A;  3SU6 A;  2XXL A;  3GDS A;  3SNE A;  1KIG H;  2ILN A;  1EAT A;  2RDL A;  1RTL A;  5E0G A;  4YLU A;  5E8E H;  3W94 A;  2R3Y A;  1OKX A;  1EB2 A;  1QL8 A;  1L2E A;  3M3S A;  1L4D A;  4JZ1 A;  4ABA A;  1HYL A;  2VWN A;  2GV6 A;  3RXI A;  1BIO A;  1J17 T;  1DIC A;  1A4W H;  1BHX B;  3H7T A;  1T8L A;  4D8N A;  3O8D A;  1HJ8 A;  1ZLR A;  1Y3V A;  1G2M A;  1OWI A;  1ABI H;  1SGC A;  1SG8 B;  1UTJ A;  1O3O A;  1UCY H;  1D3T B;  1O2K A;  2BDA A;  4AOQ A;  1N6X A;  1P3C A;  2KAI B;  2CJI A;  1CHO G;  1GJA B;  2ODQ A;  4ACB A;  1TGC A;  1W7X H;  1DWB H;  2AER H;  3DD2 H;  1IQM A;  1QJ6 B;  3F0O A;  1B5G H;  2J4I A;  4AFU A;  1AUJ A;  3NUM A;  3MO6 A;  1UVU H;  4AYY B;  1S85 A;  1O2W A;  4SGB E;  1C1O A;  2G52 A;  1TNL A;  3SU5 A;  1K1I A;  2ULL A;  3V7T A;  4K5Z A;  3A85 A;  1UW7 A;  2TGD A;  3NKK A;  5GCH G;  3SNC A;  3EA9 A;  1IQJ A;  2M2A A;  1DFP A;  5FPY A;  1LPG B;  1HAG E;  2FIR H;  2UWO A;  1G3D A;  2J5U A;  1WQV H;  2LP6 A;  1SQA A;  1VKY A;  1DT2 A;  1ELE E;  1JIM A;  2EST E;  2Q6F A;  1DS2 E;  5GDS H;  3QDZ B;  2WZQ A;  4HI3 A;  3MNX A;  2A31 A;  1S82 A;  1C1N A;  3GDU A;  1VGC C;  1KTS B;  1L0Z A;  4XD7 D;  1JXP A;  1GHA F;  1C5V A;  1H8H D;  1VJ9 U;  5LPE A;  1D9I A;  4Q2K A;  2TBS A;  3FP7 E;  4JZD H;  1SB1 H;  3MOC A;  2BX4 A;  2EEK A;  2P3T B;  1P01 A;  3ZV8 A;  1LPZ B;  2YMS D;  4JYT A;  5EW2 H;  1VR1 H;  2FEQ H;  1ETS H;  2THF B;  2BMG B;  2WPI S;  5FBI A;  1GBB A;  5EJZ A;  6GCH F;  2BDI A;  4ZXY H;  2ZCK P;  1O3F A;  4WME A;  1ETR H;  4Y76 A;  3URC A;  1XKB C;  1Z6J H;  1P8V C;  4AX9 H;  1MTN B;  1PPE E;  5C5N A;  1KXD A;  3MH5 A;  1BZX E;  1G30 B;  1O3N A;  1O30 A;  2PGQ B;  1PPZ A;  1TWX B;  3QUM P;  4NSY A;  4H4F A;  2G4U A;  2OQU A;  5B6O A;  2PTN A;  5JB9 S;  1C1M A;  2BD3 A;  1A2C H;  1UTK A;  3KYF A;  1SQT A;  3A7Z A;  5GIB A;  2B8O H;  1DXP A;  1EJM A;  1O3C A;  1GJ7 B;  1UTM A;  2YMS B;  4KKD A;  5L6N H;  1LKA A;  5EXL A;  1O2P A;  2RDE A;  4OS6 A;  1L1J A;  3BIV H;  1P2K A;  1DSU A;  1JRT A;  1C5Z B;  1TBZ H;  4UFE H;  3PV5 A;  2O8U A;  4ZXX H;  1AO5 A;  1IQN A;  2PWX A;  1C5Q A;  2EY4 C;  3KCG H;  2H1U A;  2K8I A;  2Z9L A;  2ZQ1 A;  3ODF A;  1NFU A;  5KEC A;  1O0D H;  4Y7B A;  5FX5 A;  2A2X H;  3WWF A;  2OC0 A;  1DVA H;  2W7U A;  3BTW E;  1RFN A;  4BAQ B;  1GBI A;  2JET C;  2Y5F A;  3ZYE A;  4XRN A;  1SL3 A;  2OP9 A;  1NU9 A;  3SV8 A;  1CT2 E;  2OBO A;  4I86 A;  1NRR H;  5FAH A;  5EXN A;  2KCP A;  1MU8 B;  3MFJ A;  1PQ8 A;  2YNA A;  1Q31 A;  4TPY A;  4IN1 A;  1BMM H;  1KTT B;  1SGT A;  4ISH H;  5DK1 A;  1QBN A;  1HGT H;  2A45 B;  5DP8 A;  4NIY A;  2KM0 A;  1YLC A;  3PTN A;  4JK6 A;  1EOJ A;  1BJV A;  5FCK A;  2BYA X;  1GVZ A;  1KLJ H;  1GCD A;  2HNT E;  1XX9 A;  3F9F A;  1Y5U T;  3PLP A;  1YWU A;  5IYT A;  1OSS A;  3OTP A;  1EST A;  2LPR A;  1GDN A;  1YP9 A;  3QTV H;  3UOU A;  3GY4 A;  1JRS A;  4NGA H;  1MD8 A;  1BTW A;  1TRN A;  2C90 B;  2BVR H;  2Y81 A;  4F55 A;  2LEL A;  3M3V A;  1ZTK A;  2D2D A;  1TPP A;  3MH7 A;  1GJC B;  2ODY B;  1O2T A;  1H4W A;  1OWH A;  2FS9 A;  5C0T A;  4HTC H;  2DUC A;  4FET A;  2V3H H;  1QY6 A;  2VID A;  1AKS A;  1GJ6 A;  2TPI Z;  2ZO3 H;  3QWC H;  3H5C B;  2QV1 A;  2ZEB A;  1VIT H;  3KN2 A;  1OWK A;  1N8O C;  1TA6 A;  1OXG A;  3Q3X A;  5F53 A;  2ZU3 A;  2QXG A;  1VJA U;  2D8W A;  3CP7 A;  1C1U H;  3ODD A;  1K21 H;  1GBD A;  2G81 E;  3VG8 A;  1LO6 A;  1SGD E;  2ZDA H;  1HLT H;  3RXD A;  2AIQ A;  3OY5 U;  5LPR A;  3OEH D;  3RXT A;  3BG4 B;  1AUT C;  1S81 A;  1A61 H;  3MU4 A;  1SGN E;  4B76 A;  1T32 A;  1F7Z A;  3BTM E;  1FIZ A;  1GMD G;  3VGC B;  4A7I B;  1FAK H;  3R3G B;  3KID U;  1C9T A;  1RRK A;  3SV2 H;  1WYK A;  3E3T A;  3RML H;  1GWA A;  1AE5 A;  2BDB A;  4NA8 A;  3OTJ E;  3FFG A;  3S7H B;  1CA8 B;  2B0F A;  1O2J A;  3F2H A;  3BEF B;  1GBT A;  2BB4 A;  2BY5 X;  7GCH F;  1C5L H;  2AHM E;  2ZP0 H;  2A7J A;  5DSF A;  3SJK A;  4KP0 A;  2BY9 X;  1QGF A;  5HYO A;  3SZN A;  2F9U A;  4AOR A;  2OK5 A;  2SNW A;  4GPG A;  1QIX B;  1MTV A;  2GGV B;  1PQ7 A;  3Q76 A;  3T28 A;  4YM9 A;  3BTD E;  2AMD A;  4AN7 A;  4HFP B;  3NCL A;  2DE9 A;  1O2R A;  3VXE H;  3BTG E;  4XBC A;  1NBM E;  3PRB A;  1C9P A;  3HGN A;  3TH2 H;  1EAX A;  1MTN C;  1SC8 U;  3A8C A;  1HAP H;  1FN6 A;  2BDY A;  1C1Q A;  3SV7 A;  4LZ4 B;  1LTO A;  4X6N A;  2SGF E;  4GSO A;  3F9G A;  2V0B A;  3EDX B;  1SPJ A;  3MU1 A;  3U28 C;  2GX4 A;  4OS1 A;  4F48 B;  3HK3 B;  4F4O C;  1KLI H;  2YMS C;  2STA E;  2BD5 A;  3P70 B;  3T2N A;  2FI5 E;  1F5L A;  2FTL E;  5C5O A;  2GCT B;  2GCH F;  1SQR A;  2V35 A;  1C1S A;  3RU4 T;  3HKJ B;  2IN2 A;  2ASU B;  3VXF H;  1RTF B;  3C1K A;  2EQN A;  1CHG A;  2WPD D;  1ELD E;  1SR5 C;  1B0F A;  2WUC A;  2FOC A;  2R9P A;  1O36 A;  3GIC B;  1ZGI A;  4KEL A;  2WIN I;  3B23 B;  3HKI B;  1AFQ B;  2C8W B;  1E38 B;  2Z3C A;  4AG1 A;  3SU3 A;  4YOJ A;  1ANB A;  1P9S A;  1ZSK A;  2AMQ A;  4FUB A;  1TX8 A;  3M5O A;  3A7W A;  1OWD A;  2ZPQ A;  1B7X B;  1RJX B;  3SV6 A;  2PW8 H;  1GMC F;  4UFG H;  3FVF B;  1MTW A;  5F03 A;  4ISI H;  4JZI A;  3ITI A;  1AVG H;  1JIR A;  1T8N A;  1Z1I A;  5C1X A;  4WMF A;  1YCP H;  5AFY H;  4CH2 B;  2G5N A;  2TIO A;  3A87 A;  2SGD E;  1OOK B;  3OYP A;  4K1E A;  3D62 A;  1BQY A;  1UTN A;  3ZVE A;  3FAN A;  3V12 A;  2VWO A;  1DPO A;  1GCT B;  1C1R A;  3IG6 B;  5F8X A;  4CRD A;  1TX6 A;  3LGU A;  4X1P U;  2KFW A;  1BBR K;  1OS8 A;  1UVP A;  1WV7 H;  2ZIQ H;  2P95 A;  1YM0 A;  3E1X B;  3DFL A;  5GJ4 B;  1AHT H;  1S0Q A;  2PKA A;  3ZV9 A;  1SGE E;  1DLE A;  3LIW A;  4I8H A;  5LH8 A;  1IHT H;  1P2M A;  4X6O A;  2EI6 A;  2QA9 E;  1GJ4 H;  1O2I A;  1EXF A;  1YPE H;  1V6D A;  3TIT A;  4Z1M D;  5C17 A;  1N1L A;  3RXU A;  4CBO A;  3T62 A;  5EXM A;  5JBT A;  1SBW A;  3D23 A;  5EPY A;  3UWI A;  1K1L A;  5E2O A;  1IQK A;  1BA8 B;  4O9V A;  1C2G A;  3MQK C;  1FDP A;  1FPH H;  1EP5 A;  1F5K U;  2SNV A;  1D6R A;  2FYQ A;  2BY7 X;  2AGG X;  3PM3 A;  3ATK A;  4CR5 A;  2ZGX H;  2XTT B;  3BG4 C;  1LQE A;  4B1T A;  3TJN A;  2ZGH A;  1K1J A;  3LKW A;  4OGX A;  5JYI A;  3T29 A;  3GCT F;  2TGP Z;  4FUC A;  4ABB A;  2VU8 E;  3WW7 A;  2ANM H;  4NG9 H;  4O03 A;  3Q3Y A;  4AZ2 B;  1MTS A;  2OBQ A;  1FY5 A;  1PYT C;  4YOI A;  2ZPS A;  1KMH B;  4BOH A;  1BRA A;  3TVJ B;  3FAO A;  1M9U A;  1H8I H;  3TH3 H;  3BTT E;  1FNI A;  2NU1 E;  1OWJ A;  4MDS A;  4Q7Z A;  1QQU A;  2GZ7 A;  5JBA S;  3A82 A;  3O8R A;  4Y10 E;  1V2R T;  1DLK B;  4MPX A;  1TX7 A;  2BD2 A;  2VNT A;  4RN6 A;  1XUG A;  5T3H A;  3VB4 A;  2AFQ B;  4Q7X A;  3P8F A;  3K65 B;  1DX5 M;  4X2V A;  3ZZ7 A;  2J98 A;  3SJO A;  1LVY A;  3DSO A;  3SZE A;  4DT7 B;  4FUI A;  3TJV A;  4E7N A;  3QN7 A;  4U32 A;  3TU7 H;  3DT0 H;  1C5O H;  3SYJ A;  3M5N A;  1DIT H;  1GHB G;  3N99 A;  1O3P B;  1RS0 A;  2Q6G A;  4OGY A;  1DM4 B;  2ZHE H;  1ZRK A;  1TQ0 B;  1EAW A;  4KTC A;  1HNE E;  1TYN A;  4RSP A;  2A4O A;  1C1V H;  4UD9 H;  3SHC H;  4ASH A;  3FOA A;  1GL0 E;  4CRA A;  1FON A;  2XOK D;  1HDT H;  1V2P T;  1ELG A;  4ZUH A;  3DCL A;  3RP2 A;  4K1S A;  1QRW A;  1UMA H;  1HAO H;  1EAI A;  3ZVF A;  4Y79 A;  1MBM A;  4INK A;  4ABJ A;  2GCT C;  3HPT B;  1IQH A;  1HUT H;  3DSG A;  3LC3 A;  2XWA A;  1E35 B;  1GBE A;  2JJ1 D;  2VVV A;  3LC5 A;  4U2W A;  3TJO A;  3BG8 A;  4EST E;  1ZML A;  2TGA A;  1BCU H;  4MNY A;  4GAW A;  3RU4 D;  1MBQ A;  2SFA A;  1NBM D;  3ZVA A;  2J38 A;  3U69 H;  5KED A;  2HAL A;  1AFQ C;  4A92 A;  3RXJ A;  1SLW B;  2PGB B;  2A4G A;  2FLR H;  3UFA A;  1K1N A;  3S9B A;  3A8A A;  3PO1 B;  2FPZ A;  1FIW A;  4NA7 A;  3ENS B;  5DKM A;  4E06 H;  3E91 A;  2H5D A;  3GOV B;  4IS5 A;  1IOE A;  1ELA A;  2H2Z A;  1MAY A;  3A7X A;  3KYG A;  4X1N U;  2BLW A;  1O5A B;  3EST A;  3RLY H;  2GKV E;  1DE7 H;  2A5I A;  3ZVC A;  5L2Z H;  2GZ9 A;  2PKA B;  4A6L A;  1C1W H;  5E0H A;  4I8K A;  5DPA A;  1PQA A;  1O3B A;  1BHX F;  2WV9 A;  2XC5 A;  3U98 H;  3SI4 H;  2QE7 D;  5A0C A;  3TK9 A;  3FKS D;  1AU8 A;  4MG3 A;  3K2U A;  4M9F A;  1TON A;  4ZCN A;  1CBW B;  1A7S A;  4I8G A;  2ZHF H;  1QJ1 B;  1HV7 A;  1BIT A;  1YYY 1;  1CE5 A;  4ZHM U;  5ESB A;  1PFX C;  1A5G H;  4FUJ A;  1K28 D;  1MCT A;  2UWP A;  4KTS A;  1J9C H;  5BRR E;  1IQE A;  4X2Y A;  4GUX A;  2XND D;  5A0B A;  2ZU4 A;  5CMX H;  2W6J D;  4HZH A;  1TAL A;  4B2A A;  1C2I A;  1VIT G;  2NWN A;  1LMW B;  2BZA A;  4QT8 C;  1O33 A;  1GBF A;  1TNI A;  2SGA A;  2FWW A;  1NO9 H;  5EQQ A;  1BML A;  3RM0 H;  3UUZ A;  3M7U A;  2ZCL P;  5FBE A;  4DG4 A;  8GCH G;  2FX6 A;  3AAS A;  3UR6 A;  1P2N A;  2H9T H;  2ZEC A;  5GND A;  5KGO A;  2Q1J A;  5CE1 A;  1SI5 H;  2BVS H;  1NRO H;  2WV4 A;  4IMQ A;  1FY3 A;  1Z8I B;  1DUE A;  1PJP A;  4I8J A;  4I31 A;  1WBG B;  2PP6 A;  1HXE H;  3N7E A;  3QZQ A;  3SNA A;  2CGA A;  3OFN D;  3ZZ6 A;  5DP4 A;  1ZZZ A;  2BQ6 B;  3Q3K A;  3RXO A;  1P11 E;  1MKW K;  2F9V A;  5C0U A;  1O37 A;  3MH6 A;  2J98 B;  1CGI E;  3SU0 A;  3UY9 A;  2XBX A;  1P04 A;  4FU9 A;  2XBY A;  3T5F H;  1LHE H;  1UTO A;  1NFX A;  1FQ3 A;  4AG2 A;  1GI4 A;  3BSQ A;  5HXF A;  3V0X A;  4Y6D A;  1LQD B;  4B6E A;  3ZZ5 A;  3M61 U;  4WVP E;  3C27 B;  2KZ4 A;  3PWC A;  4WMD A;  5DP5 A;  4UEH H;  5HIY A;  4NZQ A;  1C5Y B;  1NC6 A;  4AYV B;  5DP6 A;  5EJ1 A;  1GBA A;  1QZ8 A;  2OC7 A;  4Y0Y E;  1YY3 A;  2ZGB H;  4XFQ A;  1ACB E;  1T31 A;  1YC0 A;  3FN8 A;  2R2M B;  3SW2 B;  5EG4 A;  2G00 A;  2ZCH P;  4YT7 H;  1ANE A;  1ID5 H;  3UR9 A;  2FMJ A;  3A86 A;  3GDV A;  1P2O A;  1TGT A;  5HGG A;  2B7D H;  1NRQ H;  2QGR A;  3F3B A;  2QF0 A;  1O5F H;  4UE7 H;  1QA7 A;  3FP6 E;  3AK5 A;  2ZGC A;  2ZPR A;  2OC8 A;  4Y8Z A;  3NXP A;  4DCD A;  1MU6 B;  2Q6D A;  3PMH B;  1GI7 B;  2J34 A;  1QBO A;  4BXS A;  1C4V 2;  4TT3 D;  1PPH E;  1E1Q D;  5FPS A;  2ZHW H;  3DA9 B;  5FX6 A; 
#chains in the Genus database with same CATH homology
 5HIY A;  5HIZ A;  2J98 A;  2J97 A;  1UW7 A;  5C94 A;  2J98 B;  3EE7 A;  1QZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...