3SNEA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (soaking)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sneA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sneA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sneA02
4DVAU 3TJVA 1A5IA 1ZMLA 2TGTA 1HIAA 1SSXA 2ZHDA 3SJKA 2Z3EA 2ZTZA 2BDYA 3RXKA 1W13U 2XWAA 2VWOA 5JB9S 1MU6B 4B74A 1C5NH 5FAHA 1XUFA 2SNWA 3SJIA 4JZFH 4B1TA 5DGJA 1EZUC 4FUHA 1YM0A 4X8UH 3V3MA 2FOCA 4MPWA 3BG4B 2BY8X 1VJ9U 4ZKSU 3SU0A 2OCVB 1SFIA 1HFDA 1GMCG 2RA0A 5JBAS 1F5KU 1NRRH 1C4Y2 1P8VC 3URDA 3ZZCA 3F1SB 3T28A 1ELVA 1ZSJA 7ESTE 1G3EA 3PO1C 1A2CH 3HK6B 3MU8A 5AHGH 1FUJA 1UCYK 2O8MA 1P2KA 2W26A 1BRCE 2A7CA 2BDBA 2EI8A 4MQAA 2BX3A 2ZWLH 2GZ8A 1D3DB 2FXRA 1SHHB 5DP6A 2FPZA 4X6PA 1YYY1 3BTKE 3P6ZB 1SG8B 1O3FA 4Y8ZA 2O8TA 2TGDA 1BRBE 2ODPA 1GI3A 2VWMA 3MO9A 2BTCE 4NCYA 5PTPA 1K1PA 4CRBA 2QAAA 1Z8GA 2YNBA 1A0HB 1HIAB 2TBSA 1AE8H 1NFXA 5E2OA 2ZGBH 3VB5A 4WMEA 2GGVB 2FP7B 3HGNA 1DT2A 1GG6C 1LHFH 5LPEA 4K1SA 1EJNA 5JDUB 1O3LA 1P57B 4BAHB 3D49H 4X1NU 1FIWA 1SGEE 3A8DA 4MTBA 4KTCA 4FVDA 3PYHA 4X0WU 2ZU1A 1GBFA 4SGBE 4FUEA 3TGJE 1QGFA 2H6MA 8KME2 2GV7A 2VH6A 4ZAEA 2QYIA 5EPNA 1TX7A 1GJBB 1GHVH 2Z9IA 1TOCB 1KYNA 1FQ3A 1Y3WA 4WVPE 3LC5A 1HV7A 3UWJH 1C1WH 3M5LA 1GI5A 4UONA 3KHVA 1CHOF 3GISB 3F9FA 2AGIX 1IQIA 3KNXA 1IQJA 4YT7H 2ZCLP 1J15A 1O2UA 2XYAA 1INCA 2TRMA 4CH2B 4UDWH 3KEEA 1N1LA 2CXVA 1AQ7A 4ZKNU 1FDPA 3UNRA 2HRVA 1MBQA 2ZHQH 3SOSA 5A0BA 1UTJA 1GHAF 3RXTA 1GJ7B 2OTVA 3HK3B 1SGQE 4AFZA 1TALA 1V2TT 1NN6A 2V3HH 3UTUH 3M36A 4H4FA 3RM2H 5DP9A 4DY7B 1GBAA 1YPGH 2V35A 1GJ8B 3QO6A 1WQVH 4Y10E 2ZG0H 3RXCA 3A80A 3FZZA 4IBLH 1VITG 1J14A 1V2WT 3ZZDA 2R3UA 1BHXB 1QURH 2QXJA 1OYTH 2XRCA 1ZGVA 2PLXA 3E3TA 1ZPZA 1ELGA 1OXGA 1ZJKA 1HCGA 1OSSA 3TJUA 1O5FH 4AFUA 4CRCA 1ETSH 1BJVA 3GYMA 1GPZA 3LC3A 4JYTA 5C2ZA 3ZV8A 1TONA 1KXAA 1LMWB 2VGCB 1UTKA 9ESTA 3MFJA 1ZHRA 3SU2A 2RDLA 5ABWA 1OOKB 3QGNB 5ESBA 4LXBH 2R9PA 6GCHF 2OC1A 1AWFH 1Q31A 1ESAA 3GCHB 1YPJH 2A4RA 1HAVA 1C5TA 3KGPA 5DKMA 1SHYA 3O8DA 2GZ9A 1AZ8A 1JRTA 1GCTC 1LKBA 1S82A 2VVCA 4VGCC 3A7WA 4YTAA 1GBMA 2FS8A 1Y5UT 2ILNA 1MCVA 1SQAA 3URCA 3LIWA 1YCPH 4AFQA 4DT7B 1FN8A 4ZUHA 4YOJA 5AF9H 2HNTC 5EOKA 1GDNA 3S69A 4NFFA 1UK2A 4ZXXH 3GICB 1MQ5A 4WY3A 5E0JA 4K8YA 2ODQA 3QK1A 1P0SH 1G9IE 2GCTB 2NU4E 1L2EA 1WSSH 2WUCA 3RXIA 4X2YA 3E6PH 2BYAX 1AO5A 1CU1A 1KTTB 1NROH 4Y0ZE 2GDDA 2C93B 5JBCS 1RJXB 3ATMA 1P10A 2P16A 1EAWA 2UUJB 2XCFA 3E16B 2HWLB 1SLXB 1MTWA 1XXDA 2ZTYA 1ANBA 2QA9E 3EA9A 1P9UA 3LGWA 1V6DA 1O2JA 4ABIA 1C1PA 5DP3A 1QRXA 1L4DA 5CHAB 3B9FH 1HAIH 1JIMA 1S6FA 1UVSH 2BZ6H 3SI3H 3KQBA 2Z9JA 2D8WA 2FMJA 1ZGIA 1W0ZU 3LH3A 2ZI2H 1PPFE 1O2IA 5L2YH 1F2SE 1LPZB 4X6MA 3RXEA 1LPGB 3B23B 4NZQA 1N6YA 3DFLA 1LO6A 1O34A 1TGSZ 2ZDLA 4UFFH 1FY8E 2HNTF 2BLQA 3K2UA 2BD4A 5GPIB 1FJSA 3U98H 2BVRH 3ZYEA 1O2RA 5TCCA 1C2DA 5JB8S 3SV6A 1HAOH 3KF2A 3SUFA 2Y5FA 6LPRA 1UVTH 4UFEH 4AYYB 2BXUH 1C1MA 1HBTH 3BV9B 2ZEBA 5T6GA 1TGBA 4AG2A 4AX9H 2JH0D 4OGXA 1H9LB 2BVXH 4U2WA 1YCPK 1O3CA 2FOEA 5DPAA 5AVDA 3ZV9A 1Z1IA 3SU5A 1C5WB 4NZLA 5FCRA 1CA0B 1GI8B 2QXHA 3E8LA 5C3NA 1GGDC 3SORA 2Y80A 3C1KA 2SNVA 1NESE 1W2KH 1GWAA 2FM2A 3A7TA 2VU8E 3S9CA 4INLA 4JK5A 2VIPA 3RXRA 3UNSA 3D62A 3ZVCA 1EUFA 1WCZA 3LPRA 2G4TA 1SLWB 1DUEA 2VIQA 3BTGE 3IITA 1P11E 4O3UA 4YLUA 2Z9GA 1ZSKA 1C2KA 1TMBH 4DIIH 1C5RA 2FI4E 2P95A 4GCHG 4QT8C 4ZH8A 2J92A 2WPIS 1NTPA 3M7UA 5EXNA 1BTYA 5GXPA 5TJXA 1KDQA 1Z6EA 4U32A 5FX5A 4O97A 1AI8H 4XBBA 1EJMA 1LKAA 1HYLA 1JOUB 1TNHA 2XXLA 2K1QA 1ZPBA 1AY6H 3BF6H 1HJ9A 2FOBA 4FVBA 1TAWA 3LGTA 2WPLS 3RXLA 2QF0A 1O3DA 1O32A 1BMLA 2CF9H 1IAUA 2ZU3A 1MTVA 1ZHMA 1KLJH 3PMJA 1SGYE 2D2DA 1P2OA 3FP7E 3OSYA 1GJDB 5EXMA 4ABBA 1HDTH 1AB9C 3ZZBA 4Y7AA 4YT6H 1MD7A 2BDAA 3U1JB 1TIOA 1TBQH 3SV9A 3SN8A 1GHBG 2OQ5A 3SQHE 1JRSA 4MPVA 2BZAA 1UCYE 4MG3A 2QXIA 2AMQA 1ARBA 3V7TA 1GI7B 3ITIA 4TYDA 1WU1A 4K5ZA 1P2MA 3MNXA 4ZXYH 1G36A 1MTNB 1TLDA 1BRUP 1ZR0A 1G3CA 2ZTXA 3RXSA 1QJ6B 1LVYA 3R0FA 6CHAC 4FUBA 1XVOA 1ARCA 4Q7XA 2ZU4A 5C5NA 1KDQB 4I8KA 7LPRA 4HZHA 4ABEA 2ZGJA 3NK8A 1L1JA 4BOHA 4IGDA 3TIUA 5C67A 4IMZA 1YLDA 5K0HA 1BTUA 4Y7BA 2FYRA 1C2JA 2FOFA 3TGIE 1D6RA 4AN7A 3GCOA 3NPSA 2BDGA 4WJG2 5HMAA 4D8NA 3SV7A 3BG8A 3LU9B 2ZU2A 2UWOA 1DS2E 2ZF0H 1AGJA 3L3TA 3M35A 2XBWA 1D3PB 2RG3A 1SGIB 4RSPA 4UD9H 1IQEA 3PMAB 3GYLB 3SGQE 3TGKE 1OP2A 2R3YA 4K3JA 1CA0C 2GP9B 3S0NA 3EYDA 4X6OA 3RXQA 3BEFB 4D76A 1RGQA 1EOLA 3QZQA 5F8XA 1L1NA 2WUBA 3LGUA 5GJ4B 4CREA 4Y8YA 1RTKA 1E36B 1DX5M 1BBRE 1TA6A 4FUGA 1L4ZA 3GY8A 1MKWH 2OBQA 3MU5A 1O3HA 1K1LA 3ZZ6A 1C5VA 1VR1H 5GCHF 3SU4A 1DICA 1BQYA 3RXPA 3U1IB 1GBHA 1MZDA 4CRGA 4IN2A 2J34A 1GHXH 2SGQE 1S84A 1XUHA 2G81E 3T26A 3BTTE 1OP0A 4WMDA 4NA7A 2ZPRA 5A2MH 1TPAE 3UR9A 2C3SA 2VIDA 1TBRH 1CGHA 4ABDA 3NUMA 1GBKA 1SC8U 1LQDB 5LH8A 2UUYA 5FXLA 1X7AC 3A7XA 4A1VA 2P8OB 1YLCA 2ZCHP 1BTPA 1F0TA 2AIPA 1UK4A 2CHAC 1N8OC 4M7GA 8GCHG 3T25A 3MU0A 3U8RH 1PYTC 4NIYA 1O3AA 2ASUB 3UR6A 1TGCA 2SGPE 3VXFH 3A82A 2DE8A 4Y8XA 1EB2A 1H9HE 1QJ1B 3MWIU 4A7IB 2TGPZ 3RC5A 4MPXA 1BA8B 4RKJB 1EAXA 1ETTH 1THPB 1C5LH 2OUAA 1AUJA 1W10U 1PPEE 2PFEA 5A8YA 5K7RA 4YZUA 2RA3A 5G4BA 1OWJA 2BHGA 5FPSA 2BD5A 2QV1A 4MNXA 1CSOE 1SGFA 1Y3VA 1LHEH 1TPOA 4X6NA 3SJ9A 3A83A 3VGCB 1O3NA 1DSUA 1LCYA 3MNSA 2J95A 2CMYA 1O5CB 3GCTG 4HFPB 2HVXA 2WPKS 1NU7B 5FPTA 3DFJA 3MH7A 2Q6GA 3O8RA 4BTUB 2VINA 1CO7E 1CT0E 1SVPA 4DIHH 2ZGCA 3QLPH 1PPZA 2O8WA 1P2NA 1GMDF 1OWDA 1O2QA 3F6UH 1ZTKA 1MKWK 1MUEB 1BBRH 2G5NA 1B0EA 1HJ8A 3JZ2B 3DD2H 1A0LA 5A8XA 2HNTE 2BQ7B 3A7VA 3MMGA 3TVJB 3RXGA 1MCTA 5FBEA 1QL9A 3MO3A 3DT0H 2SGFE 2THFB 1CE5A 2XBVA 4UFDH 2A5KA 4THNH 2ZFTA 1AVXA 1T8LA 5DP7A 2OXSA 1A0JA 1GBEA 3UPEA 2BX4A 2B7DH 1ZRBA 1TE0A 1S5SA 2PKAB 4OS5A 3ATLA 3SI4H 1G3DA 4NWLA 3MO6A 1C2LA 5F6MA 2F3CE 1TNIA 1PJPA 2BD7A 3M3TA 2PWXA 3Q3KA 1XXFA 3PMHB 2F91A 4BAQB 3E90B 4CRDA 4HTCH 1PPCE 1TNJA 2K7XA 2V6NA 3ZYDA 3QTOH 4I7YH 4ABFA 2F9BH 1QL8A 2A5AA 2W5EA 1GCDA 2JKHA 5BPEA 1K28D 4NA9H 1RXPA 4XFQA 4ISIH 3MH6A 5LGOA 1SGRE 4FU8A 5FCKA 1Q3XA 4DURA 2BXTH 1VGCC 3K6YA 2A32A 3RDZA 4GLYA 1C5OH 1FY3A 1OYQA 1T8MA 2A4QA 2F9PA 1SQTA 2GMTC 3SGAE 2V0BA 3EGKH 1ZHPA 3ZZAA 3LKWA 1BRAA 4Q2KA 1NFWA 1F92A 1VCQA 3UQOA 1W8BH 5DG6A 2AGEX 1LVOA 5HM9A 2A5IA 5FHTA 3VFEA 2FTLE 2GZ7A 3T2NA 3PM3A 1WUNH 7GCHG 1SLUB 3SHAH 2FLRH 3SW2B 2Y82A 5J4QA 1S0RA 1HAHH 1DXWA 4ZHLU 1DY8A 2C90B 1BBRK 1O0DH 2JH5D 2GT8A 1ABJH 3TK5A 3UWIA 4Q80A 4FUFA 4CHAC 2J9NA 1UVOA 1BT7A 2BDHA 2Q1JA 2WV5A 3UFAA 2VIOA 1GJ9B 1HAZB 1A7SA 1YPEH 2Q6FA 1P2IA 1O2NA 2WYJA 1V2QT 1O2HA 5IDKA 1C5MD 1SGNE 1TPSA 4X1QU 4DGJA 1HPGA 1KSNA 1NFUA 3OYPA 4IW4E 1DFPA 1O5BB 2CN0H 4AFSA 2ALVA 3A84A 4I8JA 5HGGA 1V2KT 2GCHG 1C2GA 1SL3A 1C1VH 1FY1A 5F03A 2NU0E 2AH4X 3ELAH 1SR5C 2FYQA 3T62A 2I6SA 1EASA 3O8CA 1W7GH 3QN7A 3QDZB 1C4V2 2FESH 4B76A 3BG4C 1AVGH 3A88A 1GJCB 1QA0A 2B8OH 2BY9X 2WPHS 1F0UA 1F5LA 1SMFE 2PKSB 3V12A 4O03A 3ODDA 1MKXH 1ZMNA 1IHSH 1WV7H 4A1XA 3TJNA 1H4WA 1EAUA 2EC9H 3LONA 1C1UH 1NRNH 2QN5T 1AN1E 3BTDE 5EU8A 1KLIH 1L0ZA 2PW8H 8LPRA 4PROA 1UMAH 4K2YA 1FXYA 3LGIA 1PYTD 2OLGA 2BLVA 1OPHB 3FP6E 1YF4A 2BOKA 4X2XA 1PQ7A 1HRTH 4UEHH 1T4UH 1DITH 3RC6A 1K1JA 3EBNA 2G55A 3O8BA 3GCNA 2EI6A 4Y11E 2B9LA 1A3BH 1QB1A 1W7XH 4IMQA 2A31A 1VJAU 1QBOA 2ZKSA 1MQ6A 3UNQA 1CBWB 4FUDA 3SNCA 2ZGXH 3PWBA 1KXBA 5ETXA 2ZHEH 1OX1A 1AVWA 2PTCE 1FPHH 1O2SA 4CR9A 3E0NB 1GJ4H 4X8TH 4ISHH 4OS4A 1GBTA 4ASHA 1T8NA 1O5GH 2AYWA 1VCWA 1AWHB 3MOCA 4ABJA 1L1GA 3QWCH 1GI0A 3M5MA 1D3QB 2P94A 3S7HB 2F9NA 3TITA 2R0LA 1AFEH 1AFQB 1NC6A 2OQUA 3QX5H 3MU1A 4JMYA 1IOEA 3ZVAA 1QR3E 1C2HA 3P95A 3LOXA 2FODA 1A5GH 3A8BA 3M7QA 1TOMH 2Z3CA 4B2AA 1A5HA 4WXIA 4NGAH 5F8TA 1ESBA 1NS3A 2V3OH 2BD9A 4FUCA 3MTYA 3TK9A 1VZQH 1E38B 1GL0E 1LVBA 5LPRA 1D4PB 2Y5HA 3RXMA 2PTNA 3RP2A 1MKXK 4YOIA 5BRRE 1XUGA 4Q7ZA 1GHYH 2ZDKA 1CHOG 1G30B 4YOGA 2SGEE 5JBTA 1EATA 2G8TA 2LPRA 3GOVB 1E35B 2R0KA 1FZZA 1EPTA 2QF3A 1UHBB 2STBE 1ZTLA 1XKBC 3ESTA 3PTBA 3NZIA 2AMPA 2VNTA 5CE1A 1C1SA 2OC0A 1C1NA 1FN6A 1TGTA 5FX6A 3RXFA 7KMEH 1DANH 1G37A 1O33A 1V2MT 2ZPSA 1GHAG 4FU9A 1GBCA 4ISOA 1UTOA 1C5UA 1C1RA 1XUIA 3N7OA 3E91A 1C1OA 1W3CA 1MU8B 4A6LA 3RXAA 1C5ZB 1TQ7B 4B75A 4AYVB 1TGNA 4H6TA 1MAYA 3TPIZ 5DJ7A 2VGCC 2O8UA 1MTSA 2STAE 3ZVEA 4IN1A 5C20A 4J1YA 3TLOA 2HGTH 4AOQA 2EA3A 1DLEA 2F9OA 2O8LA 1NRSH 3JZ1B 3GCHC 1AUTC 1BTZA 2ESTE 2VWNA 1BCUH 1S0QA 4CRAA 2J4IA 4JK6A 2OINA 3PB1E 5A0CA 1P3CA 2VVUA 3UOUA 1GMHF 5EG4A 1D6WA 1FLEE 1O3BA 1M9UA 4MNWA 1J16A 1V2VT 1EP5A 3BEIB 3S9AA 5DO4H 4DCDA 1O39A 1BIOA 2LIZA 2WPJS 1S83A 3BTHE 1FI8A 2G52A 2G00A 1EPTB 6GCHG 1MZAA 5HYOA 4TPIZ 1LHDH 3SUGA 2XW9A 2XTTB 3LGYA 2WV4A 5AFYH 2FI5E 4ZHAA 1BHXF 4A5TS 2GCTC 2TPIZ 2RCEA 2IPHA 1TNKA 1FONA 3GY5A 4BTIB 4JZDH 1K2I1 3FVFB 1EX3A 2GTBA 3VB3A 1BTXA 1GVLA 1ANEA 1HJAB 3BTFE 3PLKA 1WTHD 2GKVE 1ESTA 1C1QA 1K9OE 1TRMA 1AHTH 1DWEH 2ZA5A 1DWBH 1TYNA 1WBGB 3I77A 3ZVDA 1GBIA 1MMJN 2ZECA 1XX9A 2AMDA 1RIWB 1FIZA 1VITH 4KTUA 1TFXA 1QY6A 1G2MA 4NIXA 2P3UB 2XCNA 2CJIA 2KAIA 1QJ7B 1ZPCA 5CHAC 1ELEE 4YLQH 3NWUA 2GX4A 1TQ0B 1J17T 1XUKA 1G32B 1V2OT 1C5SA 1YPKH 3P70B 3ZZ4A 4Y6DA 2BDIA 1GMCF 1O2VA 4Y0YE 4D7GA 3ZZ5A 3KIDU 3RXJA 4JCNA 3L33A 2A0QB 4SGAE 2UWLA 2Z94A 2ZDAH 2ZFRH 1BOQA 3P17H 4DOQA 1KXEA 1O3OA 5AFZH 1DSTA 1QIXB 1P9SA 2ZFSA 3ZZ3A 3WY8A 3A8CA 1BMNH 3BTME 3SZNA 3FP8E 2BQWB 5E0HA 1KXCA 1JBUH 1O36A 3BIUH 1DDJA 1N6XA 1AD8H 1Z6JH 5A8ZA 2Z9LA 1H8DH 3SU1A 4B2BA 3OY6U 2QCYA 1BTHH 4AZ2B 4XBDA 4MNVA 2ZNKH 1C1TA 1ZSLA 2HALA 1OP8A 2JETB 4KGAA 2PHBA 1QCPA 2BY5X 1P2QA 3RMNH 3PO1B 1V2UT 3SJOA 4BTTB 1WAYB 2EI7A 4TY6A 1FV9A 1V2JT 4E05H 1GHWH 1O31A 1O3PB 3S7KB 3SU6A 1WYKA 2OC7A 4NA8A 1J9CH 1SOTA 2A4GA 1KIGH 1OS8A 1PPHE 2KAIB 3RXBA 5A0AE 1YKTA 1D9IA 3HATH 1EZXC 3TH2H 4LOYH 2YOLA 2XNIA 1GI6A 1GJ5H 1UTNA 3BTEE 1ANDA 4WWYA 3U8OH 3STJA 1TPPA 4UFGH 3SUDA 3D65E 1Y5BT 2FO9A 2C8YB 4GUXA 3SUEA 3ATWA 1BB0B 4B73A 3FANA 1O2ZA 1ELCA 4E7RG 1LVMA 3SO3A 4GSOA 2I6QA 3GY6A 4NWKA 4Z6AH 2BY7X 1P04A 3T29A 4F4OC 1HNEE 3A87A 1DLKB 2C4FH 2Z7FE 3KQEA 1GI2A 5EODA 5C5OA 1CA8B 2FS9A 1XVMA 1ELFA 4IC5A 1SQOA 2P93A 2HPPH 4XOJA 1IQFA 2XBXA 1O3IA 4O3TA 1D3TB 1H9IE 4WH6A 1O3JA 1BZXE 2BLOA 3A85A 4JYVH 3SV8A 4X8VH 3UIRA 1A4WH 3P8GA 1IHTH 2XC5A 3OY5U 5CMXH 1C5YB 3A7ZA 5IYTA 2W7UA 1O2WA 5E0GA 2P59A 1H8IH 2ALPA 4B2CA 4K1EA 3RMLH 2ZFFH 1PPGE 4ISLA 4ABGA 5L2ZH 1V3XA 2BOHB 3ZVGA 1GVKB 3IWMA 1GL1A 1VITF 2VIVA 1SGPE 1W14U 3RM0H 1ZLRA 4Y71A 3RXUA 1W11U 2ZO3H 2PKAA 4MPUA 3GY7A 1HAGE 2B5TB 3SBKA 3TH3H 1LDTT 4I33A 1EKBB 4MVNA 1GBDA 5GDSH 1A1RA 1P3EA 3GY3A 3AW0A 1F7ZA 2G4UA 2Z6BD 2A7HA 5EW2H 1WTGH 1C2IA 1QQUA 2ZDNA 3IG6B 1TB6H 3GY2A 1C2MA 2GT7A 1DE7H 1V2PT 5DP8A 3DA9B 3PLPA 3UOPA 3TK6A 1C2FA 3FZDA 1IQMA 2QC2A 2OD3B 5T6FA 1AKSA 1NPMA 2OC8A 1MTNC 1NT1A 1O2OA 1PPBH 1KLTA 4HGCA 3SHCH 4INKA 4I32A 2UUFB 1THSH 1UVPA 3RMMH 3UY9A 4NIVA 5EQRA 2A4OA 3BSQA 5JBBS 1TMTH 3M7TA 1DUAA 4NSVA 1IQGA 4X8SH 3U8TH 3PROA 2FTMA 3F9GA 4OGYA 1MBMA 4FXGH 1A3EH 1NFYA 3UQVA 4CR5A 2FOMB 1TBZH 2VH0A 3Q77A 3RU4T 1GJAB 4LK4A 4BAKB 3EE0B 4E06H 2CV3A 1H1BA 1ABIH 3RXVA 4KKDA 1XMNB 3RXDA 1O5AB 2ZP0H 3P8OA 1E34B 1EJAA 4YO9A 1Z8RA 2P3FH 4JZIA 4CRFA 2JETC 2ZHWH 1GCTB 3M5NA 3EQ0H 4VGCB 2ZC9H 4R8TB 4X1SU 3AAUA 4TY7A 1QNJA 3PWCA 4TWWA 2FX6A 4K69A 3KQCA 4Z0KA 3T27A 4UE7H 3BTWE 2BY6X 1UVUH 4ABAA 1FPCH 1B5GH 3MH5A 2OBOA 1AZZA 1AKSB 5C1UA 1IQHA 3BTQE 4AGKA 1CQQA 1XKAC 4NG9H 2ZQ1A 5DP4A 3U9AH 3LDXH 2BLWA 2W3KA 4I8HA 2AGGX 3BIVH 3FAOA 2ZFQH 2A7JA 1HUTH 2XBYA 3NKKA 4XBCA 3GDSA 2HPQH 3P8FA 3M37A 1W0YH 1HXFH 2IOTA 4ZMAH 2PUXB 4ABHA 2UWPA 1BMMH 1ZMJA 5T6DA 1DVAH 3T5FH 1BJUA 5DP5A 2B0FA 1RTLA 3BEUA 1SBWA 3A7YA 8ESTE 1SB1H 2R2MB 2PGBB 2P8OC 1HXEH 1C5XB 1FNIA 1V2RT 2H9EH 2XC4A 2LNCA 5GCHG 1Y3YA 1DPOA 1K21H 1SOZA 3CP7A 2BB4A 1J8AA 2IN2A 4LZ1H 4ZROA 2AS9A 1VCPA 1HAPH 5LPFA 2GDEH 3I78A 1SPJA 1IQNA 3RU4E 1CGJE 3V13A 1NZQH 1GI4A 4AG1A 1YPHE 1FMGA 2H9TH 1Z8IB 1GDQA 3K6ZA 1O37A 1T32A 4OS1A 4NFEA 4K8BA 2FX4A 3ZZ8A 1OWKA 1OKXA 4OS6A 1GBLA 1T8OA 1JIRA 1P2JA 1NM6A 4INHA 2D1JA 1K22H 1O3KA 1B7XB 2BD8A 1ANCA 3S9BA 3VGCC 3QGJA 4KP0A 3Q00A 5T3HA 4JYUH 5EQSA 1JMOH 4OS7A 2Z3DA 4WF8A 1HGTH 1K1IA 1FAXA 2QIQA 1AU8A 1BUIA 4H6SB 2AIQA 5L30H 1YC0A 1GI1A 4O9VA 4BAOB 1G2LA 2VIWA 1ZJDA 1LHCH 1GGDB 2FZZA 3E0PB 1LPKB 1NY22 2FOGA 5GIBA 1W12U 1ZZZA 2ANMH 4GCHF 1ID5H 1CHGA 3UREA 5I25A 5L6NH 1MAXA 3AAVA 4BAMB 3F9EA 3H7OA 2ZDMA 2BQ6B 3EA7A 3HPTB 1QA7A 2P3TB 1JWTA 1TX6A 4WH8A 2FIRH 3OU0A 1OWEA 1QTFA 2Z9KA 1F5RA 2PUQH 5J4SA 4H42U 4XE4A 1EZQA 1P09A 2XWBI 4ZKRU 4JZEH 1TMUH 4RN6A 2VB0A 3GY4A 4ZHMU 3STIA 3OX7U 3HKJB 1RFNA 3RLWH 4CH8B 5EQQA 2J38A 1QB6A 1GMDG 3SV2H 3Q3XA 1A61H 1MH0A 1E0FD 4TWYA 1IQKA 1UTMA 2EEKA 2ZFPH 1Y59T 1O2XA 5ESTE 3ZVFA 2Y81A 4AORA 2QGRA 4B71A 1OWHA 2H1UA 1GHBF 5I46H 4ISNA 1XM1A 1UTQA 1ETRH 1Z7KA 2BD3A 4KELA 1S6HA 2PR3A 3NCLA 2ZU5A 4GHQA 1ELAA 1AIXH 3R3GB 3W95A 1UHBA 2BD2A 1O2PA 4E7NA 3NXPA 4I31A 1ZTJA 2PGQB 5JYIA 2XC0A 2Y7ZA 1AB9B 1GHZA 2WPMS 5B6OA 1Y8TA 4I8LA 1FAKH 1SI5H 3K9XB 1Y3XA 1ZRKA 1KY9A 3ENSB 1GVZA 1ELTA 3OTJE 1O3GA 1O3EA 1KTSB 2CGAA 3VXEH 4D9QA 3SQEE 5SGAE 1Q2WA 4R0IA 3SNDA 1ZYOA 2SFAA 1HB0B 3TNSA 1DY9A 1HAVB 3HKIB 2Q6DA 4YM9A 5H4IB 3AVZA 2C8XB 1O2LA 2ZCKP 2H9HA 6CHAB 1C9PA 1NRQH 1YPMH 1WQSA 2A1DB 1BITA 4AB8A 1A46H 1MD8A 4BNRA 3ATKA 1K1OA 4JZ1A 3AW1A 1CGIE 1C5QA 2NU2E 3I29A 4DW2U 4A1TA 4X2VA 1EQ9A 3GDUA 6ESTA 2HOBA 3SNAA 1TX8A 3LJOA 3MH4A 4MLFB 4Y76A 4OS2A 2FDAA 2Y6TA 1Z8JB 1YPHC 4J2YB 1TABE 5EPYA 2ANWA 2ZDVH 4GVUA 3TJOA 1Z1JA 1F0SA 3SNBA 4BXSA 1QL7A 1SGCA 2W3IA 1QB9A 1K1NA 1K1MA 2FWWA 4WXVA 2GV6A 2ZIQH 2GVFA 2F9VA 2FEQH 3SGBE 3D23A 3ZZ7A 1HAYB 2NU1E 1TA2A 3L6PA 2DE9A 1O38A 4D7FA 1IQLA 5F8ZA 5GWZA 1SFQB 1DOJA 4X1RU 1QRZA 1EP6A 2D26C 2PKSC 4BXWA 1V2LT 3EDXB 2WINI 2ZPQA 2TIOA 4RKOB 8GCHF 1ACBE 1Y3UA 2TGAA 2AFQB 1CT4E 3ODFA 4GAWA 1DWDH 1UJ1A 1TRYA 1RTFB 3HGPA 2BMGB 5TCAA 3RMOH 3MNBA 2OP9A 3U69H 3GDVA 1GBBA 2QXGA 4F49A 2HLCA 2ODYB 3A8AA 3A81A 4NSYA 3VB4A 2GD4B 1S85A 1FY5A 2VJ1A 1RD3B 2FOAA 2WYGA 3RLYH 3TH4H 1LQEA 4ZKOU 2ANYA 5C1XA 3EA8A 2CHAB 2ZHFH 1N8OB 4IS5A 2A2XH 4K1TA 1QQ4A 1T4VH 1TRNA 1QBVH 5HM2A 1WOFA 1CBWC 1QHRB 1V2NT 3H5CB 3DHKH 1DM4B 1O2GH 3PLBA 4GHTA 2PSXA 4KTSA 1E37B 1Y5AT 3GCTF 3AASA 2FOHA 2W7SA 4XSKU 4WMFA 4A92A 1C4U2 1GDUA 4AB9A 4HI3A 1FY4A 4K60A 2CF8H 1UTLM 2SGAA 2PV9B 3DUXH 3MNCA 1S81A 3QTVH 1RS0A 1O2MA 5EXLA 1EXFA 1PQ5A 3VEQB 1AFQC 2BDCA 4LZ4B 3SJ8A 4NIWA 1TWXB 2BVSH 1O5EH 3K65B 4I8GA 1QRWA 4FU7A 1O2YA 4BANB 3B8JA 1NRPH 1UO6A 2H2ZA 2ULLA 2J2UA 1C2EA 3KCGH 2F9UA 2A2QH 1B0FA 1KXFA 3H7TA 1P06A 1O5DH 3CENA 3TNTA 1RRKA 1TNLA 3VB6A 1MTUA 1GI9B 3CS0A 1P03A 2IJOB 1GBJA 4MDSA 4ESTE 3C27B 1EB1H 3MHWU 3TU7H 3CS7A 1JXPA 2J94A 5E2PA 3V0XA 2R2WU 3RXOA 3PTNA 3KQDA 1GJ6A 1YCPM 4IC6A 1UTPA 1QBNA 1SGFG 1PFXC 3RC4A 1TNGA 1KXDA 1ORFA 3UUZA 9LPRA 1SLVB 3QUMP 4X2WA 5E8EH 4MNYA 3F9HA 1YBWA 1PQAA 1AE5A 3G01A 1SGDE 3LT3A 2F83A 3SNEA 1Z71A 4Q7YA 2C8WB 3W94A 4U30A 1EAIA 4X1PU 1T31A 5EGMA 3P8NA 1P05A 3Q76A 5EW1H 2ANKH 1UK3A 1GG6B 1LHGH 1V2ST 2Y5GA 1HLTH 2G5VA 4TPYA 4DG4A 2FLBH 3LGVA 3MU4A 1HAXB 2O9QA 3ATIA 2AEIH 3LH1A 1NO9H 3A86A 1BMAA 1ELBA 3LJJA 2BM2A 7GCHF 3MI4A 2PSYA 1VGCB 1YPLH 3ZZ9A 3RUOA 2M5TA 5FPYA 2ZZUH 4CBNA 3PMBB 2ZGHA 4FUJA 1THRH 1CT2E 1EOJA 1CVWH 2NU3E 2VWLA 3E1XB 3QZRA 1NU9A 2GMTB 3PV4A 4FUIA 2NWNA 1EZSC 1QFKH 3EAJA 1YGCH 4AGJA 1UCYH 1C5PA 4GPGA 1P12E 1O2KA 1EPTC 2UUKB 1OWIA 3M61U 4Y79A 3VB7A 1LTOA 2DUCA 1P01A 2AERH 4U01A 3M3VA 2C8ZB 2JH6D 5HXFA 1GMHG 1BTWA 1O2TA 1ELDE 1F0RA 3Q3YA 3ZVBA 1YP9A 1AMHA 2Y7XA 1O30A 3F68H 4DJZB 1HJAC 1SGTA 3RU4D 5C1YA 2VVVA 2GCHF 1T7CA 3FFGA 4D9RA 2SGDE 4CHAB 4XDEA 2QY0B 3P92A 3SU3A 5A09A 1DXPA 5JPMH 1RIWC 1BDAA 1XUJA 2FI3E 2ZQ2A 1O35A 3M3SA 3M5OA 3MYWA 2G51A 1C9TA 1P02A 1PQ8A 3A89A 1O3MA 1G3BA 3KN2A 3KL6A 3VPKA 4CBOA 5DK1A 1ZOMA 2H5CA 3BN9A 2A45B 2H5DA 2YNAA 5FBIA 4YESB 1DWCH 1U6QA 3RXHA
chains in the Genus database with same CATH superfamily
4DVAU 3TJVA 1A5IA 1ZMLA 2TGTA 1HIAA 1SSXA 2ZHDA 3SJKA 2Z3EA 2ZTZA 2BDYA 3RXKA 1W13U 2XWAA 2VWOA 5JB9S 1MU6B 4B74A 1C5NH 5FAHA 1XUFA 2SNWA 3SJIA 4JZFH 4B1TA 5DGJA 1EZUC 4FUHA 1MABB 1YM0A 4X8UH 3V3MA 2FOCA 4MPWA 3BG4B 2BY8X 1VJ9U 4ZKSU 3SU0A 2OCVB 1SFIA 1HFDA 1GMCG 2RA0A 5JBAS 1F5KU 1NRRH 1C4Y2 1P8VC 3URDA 3ZZCA 3F1SB 3T28A 1ELVA 1ZSJA 7ESTE 1G3EA 3PO1C 1WXRA 1A2CH 3HK6B 3MU8A 5AHGH 1FUJA 1UCYK 2O8MA 1P2KA 2W26A 1BRCE 2A7CA 2BDBA 2EI8A 4MQAA 2BX3A 2ZWLH 4P00A 2GZ8A 1D3DB 2FXRA 1SHHB 5DP6A 2FPZA 4X6PA 1YYY1 3BTKE 3P6ZB 1SG8B 1O3FA 4Y8ZA 2O8TA 2TGDA 1BRBE 2ODPA 1GI3A 2VWMA 3MO9A 2BTCE 4NCYA 5PTPA 1K1PA 4CRBA 2QAAA 1Z8GA 2YNBA 1A0HB 1HIAB 2TBSA 1AE8H 1NFXA 5E2OA 2ZGBH 3VB5A 4WMEA 2GGVB 2FP7B 3HGNA 1DT2A 1GG6C 1LHFH 5LPEA 4K1SA 1EJNA 5JDUB 2LP6A 5C17A 1O3LA 1P57B 4BAHB 3D49H 4X1NU 1FIWA 1SGEE 3A8DA 4MTBA 4KTCA 4FVDA 3PYHA 1W0KD 2L74A 4X0WU 2ZU1A 1GBFA 4SGBE 4FUEA 5DSFA 3TGJE 1QGFA 2H6MA 8KME2 2HVYB 2GV7A 2VH6A 4ZAEA 2QYIA 5EPNA 1TX7A 1GJBB 1GHVH 2Z9IA 1TOCB 1KYNA 1FQ3A 1Y3WA 4WVPE 3LC5A 1HV7A 2JDID 1C1WH 3UWJH 3M5LA 1GI5A 4UONA 3KHVA 1CHOF 3GISB 3F9FA 2AGIX 1IQIA 3KNXA 1IQJA 4YT7H 2ZCLP 1J15A 1O2UA 2XYAA 3F3BA 1INCA 2TRMA 4CH2B 4UDWH 3KEEA 1N1LA 2CXVA 1AQ7A 4ZKNU 1FDPA 3UNRA 2HRVA 1MBQA 2ZHQH 4HG6A 3SOSA 5A0BA 1UTJA 1GHAF 3RXTA 1GJ7B 2OTVA 3HK3B 1SGQE 5FL7D 4AFZA 1TALA 1V2TT 1NN6A 2V3HH 3UTUH 3M36A 4H4FA 3RM2H 5DP9A 4DY7B 1GBAA 1YPGH 2V35A 1GJ8B 3QO6A 1WQVH 4Y10E 2ZG0H 3RXCA 3A80A 3FZZA 4IBLH 1VITG 1J14A 1V2WT 3ZZDA 3FN8A 2R3UA 1BHXB 4TSFD 1QURH 2QXJA 1OYTH 2XRCA 1ZGVA 2RDEA 2PLXA 3E3TA 1ZPZA 1ELGA 1OXGA 1ZJKA 1HCGA 1OSSA 3TJUA 1O5FH 4AFUA 4CRCA 1ETSH 1BJVA 3GYMA 1GPZA 3LC3A 4JYTA 5C2ZA 3ZV8A 1TONA 1KXAA 1LMWB 2VGCB 1UTKA 9ESTA 3MFJA 1ZHRA 3SU2A 2RDLA 5ABWA 1OOKB 3QGNB 5ESBA 2V7QD 4LXBH 2R9PA 2WZQA 6GCHF 2OC1A 1AWFH 1Q31A 1ESAA 3GCHB 3FKSD 1YPJH 2YMSC 2A4RA 1HAVA 4B6FA 1C5TA 3KGPA 5DKMA 1SHYA 3O8DA 2GZ9A 1AZ8A 1JRTA 1GCTC 1LKBA 1S82A 2VVCA 3KQ5A 4VGCC 3A7WA 4YTAA 1GBMA 2FS8A 1Y5UT 2ILNA 1MCVA 1SQAA 2OK5A 3URCA 3LIWA 1YCPH 4AFQA 4DT7B 1FN8A 4ZUHA 4YOJA 5AF9H 2HNTC 5EOKA 1GDNA 3S69A 4NFFA 1UK2A 4ZXXH 3GICB 1MQ5A 4WY3A 5E0JA 4K8YA 2ODQA 3QK1A 1P0SH 1G9IE 2GCTB 2NU4E 1L2EA 1WSSH 2WUCA 3RXIA 4X2YA 3E6PH 2BYAX 1AO5A 1CU1A 1KTTB 1NROH 4Y0ZE 2W6ID 2GDDA 2C93B 5JBCS 1RJXB 3ATMA 1P10A 2P16A 1EAWA 2UUJB 2XCFA 3GS9A 3E16B 2HWLB 1SLXB 1MTWA 1XXDA 2ZTYA 1ANBA 2QA9E 3EA9A 1P9UA 3LGWA 1V6DA 1O2JA 4ABIA 1C1PA 5DP3A 1QRXA 1L4DA 5CHAB 3B9FH 1HAIH 1JIMA 1S6FA 1UVSH 2BZ6H 3SI3H 3KQBA 2Z9JA 2D8WA 2FMJA 1ZGIA 1W0ZU 3LH3A 2ZI2H 1PPFE 1O2IA 5L2YH 1F2SE 1LPZB 4X6MA 3RXEA 1LPGB 3B23B 4NZQA 1N6YA 3DFLA 1LO6A 1O34A 1TGSZ 2ZDLA 4UFFH 1FY8E 2HNTF 2BLQA 3K2UA 2BD4A 5GPIB 3DSPA 1FJSA 5T1VA 3U98H 2BVRH 3ZYEA 1O2RA 5TCCA 1C2DA 5JB8S 3SV6A 1HAOH 3KF2A 3SUFA 2Y5FA 6LPRA 1UVTH 4UFEH 4AYYB 2BXUH 1C1MA 1HBTH 3BV9B 2ZEBA 5T6GA 1TGBA 4ASUD 4AG2A 4AX9H 2JH0D 4OGXA 1H9LB 2BVXH 4U2WA 1YCPK 1O3CA 2FOEA 5DPAA 5AVDA 3ZV9A 1Z1IA 3SU5A 1C5WB 4NZLA 5FCRA 1CA0B 1GI8B 2QXHA 3E8LA 5C3NA 1GGDC 4DT4A 3SORA 4RT1A 2Y80A 3C1KA 2SNVA 1NESE 1W2KH 1GWAA 2FM2A 3A7TA 2VU8E 3S9CA 4INLA 4JK5A 2VIPA 5EIYA 3RXRA 3UNSA 4AC9A 3D62A 3ZVCA 5C0UA 1EUFA 1WCZA 3LPRA 2G4TA 1SLWB 1DUEA 2VIQA 3BTGE 3IITA 1P11E 4O3UA 4YLUA 2Z9GA 1ZSKA 2XOKD 1C2KA 1TMBH 4DIIH 1C5RA 2FI4E 2KCPA 2P95A 4GCHG 4QT8C 4ZH8A 2J92A 2WPIS 1NTPA 3M7UA 5EXNA 1BTYA 5GXPA 5TJXA 1KDQA 1Z6EA 4U32A 5FX5A 3UB0A 4O97A 1AI8H 4XBBA 1EJMA 1LKAA 1HYLA 1JOUB 1TNHA 2XXLA 2K1QA 1ZPBA 1AY6H 3BF6H 1HJ9A 2FOBA 3OAAD 4FVBA 1TAWA 3LGTA 2WPLS 3RXLA 2QF0A 1O3DA 1O32A 1BMLA 2CF9H 1IAUA 2ZU3A 1MTVA 1ZHMA 1KLJH 3PMJA 1SGYE 2D2DA 1P2OA 3FP7E 3OSYA 5C0TA 1GJDB 5EXMA 4ABBA 1HDTH 1AB9C 3ZZBA 4Y7AA 4YT6H 1MD7A 2BDAA 2QF5A 5DN6D 3U1JB 1TIOA 1TBQH 3SV9A 3SN8A 1GHBG 2OQ5A 3SQHE 1JRSA 4MPVA 2BZAA 1UCYE 4MG3A 2QXIA 2AMQA 1ARBA 3V7TA 2AHME 1GI7B 3ITIA 4TYDA 1WU1A 4K5ZA 1P2MA 3MNXA 4ZXYH 1G36A 1MTNB 1TLDA 1BRUP 1ZR0A 1G3CA 2ZTXA 3OFND 3RXSA 1QJ6B 1LVYA 3R0FA 6CHAC 4FUBA 1XVOA 1ARCA 4Q7XA 2ZU4A 5C5NA 1KDQB 4I8KA 7LPRA 4HZHA 4ABEA 2ZGJA 3NK8A 1L1JA 4BOHA 4IGDA 3TIUA 5C67A 4IMZA 1YLDA 5K0HA 1BTUA 2QE7D 4Y7BA 2FYRA 1C2JA 2FOFA 3TGIE 1D6RA 4AN7A 3GCOA 3NPSA 2BDGA 4WJG2 5HMAA 4D8NA 3SV7A 3BG8A 3LU9B 2ZU2A 2UWOA 1DS2E 2ZF0H 1AGJA 3L3TA 3N7EA 3M35A 2XBWA 1D3PB 2RG3A 1SGIB 4RSPA 4UD9H 1IQEA 3PMAB 3GYLB 3SGQE 3TGKE 1OP2A 2R3YA 4K3JA 1CA0C 2GP9B 3S0NA 3EYDA 4X6OA 3RXQA 1YY3A 3BEFB 4D76A 1RGQA 1EOLA 3QZQA 5F8XA 1L1NA 2WUBA 3LGUA 5GJ4B 4CREA 4Y8YA 2KCYA 1RTKA 1E36B 1DX5M 1BBRE 1TA6A 4FUGA 1L4ZA 3GY8A 1MKWH 2OBQA 3MU5A 1O3HA 1K1LA 3SYJA 1C5VA 1VR1H 5GCHF 3SU4A 3ZZ6A 1DICA 1BQYA 3RXPA 3U1IB 1GBHA 1MZDA 4CRGA 4IN2A 2J34A 1GHXH 2SGQE 1S84A 1XUHA 2G81E 3T26A 3BTTE 1OP0A 4WMDA 4NA7A 2ZPRA 5A2MH 1TPAE 3UR9A 2C3SA 2VIDA 1TBRH 1CGHA 4ABDA 3NUMA 1GBKA 1SC8U 1LQDB 5LH8A 1QZ8A 2UUYA 5FXLA 1X7AC 3A7XA 4A1VA 2P8OB 1YLCA 2ZCHP 1BTPA 1F0TA 2AIPA 1UK4A 1S6LA 2CHAC 1N8OC 4M7GA 8GCHG 3T25A 3MU0A 3U8RH 1PYTC 4NIYA 1O3AA 2ASUB 3UR6A 1TGCA 2SGPE 3VXFH 3A82A 2DE8A 4Y8XA 1EB2A 1H9HE 1QJ1B 3MWIU 4A7IB 2TGPZ 3RC5A 4MPXA 1BA8B 4RKJB 1EAXA 1ETTH 2VBCA 1THPB 1C5LH 2OUAA 1AUJA 1W10U 1PPEE 2PFEA 5A8YA 5K7RA 4YZUA 2RA3A 5G4BA 1OWJA 2BHGA 5FPSA 2BD5A 2QV1A 4MNXA 1CSOE 1SGFA 1Y3VA 5EJLA 1LHEH 1TPOA 2GJGA 4X6NA 1EFRD 3SJ9A 2J98A 3A83A 3VGCB 1O3NA 1DSUA 1LCYA 3MNSA 2J95A 2CMYA 2JJ1D 1O5CB 3GCTG 4HFPB 2HVXA 2WPKS 1NU7B 5FPTA 3DFJA 3MH7A 2Q6GA 3O8RA 4BTUB 2VINA 1CO7E 1CT0E 1SVPA 4DIHH 2ZGCA 3QLPH 1PPZA 2O8WA 1P2NA 1GMDF 1OWDA 1YWUA 1O2QA 2KM0A 3F6UH 1ZTKA 2W6JD 5IK2D 1MKWK 1MUEB 1BBRH 2G5NA 1B0EA 1HJ8A 3JZ2B 3DD2H 1A0LA 5A8XA 2HNTE 2BQ7B 3A7VA 3MMGA 3TVJB 3RXGA 1MCTA 5FBEA 1QL9A 3MO3A 3DT0H 2SGFE 2THFB 1CE5A 2XBVA 4UFDH 2A5KA 4THNH 2ZFTA 1AVXA 1T8LA 5DP7A 2OXSA 1A0JA 1GBEA 3UPEA 2BX4A 2B7DH 1ZRBA 1TE0A 1S5SA 2PKAB 4OS5A 3ATLA 3SI4H 1G3DA 4NWLA 3MO6A 1C2LA 5F6MA 2F3CE 1TNIA 1PJPA 3WWFA 2BD7A 2J98B 3M3TA 2PWXA 3Q3KA 3CNRA 2KCOA 1XXFA 3PMHB 2F91A 4BAQB 3E90B 4CRDA 4HTCH 1PPCE 1TNJA 2K7XA 2WHXA 2V6NA 3ZYDA 3QTOH 4I7YH 4ABFA 2F9BH 1QL8A 4YXWD 2A5AA 2W5EA 1GCDA 2JKHA 5BPEA 1K28D 4NA9H 1RXPA 4XFQA 4ISIH 3MH6A 5LGOA 1SGRE 4FU8A 5FCKA 1Q3XA 4DURA 2BXTH 1VGCC 3K6YA 2A32A 3RDZA 4GLYA 1C5OH 1FY3A 1OYQA 1T8MA 2A4QA 2F9PA 1SQTA 4M9FA 2GMTC 3SGAE 2V0BA 3EGKH 1ZHPA 3ZZAA 3LKWA 1BRAA 4Q2KA 1NFWA 1F92A 1VCQA 3UQOA 1W8BH 5DG6A 2AGEX 3AK5A 1LVOA 5HM9A 2A5IA 5FHTA 3VFEA 2FTLE 2GZ7A 3T2NA 3PM3A 3FO8D 1WUNH 7GCHG 3DSOA 1SLUB 4I86A 3SHAH 2FLRH 3SW2B 2Y82A 5J4QA 1S0RA 1HAHH 1DXWA 4ZHLU 1DY8A 2C90B 1BBRK 1O0DH 2JH5D 2GT8A 1ABJH 3TK5A 3UWIA 4Q80A 4FUFA 4CHAC 2J9NA 1UVOA 1BT7A 4ZCNA 2BDHA 2Q1JA 2WV5A 3UFAA 2VIOA 1GJ9B 1HAZB 1A7SA 1YPEH 2Q6FA 1P2IA 1O2NA 2WYJA 1V2QT 1O2HA 5IDKA 1C5MD 1SGNE 1TPSA 4X1QU 4DGJA 1HPGA 1KSNA 1NFUA 3OYPA 4IW4E 1DFPA 1O5BB 2CN0H 3U28C 4AFSA 2ALVA 3A84A 4I8JA 5HGGA 1V2KT 2GCHG 1E1RD 1C2GA 1SL3A 1C1VH 1FY1A 5F03A 2NU0E 2AH4X 3ELAH 1SR5C 2FYQA 3T62A 2I6SA 1EASA 4B6EA 3O8CA 3SZEA 1W7GH 2IJD1 3QN7A 3QDZB 1C4V2 2FESH 4B76A 3BG4C 1AVGH 3A88A 1GJCB 1QA0A 2B8OH 2BY9X 2WPHS 1F0UA 1F5LA 1SMFE 2PKSB 3V12A 4O03A 3ODDA 1MKXH 1ZMNA 1IHSH 1WV7H 4A1XA 3TJNA 1H4WA 1EAUA 2EC9H 3LONA 1C1UH 1NRNH 2QN5T 5EJZA 1AN1E 3BTDE 5EU8A 1KLIH 1L0ZA 2PW8H 8LPRA 4PROA 3F0PA 1UMAH 4K2YA 1FXYA 3LGIA 1PYTD 2OLGA 2BLVA 1OPHB 3FP6E 1YF4A 2BOKA 4X2XA 1PQ7A 1HRTH 4UEHH 1T4UH 3UAIC 1DITH 3RC6A 1K1JA 4RI0A 3EBNA 2G55A 3O8BA 3GCNA 2EI6A 4Y11E 2B9LA 1A3BH 1QB1A 1W7XH 4IMQA 2A31A 1VJAU 1QBOA 2ZKSA 1MQ6A 3UNQA 1CBWB 4FUDA 3SNCA 2ZGXH 3PWBA 1KXBA 5ETXA 2ZHEH 1OX1A 1AVWA 2PTCE 4FETA 1FPHH 1O2SA 4CR9A 3E0NB 1GJ4H 4X8TH 4ISHH 4OS4A 1GBTA 4ASHA 3WWBA 1T8NA 1O5GH 2AYWA 1VCWA 1AWHB 3MOCA 4ABJA 1L1GA 3QWCH 1GI0A 3M5MA 1D3QB 2P94A 3S7HB 2F9NA 3TITA 2R0LA 2WPDD 1AFEH 1AFQB 1NC6A 2OQUA 3QX5H 3MU1A 4JMYA 1IOEA 3ZVAA 1QR3E 1C2HA 3P95A 3LOXA 2FODA 1A5GH 2KFWA 4ACBA 3A8BA 3M7QA 1TOMH 2Z3CA 4B2AA 1A5HA 4WXIA 4NGAH 5F8TA 1ESBA 1NS3A 2V3OH 2BD9A 4FUCA 3MTYA 3TK9A 1VZQH 1E38B 1GL0E 1LVBA 5LPRA 1D4PB 2Y5HA 2KR7A 3RXMA 2PTNA 3RP2A 1MKXK 4YOIA 5BRRE 1XUGA 4Q7ZA 1GHYH 2ZDKA 1CHOG 1G30B 2EY4C 4YOGA 2SGEE 5JBTA 1EATA 2G8TA 2LPRA 3GOVB 1E35B 2R0KA 1FZZA 1EPTA 2QF3A 1UHBB 2STBE 1ZTLA 1XKBC 3ESTA 3PTBA 3WW7A 3NZIA 2AMPA 2VNTA 5CE1A 1C1SA 2OC0A 1C1NA 1FN6A 1TGTA 5FX6A 3OEHD 3RXFA 7KMEH 1DANH 1G37A 1O33A 1V2MT 2ZPSA 1GHAG 4FU9A 1GBCA 4ISOA 1UTOA 1C5UA 1C1RA 1XUIA 3N7OA 4RT0A 3E91A 1C1OA 1W3CA 1MU8B 4A6LA 3RXAA 1C5ZB 1TQ7B 4B75A 4AYVB 1TGNA 4H6TA 1MAYA 3TPIZ 5DJ7A 2VGCC 2O8UA 1MTSA 2STAE 3ZVEA 3FOAA 4IN1A 5C20A 4J1YA 3TLOA 3N99A 2HGTH 3F0OA 4AOQA 2EA3A 1DLEA 2F9OA 2O8LA 1NRSH 3JZ1B 3GCHC 1AUTC 1BTZA 2ESTE 2VWNA 1BCUH 1S0QA 4CRAA 2J4IA 4JK6A 2OINA 3PB1E 5A0CA 1P3CA 2QF4A 2VVUA 3EE7A 3UOUA 1GMHF 5EG4A 1D6WA 1FLEE 1O3BA 1M9UA 4MNWA 1J16A 1V2VT 1EP5A 3BEIB 3S9AA 3ZIAD 4DCDA 1O39A 5DO4H 1BIOA 2LIZA 5F53A 2WPJS 1S83A 3BTHE 1FI8A 2G52A 2G00A 1EPTB 3PRDA 6GCHG 1MZAA 5HYOA 4TPIZ 1LHDH 3OTPA 3SUGA 2XW9A 2XTTB 3LGYA 2WV4A 5AFYH 2FI5E 4ZHAA 1BHXF 4A5TS 2GCTC 2TPIZ 2RCEA 2IPHA 1TNKA 1FONA 3GY5A 4BTIB 4JZDH 1K2I1 2WSSD 3FVFB 1EX3A 2GTBA 3VB3A 1BTXA 1GVLA 1ANEA 1HJAB 2IPQX 3BTFE 3PLKA 1WTHD 2GKVE 1ESTA 1C1QA 1TRMA 1K9OE 1AHTH 2V3MA 1DWEH 2ZA5A 1DWBH 1TYNA 1WBGB 3I77A 3N7DA 3ZVDA 1GBIA 1MMJN 5KEDA 2ZECA 3PV5A 1XX9A 2AMDA 1RIWB 1FIZA 1VITH 4KTUA 1TFXA 1QY6A 1G2MA 4NIXA 2P3UB 2XCNA 2CJIA 2KAIA 1QJ7B 1ZPCA 5CHAC 1ELEE 4YLQH 3NWUA 2GX4A 1TQ0B 1J17T 1XUKA 1G32B 1V2OT 1C5SA 1YPKH 3P70B 3ZZ4A 4Y6DA 2BDIA 1GMCF 1O2VA 4Y0YE 4D7GA 3ZZ5A 3KIDU 3RXJA 4JCNA 3L33A 2A0QB 4SGAE 2UWLA 2Z94A 2YMSD 2ZDAH 2ZFRH 1BOQA 3P17H 4DOQA 1KXEA 2JIZD 1O3OA 5AFZH 1DSTA 1QIXB 1P9SA 2ZFSA 3ZZ3A 3WY8A 3A8CA 1BMNH 3BTME 3SZNA 3FP8E 2BQWB 5E0HA 1KXCA 1JBUH 1O36A 3BIUH 1DDJA 1N6XA 1AD8H 1Z6JH 5A8ZA 2Z9LA 1H8DH 3SU1A 4B2BA 3OY6U 2QCYA 1BTHH 3F2FA 4AZ2B 4XBDA 4MNVA 2ZNKH 1C1TA 1ZSLA 2HALA 1OP8A 2JETB 4KGAA 2PHBA 3OEED 1QCPA 2BY5X 1P2QA 3RMNH 3PO1B 1V2UT 3SJOA 4BTTB 1WAYB 2EI7A 4TY6A 1FV9A 1V2JT 4E05H 4F48B 3F2HA 1GHWH 1O31A 1O3PB 3S7KB 3SU6A 1WYKA 2OC7A 4NA8A 1J9CH 1SOTA 2A4GA 1KIGH 1OS8A 1PPHE 2J97A 2KAIB 3RXBA 5A0AE 1YKTA 1D9IA 3HATH 1EZXC 3TH2H 4LOYH 2YOLA 2XNIA 1GI6A 1GJ5H 1UTNA 3BTEE 1ANDA 4WWYA 3U8OH 3STJA 1W0JD 1TPPA 4UFGH 3SUDA 3D65E 1Y5BT 2FO9A 2C8YB 4GUXA 3SUEA 3ATWA 1BB0B 4B73A 3FANA 1O2ZA 1ELCA 4E7RG 1LVMA 3SO3A 4GSOA 2I6QA 3GY6A 4NWKA 1KMHB 4Z6AH 2BY7X 1P04A 3T29A 4F4OC 1HNEE 3A87A 1DLKB 2C4FH 2Z7FE 3KQEA 1GI2A 5EODA 5C5OA 1CA8B 2FS9A 1XVMA 1ELFA 4IC5A 1SQOA 2P93A 2HPPH 4XOJA 1IQFA 2XBXA 1O3IA 4O3TA 1D3TB 1H9IE 3DCLA 4WH6A 1O3JA 1BZXE 2BLOA 5C94A 3A85A 4JYVH 3SV8A 4X8VH 1NBME 1A4WH 3P8GA 3UIRA 1IHTH 2XC5A 3OY5U 5CMXH 1C5YB 3A7ZA 5IYTA 2W7UA 1O2WA 5E0GA 3PV2A 2P59A 1H8IH 2ALPA 4B2CA 4K1EA 3RMLH 2ZFFH 1PPGE 4ISLA 4ABGA 5L2ZH 1V3XA 2BOHB 3ZVGA 1GVKB 3IWMA 1GL1A 1VITF 2VIVA 3VG8A 1SGPE 1W14U 3RM0H 2F4LA 1ZLRA 4Y71A 3RXUA 1W11U 2ZO3H 2PKAA 4MPUA 3GY7A 1HAGE 2B5TB 3SBKA 3TH3H 1LDTT 4I33A 1EKBB 4MVNA 1GBDA 5GDSH 1A1RA 4TT3D 1P3EA 3GY3A 3AW0A 1F7ZA 2G4UA 2Z6BD 2A7HA 5EW2H 1WTGH 1C2IA 1QQUA 2ZDNA 3IG6B 1TB6H 3GY2A 1C2MA 2GT7A 1DE7H 1V2PT 2JJ2D 5DP8A 3DA9B 3PLPA 3UOPA 3TK6A 1C2FA 3FZDA 1IQMA 2QC2A 2OD3B 5T6FA 1AKSA 1NPMA 2OC8A 1MTNC 1NT1A 1O2OA 1PPBH 1KLTA 4HGCA 3SHCH 4INKA 4I32A 2UUFB 1THSH 1UVPA 3RMMH 3UY9A 4NIVA 5EQRA 2A4OA 3BSQA 5JBBS 1TMTH 1H8HD 3M7TA 1DUAA 4ACAA 4NSVA 1IQGA 4X8SH 3U8TH 3PROA 2FTMA 3F9GA 4OGYA 1MBMA 4FXGH 1A3EH 1NFYA 2K0QA 3UQVA 4CR5A 2FOMB 1TBZH 2VH0A 3Q77A 3RU4T 1GJAB 4LK4A 4BAKB 3EE0B 4E06H 2CV3A 1H1BA 1ABIH 3RXVA 4KKDA 1XMNB 3RXDA 1O5AB 2YMSB 2ZP0H 3P8OA 1E34B 1EJAA 4YO9A 1Z8RA 2P3FH 4JZIA 4CRFA 2JETC 2ZHWH 1GCTB 3M5NA 3EQ0H 4VGCB 2ZC9H 4R8TB 4X1SU 3AAUA 4TY7A 1QNJA 3PWCA 4TWWA 2FX6A 4K69A 3KQCA 4Z0KA 3T27A 1BMFD 4UE7H 1K0HA 3BTWE 2BY6X 1UVUH 4ABAA 1FPCH 1E1QD 2LELA 1B5GH 3MH5A 2OBOA 1AZZA 1AKSB 5C1UA 1IQHA 3BTQE 4AGKA 1CQQA 1XKAC 4NG9H 2ZQ1A 5DP4A 3U9AH 2HLDD 3LDXH 2BLWA 2W3KA 4XRNA 4I8HA 2AGGX 3BIVH 3FAOA 2ZFQH 2A7JA 1HUTH 2XBYA 3NKKA 4XBCA 3GDSA 2HPQH 3P8FA 3M37A 1W0YH 1HXFH 2IOTA 4ZMAH 2PUXB 4ABHA 2UWPA 1BMMH 1ZMJA 5T6DA 1DVAH 3T5FH 1BJUA 5DP5A 2B0FA 1RTLA 3BEUA 1SBWA 3A7YA 8ESTE 1SB1H 2R2MB 2PGBB 2P8OC 1HXEH 1C5XB 1FNIA 1V2RT 2H9EH 2XC4A 2LNCA 5GCHG 1Y3YA 1DPOA 1K21H 1SOZA 3CP7A 2BB4A 1J8AA 2IN2A 4LZ1H 4ZROA 5KGOA 2AS9A 1VCPA 1HAPH 5LPFA 2GDEH 3I78A 1SPJA 1IQNA 3OE7D 1CGJE 3RU4E 3V13A 1NZQH 1GI4A 4AG1A 1YPHE 1FMGA 2H9TH 1Z8IB 1GDQA 3K6ZA 1O37A 1T32A 4OS1A 4NFEA 4K8BA 2FX4A 3ZZ8A 1OWKA 1OKXA 4OS6A 1GBLA 1T8OA 1JIRA 1P2JA 1NM6A 4INHA 2D1JA 1K22H 1O3KA 1B7XB 2BD8A 1SKYE 1ANCA 1SQRA 3S9BA 3VGCC 3QGJA 4KP0A 3Q00A 5T3HA 4JYUH 5EQSA 1JMOH 4OS7A 2Z3DA 4WF8A 1HGTH 1K1IA 5HIYA 1FAXA 2QIQA 1AU8A 1BUIA 4H6SB 2AIQA 5L30H 1YC0A 1GI1A 4O9VA 4BAOB 1G2LA 2KCAA 2VIWA 1ZJDA 1LHCH 1GGDB 2FZZA 3E0PB 1LPKB 1NY22 2FOGA 5GIBA 1W12U 1ZZZA 2ANMH 4GCHF 1ID5H 1CHGA 3UREA 5I25A 5L6NH 1MAXA 3AAVA 4BAMB 3F9EA 3H7OA 2ZDMA 2BQ6B 3EA7A 3HPTB 1QA7A 2P3TB 1JWTA 1TX6A 2CK3D 2FIRH 3OU0A 4WH8A 1OWEA 1QTFA 2Z9KA 1F5RA 2PUQH 5J4SA 4H42U 4XE4A 1EZQA 1P09A 2XWBI 4ZKRU 4JZEH 1TMUH 4RN6A 2VB0A 3GY4A 4ZHMU 3STIA 1WDIA 3OX7U 3HKJB 1RFNA 3RLWH 4CH8B 5EQQA 2J38A 1QB6A 1GMDG 3SV2H 3Q3XA 1A61H 1MH0A 1E0FD 4TWYA 1IQKA 1UTMA 2EEKA 2ZFPH 5HIZA 1Y59T 1O2XA 5ESTE 3ZVFA 2Y81A 4AORA 2QGRA 4B71A 5GNDA 1OWHA 2H1UA 1GHBF 5I46H 4ISNA 1XM1A 1UTQA 1ETRH 1Z7KA 2BD3A 4KELA 3NRLA 1S6HA 2PR3A 3NCLA 2ZU5A 4GHQA 1ELAA 1AIXH 3R3GB 3W95A 1UHBA 2BD2A 1O2PA 4E7NA 3NXPA 4I31A 1ZTJA 1H8ED 2PGQB 5JYIA 2XC0A 2Y7ZA 4F55A 1AB9B 1GHZA 2WPMS 5B6OA 1Y8TA 4I8LA 5CDFE 1FAKH 1SI5H 3K9XB 1Y3XA 1ZRKA 1KY9A 3ENSB 1GVZA 1ELTA 3OTJE 1FX0B 1O3GA 1O3EA 1KTSB 2CGAA 3VXEH 2J5UA 4D9QA 2L6OA 3SQEE 4Q4LA 5SGAE 1Q2WA 4R0IA 4OM9A 3SNDA 1ZYOA 2SFAA 1HB0B 3TNSA 1DY9A 1HAVB 3HKIB 2Q6DA 4YM9A 5H4IB 3AVZA 2C8XB 1O2LA 2ZCKP 2H9HA 6CHAB 1C9PA 1NRQH 1YPMH 1WQSA 2A1DB 1BITA 4AB8A 1A46H 1MD8A 4BNRA 3ATKA 1K1OA 4JZ1A 3AW1A 1CGIE 1C5QA 2NU2E 5EJ1A 3I29A 4DW2U 4A1TA 4X2VA 1EQ9A 3GDUA 4Q63A 6ESTA 2HOBA 3SNAA 1TX8A 3LJOA 3MH4A 4MLFB 4Y76A 4OS2A 2FDAA 1VKYA 2Y6TA 1Z8JB 1YPHC 4J2YB 1TABE 5EPYA 2ANWA 2ZDVH 4GVUA 3TJOA 1Z1JA 1F0SA 2WV9A 3MQKC 3SNBA 4BXSA 1QL7A 1SGCA 2W3IA 1YLNA 1QB9A 1K1NA 1K1MA 2M2AA 2FWWA 4WXVA 2GV6A 2ZIQH 2GVFA 2F9VA 2FEQH 3SGBE 3D23A 3ZZ7A 1HAYB 2NU1E 1TA2A 2XNDD 3L6PA 2DE9A 1O38A 4D7FA 1IQLA 5F8ZA 5GWZA 1SFQB 1DOJA 4X1RU 1QRZA 1EP6A 2D26C 2PKSC 4BXWA 1V2LT 3EDXB 2WINI 2ZPQA 2TIOA 4RKOB 8GCHF 1ACBE 1Y3UA 2TGAA 2AFQB 1CT4E 3ODFA 4GAWA 1DWDH 1UJ1A 1TRYA 1RTFB 3HGPA 2BMGB 5TCAA 2F43B 3RMOH 3MNBA 2OP9A 3U69H 3GDVA 1GBBA 2QXGA 4F49A 2RFKC 2HLCA 2ODYB 3A8AA 3A81A 4NSYA 3VB4A 2GD4B 5B6LA 1S85A 1FY5A 2VJ1A 1RD3B 2FOAA 2WYGA 3RLYH 3TH4H 1LQEA 4ZKOU 2ANYA 5C1XA 3EA8A 2CHAB 1NBMD 1N8OB 2ZHFH 2A2XH 4IS5A 4K1TA 1QQ4A 1T4VH 1TRNA 1QBVH 5HM2A 1WOFA 1CBWC 1QHRB 1V2NT 3H5CB 3DHKH 1DM4B 1O2GH 3PLBA 4GHTA 2PSXA 4KTSA 1E37B 1Y5AT 3GCTF 5KECA 3AASA 2FOHA 2W7SA 4XSKU 4WMFA 4A92A 1C4U2 1GDUA 4AB9A 4HI3A 1FY4A 4K60A 2CF8H 3KYGA 1UTLM 2SGAA 2PV9B 3DUXH 3MNCA 1S81A 3QTVH 1RS0A 1O2MA 5EXLA 1EXFA 1PQ5A 3VEQB 1AFQC 2BDCA 4LZ4B 3SJ8A 4NIWA 1TWXB 2BVSH 1O5EH 3K65B 4I8GA 1QRWA 4FU7A 1O2YA 4BANB 3B8JA 1NRPH 1UO6A 1COWD 2H2ZA 2ULLA 2J2UA 1C2EA 3KCGH 2F9UA 2A2QH 1B0FA 1KXFA 3H7TA 1P06A 1O5DH 3CENA 3TNTA 1RRKA 1TNLA 3VB6A 1MTUA 1GI9B 3CS0A 1P03A 2IJOB 1GBJA 4MDSA 4ESTE 3C27B 1EB1H 3MHWU 3TU7H 3CS7A 1JXPA 2J94A 5E2PA 3V0XA 2R2WU 3RXOA 3PTNA 5CHBA 3KQDA 1GJ6A 1YCPM 1OHHD 3KYFA 4IC6A 1UTPA 1QBNA 1SGFG 1PFXC 3RC4A 1TNGA 1KXDA 1ORFA 2K8IA 3UUZA 9LPRA 1SLVB 3QUMP 4X2WA 5E8EH 4MNYA 3F9HA 1YBWA 2PP6A 1PQAA 4Z1MD 1AE5A 3G01A 1SGDE 3LT3A 2F83A 3SNEA 1Z71A 4Q7YA 2C8WB 3W94A 4U30A 1EAIA 4X1PU 1T31A 5EGMA 3P8NA 1P05A 3Q76A 5EW1H 2ANKH 1UK3A 1GG6B 1LHGH 1V2ST 2Y5GA 1HLTH 2G5VA 4TPYA 3PRBA 4DG4A 2FLBH 2KZ4A 3LGVA 3MU4A 1HAXB 2O9QA 3ATIA 2AEIH 3LH1A 1NO9H 3A86A 1BMAA 1ELBA 3LJJA 2BM2A 7GCHF 1E79D 3MI4A 2PSYA 1VGCB 1YPLH 3ZZ9A 3RUOA 1UW7A 2M5TA 5FPYA 2ZZUH 4CBNA 3H09A 3PMBB 2ZGHA 4FUJA 1THRH 1CT2E 1EOJA 1CVWH 2NU3E 2VWLA 3E1XB 3QZRA 1NU9A 2GMTB 3PV4A 4FUIA 2NWNA 1EZSC 1QFKH 3EAJA 1YGCH 4AGJA 1UCYH 1C5PA 4XD7D 4GPGA 1P12E 1O2KA 1EPTC 2UUKB 1OWIA 3M61U 4Y79A 3VB7A 1LTOA 2DUCA 1P01A 2AERH 4U01A 3M3VA 2C8ZB 2EQNA 2JH6D 5HXFA 1GMHG 1BTWA 1O2TA 1ELDE 1F0RA 3Q3YA 3ZVBA 1YP9A 1AMHA 2Y7XA 4P02A 1O30A 3F68H 4DJZB 1HJAC 1SGTA 3RU4D 5C1YA 5HKKD 4FOUC 2VVVA 2GCHF 1T7CA 3FFGA 4D9RA 2SGDE 4CHAB 4XDEA 2QY0B 3P92A 3SU3A 5A09A 1DXPA 5JPMH 2KX4A 1RIWC 1BDAA 1XUJA 2FI3E 2ZQ2A 3W1EA 1O35A 3M3SA 3M5OA 3MYWA 2G51A 1C9TA 1P02A 1PQ8A 3A89A 3DSGA 1O3MA 1G3BA 3KN2A 3KL6A 3VPKA 4CBOA 5DK1A 1ZOMA 2H5CA 3BN9A 2A45B 2H5DA 3F2GA 2YNAA 5FBIA 4YESB 1DWCH 1U6QA 3RXHA
chains in the Genus database with same CATH topology
4DVAU 3TJVA 1A5IA 1ZMLA 2TGTA 1HIAA 1SSXA 2ZHDA 3SJKA 2Z3EA 2ZTZA 2BDYA 3RXKA 1W13U 2XWAA 2VWOA 5JB9S 1MU6B 4B74A 1C5NH 5FAHA 1XUFA 2SNWA 3SJIA 4JZFH 4B1TA 5DGJA 1EZUC 4FUHA 1YM0A 4X8UH 3V3MA 2FOCA 4MPWA 3BG4B 2BY8X 1VJ9U 4ZKSU 3SU0A 2OCVB 1SFIA 1HFDA 1GMCG 2RA0A 5JBAS 1F5KU 1NRRH 1C4Y2 1P8VC 3URDA 3ZZCA 3F1SB 3T28A 1ELVA 1ZSJA 7ESTE 1G3EA 3PO1C 1A2CH 3HK6B 3MU8A 5AHGH 1FUJA 1UCYK 2O8MA 1P2KA 2W26A 1BRCE 2A7CA 2BDBA 2EI8A 4MQAA 2BX3A 2ZWLH 2GZ8A 1D3DB 2FXRA 1SHHB 5DP6A 2FPZA 4X6PA 1YYY1 3BTKE 3P6ZB 1SG8B 1O3FA 4Y8ZA 2O8TA 2TGDA 1BRBE 2ODPA 1GI3A 2VWMA 3MO9A 2BTCE 4NCYA 5PTPA 1K1PA 4CRBA 2QAAA 1Z8GA 2YNBA 1A0HB 1HIAB 2TBSA 1AE8H 1NFXA 5E2OA 2ZGBH 3VB5A 4WMEA 2GGVB 2FP7B 3HGNA 1DT2A 1GG6C 1LHFH 5LPEA 4K1SA 1EJNA 5JDUB 1O3LA 1P57B 4BAHB 3D49H 4X1NU 1FIWA 1SGEE 3A8DA 4MTBA 4KTCA 4FVDA 3PYHA 4X0WU 2ZU1A 1GBFA 4SGBE 4FUEA 3TGJE 1QGFA 2H6MA 8KME2 2GV7A 2VH6A 4ZAEA 2QYIA 5EPNA 1TX7A 1GJBB 1GHVH 2Z9IA 1TOCB 1KYNA 1FQ3A 1Y3WA 4WVPE 3LC5A 1HV7A 3UWJH 1C1WH 3M5LA 1GI5A 4UONA 3KHVA 1CHOF 3GISB 3F9FA 2AGIX 1IQIA 3KNXA 1IQJA 4YT7H 2ZCLP 1J15A 1O2UA 2XYAA 1INCA 2TRMA 4CH2B 4UDWH 3KEEA 1N1LA 2CXVA 1AQ7A 4ZKNU 1FDPA 3UNRA 2HRVA 1MBQA 2ZHQH 3SOSA 5A0BA 1UTJA 1GHAF 3RXTA 1GJ7B 2OTVA 3HK3B 1SGQE 4AFZA 1TALA 1V2TT 1NN6A 2V3HH 3UTUH 3M36A 4H4FA 3RM2H 5DP9A 4DY7B 1GBAA 1YPGH 2V35A 1GJ8B 3QO6A 1WQVH 4Y10E 2ZG0H 3RXCA 3A80A 3FZZA 4IBLH 1VITG 1J14A 1V2WT 3ZZDA 2R3UA 1BHXB 1QURH 2QXJA 1OYTH 2XRCA 1ZGVA 2PLXA 3E3TA 1ZPZA 1ELGA 1OXGA 1ZJKA 1HCGA 1OSSA 3TJUA 1O5FH 4AFUA 4CRCA 1ETSH 1BJVA 3GYMA 1GPZA 3LC3A 4JYTA 5C2ZA 3ZV8A 1TONA 1KXAA 1LMWB 2VGCB 1UTKA 9ESTA 3MFJA 1ZHRA 3SU2A 2RDLA 5ABWA 1OOKB 3QGNB 5ESBA 4LXBH 2R9PA 6GCHF 2OC1A 1AWFH 1Q31A 1ESAA 3GCHB 1YPJH 2A4RA 1HAVA 1C5TA 3KGPA 5DKMA 1SHYA 3O8DA 2GZ9A 1AZ8A 1JRTA 1GCTC 1LKBA 1S82A 2VVCA 4VGCC 3A7WA 4YTAA 1GBMA 2FS8A 1Y5UT 2ILNA 1MCVA 1SQAA 3URCA 3LIWA 1YCPH 4AFQA 4DT7B 1FN8A 4ZUHA 4YOJA 5AF9H 2HNTC 5EOKA 1GDNA 3S69A 4NFFA 1UK2A 4ZXXH 3GICB 1MQ5A 4WY3A 5E0JA 4K8YA 2ODQA 3QK1A 1P0SH 1G9IE 2GCTB 2NU4E 1L2EA 1WSSH 2WUCA 3RXIA 4X2YA 3E6PH 2BYAX 1AO5A 1CU1A 1KTTB 1NROH 4Y0ZE 2GDDA 2C93B 5JBCS 1RJXB 3ATMA 1P10A 2P16A 1EAWA 2UUJB 2XCFA 3E16B 2HWLB 1SLXB 1MTWA 1XXDA 2ZTYA 1ANBA 2QA9E 3EA9A 1P9UA 3LGWA 1V6DA 1O2JA 4ABIA 1C1PA 5DP3A 1QRXA 1L4DA 5CHAB 3B9FH 1HAIH 1JIMA 1S6FA 1UVSH 2BZ6H 3SI3H 3KQBA 2Z9JA 2D8WA 2FMJA 1ZGIA 1W0ZU 3LH3A 2ZI2H 1PPFE 1O2IA 5L2YH 1F2SE 1LPZB 4X6MA 3RXEA 1LPGB 3B23B 4NZQA 1N6YA 3DFLA 1LO6A 1O34A 1TGSZ 2ZDLA 4UFFH 1FY8E 2HNTF 2BLQA 3K2UA 2BD4A 5GPIB 1FJSA 3U98H 2BVRH 3ZYEA 1O2RA 5TCCA 1C2DA 5JB8S 3SV6A 1HAOH 3KF2A 3SUFA 2Y5FA 6LPRA 1UVTH 4UFEH 4AYYB 2BXUH 1C1MA 1HBTH 3BV9B 2ZEBA 5T6GA 1TGBA 4AG2A 4AX9H 2JH0D 4OGXA 1H9LB 2BVXH 4U2WA 1YCPK 1O3CA 2FOEA 5DPAA 5AVDA 3ZV9A 1Z1IA 3SU5A 1C5WB 4NZLA 5FCRA 1CA0B 1GI8B 2QXHA 3E8LA 5C3NA 1GGDC 3SORA 2Y80A 3C1KA 2SNVA 1NESE 1W2KH 1GWAA 2FM2A 3A7TA 2VU8E 3S9CA 4INLA 4JK5A 2VIPA 3RXRA 3UNSA 3D62A 3ZVCA 1EUFA 1WCZA 3LPRA 2G4TA 1SLWB 1DUEA 2VIQA 3BTGE 3IITA 1P11E 4O3UA 4YLUA 2Z9GA 1ZSKA 1C2KA 1TMBH 4DIIH 1C5RA 2FI4E 2P95A 4GCHG 4QT8C 4ZH8A 2J92A 2WPIS 1NTPA 3M7UA 5EXNA 1BTYA 5GXPA 5TJXA 1KDQA 1Z6EA 4U32A 5FX5A 4O97A 1AI8H 4XBBA 1EJMA 1LKAA 1HYLA 1JOUB 1TNHA 2XXLA 2K1QA 1ZPBA 1AY6H 3BF6H 1HJ9A 2FOBA 4FVBA 1TAWA 3LGTA 2WPLS 3RXLA 2QF0A 1O3DA 1O32A 1BMLA 2CF9H 1IAUA 2ZU3A 1MTVA 1ZHMA 1KLJH 3PMJA 1SGYE 2D2DA 1P2OA 3FP7E 3OSYA 1GJDB 5EXMA 4ABBA 1HDTH 1AB9C 3ZZBA 4Y7AA 4YT6H 1MD7A 2BDAA 3U1JB 1TIOA 1TBQH 3SV9A 3SN8A 1GHBG 2OQ5A 3SQHE 1JRSA 4MPVA 2BZAA 1UCYE 4MG3A 2QXIA 2AMQA 1ARBA 3V7TA 1GI7B 3ITIA 4TYDA 1WU1A 4K5ZA 1P2MA 3MNXA 4ZXYH 1G36A 1MTNB 1TLDA 1BRUP 1ZR0A 1G3CA 2ZTXA 3RXSA 1QJ6B 1LVYA 3R0FA 6CHAC 4FUBA 1XVOA 1ARCA 4Q7XA 2ZU4A 5C5NA 1KDQB 4I8KA 7LPRA 4HZHA 4ABEA 2ZGJA 3NK8A 1L1JA 4BOHA 4IGDA 3TIUA 5C67A 4IMZA 1YLDA 5K0HA 1BTUA 4Y7BA 2FYRA 1C2JA 2FOFA 3TGIE 1D6RA 4AN7A 3GCOA 3NPSA 2BDGA 4WJG2 5HMAA 4D8NA 3SV7A 3BG8A 3LU9B 2ZU2A 2UWOA 1DS2E 2ZF0H 1AGJA 3L3TA 3M35A 2XBWA 1D3PB 2RG3A 1SGIB 4RSPA 4UD9H 1IQEA 3PMAB 3GYLB 3SGQE 3TGKE 1OP2A 2R3YA 4K3JA 1CA0C 2GP9B 3S0NA 3EYDA 4X6OA 3RXQA 3BEFB 4D76A 1RGQA 1EOLA 3QZQA 5F8XA 1L1NA 2WUBA 3LGUA 5GJ4B 4CREA 4Y8YA 1RTKA 1E36B 1DX5M 1BBRE 1TA6A 4FUGA 1L4ZA 3GY8A 1MKWH 2OBQA 3MU5A 1O3HA 1K1LA 3ZZ6A 1C5VA 1VR1H 5GCHF 3SU4A 1DICA 1BQYA 3RXPA 3U1IB 1GBHA 1MZDA 4CRGA 4IN2A 2J34A 1GHXH 2SGQE 1S84A 1XUHA 2G81E 3T26A 3BTTE 1OP0A 4WMDA 4NA7A 2ZPRA 5A2MH 1TPAE 3UR9A 2C3SA 2VIDA 1TBRH 1CGHA 4ABDA 3NUMA 1GBKA 1SC8U 1LQDB 5LH8A 2UUYA 5FXLA 1X7AC 3A7XA 4A1VA 2P8OB 1YLCA 2ZCHP 1BTPA 1F0TA 2AIPA 1UK4A 2CHAC 1N8OC 4M7GA 8GCHG 3T25A 3MU0A 3U8RH 1PYTC 4NIYA 1O3AA 2ASUB 3UR6A 1TGCA 2SGPE 3VXFH 3A82A 2DE8A 4Y8XA 1EB2A 1H9HE 1QJ1B 3MWIU 4A7IB 2TGPZ 3RC5A 4MPXA 1BA8B 4RKJB 1EAXA 1ETTH 1THPB 1C5LH 2OUAA 1AUJA 1W10U 1PPEE 2PFEA 5A8YA 5K7RA 4YZUA 2RA3A 5G4BA 1OWJA 2BHGA 5FPSA 2BD5A 2QV1A 4MNXA 1CSOE 1SGFA 1Y3VA 1LHEH 1TPOA 4X6NA 3SJ9A 3A83A 3VGCB 1O3NA 1DSUA 1LCYA 3MNSA 2J95A 2CMYA 1O5CB 3GCTG 4HFPB 2HVXA 2WPKS 1NU7B 5FPTA 3DFJA 3MH7A 2Q6GA 3O8RA 4BTUB 2VINA 1CO7E 1CT0E 1SVPA 4DIHH 2ZGCA 3QLPH 1PPZA 2O8WA 1P2NA 1GMDF 1OWDA 1O2QA 3F6UH 1ZTKA 1MKWK 1MUEB 1BBRH 2G5NA 1B0EA 1HJ8A 3JZ2B 3DD2H 1A0LA 5A8XA 2HNTE 2BQ7B 3A7VA 3MMGA 3TVJB 3RXGA 1MCTA 5FBEA 1QL9A 3MO3A 3DT0H 2SGFE 2THFB 1CE5A 2XBVA 4UFDH 2A5KA 4THNH 2ZFTA 1AVXA 1T8LA 5DP7A 2OXSA 1A0JA 1GBEA 3UPEA 2BX4A 2B7DH 1ZRBA 1TE0A 1S5SA 2PKAB 4OS5A 3ATLA 3SI4H 1G3DA 4NWLA 3MO6A 1C2LA 5F6MA 2F3CE 1TNIA 1PJPA 2BD7A 3M3TA 2PWXA 3Q3KA 1XXFA 3PMHB 2F91A 4BAQB 3E90B 4CRDA 4HTCH 1PPCE 1TNJA 2K7XA 2V6NA 3ZYDA 3QTOH 4I7YH 4ABFA 2F9BH 1QL8A 2A5AA 2W5EA 1GCDA 2JKHA 5BPEA 1K28D 4NA9H 1RXPA 4XFQA 4ISIH 3MH6A 5LGOA 1SGRE 4FU8A 5FCKA 1Q3XA 4DURA 2BXTH 1VGCC 3K6YA 2A32A 3RDZA 4GLYA 1C5OH 1FY3A 1OYQA 1T8MA 2A4QA 2F9PA 1SQTA 2GMTC 3SGAE 2V0BA 3EGKH 1ZHPA 3ZZAA 3LKWA 1BRAA 4Q2KA 1NFWA 1F92A 1VCQA 3UQOA 1W8BH 5DG6A 2AGEX 1LVOA 5HM9A 2A5IA 5FHTA 3VFEA 2FTLE 2GZ7A 3T2NA 3PM3A 1WUNH 7GCHG 1SLUB 3SHAH 2FLRH 3SW2B 2Y82A 5J4QA 1S0RA 1HAHH 1DXWA 4ZHLU 1DY8A 2C90B 1BBRK 1O0DH 2JH5D 2GT8A 1ABJH 3TK5A 3UWIA 4Q80A 4FUFA 4CHAC 2J9NA 1UVOA 1BT7A 2BDHA 2Q1JA 2WV5A 3UFAA 2VIOA 1GJ9B 1HAZB 1A7SA 1YPEH 2Q6FA 1P2IA 1O2NA 2WYJA 1V2QT 1O2HA 5IDKA 1C5MD 1SGNE 1TPSA 4X1QU 4DGJA 1HPGA 1KSNA 1NFUA 3OYPA 4IW4E 1DFPA 1O5BB 2CN0H 4AFSA 2ALVA 3A84A 4I8JA 5HGGA 1V2KT 2GCHG 1C2GA 1SL3A 1C1VH 1FY1A 5F03A 2NU0E 2AH4X 3ELAH 1SR5C 2FYQA 3T62A 2I6SA 1EASA 3O8CA 1W7GH 3QN7A 3QDZB 1C4V2 2FESH 4B76A 3BG4C 1AVGH 3A88A 1GJCB 1QA0A 2B8OH 2BY9X 2WPHS 1F0UA 1F5LA 1SMFE 2PKSB 3V12A 4O03A 3ODDA 1MKXH 1ZMNA 1IHSH 1WV7H 4A1XA 3TJNA 1H4WA 1EAUA 2EC9H 3LONA 1C1UH 1NRNH 2QN5T 1AN1E 3BTDE 5EU8A 1KLIH 1L0ZA 2PW8H 8LPRA 4PROA 1UMAH 4K2YA 1FXYA 3LGIA 1PYTD 2OLGA 2BLVA 1OPHB 3FP6E 1YF4A 2BOKA 4X2XA 1PQ7A 1HRTH 4UEHH 1T4UH 1DITH 3RC6A 1K1JA 3EBNA 2G55A 3O8BA 3GCNA 2EI6A 4Y11E 2B9LA 1A3BH 1QB1A 1W7XH 4IMQA 2A31A 1VJAU 1QBOA 2ZKSA 1MQ6A 3UNQA 1CBWB 4FUDA 3SNCA 2ZGXH 3PWBA 1KXBA 5ETXA 2ZHEH 1OX1A 1AVWA 2PTCE 1FPHH 1O2SA 4CR9A 3E0NB 1GJ4H 4X8TH 4ISHH 4OS4A 1GBTA 4ASHA 1T8NA 1O5GH 2AYWA 1VCWA 1AWHB 3MOCA 4ABJA 1L1GA 3QWCH 1GI0A 3M5MA 1D3QB 2P94A 3S7HB 2F9NA 3TITA 2R0LA 1AFEH 1AFQB 1NC6A 2OQUA 3QX5H 3MU1A 4JMYA 1IOEA 3ZVAA 1QR3E 1C2HA 3P95A 3LOXA 2FODA 1A5GH 3A8BA 3M7QA 1TOMH 2Z3CA 4B2AA 1A5HA 4WXIA 4NGAH 5F8TA 1ESBA 1NS3A 2V3OH 2BD9A 4FUCA 3MTYA 3TK9A 1VZQH 1E38B 1GL0E 1LVBA 5LPRA 1D4PB 2Y5HA 3RXMA 2PTNA 3RP2A 1MKXK 4YOIA 5BRRE 1XUGA 4Q7ZA 1GHYH 2ZDKA 1CHOG 1G30B 4YOGA 2SGEE 5JBTA 1EATA 2G8TA 2LPRA 3GOVB 1E35B 2R0KA 1FZZA 1EPTA 2QF3A 1UHBB 2STBE 1ZTLA 1XKBC 3ESTA 3PTBA 3NZIA 2AMPA 2VNTA 5CE1A 1C1SA 2OC0A 1C1NA 1FN6A 1TGTA 5FX6A 3RXFA 7KMEH 1DANH 1G37A 1O33A 1V2MT 2ZPSA 1GHAG 4FU9A 1GBCA 4ISOA 1UTOA 1C5UA 1C1RA 1XUIA 3N7OA 3E91A 1C1OA 1W3CA 1MU8B 4A6LA 3RXAA 1C5ZB 1TQ7B<