3SNEA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (soaking)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sneA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sneA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sneA02
2BQ6B 2AMPA 4KELA 4YOGA 1KLJH 2PKAA 1BJVA 1GJ9B 1RTLA 1UO6A 3LH1A 1U6QA 5EPNA 3LU9B 1AZZA 3RXGA 3UR6A 1GL0E 1C5MD 1BTXA 2HNTF 2H5CA 3UQVA 3TH3H 3RU4T 1BHXB 3QX5H 2VU8E 9ESTA 3SGQE 4BXSA 1JIMA 3QGJA 1O2ZA 3IWMA 4LZ1H 2Y5GA 2C8WB 3NKKA 3NXPA 1QRXA 1XM1A 3M35A 1XUFA 1GJDB 1YPJH 1LKAA 3CP7A 1EQ9A 1HAVB 3RXSA 2OC0A 4ISOA 1SGDE 1GVZA 4AYVB 1K22H 4TPYA 5FHTA 3BTGE 1KXBA 2THFB 4JZDH 2BXUH 3RU4E 1YPMH 3GYLB 4PROA 3E90B 2H9TH 1EUFA 4FU7A 1A2CH 4YLQH 1YC0A 4NIYA 1C5WB 4ZUHA 3GDUA 1Y5BT 5TJXA 3KEEA 3PMJA 1FNIA 1UVPA 2ZEBA 2AEIH 2O8UA 1C2MA 5FPTA 1TGNA 4X8SH 1HIAA 2GZ8A 3MFJA 3MU4A 3MO6A 2YOLA 4ISLA 1L2EA 4AORA 1TNGA 3JZ1B 5GCHF 1TQ7B 1HBTH 4X8TH 2G8TA 3ZZCA 2B8OH 2VIQA 4KGAA 2ZGXH 1JBUH 1EX3A 1TAWA 1SGCA 2UWPA 2EI6A 4ZKSU 4K69A 4CBOA 1UHBA 1ZHRA 3MU0A 1XMNB 4FU8A 5E8EH 5EODA 1BBRH 1EKBB 2V0BA 1XUKA 1MCTA 4X1RU 3LT3A 1AI8H 2ZNKH 1O5FH 1P3EA 3KGPA 2BOHB 3Q3KA 3A85A 3RXTA 4LOYH 3SUFA 1VGCB 3LJJA 2FODA 4A92A 1MH0A 3O8BA 7GCHF 3EBNA 2PLXA 1G36A 1GI4A 1Z6JH 4Y10E 5IDKA 1ZSLA 2GCHF 1NPMA 3A84A 1Q3XA 3ZV9A 1BDAA 3B23B 1QURH 3ZVEA 8LPRA 1SFIA 4MVNA 2VJ1A 1GI0A 4CREA 1S81A 1BCUH 4CRBA 3RXMA 4X1NU 1PFXC 2QYIA 5FAHA 3ODFA 3ATLA 2TIOA 1LO6A 1O2UA 1V2OT 1HUTH 1UTQA 1DSUA 2VIPA 1TLDA 1O3FA 3F9HA 1ESTA 1SGRE 5EGMA 1GBMA 4GCHF 2HPQH 1AN1E 3ESTA 1IOEA 1JMOH 1E35B 1UVSH 4FUEA 4UFGH 1GI9B 2Y5FA 2B5TB 4D9RA 5JB8S 3DFJA 4JK5A 1SQOA 3RXBA 1TB6H 4MNYA 5A8XA 1SVPA 1WCZA 4INLA 1HAYB 2C90B 3BTHE 5DKMA 2AIQA 5DG6A 1DITH 5PTPA 3Q3XA 1WBGB 4BXWA 3O8DA 4CR5A 1Z6EA 2J95A 4A1TA 3QUMP 1LTOA 3GY8A 4CRFA 2PV9B 3VEQB 2LIZA 1TGTA 4K1SA 1S83A 3PV4A 1OYQA 2Z3CA 1ANDA 2F9VA 1YPLH 1DE7H 1UCYH 1PPEE 2PFEA 2VVCA 3V7TA 1EAXA 2R0KA 1THRH 4BAMB 1T8NA 1NM6A 2G51A 2ZCKP 3BEIB 1NESE 1C2IA 4UONA 4ASHA 4BANB 3SNAA 7KMEH 3KIDU 2VINA 2Z94A 1AD8H 1AFEH 3F1SB 3ZZAA 3LGWA 1HAOH 1V2KT 4ZKRU 2H2ZA 1ETSH 2BD8A 4X2YA 4JZFH 3RUOA 2BD7A 4THNH 1F92A 2R9PA 2UWLA 3BN9A 1YGCH 1DUEA 2H9EH 3V0XA 2SGPE 1TRNA 1X7AC 3QWCH 1FXYA 3VPKA 2P3UB 2RDLA 4FU9A 1IQMA 2ASUB 3P8OA 5A0BA 1GBKA 2UUKB 1GJBB 5J4QA 1T31A 2A32A 4IC5A 2GX4A 1O38A 1QNJA 4Y8ZA 1EZSC 2ZDKA 3A87A 2XWAA 1E37B 3MNSA 1C5PA 1TX6A 2JETC 2ALVA 3QLPH 3GY6A 3SUDA 4KTCA 1NRQH 1AIXH 5A8YA 1C1RA 2QF0A 1Z71A 3SU5A 2G52A 3P70B 2QXJA 2V6NA 1NROH 4X6PA 4LZ4B 2QXIA 3SHCH 1FMGA 3AVZA 1SI5H 1O3EA 4A5TS 1A46H 4JZIA 1GJAB 2TBSA 1K1MA 2C93B 1HAIH 3GICB 1A0HB 2HOBA 3M5MA 1CQQA 3URCA 1HAPH 2GCTC 3SI3H 2ILNA 4XBDA 1SMFE 1Z8RA 2ZECA 2ZDNA 2ZHWH 2J94A 1SLWB 1LHEH 2VWLA 5E0HA 2O9QA 5DJ7A 4AGKA 2QA9E 2ANYA 1ELDE 1DWDH 1GMCF 1GMHG 3EA7A 1EJMA 2BLOA 2ZWLH 2BY7X 3BV9B 2XTTB 1MKWH 5F8TA 3S7HB 5JBAS 1YPEH 4YZUA 3URDA 4MPUA 1BIOA 2J92A 2IN2A 3PTBA 3LC3A 1IQGA 1KY9A 7LPRA 5JDUB 1P2NA 4AFSA 1O35A 2HWLB 3ATKA 1CSOE 3ZVFA 1AQ7A 1DOJA 4CRCA 2OTVA 1DLKB 4DIIH 3LJOA 4WH8A 4X1QU 1SQAA 1HB0B 1L4ZA 1TYNA 2VWOA 1BRUP 3D62A 1F5KU 2BXTH 2I6SA 1JRSA 2G55A 3BTTE 1ELCA 2GZ7A 3UY9A 1PYTC 1N6XA 4BTTB 3A83A 1FLEE 4BTUB 4AB9A 3BG4C 1T32A 4ISIH 1C5SA 1BBRK 1TRYA 1O2VA 2LPRA 1VJAU 3VB4A 1HPGA 1K1OA 1O5GH 1JRTA 1WQSA 1ELBA 4Y76A 2JETB 3SQEE 1A5HA 3LGUA 3RXHA 1NFXA 2Z9LA 4B1TA 4JK6A 3T5FH 3BTDE 3VB7A 3M7UA 2ZPRA 2BD3A 1BITA 1H9IE 1O3HA 1VCPA 1KDQB 4FVDA 1DWEH 1FV9A 4M7GA 1CGHA 3V12A 2OC1A 4KTSA 8GCHG 1W2KH 1AFQC 1CGJE 4O9VA 1N6YA 4AFQA 2GP9B 2TGAA 4RSPA 4ABAA 1YPHC 1SHYA 2BDHA 2QY0B 1RIWC 1P2QA 3MU1A 3SJIA 3SV8A 2BM2A 2GCTB 2SNVA 5L2YH 1L1JA 4X2VA 1CU1A 1LQEA 3ZZ6A 3I77A 2A31A 5F8XA 3QZRA 1B5GH 6ESTA 3PM3A 4AFUA 4HI3A 3GY2A 4OS6A 3SUGA 3FP8E 1ELTA 3UNQA 1EZQA 3SJKA 5T6DA 2GT8A 3C1KA 3P17H 5E2OA 1ELEE 4SGBE 3U8TH 1GHZA 3OX7U 4X6OA 4NFFA 5E2PA 1MD7A 4H6SB 2UUFB 1NRNH 4U30A 3PYHA 3KCGH 1GI2A 3MOCA 4ABFA 4Z0KA 1BQYA 1V2RT 3FANA 1HV7A 2R3UA 3SU6A 1YBWA 1TX8A 2D2DA 1SC8U 1PJPA 1KLIH 3IG6B 2NU4E 1QHRB 1F0SA 2ZTXA 4WVPE 1AUTC 1SGNE 1PPZA 4WMFA 1EZXC 2AH4X 4UFEH 3RC4A 3U1IB 1QA0A 1HAGE 4TY7A 3QO6A 2GDEH 2VWMA 4JYVH 1AY6H 1IQHA 1BMMH 2ZHEH 5AFYH 1P11E 3RXFA 4I31A 1P04A 1ELVA 1MKXH 1PPHE 1OYTH 1BRAA 1UCYK 1K2I1 4CHAC 3BG4B 1H9HE 4NG9H 4Y6DA 1P03A 1YCPM 3U98H 2B9LA 1ZMLA 1K1PA 2BX3A 3BTQE 1HGTH 1ZOMA 5LPEA 3QK1A 5TCAA 1NFYA 3U8OH 3BSQA 2PWXA 1XKBC 3SGAE 1NU7B 1QL8A 4BAQB 1ARCA 5C3NA 3EQ0H 1O0DH 2AIPA 4RKJB 1ABIH 1BJUA 1GMDG 5HMAA 1CT2E 2HPPH 2ESTE 2C4FH 1SGPE 3L3TA 5H4IB 4ABJA 2BD5A 1DWCH 4DW2U 4AOQA 1LMWB 5I25A 5TCCA 4ZHMU 1GDQA 3GY3A 1AE8H 1W11U 1AFQB 1SQTA 3A7YA 4X6MA 3TPIZ 1GJ6A 4JYTA 1K1NA 4CH8B 1J15A 2GKVE 1EJAA 1O31A 2JKHA 1RIWB 2A1DB 3K6ZA 4AFZA 1HAZB 1XXDA 4YOJA 1GI6A 2RG3A 4TWWA 1P01A 2Y7ZA 3SUEA 3SV9A 1WU1A 2NU3E 3M7TA 4J1YA 1A61H 1IHTH 1K1JA 1O32A 1O3LA 1ID5H 1C5RA 2ZZUH 3TIUA 1GBLA 1FUJA 1QL9A 4H6TA 3ZZ8A 2BVRH 1UK2A 1C5ZB 2BVSH 2UUYA 2QXGA 1QIXB 2ODQA 4KP0A 2ULLA 1K28D 3ZYDA 4O97A 4MPVA 1C1PA 3KQBA 4INHA 2BDCA 4R8TB 2XBWA 1TPSA 2ZQ2A 1Y3WA 3KL6A 1ZJKA 2CV3A 2BMGB 2PSXA 3SNCA 2FM2A 4DIHH 3O8CA 1PQ5A 1V2PT 1YLDA 4LK4A 1C1NA 3FAOA 4IN1A 1GBHA 5FPYA 4WXIA 1HIAB 2FI5E 4CRDA 1TX7A 3T29A 1Y3UA 2ZFRH 1A7SA 3AW0A 1QJ7B 3LGTA 2A5IA 5JBBS 4Z6AH 1SGIB 3SV2H 2YNAA 2OUAA 4CHAB 1WQVH 2BY8X 1MMJN 4GHTA 2F9PA 5LPRA 5DK1A 1ZSKA 3TGJE 1O39A 3A7ZA 1YF4A 3KQEA 1MKWK 1AO5A 3S69A 5LGOA 2A4RA 1TMUH 3AAVA 2VH0A 3F68H 3VB3A 3ATWA 4IN2A 2OLGA 4JMYA 2OP9A 2SGDE 3LH3A 3ZZBA 1P2IA 2Z9GA 1O2NA 2M5TA 4FUBA 4VGCC 4A1XA 3RXQA 1LHFH 1W13U 1AE5A 2AFQB 5EQSA 3H7TA 1F7ZA 3KQCA 1NRRH 3DFLA 4KKDA 4ZH8A 1E34B 2FOMB 1EPTC 1LPZB 5J4SA 1C4V2 3TK9A 1QL7A 2OQ5A 4NWLA 3E16B 2PUQH 1FAKH 3GCTG 4OS1A 3T28A 4FUJA 5C1YA 1DXPA 2BD2A 2C8XB 1UTKA 1O2SA 2AMDA 1XVMA 4R0IA 2A7JA 5E0GA 3VXEH 1TMTH 1QJ1B 1IAUA 1ESBA 3MU8A 6CHAC 5EW1H 2ZDVH 2XBYA 5AF9H 2SNWA 1O3AA 4D9QA 2SFAA 1IQKA 1H1BA 2ZIQH 2ZU5A 1NS3A 3STIA 1W8BH 2Y6TA 2ZDAH 1GBTA 1DM4B 1NZQH 4NIVA 1SGTA 2CN0H 2FPZA 4CH2B 3TJNA 4YT6H 2Y7XA 3UTUH 4AGJA 2NU1E 1KSNA 4D7GA 1ZSJA 2R0LA 2BZ6H 3PTNA 1QBOA 1YLCA 1FIWA 3MO3A 2AYWA 4XBCA 4IMZA 3HGPA 5BPEA 3TLOA 3IITA 5DP4A 2OBQA 2G81E 1MAXA 3A82A 3D65E 3LGYA 4Y0YE 1M9UA 1GPZA 4DY7B 5SGAE 1YKTA 2ZPQA 4IW4E 3HK6B 1TPOA 2C3SA 4FUCA 1V6DA 4K2YA 3TJVA 3A89A 4NA8A 2IOTA 2BHGA 1A5GH 1EJNA 1NRPH 1AKSA 1YPKH 5C1UA 2ZC9H 3A8DA 1C2GA 4MTBA 3W94A 3MYWA 3QDZB 1BTZA 2HVXA 3GDSA 4DG4A 3HKJB 1W0YH 1UTPA 4I8LA 1HRTH 1WOFA 1ZRKA 4Q7YA 3ELAH 1C1MA 1TNJA 4VGCB 3T27A 1T4UH 1NFWA 5C5NA 1GL1A 3DHKH 4X1PU 1C1TA 2Y80A 2BLWA 4UE7H 1CBWC 3RXRA 1GJCB 1GBAA 5DGJA 1EPTB 6GCHF 2XC5A 1AVGH 1GHBF 1TOCB 5A0AE 2ZFQH 2WPIS 1VCQA 1F0UA 1C2HA 3ATMA 4E7RG 3RXOA 2YNBA 2WPKS 1A3BH 4E7NA 1KYNA 1MKXK 1OP8A 4YOIA 4TWYA 4K5ZA 1ELFA 1C2EA 4NZLA 1H8IH 1O3DA 3UR9A 4HFPB 1OX1A 3RXCA 1C5TA 2G4UA 4BAOB 2XYAA 4Q7ZA 1CGIE 6CHAB 1FPHH 1O3PB 4ZKOU 4YM9A 2PGBB 1F5RA 1A5IA 4FUIA 5HYOA 1C9TA 2TGDA 2WPHS 4NGAH 2QF3A 2BDBA 1O3NA 3OYPA 3NZIA 3L33A 2AMQA 4WY3A 4B2CA 1TMBH 3K65B 1O3IA 1QTFA 2G5NA 5EG4A 3ENSB 3SHAH 1FDPA 3D23A 2JH0D 5A8ZA 4MQAA 4FUFA 3LKWA 3LPRA 1KXEA 1HAHH 2PW8H 1UK3A 2P94A 4K1TA 2A5AA 3SI4H 1SGYE 1THPB 1VITG 2A7HA 3H7OA 1TBRH 2V3OH 2FEQH 2QIQA 3WY8A 1O37A 1MU6B 3O8RA 3B8JA 2FESH 1WTHD 3PB1E 1P2KA 2ANKH 1OWEA 3V3MA 3E6PH 1ZHMA 2D8WA 1L1NA 2FXRA 2Z3DA 3UREA 1CO7E 2D26C 1OWKA 1MZDA 1PQ7A 4DVAU 4WJG2 1QBVH 3RXEA 4A6LA 1OWHA 2CF9H 2BDYA 3RXIA 2QN5T 3RMLH 4X1SU 5K0HA 5GIBA 1Y3VA 2TRMA 4D8NA 1P10A 1AWFH 5AFZH 1C5LH 2QC2A 2H6MA 2WYJA 4X2WA 3AW1A 2DE9A 1RJXB 4ABDA 5A0CA 5CE1A 2UUJB 1J16A 3NUMA 3TJUA 1EOJA 1HXEH 1KXAA 2OCVB 1G3BA 2VH6A 1MBMA 2FLRH 2TGTA 1C1UH 1CBWB 4UEHH 1GI8B 1KIGH 3M5OA 1GWAA 5EPYA 1INCA 2C8YB 3UPEA 1QB9A 2FYRA 1EAIA 1C5QA 1EZUC 1YM0A 2CXVA 3LGIA 1CA0C 4GHQA 3MH6A 3QGNB 1S84A 3KNXA 2XBXA 4I32A 1CHOG 4NSYA 1H8DH 1ZPBA 1FY3A 3LGVA 4Y71A 1MTNC 4BNRA 1QFKH 1W7XH 1SLVB 2ZFTA 4MDSA 4B75A 2PTCE 3ZZDA 1C1SA 4ZKNU 1VJ9U 4CR9A 1Z1IA 4Q80A 4B71A 3PROA 3SN8A 2J2UA 1QCPA 1QQUA 3T2NA 1F5LA 8ESTE 1C2DA 4BAHB 1IQNA 1WSSH 5G4BA 5I46H 1CVWH 2Y5HA 4ZXYH 3MH7A 5FBEA 4NA9H 2P95A 3SU3A 1QB1A 4DGJA 1O3BA 3BIUH 1J14A 2AS9A 3E0PB 4JYUH 1ZPCA 4Y0ZE 4Y8YA 4I8KA 1ESAA 3RXJA 1BRCE 1V2UT 1SLXB 5ABWA 2FOCA 5FBIA 5EXMA 1IQIA 2Z7FE 1GGDC 4TYDA 1C2FA 3U69H 2ALPA 2BDGA 1JXPA 3UNSA 3ZV8A 1GG6C 2FX6A 1Y5UT 1O2QA 3A7XA 1GBCA 3M7QA 3E3TA 3MNBA 2IJOB 3Q3YA 3A86A 4MPXA 3RXAA 3OU0A 1ETRH 1G2LA 1ZMNA 2HRVA 2PR3A 4YT7H 4H42U 1IQEA 2CJIA 1DANH 2FS8A 4GLYA 3I78A 4TY6A 1KXCA 3NCLA 1PPFE 4Y7AA 3V13A 1QA7A 2PGQB 1MD8A 2BX4A 2RA3A 4X6NA 1DICA 3TJOA 5K7RA 3STJA 2Z6BD 3SU0A 3P8NA 2JH6D 1GI3A 2QV1A 1S0RA 3M5LA 1PPBH 1EXFA 1LPGB 2AGEX 1JIRA 2GV6A 1C2JA 1D6RA 1TALA 3RDZA 1LVOA 3MNXA 2F9BH 2KAIB 4ABBA 5DP6A 1UVTH 1CA0B 3NWUA 3MH4A 2ZGHA 2OINA 2XC4A 3SQHE 5A09A 4DCDA 2J38A 4WXVA 4I8JA 1GDUA 1EB1H 1AWHB 1MTNB 3SJ9A 1O36A 2VVUA 5T6GA 1P3CA 4WF8A 2J4IA 4B73A 4X8VH 4MNWA 1S6HA 2GD4B 4MPWA 4WH6A 1DY9A 2FDAA 2B0FA 1F0RA 2GTBA 2FOAA 1CT0E 3M3TA 1BOQA 2A2XH 2A5KA 1BTWA 1PPCE 2H9HA 1P57B 1XXFA 1O2LA 3M3VA 1SSXA 1V2VT 1D3PB 3DT0H 3SNEA 6LPRA 1GDNA 3ZZ3A 3P8FA 2EC9H 1O5AB 4OS2A 2OXSA 1P8VC 3U9AH 2G4TA 1C9PA 4B2AA 2Q1JA 2P93A 1SB1H 2RA0A 3PMHB 3VFEA 3HK3B 3PLPA 5GCHG 1AU8A 2GV7A 2F9NA 1J9CH 3EE0B 3UWIA 2DUCA 1C5OH 4FUDA 1OXGA 1V2WT 1GGDB 4ABIA 1GBJA 4DT7B 1BTYA 3LIWA 4XOJA 1GG6B 2O8LA 1NTPA 3SZNA 5HM9A 1MUEB 1HFDA 2FWWA 1DWBH 1O2GH 1TA6A 2GMTC 2ZU1A 2UWOA 4Q7XA 5C2ZA 5F6MA 2BVXH 5F03A 4UFDH 2TPIZ 3FFGA 5T6FA 4ISHH 3TH4H 3JZ2B 4UD9H 2O8MA 4XSKU 1F0TA 1S5SA 3E8LA 1B7XB 3E1XB 1TONA 2PKSC 2OC8A 3OY5U 3A8AA 1P06A 4Q2KA 1LHGH 1O3MA 1OKXA 2OD3B 2DE8A 1MQ5A 2XBVA 1YP9A 2NU0E 3UIRA 3E0NB 1AVXA 1GMHF 1S0QA 1T8LA 1WAYB 5GJ4B 2W26A 3ZVGA 4K1EA 1SLUB 4A7IB 1O5BB 7GCHG 3LONA 1V2ST 2PKAB 4GVUA 4INKA 1RTFB 3SBKA 4B76A 5GWZA 2GCHG 5FX5A 3GYMA 4LXBH 3EAJA 2HLCA 2ZHQH 1O33A 1TA2A 2WINI 1O2YA 2VNTA 3K9XB 2W3IA 5FCKA 3MHWU 1ZGIA 3F9GA 5L6NH 4RKOB 4E06H 4NA7A 4NWKA 2PUXB 1WTGH 1C5XB 3T26A 3KQDA 2BD9A 2BDIA 3AAUA 5AHGH 5JYIA 2FYQA 1W3CA 2AGGX 1UTNA 3S9AA 1UTJA 1XUHA 3T25A 1T4VH 4Y79A 1TNLA 3TU7H 3QTOH 3RMOH 1FY5A 1UVUH 3GCNA 4XFQA 1JOUB 5DP5A 4E05H 2RCEA 1SHHB 3BG8A 1THSH 4HTCH 3PMBB 2ZKSA 3GISB 1DDJA 2F9UA 3A7TA 3RM0H 2WPLS 4K60A 1G2MA 3ODDA 3EA9A 3NPSA 3TNSA 1CT4E 5DP8A 3VB6A 4O3TA 2ODYB 2EI8A 4GAWA 3SGBE 1O5CB 3BTKE 1GI7B 3E91A 1H4WA 3RLWH 2ZTYA 1V2TT 3U1JB 4U2WA 4IMQA 2BLVA 4YO9A 2OC7A 1UTOA 3FP7E 2H5DA 3M5NA 8GCHF 3GY5A 3SW2B 1Y8TA 1TGBA 1L0ZA 3BIVH 1EP6A 1BMNH 3RC6A 3PLBA 3TGIE 1YPGH 2GMTB 2VIDA 1W14U 3NK8A 2G00A 3SO3A 2CGAA 1TIOA 1QQ4A 3EYDA 3SU4A 1UHBB 2Y81A 3I29A 3ZZ4A 1VZQH 1E36B 3A80A 3FVFB 5HXFA 2Q6DA 2VWNA 1TABE 1SGQE 2PKSB 1O2PA 2ZO3H 4ZMAH 5B6OA 3Q00A 1W10U 1O2WA 1PYTD 4SGAE 4ISNA 3RP2A 2Y82A 1HJ8A 2BD4A 3LOXA 1A3EH 1ZR0A 3GCOA 1OWJA 1QBNA 4MG3A 1O2IA 4YESB 3TNTA 1TRMA 1Z7KA 1HYLA 2FTMA 4BAKB 1DX5M 2QXHA 3SORA 2FX4A 5IYTA 1O2MA 2XC0A 5DPAA 1RS0A 2FMJA 1FPCH 5DP7A 5C1XA 4HZHA 1KLTA 1FAXA 3GOVB 2EI7A 2Q6GA 2FOGA 3GDVA 3TH2H 3GY4A 4I8HA 2BDAA 5ESBA 5LH8A 1LKBA 1DLEA 2FOBA 4BOHA 2A45B 1G3CA 4WMEA 1GHVH 1OOKB 2ANMH 3CS0A 1AKSB 3R0FA 2XNIA 1C5NH 1Y5AT 1D6WA 1HAVA 1W0ZU 1GHWH 1K1IA 3B9FH 1BZXE 1TQ0B 4OS7A 1SBWA 3RXLA 1LVMA 2STBE 1UMAH 1AGJA 2P59A 2ANWA 1MZAA 1ACBE 4AN7A 2ZU3A 3UQOA 3RC5A 1LQDB 3SV6A 1GHAG 4OGYA 2XCFA 8KME2 3RXDA 1OSSA 2STAE 1Q2WA 2QCYA 5FX6A 1K1LA 1GMDF 2W5EA 4O3UA 3SNBA 3P6ZB 1N8OC 3Q77A 3A81A 4Y11E 1FI8A 3DUXH 4D7FA 1QRZA 4QT8C 2P3TB 1TPPA 1G9IE 1SFQB 1XKAC 4H4FA 2FLBH 4B74A 1T8OA 2WUBA 3BEUA 4AG1A 5A2MH 1DFPA 1KXDA 4ZAEA 3P92A 1H9LB 1FY8E 3MTYA 1BB0B 1UJ1A 2VIWA 2FOEA 4I33A 2XW9A 2AGIX 1GMCG 5L30H 1P9SA 3ZVAA 5C20A 1GJ4H 1P09A 3UUZA 1BRBE 2FIRH 1G32B 1GCDA 1HJ9A 1NY22 2A0QB 3K2UA 1ZJDA 1FJSA 5JBCS 3HKIB 4IBLH 4F49A 1KTSB 1BHXF 2ZFFH 3PMAB 2GZ9A 3FP6E 1O2JA 3DD2H 4FUGA 3MI4A 3GCHC 1PQ8A 4FXGH 1VCWA 1C4Y2 1O2TA 1P12E 5ESTE 1AZ8A 1YCPH 1B0FA 1C1QA 1C5UA 3EGKH 3MWIU 3VXFH 4ESTE 2D1JA 2VIVA 5EW2H 3BTEE 1ZTJA 2I6QA 3A7WA 1E38B 3RMMH 2A4GA 3RXKA 2FS9A 1EB2A 1YYY1 1V2NT 1D9IA 4J2YB 3QZQA 2SGEE 4UDWH 2F83A 2WPJS 2NU2E 1WUNH 1O2RA 3AASA 3SV7A 2BY6X 3S9CA 3VGCC 3SOSA 4O03A 5GPIB 2ZDLA 1GBIA 2GT7A 5EU8A 3RXVA 1UTLM 2BY9X 1MCVA 1P2MA 2P8OC 1ZHPA 4AYYB 1C2LA 1IQFA 1MU8B 1TGCA 5ETXA 1AVWA 1OPHB 1G3EA 1DS2E 1XX9A 1XVOA 3RXPA 1GI5A 4NSVA 4ABGA 4AX9H 1G37A 1GCTC 3MO9A 1V3XA 1QRWA 3M61U 5E0JA 4U32A 2FI4E 2BQ7B 1BMLA 1LVBA 3BTWE 1IHSH 1O34A 1N8OB 1BTUA 1HXFH 2A4QA 3VB5A 2SGAA 2ZFPH 4FVBA 4AZ2B 1EPTA 2TGPZ 2ODPA 1Z1JA 3ZVBA 1BTHH 5L2ZH 1PPGE 3UOUA 1VR1H 3C27B 3MNCA 2HNTE 1SG8B 2WV5A 3H5CB 4JZEH 1ZRBA 3GCTF 4HGCA 2ZTZA 3BTME 3HPTB 5HM2A 3EA8A 1NN6A 4MNXA 1Z8JB 1TE0A 1LDTT 1G30B 1HJAC 1XUGA 1BBRE 1K21H 5JB9S 2CMYA 5EQRA 1OWDA 1V2JT 2R3YA 2P3FH 4I8GA 2QAAA 1GHXH 1OP2A 4MLFB 1SR5C 1AMHA 1RD3B 4IGDA 1EAWA 1BA8B 1TNHA 3RXUA 3DA9B 3HATH 1WYKA 2BLQA 3GCHB 3LC5A 1LHCH 1ELAA 3RM2H 1O3OA 3ITIA 3ZZ9A 2A2QH 3G01A 4FUHA 2W7UA 1FONA 2Z9JA 5DP9A 1BUIA 1P0SH 2ZDMA 1GHAF 2XXLA 2F91A 5EQQA 3RLYH 4Y8XA 3A8CA 3A7VA 1ORFA 5DP3A 4D76A 3ZZ7A 3W95A 3VGCB 1O3JA 1F2SE 1AUJA 3CS7A 7ESTE 2BOKA 1CHGA 1XUIA 3SJ8A 3PWBA 2P8OB 4X8UH 1B0EA 1DT2A 2FTLE 2PTNA 1O30A 3PO1C 2XCNA 2ZCHP 1GBFA 2OBOA 2PSYA 3A8BA 3QTVH 2VGCC 1KTTB 1YPHE 3SJOA 4JCNA 1IQLA 1LCYA 5JBTA 2ZA5A 3TGKE 3BF6H 2CHAC 1ARBA 1BTPA 1GCTB 1HNEE 2A4OA 3TVJB 1ANCA 1DUAA 1DPOA 2ZP0H 5EOKA 3FZZA 4ZHAA 3L6PA 3TK5A 4OS5A 2ZU4A 2J9NA 1P2OA 2K1QA 3EDXB 3KHVA 4I7YH 3ZYEA 2HNTC 3N7OA 4OGXA 1G3DA 4K8YA 2Q6FA 2IPHA 1UTMA 1FY4A 4TPIZ 5CHAC 1OWIA 1FN8A 1GJ8B 2A7CA 2GVFA 2ZFSA 3FZDA 1HAXB 1SOZA 4XBBA 2Z9KA 1ZMJA 4BTIB 2HALA 2JH5D 3HGNA 2W7SA 3QN7A 4K8BA 1UCYE 2BTCE 3UWJH 2O8TA 1S85A 1HJAB 2K7XA 4NZQA 1ABJH 1SGEE 3OSYA 4CRGA 2ZGJA 2ZPSA 1SL3A 2OQUA 1Z8IB 1LVYA 5GDSH 3RU4D 5F8ZA 2FOFA 1TGSZ 2VB0A 5DO4H 3F9EA 1C5VA 1MQ6A 3F9FA 2AERH 1GBEA 5C67A 2WUCA 1C1VH 1O3KA 4CRAA 1NO9H 3UNRA 1ZTLA 2J34A 4AG2A 1DVAH 5T3HA 2EA3A 2FP7B 1Q31A 1EP5A 4U01A 1T8MA 2GDDA 2F9OA 1BT7A 1W7GH 4ABEA 2CF8H 1GBBA 1TNKA 3A88A 1VITF 3S7KB 4UFFH 1C2KA 3S9BA 2WYGA 1ANBA 1RFNA 1D4PB 2ZQ1A 5CMXH 3UFAA 1NT1A 1QY6A 4X0WU 3P8GA 2H1UA 1O2XA 3Q76A 3PO1B 1OP0A 1SGFG 3BEFB 1WV7H 4IC6A 2BY5X 1RTKA 3RMNH 3KN2A 1IQJA 2ZI2H 3MU5A 2V3HH 4GPGA 1AHTH 1FQ3A 2VGCB 1Y3XA 1LPKB 1TBQH 4XDEA 2C8ZB 5FCRA 1C1OA 1OS8A 1HLTH 2CHAB 9LPRA 1O2OA 1MTSA 1MTWA 1L1GA 1MTVA 1ANEA 2ZF0H 1Y3YA 3BTFE 1UVOA 3ATIA 1V2MT 1YCPK 1A1RA 1GHYH 5C5OA 1LHDH 1J17T 1AB9C 5HGGA 3KF2A 3K6YA 1KDQA 1ETTH 4GUXA 4GSOA 4DURA 4NFEA 2ZGBH 5EXLA 1ZPZA 4K3JA 4A1VA 1EASA 1GJ7B 1TWXB 3R3GB 5LPFA 1NC6A 1SOTA 2ZHFH 2XRCA 3M3SA 5CHAB 4KTUA 1EAUA 3S0NA 1D3QB 2ZHDA 3UOPA 1RXPA 4RN6A 1T7CA 3TK6A 1TOMH 2KAIA 1O5DH 1TBZH 4DJZB 5JPMH 1GVLA 1VITH 2ZGCA 1C4U2 1CA8B 1O5EH 1NRSH 1RRKA 1S82A 1V2QT 1W12U 2FZZA 3CENA 1NU9A 1HDTH 1V2LT 1DXWA 1Y59T 5AVDA 1FIZA 1CHOF 2PHBA 2VIOA 1ZGVA 3P95A 1FZZA 1O2KA 1P02A 2V35A 2ZG0H 2F3CE 2FO9A 2QGRA 1L4DA 5EXNA 2SGFE 1J8AA 3GY7A 1ZYOA 1O3CA 1P05A 1SPJA 1TFXA 4ZXXH 3M37A 3ZZ5A 3ZVCA 4DOQA 1GJ5H 4NCYA 4CBNA 3PLKA 1O2HA 1QB6A 4YLUA 4AB8A 2ZCLP 1HCGA 3M36A 1EATA 2WPMS 2Z9IA 3ZVDA 1GI1A 3TITA 1D3DB 1ELGA 1DY8A 1TNIA 2ZU2A 1FN6A 1GVKB 1QR3E 2BZAA 1BMAA 1QJ6B 2R2MB 2VVVA 1XUJA 5FXLA 1MAYA 1K9OE 2O8WA 1SGFA 2BQWB 4X2XA 3SU2A 1A0JA 4ZROA 3MMGA 1MBQA 2WV4A 2R2WU 1P2JA 3U8RH 5GXPA 1C5YB 1S6FA 1Z8GA 1RGQA 2Z3EA 2GGVB 3LDXH 4IS5A 3OY6U 2SGQE 4GCHG 4B2BA 2FOHA 4Y7BA 1ZTKA 2XWBI 1E0FD 1PQAA 5BRRE 1C1WH 1O3GA 2W3KA 2BYAX 4NIWA 4JZ1A 4WWYA 4YTAA 3T62A 3F6UH 4MNVA 4XE4A 2FI3E 1TPAE 4NIXA 1KXFA 2G5VA 2BB4A 1JWTA 4ZHLU 1DSTA 4WMDA 2NWNA 1EOLA 3SU1A 2P16A 1A4WH 6GCHG 1GHBG 1AB9B 2HGTH 1A0LA 1GBDA 5FPSA 4F4OC 3OTJE 1N1LA 1QGFA 3SNDA 3MH5A 1CE5A 1D3TB 1FY1A 3PWCA 4ABHA 1NFUA 1ZLRA 1UK4A 1MTUA 1ZZZA 2LNCA 2B7DH 1P9UA 3D49H 1VGCC 4OS4A 2EEKA
chains in the Genus database with same CATH superfamily
2BQ6B 2AMPA 4KELA 4YOGA 1KLJH 2PKAA 1BJVA 1GJ9B 1RTLA 1UO6A 3LH1A 1U6QA 5EPNA 3LU9B 1AZZA 3RXGA 3UR6A 1E1QD 1GL0E 1C5MD 1BTXA 2HNTF 2H5CA 1WXRA 3UQVA 3TH3H 3RU4T 1BHXB 3QX5H 2VU8E 9ESTA 3SGQE 4BXSA 1JIMA 3QGJA 1O2ZA 3IWMA 2J5UA 4LZ1H 2Y5GA 2C8WB 3NKKA 3NXPA 1QRXA 1XM1A 2WZQA 3M35A 1XUFA 1GJDB 1YPJH 1LKAA 3CP7A 1EQ9A 1HAVB 3RXSA 2OC0A 4ISOA 1SGDE 5EJ1A 1GVZA 4AYVB 1K22H 4TPYA 5FHTA 3BTGE 1KXBA 2THFB 4JZDH 2BXUH 3RU4E 1YPMH 3GYLB 4PROA 3E90B 2H9TH 1EUFA 4FU7A 1A2CH 4YLQH 1YC0A 4NIYA 1C5WB 4ZUHA 3GDUA 1Y5BT 5TJXA 3KEEA 3PMJA 1FNIA 1UVPA 4TSFD 2ZEBA 2AEIH 2O8UA 1C2MA 5FPTA 1TGNA 4X8SH 1HIAA 2GZ8A 3MFJA 3MU4A 3WWFA 3MO6A 5EIYA 2YOLA 4ISLA 1L2EA 4AORA 1TNGA 3JZ1B 5GCHF 1TQ7B 1HBTH 4X8TH 2G8TA 3ZZCA 3EE7A 5F53A 4XRNA 2B8OH 2VIQA 4KGAA 2ZGXH 1JBUH 1EX3A 1TAWA 1SGCA 2UWPA 2EI6A 4ZKSU 4K69A 4CBOA 1UHBA 1ZHRA 3MU0A 1XMNB 4FU8A 5E8EH 5EODA 1BBRH 1EKBB 2V0BA 1XUKA 1MCTA 4X1RU 3LT3A 1AI8H 2ZNKH 1O5FH 1P3EA 3KGPA 2BOHB 3Q3KA 3A85A 3RXTA 4LOYH 3SUFA 1VGCB 3LJJA 2FODA 4A92A 1MH0A 3O8BA 7GCHF 3EBNA 2PLXA 1G36A 1S6LA 1GI4A 1Z6JH 4Y10E 5IDKA 1ZSLA 2GCHF 1NPMA 3A84A 1Q3XA 3ZV9A 1BDAA 3B23B 1QURH 3ZVEA 8LPRA 1SFIA 4MVNA 2VJ1A 1GI0A 4CREA 1S81A 1BCUH 4CRBA 3RXMA 4X1NU 1PFXC 2QYIA 5FAHA 3ODFA 3ATLA 2TIOA 1LO6A 1O2UA 1V2OT 1HUTH 1UTQA 1DSUA 2VIPA 1TLDA 2KFWA 1O3FA 3F9HA 5KEDA 1ESTA 3OE7D 3KYGA 1SGRE 5EGMA 1GBMA 4GCHF 2HPQH 1AN1E 3ESTA 1IOEA 1JMOH 1E35B 1UVSH 4FUEA 4UFGH 3NRLA 1GI9B 2Y5FA 2B5TB 4D9RA 5JB8S 3DFJA 4JK5A 1SQOA 3RXBA 1TB6H 4MNYA 5A8XA 1SVPA 1WCZA 3FO8D 4INLA 1HAYB 2C90B 3BTHE 5DKMA 2AIQA 2QF5A 5DG6A 1DITH 5PTPA 3Q3XA 1WBGB 4BXWA 3O8DA 4CR5A 1Z6EA 2J95A 4A1TA 3QUMP 1LTOA 3DCLA 3GY8A 4CRFA 4RT0A 2PV9B 3VEQB 2LIZA 1TGTA 3PRBA 4K1SA 1S83A 3PV4A 1OYQA 4F55A 2Z3CA 1ANDA 2F9VA 1YPLH 1DE7H 1UCYH 1PPEE 2PFEA 2VVCA 3V7TA 1EAXA 2R0KA 1THRH 4BAMB 1T8NA 1NM6A 4XD7D 4YXWD 2G51A 2ZCKP 3BEIB 1NESE 1C2IA 4UONA 1FX0B 4ASHA 4BANB 3SNAA 7KMEH 3KIDU 2VINA 2Z94A 1AD8H 1AFEH 2EY4C 3F1SB 3ZZAA 3LGWA 4AC9A 1V2KT 4ZKRU 1HAOH 2H2ZA 1ETSH 2BD8A 4X2YA 4JZFH 3RUOA 2BD7A 4THNH 1F92A 2R9PA 3KQ5A 2UWLA 3BN9A 1YGCH 1DUEA 2H9EH 3V0XA 2SGPE 3W1EA 1TRNA 1X7AC 3QWCH 1FXYA 3VPKA 2P3UB 2RDLA 4FU9A 1IQMA 2LP6A 2ASUB 3P8OA 5A0BA 1GBKA 2UUKB 1GJBB 5J4QA 1T31A 2A32A 4IC5A 2GX4A 1O38A 1QNJA 4Y8ZA 1EZSC 2ZDKA 3A87A 2XWAA 1E37B 3MNSA 1C5PA 1TX6A 2JETC 2ALVA 3QLPH 5CDFE 3GY6A 3SUDA 4KTCA 1NRQH 1AIXH 5A8YA 1C1RA 2QF0A 1Z71A 3SU5A 2G52A 3P70B 2QXJA 2XOKD 2V6NA 1NROH 4FETA 4X6PA 4LZ4B 2QXIA 3SHCH 1FMGA 3AVZA 1SI5H 1O3EA 4A5TS 1A46H 4JZIA 2JJ2D 1GJAB 2TBSA 1K1MA 2C93B 1HAIH 3GICB 1A0HB 2HOBA 3M5MA 1CQQA 3URCA 1HAPH 2GCTC 2LELA 3SI3H 2ILNA 4XBDA 1SMFE 1Z8RA 2ZECA 2ZDNA 2ZHWH 2J94A 1SLWB 3PRDA 1LHEH 2VWLA 5E0HA 2O9QA 5DJ7A 4AGKA 5FL7D 2QA9E 2ANYA 1ELDE 1DWDH 1GMCF 1GMHG 3EA7A 1EJMA 2BLOA 2ZWLH 2BY7X 3BV9B 2XTTB 1MKWH 5F8TA 3S7HB 5JBAS 1YPEH 4YZUA 3URDA 4MPUA 1BIOA 2J92A 2IN2A 3PTBA 3LC3A 1IQGA 1KY9A 7LPRA 5JDUB 1P2NA 4AFSA 1O35A 2HWLB 3ATKA 1CSOE 3ZVFA 1AQ7A 1DOJA 4CRCA 2OTVA 1DLKB 4DIIH 1BMFD 3LJOA 4WH8A 4X1QU 1MABB 1SQAA 1HB0B 1L4ZA 1H8HD 1TYNA 2VWOA 1BRUP 3D62A 1F5KU 2BXTH 2I6SA 1JRSA 2G55A 3BTTE 1ELCA 2GZ7A 3UY9A 1PYTC 1N6XA 4BTTB 3A83A 1FLEE 4BTUB 4AB9A 3BG4C 1T32A 4ISIH 1C5SA 1BBRK 1TRYA 1O2VA 2LPRA 1VJAU 3VB4A 1HPGA 1K1OA 1O5GH 1JRTA 1WQSA 1ELBA 4Y76A 2JETB 3SQEE 1A5HA 3LGUA 3RXHA 1NFXA 2Z9LA 4B1TA 4JK6A 3T5FH 3BTDE 3VB7A 3M7UA 2ZPRA 2BD3A 5KECA 1BITA 1H9IE 1O3HA 1VCPA 2J98B 1KDQB 4FVDA 1DWEH 1FV9A 4M7GA 1CGHA 3V12A 2OC1A 4KTSA 8GCHG 1W2KH 1AFQC 1CGJE 4O9VA 1N6YA 4AFQA 2GP9B 2TGAA 4RSPA 4ABAA 1YPHC 1SHYA 2BDHA 2QY0B 1RIWC 1SKYE 1P2QA 3MU1A 3SJIA 3SV8A 2BM2A 2GCTB 2SNVA 5L2YH 1L1JA 4X2VA 1CU1A 2JJ1D 1LQEA 3ZZ6A 3I77A 2A31A 5F8XA 3QZRA 1B5GH 6ESTA 3PM3A 4AFUA 4HI3A 3GY2A 4OS6A 3SUGA 3FP8E 1ELTA 3UNQA 1EZQA 3SJKA 5T6DA 2GT8A 3C1KA 3P17H 5E2OA 1ELEE 4SGBE 3U8TH 1GHZA 3OX7U 4X6OA 5C94A 5GNDA 4NFFA 5E2PA 1MD7A 4H6SB 2UUFB 1NRNH 4U30A 3PYHA 3KCGH 1GI2A 3MOCA 4ABFA 4Z0KA 1BQYA 1V2RT 3FANA 1HV7A 2R3UA 3SU6A 1YBWA 1TX8A 2D2DA 1SC8U 1PJPA 1KLIH 3IG6B 2NU4E 1QHRB 1F0SA 2ZTXA 4WVPE 1AUTC 1SGNE 1PPZA 4WMFA 1EZXC 2AH4X 4UFEH 3RC4A 3U1IB 1QA0A 1HAGE 3UAIC 4TY7A 3QO6A 2GDEH 2VWMA 4JYVH 1AY6H 1IQHA 1BMMH 2ZHEH 5AFYH 1P11E 3RXFA 4I31A 1P04A 1ELVA 1MKXH 1PPHE 1OYTH 1BRAA 1UCYK 1K2I1 4CHAC 3BG4B 1H9HE 4NG9H 4Y6DA 1P03A 1YCPM 3U98H 2B9LA 1ZMLA 1K1PA 2BX3A 3BTQE 2YMSC 1HGTH 1ZOMA 5LPEA 3QK1A 5TCAA 1NFYA 3U8OH 3BSQA 2PWXA 1XKBC 2JDID 3SGAE 1NU7B 1QL8A 4BAQB 1ARCA 5C3NA 3EQ0H 1O0DH 2AIPA 4RKJB 1ABIH 1BJUA 1GMDG 5HMAA 1CT2E 2HPPH 2ESTE 2C4FH 1SGPE 3L3TA 5H4IB 4ABJA 2BD5A 1DWCH 4DW2U 4AOQA 1LMWB 5I25A 5TCCA 4ZHMU 1GDQA 3GY3A 1AE8H 1W11U 1AFQB 1SQTA 3A7YA 4X6MA 3TPIZ 1GJ6A 4JYTA 2W6ID 1K1NA 4CH8B 1J15A 2GKVE 1EJAA 1O31A 2JKHA 1RIWB 2A1DB 3K6ZA 2K0QA 4AFZA 1HAZB 1XXDA 4YOJA 1GI6A 2RG3A 4TWWA 1P01A 2Y7ZA 3SUEA 3SV9A 1WU1A 2NU3E 3M7TA 4J1YA 1A61H 1IHTH 1K1JA 1O32A 3OAAD 2AHME 1O3LA 1ID5H 1C5RA 2ZZUH 3TIUA 1GBLA 1FUJA 1QL9A 4H6TA 3ZZ8A 2BVRH 1UK2A 1C5ZB 2BVSH 2UUYA 2QXGA 1QIXB 2ODQA 4KP0A 2ULLA 2VBCA 1K28D 3ZYDA 4O97A 4MPVA 1C1PA 3KQBA 4INHA 2BDCA 4R8TB 2XBWA 1TPSA 2ZQ2A 1Y3WA 3KL6A 1ZJKA 2CV3A 2BMGB 2PSXA 3SNCA 2FM2A 4DIHH 3O8CA 1PQ5A 1V2PT 1YLDA 1NBMD 4LK4A 1QZ8A 1C1NA 3FAOA 4IN1A 1GBHA 5FPYA 4WXIA 2F43B 1HIAB 2FI5E 4CRDA 1TX7A 3T29A 1Y3UA 2ZFRH 1A7SA 3AW0A 3H09A 1QJ7B 3LGTA 2A5IA 5JBBS 4Z6AH 1SGIB 3SV2H 2YNAA 2OUAA 4Q63A 4CHAB 1WQVH 2BY8X 1MMJN 4GHTA 2F9PA 4DT4A 5LPRA 5DK1A 1ZSKA 3TGJE 1O39A 3A7ZA 1YF4A 3KQEA 2YMSB 1MKWK 1AO5A 3S69A 5LGOA 2A4RA 1TMUH 3AAVA 2VH0A 3F68H 3VB3A 3ATWA 4IN2A 2OLGA 4JMYA 2OP9A 2SGDE 3LH3A 3ZZBA 1P2IA 2Z9GA 1O2NA 2M5TA 4FUBA 4VGCC 4A1XA 3RXQA 1LHFH 1W13U 1AE5A 2AFQB 5EQSA 3H7TA 1F7ZA 3KQCA 1NRRH 3DFLA 4KKDA 4ZH8A 1E34B 2FOMB 1EPTC 1LPZB 5J4SA 1C4V2 3F3BA 3TK9A 1QL7A 2OQ5A 4NWLA 3E16B 2PUQH 1FAKH 3GCTG 4OS1A 3T28A 4FUJA 5C1YA 1DXPA 2BD2A 2C8XB 1UTKA 1O2SA 2AMDA 3N7DA 1XVMA 4R0IA 2A7JA 5E0GA 3VXEH 1TMTH 1QJ1B 1IAUA 1ESBA 3MU8A 6CHAC 5EW1H 2ZDVH 2XBYA 5AF9H 5KGOA 2SNWA 1O3AA 4D9QA 2SFAA 1IQKA 1H1BA 2ZIQH 2ZU5A 1NS3A 3STIA 5HKKD 1W8BH 2L74A 2Y6TA 2ZDAH 1GBTA 1DM4B 1NZQH 4NIVA 1SGTA 2CN0H 2FPZA 4CH2B 3TJNA 4YT6H 2Y7XA 3UTUH 4AGJA 2NU1E 1KSNA 5EJLA 4D7GA 4RI0A 3ZIAD 1ZSJA 2R0LA 2BZ6H 3PTNA 1QBOA 1YLCA 1FIWA 3MO3A 2AYWA 4XBCA 4IMZA 3HGPA 5BPEA 2F4LA 3TLOA 3IITA 5DP4A 2OBQA 2G81E 1MAXA 3A82A 3D65E 3LGYA 5EJZA 4Y0YE 1M9UA 1GPZA 4DY7B 5SGAE 1YKTA 2ZPQA 4IW4E 3HK6B 1TPOA 2C3SA 4FUCA 1V6DA 4K2YA 3FN8A 3TJVA 3A89A 4NA8A 2IOTA 2BHGA 1A5GH 1EJNA 1NRPH 1AKSA 1YPKH 5C1UA 2ZC9H 3A8DA 1C2GA 4MTBA 3W94A 3MYWA 2KR7A 3QDZB 1BTZA 2HVXA 3GDSA 4DG4A 3HKJB 1W0YH 1UTPA 4I8LA 1HRTH 1WOFA 1ZRKA 4Q7YA 3ELAH 1C1MA 1TNJA 4VGCB 3T27A 1T4UH 1NFWA 5C5NA 1GL1A 3DHKH 4X1PU 1C1TA 2Y80A 2BLWA 4UE7H 1CBWC 3RXRA 1GJCB 1GBAA 5DGJA 1EPTB 6GCHF 2XC5A 1AVGH 1GHBF 1TOCB 5A0AE 2ZFQH 2WPIS 1VCQA 1F0UA 1C2HA 3ATMA 4E7RG 3RXOA 2YNBA 2WPKS 1A3BH 4E7NA 1KYNA 1MKXK 1OP8A 4YOIA 4TWYA 4K5ZA 1ELFA 1C2EA 4NZLA 1H8IH 1O3DA 3UR9A 4HFPB 1OX1A 4Z1MD 3RXCA 1C5TA 2G4UA 4BAOB 2XYAA 4Q7ZA 1CGIE 6CHAB 1FPHH 1O3PB 4ZKOU 4YM9A 2PGBB 1F5RA 1A5IA 4FUIA 5HYOA 1C9TA 1WDIA 2TGDA 2WPHS 4NGAH 1E79D 2QF3A 2BDBA 1O3NA 3OYPA 3NZIA 3L33A 2AMQA 4WY3A 4B2CA 1TMBH 3K65B 1O3IA 1QTFA 2G5NA 5EG4A 3ENSB 3SHAH 1FDPA 3D23A 2JH0D 5A8ZA 4MQAA 4FUFA 3LKWA 3LPRA 1KXEA 1HAHH 2PW8H 2K8IA 1UK3A 2P94A 4K1TA 2A5AA 3SI4H 1SGYE 1THPB 1VITG 2A7HA 3H7OA 1TBRH 2V3OH 2FEQH 2QIQA 3WY8A 2KCPA 1NBME 1O37A 1MU6B 3O8RA 3B8JA 2FESH 1WTHD 3PB1E 1P2KA 3VG8A 2ANKH 1OWEA 3V3MA 3E6PH 3F2FA 1ZHMA 2D8WA 1L1NA 2FXRA 2Z3DA 3UREA 1CO7E 2D26C 1H8ED 1OWKA 1MZDA 1PQ7A 4DVAU 4WJG2 1QBVH 3RXEA 5C0TA 4A6LA 1OWHA 2CF9H 2BDYA 3RXIA 2QN5T 3RMLH 4X1SU 5K0HA 5GIBA 1Y3VA 2TRMA 4D8NA 1P10A 1AWFH 5AFZH 3OEED 1C5LH 2QC2A 2H6MA 2WYJA 4X2WA 3AW1A 2DE9A 1RJXB 4ABDA 1YLNA 5A0CA 5CE1A 2UUJB 4OM9A 1J16A 3NUMA 3TJUA 1EOJA 1HXEH 1KXAA 2OCVB 1G3BA 2VH6A 1MBMA 2FLRH 2TGTA 1C1UH 1CBWB 4UEHH 1GI8B 1KIGH 2KM0A 3M5OA 1GWAA 5EPYA 1INCA 2C8YB 3SYJA 3UPEA 1QB9A 2FYRA 1EAIA 1C5QA 1EZUC 1YM0A 2CXVA 3OEHD 3LGIA 1CA0C 4GHQA 3MH6A 3QGNB 1S84A 3KNXA 2XBXA 4I32A 1CHOG 4NSYA 1H8DH 1ZPBA 1FY3A 3LGVA 4Y71A 1MTNC 4BNRA 1QFKH 1W7XH 1SLVB 2ZFTA 4MDSA 4M9FA 4B75A 2PTCE 3ZZDA 1C1SA 4ZKNU 1VJ9U 4CR9A 1Z1IA 4Q80A 4B71A 3PROA 3SN8A 2J2UA 1QCPA 1QQUA 3T2NA 1F5LA 8ESTE 1C2DA 4BAHB 1IQNA 1WSSH 5G4BA 5I46H 1CVWH 2Y5HA 4ZXYH 3MH7A 5FBEA 4NA9H 2P95A 3SU3A 1QB1A 4DGJA 1O3BA 3BIUH 1J14A 2AS9A 3E0PB 4JYUH 1ZPCA 4Y0ZE 4Y8YA 4I8KA 1ESAA 3RXJA 1BRCE 1V2UT 1SLXB 5ABWA 2FOCA 5FBIA 5EXMA 1IQIA 2Z7FE 1GGDC 4TYDA 1C2FA 3U69H 2ALPA 2BDGA 1JXPA 3UNSA 3ZV8A 1GG6C 2FX6A 1Y5UT 3UB0A 1O2QA 3A7XA 1GBCA 3M7QA 3E3TA 3MNBA 2IJOB 3Q3YA 3A86A 4MPXA 3RXAA 1W0KD 3OU0A 1ETRH 1G2LA 1ZMNA 2HRVA 2PR3A 4YT7H 5C0UA 4H42U 1E1RD 2PP6A 1IQEA 2CJIA 1DANH 2FS8A 4GLYA 3I78A 4TY6A 1KXCA 3NCLA 1PPFE 4Y7AA 3V13A 1QA7A 2PGQB 3AK5A 1MD8A 2BX4A 2RA3A 4X6NA 1DICA 3TJOA 5K7RA 3STJA 2Z6BD 3SU0A 3P8NA 2JH6D 3CNRA 1GI3A 2QV1A 1S0RA 3M5LA 1PPBH 1EXFA 1LPGB 2AGEX 1JIRA 2GV6A 1C2JA 1D6RA 1TALA 3RDZA 1LVOA 3MNXA 1EFRD 2F9BH 2KAIB 5DP6A 1UVTH 4ABBA 1CA0B 3NWUA 3MH4A 2ZGHA 2OINA 2XC4A 4ACAA 3SQHE 5A09A 1YY3A 3N7EA 4DCDA 2J38A 4WXVA 4I8JA 1GDUA 1EB1H 1AWHB 1MTNB 3SJ9A 1O36A 3KYFA 2VVUA 5T6GA 1P3CA 4WF8A 2J4IA 4B73A 4X8VH 4MNWA 1S6HA 2GD4B 4MPWA 4WH6A 1DY9A 2FDAA 2B0FA 1F0RA 2GTBA 2FOAA 1CT0E 3M3TA 1BOQA 2A2XH 2A5KA 1BTWA 1PPCE 1W0JD 2H9HA 1P57B 1XXFA 1O2LA 3M3VA 1SSXA 1V2VT 1D3PB 3DT0H 3SNEA 6LPRA 1GDNA 3ZZ3A 3P8FA 2EC9H 1O5AB 4OS2A 2OXSA 1P8VC 3PV5A 3MQKC 3U9AH 2G4TA 1C9PA 2J98A 4B2AA 2CK3D 2Q1JA 2P93A 1SB1H 2RA0A 3PMHB 3VFEA 3HK3B 3PLPA 2KCYA 5GCHG 1AU8A 2GV7A 2F9NA 1J9CH 3EE0B 3UWIA 2DUCA 1C5OH 4FUDA 1OXGA 1V2WT 1GGDB 4ABIA 1GBJA 4DT7B 1BTYA 3LIWA 4XOJA 1GG6B 2O8LA 3F0PA 1NTPA 3SZNA 5HM9A 1MUEB 1HFDA 2FWWA 1DWBH 1O2GH 1TA6A 2GMTC 2ZU1A 2UWOA 4Q7XA 5C2ZA 5F6MA 2BVXH 5F03A 4UFDH 2TPIZ 3FFGA 5T6FA 4ISHH 3TH4H 3JZ2B 4UD9H 2O8MA 2XNDD 1F0TA 4XSKU 5DN6D 1S5SA 3E8LA 1B7XB 3E1XB 1TONA 2PKSC 2OC8A 3OY5U 3A8AA 1P06A 4Q2KA 1LHGH 1O3MA 1OKXA 2OD3B 2DE8A 4Q4LA 1MQ5A 2XBVA 1YP9A 2NU0E 3UIRA 3E0NB 1AVXA 1GMHF 1S0QA 1T8LA 1WAYB 5GJ4B 2W26A 3ZVGA 4K1EA 1SLUB 2J97A 1O5BB 4A7IB 3LONA 7GCHG 1V2ST 2PKAB 4GVUA 2IPQX 2KX4A 4INKA 1RTFB 3SBKA 4B76A 5GWZA 2GCHG 5FX5A 3GYMA 4LXBH 3EAJA 2HLCA 2ZHQH 1O33A 1TA2A 2L6OA 2WINI 2RFKC 1O2YA 2VNTA 3K9XB 2W3IA 5FCKA 3MHWU 1ZGIA 3F9GA 5L6NH 3OFND 4RKOB 4B6EA 4E06H 4NA7A 4NWKA 2PUXB 1WTGH 1C5XB 2W6JD 3T26A 3KQDA 2BD9A 2QF4A 2BDIA 3AAUA 5AHGH 5JYIA 2FYQA 1W3CA 2AGGX 1UTNA 3S9AA 1UTJA 1XUHA 3T25A 1T4VH 4ZCNA 4Y79A 1TNLA 3TU7H 3QTOH 3RMOH 1FY5A 1UVUH 3GCNA 4XFQA 1JOUB 5DP5A 4E05H 2RCEA 3F2GA 1SHHB 3BG8A 1THSH 4HTCH 3PMBB 2ZKSA 3GISB 1DDJA 3WW7A 2F9UA 3A7TA 3RM0H 2WPLS 4K60A 1G2MA 3ODDA 3EA9A 3NPSA 3TNSA 1CT4E 5DP8A 3VB6A 4O3TA 2ODYB 2EI8A 4GAWA 3SGBE 1O5CB 3BTKE 1GI7B 3E91A 1H4WA 2WV9A 3RLWH 2ZTYA 1V2TT 3U1JB 4U2WA 4IMQA 2BLVA 4YO9A 2KZ4A 2OC7A 1UTOA 3FP7E 2H5DA 3M5NA 8GCHF 3GY5A 3SW2B 1Y8TA 1YWUA 1TGBA 1L0ZA 3BIVH 1EP6A 1BMNH 3RC6A 3PLBA 3TGIE 1YPGH 2GMTB 2VIDA 1W14U 3NK8A 2G00A 3SO3A 2CGAA 1TIOA 1QQ4A 3EYDA 3SU4A 1UHBB 2Y81A 3I29A 3ZZ4A 1VZQH 1E36B 3A80A 3FVFB 5HXFA 2Q6DA 2VWNA 1TABE 1SGQE 2PKSB 1O2PA 1K0HA 2ZO3H 4ZMAH 5B6OA 3Q00A 1W10U 1O2WA 1PYTD 4SGAE 4ISNA 3RP2A 2Y82A 1HJ8A 2BD4A 3LOXA 1A3EH 1ZR0A 2V3MA 3GCOA 1OWJA 1QBNA 4MG3A 1O2IA 4YESB 3TNTA 1TRMA 1Z7KA 1HYLA 2FTMA 4BAKB 1DX5M 2QXHA 3SORA 2FX4A 5IYTA 1O2MA 2XC0A 5DPAA 1RS0A 2IJD1 2FMJA 1FPCH 5DP7A 5C1XA 4HZHA 1KLTA 1FAXA 3GOVB 2EI7A 4ASUD 2Q6GA 2GJGA 2FOGA 3GDVA 3TH2H 3GY4A 4I8HA 5C17A 2BDAA 5ESBA 5LH8A 1LKBA 1DLEA 2FOBA 4BOHA 2A45B 1G3CA 4WMEA 1GHVH 1OOKB 2ANMH 3CS0A 1AKSB 3R0FA 2XNIA 1C5NH 1Y5AT 1D6WA 1HAVA 1W0ZU 1GHWH 1K1IA 3B9FH 1BZXE 1TQ0B 4OS7A 1SBWA 3RXLA 1LVMA 2STBE 1UMAH 1AGJA 2P59A 2ANWA 1MZAA 1ACBE 4AN7A 2ZU3A 3UQOA 3RC5A 1LQDB 3SV6A 1GHAG 4OGYA 2XCFA 8KME2 3RXDA 1OSSA 2STAE 1Q2WA 2QCYA 5FX6A 1K1LA 1GMDF 2W5EA 4O3UA 3SNBA 3P6ZB 1N8OC 3Q77A 3A81A 4Y11E 1FI8A 3DUXH 4D7FA 1QRZA 4QT8C 2P3TB 1TPPA 1G9IE 1SFQB 1XKAC 4H4FA 2FLBH 4B74A 1T8OA 2WUBA 3N99A 3BEUA 4AG1A 5A2MH 1DFPA 1KXDA 2JIZD 4ZAEA 3P92A 1H9LB 1FY8E 3MTYA 1BB0B 1UJ1A 2VIWA 2FOEA 4I33A 2XW9A 2AGIX 1GMCG 5L30H 1P9SA 3ZVAA 5C20A 1GJ4H 1P09A 3UUZA 1BRBE 2FIRH 4RT1A 1G32B 1GCDA 1HJ9A 1NY22 2A0QB 3K2UA 1ZJDA 1FJSA 5JBCS 3HKIB 4IBLH 4F49A 3DSGA 3F2HA 2HVYB 1KTSB 1BHXF 2ZFFH 3PMAB 2GZ9A 3FP6E 1SQRA 1O2JA 3DD2H 4FUGA 3MI4A 3GCHC 1PQ8A 4FXGH 1VCWA 1C4Y2 1O2TA 1P12E 5ESTE 1AZ8A 1YCPH 1B0FA 2YMSD 1C1QA 1C5UA 3EGKH 3MWIU 3VXFH 4ESTE 2D1JA 2VIVA 5EW2H 3BTEE 1ZTJA 2I6QA 2WPDD 3A7WA 1E38B 3RMMH 2A4GA 3RXKA 5HIZA 2FS9A 1EB2A 1YYY1 1V2NT 1D9IA 4J2YB 3QZQA 2SGEE 4UDWH 2F83A 2WPJS 2NU2E 1WUNH 1O2RA 3AASA 3SV7A 2BY6X 3S9CA 3VGCC 3SOSA 4O03A 5GPIB 2ZDLA 1GBIA 2GT7A 5EU8A 3RXVA 1UTLM 2BY9X 1MCVA 1P2MA 2P8OC 1ZHPA 4AYYB 1C2LA 1IQFA 1MU8B 1TGCA 5ETXA 1AVWA 1OPHB 1G3EA 1DS2E 1XX9A 1XVOA 3RXPA 1GI5A 4NSVA 4ABGA 4AX9H 1G37A 1GCTC 3MO9A 4B6FA 1V3XA 1QRWA 3M61U 5E0JA 4U32A 2FI4E 2BQ7B 1BMLA 2WSSD 4P02A 1LVBA 3BTWE 1IHSH 1O34A 1N8OB 1BTUA 1HXFH 2A4QA 3VB5A 2SGAA 2ZFPH 4FVBA 4AZ2B 1EPTA 2TGPZ 2ODPA 1Z1JA 3ZVBA 1BTHH 5L2ZH 1PPGE 3UOUA 1VR1H 3C27B 3MNCA 5HIYA 2HNTE 1SG8B 2WV5A 3H5CB 4JZEH 4F48B 1ZRBA 2M2AA 3GCTF 4HGCA 1COWD 2ZTZA 3BTME 3HPTB 5HM2A 3EA8A 1NN6A 4MNXA 1Z8JB 1TE0A 1LDTT 1G30B 1HJAC 1XUGA 1BBRE 1K21H 5JB9S 3FKSD 2CMYA 2KCAA 5EQRA 1OWDA 1V2JT 2R3YA 2OK5A 2P3FH 4I8GA 2QAAA 1GHXH 1OP2A 4MLFB 1SR5C 1AMHA 1RD3B 4IGDA 1EAWA 1BA8B 1TNHA 3RXUA 3DA9B 3HATH 1WYKA 2BLQA 3GCHB 3LC5A 1LHCH 1ELAA 3RM2H 1O3OA 3ITIA 3ZZ9A 2A2QH 1VKYA 5T1VA 3G01A 4FUHA 2W7UA 1FONA 2Z9JA 5DP9A 1BUIA 3FOAA 1P0SH 2ZDMA 1GHAF 2XXLA 2F91A 5EQQA 3RLYH 4Y8XA 3A8CA 3A7VA 1ORFA 5DP3A 4D76A 3ZZ7A 3W95A 2V7QD 3VGCB 1O3JA 1F2SE 1AUJA 3CS7A 7ESTE 2BOKA 1CHGA 1XUIA 3SJ8A 3PWBA 2P8OB 4X8UH 1B0EA 1DT2A 2FTLE 2PTNA 1O30A 3PO1C 2XCNA 3F0OA 2ZCHP 1GBFA 2OBOA 2PSYA 3A8BA 3QTVH 2VGCC 1KTTB 1YPHE 3SJOA 4JCNA 1IQLA 1LCYA 5JBTA 2ZA5A 3TGKE 3BF6H 2CHAC 1ARBA 1BTPA 1GCTB 1HNEE 2A4OA 3TVJB 1ANCA 1DUAA 1DPOA 2ZP0H 5EOKA 3FZZA 4ZHAA 3L6PA 3DSOA 3TK5A 4OS5A 2ZU4A 2J9NA 1P2OA 2K1QA 3EDXB 3KHVA 4I7YH 3ZYEA 2HNTC 3N7OA 4OGXA 5IK2D 1G3DA 4K8YA 2Q6FA 2IPHA 1UTMA 1FY4A 4TPIZ 5CHAC 1OWIA 1FN8A 1GJ8B 2A7CA 2GVFA 2ZFSA 3FZDA 1HAXB 1SOZA 4XBBA 2Z9KA 1ZMJA 2HLDD 4BTIB 2HALA 2JH5D 3HGNA 2W7SA 3QN7A 4K8BA 1UCYE 2BTCE 3UWJH 2O8TA 1S85A 1HJAB 2K7XA 4NZQA 1ABJH 1SGEE 3OSYA 4CRGA 2ZGJA 2ZPSA 1SL3A 2OQUA 1Z8IB 1LVYA 5GDSH 3RU4D 5F8ZA 2FOFA 1TGSZ 2VB0A 5DO4H 1UW7A 3F9EA 1C5VA 1MQ6A 3F9FA 2AERH 1GBEA 5C67A 2WUCA 3U28C 1C1VH 1O3KA 4CRAA 1NO9H 3UNRA 1ZTLA 4TT3D 2J34A 4AG2A 1DVAH 5T3HA 2EA3A 2FP7B 1Q31A 1EP5A 4U01A 1T8MA 2GDDA 2F9OA 1BT7A 1W7GH 4ABEA 2CF8H 1GBBA 5DSFA 1TNKA 3A88A 1VITF 3S7KB 4UFFH 1C2KA 3S9BA 2WYGA 1KMHB 1ANBA 1RFNA 1D4PB 2ZQ1A 5CMXH 3UFAA 1NT1A 1QY6A 3WWBA 4X0WU 2RDEA 3P8GA 2H1UA 1O2XA 1OHHD 3Q76A 3PO1B 1OP0A 1SGFG 3BEFB 1WV7H 4IC6A 2BY5X 1RTKA 3RMNH 3KN2A 1IQJA 2ZI2H 3MU5A 2V3HH 4GPGA 1AHTH 1FQ3A 2VGCB 1Y3XA 1LPKB 1TBQH 4XDEA 2C8ZB 5FCRA 1C1OA 1OS8A 1HLTH 2CHAB 9LPRA 1O2OA 1MTSA 1MTWA 5B6LA 1L1GA 1MTVA 3OTPA 1ANEA 2ZF0H 1Y3YA 3BTFE 1UVOA 3ATIA 1V2MT 1YCPK 1A1RA 1GHYH 5C5OA 1LHDH 1J17T 1AB9C 4ACBA 5HGGA 3KF2A 3SZEA 3K6YA 1KDQA 1ETTH 4GUXA 4GSOA 4DURA 4NFEA 2ZGBH 5CHBA 5EXLA 1ZPZA 4K3JA 4A1VA 1EASA 1GJ7B 1TWXB 3R3GB 5LPFA 1NC6A 1SOTA 2ZHFH 2XRCA 2WHXA 3M3SA 5CHAB 4KTUA 1EAUA 2KCOA 3S0NA 1D3QB 2ZHDA 3UOPA 1RXPA 4RN6A 1T7CA 3TK6A 1TOMH 2KAIA 1O5DH 1TBZH 4DJZB 5JPMH 1GVLA 1VITH 2ZGCA 1C4U2 1CA8B 1O5EH 1NRSH 1RRKA 1S82A 1V2QT 1W12U 2FZZA 3CENA 1NU9A 3GS9A 1HDTH 1V2LT 1DXWA 1Y59T 4I86A 5AVDA 1FIZA 4FOUC 1CHOF 2PHBA 2VIOA 1ZGVA 3P95A 1FZZA 1O2KA 1P02A 2V35A 2ZG0H 2F3CE 2FO9A 2QGRA 1L4DA 5EXNA 2SGFE 1J8AA 3GY7A 1ZYOA 1O3CA 1P05A 1SPJA 1TFXA 4P00A 3M37A 4ZXXH 3ZVCA 3ZZ5A 4DOQA 1GJ5H 4NCYA 4CBNA 3PLKA 1O2HA 1QB6A 4YLUA 4AB8A 2ZCLP 1HCGA 3M36A 1EATA 2WPMS 2Z9IA 3ZVDA 1GI1A 3TITA 1D3DB 1ELGA 1DY8A 1TNIA 2ZU2A 1FN6A 1GVKB 1QR3E 2BZAA 1BMAA 1QJ6B 2R2MB 3PV2A 2VVVA 1XUJA 5FXLA 1MAYA 1K9OE 2O8WA 1SGFA 2BQWB 4X2XA 3SU2A 1A0JA 2QE7D 4ZROA 3MMGA 1MBQA 2WV4A 2R2WU 1P2JA 3U8RH 5GXPA 1C5YB 1S6FA 1Z8GA 1RGQA 2Z3EA 2GGVB 3LDXH 4IS5A 3OY6U 2SGQE 4GCHG 4B2BA 2FOHA 4Y7BA 1ZTKA 2XWBI 1E0FD 1PQAA 5BRRE 1C1WH 1O3GA 2W3KA 2BYAX 4NIWA 4JZ1A 4WWYA 4YTAA 3T62A 3F6UH 4MNVA 4XE4A 2FI3E 1TPAE 4NIXA 1KXFA 2G5VA 2BB4A 1JWTA 4ZHLU 1DSTA 4WMDA 2NWNA 1EOLA 3SU1A 2P16A 1A4WH 6GCHG 1GHBG 1AB9B 2HGTH 1A0LA 1GBDA 2EQNA 5FPSA 4F4OC 3OTJE 3DSPA 1N1LA 1QGFA 3SNDA 3MH5A 1CE5A 1D3TB 1FY1A 3PWCA 4ABHA 1NFUA 1ZLRA 4HG6A 1UK4A 1MTUA 1ZZZA 2LNCA 2B7DH 1P9UA 3D49H 1VGCC 4OS4A 2EEKA
chains in the Genus database with same CATH topology
2BQ6B 2AMPA 4KELA 4YOGA 1KLJH 2PKAA 1BJVA 1GJ9B 1RTLA 1UO6A 3LH1A 1U6QA 5EPNA 3LU9B 1AZZA 3RXGA 3UR6A 1GL0E 1C5MD 1BTXA 2HNTF 2H5CA 3UQVA 3TH3H 3RU4T 1BHXB 3QX5H 2VU8E 9ESTA 3SGQE 4BXSA 1JIMA 3QGJA 1O2ZA 3IWMA 4LZ1H 2Y5GA 2C8WB 3NKKA 3NXPA 1QRXA 1XM1A 3M35A 1XUFA 1GJDB 1YPJH 1LKAA 3CP7A 1EQ9A 1HAVB 3RXSA 2OC0A 4ISOA 1SGDE 1GVZA 4AYVB 1K22H 4TPYA 5FHTA 3BTGE 1KXBA 2THFB 4JZDH 2BXUH 3RU4E 1YPMH 3GYLB 4PROA 3E90B 2H9TH 1EUFA 4FU7A 1A2CH 4YLQH 1YC0A 4NIYA 1C5WB 4ZUHA 3GDUA 1Y5BT 5TJXA 3KEEA 3PMJA 1FNIA 1UVPA 2ZEBA 2AEIH 2O8UA 1C2MA 5FPTA 1TGNA 4X8SH 1HIAA 2GZ8A 3MFJA 3MU4A 3MO6A 2YOLA 4ISLA 1L2EA 4AORA 1TNGA 3JZ1B 5GCHF 1TQ7B 1HBTH 4X8TH 2G8TA 3ZZCA 2B8OH 2VIQA 4KGAA 2ZGXH 1JBUH 1EX3A 1TAWA 1SGCA 2UWPA 2EI6A 4ZKSU 4K69A 4CBOA 1UHBA 1ZHRA 3MU0A 1XMNB 4FU8A 5E8EH 5EODA 1BBRH 1EKBB 2V0BA 1XUKA 1MCTA 4X1RU 3LT3A 1AI8H 2ZNKH 1O5FH 1P3EA 3KGPA 2BOHB 3Q3KA 3A85A 3RXTA 4LOYH 3SUFA 1VGCB 3LJJA 2FODA 4A92A 1MH0A 3O8BA 7GCHF 3EBNA 2PLXA 1G36A 1GI4A 1Z6JH 4Y10E 5IDKA 1ZSLA 2GCHF 1NPMA 3A84A 1Q3XA 3ZV9A 1BDAA 3B23B 1QURH 3ZVEA 8LPRA 1SFIA 4MVNA 2VJ1A 1GI0A 4CREA 1S81A 1BCUH 4CRBA 3RXMA 4X1NU 1PFXC 2QYIA 5FAHA 3ODFA 3ATLA 2TIOA 1LO6A 1O2UA 1V2OT 1HUTH 1UTQA 1DSUA 2VIPA 1TLDA 1O3FA 3F9HA 1ESTA 1SGRE 5EGMA 1GBMA 4GCHF 2HPQH 1AN1E 3ESTA 1IOEA 1JMOH 1E35B 1UVSH 4FUEA 4UFGH 1GI9B 2Y5FA 2B5TB 4D9RA 5JB8S 3DFJA 4JK5A 1SQOA 3RXBA 1TB6H 4MNYA 5A8XA 1SVPA 1WCZA 4INLA 1HAYB 2C90B 3BTHE 5DKMA 2AIQA 5DG6A 1DITH 5PTPA 3Q3XA 1WBGB 4BXWA 3O8DA 4CR5A 1Z6EA 2J95A 4A1TA 3QUMP 1LTOA 3GY8A 4CRFA 2PV9B 3VEQB 2LIZA 1TGTA 4K1SA 1S83A 3PV4A 1OYQA 2Z3CA 1ANDA 2F9VA 1YPLH 1DE7H 1UCYH 1PPEE 2PFEA 2VVCA 3V7TA 1EAXA 2R0KA 1THRH 4BAMB 1T8NA 1NM6A 2G51A 2ZCKP 3BEIB 1NESE 1C2IA 4UONA 4ASHA 4BANB 3SNAA 7KMEH 3KIDU 2VINA 2Z94A 1AD8H 1AFEH 3F1SB 3ZZAA 3LGWA 1HAOH 1V2KT 4ZKRU 2H2ZA 1ETSH 2BD8A 4X2YA 4JZFH 3RUOA 2BD7A 4THNH 1F92A 2R9PA 2UWLA 3BN9A 1YGCH 1DUEA 2H9EH 3V0XA 2SGPE 1TRNA 1X7AC 3QWCH 1FXYA 3VPKA 2P3UB 2RDLA 4FU9A 1IQMA 2ASUB 3P8OA 5A0BA 1GBKA 2UUKB 1GJBB 5J4QA 1T31A 2A32A 4IC5A 2GX4A 1O38A 1QNJA 4Y8ZA 1EZSC 2ZDKA 3A87A 2XWAA 1E37B 3MNSA 1C5PA 1TX6A 2JETC 2ALVA 3QLPH 3GY6A 3SUDA 4KTCA 1NRQH 1AIXH 5A8YA 1C1RA 2QF0A 1Z71A 3SU5A 2G52A 3P70B 2QXJA 2V6NA 1NROH 4X6PA 4LZ4B 2QXIA 3SHCH 1FMGA 3AVZA 1SI5H 1O3EA 4A5TS 1A46H 4JZIA 1GJAB 2TBSA 1K1MA 2C93B 1HAIH 3GICB 1A0HB 2HOBA 3M5MA 1CQQA 3URCA 1HAPH 2GCTC 3SI3H 2ILNA 4XBDA 1SMFE 1Z8RA 2ZECA 2ZDNA 2ZHWH 2J94A 1SLWB 1LHEH 2VWLA 5E0HA 2O9QA 5DJ7A 4AGKA 2QA9E 2ANYA 1ELDE 1DWDH 1GMCF 1GMHG 3EA7A 1EJMA 2BLOA 2ZWLH 2BY7X 3BV9B 2XTTB 1MKWH 5F8TA 3S7HB 5JBAS 1YPEH 4YZUA 3URDA 4MPUA 1BIOA 2J92A 2IN2A 3PTBA 3LC3A 1IQGA 1KY9A 7LPRA 5JDUB 1P2NA 4AFSA 1O35A 2HWLB 3ATKA 1CSOE 3ZVFA 1AQ7A 1DOJA 4CRCA 2OTVA 1DLKB 4DIIH 3LJOA 4WH8A 4X1QU 1SQAA 1HB0B 1L4ZA 1TYNA 2VWOA 1BRUP 3D62A 1F5KU 2BXTH 2I6SA 1JRSA 2G55A 3BTTE 1ELCA 2GZ7A 3UY9A 1PYTC 1N6XA 4BTTB 3A83A 1FLEE 4BTUB 4AB9A 3BG4C 1T32A 4ISIH 1C5SA 1BBRK 1TRYA 1O2VA 2LPRA 1VJAU 3VB4A 1HPGA 1K1OA 1O5GH 1JRTA 1WQSA 1ELBA 4Y76A 2JETB 3SQEE 1A5HA 3LGUA 3RXHA 1NFXA 2Z9LA 4B1TA 4JK6A 3T5FH 3BTDE 3VB7A 3M7UA 2ZPRA 2BD3A 1BITA 1H9IE 1O3HA 1VCPA 1KDQB 4FVDA 1DWEH 1FV9A 4M7GA 1CGHA 3V12A 2OC1A 4KTSA 8GCHG 1W2KH 1AFQC 1CGJE 4O9VA 1N6YA 4AFQA 2GP9B 2TGAA 4RSPA 4ABAA 1YPHC 1SHYA 2BDHA 2QY0B 1RIWC 1P2QA 3MU1A 3SJIA 3SV8A 2BM2A 2GCTB 2SNVA 5L2YH 1L1JA 4X2VA 1CU1A 1LQEA 3ZZ6A 3I77A 2A31A 5F8XA 3QZRA 1B5GH 6ESTA 3PM3A 4AFUA 4HI3A 3GY2A 4OS6A 3SUGA 3FP8E 1ELTA 3UNQA 1EZQA 3SJKA 5T6DA 2GT8A 3C1KA 3P17H 5E2OA 1ELEE 4SGBE 3U8TH 1GHZA 3OX7U 4X6OA 4NFFA 5E2PA 1MD7A 4H6SB 2UUFB 1NRNH 4U30A 3PYHA 3KCGH 1GI2A 3MOCA 4ABFA 4Z0KA 1BQYA 1V2RT 3FANA 1HV7A 2R3UA 3SU6A 1YBWA 1TX8A 2D2DA 1SC8U 1PJPA 1KLIH 3IG6B 2NU4E 1QHRB 1F0SA 2ZTXA 4WVPE 1AUTC 1SGNE 1PPZA 4WMFA 1EZXC 2AH4X 4UFEH 3RC4A 3U1IB 1QA0A 1HAGE 4TY7A 3QO6A 2GDEH 2VWMA 4JYVH 1AY6H 1IQHA 1BMMH 2ZHEH 5AFYH 1P11E 3RXFA 4I31A 1P04A 1ELVA 1MKXH 1PPHE 1OYTH 1BRAA 1UCYK 1K2I1 4CHAC 3BG4B 1H9HE 4NG9H 4Y6DA 1P03A 1YCPM 3U98H 2B9LA 1ZMLA 1K1PA 2BX3A 3BTQE 1HGTH 1ZOMA 5LPEA 3QK1A 5TCAA 1NFYA 3U8OH 3BSQA 2PWXA 1XKBC 3SGAE 1NU7B 1QL8A 4BAQB 1ARCA 5C3NA 3EQ0H 1O0DH 2AIPA 4RKJB 1ABIH 1BJUA 1GMDG 5HMAA 1CT2E 2HPPH 2ESTE 2C4FH 1SGPE 3L3TA 5H4IB 4ABJA 2BD5A 1DWCH 4DW2U 4AOQA 1LMWB 5I25A 5TCCA 4ZHMU 1GDQA 3GY3A 1AE8H 1W11U 1AFQB 1SQTA 3A7YA 4X6MA 3TPIZ 1GJ6A 4JYTA 1K1NA 4CH8B 1J15A 2GKVE 1EJAA 1O31A 2JKHA 1RIWB 2A1DB 3K6ZA 4AFZA 1HAZB 1XXDA 4YOJA 1GI6A 2RG3A 4TWWA 1P01A 2Y7ZA 3SUEA 3SV9A 1WU1A 2NU3E 3M7TA 4J1YA 1A61H 1IHTH 1K1JA 1O32A 1O3LA 1ID5H 1C5RA 2ZZUH 3TIUA 1GBLA 1FUJA 1QL9A 4H6TA 3ZZ8A 2BVRH 1UK2A 1C5ZB 2BVSH 2UUYA 2QXGA 1QIXB 2ODQA 4KP0A 2ULLA 1K28D 3ZYDA 4O97A 4MPVA 1C1PA 3KQBA 4INHA 2BDCA 4R8TB 2XBWA 1TPSA 2ZQ2A 1Y3WA 3KL6A 1ZJKA 2CV3A 2BMGB 2PSXA 3SNCA 2FM2A 4DIHH 3O8CA 1PQ5A 1V2PT 1YLDA 4LK4A 1C1NA 3FAOA 4IN1A 1GBHA 5FPYA 4WXIA 1HIAB 2FI5E 4CRDA 1TX7A 3T29A 1Y3UA 2ZFRH 1A7SA 3AW0A 1QJ7B 3LGTA 2A5IA 5JBBS 4Z6AH 1SGIB 3SV2H 2YNAA 2OUAA 4CHAB 1WQVH 2BY8X 1MMJN 4GHTA 2F9PA 5LPRA 5DK1A 1ZSKA 3TGJE 1O39A 3A7ZA 1YF4A 3KQEA 1MKWK 1AO5A 3S69A 5LGOA 2A4RA 1TMUH 3AAVA 2VH0A 3F68H 3VB3A 3ATWA 4IN2A 2OLGA 4JMYA 2OP9A 2SGDE 3LH3A 3ZZBA 1P2IA 2Z9GA 1O2NA 2M5TA 4FUBA 4VGCC 4A1XA 3RXQA 1LHFH 1W13U 1AE5A 2AFQB 5EQSA 3H7TA 1F7ZA 3KQCA 1NRRH 3DFLA 4KKDA 4ZH8A 1E34B 2FOMB 1EPTC 1LPZB 5J4SA 1C4V2 3TK9A 1QL7A 2OQ5A 4NWLA 3E16B 2PUQH 1FAKH 3GCTG 4OS1A 3T28A 4FUJA 5C1YA 1DXPA 2BD2A 2C8XB 1UTKA 1O2SA 2AMDA 1XVMA 4R0IA 2A7JA 5E0GA 3VXEH 1TMTH 1QJ1B 1IAUA 1ESBA 3MU8A 6CHAC 5EW1H 2ZDVH 2XBYA 5AF9H 2SNWA 1O3AA 4D9QA 2SFAA 1IQKA 1H1BA 2ZIQH 2ZU5A 1NS3A 3STIA 1W8BH 2Y6TA 2ZDAH 1GBTA 1DM4B 1NZQH 4NIVA 1SGTA 2CN0H 2FPZA 4CH2B 3TJNA 4YT6H 2Y7XA 3UTUH 4AGJA 2NU1E 1KSNA 4D7GA 1ZSJA 2R0LA 2BZ6H 3PTNA 1QBOA 1YLCA 1FIWA 3MO3A 2AYWA 4XBCA 4IMZA 3HGPA 5BPEA 3TLOA 3IITA 5DP4A 2OBQA 2G81E 1MAXA 3A82A 3D65E 3LGYA 4Y0YE 1M9UA 1GPZA 4DY7B 5SGAE 1YKTA 2ZPQA 4IW4E 3HK6B 1TPOA 2C3SA 4FUCA 1V6DA 4K2YA 3TJVA 3A89A 4NA8A 2IOTA 2BHGA 1A5GH 1EJNA 1NRPH 1AKSA 1YPKH 5C1UA 2ZC9H 3A8DA 1C2GA 4MTBA 3W94A 3MYWA 3QDZB 1BTZA 2HVXA 3GDSA 4DG4A 3HKJB 1W0YH 1UTPA 4I8LA 1HRTH 1WOFA 1ZRKA 4Q7YA 3ELAH 1C1MA 1TNJA 4VGCB 3T27A 1T4UH 1NFWA 5C5NA 1GL1A 3DHKH 4X1PU 1C1TA 2Y80A 2BLWA 4UE7H 1CBWC 3RXRA 1GJCB 1GBAA 5DGJA 1EPTB 6GCHF 2XC5A 1AVGH 1GHBF 1TOCB 5A0AE 2ZFQH 2WPIS 1VCQA 1F0UA 1C2HA 3ATMA 4E7RG 3RXOA 2YNBA 2WPKS 1A3BH 4E7NA 1KYNA 1MKXK 1OP8A 4YOIA 4TWYA 4K5ZA 1ELFA 1C2EA 4NZLA 1H8IH 1O3DA 3UR9A 4HFPB 1OX1A 3RXCA 1C5TA 2G4UA 4BAOB 2XYAA 4Q7ZA 1CGIE 6CHAB 1FPHH 1O3PB 4ZKOU 4YM9A 2PGBB 1F5RA 1A5IA 4FUIA 5HYOA 1C9TA 2TGDA 2WPHS 4NGAH 2QF3A 2BDBA 1O3NA 3OYPA 3NZIA 3L33A 2AMQA 4WY3A 4B2CA 1TMBH 3K65B 1O3IA 1QTFA 2G5NA 5EG4A 3ENSB 3SHAH 1FDPA 3D23A 2JH0D 5A8ZA 4MQAA 4FUFA 3LKWA 3LPRA 1KXEA 1HAHH 2PW8H 1UK3A 2P94A 4K1TA 2A5AA 3SI4H 1SGYE 1THPB 1VITG 2A7HA 3H7OA 1TBRH 2V3OH 2FEQH 2QIQA 3WY8A 1O37A 1MU6B 3O8RA 3B8JA 2FESH 1WTHD 3PB1E 1P2KA 2ANKH 1OWEA 3V3MA 3E6PH 1ZHMA 2D8WA 1L1NA 2FXRA 2Z3DA 3UREA 1CO7E 2D26C 1OWKA 1MZDA 1PQ7A 4DVAU 4WJG2 1QBVH 3RXEA 4A6LA 1OWHA 2CF9H 2BDYA 3RXIA 2QN5T 3RMLH 4X1SU 5K0HA 5GIBA 1Y3VA 2TRMA 4D8NA 1P10A 1AWFH 5AFZH 1C5LH 2QC2A 2H6MA 2WYJA 4X2WA 3AW1A 2DE9A 1RJXB 4ABDA 5A0CA 5CE1A 2UUJB 1J16A 3NUMA 3TJUA 1EOJA 1HXEH 1KXAA 2OCVB 1G3BA 2VH6A 1MBMA 2FLRH 2TGTA 1C1UH 1CBWB 4UEHH 1GI8B 1KIGH 3M5OA 1GWAA 5EPYA 1INCA 2C8YB 3UPEA 1QB9A 2FYRA 1EAIA 1C5QA 1EZUC 1YM0A 2CXVA 3LGIA 1CA0C 4GHQA 3MH6A 3QGNB 1S84A 3KNXA 2XBXA 4I32A 1CHOG 4NSYA 1H8DH 1ZPBA 1FY3A 3LGVA 4Y71A 1MTNC 4BNRA 1QFKH 1W7XH 1SLVB 2ZFTA 4MDSA 4B75A 2PTCE 3ZZDA 1C1SA 4ZKNU 1VJ9U 4CR9A 1Z1IA 4Q80A 4B71A 3PROA 3SN8A 2J2UA 1QCPA 1QQUA 3T2NA 1F5LA 8ESTE 1C2DA 4BAHB 1IQNA 1WSSH 5G4BA 5I46H 1CVWH 2Y5HA 4ZXYH 3MH7A 5FBEA 4NA9H 2P95A 3SU3A 1QB1A 4DGJA 1O3BA 3BIUH 1J14A