1TPAE

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase/inhibitor)
molecule keywords ANHYDRO-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpaE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpaE02
2PTNA 1WSSH 1LCYA 1P8VC 3QN7A 1S84A 1O2TA 1GVKB 1Y59T 1C5LH 3FZDA 2J34A 2A45B 3MNBA 3D62A 3FVFB 1B0FA 2OQUA 4B2CA 2BYAX 2NWNA 3M5MA 1VCPA 4X2VA 4WWYA 4ABDA 1O2HA 3SHCH 1AZ8A 1YPMH 1O2OA 3HK3B 1O2WA 3VGCC 1QA0A 1JRTA 3EA7A 4MQAA 2BDBA 1GL1A 1HAGE 1MCVA 1TLDA 3DD2H 1HFDA 2KAIB 2Z3EA 3RXMA 3LGTA 2Z3DA 1EUFA 3GY3A 1V2WT 1A0HB 1GI8B 1UTOA 1TFXA 4MNYA 2ZDKA 1CA0C 3LGWA 1ELEE 2GZ9A 1LQEA 5L30H 2A7CA 1SG8B 6GCHG 1QBOA 1UCYE 2Q6FA 2ANWA 1QB1A 2FX6A 2KAIA 2VB0A 1OYQA 4BXSA 1FAKH 2EEKA 3P70B 1J8AA 1RD3B 3KQCA 2G00A 1HIAB 3ZVEA 4TPYA 1MAXA 1SVPA 2ZCHP 1HCGA 3GYMA 2AMQA 2BY5X 3ZV8A 4JK6A 2Y7ZA 3U69H 1DFPA 3V7TA 2BOKA 5C2ZA 1DX5M 3ENSB 3SZNA 5FCKA 3U8TH 2BD9A 3SNBA 2THFB 5JPMH 2Z3CA 2PLXA 3A7WA 4DT7B 1MTVA 2P93A 3V0XA 4K69A 3A7YA 2GGVB 5FHTA 1PFXC 1B0EA 1MKWH 2J38A 1P10A 2J95A 1Z71A 1DE7H 1G32B 1YC0A 2PV9B 4BANB 2QF3A 4Y7BA 2VIOA 2JKHA 4UDWH 2HNTE 2NU2E 1P2OA 3EDXB 2JETB 1SC8U 4KGAA 1PQAA 3HGPA 1FY4A 1NFXA 1OWEA 3RLYH 5F8TA 1O3LA 5ABWA 3TLOA 4ABEA 1PQ7A 3E6PH 3PMBB 3ZZ7A 2TGPZ 4NIYA 1NS3A 1K9OE 1TNKA 3GICB 3PLKA 1NC6A 3T2NA 3P92A 1AFQC 1MTSA 2OC1A 4FU9A 1E38B 1YBWA 2WUBA 2WYGA 5EPYA 1TE0A 2BD8A 3QWCH 3ELAH 4X1SU 1EPTB 1GBTA 2RA3A 1MTUA 1NFUA 4NWKA 3SQEE 3SNCA 1C1RA 1AUJA 4OS7A 2YOLA 1TOMH 4X2WA 2ZHQH 4ISNA 3A8BA 1A1RA 4K1EA 1UCYH 1SLUB 2FPZA 1O2XA 1BBRE 1DWEH 1ABJH 3FP6E 3HATH 1AE5A 1EPTA 1FONA 3EYDA 1A5IA 1XVMA 2ZQ2A 1FY1A 1LVMA 3P8NA 4XE4A 3M7UA 1IAUA 3FP7E 1RIWB 2ZG0H 3A8AA 3S9AA 4O3TA 4UEHH 1VJ9U 3L3TA 1YKTA 3A80A 1O3PB 1K21H 3SHAH 1LHGH 2VVVA 3HGNA 2F9UA 3U9AH 1GJCB 1GBJA 1YPLH 1ESTA 3MMGA 2ZU1A 4SGAE 1H8IH 3UREA 4U2WA 2PWXA 1C1MA 1GI1A 1WQVH 2BLOA 2H9EH 7GCHF 3E91A 1K1LA 1GHZA 1YM0A 1K1PA 1FDPA 4E06H 4Q2KA 1NRRH 1L4DA 2K1QA 4WMEA 1ESAA 5EG4A 1SMFE 4NA9H 3PMHB 3VPKA 2HRVA 1FXYA 1TNGA 4UFFH 1OXGA 3JZ2B 1GBMA 2F9BH 1W0ZU 4YOIA 1SGDE 4ISIH 5FPYA 4JZFH 2QCYA 3Q77A 9LPRA 3P6ZB 4AFZA 2Y7XA 3Q3XA 1T31A 5L2YH 3U1IB 1SLVB 1ZMJA 2Q6GA 2WPKS 2OBQA 4LZ4B 1PQ8A 3E0NB 1GMDF 4TWWA 2FM2A 1DSUA 1PQ5A 5T3HA 1SHYA 1AKSB 2EA3A 1V2ST 2GCTC 2XWBI 4D76A 1AB9B 2BXUH 3O8DA 3LIWA 3GY6A 2FOAA 4Q7XA 1S83A 1BBRH 1P2MA 2QIQA 1GJDB 1GHVH 4K8BA 1KYNA 2ZKSA 1WTGH 1AIXH 3SGQE 2Z6BD 3KF2A 4I8KA 1AKSA 1BTYA 3MH4A 1UVUH 1DY8A 2AGEX 1MTWA 1RGQA 4YZUA 1THPB 2PFEA 3KHVA 1T8LA 3A7TA 1HJ9A 1KXDA 2VWNA 1B5GH 2EI7A 2RG3A 5AHGH 2WPIS 4Y8YA 3F9GA 2Y82A 2BHGA 1ELAA 5K0HA 3GCTG 3V13A 4AB8A 3P17H 4Y10E 2P3UB 1K1NA 1NM6A 1SGYE 3AW0A 3EGKH 1TONA 3TNSA 4NFEA 2AMDA 1XVOA 2A32A 4FUCA 5SGAE 1HAVA 1AHTH 4UFGH 3UPEA 1GI9B 3LONA 3PYHA 3RMMH 1VZQH 5A0AE 3BTEE 3SJIA 2BD3A 4X1RU 4HTCH 2F9VA 2XBYA 4R0IA 3SU3A 1KXCA 2C8YB 2GTBA 2UUFB 1O3NA 4XBDA 1EAUA 1EZSC 2ZGCA 5BPEA 4WVPE 3SNDA 4X0WU 1C5SA 2GV6A 1FIWA 1UTJA 1DXWA 4CR9A 3S7HB 3LC3A 2ALPA 2CN0H 1B7XB 5HM2A 1BRCE 1C5QA 1OX1A 1TOCB 2DE8A 2HPQH 2ZFQH 5CMXH 4E05H 4X6NA 1A3BH 1RS0A 4ZAEA 1G36A 4CRFA 3GY4A 3O8CA 1FZZA 1GJ4H 2SGQE 5DO4H 1EB2A 2QAAA 1H1BA 2PTCE 4HZHA 1XUIA 3LDXH 3SJ8A 1A61H 1O2JA 1S81A 4A1TA 1HYLA 2VH6A 1HXEH 2ZFFH 1C1NA 1H4WA 1N6XA 2G4TA 1E36B 3VXFH 1KDQB 1ELDE 1YF4A 1O35A 1KTTB 1GI7B 2SFAA 4IMZA 1MTNC 1P12E 2ZP0H 2QC2A 5LPEA 2W3KA 3LH3A 3KCGH 3QZQA 1HAHH 1N1LA 5TCCA 1BB0B 3RUOA 2VWMA 4CH2B 4IBLH 2FOHA 4B76A 1SGQE 1NO9H 1U6QA 2ZWLH 1FI8A 1LPKB 4KTSA 4NFFA 1Q3XA 1C2KA 2FP7B 4UFDH 1DDJA 1MCTA 2XBWA 4FUDA 2D1JA 4ZXXH 1L1GA 1TGBA 3RXSA 3RXRA 4B71A 1HDTH 3SU0A 2Y6TA 1RTLA 2FOCA 4LXBH 4DY7B 1TPAE 4KTUA 4YT7H 2JH0D 2EC9H 2A7HA 5JB8S 1Z6EA 3L6PA 1P2IA 1MU8B 1L0ZA 4TPIZ 1VITG 3TIUA 5ETXA 5I46H 4MPVA 1G3CA 3RXAA 1Z8IB 1IQNA 3SJKA 3BEIB 1Y8TA 4Q7ZA 1TGTA 3NCLA 4Y11E 2P8OB 3OYPA 2B5TB 2VINA 3RXUA 2FODA 1T8NA 4BTIB 2OC0A 3VEQB 2BMGB 2ZFRH 1YCPK 1O5GH 1O3IA 3IWMA 2XC0A 2ZTXA 3PMJA 2GD4B 2VIQA 1BTPA 4AX9H 1ESBA 2XW9A 4BOHA 1AY6H 1W10U 3BG8A 4INHA 3UOPA 1CHOF 3GCNA 8LPRA 1IQHA 3PLPA 2O8LA 4E7NA 1GI2A 2DE9A 1QRZA 3RP2A 3NZIA 3ESTA 2AMPA 1SOZA 1SLXB 3I77A 2ZGXH 2O8MA 2WPMS 2GMTB 4ZROA 1D3DB 3RXVA 3STIA 1KIGH 8GCHG 1SGPE 4Y7AA 1EXFA 2GT7A 1HAYB 1OWIA 2J4IA 1FMGA 1FNIA 2F91A 4ABAA 2FOBA 5H4IB 2RCEA 1C5XB 2BVSH 2PKSB 3CS7A 1FN8A 1PYTD 1SQTA 1NPMA 1UTPA 1LVYA 1BTHH 3RU4T 1O5EH 1P02A 3SUDA 3AAVA 4NA8A 1QIXB 2J92A 5F8ZA 2XRCA 3SI4H 3UNSA 4RSPA 1GHBG 2CV3A 3SQHE 3VB5A 1CT0E 2G5VA 5C5NA 2W5EA 1YPGH 1ZMNA 4Y6DA 1O33A 2AERH 3DFJA 4INLA 3A84A 2GT8A 3SUEA 1NT1A 4X6PA 4CR5A 2G8TA 5J4QA 4TY7A 2FOFA 1UK2A 1CO7E 3F9HA 3ZYEA 3A7VA 1TABE 3KQEA 1VCQA 2A4QA 4ABJA 2OINA 2VIPA 2PGBB 4DGJA 2BD7A 1O2YA 4K8YA 1UJ1A 3E0PB 1SR5C 1J9CH 3AASA 4O03A 2FZZA 4B74A 2JETC 2V3OH 4WMDA 3UQOA 1CGIE 1IHTH 2I6QA 3PM3A 4K1SA 2ANMH 2SGFE 3M36A 1V2NT 4MNXA 1IQJA 1BOQA 2VIVA 1T32A 3SU6A 1P11E 4AG2A 1K1IA 1FAXA 3SU5A 4GSOA 1EPTC 1EZQA 1L1NA 1E0FD 1F0TA 2VIDA 2HALA 2NU4E 1C5OH 1D9IA 1K2I1 3ATLA 5EW1H 4H6TA 1PJPA 1UTKA 3TK5A 3ZVAA 1T4VH 1PPFE 1QGFA 2ZPQA 3VB6A 5DP9A 2C93B 3SV6A 2ZQ1A 1NFYA 1SFIA 3SORA 4Y79A 2R0KA 1GBEA 2FTLE 3BTGE 2C3SA 1EATA 4MPUA 3LT3A 1VGCB 2AIQA 2VJ1A 4J1YA 3GCOA 1N8OB 1SI5H 4HFPB 1RIWC 2C4FH 1CHGA 4DW2U 3ZZ3A 3E3TA 1HAPH 1ORFA 3OY5U 3NPSA 4DJZB 5C1XA 3MNCA 1ZHMA 2ODYB 4LOYH 2AIPA 3SN8A 3RXDA 1O2KA 3BV9B 1KXEA 4JK5A 1G3EA 4CHAB 1DANH 3A8CA 2AS9A 2CGAA 2UWPA 1O2GH 1TX8A 3A83A 1YP9A 4D7FA 4HI3A 1OWHA 4YM9A 3ODDA 1BJVA 1QCPA 1EAIA 1HRTH 1Z8RA 2BY8X 1BMLA 3DHKH 3OTJE 3A7XA 4K3JA 4NZLA 1CT4E 1O5FH 1PPBH 4FU8A 2CHAB 4Z0KA 3RU4E 4GHQA 5B6OA 3MTYA 4WF8A 2ZHFH 5GCHF 1SL3A 1K1JA 1TRYA 2FEQH 1D3PB 1YPHE 5K7RA 1GI3A 1FPHH 2ZEBA 1LPGB 1RJXB 2BQ7B 2PKAA 3RC5A 1IQEA 4GUXA 2WPHS 1QQ4A 4RKOB 4CRBA 3GOVB 3JZ1B 3T29A 5FXLA 3FP8E 1E37B 1EAWA 1AB9C 1ZZZA 4AORA 3DFLA 1GHWH 1TIOA 4CBNA 1YYY1 1O5BB 5HM9A 1TPPA 2A0QB 5GJ4B 3W94A 2FI3E 4X1PU 1Z8GA 2BVXH 3V12A 2ZCLP 2F83A 4A6LA 3GY7A 2ZFTA 3LGYA 4JCNA 5GXPA 3MNXA 3D49H 3E8LA 2GZ8A 1NRSH 2GVFA 1SGCA 2FLRH 1YLDA 2JH5D 2ZGBH 1VITH 2BLWA 5LPRA 1ZHRA 1QRWA 1C4Y2 2A4RA 1NZQH 1W12U 3U8OH 3BIVH 4ZHLU 4K2YA 4XSKU 4AFUA 3S7KB 3M3VA 1GMHF 1AN1E 3TH3H 1THSH 1TAWA 1GVZA 1MMJN 2HOBA 2WYJA 5EODA 3RMNH 2HPPH 3ZVBA 1G3BA 1ELTA 5DGJA 4FU7A 5AF9H 4ZUHA 5E2PA 4JZIA 3SBKA 4CBOA 2C8XB 5I25A 2BD4A 1IQLA 1PPGE 6LPRA 1UCYK 4CRCA 4NWLA 5HGGA 3H7OA 1V2VT 5A0CA 2AEIH 1GBCA 5A09A 2XC5A 3F9FA 4X6OA 2ZFPH 1MD8A 1CGJE 4FUGA 1FUJA 1YGCH 5G4BA 3SNEA 1RTKA 3IG6B 3RXIA 1BMAA 1MD7A 1BTWA 2B9LA 2ZDLA 4I8LA 1A7SA 2PGQB 3PWBA 1ZJDA 3F68H 2Q1JA 4CH8B 2GV7A 3QZRA 3ZV9A 1ZMLA 4OS6A 4DCDA 3NXPA 4FUBA 3BTTE 1BZXE 1ACBE 1O3GA 5GPIB 1DWDH 1DS2E 3GY8A 4NCYA 1IQKA 3LOXA 3SUGA 4I32A 2BY7X 1NRQH 3R0FA 2VNTA 1EZXC 1YLCA 1WOFA 1JWTA 1Z1IA 4Y8XA 1LMWB 1Z7KA 1AVWA 4IC6A 3QX5H 3FFGA 1L4ZA 3BEUA 4B2AA 5TCAA 2HLCA 3FANA 1O3JA 1JIMA 4FUJA 4TY6A 3U98H 1ARCA 1O39A 1QTFA 1EAXA 1P06A 4AFQA 1T4UH 2F9NA 1GGDB 1DPOA 4J2YB 3BTWE 4JZDH 1WCZA 1V2JT 4KKDA 3ZZAA 5JBCS 1GDQA 1S0QA 3O8BA 2UWOA 4Y71A 1UVOA 3HK6B 1DY9A 3MWIU 1BBRK 1GJ7B 4ZKNU 2ZGJA 3LPRA 4AOQA 1XM1A 3TJNA 1RTFB 3OY6U 3M7QA 5FBIA 1LKBA 3T26A 1F5KU 2WV5A 4ESTE 5C67A 3S9CA 5F8XA 3LC5A 1C2LA 1NRNH 2PUQH 1ZPCA 3QTOH 2ZDMA 4BXWA 1QR3E 4UE7H 5C20A 2H5DA 2P8OC 2B8OH 1P2NA 1TGNA 5FPSA 3S69A 2QXHA 2BQ6B 1FV9A 2R2MB 1C2DA 3PROA 1G2MA 3UR6A 4MDSA 1O2IA 1AD8H 2QXIA 1RXPA 1QY6A 1L2EA 2YNBA 1GBAA 1V3XA 1FY5A 1QB6A 1TBZH 3UUZA 1HAVB 3NK8A 2FX4A 3MOCA 3SV2H 3UWJH 2ZTYA 2OD3B 2BZ6H 4FVBA 4AG1A 1GBDA 4H4FA 1IQIA 1HJAB 2RDLA 6CHAB 3DT0H 2ZF0H 1FY3A 1EB1H 2FOMB 3BTKE 3M7TA 1O3FA 3I78A 1ZRBA 5DP8A 3BEFB 1TA6A 1O2ZA 4FUEA 3QGNB 5A8YA 1O3AA 4IMQA 2UUKB 1MBMA 1QHRB 3UNQA 2QXGA 1XUKA 3MU4A 4NSYA 3VXEH 4CRAA 3RXLA 1XX9A 3FZZA 4NSVA 1INCA 4E7RG 1CBWB 2GMTC 1J15A 1GI4A 1O2RA 1SSXA 1OWDA 3ZZBA 1LHEH 7GCHG 5CE1A 2P16A 5C1UA 3RC6A 5A0BA 2ZDNA 1ABIH 1QBNA 1O2VA 1QL9A 1ZTJA 2G52A 2PW8H 3MO9A 2D8WA 1C5VA 1TWXB 4BTUB 2PKSC 1GHYH 3H7TA 1NY22 2R3UA 3MU5A 5CHAB 1LO6A 3F6UH 1UHBB 2AH4X 2BDHA 2ZDVH 2ANYA 4AYYB 1WV7H 1F2SE 2QV1A 1QJ6B 3URDA 5DKMA 2CJIA 3TJOA 3M61U 1ARBA 2CXVA 1V2TT 3KN2A 1GMDG 1RFNA 2XNIA 3HPTB 3UTUH 1MQ6A 2HNTC 2TRMA 3ATKA 3SV9A 2QYIA 2R9PA 1UHBA 3ATWA 1W14U 1Z1JA 1GBLA 1T8OA 1ETRH 3S9BA 2H9TH 2J9NA 1GJ8B 1V2QT 3SI3H 1S6FA 1ZYOA 4YLQH 2EI6A 1NRPH 1C2MA 1QL8A 2ZA5A 1FPCH 2FDAA 1EX3A 4WH8A 1MKXK 1EKBB 1MBQA 4YOJA 3RDZA 3H5CB 4NIWA 2XYAA 1V2PT 3E90B 4GVUA 1GDUA 1X7AC 1HAXB 2BLVA 3TITA 3GCHB 1TMTH 2BD2A 4BAKB 2FXRA 1WBGB 4IC5A 1P09A 1ZSKA 5EU8A 3SW2B 3BF6H 2OCVB 2ZU2A 2AFQB 2VGCB 1ETSH 1CQQA 1UTNA 3MH5A 1DITH 2A5IA 4F49A 2P59A 1ELBA 3PO1B 3P8FA 3GY5A 4YO9A 1NTPA 4QT8C 1W11U 4JYTA 3QK1A 3RXHA 1UK3A 2HVXA 1OS8A 2WPJS 4GCHF 3K2UA 1ZHPA 5FX6A 1SBWA 1GBHA 4B75A 3ZYDA 2G5NA 1TYNA 1KXFA 2BDGA 2F9OA 4AGJA 2Q6DA 1IQMA 3MI4A 4CRGA 1O0DH 1T7CA 5EXMA 3ZZ4A 2O8WA 1GMCF 1VGCC 1E35B 3MO3A 1N8OC 2HNTF 2CF8H 4TWYA 1EASA 4AFSA 1KLJH 3SU2A 1W8BH 2TGTA 1XXDA 4D9QA 1HAZB 4X6MA 1J14A 3KEEA 4A5TS 2BY6X 5PTPA 1GG6B 1O3MA 3B23B 4THNH 2HWLB 3A7ZA 1C5PA 4CHAC 1GBKA 3M3SA 1A46H 3CENA 1DM4B 5HXFA 1FY8E 5BRRE 1WU1A 1ZTLA 2P3TB 4MG3A 2GCHF 4HGCA 5F6MA 5AFYH 5E0GA 4H6SB 4XBCA 2JH6D 1TX6A 4U32A 1IQGA 1OKXA 2TPIZ 3V3MA 1QJ7B 3MH7A 2CHAC 3SO3A 1K1MA 3ZVDA 1SLWB 3O8RA 5EQQA 2M5TA 1HB0B 2WINI 1C2IA 1XMNB 3BTME 1F92A 1S0RA 1G9IE 1W3CA 3LU9B 2G4UA 1YCPH 1DWBH 2IOTA 2QF0A 2PSXA 3GDUA 1CU1A 4X2YA 2FWWA 8KME2 2A1DB 1V2LT 1HJ8A 5DP3A 3TGIE 1GBBA 2F3CE 1AFEH 1SQAA 2ZHDA 1ZLRA 2VU8E 1GHAF 4ASHA 1Y3WA 1YPEH 1O5DH 1O2NA 1S5SA 1A2CH 2UUYA 1GWAA 2XBXA 1UTLM 1DOJA 2ZFSA 3MNSA 3T25A 1NN6A 4UFEH 3SGBE 1UVSH 1DLKB 3ZVFA 1PPCE 3R3GB 3ZZCA 2Z9GA 4RN6A 1TQ7B 1Z6JH 4GAWA 1GCDA 2ZU4A 1QJ1B 3UY9A 2A2XH 2W3IA 3TNTA 3GDSA 1GI6A 3CS0A 4CREA 2XBVA 1GJ5H 4XOJA 7KMEH 3SOSA 5A2MH 3KNXA 2LNCA 4NGAH 3ODFA 5EPNA 1ELGA 4MPWA 1LDTT 1P03A 4MLFB 3ITIA 1BMMH 2GZ7A 2IPHA 3L33A 1RRKA 2BX3A 4WH6A 1F5LA 4WXIA 1ZPBA 1F5RA 1P2JA 1A0JA 1CHOG 4GLYA 4KP0A 1NU9A 2PHBA 3M35A 4FXGH 4Q80A 3OX7U 1C2GA 1F0UA 2WPLS 2QA9E 4WJG2 1TGSZ 1C1VH 1C9TA 1AQ7A 1SGEE 2IN2A 3RXQA 1SFQB 1C5MD 1QNJA 2UWLA 2XWAA 1YPJH 1WQSA 2FIRH 3VB3A 4ISHH 1PPZA 1JMOH 1UMAH 2D2DA 1KY9A 2FS8A 7LPRA 3RM0H 5LH8A 4JYUH 1OYTH 1TPOA 1OSSA 3Q00A 1SHHB 2Y81A 1QQUA 1O2PA 3A86A 5C1YA 3PWCA 1V2MT 3AAUA 3A82A 3DA9B 1G37A 3EE0B 3MU1A 4IGDA 2OQ5A 1SPJA 3ZZ8A 6GCHF 3K6ZA 1ELFA 1ELCA 1Y3VA 2BXTH 2V3HH 3CP7A 1QRXA 1TALA 1ETTH 3LGVA 2FOGA 3Q3KA 1BTZA 3RXJA 2BM2A 1M9UA 4VGCB 1DUAA 1ZSLA 2V6NA 1EJAA 3SU4A 3ATMA 3QDZB 1Z8JB 3TJVA 3HKIB 2G55A 2GP9B 3BSQA 1KXAA 1MZDA 1C1PA 2ZO3H 1HXFH 1HUTH 4ZHMU 1AI8H 2EI8A 3NWUA 3BG4B 1QL7A 3RXOA 1HGTH 2ZHWH 3GY2A 3A81A 3RMLH 3UR9A 4ZKOU 1LHFH 3LJJA 2PKAB 1GGDC 1VCWA 2SNVA 3BTDE 5TJXA 2ZPRA 3LGIA 3PLBA 3UFAA 5JBTA 2ZTZA 2QN5T 4GPGA 1SGRE 1G3DA 2BQWB 2BOHB 1XUFA 3GYLB 1MZAA 2SNWA 3SJ9A 1F7ZA 1THRH 1AGJA 1BCUH 1C5RA 4ISLA 2ZI2H 3RXPA 2FO9A 2OLGA 1JRSA 1S85A 1FN6A 2STAE 2BY9X 1DVAH 1TNIA 2P95A 1AUTC 1P2KA 1IOEA 1BTXA 1ANCA 1LVOA 2H6MA 2B7DH 1HPGA 1A0LA 1HBTH 5C5OA 2FTMA 3M5LA 5L6NH 2A5KA 3MU0A 4X8UH 4X1QU 1MKWK 5DP4A 3RMOH 1DLEA 1XKBC 1V2KT 2H2ZA 3GDVA 4AGKA 2FLBH 1P01A 3RXFA 3VFEA 1V6DA 1BHXB 2Y5FA 4I8GA 1OPHB 2ZGHA 4LK4A 7ESTE 1HJAC 3KIDU 4JYVH 2GDEH 6CHAC 1FLEE 1C2HA 1W2KH 3UQVA 3P95A 3UOUA 3ZZDA 1Y3UA 5GIBA 4WMFA 1HLTH 1GJ6A 4Q7YA 3IITA 1O37A 5ESTE 5ESBA 1TPSA 5F03A 5E2OA 1OP0A 1P04A 2RA0A 2ZPSA 1GPZA 1OWKA 1O2SA 1CBWC 8ESTE 2Y5GA 1DT2A 2ZCKP 3EA9A 1O3OA 1MH0A 1JXPA 4I31A 3WY8A 1O2MA 1HIAA 4U01A 4X8SH 1Y5UT 1EP5A 3C27B 5HMAA 4IW4E 3TJUA 1JIRA 1KTSB 3KGPA 5FX5A 1WTHD 5CHAC 1LVBA 1DSTA 2H9HA 4I8HA 4OS1A 5GCHG 1C5NH 1S82A 2QGRA 1TBRH 2XC4A 3A8DA 4BTTB 4X8TH 2FI5E 3TGKE 2BTCE 4OGXA 1TB6H 1TX7A 2ODQA 2Y5HA 4B1TA 1BMNH 1EOJA 1ELVA 4OGYA 2LPRA 3GISB 1C5WB 1XUJA 1TA2A 1BQYA 1CA8B 1SGNE 3MH6A 4O97A 4LZ1H 1XXFA 1P05A 2NU0E 1QB9A 2W26A 3E16B 1W13U 1UO6A 1C5YB 3PV4A 4ZH8A 4A7IB 1SB1H 2R2WU 1P9SA 2OXSA 1UK4A 4FUIA 1A4WH 1XUHA 1ANBA 1TBQH 1LKAA 2P3FH 5DP7A 1D6RA 1L1JA 2A4OA 3GCTF 1AVGH 1QA7A 5J4SA 1IQFA 2UUJB 4ZMAH 5HYOA 5JB9S 3GCHC 3SJOA 1DICA 1O3HA 2D26C 5EQRA 5A8ZA 1C4U2 1O31A 5AFZH 3MO6A 1DUEA 2J94A 2VGCC 1YPKH 2ULLA 2ZDAH 1ZR0A 1Y3XA 4MNVA 1GBFA 1GMHG 3PO1C 2DUCA 2ZIQH 3LJOA 1EP6A 3DUXH 1HNEE 4X2XA 1KLTA 1FIZA 1HV7A 4XDEA 1TNJA 1TNLA 5DG6A 2ZC9H 4B2BA 1W0YH 4ZKRU 2GX4A 1GI5A 3TVJB 3QGJA 2PUXB 3C1KA 1Q2WA 3VGCB 4BAMB 2QY0B 2SGPE 4KTCA 1BITA 5T6DA 5JBBS 4UONA 2OP9A 1LHCH 4NIVA 2Z94A 1GDNA 3LGUA 4YTAA 1EJNA 1BTUA 1V2RT 3NKKA 2PR3A 5EQSA 1P57B 1MU6B 1HAIH 2PSYA 4F4OC 1O5AB 3QTVH 1C9PA 3LH1A 2ODPA 1CA0B 3A89A 2XCFA 1GG6C 1BT7A 1Y5AT 1C1OA 1ZSJA 1PPHE 1YPHC 4I7YH 4XBBA 1TQ0B 2Z7FE 4XFQA 4MVNA 2I6SA 4SGBE 4BAHB 2XCNA 3P8GA 4K60A 1P0SH 5FCRA 1LQDB 1DXPA 4D7GA 4OS5A 1AE8H 2TIOA 1DWCH 1H9IE 3T5FH 2VVCA 2AGGX 2SGEE 3Q76A 4Y76A 1H9LB 1OP2A 2V35A 2AYWA 4A92A 3D65E 2CMYA 2WV4A 2NU1E 3RXKA 4IN1A 2FMJA 4I8JA 1BIOA 4FUHA 3KQDA 2O8UA 3ATIA 3RXGA 4ABIA 1C2JA 1GHXH 2FI4E 1F0SA 1VITF 5FAHA 1GBIA 1A5HA 3BIUH 2A31A 1AFQB 1MAYA 2NU3E 3KQBA 4D9RA 5GWZA 5C3NA 1IHSH 3FAOA 1BRBE 3NUMA 4DURA 5DP6A 2R0LA 1C2FA 4ABGA 1PYTC 3K6YA 4ZXYH 2HGTH 3RXBA 2FOEA 3HKJB 1K1OA 1EOLA 6ESTA 2B0FA 1O32A 3P8OA 1EJMA 1QURH 1P3EA 2OBOA 2ALVA 3RXCA 1N6YA 2VH0A 1KLIH 3TH2H 2F9PA 1C1WH 3T62A 1TMBH 4Y0YE 4BAQB 5EGMA 2BB4A 3TPIZ 4A1XA 4AB9A 1XKAC 1O30A 4OS2A 4IN2A 2OTVA 3ZZ5A 3RXEA 1E34B 2V0BA 3A85A 1ZJKA 4IS5A 4CRDA 3QUMP 1ANEA 4DG4A 1O5CB 1FJSA 2ZNKH 2Y80A 2GDDA 2Z9KA 4Y8ZA 1C1QA 4X8VH 3VB7A 1BA8B 1EZUC 1W7GH 1P2QA 2P94A 1J17T 3TH4H 2VWLA 8GCHF 2AGIX 2Z9LA 1GJ9B 1VR1H 1KDQA 2IJOB 3I29A 2H1UA 2BDIA 2OC7A 3UNRA 1O38A 1WYKA 3T27A 1GCTC 1MQ5A 1TGCA 2STBE 3MU8A 1C5ZB 4GHTA 4DVAU 2BDYA 1QBVH 1HAOH 2BLQA 2ZECA 1CGHA 1MKXH 1KXBA 4D8NA 1O2LA 4OS4A 2FS9A 2R3YA 1O36A 1P9UA 1CSOE 2O9QA 3A88A 3M37A 5E0JA 1WAYB 3U8RH 1EQ9A 4B73A 2BDAA 2W7SA 1AZZA 1P3CA 1D6WA 2Z9IA 5IDKA 1GHBF 1OP8A 4INKA 1ZOMA 1BRUP 2ZHEH 1BDAA 3F9EA 4FVDA 4JZEH 3M3TA 1C2EA 2FESH 4VGCC 5E8EH 2GCTB 4NIXA 1GL0E 2XXLA 3PB1E 3SNAA 2VIWA 1JBUH 3T28A 2XTTB 3RU4D 5FPTA 2WUCA 1LTOA 2ANKH 3AVZA 1UTQA 1ID5H 2SGDE 4TYDA 2A5AA 4H42U 2FYRA 2FYQA 3ZVGA 5DK1A 1ZGIA 1O3EA 4AN7A 3ZZ9A 4MPXA 1BJUA 1SOTA 2BVRH 4NZQA 5LPFA 2SGAA 4FUFA 3BG4C 4ZHAA 4ABFA 4MNWA 1OOKB 1TRMA 2YNAA 5JBAS 3PTNA 2ASUB 1A5GH 1Q31A 3STJA 4DOQA 1SGTA 1O3DA 3VB4A 2W7UA 1V2OT 1QFKH 2A7JA 1UTMA 5JYIA 2G81E 3ZZ6A 1CVWH 2VVUA 5DP5A 3B8JA 4WY3A 4A1VA 1JOUB 1V2UT 1C1UH 1AMHA 2Z9JA 2A4GA 3U1JB 3OSYA 9ESTA 1GI0A 1VJAU 3F1SB 3G01A 3BTFE 5IYTA 3MHWU 2ZU3A 4UD9H 2H5CA 5DPAA 4O3UA 1OWJA 3Q3YA 3TK6A 1C5TA 1WUNH 2O8TA 4YESB 1ZGVA 2TGDA 3RC4A 3SUFA 1GJAB 1XUGA 1Y3YA 1O3KA 1H9HE 5LGOA 4O9VA 2G51A 3K9XB 4YLUA 1TRNA 3S0NA 4GCHG 1K22H 4R8TB 3OU0A 1H8DH 3RM2H 1O3BA 1C4V2 4RKJB 5T6FA 4JMYA 2CF9H 1AU8A 3PMAB 1UVTH 3D23A 1ANDA 1O2UA 3MFJA 1A3EH 5L2ZH 4AZ2B 1YCPM 1UVPA 4Y0ZE 2GKVE 3M5NA 5EXNA 1PPEE 1GMCG 3B9FH 1D3TB 1LPZB 4KELA 4K1TA 1K28D 5A8XA 1CT2E 4NA7A 4ISOA 4PROA 5EW2H 4NG9H 3QLPH 4K5ZA 4YT6H 5AVDA 3TU7H 4ABHA 1T8MA 1NU7B 1BUIA 4AYVB 3SV7A 4ABBA 3BTHE 2J2UA 4MTBA 1D4PB 2OUAA 1AO5A 1MTNB 2BX4A 3E1XB 3UIRA 2C90B 2C8WB 2GCHG 3LKWA 4Z6AH 2ZU5A 1O3CA 5T6GA 1O34A 3EAJA 3PTBA 4U30A 4M7GA 1ZPZA 1BRAA 3RLWH 2BD5A 4DIHH 1FQ3A 5EOKA 1NESE 1GCTB 1W7XH 4BAOB 2QXJA 1ZRKA 2A2QH 3SGAE 4DIIH 1C1SA 1J16A 3URCA 1G2LA 1AWHB 1G30B 1GVLA 2TGAA 3AW1A 1AWFH 1ZTKA 1SQOA 2OC8A 5E0HA 1NROH 3EQ0H 2VWOA 5GDSH 1TNHA 2ZZUH 3N7OA 3K65B 1GJBB 3W95A 1C1TA 4BNRA 1O2QA 4WXVA 1TMUH 2ILNA 2TBSA 3TK9A 4I33A 1GHAG 1Y5BT 5FBEA 1C5UA 3QO6A 1D3QB 4X1NU 1BHXF 5EXLA 3RXTA 3EA8A 1SGFG 3KL6A 1F0RA 1KSNA 1MUEB 1CE5A 3SV8A 3TGJE 3SU1A 1AVXA 4ZKSU 3UWIA 2C8ZB 5DJ7A 1S6HA 1LHDH 1NFWA 3BTQE 2ESTE 4YOGA 2BZAA 3A87A 4JZ1A 5JDUB 3ZVCA 3BN9A 3M5OA 1SGFA 1SGIB 2BDCA 3MYWA
chains in the Genus database with same CATH superfamily
2PTNA 1WSSH 1LCYA 1P8VC 2KZ4A 3QN7A 1S84A 1O2TA 1GVKB 1Y59T 1C5LH 3F2FA 3FZDA 2J34A 2A45B 3MNBA 3D62A 3FVFB 1B0FA 2OQUA 3WWBA 4B2CA 2BYAX 2NWNA 3M5MA 1VCPA 4X2VA 4WWYA 4ABDA 1O2HA 3SHCH 1AZ8A 1YPMH 1O2OA 2YMSB 3HK3B 1O2WA 5HIYA 3VGCC 1QA0A 1JRTA 3EA7A 4MQAA 2BDBA 1GL1A 1HAGE 1MCVA 1TLDA 1NBME 1HFDA 2KAIB 2Z3EA 3DD2H 3RXMA 3LGTA 2Z3DA 1EUFA 3GY3A 1V2WT 4RI0A 1A0HB 1GI8B 1UTOA 1TFXA 4MNYA 3F0PA 2ZDKA 1CA0C 3LGWA 1ELEE 2GZ9A 1LQEA 5L30H 2A7CA 4XRNA 1SG8B 6GCHG 1QBOA 1UCYE 2Q6FA 2ANWA 1QB1A 2FX6A 2KAIA 2VB0A 1OYQA 4BXSA 1FAKH 3DSOA 2EEKA 3P70B 1J8AA 1RD3B 3KQCA 2G00A 1HIAB 3ZVEA 4TPYA 1MAXA 1SVPA 2ZCHP 1HCGA 3GYMA 2AMQA 2BY5X 3ZV8A 4JK6A 2Y7ZA 2KR7A 3U69H 1DFPA 3V7TA 2BOKA 5C2ZA 1DX5M 3ENSB 3SZNA 5FCKA 3U8TH 2BD9A 3SNBA 2THFB 5JPMH 2Z3CA 2PLXA 3A7WA 4DT7B 1MTVA 2P93A 3V0XA 4K69A 3A7YA 2GGVB 5FHTA 1PFXC 1B0EA 1MKWH 2J38A 1P10A 2J95A 1Z71A 1DE7H 1G32B 1YC0A 2J97A 2PV9B 4BANB 2QF3A 4Y7BA 2VIOA 2JKHA 4UDWH 2HNTE 2NU2E 1P2OA 3EDXB 2JETB 1SC8U 4KGAA 1PQAA 3HGPA 1FY4A 1NFXA 1OWEA 3RLYH 5F8TA 1O3LA 5ABWA 3TLOA 4ABEA 1PQ7A 3E6PH 3PMBB 3ZZ7A 2TGPZ 4NIYA 1NS3A 1K9OE 1TNKA 3GICB 3PLKA 1NC6A 3T2NA 3P92A 1AFQC 1MTSA 2OC1A 4FU9A 1E38B 1YBWA 2WUBA 4FOUC 2WYGA 5EPYA 1TE0A 2BD8A 3QWCH 3ELAH 4X1SU 1EPTB 1GBTA 2RA3A 1MTUA 1NFUA 4NWKA 3SQEE 3SNCA 1C1RA 1AUJA 4OS7A 5HKKD 2YOLA 1TOMH 4X2WA 2ZHQH 4ISNA 3A8BA 1A1RA 4K1EA 1UCYH 5HIZA 1SLUB 2FPZA 1O2XA 1BBRE 1DWEH 1ABJH 3FP6E 3HATH 1AE5A 1EPTA 1FONA 3EYDA 1A5IA 1XVMA 2ZQ2A 1FY1A 1LVMA 3P8NA 4XE4A 3M7UA 1IAUA 3FP7E 1RIWB 2ZG0H 3A8AA 3S9AA 4O3TA 4UEHH 1VJ9U 3L3TA 1YKTA 3A80A 1O3PB 1K21H 3SHAH 1LHGH 2VVVA 3HGNA 2F9UA 1MABB 3U9AH 1GJCB 1GBJA 1YY3A 1YPLH 1ESTA 3MMGA 2ZU1A 4SGAE 1H8IH 3UREA 4U2WA 2PWXA 1C1MA 1GI1A 1WQVH 2BLOA 2H9EH 7GCHF 4HG6A 3E91A 1K1LA 1GHZA 1YM0A 1K1PA 1FDPA 4E06H 4Q2KA 1NRRH 1L4DA 2K1QA 4WMEA 1ESAA 5EG4A 1SMFE 4NA9H 3PMHB 3VPKA 2HRVA 1FXYA 1TNGA 4UFFH 1OXGA 3F2HA 3JZ2B 1GBMA 2F9BH 2HLDD 1W0ZU 4YOIA 1SGDE 4ISIH 5FPYA 4JZFH 2QCYA 3Q77A 9LPRA 3P6ZB 4AFZA 2Y7XA 3Q3XA 1T31A 5L2YH 3U1IB 1SLVB 1ZMJA 2Q6GA 2WPKS 2OBQA 4LZ4B 1PQ8A 3E0NB 5T1VA 1GMDF 4TWWA 2FM2A 1DSUA 1PQ5A 5T3HA 1SHYA 1AKSB 2EA3A 1V2ST 2GCTC 2XWBI 4D76A 1AB9B 2F4LA 2BXUH 3O8DA 3LIWA 3GY6A 2FOAA 4Q7XA 1S83A 1BBRH 1P2MA 2QIQA 1GJDB 1K0HA 1GHVH 4K8BA 1KYNA 2ZKSA 1WTGH 1AIXH 3SGQE 3WWFA 2Z6BD 3KF2A 4I8KA 1AKSA 1BTYA 3MH4A 1UVUH 1DY8A 2AGEX 1MTWA 1RGQA 4YZUA 1THPB 2PFEA 3KHVA 1T8LA 3A7TA 1HJ9A 1KXDA 2VWNA 1B5GH 2EI7A 2RG3A 5AHGH 1COWD 2WPIS 4Y8YA 3F9GA 2Y82A 2BHGA 1ELAA 5K0HA 3GCTG 3V13A 4AB8A 3P17H 4Y10E 2P3UB 1K1NA 1NM6A 1SGYE 3AW0A 3EGKH 1TONA 3TNSA 4NFEA 2AMDA 1XVOA 2A32A 4FUCA 5SGAE 1HAVA 1AHTH 4UFGH 3UPEA 1GI9B 3LONA 3PYHA 3RMMH 1VZQH 5A0AE 3BTEE 3SJIA 2BD3A 4X1RU 4HTCH 2F9VA 2XBYA 4R0IA 3SU3A 1KXCA 2C8YB 2GTBA 2UUFB 1O3NA 4XBDA 1EAUA 1EZSC 2ZGCA 5BPEA 4WVPE 3SNDA 4X0WU 1C5SA 2GV6A 1FIWA 1UTJA 1DXWA 4CR9A 3S7HB 3LC3A 2ALPA 2CN0H 1B7XB 5HM2A 1BRCE 1C5QA 1OX1A 1TOCB 2DE8A 2HPQH 2ZFQH 5CMXH 4E05H 4X6NA 1A3BH 1RS0A 4ZAEA 1G36A 4CRFA 3GY4A 3O8CA 1FZZA 1GJ4H 2SGQE 5DO4H 1EB2A 2QAAA 1H1BA 2PTCE 4HZHA 1XUIA 3LDXH 3SJ8A 1A61H 1O2JA 1S81A 4A1TA 1HYLA 2VH6A 1HXEH 2ZFFH 1C1NA 1H4WA 1N6XA 2G4TA 1E36B 3VXFH 1KDQB 1ELDE 1YF4A 1O35A 1KTTB 1GI7B 2SFAA 4IMZA 1MTNC 1P12E 2ZP0H 2QC2A 5LPEA 2W3KA 3LH3A 3KCGH 3QZQA 1HAHH 1N1LA 5TCCA 1BB0B 3RUOA 2VWMA 4CH2B 4IBLH 2FOHA 4B76A 1SGQE 1NO9H 1U6QA 2ZWLH 1FI8A 3OE7D 1LPKB 4KTSA 4NFFA 1Q3XA 1C2KA 2KCPA 3N7EA 2FP7B 4UFDH 1DDJA 1MCTA 2XBWA 4FUDA 2D1JA 4ZXXH 1L1GA 1TGBA 3RXSA 3RXRA 4B71A 1HDTH 3SU0A 2Y6TA 1RTLA 2FOCA 4LXBH 4DY7B 1TPAE 4KTUA 4YT7H 2JH0D 2EC9H 2A7HA 2L74A 5JB8S 1Z6EA 3L6PA 1P2IA 1MU8B 1L0ZA 4TPIZ 1VITG 3TIUA 5ETXA 5I46H 4MPVA 1G3CA 3FOAA 3RXAA 1Z8IB 1IQNA 3SJKA 5FL7D 4TSFD 3BEIB 1Y8TA 4Q7ZA 1TGTA 3NCLA 5KECA 4Y11E 2P8OB 3OYPA 2B5TB 1S6LA 2VINA 3RXUA 2FODA 1T8NA 4BTIB 2OC0A 3VEQB 2BMGB 2ZFRH 1YCPK 1O5GH 1O3IA 3IWMA 4P00A 2XC0A 2ZTXA 3PMJA 2WZQA 2GD4B 2VIQA 2WV9A 3KQ5A 3NRLA 1BTPA 4AX9H 1ESBA 2XW9A 4BOHA 1AY6H 1W10U 3BG8A 4INHA 3UOPA 1CHOF 3GCNA 8LPRA 1IQHA 3PLPA 2O8LA 4E7NA 1GI2A 2DE9A 1QRZA 3RP2A 3NZIA 3ESTA 2AMPA 1SOZA 1SLXB 3I77A 2ZGXH 2O8MA 2WPMS 2GMTB 4ZROA 1D3DB 5B6LA 3RXVA 3STIA 1KIGH 8GCHG 1SGPE 2YMSC 4Y7AA 1EXFA 2GT7A 3UB0A 1HAYB 1W0JD 1OWIA 2J4IA 1FMGA 1FNIA 2F91A 4ABAA 2FOBA 5H4IB 2RCEA 1C5XB 2BVSH 2PKSB 3CS7A 1FN8A 1PYTD 1SQTA 1NPMA 1UTPA 1LVYA 3OTPA 1BTHH 3RU4T 1O5EH 1P02A 3SUDA 3AAVA 4NA8A 1QIXB 2J92A 5F8ZA 2XRCA 3SI4H 3UNSA 4RSPA 1GHBG 2J98B 2CV3A 3SQHE 3VB5A 1CT0E 2G5VA 5C5NA 2W5EA 1YPGH 1ZMNA 4Y6DA 1O33A 2AERH 3DFJA 4INLA 3A84A 2GT8A 3SUEA 1NT1A 4X6PA 4CR5A 2G8TA 5J4QA 4TY7A 2FOFA 2LP6A 1UK2A 1CO7E 3F9HA 3ZYEA 3A7VA 1TABE 3KQEA 2J98A 1VCQA 2A4QA 4ABJA 2OINA 2VIPA 2PGBB 2RDEA 4DGJA 2BD7A 4RT1A 1O2YA 4K8YA 1UJ1A 3E0PB 1SR5C 1J9CH 3AASA 4O03A 2FZZA 4B74A 2JETC 2V3OH 4WMDA 3UQOA 1CGIE 1IHTH 2I6QA 3PM3A 4K1SA 2ANMH 2SGFE 3M36A 1V2NT 4MNXA 1IQJA 1BOQA 2KCOA 2VIVA 1T32A 3SU6A 1P11E 4AG2A 1K1IA 1FAXA 3SU5A 4GSOA 1EPTC 1EZQA 1L1NA 1E0FD 1F0TA 2VIDA 2HALA 2NU4E 1C5OH 1D9IA 4YXWD 1K2I1 3ATLA 5EW1H 4H6TA 1PJPA 1UTKA 3TK5A 3ZVAA 1T4VH 1PPFE 1QGFA 2ZPQA 3VB6A 5DP9A 2C93B 3SV6A 2ZQ1A 1NFYA 1SFIA 3SORA 4Y79A 2R0KA 1GBEA 2FTLE 3BTGE 2C3SA 1EATA 4MPUA 3LT3A 1VGCB 2AIQA 2VJ1A 4J1YA 3GCOA 1N8OB 1SI5H 2V7QD 4HFPB 1RIWC 2C4FH 1CHGA 4DW2U 3ZZ3A 4Q63A 3E3TA 1HAPH 1ORFA 3OY5U 3NPSA 4DJZB 5C1XA 3MNCA 1ZHMA 2ODYB 4LOYH 2AIPA 3SN8A 3RXDA 1O2KA 3BV9B 1KXEA 4JK5A 1G3EA 4CHAB 1DANH 3A8CA 2AS9A 2CGAA 2UWPA 1O2GH 1TX8A 3A83A 1YP9A 4D7FA 4HI3A 1OWHA 3EE7A 4YM9A 3ODDA 1BJVA 1QCPA 1EAIA 1HRTH 1Z8RA 2BY8X 1BMLA 3FKSD 3DHKH 3OTJE 3A7XA 4K3JA 4NZLA 1CT4E 1O5FH 1PPBH 4FU8A 2CHAB 4Z0KA 3RU4E 4GHQA 5B6OA 3MTYA 4WF8A 2ZHFH 5GCHF 1SL3A 2YMSD 1K1JA 1TRYA 2FEQH 1D3PB 1YPHE 5K7RA 1FX0B 1GI3A 1FPHH 2ZEBA 1LPGB 1RJXB 2BQ7B 2PKAA 3RC5A 1IQEA 4GUXA 2WPHS 3MQKC 1QQ4A 4RKOB 4CRBA 3GOVB 3JZ1B 3T29A 5FXLA 3FP8E 1E37B 1EAWA 1AB9C 1ZZZA 4AORA 3DFLA 1GHWH 1TIOA 4CBNA 1YYY1 1O5BB 5HM9A 1TPPA 2A0QB 5GJ4B 1KMHB 3W94A 2FI3E 4X1PU 1Z8GA 2BVXH 3V12A 2ZCLP 2F83A 4A6LA 3GY7A 2ZFTA 2IPQX 3LGYA 4JCNA 4P02A 5GXPA 3MNXA 3D49H 3E8LA 4F55A 2GZ8A 1NRSH 2GVFA 1SGCA 2FLRH 3CNRA 1YLDA 2JH5D 2ZGBH 1VITH 2BLWA 5LPRA 1ZHRA 1QRWA 1C4Y2 2A4RA 1NZQH 1W12U 3U8OH 3BIVH 4ZHLU 4K2YA 4XSKU 4AFUA 3S7KB 3M3VA 1GMHF 1AN1E 3TH3H 1THSH 1TAWA 1GVZA 1MMJN 2HOBA 2WYJA 5EODA 3RMNH 2HPPH 3ZVBA 1G3BA 1ELTA 5DGJA 4FU7A 5AF9H 4ZUHA 5E2PA 4JZIA 3SBKA 4CBOA 2C8XB 5I25A 2BD4A 1IQLA 1PPGE 6LPRA 1UCYK 4CRCA 4NWLA 5HGGA 3H7OA 1V2VT 5A0CA 2AEIH 1GBCA 5A09A 2XC5A 3F9FA 3DCLA 2ZFPH 1MD8A 4X6OA 4OM9A 1CGJE 4FUGA 1FUJA 1YGCH 5G4BA 3SNEA 1RTKA 3IG6B 3RXIA 1BMAA 1MD7A 1BTWA 2B9LA 2ZDLA 4I8LA 1A7SA 2PGQB 3PWBA 1ZJDA 3F68H 2Q1JA 4CH8B 2GV7A 3QZRA 3ZV9A 1ZMLA 4OS6A 4DCDA 3NXPA 4FUBA 3BTTE 1BZXE 1ACBE 1O3GA 5GPIB 1DWDH 1DS2E 3GY8A 4NCYA 1IQKA 3LOXA 3SUGA 4I32A 2BY7X 1NRQH 3R0FA 2VNTA 1EZXC 2L6OA 1YLCA 1WOFA 1JWTA 1Z1IA 4Y8XA 1LMWB 1Z7KA 3W1EA 1AVWA 4IC6A 3QX5H 3FFGA 1L4ZA 3BEUA 4B2AA 5TCAA 2HLCA 3FANA 1O3JA 1JIMA 4FUJA 4TY6A 3U98H 1ARCA 1O39A 1QTFA 1EAXA 1P06A 3PV2A 4AFQA 1T4UH 2WSSD 2F9NA 1GGDB 1DPOA 4J2YB 3BTWE 4JZDH 1WCZA 2QE7D 1V2JT 4KKDA 2HVYB 3ZZAA 5JBCS 1GDQA 1S0QA 3O8BA 2UWOA 4Y71A 1UVOA 1QZ8A 3HK6B 1DY9A 3MWIU 1BBRK 1GJ7B 4ZKNU 2ZGJA 3LPRA 4AOQA 1XM1A 3TJNA 1RTFB 3OY6U 3M7QA 5FBIA 1LKBA 3AK5A 3T26A 1F5KU 2WV5A 4ESTE 5C67A 3S9CA 5F8XA 3LC5A 1C2LA 1NRNH 2PUQH 1ZPCA 3QTOH 2ZDMA 4BXWA 1QR3E 2WPDD 4UE7H 5C20A 2H5DA 2P8OC 2B8OH 1P2NA 1TGNA 5FPSA 3S69A 2QXHA 1EFRD 2BQ6B 1FV9A 2R2MB 1C2DA 3PROA 1G2MA 3UR6A 4MDSA 1O2IA 1AD8H 2QXIA 1RXPA 1QY6A 1L2EA 2YNBA 1GBAA 1V3XA 1FY5A 1QB6A 1TBZH 3UUZA 1HAVB 3NK8A 2FX4A 3MOCA 3SV2H 3UWJH 2ZTYA 2OD3B 2BZ6H 4FVBA 4AG1A 1GBDA 4H4FA 1IQIA 1HJAB 2RDLA 6CHAB 3DT0H 2ZF0H 1FY3A 1EB1H 2FOMB 3BTKE 3M7TA 1O3FA 3I78A 1ZRBA 3KYGA 5DP8A 3BEFB 1TA6A 1YWUA 1O2ZA 4FUEA 3QGNB 5A8YA 1O3AA 4IMQA 2UUKB 1MBMA 1QHRB 3UNQA 2QXGA 1XUKA 3MU4A 5CDFE 4NSYA 3VXEH 4CRAA 3RXLA 1XX9A 3FZZA 4NSVA 1INCA 4E7RG 1CBWB 2GMTC 1J15A 1GI4A 1O2RA 1SSXA 1OWDA 5DSFA 3ZZBA 1LHEH 7GCHG 5CE1A 2P16A 5C1UA 3RC6A 5A0BA 2ZDNA 1ABIH 1QBNA 1O2VA 1QL9A 1ZTJA 2G52A 2PW8H 3MO9A 2D8WA 1C5VA 1TWXB 4BTUB 2PKSC 1GHYH 3H7TA 1NY22 2R3UA 3MU5A 5CHAB 1LO6A 3F6UH 1UHBB 2AH4X 2BDHA 2ZDVH 2ANYA 4AYYB 1WV7H 1F2SE 2JDID 2QV1A 1QJ6B 5C0UA 3URDA 5DKMA 2CJIA 3TJOA 3M61U 1ARBA 2CXVA 1V2TT 3KN2A 1GMDG 1RFNA 2XNIA 3HPTB 3UTUH 1MQ6A 2HNTC 2TRMA 3ATKA 2EQNA 3SV9A 2QYIA 2R9PA 1UHBA 3ATWA 1W14U 1Z1JA 1GBLA 1T8OA 1ETRH 3S9BA 2H9TH 2J9NA 1GJ8B 1V2QT 3SI3H 1S6FA 1ZYOA 4YLQH 2EI6A 1NRPH 1C2MA 1QL8A 2ZA5A 1FPCH 3U28C 2FDAA 1EX3A 4WH8A 1MKXK 1EKBB 1MBQA 4YOJA 3RDZA 3H5CB 4NIWA 2XYAA 1V2PT 3E90B 3FN8A 4GVUA 1GDUA 1X7AC 3OFND 1HAXB 2BLVA 3TITA 3GCHB 1TMTH 2BD2A 4BAKB 2FXRA 1WBGB 4IC5A 4TT3D 2EY4C 1P09A 1ZSKA 5EU8A 4AC9A 3SW2B 3BF6H 2OCVB 2ZU2A 2AFQB 2VGCB 1ETSH 1CQQA 1UTNA 3MH5A 1DITH 2A5IA 4F49A 2P59A 1ELBA 3PO1B 3P8FA 3GY5A 4YO9A 1NTPA 4QT8C 1W11U 4JYTA 3QK1A 3RXHA 1UK3A 2HVXA 1OS8A 2WPJS 4GCHF 3K2UA 1ZHPA 5FX6A 1SBWA 1GBHA 4B75A 3ZYDA 2G5NA 1TYNA 1KXFA 2BDGA 2F9OA 4AGJA 2Q6DA 1IQMA 2KFWA 3MI4A 4CRGA 1WDIA 1O0DH 1T7CA 2OK5A 3OAAD 1SKYE 5EXMA 3ZZ4A 2O8WA 1GMCF 1VGCC 1E35B 3MO3A 1N8OC 2HNTF 2CF8H 4TWYA 1EASA 4AFSA 1KLJH 3SU2A 1W8BH 2TGTA 1XXDA 4D9QA 1HAZB 4X6MA 1J14A 4DT4A 3KEEA 4A5TS 2BY6X 5PTPA 1GG6B 1O3MA 3B23B 4THNH 2HWLB 3A7ZA 1C5PA 3ZIAD 4CHAC 1GBKA 3M3SA 1A46H 3CENA 3GS9A 1DM4B 3DSPA 5HXFA 1FY8E 5BRRE 1WU1A 1ZTLA 2P3TB 4MG3A 5C94A 2GCHF 4HGCA 5F6MA 5AFYH 5E0GA 4H6SB 4XBCA 2JH6D 1TX6A 4U32A 1IQGA 1OKXA 2TPIZ 4FETA 3V3MA 1QJ7B 3MH7A 2CHAC 3SO3A 1K1MA 3ZVDA 1SLWB 2GJGA 3O8RA 5EQQA 2M5TA 1HB0B 2WINI 1C2IA 1XMNB 3BTME 1F92A 1S0RA 1G9IE 1W3CA 3LU9B 2G4UA 1YCPH 1DWBH 2IOTA 2QF0A 2PSXA 3GDUA 1CU1A 4X2YA 2FWWA 8KME2 2M2AA 2A1DB 1V2LT 1HJ8A 5DP3A 3TGIE 1GBBA 2F3CE 1AFEH 1SQAA 2ZHDA 3PRDA 1ZLRA 2VU8E 1GHAF 4ASHA 1Y3WA 1YPEH 1O5DH 1O2NA 1S5SA 1A2CH 2UUYA 1GWAA 2XBXA 1UTLM 1DOJA 2KCYA 2ZFSA 3MNSA 3T25A 1NN6A 4UFEH 3SGBE 1UVSH 1DLKB 3ZVFA 1H8ED 1PPCE 3R3GB 3ZZCA 2Z9GA 4RN6A 1TQ7B 1Z6JH 4GAWA 1GCDA 2ZU4A 1QJ1B 3UY9A 2A2XH 2W3IA 3TNTA 3GDSA 1GI6A 3CS0A 4CREA 2XBVA 3N7DA 1GJ5H 4XOJA 7KMEH 3SOSA 5A2MH 1SQRA 3KNXA 2LNCA 4NGAH 3ODFA 5EPNA 1ELGA 4MPWA 1LDTT 1P03A 4MLFB 3ITIA 1BMMH 2GZ7A 2IPHA 3L33A 1RRKA 2BX3A 4WH6A 1F5LA 4WXIA 1ZPBA 1F5RA 2CK3D 1P2JA 1A0JA 1CHOG 4GLYA 4KP0A 1NU9A 2PHBA 3M35A 1H8HD 4FXGH 4Q80A 3OX7U 1C2GA 1F0UA 2WPLS 2QA9E 4WJG2 1TGSZ 1C1VH 1C9TA 1AQ7A 1SGEE 2IN2A 3RXQA 1SFQB 1C5MD 1QNJA 2UWLA 2XWAA 1YPJH 1WQSA 2FIRH 3VB3A 4ISHH 1PPZA 1JMOH 1UMAH 2D2DA 1KY9A 2FS8A 7LPRA 3RM0H 2V3MA 5LH8A 4JYUH 1OYTH 1TPOA 1OSSA 3Q00A 1SHHB 2Y81A 2J5UA 1QQUA 1O2PA 3A86A 3UAIC 5C1YA 3PWCA 1V2MT 3AAUA 3A82A 3DA9B 1G37A 3EE0B 3MU1A 4IGDA 2OQ5A 1SPJA 3ZZ8A 6GCHF 3K6ZA 1ELFA 1ELCA 1Y3VA 2BXTH 2V3HH 3CP7A 1QRXA 5EJ1A 1TALA 1ETTH 3F2GA 3LGVA 4B6EA 2FOGA 3Q3KA 1BTZA 3RXJA 2BM2A 1E1QD 1M9UA 4VGCB 1DUAA 1ZSLA 2V6NA 1EJAA 2VBCA 3SU4A 3ATMA 3QDZB 5KEDA 1Z8JB 3TJVA 3HKIB 2G55A 2GP9B 3BSQA 1KXAA 1MZDA 4XD7D 1C1PA 2ZO3H 1HXFH 1HUTH 4ZHMU 1AI8H 2EI8A 3NWUA 3BG4B 1QL7A 3RXOA 1HGTH 2ZHWH 2F43B 3GY2A 3A81A 3RMLH 3UR9A 4ZKOU 1LHFH 3LJJA 2PKAB 1GGDC 1VCWA 2SNVA 3BTDE 5TJXA 2ZPRA 3LGIA 3PLBA 3UFAA 5JBTA 2ZTZA 2QN5T 4GPGA 1SGRE 1G3DA 2BQWB 2BOHB 1XUFA 3GYLB 1MZAA 2SNWA 3SJ9A 1F7ZA 1THRH 1AGJA 2W6ID 1BCUH 1C5RA 4ISLA 2ZI2H 3RXPA 2FO9A 2OLGA 1JRSA 1S85A 1FN6A 2STAE 2BY9X 1DVAH 1TNIA 2RFKC 2P95A 1AUTC 1P2KA 1IOEA 1BTXA 1ANCA 1LVOA 2H6MA 2B7DH 1HPGA 1A0LA 1HBTH 5C5OA 3OEHD 2FTMA 3M5LA 5L6NH 2A5KA 3MU0A 4X8UH 4X1QU 1MKWK 5DP4A 3RMOH 1DLEA 1XKBC 1V2KT 2H2ZA 3GDVA 4AGKA 2FLBH 1P01A 3RXFA 3VFEA 1V6DA 1BHXB 2Y5FA 4I8GA 1OPHB 2ZGHA 4LK4A 7ESTE 1HJAC 3KIDU 4JYVH 2GDEH 6CHAC 1FLEE 5C17A 1C2HA 1W2KH 3UQVA 3P95A 3UOUA 3ZZDA 1Y3UA 5GIBA 3PV5A 4WMFA 1HLTH 1GJ6A 4Q7YA 3IITA 1O37A 5ESTE 5ESBA 1TPSA 3PRBA 5E2OA 5F03A 2AHME 1OP0A 1P04A 2RA0A 2ZPSA 1GPZA 3SYJA 1OWKA 1O2SA 1CBWC 8ESTE 2Y5GA 1DT2A 2ZCKP 3EA9A 5EJLA 1O3OA 1MH0A 1JXPA 4I31A 3WY8A 1O2MA 1HIAA 4U01A 4X8SH 1Y5UT 1EP5A 3C27B 5HMAA 4IW4E 3TJUA 1JIRA 1KTSB 3KGPA 5FX5A 1WTHD 5CHAC 1LVBA 1DSTA 2H9HA 4I8HA 2XOKD 4OS1A 5GCHG 1C5NH 5EJZA 1S82A 1WXRA 2QGRA 1TBRH 2XC4A 3A8DA 4BTTB 4X8TH 2FI5E 3TGKE 2BTCE 4OGXA 1TB6H 1TX7A 2ODQA 2Y5HA 4B1TA 1BMNH 1EOJA 1ELVA 4OGYA 4ZCNA 2LPRA 3GISB 1C5WB 1XUJA 1TA2A 1BQYA 1CA8B 1SGNE 3MH6A 3WW7A 4O97A 4LZ1H 1XXFA 1P05A 2NU0E 1QB9A 2W26A 3E16B 1W13U 1UO6A 1C5YB 3PV4A 4ZH8A 4A7IB 1SB1H 2R2WU 1P9SA 1UK4A 2OXSA 4FUIA 1A4WH 2IJD1 1ANBA 1TBQH 1LKAA 1XUHA 2P3FH 5DP7A 1D6RA 1L1JA 2A4OA 3GCTF 1AVGH 1QA7A 5J4SA 1IQFA 2UUJB 4ZMAH 5HYOA 5JB9S 3GCHC 3SJOA 4M9FA 1DICA 1O3HA 2D26C 5EQRA 1VKYA 5A8ZA 1C4U2 1O31A 5AFZH 3MO6A 1DUEA 2J94A 2VGCC 1YPKH 2ULLA 2ZDAH 1ZR0A 1Y3XA 4MNVA 1GBFA 1GMHG 3PO1C 2DUCA 2ZIQH 3LJOA 1EP6A 3DUXH 3F3BA 1HNEE 4X2XA 1KLTA 1FIZA 1HV7A 4XDEA 1TNJA 1TNLA 5DG6A 2QF4A 2ZC9H 4Z1MD 4B2BA 1W0YH 4ZKRU 2GX4A 2LELA 1GI5A 3TVJB 3QGJA 2PUXB 3C1KA 1Q2WA 3VGCB 4BAMB 2QY0B 2SGPE 4KTCA 1BITA 5T6DA 5JBBS 4UONA 2OP9A 1LHCH 4NIVA 2Z94A 1GDNA 3LGUA 4YTAA 1EJNA 1BTUA 1V2RT 3NKKA 2PR3A 5EQSA 1P57B 1MU6B 1HAIH 2PSYA 4F4OC 1O5AB 3QTVH 1C9PA 3FO8D 2ODPA 3LH1A 1CA0B 3A89A 2XCFA 1GG6C 1E79D 1BT7A 1Y5AT 1C1OA 1ZSJA 1PPHE 1YPHC 4I7YH 4XBBA 1TQ0B 2Z7FE 4XFQA 4MVNA 2I6SA 4SGBE 4BAHB 2XCNA 3P8GA 4K60A 1P0SH 5FCRA 1LQDB 1DXPA 4D7GA 4OS5A 1AE8H 2TIOA 1DWCH 1H9IE 3T5FH 2VVCA 2AGGX 2SGEE 3Q76A 4Y76A 1H9LB 1OP2A 2V35A 2AYWA 4A92A 3D65E 2CMYA 2WV4A 5KGOA 2NU1E 3RXKA 4IN1A 4RT0A 2FMJA 4I8JA 1BIOA 4FUHA 3KQDA 2O8UA 3ATIA 3RXGA 4ABIA 1C2JA 1GHXH 2FI4E 1F0SA 1VITF 5FAHA 1GBIA 1A5HA 1W0KD 3BIUH 2A31A 1AFQB 1MAYA 2NU3E 3KQBA 4D9RA 5GWZA 5C3NA 1IHSH 3FAOA 1BRBE 3NUMA 4DURA 5DP6A 2R0LA 1C2FA 4ABGA 1PYTC 3K6YA 4ZXYH 2HGTH 3RXBA 2FOEA 3HKJB 1K1OA 1EOLA 6ESTA 2B0FA 1O32A 1YLNA 1EJMA 1QURH 1P3EA 2OBOA 2ALVA 3P8OA 3RXCA 1N6YA 2VH0A 1KLIH 3TH2H 2F9PA 1C1WH 3T62A 1TMBH 4Y0YE 4BAQB 5EGMA 2BB4A 2KX4A 3TPIZ 4A1XA 4AB9A 1OHHD 1XKAC 1O30A 4OS2A 4IN2A 2OTVA 3ZZ5A 3RXEA 1E34B 2V0BA 3A85A 1ZJKA 5EIYA 4IS5A 4B6FA 4CRDA 3QUMP 1ANEA 4DG4A 1O5CB 1FJSA 2ZNKH 2Y80A 2GDDA 2Z9KA 4Y8ZA 1C1QA 4X8VH 3VB7A 1BA8B 1EZUC 1W7GH 1P2QA 2P94A 1J17T 3TH4H 2VWLA 8GCHF 2AGIX 2Z9LA 1GJ9B 1VR1H 5C0TA 1KDQA 2IJOB 4ASUD 3I29A 2H1UA 2BDIA 2OC7A 3UNRA 1O38A 1WYKA 3T27A 1GCTC 1MQ5A 1TGCA 2STBE 3MU8A 1C5ZB 4GHTA 4DVAU 2BDYA 1QBVH 1HAOH 2BLQA 2ZECA 1CGHA 1MKXH 1KXBA 4D8NA 1O2LA 4OS4A 2FS9A 2R3YA 1O36A 1P9UA 1CSOE 2O9QA 5GNDA 1E1RD 3A88A 3M37A 5E0JA 1WAYB 3U8RH 1EQ9A 4B73A 2BDAA 4F48B 2W7SA 1AZZA 1P3CA 1D6WA 2Z9IA 5IDKA 1GHBF 1OP8A 4INKA 1ZOMA 1BRUP 2ZHEH 2JIZD 1BDAA 3F9EA 4FVDA 4JZEH 3M3TA 1C2EA 2FESH 4VGCC 5E8EH 2GCTB 4NIXA 1GL0E 2XXLA 3PB1E 3SNAA 2VIWA 1JBUH 3T28A 2XTTB 3RU4D 5FPTA 2WUCA 1LTOA 2ANKH 3AVZA 1UTQA 1ID5H 2SGDE 4TYDA 2A5AA 4H42U 2FYRA 1UW7A 2FYQA 3ZVGA 5DK1A 1ZGIA 1O3EA 3SZEA 4AN7A 3ZZ9A 4MPXA 1BJUA 1SOTA 2BVRH 1NBMD 4Q4LA 4NZQA 5LPFA 2SGAA 4FUFA 3BG4C 4ZHAA 4ABFA 4MNWA 1OOKB 3N99A 1TRMA 5F53A 2YNAA 5JBAS 3PTNA 2ASUB 1A5GH 1Q31A 3F0OA 3STJA 4DOQA 1SGTA 1O3DA 3VB4A 2W7UA 1V2OT 1QFKH 2A7JA 1UTMA 5JYIA 2JJ2D 2G81E 3ZZ6A 1CVWH 2VVUA 5DP5A 3B8JA 4WY3A 4A1VA 1JOUB 1V2UT 1C1UH 1AMHA 2Z9JA 2A4GA 3U1JB 3OSYA 4ACAA 9ESTA 1GI0A 1VJAU 3F1SB 3G01A 3BTFE 5IYTA 3MHWU 2ZU3A 4UD9H 2H5CA 5DPAA 4O3UA 1OWJA 3Q3YA 3TK6A 1C5TA 1WUNH 2O8TA 4YESB 1ZGVA 2TGDA 4ACBA 3RC4A 3SUFA 1GJAB 1XUGA 1Y3YA 2WHXA 1O3KA 1H9HE 5LGOA 4O9VA 3H09A 2G51A 3K9XB 2W6JD 4YLUA 1TRNA 3S0NA 3KYFA 4GCHG 1K22H 4R8TB 3OU0A 1H8DH 3RM2H 1O3BA 1C4V2 4RKJB 5T6FA 4JMYA 2CF9H 1AU8A 3PMAB 1UVTH 3D23A 1ANDA 1O2UA 3MFJA 1A3EH 5L2ZH 4AZ2B 1YCPM 1UVPA 4Y0ZE 2GKVE 3M5NA 5EXNA 1PPEE 1GMCG 3DSGA 3B9FH 1D3TB 1LPZB 2QF5A 4KELA 4K1TA 1K28D 5A8XA 1CT2E 3OEED 4NA7A 4ISOA 4PROA 5EW2H 2KCAA 4NG9H 5CHBA 4K5ZA 4YT6H 5AVDA 3QLPH 3TU7H 4ABHA 1T8MA 1NU7B 1BUIA 4AYVB 3SV7A 4ABBA 2K0QA 2J2UA 3BTHE 1D4PB 4MTBA 2OUAA 1AO5A 1MTNB 2BX4A 3E1XB 3UIRA 2C90B 2C8WB 2GCHG 3LKWA 4Z6AH 2ZU5A 1O3CA 5T6GA 1O34A 5DN6D 3EAJA 3PTBA 4U30A 4M7GA 1ZPZA 1BRAA 3RLWH 2BD5A 4DIHH 1FQ3A 5EOKA 1NESE 1GCTB 1W7XH 4BAOB 2QXJA 1ZRKA 2PP6A 2A2QH 3SGAE 4DIIH 1C1SA 1J16A 3URCA 1G2LA 1AWHB 1G30B 1GVLA 2TGAA 3AW1A 1AWFH 1ZTKA 1SQOA 2OC8A 5E0HA 1NROH 3EQ0H 2VWOA 5GDSH 1TNHA 2ZZUH 3N7OA 3K65B 1GJBB 1BMFD 1C1TA 3W95A 4BNRA 1O2QA 4WXVA 1TMUH 2ILNA 2TBSA 3TK9A 4I33A 1GHAG 1Y5BT 5FBEA 1C5UA 3QO6A 1D3QB 4X1NU 1BHXF 5EXLA 4I86A 3RXTA 3EA8A 3VG8A 1SGFG 3KL6A 1F0RA 1KSNA 1MUEB 2XNDD 1CE5A 3SV8A 3TGJE 3SU1A 1AVXA 4ZKSU 3UWIA 2C8ZB 5DJ7A 1S6HA 1LHDH 1NFWA 3BTQE 2K8IA 2ESTE 4YOGA 2KM0A 2BZAA 2JJ1D 5IK2D 3A87A 4JZ1A 5JDUB 3ZVCA 3BN9A 3M5OA 1SGFA 1SGIB 2BDCA 3MYWA
chains in the Genus database with same CATH topology
2PTNA 1WSSH 1LCYA 1P8VC 3QN7A 1S84A 1O2TA 1GVKB 1Y59T 1C5LH 3FZDA 2J34A 2A45B 3MNBA 3D62A 3FVFB 1B0FA 2OQUA 4B2CA 2BYAX 2NWNA 3M5MA 1VCPA 4X2VA 4WWYA 4ABDA 1O2HA 3SHCH 1AZ8A 1YPMH 1O2OA 3HK3B 1O2WA 3VGCC 1QA0A 1JRTA 3EA7A 4MQAA 2BDBA 1GL1A 1HAGE 1MCVA 1TLDA 3DD2H 1HFDA 2KAIB 2Z3EA 3RXMA 3LGTA 2Z3DA 1EUFA 3GY3A 1V2WT 1A0HB 1GI8B 1UTOA 1TFXA 4MNYA 2ZDKA 1CA0C 3LGWA 1ELEE 2GZ9A 1LQEA 5L30H 2A7CA 1SG8B 6GCHG 1QBOA 1UCYE 2Q6FA 2ANWA 1QB1A 2FX6A 2KAIA 2VB0A 1OYQA 4BXSA 1FAKH 2EEKA 3P70B 1J8AA 1RD3B 3KQCA 2G00A 1HIAB 3ZVEA 4TPYA 1MAXA 1SVPA 2ZCHP 1HCGA 3GYMA 2AMQA 2BY5X 3ZV8A 4JK6A 2Y7ZA 3U69H 1DFPA 3V7TA 2BOKA 5C2ZA 1DX5M 3ENSB 3SZNA 5FCKA 3U8TH 2BD9A 3SNBA 2THFB 5JPMH 2Z3CA 2PLXA 3A7WA 4DT7B 1MTVA 2P93A 3V0XA 4K69A 3A7YA 2GGVB 5FHTA 1PFXC 1B0EA 1MKWH 2J38A 1P10A 2J95A 1Z71A 1DE7H 1G32B 1YC0A 2PV9B 4BANB 2QF3A 4Y7BA 2VIOA 2JKHA 4UDWH 2HNTE 2NU2E 1P2OA 3EDXB 2JETB 1SC8U 4KGAA 1PQAA 3HGPA 1FY4A 1NFXA 1OWEA 3RLYH 5F8TA 1O3LA 5ABWA 3TLOA 4ABEA 1PQ7A 3E6PH 3PMBB 3ZZ7A 2TGPZ 4NIYA 1NS3A 1K9OE 1TNKA 3GICB 3PLKA 1NC6A 3T2NA 3P92A 1AFQC 1MTSA 2OC1A 4FU9A 1E38B 1YBWA 2WUBA 2WYGA 5EPYA 1TE0A 2BD8A 3QWCH 3ELAH 4X1SU 1EPTB 1GBTA 2RA3A 1MTUA 1NFUA 4NWKA 3SQEE 3SNCA 1C1RA 1AUJA 4OS7A 2YOLA 1TOMH 4X2WA 2ZHQH 4ISNA 3A8BA 1A1RA 4K1EA 1UCYH 1SLUB 2FPZA 1O2XA 1BBRE 1DWEH 1ABJH 3FP6E 3HATH 1AE5A 1EPTA 1FONA 3EYDA 1A5IA 1XVMA 2ZQ2A 1FY1A 1LVMA 3P8NA 4XE4A 3M7UA 1IAUA 3FP7E 1RIWB 2ZG0H 3A8AA 3S9AA 4O3TA 4UEHH 1VJ9U 3L3TA 1YKTA 3A80A 1O3PB 1K21H 3SHAH 1LHGH 2VVVA 3HGNA 2F9UA 3U9AH 1GJCB 1GBJA 1YPLH 1ESTA 3MMGA 2ZU1A 4SGAE 1H8IH 3UREA 4U2WA 2PWXA 1C1MA 1GI1A 1WQVH 2BLOA 2H9EH 7GCHF 3E91A 1K1LA 1GHZA 1YM0A 1K1PA 1FDPA 4E06H 4Q2KA 1NRRH 1L4DA 2K1QA 4WMEA 1ESAA 5EG4A 1SMFE 4NA9H 3PMHB 3VPKA 2HRVA 1FXYA 1TNGA 4UFFH 1OXGA 3JZ2B 1GBMA 2F9BH 1W0ZU 4YOIA 1SGDE 4ISIH 5FPYA 4JZFH 2QCYA 3Q77A 9LPRA 3P6ZB 4AFZA 2Y7XA 3Q3XA 1T31A 5L2YH 3U1IB 1SLVB 1ZMJA 2Q6GA 2WPKS 2OBQA 4LZ4B 1PQ8A 3E0NB 1GMDF 4TWWA 2FM2A 1DSUA 1PQ5A 5T3HA 1SHYA 1AKSB 2EA3A 1V2ST 2GCTC 2XWBI 4D76A 1AB9B 2BXUH 3O8DA 3LIWA 3GY6A 2FOAA 4Q7XA 1S83A 1BBRH 1P2MA 2QIQA 1GJDB 1GHVH 4K8BA 1KYNA 2ZKSA 1WTGH 1AIXH 3SGQE 2Z6BD 3KF2A 4I8KA 1AKSA 1BTYA 3MH4A 1UVUH 1DY8A 2AGEX 1MTWA 1RGQA 4YZUA 1THPB 2PFEA 3KHVA 1T8LA 3A7TA 1HJ9A 1KXDA 2VWNA 1B5GH 2EI7A 2RG3A 5AHGH 2WPIS 4Y8YA 3F9GA 2Y82A 2BHGA 1ELAA 5K0HA 3GCTG 3V13A 4AB8A 3P17H 4Y10E 2P3UB 1K1NA 1NM6A 1SGYE 3AW0A 3EGKH 1TONA 3TNSA 4NFEA 2AMDA 1XVOA 2A32A 4FUCA 5SGAE 1HAVA 1AHTH 4UFGH 3UPEA 1GI9B 3LONA 3PYHA 3RMMH 1VZQH 5A0AE 3BTEE 3SJIA 2BD3A 4X1RU 4HTCH 2F9VA 2XBYA 4R0IA 3SU3A 1KXCA 2C8YB 2GTBA 2UUFB 1O3NA 4XBDA 1EAUA 1EZSC 2ZGCA 5BPEA 4WVPE 3SNDA 4X0WU 1C5SA 2GV6A 1FIWA 1UTJA 1DXWA 4CR9A 3S7HB 3LC3A 2ALPA 2CN0H 1B7XB 5HM2A 1BRCE 1C5QA 1OX1A 1TOCB 2DE8A 2HPQH 2ZFQH 5CMXH 4E05H 4X6NA 1A3BH 1RS0A 4ZAEA 1G36A 4CRFA 3GY4A 3O8CA 1FZZA 1GJ4H 2SGQE 5DO4H 1EB2A 2QAAA 1H1BA 2PTCE 4HZHA 1XUIA 3LDXH 3SJ8A 1A61H 1O2JA 1S81A 4A1TA 1HYLA 2VH6A 1HXEH 2ZFFH 1C1NA 1H4WA 1N6XA 2G4TA 1E36B 3VXFH 1KDQB 1ELDE 1YF4A 1O35A 1KTTB 1GI7B 2SFAA 4IMZA 1MTNC 1P12E 2ZP0H 2QC2A 5LPEA 2W3KA 3LH3A 3KCGH 3QZQA 1HAHH 1N1LA 5TCCA 1BB0B 3RUOA 2VWMA 4CH2B 4IBLH 2FOHA 4B76A 1SGQE 1NO9H 1U6QA 2ZWLH 1FI8A 1LPKB 4KTSA 4NFFA 1Q3XA 1C2KA 2FP7B 4UFDH 1DDJA 1MCTA 2XBWA 4FUDA 2D1JA 4ZXXH 1L1GA 1TGBA 3RXSA 3RXRA 4B71A 1HDTH 3SU0A 2Y6TA 1RTLA 2FOCA 4LXBH 4DY7B 1TPAE 4KTUA 4YT7H 2JH0D 2EC9H 2A7HA 5JB8S 1Z6EA 3L6PA 1P2IA 1MU8B 1L0ZA 4TPIZ 1VITG 3TIUA 5ETXA 5I46H 4MPVA 1G3CA 3RXAA 1Z8IB 1IQNA 3SJKA 3BEIB 1Y8TA 4Q7ZA 1TGTA 3NCLA 4Y11E 2P8OB 3OYPA 2B5TB 2VINA 3RXUA 2FODA 1T8NA 4BTIB 2OC0A 3VEQB 2BMGB 2ZFRH 1YCPK 1O5GH 1O3IA 3IWMA 2XC0A 2ZTXA 3PMJA 2GD4B 2VIQA 1BTPA 4AX9H 1ESBA 2XW9A 4BOHA 1AY6H 1W10U 3BG8A 4INHA 3UOPA 1CHOF 3GCNA 8LPRA 1IQHA 3PLPA 2O8LA 4E7NA 1GI2A 2DE9A 1QRZA 3RP2A 3NZIA 3ESTA 2AMPA 1SOZA 1SLXB 3I77A 2ZGXH 2O8MA 2WPMS 2GMTB 4ZROA 1D3DB 3RXVA 3STIA 1KIGH 8GCHG 1SGPE 4Y7AA 1EXFA 2GT7A 1HAYB 1OWIA 2J4IA 1FMGA 1FNIA 2F91A 4ABAA 2FOBA 5H4IB 2RCEA 1C5XB 2BVSH 2PKSB 3CS7A 1FN8A 1PYTD 1SQTA 1NPMA 1UTPA 1LVYA 1BTHH 3RU4T 1O5EH 1P02A 3SUDA 3AAVA 4NA8A 1QIXB 2J92A 5F8ZA 2XRCA 3SI4H 3UNSA 4RSPA 1GHBG 2CV3A 3SQHE 3VB5A 1CT0E 2G5VA 5C5NA 2W5EA 1YPGH 1ZMNA 4Y6DA 1O33A 2AERH 3DFJA 4INLA 3A84A 2GT8A 3SUEA 1NT1A 4X6PA 4CR5A 2G8TA 5J4QA 4TY7A 2FOFA 1UK2A 1CO7E 3F9HA 3ZYEA 3A7VA 1TABE 3KQEA 1VCQA 2A4QA 4ABJA 2OINA 2VIPA 2PGBB 4DGJA 2BD7A 1O2YA 4K8YA 1UJ1A 3E0PB 1SR5C 1J9CH 3AASA 4O03A 2FZZA 4B74A 2JETC 2V3OH 4WMDA 3UQOA 1CGIE 1IHTH 2I6QA 3PM3A 4K1SA 2ANMH 2SGFE 3M36A 1V2NT 4MNXA 1IQJA 1BOQA 2VIVA 1T32A 3SU6A 1P11E 4AG2A 1K1IA 1FAXA 3SU5A 4GSOA 1EPTC 1EZQA 1L1NA 1E0FD 1F0TA 2VIDA 2HALA 2NU4E 1C5OH 1D9IA 1K2I1 3ATLA 5EW1H 4H6TA 1PJPA 1UTKA 3TK5A 3ZVAA 1T4VH 1PPFE 1QGFA 2ZPQA 3VB6A 5DP9A 2C93B 3SV6A 2ZQ1A 1NFYA 1SFIA 3SORA 4Y79A 2R0KA 1GBEA 2FTLE 3BTGE 2C3SA 1EATA 4MPUA 3LT3A 1VGCB 2AIQA 2VJ1A 4J1YA 3GCOA 1N8OB 1SI5H 4HFPB 1RIWC 2C4FH 1CHGA 4DW2U 3ZZ3A 3E3TA 1HAPH 1ORFA 3OY5U 3NPSA 4DJZB 5C1XA 3MNCA 1ZHMA 2ODYB 4LOYH 2AIPA 3SN8A 3RXDA 1O2KA 3BV9B 1KXEA 4JK5A 1G3EA 4CHAB 1DANH 3A8CA 2AS9A 2CGAA 2UWPA 1O2GH 1TX8A 3A83A 1YP9A 4D7FA 4HI3A 1OWHA 4YM9A 3ODDA 1BJVA 1QCPA 1EAIA 1HRTH 1Z8RA 2BY8X 1BMLA 3DHKH 3OTJE 3A7XA 4K3JA 4NZLA 1CT4E 1O5FH 1PPBH 4FU8A 2CHAB 4Z0KA 3RU4E 4GHQA 5B6OA 3MTYA 4WF8A 2ZHFH 5GCHF 1SL3A 1K1JA 1TRYA 2FEQH 1D3PB 1YPHE 5K7RA 1GI3A 1FPHH 2ZEBA 1LPGB 1RJXB 2BQ7B 2PKAA 3RC5A 1IQEA 4GUXA 2WPHS 1QQ4A 4RKOB 4CRBA 3GOVB 3JZ1B 3T29A 5FXLA 3FP8E 1E37B 1EAWA 1AB9C 1ZZZA 4AORA 3DFLA 1GHWH 1TIOA 4CBNA 1YYY1 1O5BB 5HM9A 1TPPA 2A0QB 5GJ4B 3W94A 2FI3E 4X1PU 1Z8GA 2BVXH 3V12A 2ZCLP 2F83A 4A6LA 3GY7A 2ZFTA 3LGYA 4JCNA 5GXPA 3MNXA 3D49H 3E8LA 2GZ8A 1NRSH 2GVFA 1SGCA 2FLRH 1YLDA 2JH5D 2ZGBH 1VITH 2BLWA 5LPRA 1ZHRA 1QRWA 1C4Y2 2A4RA 1NZQH 1W12U 3U8OH 3BIVH 4ZHLU 4K2YA 4XSKU 4AFUA 3S7KB 3M3VA 1GMHF 1AN1E 3TH3H 1THSH 1TAWA 1GVZA 1MMJN 2HOBA 2WYJA 5EODA 3RMNH 2HPPH 3ZVBA 1G3BA 1ELTA 5DGJA 4FU7A 5AF9H 4ZUHA 5E2PA 4JZIA 3SBKA 4CBOA 2C8XB 5I25A 2BD4A 1IQLA 1PPGE 6LPRA 1UCYK 4CRCA 4NWLA 5HGGA 3H7OA 1V2VT 5A0CA 2AEIH 1GBCA 5A09A 2XC5A 3F9FA 4X6OA 2ZFPH 1MD8A 1CGJE 4FUGA 1FUJA 1YGCH 5G4BA 3SNEA 1RTKA 3IG6B 3RXIA 1BMAA 1MD7A 1BTWA 2B9LA 2ZDLA 4I8LA 1A7SA 2PGQB 3PWBA 1ZJDA 3F68H 2Q1JA 4CH8B 2GV7A 3QZRA 3ZV9A 1ZMLA 4OS6A 4DCDA 3NXPA 4FUBA 3BTTE 1BZXE 1ACBE 1O3GA 5GPIB 1DWDH 1DS2E 3GY8A 4NCYA 1IQKA 3LOXA 3SUGA 4I32A 2BY7X 1NRQH 3R0FA 2VNTA 1EZXC 1YLCA 1WOFA 1JWTA 1Z1IA 4Y8XA 1LMWB 1Z7KA 1AVWA 4IC6A 3QX5H 3FFGA 1L4ZA 3BEUA 4B2AA 5TCAA 2HLCA 3FANA 1O3JA 1JIMA 4FUJA 4TY6A 3U98H 1ARCA 1O39A 1QTFA 1EAXA 1P06A 4AFQA 1T4UH 2F9NA 1GGDB 1DPOA 4J2YB 3BTWE 4JZDH 1WCZA 1V2JT 4KKDA 3ZZAA 5JBCS 1GDQA 1S0QA 3O8BA 2UWOA 4Y71A 1UVOA 3HK6B 1DY9A 3MWIU 1BBRK 1GJ7B 4ZKNU 2ZGJA 3LPRA 4AOQA 1XM1A 3TJNA 1RTFB 3OY6U 3M7QA 5FBIA 1LKBA 3T26A 1F5KU 2WV5A 4ESTE 5C67A 3S9CA 5F8XA 3LC5A 1C2LA 1NRNH 2PUQH 1ZPCA 3QTOH 2ZDMA 4BXWA 1QR3E 4UE7H 5C20A 2H5DA 2P8OC 2B8OH 1P2NA 1TGNA 5FPSA 3S69A 2QXHA 2BQ6B 1FV9A 2R2MB 1C2DA 3PROA 1G2MA 3UR6A 4MDSA 1O2IA 1AD8H 2QXIA 1RXPA 1QY6A 1L2EA 2YNBA 1GBAA 1V3XA 1FY5A 1QB6A 1TBZH 3UUZA 1HAVB 3NK8A 2FX4A 3MOCA 3SV2H 3UWJH 2ZTYA 2OD3B 2BZ6H 4FVBA 4AG1A 1GBDA 4H4FA 1IQIA 1HJAB 2RDLA 6CHAB 3DT0H 2ZF0H 1FY3A 1EB1H 2FOMB 3BTKE 3M7TA 1O3FA 3I78A 1ZRBA 5DP8A 3BEFB 1TA6A 1O2ZA 4FUEA 3QGNB 5A8YA 1O3AA 4IMQA 2UUKB 1MBMA 1QHRB 3UNQA 2QXGA 1XUKA 3MU4A 4NSYA 3VXEH 4CRAA 3RXLA 1XX9A 3FZZA 4NSVA 1INCA 4E7RG 1CBWB 2GMTC 1J15A 1GI4A 1O2RA 1SSXA 1OWDA 3ZZBA 1LHEH 7GCHG 5CE1A 2P16A 5C1UA 3RC6A 5A0BA 2ZDNA 1ABIH 1QBNA 1O2VA 1QL9A 1ZTJA 2G52A 2PW8H 3MO9A 2D8WA 1C5VA 1TWXB 4BTUB 2PKSC 1GHYH 3H7TA 1NY22 2R3UA 3MU5A 5CHAB 1LO6A 3F6UH 1UHBB 2AH4X 2BDHA 2ZDVH 2ANYA 4AYYB 1WV7H 1F2SE 2QV1A 1QJ6B 3URDA 5DKMA 2CJIA 3TJOA 3M61U 1ARBA 2CXVA 1V2TT 3KN2A 1GMDG 1RFNA 2XNIA 3HPTB 3UTUH 1MQ6A 2HNTC