4XBDA

1.45a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (orthorhombic p form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
163
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
total genus 40
structure length 163
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA01
5FHTA 2B5TB 3VEQB 2ZGJA 1IQGA 1C2IA 3MU4A 3RC4A 2VWOA 4K1EA 4AB9A 3OY6U 1GJBB 1VITH 1LHCH 1O3MA 3AASA 4CRAA 1P2NA 2NU0E 4RKJB 1GMCG 1FMGA 1K1IA 3RXJA 2J94A 2Z6BD 4ISLA 4DY7B 1YPHC 5DP6A 1KXFA 4ABAA 1PQAA 3FZZA 1HLTH 1C5OH 2ASUB 1DXPA 1RRKA 1LHGH 1E0FD 1O3LA 2O8UA 1GI4A 2BOHB 1T32A 3SHAH 1XUGA 2I6SA 2CHAC 5FAHA 4GCHF 4SGBE 1FY8E 1ARCA 1Y5UT 4NIWA 1VGCB 3LIWA 4XSKU 3UNQA 3HATH 4CHAC 1O3BA 3P8OA 1VCQA 4DJZB 3UIRA 7GCHF 2PUXB 1C2JA 3KNXA 1GJCB 1F7ZA 2BOKA 3ZZDA 4U32A 2ZTZA 3U8TH 1TFXA 1CHOG 5GXPA 5FPYA 3SV8A 4H4FA 4YO9A 3TJOA 4FUBA 1EPTC 3RXGA 1FY5A 2NWNA 3ITIA 1ANCA 2TBSA 2BD3A 3ZYDA 3V0XA 2Z9GA 4BOHA 1S83A 2M5TA 1Y8TA 5EQQA 4BAOB 1EZUC 1C4V2 1B0FA 2GGVB 1KLJH 4U01A 2F9NA 4AFQA 2SGFE 2SGPE 4KTSA 4ZKRU 1TQ7B 5L2ZH 3SV2H 1C5NH 1KXAA 2Y80A 1GHYH 4ABDA 2ZHWH 1VR1H 1UJ1A 4YESB 3NKKA 1V3XA 3SJIA 1PJPA 1QTFA 4YM9A 2PSYA 3PO1B 2VINA 1SPJA 3BG8A 2PGQB 5K7RA 2FI4E 4JZIA 1IQHA 1MCVA 1HAGE 1ZSLA 2GDEH 1THRH 4NFEA 1GI1A 4X6MA 2HVXA 1EAWA 3QTOH 3RXSA 3P17H 1UHBB 1TGBA 2BDCA 1O35A 4Y79A 5JBTA 5HMAA 5FBIA 3NCLA 1XUIA 1S6HA 2F9VA 2H9EH 1XKBC 4Q80A 1SGCA 3QDZB 6ESTA 3NUMA 2FTMA 4FU9A 2QF3A 1C5WB 4I31A 4B2CA 4QT8C 1AKSA 1TOCB 3QX5H 3KHVA 1CT2E 1OWHA 3KCGH 2TIOA 5LGOA 1PPGE 1ZPZA 1V2KT 1SGPE 3TJNA 4ASHA 1LPKB 4YOJA 4IBLH 1C5XB 1O2OA 3S69A 6LPRA 3K65B 1L4DA 5EW1H 3ZV9A 1Z1IA 4TWYA 1J14A 1C4U2 1GHWH 2B8OH 3UWIA 1H8IH 1RXPA 1C5UA 4MLFB 3BTDE 2W7SA 5FBEA 3TU7H 4E06H 3BG4C 9LPRA 4WMEA 3R3GB 3MH7A 4JYTA 1MQ6A 4WH8A 3KQCA 4BXSA 1ELVA 3V12A 3QWCH 1DPOA 3RXRA 2ZDAH 4NCYA 1LQEA 1V2QT 1L1NA 5ESBA 1K2I1 3RXIA 1C1WH 2VWNA 3TGJE 3GY3A 5FCRA 1GI8B 1KXDA 3RC5A 1MZAA 2VNTA 1AZZA 3UREA 5I25A 1F92A 4HGCA 1GBBA 3UUZA 1J9CH 5DKMA 3HK3B 3PMJA 1Z8RA 5A0BA 1Q2WA 3BSQA 4X1SU 1GMHG 1YPGH 4I33A 1O3NA 2O9QA 2EEKA 3MU5A 1YPJH 3QLPH 3GY7A 1TQ0B 4TYDA 3SJKA 1YGCH 1TGTA 4AYYB 2JH0D 1GWAA 1WOFA 3I29A 2RA3A 1TNIA 4LK4A 1L4ZA 1D3PB 2A5AA 3A86A 2CF8H 1A5HA 5AF9H 4SGAE 4NWKA 3FANA 3UQVA 3P92A 4FUHA 2ZGCA 2KAIA 3U1IB 4INKA 2FX6A 4Y7AA 1O5FH 1ZRBA 2XRCA 1B5GH 1K1LA 1LVYA 3OTJE 1GDNA 1HDTH 4JK5A 1A0LA 4WH6A 3E0NB 1ZMJA 3PMBB 1DSUA 4OS5A 4AFZA 1FY4A 1GVLA 1ELTA 1FAXA 5GJ4B 1EB2A 1O5GH 1GDQA 1P01A 4JZDH 2QY0B 1SLUB 4O3TA 2BVSH 1BTXA 1N6YA 3N7OA 3C27B 2AH4X 1C1OA 1O36A 3LGWA 1QURH 1TBZH 1KXEA 4D8NA 4NIXA 1O5AB 2A0QB 1O2QA 1HUTH 1FQ3A 3OX7U 2XYAA 5EW2H 1G36A 4ZKOU 3ZVCA 4MG3A 3PTNA 2PWXA 4AGKA 1GGDB 5JB8S 2EI7A 1FJSA 2PKAA 2XWAA 2WYJA 3QGJA 1O3IA 2ZPRA 1C1SA 1GHVH 2BMGB 2CHAB 9ESTA 3TGIE 5A8YA 4TWWA 5B6OA 1W0YH 4INHA 4NGAH 1W8BH 2RG3A 1CGHA 1GVZA 4AB8A 1YC0A 5LH8A 2ZHDA 3NPSA 1PQ8A 4B2AA 3A8AA 1DUEA 1GHBF 1XVMA 1ZHMA 3QUMP 2HWLB 2WV4A 4ZHMU 3ZVGA 1BTHH 1V2NT 1EAUA 2OBQA 4X6OA 2A4GA 5DPAA 3SU5A 1KLTA 1TGNA 4BANB 1OWEA 3ZYEA 1TNKA 5FPTA 2B0FA 4ZMAH 5DP3A 4FUFA 2V0BA 1DY9A 3A7ZA 1O3EA 4MPUA 1G3BA 1P02A 3SU4A 4ZHAA 1DXWA 1EOLA 3FP7E 1DITH 1WQVH 1NESE 1Q3XA 1XXDA 3RLYH 3STJA 2GCTB 3BTME 3SO3A 1WCZA 1QB1A 1IQLA 1HGTH 1W3CA 2OC0A 2HPQH 2UUFB 3LGYA 2ANYA 4Q2KA 3KF2A 4XOJA 3LC3A 3SOSA 5EXNA 1F0TA 3A8DA 5EGMA 3DFJA 3LDXH 1RIWB 2QCYA 4UEHH 1DLEA 2EI8A 4FVDA 3UR9A 1BTWA 1EATA 7LPRA 8ESTE 1KXCA 1QBVH 2BD9A 1SHYA 1BIOA 3K9XB 3QGNB 1X7AC 4YOIA 5LPEA 2JKHA 3MNSA 5E0HA 1TBQH 1VZQH 4NIVA 4JYVH 3SU2A 2AERH 2GDDA 1VGCC 1P2JA 1C2EA 2JH6D 5J4QA 2ZO3H 2QA9E 2C3SA 1BITA 1P09A 4XBBA 3SJ8A 2FS9A 3K6ZA 4CRGA 1CA0B 3UNRA 3FVFB 1TX6A 1O5EH 2WUBA 3SUDA 3BTTE 3SU6A 3F9EA 1GBJA 4Y71A 1G3EA 1OXGA 1Y3YA 1UVTH 2XBYA 1GI5A 2ZC9H 1O2GH 2D26C 2BY7X 1K1PA 3TH3H 4KTUA 3SV7A 1O2WA 1QFKH 1ETSH 3BG4B 4J2YB 1GPZA 3ATKA 4IGDA 4BTIB 1IQIA 4H6SB 2C4FH 3BIUH 1LHDH 2GD4B 3GY6A 4RSPA 3TK5A 3A81A 1NU7B 1HAHH 1ELGA 1HAXB 4MNYA 4B1TA 1P8VC 1O2JA 1XKAC 3QO6A 5L2YH 1YBWA 2C8ZB 4NA7A 2FI5E 3PO1C 5DP5A 1HPGA 1A4WH 3F6UH 1QBOA 5J4SA 5C3NA 5E2OA 1BBRH 3FP6E 3U9AH 1FN6A 1PYTD 1G3CA 1ZPBA 2ANKH 1SQOA 3A8CA 1LVBA 1TRNA 2AGIX 1NY22 1EZQA 4X6NA 1NRSH 1XUJA 5EG4A 4TY6A 1GBDA 3A7TA 4PROA 5G4BA 2BY9X 1P10A 3MH5A 3O8BA 5T6GA 3O8DA 4OS1A 1MU8B 1V2RT 3S9AA 5DJ7A 1MAXA 1OS8A 3SNDA 3GCHB 1C2KA 1SGEE 3UTUH 1YPKH 3T28A 5E0JA 4B71A 1T31A 1VCWA 1UTJA 2FMJA 3HGNA 4KGAA 2ZU1A 4I8HA 2W3KA 1V2LT 1FY3A 1DWCH 3TK9A 4DT7B 4CBNA 3M35A 1CBWB 2C90B 1ZSKA 5AHGH 1BRBE 4GHQA 1C5VA 3IG6B 3EYDA 2ZU3A 1LDTT 3RUOA 4DG4A 1E38B 2B7DH 3GCOA 4GCHG 1GJAB 5EQRA 2F9UA 1O3KA 3ZZ6A 1BCUH 1YPHE 3BEFB 4XFQA 2OQ5A 1P3EA 2ZIQH 3SUGA 2V6NA 3M61U 2HNTC 3TK6A 4TPIZ 1SGDE 2OINA 4D9RA 1BT7A 1BHXB 1D6RA 3BTEE 1TBRH 3RXMA 4JK6A 3SJOA 1LHFH 7GCHG 2AEIH 1RFNA 4B75A 3DA9B 4DIIH 2ZGHA 3M5OA 3ZZBA 4YLUA 3V7TA 1CQQA 3GDVA 2G81E 3ENSB 1ZTLA 3A85A 1EZSC 3M3TA 1K1JA 4MTBA 1KYNA 1UK4A 2GV6A 2A5KA 5I46H 2ZTXA 1ZHRA 1A2CH 4AX9H 1NM6A 5C5OA 4JYUH 1N6XA 4H6TA 1EJAA 1KDQB 1P0SH 2BYAX 1ZSJA 1C5PA 4A1VA 1TIOA 2H1UA 4UD9H 4X1PU 4AG1A 1ZMLA 3OY5U 2ZU2A 1E36B 3QZRA 1MKWH 1GBAA 3M37A 1V2OT 1GDUA 3Q76A 1DICA 3T62A 1AB9B 1ELEE 4ZAEA 3BF6H 2BTCE 2GV7A 3VXEH 2Z9LA 3E6PH 4MNXA 5BPEA 1THPB 1B0EA 2BM2A 1HAVA 1NTPA 1O2NA 4ABHA 1NROH 4WVPE 1CT0E 1XM1A 1DANH 1JRTA 2VVVA 1D6WA 1NRNH 1S85A 4NIYA 1HJAC 1OYQA 1TWXB 5C20A 2NU4E 3D65E 1ETRH 1QIXB 2CMYA 5EXLA 5HYOA 2BZAA 1QB6A 1HCGA 2ESTE 3MHWU 4CRFA 1S0RA 1BMMH 2BY6X 4AOQA 3CENA 1G30B 3IWMA 1HRTH 1PPCE 2UUJB 1GGDC 3A7YA 1TPOA 1NZQH 2P3FH 3C1KA 1O5CB 4O97A 4X8UH 5DP9A 2GZ7A 1IQEA 2Y5HA 1AFEH 1PFXC 3O8CA 1F0RA 1NPMA 2WPMS 1AMHA 1GJ7B 1GHZA 2GMTB 4HFPB 5GCHF 4Y0YE 4AFUA 1AN1E 3F9GA 3TNSA 3VPKA 3Q3YA 1C5TA 2GP9B 2FX4A 5JBCS 1MUEB 4JZ1A 1YCPH 1ZJKA 3PROA 4TPYA 1VJAU 1VCPA 3H7TA 4X1NU 1TMBH 4K2YA 4I7YH 1E35B 1AO5A 1HV7A 1UCYH 1QHRB 3B8JA 1HB0B 1BMAA 1UVSH 2FESH 1S0QA 1L1GA 4RKOB 1GJDB 1A3BH 1C5RA 3A82A 1Y5BT 1ZZZA 4XDEA 1SLVB 1S81A 1EPTA 3STIA 4X2WA 3UOPA 2Q6FA 3MTYA 3E91A 2GCTC 1TRYA 1Z8JB 3E0PB 1KXBA 1S6FA 2BDYA 2ZDMA 3TJUA 1NRQH 1GBCA 2ZHQH 1PPZA 3T5FH 5EU8A 2NU2E 2XC5A 1P9UA 2IJOB 5A8XA 5IDKA 5A0AE 1QCPA 1KY9A 1A7SA 8LPRA 1IQKA 3UPEA 1OP2A 1RIWC 2Y81A 3MFJA 2LNCA 3BTWE 3RMOH 1HAOH 1WSSH 1RTFB 4K3JA 1ZJDA 1C9PA 2G51A 2ULLA 1PYTC 2SNVA 3PM3A 1EJMA 3MWIU 3ELAH 3S9CA 4DVAU 1FPHH 1BHXF 3AVZA 3EA9A 3S9BA 2F3CE 2C8YB 2STAE 1Z7KA 4UFEH 2BQWB 5LPRA 4UDWH 3SGQE 1TB6H 3TLOA 5C5NA 1GI6A 1C1TA 4OGYA 2FIRH 4ABGA 2Z9IA 3HKJB 1SGIB 3IITA 3UR6A 1CA0C 1DY8A 4X1RU 2A5IA 2A7JA 2OCVB 4MPVA 3RXTA 3NWUA 1DLKB 2ZTYA 3EQ0H 1QL8A 1WTHD 1ESAA 1Y5AT 1BRUP 3PB1E 1JRSA 2ODYB 4FUGA 1BUIA 3KQEA 3U1JB 4R8TB 1EP6A 1ELCA 2P95A 2JETC 2IN2A 4DCDA 2ODQA 5ABWA 1LCYA 1YPLH 1GBHA 2WINI 2TGPZ 2CN0H 5JBAS 1C5YB 3SBKA 4K60A 1OOKB 3TIUA 3V13A 4B76A 1BMNH 4LOYH 1P9SA 5A0CA 1TGCA 1WAYB 1XVOA 2BX3A 1GHBG 3TH2H 5HGGA 2BDBA 2ZZUH 2BZ6H 1NFXA 3RXFA 5CHAC 5IYTA 3ATLA 1TABE 1O2TA 3DUXH 1V2PT 1P04A 2FZZA 1O2SA 4KTCA 3UOUA 1M9UA 3M5LA 1DOJA 1MU6B 2GX4A 3RDZA 1A61H 3EA7A 2NU3E 4GVUA 1TGSZ 1NS3A 3AW0A 2J92A 2AFQB 1SFQB 1T7CA 2A7CA 5K0HA 1W11U 1Z6JH 1HXFH 1SGFA 1OP8A 1SGTA 2PSXA 1OSSA 4MDSA 8KME2 3PV4A 3GCHC 1BBRK 1AFQB 3RXVA 2FLBH 1P57B 1FN8A 2ZDVH 2ZG0H 3T27A 4D76A 1QRWA 1SC8U 1LVOA 1VITF 2P8OC 1HIAA 5ESTE 1EAIA 1SG8B 1SMFE 3BV9B 2VIVA 3SI3H 1BRCE 1SVPA 5FCKA 2ZF0H 1RD3B 2ALVA 1O3CA 3CS0A 1LHEH 1O37A 1CBWC 1C5QA 1ZTKA 1TAWA 2HPPH 3CS7A 1O33A 3A7VA 3M7QA 2GCHF 4CRDA 4I8LA 5DGJA 3ZZ4A 4Y6DA 4TY7A 3ZVDA 2C93B 3F1SB 3GICB 5TCCA 1C2GA 1P06A 1GBLA 2A2XH 4ESTE 1ANEA 3RXKA 3GYLB 1F0SA 4CR9A 1E34B 2J4IA 4NWLA 2EA3A 2H9HA 1V2ST 2OTVA 1HJAB 1BTZA 1A3EH 1J15A 1ELBA 1XMNB 4OS2A 2P94A 4A1TA 2P3UB 1GBTA 2TGTA 1ID5H 3BTKE 1CGIE 1GHAF 4ZUHA 4B73A 4OGXA 3E1XB 2FOGA 2BDIA 2BLVA 4KELA 4O9VA 2P3TB 1YKTA 1TNJA 1UTNA 3MO6A 2BHGA 1LVMA 2O8MA 4YZUA 3P95A 1C1QA 1QA0A 2Y7XA 2R3YA 2ZFTA 1EJNA 3SI4H 3T29A 3SJ9A 1O3OA 1JIMA 2TPIZ 1O2VA 2H5DA 2AGGX 5C1XA 2OC8A 1F0UA 2UWLA 1C1VH 1SFIA 2QXGA 2G4TA 2BY5X 4ABJA 2QN5T 1CSOE 2VWLA 1Z1JA 3HPTB 1HAYB 1GI7B 1TYNA 2QV1A 5GPIB 2A4RA 4IN2A 1SI5H 3UY9A 2GZ8A 1SOZA 2HRVA 4E7NA 3GISB 1GMDF 1AB9C 2STBE 2Y6TA 3EDXB 2FOMB 2EI6A 1O30A 1JWTA 1H1BA 4NA8A 2XXLA 1IHTH 1MKWK 1ZHPA 3ATMA 3ZVFA 1H8DH 2O8TA 1EQ9A 3RC6A 2XW9A 3FFGA 3F68H 2FS8A 5DP4A 2R2MB 1QBNA 4KKDA 1GL1A 4K1TA 1TA6A 2XBWA 3ZVEA 1GJ6A 1S82A 4Y76A 3V3MA 2Z7FE 3HKIB 1K1NA 1ZGVA 1GG6B 2GT8A 2ZCLP 1HAZB 3UFAA 1T8MA 3OSYA 2BXUH 1TMTH 2ZHFH 2PHBA 1C1UH 1AE8H 3TJVA 1NT1A 5DO4H 1AI8H 4I8KA 3RXHA 3UQOA 5DP7A 2VH0A 1GI0A 1AE5A 1P2IA 1W7GH 1MBQA 1WTGH 3URDA 5C2ZA 5AFYH 3NK8A 3ZZ3A 3ATWA 1C1PA 2Y82A 1OX1A 1TPAE 1FAKH 4FUJA 2D8WA 1DM4B 1UK2A 2HNTF 2UUYA 2FOEA 3SN8A 1HBTH 2AS9A 2OLGA 4XBDA 3LGTA 2UUKB 2W5EA 3SZNA 1D9IA 2GMTC 4HI3A 4GSOA 1AKSB 1CT4E 2PTCE 1HJ8A 2A4OA 2VB0A 1TRMA 2QGRA 3SUEA 3SU3A 3GCTF 2HNTE 1MTNB 2GVFA 1GJ5H 2ZKSA 3W94A 5CE1A 6GCHF 1NO9H 4MQAA 2FXRA 3RU4D 4K69A 3HK6B 4AG2A 8GCHF 4E7RG 2CV3A 2JETB 3ZVAA 2G8TA 1XUFA 1XX9A 3M3VA 1EB1H 5C1UA 2YNAA 4Z6AH 1A5IA 2XNIA 3RXEA 1IQJA 1V2TT 1YCPK 3D23A 2FOHA 4ABIA 2CJIA 1TX8A 1K22H 4FXGH 2Z9KA 5E8EH 1UCYK 5CHAB 4IS5A 3MOCA 4I32A 1QRZA 5BRRE 1AIXH 2ZHEH 2PLXA 1BA8B 1LKBA 1RJXB 3T25A 2PKSB 4X2YA 4DOQA 3GDUA 1GI3A 3D49H 4BAKB 3RMNH 4ZH8A 1ELFA 3BTHE 1O0DH 2G5NA 5SGAE 3ZZ5A 1QQ4A 1H9LB 1P12E 4MNWA 3JZ1B 4FUCA 1Y3VA 3Q77A 2H2ZA 1EOJA 1OKXA 4U30A 1T4VH 1DFPA 1V2JT 3GY8A 2G5VA 4ZXXH 2OC1A 1IOEA 3LGVA 1YCPM 1GL0E 2P8OB 3RM0H 2OUAA 1UHBA 3VB7A 2ILNA 2XCFA 4Y0ZE 1GI9B 1K1MA 3PMHB 2KAIB 5FX6A 1EASA 3DHKH 4GHTA 3M3SA 1O5BB 2RCEA 1P05A 3GY2A 2A2QH 1ARBA 4ISNA 2C8XB 3AAVA 5HXFA 3B23B 5CMXH 2RDLA 1XXFA 4BNRA 2UWPA 4CH2B 3I78A 1S84A 1TALA 1UTMA 1NRPH 2LPRA 3UWJH 4CR5A 2PW8H 4X1QU 1FIZA 2VJ1A 2FP7B 1O2PA 2P93A 1C1MA 3BEUA 3MU1A 3Q3XA 1T4UH 5GCHG 2F9OA 1WU1A 1KTTB 3TVJB 2ZFSA 5C1YA 1K9OE 3K2UA 3OU0A 3RXDA 2O8WA 4WJG2 4YT7H 1K28D 1LMWB 1O31A 4B2BA 1W12U 4BAQB 3A89A 4D7GA 1GCTB 1NN6A 2AYWA 2ZFQH 1EP5A 3SNBA 3U98H 2FPZA 2TGAA 4IMZA 4ZXYH 2ZDLA 1OP0A 3FP8E 2PKAB 2VIPA 1NFUA 5TJXA 1DE7H 1JBUH 6CHAC 2V35A 2R3UA 2QXIA 3VGCB 1YLDA 2P59A 2QF0A 1QGFA 1PPFE 4ZKNU 5GIBA 3A83A 3NXPA 1O2ZA 1O5DH 1C1RA 1J16A 1AFQC 1AWHB 4MNVA 1FNIA 1P2QA 4U2WA 2WPJS 4THNH 1O39A 1MD8A 4FUIA 1L2EA 3EA8A 3DD2H 2OBOA 3SV9A 4ISHH 2ZQ2A 1K1OA 1CO7E 1HAIH 1AVWA 1ACBE 1O34A 5F8XA 4MVNA 4ABFA 3MNBA 4NZQA 3MYWA 1NC6A 3A80A 1LPZB 1XUHA 1TNGA 2QC2A 2ZECA 1G2LA 2BQ6B 5EXMA 2Z3CA 2XC0A 1ZR0A 2W26A 3RXPA 2AIQA 2FWWA 2IPHA 5JDUB 4E05H 3RXOA 2ZQ1A 2J38A 3KGPA 1CGJE 4NSYA 2ZU4A 4CRBA 3VB3A 4IC5A 3SGAE 2EC9H 1Z8IB 3PWCA 1BTYA 1KIGH 3P6ZB 1UVUH 1TPPA 3PLPA 1ELAA 5JPMH 1DT2A 1GJ4H 2A32A 2JH5D 1C4Y2 4BTTB 1Z8GA 1J8AA 1WYKA 3WY8A 4CH8B 4K8BA 1U6QA 1MMJN 1DWEH 3LGIA 3P8GA 3O8RA 1FIWA 1O3PB 1P2OA 1JOUB 1MZDA 1MTUA 5ETXA 1FUJA 4FVBA 1AZ8A 1A0HB 3AAUA 3LKWA 1QL7A 5T3HA 1YPEH 4R0IA 1SHHB 1T8LA 4AN7A 1ORFA 1F5KU 1HJ9A 3P70B 2Q6GA 2OXSA 1OPHB 3SW2B 4JZEH 1P2KA 4FU7A 2PUQH 3EGKH 1SB1H 4AGJA 1QNJA 1OYTH 1TPSA 2SFAA 1UTQA 2ZCKP 4A7IB 2Z9JA 1MQ5A 1MTSA 3NZIA 4OS7A 3MMGA 4AZ2B 1D3DB 1UO6A 2BD7A 4NA9H 3SHCH 1GBEA 2W7UA 3PWBA 5F03A 2BDHA 4VGCB 3LJJA 1QR3E 2DE9A 2VGCB 4GLYA 4LZ4B 1UTKA 1GCDA 1VJ9U 3TGKE 3QK1A 1BJUA 3K6YA 4Z0KA 2VIQA 3MNCA 1MAYA 1TE0A 2XTTB 1H4WA 1HFDA 1AWFH 1MBMA 2GKVE 2ZFRH 2Z94A 1BBRE 4YTAA 3Q3KA 5EODA 3B9FH 1FPCH 5F8ZA 1OWKA 4LZ1H 3BN9A 2ZDKA 1GG6C 1VITG 1MD7A 4JCNA 3GCNA 4DW2U 3ZZCA 1SGNE 1F2SE 2SGQE 4XBCA 1YM0A 2XBVA 1RS0A 2BLQA 3RM2H 3VB4A 2GCHG 2H6MA 1JMOH 1TONA 2ANMH 4NFFA 1AVXA 1QL9A 2QXJA 1E37B 2PGBB 1AY6H 1EXFA 2VVCA 1MTWA 1RTLA 2J95A 4AORA 4IMQA 3KQBA 4F49A 2BXTH 1SSXA 3QTVH 1OWJA 2A45B 2GTBA 1UMAH 1BJVA 3RXBA 3TNTA 4OS4A 1A46H 2ZFFH 1BB0B 3ODFA 1W13U 3URCA 2WPIS 1HXEH 4A1XA 3SUFA 3TPIZ 1FXYA 1GHAG 1GJ8B 3LJOA 4CBOA 3T2NA 1PPBH 4Y11E 3A7XA 5HM9A 1MTNC 1AUTC 2VH6A 5JB9S 4A92A 2OD3B 3P8NA 3JZ2B 3GOVB 2HOBA 1W0ZU 3SQEE 2ZPSA 1C9TA 2ZPQA 1O2RA 2WUCA 2YOLA 1MKXH 1NFYA 2ZNKH 4X0WU 2QYIA 1GMCF 3UNSA 5GDSH 1G32B 2VWMA 1NU9A 1F5LA 4FUDA 1W7XH 1LTOA 1GBFA 1BTUA 1DUAA 4J1YA 1C2MA 5DG6A 2Y5FA 2I6QA 3PLBA 4HTCH 2FEQH 4ABEA 4MPWA 1JIRA 2XCNA 1O2KA 1QY6A 2BDGA 4FUEA 1ANDA 3M7TA 5FXLA 1RTKA 7ESTE 2PKSC 1GMDG 1IQMA 1UVPA 1ZRKA 3S7HB 2VIOA 3BTQE 5EQSA 3FZDA 3KIDU 2C8WB 6CHAB 2THFB 4YOGA 3LGUA 2PFEA 1CHOF 1Y3UA 2PTNA 2ZCHP 3RLWH 2Q1JA 1C1NA 2FYQA 2XC4A 1O2LA 4RN6A 3SV6A 3A7WA 2DE8A 2BB4A 1QA7A 3ODDA 3E90B 3L3TA 2FDAA 1O32A 3ZV8A 3M5MA 3S7KB 1O2UA 2SGEE 4MPXA 2K1QA 1G37A 1PQ7A 2FLRH 1SLWB 2CF9H 4KP0A 3G01A 5AFZH 2Y5GA 1SL3A 1SBWA 3SNCA 1HYLA 4X2VA 1C5MD 2B9LA 1HAVB 2AMPA 4X8VH 1ESTA 2HALA 1JXPA 1H9IE 1D4PB 4D7FA 1XUKA 2TRMA 5HM2A 1UVOA 1O2MA 1TLDA 3RXQA 1PQ5A 1IHSH 1O2XA 4CREA 5DP8A 2J2UA 1LPGB 3A87A 1MCTA 3U8OH 1KSNA 1L1JA 1QB9A 2A4QA 5JBBS 1K21H 2BD8A 3SQHE 1ZMNA 2G00A 1HNEE 3GCTG 1FZZA 2BX4A 4K5ZA 3VB6A 6GCHG 1ZTJA 2BVXH 1GCTC 5E2PA 4FU8A 1SGQE 3LC5A 4UFDH 7KMEH 3D62A 8GCHG 1SGYE 3M36A 4NSVA 2A7HA 1ABJH 1SGRE 3T26A 1O38A 3LT3A 1G3DA 2SGDE 1C5ZB 1BTPA 1TOMH 5AVDA 3VGCC 5A2MH 3E8LA 3RMLH 3QN7A 1SQAA 2BD5A 1AD8H 1N8OC 1T8NA 3PYHA 1NFWA 1AHTH 1PPHE 4NG9H 2GZ9A 3BIVH 2ZEBA 2WPLS 1GBKA 1CE5A 1YP9A 1FV9A 1BOQA 1KDQA 1UCYE 4YLQH 1C2LA 2QIQA 2VIDA 4ISIH 2ZA5A 3L33A 5EPNA 5DK1A 2WYGA 4CRCA 4XE4A 3LH1A 1SOTA 1ZYOA 1TNHA 1A5GH 2F9BH 4CHAB 2XWBI 3M5NA 1RGQA 4JZFH 2A31A 1O3FA 1Q31A 1TX7A 2UWOA 4I8JA 1C2HA 3U69H 3SORA 2O8LA 1QRXA 1SR5C 3MI4A 3VB5A 1EPTB 1QJ7B 3LPRA 4A6LA 1INCA 3MU0A 5T6DA 1P11E 4B74A 1BZXE 1EAXA 1YPMH 1Z71A 1GMHF 3RXCA 4UFFH 2ZGXH 2G55A 4WMDA 4WWYA 2PR3A 3QZQA 1P3CA 1DS2E 4DGJA 4ZHLU 1KLIH 4K1SA 2ALPA 2FTLE 4IC6A 1YYY1 1ANBA 5E0GA 1EZXC 1O2HA 1EUFA 2BD4A 1GHXH 5PTPA 1G9IE 3MNXA 4X2XA 1GI2A 1DSTA 3LOXA 4WXIA 3ZZAA 2BY8X 2CXVA 3A8BA 1UK3A 4NZLA 3W95A 4K8YA 4Q7ZA 4BAHB 4Y8ZA 1AQ7A 1CHGA 4Q7XA 2H5CA 3E16B 3F9HA 1A1RA 2SGAA 3MO9A 5EOKA 4UONA 2F91A 2R0KA 3SU0A 1C5SA 2R9PA 3KN2A 1Y3XA 1UTOA 4INLA 1EX3A 3H7OA 2FOBA 1DX5M 2F83A 2AGEX 3RMMH 2ZGBH 3H5CB 2AMQA 1QJ1B 3PTBA 4LXBH 2FO9A 4VGCC 1TMUH 4DIHH 2VGCC 2W3IA 1B7XB 3Q00A 1FI8A 3MO3A 5JYIA 3KQDA 2P16A 1BDAA 1DWDH 1ZGIA 2BQ7B 1L0ZA 3A84A 2D1JA 2V3OH 2DUCA 4GUXA 4ZROA 1OWDA 4X6PA 3LU9B 1J17T 2BLOA 3S0NA 3RXAA 1CVWH 5LPFA 5F8TA 2YNBA 3ZZ8A 1GJ9B 2WPKS 2OP9A 1CA8B 1N1LA 2Z3EA 2Z3DA 4Y8YA 1ETTH 4HZHA 1KTSB 4ISOA 1C2FA 1Y3WA 3A88A 1FLEE 3E3TA 3R0FA 2ZU5A 2ZFPH 1D3QB 2NU1E 3ATIA 3EAJA 2PV9B 1W2KH 1GBMA 3RXLA 4X8SH 1BQYA 1OWIA 1DWBH 2ODPA 2GT7A 1A0JA 2QAAA 4GPGA 1AU8A 1DVAH 3OYPA 1HAPH 5FPSA 1ELDE 3PLKA 1DDJA 2ZDNA 3LH3A 2R2WU 4O03A 2H9TH 4GAWA 3SGBE 1O3DA 2G4UA 1TNLA 2OQUA 3M7UA 1GBIA 3ZZ7A 3GY5A 2FI3E 1ESBA 1BMLA 1HIAB 5EPYA 3ZZ9A 2V3HH 2FM2A 2FOAA 3BEIB 3RXUA 1GVKB 5A8ZA 2VU8E 1WQSA 1THSH 3GY4A 1YF4A 1C2DA 5GWZA 2J9NA 1TA2A 4WY3A 4AYVB 1UTPA 1O2YA 1CU1A 2R0LA 1ZPCA 3SNEA 1MTVA 1O3HA 1IAUA 5FX5A 3MH6A 4UE7H 2ANWA 2J34A 1V2VT 1ZOMA 4O3UA 2FOCA 3AW1A 2FODA 3DT0H 1WUNH 3TITA 1D3TB 3VFEA 1V2UT 2FOFA 3VXFH 3MH4A 1IQNA 1QQUA 1WBGB 1LKAA 2BLWA 1FDPA 5L6NH 2RA0A 1FONA 5F6MA 2Y7ZA 1MKXK 1W10U 2BDAA 4BTUB 1O2IA 3FAOA 5A09A 4Q7YA 2CGAA 2OC7A 3RP2A 2HLCA 4H42U 4D9QA 2FYRA 3GDSA 1O3AA 1NRRH 3BTGE 3SNAA 4IN1A 1Z6EA 3L6PA 4X8TH 2AMDA 2TGDA 2ZI2H 1PPEE 4UFGH 4BAMB 4DURA 5TCAA 1V2WT 2WV5A 3LONA 1H9HE 1SLXB 1SGFG 1AVGH 4WMFA 1V2MT 1N8OB 1QJ6B 3I77A 4BXWA 5L30H 5T6FA 3KEEA 1S5SA 4IW4E 1YLCA 4WXVA 2IOTA 1UTLM 3GYMA 2HGTH 3P8FA 4Y7BA 3KL6A 1LO6A 4WF8A 3RU4E 1IQFA 1MH0A 3BTFE 2BD2A 4Y8XA 3TH4H 1AUJA 4ZKSU 4OS6A 3MU8A 2QXHA 3PMAB 1G2MA 2WPHS 4AFSA 2F9PA 2ZWLH 1AGJA 4I8GA 1EKBB 2A1DB 3EE0B 3F9FA 2BVRH 3HGPA 4M7GA 1LQDB 1BRAA 1C5LH 5C67A 3DFLA 2G52A 1SQTA 4YT6H 1Y59T 2VVUA 2AIPA 3ZVBA 1W14U 2ZP0H 2D2DA 3SU1A 3CP7A 1V6DA 2SNWA 1ABIH 4A5TS 1P03A 3ESTA 2VIWA 4ABBA 3RU4T 1ZLRA 4F4OC 1O3JA 2XBXA 1O3GA 5H4IB 1FY1A 4JMYA 2Q6DA 4Y10E 1P2MA 1T8OA 1F5RA 1WV7H 3U8RH
chains in the Genus database with same CATH superfamily
5FHTA 2B5TB 3VEQB 2ZGJA 1IQGA 1C2IA 3MU4A 3RC4A 2VWOA 4K1EA 4AB9A 3OY6U 1GJBB 1VITH 1LHCH 1O3MA 3AASA 4CRAA 1P2NA 2NU0E 4RKJB 1GMCG 4TSFD 1FMGA 1K1IA 3RXJA 2J94A 2Z6BD 4ISLA 4DY7B 1YPHC 5DP6A 1KXFA 4ABAA 1PQAA 3FZZA 1HLTH 1C5OH 2ASUB 1DXPA 1RRKA 1LHGH 1E0FD 1O3LA 2O8UA 1GI4A 2BOHB 1T32A 3SHAH 1XUGA 2I6SA 2CHAC 5FAHA 4GCHF 4SGBE 1FY8E 1ARCA 1Y5UT 4NIWA 1VGCB 3LIWA 4XSKU 3UNQA 3HATH 4CHAC 1O3BA 3P8OA 1VCQA 4DJZB 3UIRA 2V7QD 7GCHF 2PUXB 1C2JA 3KNXA 1GJCB 1F7ZA 2BOKA 3ZZDA 4U32A 2ZTZA 5C0UA 3U8TH 1TFXA 1CHOG 5DN6D 5FPYA 3SV8A 5GXPA 4H4FA 2KX4A 4YO9A 1E79D 3TJOA 4FUBA 1EPTC 3RXGA 1FY5A 2NWNA 3ITIA 1ANCA 2TBSA 2RDEA 2BD3A 3ZYDA 3V0XA 2Z9GA 4BOHA 1S83A 2M5TA 1Y8TA 5EQQA 4BAOB 1EZUC 1C4V2 1B0FA 2GGVB 1KLJH 4U01A 2F9NA 4AFQA 2SGFE 2SGPE 4KTSA 4ZKRU 1TQ7B 5L2ZH 3SV2H 1C5NH 1KXAA 2Y80A 1GHYH 4ABDA 2ZHWH 1VR1H 1UJ1A 4YESB 3NKKA 1V3XA 5C17A 3SJIA 1H8HD 1PJPA 1QTFA 4YM9A 2PP6A 2PSYA 3PO1B 2VINA 1SPJA 3BG8A 2PGQB 5K7RA 2FI4E 4JZIA 1YLNA 1IQHA 1MCVA 1HAGE 1ZSLA 2GDEH 1THRH 4NFEA 1GI1A 4X6MA 2HVXA 1EAWA 3QTOH 3RXSA 3P17H 1UHBB 1TGBA 2BDCA 1O35A 4Y79A 5JBTA 5HMAA 5FBIA 3NCLA 1XUIA 1S6HA 2F9VA 2H9EH 1XKBC 4Q80A 1SGCA 3QDZB 2QE7D 6ESTA 3NUMA 4HG6A 2FTMA 4FU9A 2QF3A 1C5WB 4I31A 4B2CA 4QT8C 1AKSA 1TOCB 3QX5H 3KHVA 1CT2E 1OWHA 3KCGH 2TIOA 5LGOA 1PPGE 1ZPZA 1V2KT 1SGPE 3TJNA 4ASHA 1LPKB 4YOJA 4IBLH 1C5XB 1O2OA 3S69A 6LPRA 2IPQX 3K65B 1L4DA 5EW1H 3ZV9A 1Z1IA 4TWYA 1J14A 1C4U2 1GHWH 2B8OH 1K0HA 3UWIA 1H8IH 1RXPA 1C5UA 4MLFB 3BTDE 2W7SA 5FBEA 3TU7H 4E06H 3BG4C 9LPRA 4WMEA 3R3GB 3MH7A 4JYTA 1MQ6A 4WH8A 3KQCA 4BXSA 1ELVA 3V12A 2F43B 3QWCH 1DPOA 3RXRA 2ZDAH 4NCYA 1LQEA 1V2QT 1L1NA 5ESBA 1K2I1 3N7DA 3RXIA 1C1WH 2VWNA 3TGJE 3GY3A 5FCRA 1GI8B 1KXDA 3RC5A 1MZAA 2VNTA 1AZZA 3UREA 5I25A 1F92A 4HGCA 4Q4LA 1GBBA 3UUZA 1J9CH 5DKMA 3HK3B 1E1RD 1Z8RA 3PMJA 5A0BA 1Q2WA 3BSQA 4X1SU 1GMHG 1YPGH 4I33A 1O3NA 2O9QA 2EEKA 3MU5A 1YPJH 3QLPH 3GY7A 1TQ0B 4TYDA 3SJKA 1YGCH 1TGTA 4AYYB 2JH0D 1GWAA 1WOFA 3I29A 2RA3A 1TNIA 4LK4A 1L4ZA 1KMHB 1D3PB 2A5AA 3A86A 2CF8H 1A5HA 5AF9H 4SGAE 4NWKA 3FANA 3UQVA 3P92A 4FUHA 2ZGCA 2KAIA 3U1IB 4INKA 2FX6A 4Y7AA 3EE7A 1O5FH 1ZRBA 3OTPA 2XRCA 4ACAA 1B5GH 1K1LA 1LVYA 3OTJE 1GDNA 1HDTH 4JK5A 1A0LA 4WH6A 3E0NB 1ZMJA 3PMBB 4P00A 1DSUA 4OS5A 4AFZA 1FY4A 1GVLA 1ELTA 1FAXA 5GJ4B 1EB2A 1O5GH 1GDQA 1P01A 4JZDH 2QY0B 1SLUB 4O3TA 2BVSH 1BTXA 1N6YA 3N7OA 3C27B 2AH4X 1C1OA 1O36A 3LGWA 1QURH 1TBZH 1KXEA 4D8NA 4NIXA 1O5AB 2A0QB 1O2QA 3PRBA 1HUTH 1FQ3A 3OX7U 2XYAA 3VG8A 5EW2H 1G36A 4ZKOU 3ZVCA 4MG3A 3PTNA 2PWXA 4AGKA 1GGDB 5JB8S 2EI7A 1FJSA 2PKAA 2XWAA 2WYJA 3QGJA 1O3IA 2ZPRA 1C1SA 1GHVH 2BMGB 2CHAB 9ESTA 3TGIE 5A8YA 4TWWA 5B6OA 2OK5A 1W0YH 1BMFD 4INHA 4NGAH 1W8BH 2RG3A 1CGHA 1GVZA 4AB8A 1YC0A 5LH8A 2ZHDA 3NPSA 1PQ8A 4B2AA 3A8AA 1DUEA 1GHBF 1XVMA 1ZHMA 3QUMP 2HWLB 1MABB 2WV4A 4ZHMU 3ZVGA 1BTHH 1V2NT 1EAUA 2OBQA 4X6OA 5GNDA 2A4GA 5DPAA 3SU5A 1KLTA 1TGNA 4BANB 1OWEA 3ZYEA 1NBMD 1TNKA 5FPTA 2B0FA 4ZMAH 5DP3A 4FUFA 1VKYA 2V0BA 1DY9A 3A7ZA 4RT0A 1O3EA 4MPUA 1G3BA 2KR7A 1P02A 3SU4A 4ZHAA 1DXWA 1EOLA 3FP7E 1DITH 1WQVH 1NESE 1Q3XA 1XXDA 3RLYH 3STJA 2GCTB 3BTME 3SO3A 1WCZA 1QB1A 1IQLA 1HGTH 1W3CA 2OC0A 2HPQH 2UUFB 3LGYA 2ANYA 4Q2KA 3KF2A 4XOJA 3LC3A 3SOSA 5EXNA 1F0TA 3A8DA 5EGMA 3DFJA 3LDXH 1RIWB 2QCYA 3F2HA 4UEHH 1DLEA 2EI8A 4FVDA 3UR9A 1BTWA 1EATA 7LPRA 8ESTE 1KXCA 1QBVH 2BD9A 1SHYA 1BIOA 3K9XB 3QGNB 1X7AC 4YOIA 5LPEA 2JKHA 3MNSA 5E0HA 1TBQH 1VZQH 4NIVA 4JYVH 2J97A 3SU2A 2AERH 2GDDA 1VGCC 1P2JA 1C2EA 2JH6D 2J5UA 5J4QA 2ZO3H 2QA9E 2C3SA 1BITA 3OAAD 1P09A 4XBBA 3SJ8A 2FS9A 3K6ZA 4CRGA 1CA0B 3UNRA 3FVFB 1TX6A 1O5EH 2WUBA 3SUDA 3BTTE 3SU6A 3F9EA 1GBJA 4Y71A 1G3EA 1OXGA 1Y3YA 1UVTH 2XBYA 1GI5A 2ZC9H 1O2GH 2QF5A 2D26C 2BY7X 1K1PA 3TH3H 4KTUA 3SV7A 1O2WA 1QFKH 1ETSH 3BG4B 4J2YB 1GPZA 3ATKA 4IGDA 4BTIB 5C0TA 1IQIA 4H6SB 2C4FH 2AHME 1LHDH 2GD4B 3BIUH 3GY6A 4RSPA 3TK5A 3A81A 1NU7B 1HAHH 1ELGA 1HAXB 4MNYA 4B1TA 1P8VC 1O2JA 1XKAC 2KM0A 3QO6A 5L2YH 1YBWA 2C8ZB 4NA7A 2FI5E 3PO1C 5DP5A 1HPGA 1A4WH 3F6UH 1QBOA 5J4SA 5C3NA 5E2OA 1BBRH 3FP6E 3U9AH 1FN6A 1PYTD 1G3CA 1ZPBA 2ANKH 1SQOA 3A8CA 1LVBA 1TRNA 2AGIX 1NY22 1EZQA 4X6NA 1NRSH 1XUJA 5EG4A 4TY6A 1GBDA 3A7TA 3H09A 4PROA 5G4BA 2BY9X 1P10A 2HVYB 3MH5A 3O8BA 5T6GA 3O8DA 4OS1A 1MU8B 1V2RT 3S9AA 5DJ7A 1MAXA 1OS8A 3SNDA 3GCHB 1C2KA 1SGEE 3UTUH 1YPKH 3T28A 5E0JA 4B71A 1T31A 1VCWA 1NBME 1UTJA 2FMJA 3HGNA 4KGAA 2ZU1A 4I8HA 2W3KA 1V2LT 1FY3A 1DWCH 3TK9A 4DT7B 4CBNA 3M35A 1CBWB 2C90B 1ZSKA 5AHGH 1BRBE 4GHQA 5B6LA 1C5VA 3IG6B 3EYDA 3FOAA 2ZU3A 3OE7D 1LDTT 3RUOA 4DG4A 1E38B 4ZCNA 2B7DH 3GCOA 1E1QD 4GCHG 1GJAB 5EQRA 2V3MA 2F9UA 1O3KA 3ZZ6A 1BCUH 1YPHE 3BEFB 4XFQA 2OQ5A 1P3EA 2ZIQH 3SUGA 2V6NA 3M61U 2HNTC 3TK6A 4TPIZ 1SGDE 2OINA 4D9RA 1BT7A 1BHXB 1D6RA 3PV2A 3BTEE 1TBRH 3RXMA 4JK6A 3SJOA 1LHFH 7GCHG 2WSSD 2AEIH 1RFNA 4B75A 3DA9B 4DIIH 2ZGHA 3M5OA 3ZZBA 4YLUA 3V7TA 1CQQA 3GDVA 2G81E 3ENSB 3W1EA 1ZTLA 3A85A 2L6OA 1EZSC 3M3TA 1K1JA 4MTBA 1KYNA 1UK4A 2GV6A 2A5KA 5I46H 2ZTXA 1ZHRA 3WWFA 4Z1MD 1A2CH 4AX9H 1NM6A 5C5OA 4JYUH 1N6XA 4H6TA 1EJAA 1KDQB 1P0SH 2BYAX 1ZSJA 1C5PA 4A1VA 1TIOA 2H1UA 4UD9H 4X1PU 4AG1A 1ZMLA 3OY5U 4TT3D 2ZU2A 1E36B 3QZRA 3CNRA 1MKWH 1GBAA 3M37A 1V2OT 1GDUA 3Q76A 1DICA 3T62A 1AB9B 1ELEE 1SKYE 3BF6H 4ZAEA 2BTCE 2GV7A 3VXEH 2Z9LA 3E6PH 4MNXA 5BPEA 1THPB 1B0EA 2BM2A 1HAVA 1NTPA 1O2NA 4ABHA 1NROH 4WVPE 1CT0E 1XM1A 1DANH 1JRTA 3ZIAD 2VVVA 1D6WA 1NRNH 1S85A 4NIYA 1HJAC 1OYQA 1TWXB 5C20A 2NU4E 3F2FA 3D65E 1ETRH 2JJ2D 1QIXB 2CMYA 5EXLA 5HYOA 2BZAA 1QB6A 1HCGA 2ESTE 3MHWU 4CRFA 1S0RA 1BMMH 2BY6X 4AOQA 3CENA 1G30B 3IWMA 1HRTH 1PPCE 2UUJB 1GGDC 3A7YA 1TPOA 1NZQH 2P3FH 3C1KA 1O5CB 4O97A 4X8UH 5DP9A 2GZ7A 1IQEA 2Y5HA 1AFEH 1PFXC 3O8CA 1F0RA 1UW7A 3DCLA 2IJD1 1NPMA 2WPMS 3GS9A 1AMHA 1GJ7B 1GHZA 1S6LA 2GMTB 4HFPB 5GCHF 4Y0YE 4FOUC 4AFUA 1AN1E 2J98B 3F0PA 3F9GA 3TNSA 5CHBA 3VPKA 3Q3YA 1C5TA 2GP9B 2FX4A 5JBCS 1MUEB 4JZ1A 1YCPH 1ZJKA 3PROA 4TPYA 1VJAU 1VCPA 3H7TA 4X1NU 1TMBH 4K2YA 4I7YH 1E35B 1AO5A 1HV7A 1UCYH 1QHRB 3B8JA 1HB0B 1BMAA 1UVSH 2FESH 5EIYA 1S0QA 1L1GA 4RKOB 1GJDB 1A3BH 1C5RA 3A82A 1Y5BT 1ZZZA 4XDEA 1SLVB 1S81A 1EPTA 3STIA 4X2WA 3UOPA 2Q6FA 3MTYA 3E91A 2GCTC 1TRYA 1Z8JB 3E0PB 1KXBA 1S6FA 2BDYA 2ZDMA 3TJUA 1NRQH 1GBCA 2ZHQH 1PPZA 3T5FH 5EU8A 2NU2E 2XC5A 1P9UA 2IJOB 5A8XA 5IDKA 5A0AE 1QCPA 1KY9A 3MQKC 1A7SA 2JDID 3FO8D 8LPRA 1IQKA 3UPEA 1OP2A 1RIWC 2Y81A 3MFJA 2LNCA 3BTWE 3RMOH 1HAOH 1WSSH 3OEED 4RT1A 1RTFB 2KCAA 4K3JA 1ZJDA 1C9PA 2G51A 2ULLA 1PYTC 2SNVA 3PM3A 1EJMA 3MWIU 3ELAH 3S9CA 2RFKC 2LELA 4DVAU 1FPHH 1BHXF 3AVZA 3EA9A 3S9BA 2F3CE 2C8YB 2STAE 1Z7KA 4UFEH 2BQWB 5LPRA 4UDWH 3SGQE 1TB6H 3TLOA 5C5NA 1GI6A 1C1TA 4OGYA 2FIRH 4ABGA 2Z9IA 3HKJB 5HIYA 1SGIB 3IITA 3UR6A 1CA0C 1DY8A 4X1RU 2A5IA 2A7JA 2OCVB 2K8IA 4MPVA 3NWUA 3RXTA 1DLKB 2ZTYA 3EQ0H 1QL8A 1WTHD 1ESAA 1Y5AT 1BRUP 3PB1E 1JRSA 2ODYB 4FUGA 1BUIA 3KQEA 3U1JB 4R8TB 1EP6A 1ELCA 2P95A 2JETC 2IN2A 4DCDA 2ODQA 5ABWA 1LCYA 1YPLH 1GBHA 2WINI 2TGPZ 2CN0H 5JBAS 1C5YB 3SBKA 4K60A 1OOKB 3TIUA 3V13A 4B76A 1BMNH 4LOYH 1P9SA 5A0CA 1TGCA 1WAYB 1XVOA 2BX3A 1GHBG 3TH2H 5HGGA 2BDBA 2ZZUH 2BZ6H 1NFXA 3RXFA 5CHAC 5IYTA 3ATLA 1TABE 1O2TA 3DUXH 1V2PT 1P04A 2FZZA 1O2SA 4KTCA 3UOUA 4I86A 3UAIC 1M9UA 3M5LA 1OHHD 1SQRA 1DOJA 1MU6B 2GX4A 3RDZA 1A61H 3EA7A 2NU3E 4GVUA 1TGSZ 1NS3A 3AW0A 2J92A 2AFQB 5F53A 1SFQB 1T7CA 2A7CA 5K0HA 1FX0B 1W11U 1HXFH 1Z6JH 1SGFA 1OP8A 1SGTA 2PSXA 1OSSA 4MDSA 2W6JD 8KME2 3PV4A 3GCHC 1BBRK 4ASUD 1AFQB 3RXVA 2FLBH 1P57B 4AC9A 1FN8A 2ZDVH 2ZG0H 3T27A 4D76A 1QRWA 1SC8U 1LVOA 1VITF 1HIAA 2P8OC 5ESTE 1EAIA 1SG8B 1SMFE 3BV9B 2VIVA 3SI3H 1BRCE 1SVPA 5FCKA 2ZF0H 1RD3B 2ALVA 1O3CA 3CS0A 3N99A 1LHEH 1O37A 1CBWC 1C5QA 1ZTKA 1TAWA 2HPPH 3CS7A 1O33A 3A7VA 3M7QA 2GCHF 4CRDA 4I8LA 5DGJA 3ZZ4A 4Y6DA 4TY7A 3ZVDA 2C93B 3F1SB 3GICB 5TCCA 1C2GA 1P06A 1GBLA 2A2XH 4ESTE 3WWBA 1ANEA 3RXKA 3GYLB 1F0SA 4CR9A 1E34B 2J4IA 4NWLA 2EA3A 3DSPA 2H9HA 1V2ST 2OTVA 1HJAB 3N7EA 1BTZA 1A3EH 1J15A 1ELBA 1XMNB 4OS2A 2P94A 4A1TA 2P3UB 1GBTA 2TGTA 1ID5H 3BTKE 1CGIE 1GHAF 4ZUHA 4B73A 4OGXA 3E1XB 2FOGA 2BDIA 2BLVA 4KELA 4O9VA 2P3TB 1YKTA 1TNJA 1UTNA 3MO6A 2BHGA 1LVMA 2O8MA 4YZUA 3P95A 1C1QA 1QA0A 2Y7XA 2R3YA 4FETA 2ZFTA 1EJNA 3SI4H 3T29A 3SJ9A 1O3OA 1JIMA 2TPIZ 1O2VA 2H5DA 2AGGX 5C1XA 2OC8A 4DT4A 1F0UA 2UWLA 1C1VH 1SFIA 2QXGA 2G4TA 2BY5X 4ABJA 2QN5T 1CSOE 2VWLA 1Z1JA 3HPTB 1HAYB 1GI7B 1TYNA 2QV1A 5GPIB 2A4RA 4IN2A 1SI5H 3UY9A 2GZ8A 1SOZA 2HRVA 4E7NA 3GISB 1GMDF 1AB9C 2STBE 2Y6TA 3EDXB 2FOMB 2EI6A 1O30A 4XD7D 1JWTA 1H1BA 4NA8A 2XXLA 1IHTH 1MKWK 1ZHPA 3ATMA 3ZVFA 1H8DH 2O8TA 1EQ9A 3RC6A 2XW9A 5HKKD 3FFGA 3F68H 2FS8A 5DP4A 2R2MB 1QBNA 4KKDA 1GL1A 4K1TA 1TA6A 2XBWA 3ZVEA 1GJ6A 1S82A 4Y76A 3V3MA 4YXWD 2Z7FE 3HKIB 1K1NA 1ZGVA 3NRLA 1GG6B 2GT8A 2ZCLP 1HAZB 3UFAA 1T8MA 2EY4C 3OSYA 2BXUH 1TMTH 2ZHFH 2PHBA 1WDIA 1C1UH 1AE8H 3TJVA 1NT1A 5DO4H 1QZ8A 1AI8H 4I8KA 3RXHA 3UQOA 5DP7A 2VH0A 1GI0A 1AE5A 1P2IA 1W7GH 1MBQA 1WTGH 3URDA 5C2ZA 5AFYH 3NK8A 3ZZ3A 3ATWA 1C1PA 2Y82A 1OX1A 1TPAE 1FAKH 4FUJA 2D8WA 1DM4B 1UK2A 2HNTF 2UUYA 2FOEA 3SN8A 1HBTH 2AS9A 2OLGA 4XBDA 3LGTA 2UUKB 2W5EA 3SZNA 1D9IA 2GMTC 4HI3A 4GSOA 1AKSB 1CT4E 2PTCE 1HJ8A 2A4OA 2VB0A 1TRMA 2QGRA 3SUEA 3SU3A 3GCTF 2HNTE 1MTNB 2GVFA 1GJ5H 2ZKSA 3W94A 5CE1A 6GCHF 1NO9H 4MQAA 2FXRA 3RU4D 4K69A 3HK6B 4AG2A 8GCHF 1W0JD 4E7RG 2CV3A 2JETB 3ZVAA 2G8TA 1XUFA 1XX9A 3M3VA 1WXRA 1EB1H 5C1UA 2YNAA 2KFWA 3PV5A 4Z6AH 1A5IA 2XNIA 3RXEA 1IQJA 1V2TT 1YCPK 3D23A 2FOHA 4ABIA 2CJIA 3F0OA 1TX8A 1K22H 4FXGH 2Z9KA 5E8EH 1UCYK 5CHAB 4IS5A 3MOCA 4I32A 1QRZA 5BRRE 1AIXH 2ZHEH 2PLXA 1BA8B 1LKBA 1RJXB 3T25A 2PKSB 4X2YA 4DOQA 3GDUA 1GI3A 3D49H 4BAKB 5EJLA 3RMNH 4ZH8A 1ELFA 3BTHE 1O0DH 2G5NA 5SGAE 3ZZ5A 1QQ4A 1H9LB 1P12E 4MNWA 3JZ1B 4FUCA 1Y3VA 3Q77A 2H2ZA 1EOJA 1OKXA 4U30A 1T4VH 1DFPA 1V2JT 3GY8A 2G5VA 4ZXXH 2OC1A 1IOEA 3LGVA 3WW7A 1YCPM 1GL0E 3OEHD 2P8OB 3RM0H 2OUAA 1UHBA 3VB7A 2ILNA 2XCFA 4Y0ZE 1GI9B 1K1MA 3PMHB 2KAIB 5FX6A 1EASA 3DHKH 4GHTA 3M3SA 5T1VA 1O5BB 2RCEA 1P05A 3GY2A 2A2QH 1ARBA 4ISNA 2C8XB 3AAVA 5HXFA 3B23B 5CMXH 2RDLA 1XXFA 4BNRA 2UWPA 4CH2B 3I78A 1S84A 1TALA 1UTMA 1NRPH 2LPRA 3UWJH 4CR5A 2PW8H 1YWUA 4X1QU 1FIZA 2VJ1A 2FP7B 1O2PA 5KEDA 2P93A 1C1MA 3BEUA 3MU1A 3Q3XA 1T4UH 5GCHG 2F9OA 1WU1A 1KTTB 3TVJB 2ZFSA 5C1YA 1K9OE 3K2UA 3OU0A 3RXDA 2O8WA 4WJG2 4YT7H 1K28D 1LMWB 1O31A 4B2BA 1W12U 4BAQB 3A89A 4D7GA 1GCTB 1NN6A 2AYWA 2ZFQH 1EP5A 3SNBA 3U98H 2FPZA 5EJZA 2TGAA 4IMZA 4ZXYH 2ZDLA 1OP0A 3FP8E 2PKAB 2VIPA 1NFUA 5TJXA 1DE7H 1JBUH 6CHAC 2V35A 3SYJA 2R3UA 2QXIA 3VGCB 1YLDA 2P59A 2QF0A 1QGFA 1PPFE 4ZKNU 5GIBA 3A83A 3NXPA 1O2ZA 1O5DH 1C1RA 2EQNA 1J16A 1AFQC 1AWHB 4MNVA 1FNIA 1P2QA 4U2WA 2WPJS 4THNH 1O39A 1MD8A 4FUIA 1L2EA 3EA8A 3DD2H 2OBOA 3SV9A 4ISHH 2ZQ2A 1K1OA 1CO7E 1HAIH 1AVWA 1ACBE 1O34A 5F8XA 4MVNA 4ABFA 3MNBA 4NZQA 3MYWA 1NC6A 3A80A 1LPZB 1XUHA 1TNGA 2QC2A 2ZECA 1G2LA 2BQ6B 5EXMA 2Z3CA 2XC0A 1ZR0A 2W26A 3RXPA 2AIQA 2FWWA 2YMSD 2IPHA 5JDUB 4E05H 3RXOA 2ZQ1A 2J38A 3KGPA 1CGJE 4NSYA 2ZU4A 4CRBA 3VB3A 4IC5A 3SGAE 2EC9H 1Z8IB 3PWCA 1BTYA 1KIGH 3P6ZB 1UVUH 1TPPA 3PLPA 1ELAA 5JPMH 1DT2A 1GJ4H 2A32A 2JH5D 1C4Y2 4BTTB 1Z8GA 1J8AA 1WYKA 3WY8A 4CH8B 4K8BA 1U6QA 1MMJN 1DWEH 3LGIA 3P8GA 3O8RA 1FIWA 1O3PB 1P2OA 1JOUB 2JJ1D 4F48B 2JIZD 1MZDA 1MTUA 5ETXA 1FUJA 4FVBA 1AZ8A 1A0HB 3AAUA 3LKWA 1QL7A 5T3HA 1YPEH 4R0IA 1SHHB 1T8LA 4AN7A 2XNDD 5IK2D 1ORFA 1F5KU 1HJ9A 1H8ED 3P70B 2Q6GA 2L74A 2OXSA 1OPHB 3SW2B 4JZEH 1P2KA 4FU7A 2PUQH 3EGKH 1SB1H 4AGJA 1QNJA 1OYTH 1TPSA 2SFAA 1UTQA 2ZCKP 4A7IB 2Z9JA 1MQ5A 1MTSA 3NZIA 4OS7A 3MMGA 4AZ2B 2HLDD 1D3DB 1UO6A 2BD7A 4NA9H 3SHCH 1GBEA 2W7UA 3U28C 3PWBA 5F03A 2BDHA 4VGCB 3LJJA 1QR3E 2DE9A 2VGCB 4GLYA 4LZ4B 1UTKA 1GCDA 1VJ9U 5CDFE 3TGKE 3QK1A 1BJUA 3K6YA 4Z0KA 2VIQA 3MNCA 1MAYA 1TE0A 2XTTB 1H4WA 2WHXA 1HFDA 1AWFH 1MBMA 2GKVE 2ZFRH 2Z94A 1BBRE 4YTAA 3Q3KA 5EODA 3B9FH 1COWD 1FPCH 5F8ZA 1OWKA 4LZ1H 3BN9A 2ZDKA 1GG6C 1VITG 1MD7A 4JCNA 3GCNA 4DW2U 3ZZCA 1SGNE 1F2SE 2SGQE 4XBCA 1YM0A 2XBVA 1RS0A 2BLQA 3RM2H 3VB4A 2GCHG 2H6MA 1JMOH 1TONA 2ANMH 4NFFA 1AVXA 1QL9A 2QXJA 1E37B 2PGBB 1AY6H 1EXFA 2VVCA 1MTWA 1RTLA 2J95A 4AORA 4IMQA 3KQBA 4F49A 2BXTH 1SSXA 3QTVH 1OWJA 2A45B 2GTBA 3OFND 1UMAH 1BJVA 3RXBA 3TNTA 4OS4A 1A46H 1W0KD 2ZFFH 1BB0B 3ODFA 1EFRD 1W13U 3URCA 2WPIS 5C94A 1HXEH 4A1XA 3SUFA 3TPIZ 1FXYA 1GHAG 1GJ8B 3LJOA 4CBOA 3T2NA 1PPBH 2F4LA 2M2AA 4Y11E 3A7XA 5HM9A 1MTNC 1AUTC 2VH6A 4ACBA 5JB9S 4A92A 2OD3B 3P8NA 3JZ2B 3GOVB 2HOBA 1W0ZU 3SQEE 2ZPSA 1C9TA 2ZPQA 1O2RA 2WUCA 2YOLA 1MKXH 1NFYA 2ZNKH 4X0WU 2QYIA 1GMCF 3UNSA 5GDSH 1G32B 2VWMA 1NU9A 1F5LA 4FUDA 1W7XH 1LTOA 1GBFA 1BTUA 1DUAA 4J1YA 1C2MA 5DG6A 2Y5FA 2I6QA 3PLBA 4HTCH 2FEQH 4ABEA 5KECA 4MPWA 1JIRA 2XCNA 1O2KA 1QY6A 2BDGA 4FUEA 1ANDA 3M7TA 5FXLA 1RTKA 7ESTE 5HIZA 2KZ4A 2PKSC 1GMDG 1IQMA 1UVPA 1ZRKA 3UB0A 3S7HB 2VIOA 3BTQE 5EQSA 3FZDA 3KIDU 2C8WB 6CHAB 2THFB 4YOGA 3LGUA 2PFEA 1CHOF 1Y3UA 2PTNA 2ZCHP 3RLWH 2Q1JA 4XRNA 1C1NA 2FYQA 2XC4A 1O2LA 4RN6A 3SV6A 3A7WA 2DE8A 2BB4A 1QA7A 3ODDA 3E90B 3L3TA 2VBCA 2FDAA 1O32A 3ZV8A 3M5MA 3S7KB 1O2UA 2SGEE 4MPXA 2K1QA 1G37A 4B6EA 1PQ7A 2FLRH 1SLWB 2CF9H 4KP0A 3G01A 3SZEA 5AFZH 2Y5GA 1SL3A 1SBWA 3SNCA 1HYLA 2WZQA 4X2VA 1C5MD 2B9LA 1HAVB 2AMPA 4X8VH 1ESTA 2HALA 1JXPA 1YY3A 1H9IE 1D4PB 4D7FA 1XUKA 2TRMA 5HM2A 1UVOA 2XOKD 1O2MA 2YMSC 1TLDA 3RXQA 1PQ5A 1IHSH 1O2XA 4CREA 5DP8A 2J2UA 1LPGB 3A87A 1MCTA 3U8OH 1KSNA 1L1JA 1QB9A 2A4QA 5JBBS 1K21H 2BD8A 3SQHE 1ZMNA 2G00A 1HNEE 3GCTG 1FZZA 2BX4A 4K5ZA 3VB6A 6GCHG 1ZTJA 2BVXH 4F55A 1GCTC 5E2PA 4FU8A 1SGQE 3LC5A 4UFDH 7KMEH 3D62A 8GCHG 1SGYE 3M36A 4NSVA 2A7HA 1ABJH 1SGRE 3T26A 1O38A 3LT3A 1G3DA 2SGDE 1C5ZB 1BTPA 1TOMH 5AVDA 3DSOA 3VGCC 5A2MH 3E8LA 3RMLH 3QN7A 1SQAA 2BD5A 1AD8H 1N8OC 1T8NA 3PYHA 4RI0A 1NFWA 1AHTH 1PPHE 4NG9H 2GZ9A 3BIVH 2ZEBA 2WPLS 1GBKA 1CE5A 1YP9A 1FV9A 1BOQA 1KDQA 1UCYE 4YLQH 1C2LA 2QIQA 2VIDA 4ISIH 2ZA5A 3L33A 5EPNA 5DK1A 2KCYA 2WYGA 4CRCA 4XE4A 3LH1A 1SOTA 1ZYOA 1TNHA 1A5GH 2F9BH 4CHAB 2XWBI 3M5NA 1RGQA 4JZFH 2A31A 1O3FA 1Q31A 1TX7A 2UWOA 4I8JA 1C2HA 3U69H 3SORA 2O8LA 1QRXA 1SR5C 5DSFA 3MI4A 3VB5A 1EPTB 1QJ7B 3LPRA 4A6LA 1INCA 2LP6A 3MU0A 5T6DA 1P11E 4B74A 1BZXE 1EAXA 1YPMH 1Z71A 1GMHF 3RXCA 4UFFH 2ZGXH 2G55A 4WMDA 4WWYA 2PR3A 5FL7D 3QZQA 1P3CA 1DS2E 4DGJA 4ZHLU 1KLIH 4K1SA 2ALPA 2KCOA 2FTLE 4IC6A 1YYY1 1ANBA 5E0GA 1EZXC 1O2HA 1EUFA 2BD4A 1GHXH 5PTPA 1G9IE 3MNXA 4X2XA 1GI2A 1DSTA 3LOXA 4WXIA 3ZZAA 2BY8X 3KQ5A 2CXVA 3A8BA 1UK3A 4NZLA 3W95A 4K8YA 4Q7ZA 4BAHB 4Y8ZA 3AK5A 1AQ7A 1CHGA 4Q7XA 2H5CA 3E16B 3F9HA 1A1RA 3DSGA 2SGAA 3MO9A 5EOKA 4UONA 2F91A 2R0KA 3SU0A 2GJGA 1C5SA 2R9PA 3KN2A 1Y3XA 1UTOA 4INLA 1EX3A 3H7OA 2FOBA 5EJ1A 1DX5M 2F83A 2AGEX 3RMMH 2ZGBH 3H5CB 2AMQA 1QJ1B 2J98A 3PTBA 4LXBH 2FO9A 4VGCC 1TMUH 4DIHH 2VGCC 2W3IA 1B7XB 3Q00A 1FI8A 4M9FA 2KCPA 3MO3A 5JYIA 3KQDA 4B6FA 2P16A 1BDAA 1DWDH 1ZGIA 2BQ7B 1L0ZA 3A84A 4Q63A 2D1JA 2V3OH 2DUCA 4GUXA 4ZROA 1OWDA 4X6PA 3LU9B 1J17T 2BLOA 3S0NA 3RXAA 1CVWH 5LPFA 5F8TA 2CK3D 2YNBA 3ZZ8A 1GJ9B 2WPKS 2OP9A 1CA8B 1N1LA 2Z3EA 2Z3DA 4Y8YA 1ETTH 2QF4A 1KTSB 4HZHA 4ISOA 1C2FA 3F3BA 1Y3WA 3A88A 1FLEE 3E3TA 3R0FA 2ZU5A 3FKSD 2ZFPH 1D3QB 2NU1E 3ATIA 3EAJA 2PV9B 1W2KH 1GBMA 3RXLA 4X8SH 1BQYA 1OWIA 1DWBH 2GT7A 2ODPA 1A0JA 2QAAA 4GPGA 1AU8A 1DVAH 3OYPA 1HAPH 5FPSA 1ELDE 3PLKA 1DDJA 2ZDNA 3LH3A 2R2WU 4O03A 2H9TH 4GAWA 3SGBE 1O3DA 2G4UA 1TNLA 2OQUA 3M7UA 1GBIA 3ZZ7A 3GY5A 2FI3E 1ESBA 1BMLA 1HIAB 5EPYA 3ZZ9A 5KGOA 2V3HH 2FM2A 2FOAA 3BEIB 3RXUA 1GVKB 5A8ZA 2VU8E 1WQSA 1THSH 3GY4A 1YF4A 1C2DA 5GWZA 2J9NA 1TA2A 4WY3A 4AYVB 1UTPA 1O2YA 1CU1A 2R0LA 1ZPCA 3SNEA 1MTVA 1O3HA 1IAUA 5FX5A 3MH6A 4UE7H 2ANWA 2J34A 1V2VT 1ZOMA 4O3UA 2FOCA 3AW1A 2FODA 3DT0H 1WUNH 3TITA 1D3TB 3VFEA 3PRDA 1V2UT 2FOFA 3VXFH 3MH4A 2YMSB 1IQNA 1QQUA 1WBGB 1LKAA 2BLWA 1FDPA 5L6NH 2RA0A 1FONA 5F6MA 2Y7ZA 3FN8A 2W6ID 1MKXK 1W10U 2BDAA 4BTUB 1O2IA 3FAOA 5A09A 4Q7YA 3F2GA 2WPDD 2CGAA 2K0QA 2OC7A 4P02A 3RP2A 2HLCA 4H42U 4D9QA 2FYRA 3GDSA 1O3AA 3KYGA 1NRRH 3BTGE 3SNAA 4IN1A 1Z6EA 3L6PA 4X8TH 2AMDA 2TGDA 2ZI2H 1PPEE 4UFGH 4BAMB 4DURA 5TCAA 1V2WT 2WV5A 3LONA 1H9HE 1SLXB 1SGFG 1AVGH 4WMFA 1V2MT 2WV9A 1N8OB 1QJ6B 3I77A 4BXWA 5L30H 5T6FA 3KEEA 1S5SA 4IW4E 1YLCA 4WXVA 2IOTA 1UTLM 3GYMA 2HGTH 3P8FA 4Y7BA 3KL6A 3KYFA 1LO6A 4WF8A 3RU4E 1IQFA 1MH0A 3BTFE 2BD2A 4Y8XA 3TH4H 1AUJA 4ZKSU 4OS6A 3MU8A 2QXHA 3PMAB 1G2MA 2WPHS 4AFSA 2F9PA 2ZWLH 1AGJA 4I8GA 1EKBB 2A1DB 3EE0B 3F9FA 2BVRH 3HGPA 4M7GA 1LQDB 1BRAA 1C5LH 5C67A 3DFLA 2G52A 1SQTA 4YT6H 1Y59T 2VVUA 4OM9A 2AIPA 3ZVBA 1W14U 2ZP0H 2D2DA 3SU1A 3CP7A 1V6DA 2SNWA 1ABIH 4A5TS 1P03A 3ESTA 2VIWA 4ABBA 3RU4T 1ZLRA 4F4OC 1O3JA 2XBXA 1O3GA 5H4IB 1FY1A 4JMYA 2Q6DA 4Y10E 1P2MA 1T8OA 1F5RA 1WV7H 3U8RH
chains in the Genus database with same CATH topology
5FHTA 2B5TB 3VEQB 2ZGJA 1IQGA 1C2IA 3MU4A 3RC4A 2VWOA 4K1EA 4AB9A 3OY6U 1GJBB 1VITH 1LHCH 1O3MA 3AASA 4CRAA 1P2NA 2NU0E 4RKJB 1GMCG 1FMGA 1K1IA 3RXJA 2J94A 2Z6BD 4ISLA 4DY7B 1YPHC 5DP6A 1KXFA 4ABAA 1PQAA 3FZZA 1HLTH 1C5OH 2ASUB 1DXPA 1RRKA 1LHGH 1E0FD 1O3LA 2O8UA 1GI4A 2BOHB 1T32A 3SHAH 1XUGA 2I6SA 2CHAC 5FAHA 4GCHF 4SGBE 1FY8E 1ARCA 1Y5UT 4NIWA 1VGCB 3LIWA 4XSKU 3UNQA 3HATH 4CHAC 1O3BA 3P8OA 1VCQA 4DJZB 3UIRA 7GCHF 2PUXB 1C2JA 3KNXA 1GJCB 1F7ZA 2BOKA 3ZZDA 4U32A 2ZTZA 3U8TH 1TFXA 1CHOG 5GXPA 5FPYA 3SV8A 4H4FA 4YO9A 3TJOA 4FUBA 1EPTC 3RXGA 1FY5A 2NWNA 3ITIA 1ANCA 2TBSA 2BD3A 3ZYDA 3V0XA 2Z9GA 4BOHA 1S83A 2M5TA 1Y8TA 5EQQA 4BAOB 1EZUC 1C4V2 1B0FA 2GGVB 1KLJH 4U01A 2F9NA 4AFQA 2SGFE 2SGPE 4KTSA 4ZKRU 1TQ7B 5L2ZH 3SV2H 1C5NH 1KXAA 2Y80A 1GHYH 4ABDA 2ZHWH 1VR1H 1UJ1A 4YESB 3NKKA 1V3XA 3SJIA 1PJPA 1QTFA 4YM9A 2PSYA 3PO1B 2VINA 1SPJA 3BG8A 2PGQB 5K7RA 2FI4E 4JZIA 1IQHA 1MCVA 1HAGE 1ZSLA 2GDEH 1THRH 4NFEA 1GI1A 4X6MA 2HVXA 1EAWA 3QTOH 3RXSA 3P17H 1UHBB 1TGBA 2BDCA 1O35A 4Y79A 5JBTA 5HMAA 5FBIA 3NCLA 1XUIA 1S6HA 2F9VA 2H9EH 1XKBC 4Q80A 1SGCA 3QDZB 6ESTA 3NUMA 2FTMA 4FU9A 2QF3A 1C5WB 4I31A 4B2CA 4QT8C 1AKSA 1TOCB 3QX5H 3KHVA 1CT2E 1OWHA 3KCGH 2TIOA 5LGOA 1PPGE 1ZPZA 1V2KT 1SGPE 3TJNA 4ASHA 1LPKB 4YOJA 4IBLH 1C5XB 1O2OA 3S69A 6LPRA 3K65B 1L4DA 5EW1H 3ZV9A 1Z1IA 4TWYA 1J14A 1C4U2 1GHWH 2B8OH 3UWIA 1H8IH 1RXPA 1C5UA 4MLFB 3BTDE 2W7SA 5FBEA 3TU7H 4E06H 3BG4C 9LPRA 4WMEA 3R3GB 3MH7A 4JYTA 1MQ6A 4WH8A 3KQCA 4BXSA 1ELVA 3V12A 3QWCH 1DPOA 3RXRA 2ZDAH 4NCYA 1LQEA 1V2QT 1L1NA 5ESBA 1K2I1 3RXIA 1C1WH 2VWNA 3TGJE 3GY3A 5FCRA 1GI8B 1KXDA 3RC5A 1MZAA 2VNTA 1AZZA 3UREA 5I25A 1F92A 4HGCA 1GBBA 3UUZA 1J9CH 5DKMA 3HK3B 3PMJA 1Z8RA 5A0BA 1Q2WA 3BSQA 4X1SU 1GMHG 1YPGH 4I33A 1O3NA 2O9QA 2EEKA 3MU5A 1YPJH 3QLPH 3GY7A 1TQ0B 4TYDA 3SJKA 1YGCH 1TGTA 4AYYB 2JH0D 1GWAA 1WOFA 3I29A 2RA3A 1TNIA 4LK4A 1L4ZA 1D3PB 2A5AA 3A86A 2CF8H 1A5HA 5AF9H 4SGAE 4NWKA 3FANA 3UQVA 3P92A 4FUHA 2ZGCA 2KAIA 3U1IB 4INKA 2FX6A 4Y7AA 1O5FH 1ZRBA 2XRCA 1B5GH 1K1LA 1LVYA 3OTJE 1GDNA 1HDTH 4JK5A 1A0LA 4WH6A 3E0NB 1ZMJA 3PMBB 1DSUA 4OS5A 4AFZA 1FY4A 1GVLA 1ELTA 1FAXA 5GJ4B 1EB2A 1O5GH 1GDQA 1P01A 4JZDH 2QY0B 1SLUB 4O3TA 2BVSH 1BTXA 1N6YA 3N7OA 3C27B 2AH4X 1C1OA 1O36A 3LGWA 1QURH 1TBZH 1KXEA 4D8NA 4NIXA 1O5AB 2A0QB 1O2QA 1HUTH 1FQ3A 3OX7U 2XYAA 5EW2H 1G36A 4ZKOU 3ZVCA 4MG3A 3PTNA 2PWXA 4AGKA 1GGDB 5JB8S 2EI7A 1FJSA 2PKAA 2XWAA 2WYJA 3QGJA 1O3IA 2ZPRA 1C1SA 1GHVH 2BMGB 2CHAB 9ESTA 3TGIE 5A8YA 4TWWA 5B6OA 1W0YH 4INHA 4NGAH 1W8BH 2RG3A 1CGHA 1GVZA 4AB8A 1YC0A 5LH8A 2ZHDA 3NPSA 1PQ8A 4B2AA 3A8AA 1DUEA 1GHBF 1XVMA 1ZHMA 3QUMP 2HWLB 2WV4A 4ZHMU 3ZVGA 1BTHH 1V2NT 1EAUA 2OBQA 4X6OA 2A4GA 5DPAA 3SU5A 1KLTA 1TGNA 4BANB 1OWEA 3ZYEA 1TNKA 5FPTA 2B0FA 4ZMAH 5DP3A 4FUFA 2V0BA 1DY9A 3A7ZA 1O3EA 4MPUA 1G3BA 1P02A 3SU4A 4ZHAA 1DXWA 1EOLA 3FP7E 1DITH 1WQVH 1NESE 1Q3XA 1XXDA 3RLYH 3STJA 2GCTB 3BTME 3SO3A 1WCZA 1QB1A 1IQLA 1HGTH 1W3CA 2OC0A 2HPQH 2UUFB 3LGYA 2ANYA 4Q2KA 3KF2A 4XOJA 3LC3A 3SOSA 5EXNA 1F0TA 3A8DA 5EGMA 3DFJA 3LDXH 1RIWB 2QCYA 4UEHH 1DLEA 2EI8A 4FVDA 3UR9A 1BTWA 1EATA 7LPRA 8ESTE 1KXCA 1QBVH 2BD9A 1SHYA 1BIOA 3K9XB 3QGNB 1X7AC 4YOIA 5LPEA 2JKHA 3MNSA 5E0HA 1TBQH 1VZQH 4NIVA 4JYVH 3SU2A 2AERH 2GDDA 1VGCC 1P2JA 1C2EA 2JH6D 5J4QA 2ZO3H 2QA9E 2C3SA 1BITA 1P09A 4XBBA 3SJ8A 2FS9A 3K6ZA 4CRGA 1CA0B 3UNRA 3FVFB 1TX6A 1O5EH 2WUBA 3SUDA 3BTTE 3SU6A 3F9EA 1GBJA 4Y71A 1G3EA 1OXGA 1Y3YA 1UVTH 2XBYA 1GI5A 2ZC9H 1O2GH 2D26C 2BY7X 1K1PA 3TH3H 4KTUA 3SV7A 1O2WA 1QFKH 1ETSH 3BG4B 4J2YB 1GPZA 3ATKA 4IGDA 4BTIB 1IQIA 4H6SB 2C4FH 3BIUH 1LHDH 2GD4B 3GY6A 4RSPA 3TK5A 3A81A 1NU7B 1HAHH 1ELGA 1HAXB 4MNYA 4B1TA 1P8VC 1O2JA 1XKAC 3QO6A 5L2YH 1YBWA 2C8ZB 4NA7A 2FI5E 3PO1C 5DP5A 1HPGA 1A4WH 3F6UH 1QBOA 5J4SA 5C3NA 5E2OA 1BBRH 3FP6E 3U9AH 1FN6A 1PYTD 1G3CA 1ZPBA 2ANKH 1SQOA 3A8CA 1LVBA 1TRNA 2AGIX 1NY22 1EZQA 4X6NA 1NRSH 1XUJA 5EG4A 4TY6A 1GBDA 3A7TA 4PROA 5G4BA 2BY9X 1P10A 3MH5A 3O8BA 5T6GA 3O8DA 4OS1A 1MU8B 1V2RT 3S9AA 5DJ7A 1MAXA 1OS8A 3SNDA 3GCHB 1C2KA 1SGEE 3UTUH 1YPKH 3T28A 5E0JA 4B71A 1T31A 1VCWA 1UTJA 2FMJA 3HGNA 4KGAA 2ZU1A 4I8HA 2W3KA 1V2LT 1FY3A 1DWCH 3TK9A 4DT7B 4CBNA 3M35A 1CBWB 2C90B 1ZSKA 5AHGH 1BRBE 4GHQA 1C5VA 3IG6B 3EYDA 2ZU3A 1LDTT 3RUOA 4DG4A 1E38B 2B7DH 3GCOA 4GCHG 1GJAB 5EQRA 2F9UA 1O3KA 3ZZ6A 1BCUH 1YPHE 3BEFB 4XFQA 2OQ5A 1P3EA 2ZIQH 3SUGA 2V6NA 3M61U 2HNTC 3TK6A 4TPIZ 1SGDE 2OINA 4D9RA 1BT7A 1BHXB 1D6RA 3BTEE 1TBRH 3RXMA 4JK6A 3SJOA 1LHFH 7GCHG 2AEIH 1RFNA 4B75A 3DA9B 4DIIH 2ZGHA 3M5OA 3ZZBA 4YLUA 3V7TA 1CQQA 3GDVA 2G81E 3ENSB 1ZTLA 3A85A 1EZSC 3M3TA 1K1JA 4MTBA 1KYNA 1UK4A 2GV6A 2A5KA 5I46H 2ZTXA 1ZHRA 1A2CH 4AX9H 1NM6A 5C5OA 4JYUH 1N6XA 4H6TA 1EJAA 1KDQB 1P0SH 2BYAX 1ZSJA 1C5PA 4A1VA 1TIOA 2H1UA 4UD9H 4X1PU 4AG1A 1ZMLA 3OY5U 2ZU2A 1E36B 3QZRA 1MKWH 1GBAA 3M37A 1V2OT 1GDUA 3Q76A 1DICA 3T62A 1AB9B 1ELEE 4ZAEA 3BF6H 2BTCE 2GV7A 3VXEH 2Z9LA 3E6PH 4MNXA 5BPEA 1THPB 1B0EA 2BM2A 1HAVA 1NTPA 1O2NA 4ABHA 1NROH 4WVPE 1CT0E 1XM1A 1DANH 1JRTA 2VVVA 1D6WA 1NRNH 1S85A 4NIYA 1HJAC 1OYQA 1TWXB 5C20A 2NU4E 3D65E 1ETRH 1QIXB 2CMYA 5EXLA 5HYOA 2BZAA 1QB6A 1HCGA 2ESTE 3MHWU 4CRFA 1S0RA 1BMMH 2BY6X 4AOQA 3CENA 1G30B 3IWMA 1HRTH 1PPCE 2UUJB 1GGDC 3A7YA 1TPOA 1NZQH 2P3FH 3C1KA 1O5CB 4O97A 4X8UH 5DP9A 2GZ7A 1IQEA 2Y5HA 1AFEH 1PFXC 3O8CA 1F0RA 1NPMA 2WPMS 1AMHA 1GJ7B 1GHZA 2GMTB 4HFPB 5GCHF 4Y0YE 4AFUA 1AN1E 3F9GA 3TNSA 3VPKA 3Q3YA 1C5TA 2GP9B 2FX4A 5JBCS 1MUEB 4JZ1A 1YCPH 1ZJKA 3PROA 4TPYA 1VJAU 1VCPA 3H7TA 4X1NU 1TMBH 4K2YA 4I7YH 1E35B 1AO5A 1HV7A 1UCYH 1QHRB 3B8JA 1HB0B 1BMAA 1UVSH 2FESH 1S0QA 1L1GA 4RKOB 1GJDB 1A3BH 1C5RA 3A82A 1Y5BT 1ZZZA 4XDEA 1SLVB 1S81A 1EPTA 3STIA 4X2WA 3UOPA 2Q6FA 3MTYA 3E91A 2GCTC 1TRYA 1Z8JB 3E0PB 1KXBA 1S6FA 2BDYA 2ZDMA 3TJUA 1NRQH 1GBCA 2ZHQH 1PPZA 3T5FH 5EU8A 2NU2E 2XC5A 1P9UA 2IJOB 5A8XA 5IDKA 5A0AE 1QCPA 1KY9A 1A7SA 8LPRA 1IQKA 3UPEA 1OP2A 1RIWC 2Y81A 3MFJA 2LNCA 3BTWE 3RMOH 1HAOH 1WSSH 1RTFB 4K3JA 1ZJDA 1C9PA 2G51A 2ULLA 1PYTC 2SNVA 3PM3A 1EJMA 3MWIU 3ELAH 3S9CA 4DVAU 1FPHH 1BHXF 3AVZA 3EA9A 3S9BA 2F3CE 2C8YB 2STAE 1Z7KA 4UFEH 2BQWB 5LPRA 4UDWH 3SGQE 1TB6H 3TLOA 5C5NA 1GI6A 1C1TA 4OGYA 2FIRH 4ABGA 2Z9IA 3HKJB 1SGIB 3IITA 3UR6A 1CA0C 1DY8A 4X1RU 2A5IA 2A7JA 2OCVB 4MPVA 3RXTA 3NWUA 1DLKB 2ZTYA 3EQ0H 1QL8A 1WTHD 1ESAA 1Y5AT 1BRUP 3PB1E 1JRSA 2ODYB 4FUGA 1BUIA 3KQEA 3U1JB 4R8TB 1EP6A 1ELCA 2P95A 2JETC 2IN2A 4DCDA 2ODQA 5ABWA 1LCYA 1YPLH 1GBHA 2WINI 2TGPZ 2CN0H 5JBAS 1C5YB 3SBKA 4K60A 1OOKB 3TIUA 3V13A 4B76A 1BMNH 4LOYH 1P9SA 5A0CA 1TGCA 1WAYB 1XVOA 2BX3A 1GHBG 3TH2H 5HGGA 2BDBA 2ZZUH 2BZ6H 1NFXA 3RXFA 5CHAC 5IYTA 3ATLA 1TABE 1O2TA 3DUXH 1V2PT 1P04A 2FZZA 1O2SA 4KTCA 3UOUA 1M9UA 3M5LA 1DOJA 1MU6B 2GX4A 3RDZA 1A61H 3EA7A 2NU3E 4GVUA 1TGSZ 1NS3A 3AW0A 2J92A 2AFQB 1SFQB 1T7CA 2A7CA 5K0HA 1W11U 1Z6JH 1HXFH 1SGFA 1OP8A 1SGTA 2PSXA 1OSSA 4MDSA 8KME2 3PV4A 3GCHC 1BBRK 1AFQB 3RXVA 2FLBH 1P57B 1FN8A 2ZDVH 2ZG0H 3T27A 4D76A 1QRWA 1SC8U 1LVOA 1VITF 2P8OC 1HIAA 5ESTE 1EAIA 1SG8B 1SMFE 3BV9B 2VIVA 3SI3H 1BRCE 1SVPA 5FCKA 2ZF0H 1RD3B 2ALVA 1O3CA 3CS0A 1LHEH 1O37A 1CBWC 1C5QA 1ZTKA 1TAWA 2HPPH 3CS7A 1O33A 3A7VA 3M7QA 2GCHF 4CRDA 4I8LA 5DGJA 3ZZ4A 4Y6DA 4TY7A 3ZVDA 2C93B 3F1SB 3GICB 5TCCA 1C2GA 1P06A 1GBLA 2A2XH 4ESTE 1ANEA 3RXKA 3GYLB 1F0SA 4CR9A 1E34B 2J4IA 4NWLA 2EA3A 2H9HA 1V2ST 2OTVA 1HJAB 1BTZA 1A3EH 1J15A 1ELBA 1XMNB 4OS2A 2P94A 4A1TA 2P3UB 1GBTA 2TGTA 1ID5H 3BTKE 1CGIE 1GHAF 4ZUHA 4B73A 4OGXA 3E1XB 2FOGA 2BDIA 2BLVA 4KELA 4O9VA 2P3TB 1YKTA 1TNJA 1UTNA 3MO6A 2BHGA 1LVMA 2O8MA 4YZUA 3P95A 1C1QA 1QA0A 2Y7XA 2R3YA 2ZFTA 1EJNA 3SI4H 3T29A 3SJ9A 1O3OA 1JIMA 2TPIZ 1O2VA 2H5DA 2AGGX 5C1XA 2OC8A 1F0UA 2UWLA 1C1VH 1SFIA 2QXGA 2G4TA 2BY5X 4ABJA 2QN5T 1CSOE 2VWLA 1Z1JA 3HPTB 1HAYB 1GI7B 1TYNA 2QV1A 5GPIB 2A4RA 4IN2A 1SI5H 3UY9A 2GZ8A 1SOZA 2HRVA 4E7NA 3GISB 1GMDF 1AB9C 2STBE 2Y6TA 3EDXB 2FOMB 2EI6A 1O30A 1JWTA 1H1BA 4NA8A 2XXLA 1IHTH