4XBDA

1.45a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (orthorhombic p form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
163
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
total genus 40
structure length 163
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA01
1P01A 3ELAH 1CA0B 2R2WU 2OLGA 1FY4A 4ABJA 1IQHA 1J17T 5C5NA 2AGEX 1UVTH 2YOLA 2BXTH 4X8SH 1DICA 2ZHDA 3OU0A 3UREA 3M3VA 1DWDH 1C1WH 1D3QB 1DXWA 1KLIH 3CP7A 2J92A 3P95A 3BEFB 3PWBA 2WPHS 1NZQH 3RDZA 1HNEE 3BG8A 1ZSLA 1NFYA 2WV5A 1EAXA 2ZQ1A 4ISHH 1O5AB 4XSKU 1TGBA 1BHXF 2BD5A 1C1RA 3PMAB 3MU0A 5J4QA 2AFQB 1BMMH 1V6DA 2QXJA 1XUGA 1QB1A 5E8EH 3E0PB 3K65B 3ZVGA 3S7KB 1CBWB 3MNCA 4MQAA 2VVCA 4LOYH 5L6NH 3GYMA 2BVRH 2ZPSA 1Z8JB 3MH4A 2FX6A 2OBOA 5EQSA 4ZMAH 4O03A 1LHFH 2VINA 2Z9JA 2GZ9A 2ZI2H 1T8MA 5T6DA 2J95A 2THFB 3P8GA 3URCA 2ZDAH 2VIWA 1OSSA 2Q6FA 1O32A 4Y8XA 1WOFA 1CO7E 1NN6A 1K1IA 1THSH 1NRRH 1DPOA 1OX1A 1GJ9B 4ZUHA 3M37A 3MO6A 2C93B 4U01A 1TNLA 3TNTA 3SNCA 2WINI 3H7TA 1T4VH 1ANBA 1RGQA 4B75A 1BRBE 1ELFA 1JMOH 5EGMA 2H2ZA 1CVWH 4UE7H 4B2AA 5CE1A 4A6LA 1C1SA 4X2YA 1HJAC 3PO1B 3U8TH 5DP8A 1UK3A 4Y76A 3MYWA 3ODDA 3A7XA 2A4OA 2OTVA 2FOCA 2SGEE 2XXLA 2OBQA 1AY6H 2FZZA 1G9IE 1G36A 3V0XA 1AKSA 3G01A 2FO9A 2ODQA 3SQEE 1A5GH 4AORA 1V2LT 1ZJKA 4AZ2B 5A09A 1QHRB 4UEHH 2GD4B 2G5VA 4Q2KA 4Z6AH 5A8XA 1O36A 1YPEH 2GCHG 2CMYA 3A8DA 1CA8B 5T6GA 1GBEA 5A8ZA 2GDDA 2ZCHP 2ZP0H 4R0IA 1S81A 2VJ1A 2WYGA 2BYAX 1ZSKA 1Y5AT 5JB8S 4NFEA 4K8BA 1P10A 4ABEA 8KME2 2ZTYA 2H9TH 3U69H 2ODYB 1GI6A 3N7OA 2Q6DA 4ZHLU 3WY8A 2RG3A 1C5SA 1O3PB 4IC6A 2H5DA 2OQ5A 2FOEA 2I6SA 2JETC 1SI5H 1OWHA 1SGIB 3Q3XA 4O9VA 8GCHF 1IQIA 1PPBH 3TK6A 1AE8H 1OP2A 1Q31A 3UNQA 2BMGB 1TPPA 3BTFE 4FVDA 3QZQA 4LZ4B 1OYQA 4WMDA 3SNDA 3SORA 2W5EA 2ZTZA 2BX3A 4H4FA 2VH0A 1MH0A 1QL9A 2XBYA 4X2XA 1THRH 1LVOA 1WQSA 1ZTJA 4UFEH 5C67A 2FOFA 3H7OA 1FZZA 4ZAEA 4NFFA 1EOLA 1H9IE 1HAVB 3AW0A 2LPRA 1RS0A 1P04A 1GI2A 4NGAH 3VXFH 1GGDC 1ELDE 3RXKA 1TNJA 5EQRA 3M7UA 3PM3A 2PSXA 2HPPH 1C1VH 1EP6A 3BTME 3SBKA 4CREA 1FAXA 1JRTA 1SGEE 2JKHA 3TLOA 1ANDA 3UFAA 3V13A 3B23B 3UNRA 3RU4T 1KXDA 3MO3A 5C1UA 3LGUA 4I8HA 2HALA 5BPEA 5JYIA 1FXYA 3K6YA 4FU7A 3QX5H 1HIAB 2XYAA 1O2ZA 2F9UA 1Y3UA 1EKBB 3RXOA 5EQQA 3PLKA 1QQUA 2ZHFH 2BY7X 4MTBA 1P3EA 2O8MA 2BD2A 2SGAA 1AB9C 2SNVA 3ZZBA 1BTPA 3RUOA 2VB0A 2ZCLP 3E1XB 1F0RA 1AKSB 2AIQA 2WV4A 4F4OC 1YPMH 5TCCA 1SR5C 5AHGH 3RC5A 2J9NA 3ZVCA 2CXVA 2WPKS 1EJMA 1P05A 1ELAA 1Z1IA 1W8BH 1TNKA 4HTCH 3A86A 1AFQB 1VITF 1ELEE 2O8UA 1O31A 3I78A 2UUFB 1T8NA 5EXNA 3RLYH 3RMNH 4ZROA 1C5NH 3SV6A 2RA0A 4SGBE 2QV1A 1LTOA 5LGOA 1ZHPA 2PWXA 1P2QA 1ARCA 2ZFQH 3E8LA 1QJ6B 1RD3B 3RXJA 3SGBE 1Z71A 1TLDA 1O3LA 3MNXA 5L2YH 2XCFA 1BTHH 1V2MT 3FZDA 4ZHAA 1O3DA 2A0QB 2EC9H 4CR9A 4I7YH 3TJNA 2ZHQH 1GHBF 1O2OA 1UVUH 4Y7BA 4TWYA 1UTLM 2XC4A 2SNWA 3M5OA 1ELTA 1TGTA 1SHYA 1PPEE 2FWWA 3EYDA 2A31A 1Z6EA 2CHAB 1BBRH 1K1LA 1Y59T 2A5KA 1QB9A 1NRSH 2CGAA 1AU8A 3F1SB 1A5IA 4HFPB 2BD8A 1CQQA 1QR3E 1GL1A 2XNIA 1GHYH 2PKSB 2ZDMA 4ZHMU 2WPIS 5JBBS 1TMBH 6GCHG 2RA3A 5ABWA 1H9HE 5EXLA 3VB6A 2GCTB 1WV7H 1ID5H 1O3HA 4JZDH 1TPSA 5DP4A 4IN1A 1O2SA 4JCNA 4Y8ZA 2GV6A 1O0DH 4K3JA 1EPTB 1AMHA 1GBJA 3S7HB 3CS0A 1MU6B 1F0TA 4E7NA 1CSOE 2Z9KA 1XKBC 2FYQA 4BAMB 3RXBA 5CHAC 2ZFPH 5DO4H 1G30B 1GVKB 5IYTA 1KDQA 4ZXYH 1JIRA 1Y3YA 2OC0A 2PUXB 3KNXA 1EAUA 1KLTA 1X7AC 2GZ8A 3T5FH 2FMJA 1CT2E 4CBOA 1DVAH 1FJSA 2VIDA 1G3BA 1GPZA 5L30H 4MPXA 4Y6DA 1BZXE 1K1JA 2FESH 1GJCB 1BCUH 1MKWK 3EGKH 2QF0A 1A4WH 3RXTA 1BMLA 4D8NA 1FY1A 1NESE 1Z6JH 4BAHB 2P3FH 3HPTB 3UR6A 3UWIA 3LT3A 1TFXA 1A2CH 3M35A 4NIWA 3ATKA 1O2UA 1GMDG 2GCTC 1VZQH 3OYPA 3RC6A 2D1JA 1GBLA 1NRNH 1MTWA 1C5TA 1NFXA 3GDUA 3K2UA 4IC5A 1BTYA 1DFPA 2A7JA 1INCA 3DUXH 3OTJE 2XTTB 1GG6B 2B5TB 4WH6A 2ZKSA 3D49H 3FP6E 3RU4D 1KXCA 3LONA 3SU0A 1TB6H 2G00A 3TU7H 2F9BH 1JOUB 3VB7A 2FIRH 5FCRA 2F3CE 1RIWC 3V12A 1ZJDA 2BHGA 4FU8A 4NWLA 5AVDA 1GL0E 1FN8A 3SO3A 3P8NA 1GHVH 1PFXC 2P94A 5EODA 5A2MH 3SU4A 4B2CA 3U8OH 2VH6A 1QBOA 1MTNC 2D2DA 1IQLA 1BRUP 3KIDU 3ZV8A 5HM2A 1SGRE 2HNTF 3B9FH 1QRXA 1HXEH 2GDEH 1KY9A 1D9IA 2ZEBA 3O8BA 3MU5A 4GHTA 1K21H 1B5GH 4F49A 4B73A 2Y5HA 1P2IA 3A84A 3F6UH 1D3DB 1J15A 3RXDA 1C5YB 3ZVAA 3K6ZA 1FY5A 2B7DH 2ILNA 3QGJA 4TPYA 1C2EA 3A81A 2ZNKH 1DSTA 1IQEA 1S5SA 2A32A 3JZ2B 1AVGH 2BTCE 2AMDA 4OS4A 1J14A 1DT2A 2WPJS 3PB1E 4NSYA 2P16A 1UTKA 3U98H 5DPAA 1SGNE 4A5TS 4GCHG 1C1OA 1AQ7A 1SGFA 1GI9B 1IHTH 1O3FA 1HAHH 3LKWA 4E06H 4YLQH 3IITA 1BT7A 1OWJA 1S85A 3LC3A 4HZHA 4OS7A 4BAOB 3S9BA 3HGPA 1QL7A 4NZQA 3MU1A 1S84A 1DITH 1SLUB 5AF9H 2O8LA 4UDWH 2IOTA 1C5OH 3ZZ6A 2TBSA 3PWCA 1C5WB 4YOGA 1YLCA 5A0AE 1KSNA 1TBRH 3MOCA 4IMZA 1NROH 5C1XA 3MU8A 1W2KH 3A88A 1O5CB 3A7WA 3OY6U 3QLPH 3BN9A 1W10U 2QXHA 5DGJA 1F92A 1MTNB 2PV9B 4J2YB 1KDQB 1ZHMA 1P12E 2WPMS 5ESBA 2TGPZ 3ZVBA 3O8CA 1Z8RA 1HRTH 1D6WA 3UPEA 4BTTB 1Q3XA 1UJ1A 5FAHA 1ZMJA 2Y82A 4AYYB 4JYUH 2QXGA 1KLJH 1QIXB 3I29A 1NT1A 4MPWA 2DE9A 5EPYA 1SSXA 4RKOB 4ABBA 3W94A 1UCYK 1SBWA 1K22H 1SLVB 1O3MA 1Z8GA 2FI5E 4X6PA 2ZFTA 1B0EA 1FPHH 2UWLA 1LPKB 1ETTH 3A7YA 1SQTA 2AMPA 3C1KA 1YPGH 1AGJA 2UUJB 3UOPA 2C8WB 2JH0D 1GHAF 1BITA 3M5MA 3SOSA 3S0NA 4AGJA 4DIHH 1GBKA 4MPUA 1LMWB 1DWEH 1ESTA 3TVJB 1M9UA 1MKXH 1ZPCA 2A1DB 4I32A 2ZQ2A 3M3TA 1EJAA 3GCTG 3MI4A 4XE4A 3BTGE 4UD9H 1TGCA 1B0FA 5E0HA 3SJIA 1JBUH 2OC1A 3GICB 1QJ1B 1SFQB 2BX4A 3H5CB 1ZHRA 1BTWA 5GCHF 1C2FA 1HAIH 1XX9A 2VIOA 1GI8B 3TNSA 1A61H 3A7TA 5L2ZH 2AEIH 1KXAA 2OCVB 3RU4E 2A45B 3ATWA 5ESTE 4WWYA 1HAOH 3RXHA 3C27B 1C4Y2 4RN6A 2LNCA 1O5EH 2JH5D 2BDYA 2I6QA 3BEIB 1C4V2 2XRCA 1CBWC 3ATLA 4ZXXH 1Y3VA 3UOUA 2VGCC 1GJ5H 4DVAU 3SV7A 3TGJE 4GLYA 1GI0A 1TALA 3GY4A 2ZGCA 1O2RA 2ANMH 3UWJH 4AN7A 2BLVA 2AGIX 2PTCE 4B74A 1HJAB 1K1MA 3PO1C 1TGNA 3D65E 1K1NA 1T4UH 4DCDA 4INHA 2FEQH 1C2GA 2ZA5A 4MNWA 3SUDA 3Q00A 3BSQA 3L6PA 3V7TA 1YC0A 1NPMA 1YBWA 4TYDA 3RC4A 1W7GH 6LPRA 7GCHF 1EZQA 2R3UA 1QBNA 4NZLA 7KMEH 3Q77A 4THNH 3ZZ3A 5JBAS 1XVMA 2GT8A 1CT0E 1GHBG 4ZKRU 1VJ9U 2BY9X 1GBBA 2ZHWH 1G3EA 3VGCC 4Y0ZE 1PQ7A 3RMMH 2QF3A 5DJ7A 2ZDNA 2Z94A 2J94A 1QJ7B 1WBGB 2IJOB 1O5GH 1ORFA 3FVFB 1BMAA 5ETXA 4IW4E 1W11U 3HK3B 1FIWA 6CHAB 2FOBA 2ZG0H 2GV7A 3SQHE 4YM9A 3T62A 4I8JA 1CGHA 1RJXB 2ZGXH 1ELGA 4WF8A 1C9TA 5AFYH 3KGPA 4AGKA 2FOGA 1HFDA 4FU9A 3LU9B 1FN6A 4DJZB 2XBVA 3NCLA 3PYHA 4IGDA 2A7CA 4NSVA 3VB3A 2BDCA 3ZZAA 4WY3A 2Z3DA 2BY8X 2FOAA 1O3OA 4FUHA 3IWMA 2Y7XA 3RXIA 4CHAB 1L2EA 1NTPA 3L3TA 5CMXH 3BTWE 1Q2WA 1KYNA 1O2LA 1ZPBA 1YGCH 1UO6A 4I8KA 4ISOA 2PTNA 1EAIA 1SGQE 1HPGA 1QCPA 1CU1A 1LPGB 1V2RT 2CV3A 3TGIE 1ARBA 3MU4A 4YT6H 4PROA 2CJIA 5G4BA 1S83A 2FX4A 2ZU4A 5HMAA 1TPAE 6ESTA 2A5AA 1DS2E 1D3PB 1YCPH 3FP7E 1GJ8B 1P8VC 1UHBA 4CH8B 2PGQB 4DOQA 3SUGA 4BNRA 3A7ZA 3BG4C 1YPHC 3E3TA 2SGQE 2M5TA 2G52A 4MVNA 1RRKA 1GI1A 3EA9A 1NFWA 2O8TA 2ZU3A 4MDSA 1TWXB 5EOKA 1XM1A 2CF8H 4Q7YA 3R0FA 3ZZ4A 2Q1JA 3SJ8A 3ZYDA 1D6RA 1MZDA 1VCPA 1LQEA 1C1PA 4X2WA 1TA2A 3UIRA 1V2OT 1TGSZ 4K69A 1MUEB 4NIXA 2O8WA 3LH3A 1RTKA 1WAYB 4WVPE 2ZDLA 1SGPE 2GCHF 3T29A 1TX7A 4OGYA 3ZZCA 2BDGA 4JZIA 1WTHD 4UONA 1BBRK 1A0LA 5E2OA 1MBMA 1FIZA 1U6QA 3EA7A 1QRWA 1SVPA 2NU2E 1ANCA 1HYLA 1O2IA 2J2UA 8LPRA 4YO9A 1MD8A 3M61U 1YP9A 2HGTH 3SJOA 1C2DA 3RXFA 2QXIA 4Q80A 1MAYA 2QCYA 2QYIA 2R2MB 5GPIB 4AG1A 3FANA 1KIGH 5JBTA 1G37A 2VGCB 1UVOA 4CRFA 3VPKA 3MH7A 2EI7A 1TOMH 1AZ8A 1BQYA 3SU3A 4FVBA 1DDJA 2A2QH 4BTIB 2TGDA 1HIAA 2ZC9H 2J38A 2GVFA 1TABE 5GIBA 2HWLB 4ZKSU 1C4U2 2A4RA 1V2PT 4XBCA 3FAOA 3QUMP 4KTUA 4JZEH 1TNIA 1BHXB 3I77A 2Z3EA 1CGIE 1ETRH 4XOJA 4AYVB 2BD7A 1SHHB 4ZH8A 3JZ1B 3Q76A 1W7XH 1TPOA 1C2HA 1AVXA 2OXSA 2Z3CA 1QTFA 1E35B 1ZYOA 3VGCB 3ZVFA 1HAVA 1SOZA 1BJVA 4B71A 2Y5GA 5GXPA 4AB9A 1SC8U 3OX7U 1O34A 4YT7H 4I8LA 2EA3A 2XBWA 3QZRA 4ABFA 1TYNA 1N8OC 1TNHA 3NZIA 4JK6A 1C5QA 7LPRA 3AAUA 2OD3B 3SI3H 1H8DH 1O5BB 4Y11E 2OUAA 4YOIA 1N1LA 5SGAE 1P0SH 3TIUA 1FDPA 2ULLA 2ASUB 3EE0B 3KN2A 1CT4E 4MNVA 1GJBB 1GMDF 4U2WA 1MAXA 1UTOA 2FS8A 1SLWB 3KF2A 1ESAA 3HATH 3LGWA 3DHKH 4X1NU 3A8CA 3RXAA 5K7RA 1TIOA 3S9CA 1ZMNA 2PUQH 1DWBH 2TPIZ 4IS5A 2WYJA 1UTQA 3PMHB 3MNSA 1GBAA 4D76A 1ZZZA 1OWKA 1SGCA 2ZGJA 1BJUA 1OWDA 5T3HA 8ESTE 3TJUA 3ESTA 2HLCA 5LPEA 2BQ6B 3RMLH 2HVXA 1H4WA 1J9CH 1GG6C 1TOCB 1MMJN 2XWAA 3KQEA 3M5NA 1NRQH 1HV7A 3STJA 2OC8A 1P09A 1XMNB 4ISNA 5FCKA 2BQWB 1O2MA 1GHWH 4NCYA 3RXMA 4X1QU 3FP8E 4A1XA 1O33A 2ZIQH 1C5MD 2ZO3H 3GCTF 2TRMA 4JYTA 2J4IA 3F68H 2BY5X 3A85A 1GJ4H 4KTSA 2RDLA 3PROA 2P93A 1P9UA 2QGRA 1UTMA 2BM2A 1HAGE 3SU5A 5GCHG 2ALVA 3DFJA 5FX6A 1SMFE 1W13U 5C5OA 4A1VA 2Y6TA 3GY3A 3U8RH 1AZZA 2QAAA 1SLXB 2F83A 1PJPA 5HM9A 3SNEA 3ODFA 2BOKA 1ABJH 4U32A 1P2MA 1JWTA 1O30A 4TY6A 1OYTH 4Z0KA 1DY9A 1KXFA 1PPHE 3HKIB 4ABGA 2CF9H 4ISLA 1AN1E 1KXEA 1WU1A 8GCHG 1AI8H 1OWEA 1O2GH 2G8TA 4Y0YE 3QDZB 4CRCA 1K1OA 1IQFA 1EAWA 1F2SE 2GMTC 2VVVA 4K60A 3BF6H 4VGCB 2HOBA 1O2YA 2HNTC 3URDA 1ABIH 1ZPZA 4Y79A 2UUKB 4OGXA 3TJOA 4FUJA 4K1SA 1C5PA 3BTTE 1BRCE 4AOQA 1TX8A 4NIVA 2H6MA 2PKSC 2FYRA 3FZZA 3SJ9A 4NIYA 1ZLRA 2V35A 4MLFB 4ABHA 3A80A 3LGYA 3KQCA 2W3KA 4K5ZA 3DT0H 2CHAC 2A4QA 3ENSB 2GKVE 2STBE 3F9FA 1BTUA 1MCVA 4BXWA 1XVOA 4X0WU 1GDUA 2HRVA 1GMCG 1V2NT 1VGCB 3PLPA 2P59A 3TGKE 1ELCA 3E6PH 1O5FH 2ZPQA 2JH6D 2K1QA 1S0RA 2PKAB 4FUEA 1GDQA 3T28A 2VVUA 3MHWU 3Q3YA 3A7VA 5HXFA 1CA0C 4GUXA 4H42U 4FUCA 4X1SU 1UK4A 2AGGX 4CRAA 3UUZA 4XDEA 1L1GA 4ABIA 1CHOG 1ELBA 4NWKA 4CRDA 1YCPM 1YKTA 4K8YA 4WXVA 4YESB 3UY9A 4ESTE 2TIOA 3BTQE 3KQDA 4YLUA 1AE5A 1O37A 2KAIB 3CS7A 3U1JB 1G3CA 2UWOA 2ANWA 2QY0B 1O3NA 4SGAE 2QA9E 1QY6A 1PQ5A 2GX4A 1GWAA 3GYLB 1FI8A 1LHEH 2F91A 5JPMH 2ANKH 3SUEA 3IG6B 1ZOMA 2Q6GA 1NS3A 2RCEA 1AVWA 3RXUA 5FHTA 5E0JA 1J8AA 3K9XB 1VJAU 2P3UB 2FODA 1Y5BT 1C5RA 3EQ0H 3SNBA 4H6TA 4OS5A 3F9HA 5T6FA 1HAPH 3RXVA 1W3CA 2A2XH 1DM4B 2B9LA 1C1MA 2W26A 4D9QA 1HJ9A 1IQJA 1T31A 3DD2H 1DWCH 2FTMA 3BTDE 4DG4A 1IQKA 1CGJE 1UTPA 1E37B 4JMYA 4XBBA 1FLEE 1L1JA 1QBVH 1W14U 1MTUA 2Z9LA 1QB6A 2C8ZB 2H1UA 2ZU5A 4K2YA 4R8TB 4MNYA 3VB4A 2OQUA 2KAIA 1ZTKA 2G5NA 1T7CA 2Y81A 2FP7B 3LH1A 2WUBA 4X6MA 3SU1A 3BIVH 4YZUA 1BBRE 1S6HA 1GBFA 3KL6A 3GOVB 5FPSA 1ZRBA 2G4UA 4U30A 3TJVA 3NWUA 3SW2B 1QA0A 1DX5M 1GBCA 1ESBA 2DUCA 5FX5A 3NKKA 2BQ7B 1C5VA 3LDXH 2OINA 2FLBH 3OY5U 2NU1E 1IQNA 3SGQE 5A0BA 1HBTH 3AASA 1Y3XA 3U1IB 4KTCA 1EOJA 1V2TT 2O9QA 3A83A 4J1YA 2VWNA 1HLTH 1RTLA 1MU8B 1PYTD 4ISIH 1XXFA 2TGTA 4GSOA 2G51A 1NU7B 4KP0A 3BTHE 2VIQA 2Y7ZA 2ZTXA 2GTBA 3T27A 5C3NA 3SU2A 1OP0A 1LHDH 2VWLA 1G2LA 1MTSA 1ZR0A 4JZFH 4O3UA 1BMNH 2SGFE 4RKJB 1IQGA 1QURH 3QK1A 2W7SA 1S82A 3P6ZB 1FNIA 3GY6A 4KKDA 3UNSA 3GDSA 1T8LA 3SNAA 2EI6A 1SL3A 3EDXB 4OS1A 2C4FH 3SJKA 3UQVA 2ALPA 1EUFA 3R3GB 4IBLH 3GCOA 2BDAA 5GWZA 4NA9H 1PPGE 5FPYA 3PLBA 2QN5T 2NU0E 1H1BA 1TE0A 1PQ8A 2STAE 1UTNA 2VNTA 1P2OA 1BA8B 1S6FA 2A4GA 1BRAA 4M7GA 1FY3A 1F5KU 1E0FD 1BOQA 2FOHA 1TMTH 2V6NA 3ZZDA 1VR1H 2Z9IA 5C1YA 1LDTT 4D7FA 1XKAC 2F9NA 4IMQA 4XFQA 2FTLE 2UWPA 1GBMA 2Z6BD 3RXCA 5EW2H 1EJNA 2WUCA 1GDNA 1HAZB 1IOEA 1AWHB 3RXGA 4Q7ZA 5E0GA 2ZFSA 2FDAA 5EG4A 2FS9A 3MTYA 4YOJA 4CR5A 1ZTLA 2H9HA 1O2XA 4X6NA 3SV9A 4WMEA 4FUDA 5DG6A 2F9VA 2PGBB 3LIWA 1VCWA 1C5XB 1O2JA 1T32A 4E7RG 1V2UT 1TAWA 2R3YA 1OPHB 1EX3A 3LC5A 5JDUB 1K9OE 2IPHA 1NRPH 1AFEH 1O2QA 5C20A 4BXSA 1YCPK 1HAXB 3RXQA 5LPRA 1UTJA 3RXPA 2FM2A 3SU6A 1V2KT 3E90B 1AB9B 2BDHA 1NO9H 2C3SA 1O3GA 1E34B 4NA7A 1GJDB 3ZVDA 5JBCS 3GY5A 2IN2A 4VGCC 2NU3E 1SQOA 1TRNA 2EI8A 1SGTA 1KTSB 1P2JA 1PQAA 1TBQH 3BEUA 1O38A 1YPLH 2CN0H 3F9GA 1MZAA 1MBQA 3HGNA 3A89A 2OP9A 4HGCA 3TH4H 5AFZH 1F0SA 1AUJA 3A8AA 1G3DA 2UUYA 2F9OA 1W0ZU 3ITIA 5LH8A 1HUTH 1Y8TA 3LGVA 1TBZH 1ZSJA 5IDKA 3BTEE 2V3HH 1EB2A 4HI3A 1S0QA 1DANH 1Y3WA 4GPGA 5F8ZA 1BTXA 2BLQA 3KCGH 2WPLS 3U9AH 2XCNA 2PHBA 3A87A 1P9SA 2VWMA 1H8IH 2ZDKA 1OS8A 3MH5A 3BV9B 4E05H 3NXPA 1CHGA 6GCHF 1C5ZB 1FY8E 1XUIA 1DUEA 3GY8A 4ZKOU 2JETB 2VIPA 1GMHF 4INKA 2VIVA 1W12U 3GCNA 4KELA 2FOMB 4TPIZ 1CHOF 1WTGH 5DK1A 2QIQA 1A0HB 9ESTA 3M5LA 4O97A 1K1PA 4TY7A 1HGTH 5DP6A 1Y5UT 2P8OB 4D9RA 1QQ4A 1Z7KA 1LVYA 1RIWB 2A5IA 1V2WT 2ZECA 3LPRA 3GCHC 2BLWA 3LOXA 1KXBA 4OS2A 1FONA 1WCZA 1MTVA 1OWIA 1HDTH 2ZU2A 5FBEA 1W0YH 3SN8A 1TRYA 3KEEA 3F9EA 1P06A 2ZDVH 5DP9A 1DUAA 2ZHEH 4FUIA 4GAWA 4X8UH 1MD7A 1XUHA 3NK8A 4AX9H 1L4ZA 5F03A 1E36B 4CHAC 5DKMA 2QC2A 1HJ8A 1AHTH 1GBTA 2G81E 3V3MA 1YLDA 3BTKE 1F5RA 3RXSA 2AH4X 1P2KA 1QL8A 3UTUH 2BLOA 2EEKA 3MMGA 3PV4A 1YM0A 2SGDE 1NC6A 1EZUC 2B0FA 3QO6A 3GY2A 1ZGIA 1LQDB 1YF4A 1GJAB 1N6XA 1ZGVA 4I8GA 2BB4A 2W7UA 2ZF0H 4H6SB 2G4TA 4MNXA 4BAQB 1O2NA 5JB9S 3T26A 1WSSH 1L0ZA 5F8TA 1EZXC 4DT7B 1N8OB 1TQ0B 9LPRA 1GJ7B 4LXBH 1GHZA 4Y10E 1C9PA 1TMUH 2P8OC 3UQOA 3VB5A 3O8DA 1EP5A 1OOKB 3MWIU 1A7SA 1E38B 1VITH 1BTZA 1MQ5A 5I46H 5EW1H 4DGJA 1T8OA 3ZV9A 1V2VT 1YYY1 3LJOA 3BG4B 1A3BH 1C1TA 1XUJA 4AFUA 3TH2H 3MH6A 3ZVEA 3A82A 2PW8H 3OSYA 1MCTA 2PSYA 4JZ1A 4OS6A 1IQMA 2H9EH 2BDIA 1C2JA 2PFEA 2PLXA 1L4DA 3SUFA 1SGYE 2W3IA 5TCAA 5CHAB 4Y8YA 2Y80A 2ANYA 1YPKH 3UR9A 4WMFA 2BD9A 3O8RA 1EPTC 4AFQA 1TRMA 2B8OH 2TGAA 3DA9B 3L33A 2R0LA 4A7IB 2C8XB 3Q3KA 1O3AA 4CRGA 3AVZA 2ZCKP 1D3TB 2XBXA 2FPZA 2HNTE 3T25A 1GCDA 2J34A 3E16B 1O3BA 2XC0A 1PPZA 1UCYH 4UFDH 2GZ7A 1FPCH 1TONA 1XUFA 3VEQB 1QFKH 5DP3A 4AG2A 4BOHA 1O2KA 6CHAC 1AD8H 1C2IA 5FPTA 2FI3E 1O2TA 3BIUH 1F7ZA 4ASHA 4BTUB 1P11E 2GMTB 1A46H 4ZKNU 4ABAA 4DW2U 1K2I1 4NG9H 4LK4A 4X6OA 3STIA 4XBDA 1AFQC 2BY6X 1C1UH 1DXPA 3LJJA 3QGNB 1SB1H 1SG8B 4RSPA 1QNJA 2PR3A 1ZRKA 3E91A 3ZZ8A 1G32B 1HXFH 2XWBI 4INLA 1C1NA 5BRRE 2PKAA 3TK5A 2FLRH 1H9LB 3M7TA 3VFEA 4GHQA 1QGFA 1O3EA 1AIXH 4CH2B 1QRZA 4B1TA 1O2WA 1V2JT 2GP9B 4LZ1H 1NM6A 1V2QT 1NY22 1YPHE 1SGDE 4Y7AA 1DOJA 3D23A 3PMJA 1WYKA 2VU8E 1TNGA 5LPFA 3A8BA 1FQ3A 1V3XA 1WUNH 3LGTA 1TX6A 2HPQH 3TITA 1UMAH 1XXDA 1MKWH 1P02A 3S9AA 4O3TA 4I33A 2NWNA 3PTNA 3RM2H 1GI4A 4B76A 1L1NA 2C90B 3ZZ9A 2V3OH 3QTOH 1FMGA 1N6YA 3NUMA 3RP2A 1BDAA 2ODPA 1C2KA 1GBIA 3P70B 4BANB 1BUIA 4Y71A 4AFZA 1J16A 1MQ6A 1JIMA 1CE5A 2BZAA 1DLKB 1MKXK 3M36A 1C5LH 1OP8A 1GVLA 2GT7A 3KQBA 2R0KA 1RXPA 2DE8A 3GCHB 4FUBA 1O3IA 1EB1H 1THPB 3MFJA 5TJXA 5FXLA 1C1QA 1DSUA 2ZFRH 3TPIZ 1BIOA 1G2MA 2AIPA 1EZSC 1SPJA 4D7GA 5DP7A 3SV2H 2F9PA 1HCGA 5K0HA 3T2NA 3P8OA 3ATMA 2AERH 2BZ6H 1TA6A 4B2BA 4X8TH 1P3CA 4DY7B 3GY7A 2ZFFH 3B8JA 3MO9A 1Z1JA 1GCTB 1UVPA 1WQVH 3TH3H 3SHCH 3EAJA 1PYTC 1C2MA 3QTVH 1UCYE 4X1RU 1IHSH 1GHAG 4IN2A 2P95A 1B7XB 2ZZUH 4YTAA 4AB8A 2XW9A 1LVMA 5GJ4B 2H5CA 4CRBA 4I31A 1IAUA 2FXRA 1TQ7B 4K1EA 1RFNA 2Z9GA 2ZGHA 2BD3A 1C5UA 3HKJB 1PPCE 1ACBE 7ESTE 1A5HA 1XUKA 3NPSA 1O2PA 3QN7A 4FUFA 1NU9A 5E2PA 1NFUA 2AMQA 2XC5A 3RLWH 1EPTA 1GI5A 5FBIA 1GBDA 3W95A 1LCYA 3RXEA 1DE7H 2ESTE 3RXLA 3ZZ7A 3AW1A 5A0CA 2Y5FA 1O35A 2GGVB 1DY8A 3GDVA 5H4IB 4MG3A 1UVSH 3P92A 3SI4H 1O39A 4CBNA 4X8VH 3PTBA 1LVBA 3E0NB 2A7HA 3FFGA 5F6MA 3TK9A 1ZMLA 1EASA 1A1RA 1LO6A 2D8WA 4UFGH 3S69A 1AWFH 4WXIA 5I25A 1HB0B 1C2LA 2NU4E 4FUGA 1GCTC 4JYVH 1SOTA 5EPNA 2ZGBH 1DLEA 4QT8C 5DP5A 2AYWA 2P3TB 4JK5A 1YPJH 2R9PA 1LHGH 1SGFG 2BDBA 1D4PB 4X1PU 7GCHG 4A92A 5F8XA 1VITG 1EXFA 1QA7A 2SFAA 3GISB 4GVUA 3KHVA 1P57B 2SGPE 2OC7A 2BVXH 1FUJA 4A1TA 1F0UA 2BD4A 5GDSH 4K1TA 1O5DH 2BVSH 3MNBA 2V0BA 2BOHB 3EA8A 1ELVA 1EATA 1GJ6A 1LKAA 5J4SA 4X2VA 3P17H 4FXGH 1RTFB 3SV8A 5PTPA 1FAKH 3DFLA 1SQAA 2ZWLH 3ZYEA 2ZPRA 3P8FA 4DIIH 4DURA 1LPZB 1VGCC 2VWOA 1BB0B 1UK2A 5HGGA 1O2HA 5EXMA 1GHXH 1LKBA 3M7QA 4TWWA 3LGIA 1F5LA 1VCQA 3VXEH 1JXPA 1ANEA 2ZU1A 2D26C 3PMBB 2Z7FE 1SFIA 4WH8A 4AFSA 1EQ9A 3SGAE 1AO5A 1PPFE 1GMCF 1O3JA 2YNBA 4KGAA 1A3EH 3SZNA 4BAKB 2YNAA 1O3KA 1A0JA 1JRSA 5EU8A 2FI4E 3RXRA 3QWCH 3D62A 1GBHA 2G55A 1LHCH 4MPVA 1Z8IB 3ZZ5A 5A8YA 1O3CA 5B6OA 1GI7B 3RMOH 5HYOA 3RM0H 1ETSH 1GI3A 3HK6B 1GGDB 1UHBB 5C2ZA 1O2VA 1P2NA 3M3SA 1P03A 4Q7XA 1FV9A 1AUTC 4WJG2 1HAYB 3SHAH 1OXGA 4UFFH 2C8YB 4NA8A 1GMHG 3ATIA 2BXUH 1V2ST 4ABDA 1K28D 1GVZA 1KTTB 4GCHF 1OKXA 3AAVA 2AS9A 3CENA
chains in the Genus database with same CATH superfamily
1P01A 2XNDD 1CA0B 2R2WU 3ELAH 2OLGA 1FY4A 4ABJA 1IQHA 1J17T 5C5NA 3OEHD 2AGEX 1UVTH 2YOLA 2BXTH 4X8SH 1DICA 2ZHDA 3OU0A 2J5UA 3UREA 3M3VA 1DWDH 1C1WH 1D3QB 1DXWA 1KLIH 3CP7A 2J92A 3P95A 3BEFB 3PWBA 2WPHS 1NZQH 3RDZA 1HNEE 3BG8A 1ZSLA 1NFYA 2WV5A 1EAXA 2ZQ1A 4ISHH 1O5AB 4XSKU 1TGBA 1BHXF 2BD5A 1C1RA 3PMAB 3MU0A 5J4QA 2AFQB 1BMMH 1V6DA 2QXJA 1BMFD 1XUGA 1QB1A 5E8EH 3E0PB 3K65B 3ZVGA 3S7KB 1CBWB 3MNCA 4MQAA 2VVCA 4LOYH 5L6NH 3GYMA 2BVRH 2ZPSA 1Z8JB 3MH4A 2FX6A 2OBOA 5EQSA 4ZMAH 4O03A 1LHFH 2VINA 2Z9JA 2GZ9A 2ZI2H 1T8MA 5T6DA 2J95A 2THFB 3P8GA 3URCA 2ZDAH 2VIWA 1OSSA 2Q6FA 1O32A 4Y8XA 1WOFA 1CO7E 1NN6A 1K1IA 3FN8A 1THSH 1NRRH 1DPOA 1OX1A 1GJ9B 4ZUHA 3M37A 3MO6A 2C93B 3OFND 3F2FA 4ACAA 4U01A 1TNLA 3TNTA 3SNCA 2WINI 3H7TA 1T4VH 1ANBA 1RGQA 2QE7D 4B75A 1BRBE 1ELFA 1NBME 1JMOH 5EGMA 2H2ZA 1CVWH 4UE7H 4B2AA 5CE1A 4A6LA 1C1SA 4X2YA 1HJAC 3PO1B 3U8TH 5DP8A 1UK3A 4Y76A 3MYWA 3ODDA 3A7XA 2A4OA 2OTVA 2FOCA 2SGEE 2XXLA 2OBQA 1AY6H 2FZZA 1G9IE 1G36A 3V0XA 4ZCNA 1AKSA 3G01A 3SYJA 2WV9A 2FO9A 2ODQA 3SQEE 1A5GH 4AORA 1V2LT 1ZJKA 4AZ2B 5A09A 1QHRB 4UEHH 2GD4B 2G5VA 4Q2KA 1W0JD 4Z6AH 5A8XA 1O36A 1YPEH 2GCHG 2CMYA 3A8DA 3UAIC 1CA8B 5T6GA 1GBEA 5A8ZA 2GDDA 2ZCHP 2ZP0H 4R0IA 1S81A 2VJ1A 2WYGA 2BYAX 1ZSKA 1E1RD 1Y5AT 5JB8S 3KYFA 4NFEA 4K8BA 1P10A 4ABEA 8KME2 2ZTYA 2H9TH 3U69H 2ODYB 1GI6A 3N7OA 2Q6DA 2JJ2D 4ZHLU 3WY8A 2RG3A 1C5SA 1O3PB 2OK5A 4IC6A 2H5DA 2OQ5A 2FOEA 2I6SA 2JETC 2GJGA 1SI5H 1OWHA 3EE7A 1SGIB 3Q3XA 4O9VA 8GCHF 1IQIA 3OTPA 1PPBH 3TK6A 1AE8H 1OP2A 1Q31A 3UNQA 2BMGB 1TPPA 3BTFE 4FVDA 3QZQA 4LZ4B 1OYQA 4WMDA 3SNDA 3SORA 2W5EA 2ZTZA 2BX3A 4H4FA 2VH0A 1MH0A 1QL9A 2XBYA 4X2XA 1THRH 1LVOA 1WQSA 1ZTJA 4UFEH 5C67A 2FOFA 3H7OA 1FZZA 4ZAEA 4NFFA 1EOLA 1H9IE 1HAVB 3AW0A 3KQ5A 2LPRA 1RS0A 1P04A 1GI2A 4NGAH 3VXFH 1GGDC 4DT4A 1ELDE 3RXKA 1TNJA 5EQRA 3M7UA 3PM3A 2PSXA 2HPPH 1C1VH 1EP6A 3BTME 3SBKA 4CREA 1FAXA 1JRTA 1SGEE 2JKHA 3TLOA 1ANDA 3UFAA 3V13A 3B23B 3UNRA 3RU4T 1KXDA 3MO3A 5C1UA 3LGUA 4I8HA 2HALA 5BPEA 5JYIA 1FXYA 3K6YA 4FU7A 3QX5H 1HIAB 2XYAA 1H8HD 1O2ZA 2F9UA 1Y3UA 1EKBB 3RXOA 5EQQA 3PLKA 1QQUA 2ZHFH 2BY7X 4MTBA 1P3EA 2O8MA 2BD2A 2SGAA 1AB9C 2SNVA 3ZZBA 1BTPA 3RUOA 2VB0A 2ZCLP 3E1XB 1F0RA 1AKSB 2AIQA 2WV4A 4F4OC 1YPMH 5TCCA 1SR5C 5AHGH 3RC5A 2L6OA 2J9NA 3U28C 3ZVCA 2CXVA 2WPKS 1EJMA 1P05A 1ELAA 1Z1IA 1W8BH 1TNKA 4HTCH 3A86A 3N7EA 1AFQB 1VITF 1ELEE 2O8UA 1O31A 3I78A 2UUFB 1T8NA 5EXNA 3RLYH 2EY4C 3RMNH 3OEED 4Z1MD 4ZROA 1C5NH 3SV6A 2RA0A 4SGBE 2KR7A 2QV1A 1LTOA 5LGOA 1ZHPA 2PWXA 1P2QA 1ARCA 2ZFQH 3E8LA 1QJ6B 1RD3B 3RXJA 3SGBE 1Z71A 1TLDA 1O3LA 3MNXA 5L2YH 2XCFA 1BTHH 1V2MT 3FZDA 4ZHAA 1O3DA 2A0QB 2EC9H 4CR9A 4I7YH 3TJNA 2ZHQH 1GHBF 1O2OA 1UVUH 4Y7BA 4TWYA 1UTLM 2XC4A 2SNWA 3M5OA 1ELTA 1TGTA 1SHYA 5F53A 1PPEE 2FWWA 3EYDA 2A31A 1Z6EA 1MABB 2CHAB 1BBRH 1K1LA 1Y59T 2A5KA 1QB9A 1NRSH 2CGAA 1AU8A 3F1SB 1A5IA 4HFPB 2BD8A 1CQQA 1QR3E 1GL1A 2XNIA 1GHYH 2PKSB 2ZDMA 4ZHMU 2WPIS 5JBBS 1TMBH 6GCHG 2RA3A 5ABWA 1H9HE 5EXLA 3VB6A 2GCTB 1WV7H 1ID5H 1O3HA 4JZDH 1TPSA 5DP4A 4IN1A 1O2SA 4JCNA 4Y8ZA 5FL7D 2L74A 2GV6A 1O0DH 4K3JA 1EPTB 1AMHA 1GBJA 3S7HB 3CS0A 1E1QD 1F0TA 1MU6B 5EJ1A 4E7NA 1CSOE 2Z9KA 1XKBC 2FYQA 4BAMB 3RXBA 5CHAC 2ZFPH 5DO4H 1G30B 1GVKB 5IYTA 1KDQA 4ZXYH 1JIRA 3F3BA 1Y3YA 2OC0A 2PUXB 3KNXA 1EAUA 1KLTA 1X7AC 2GZ8A 3T5FH 2FMJA 1CT2E 4CBOA 1DVAH 1FJSA 2VIDA 1G3BA 1GPZA 5L30H 3DSOA 4MPXA 4Y6DA 1BZXE 1K1JA 2FESH 3KYGA 1GJCB 5HIZA 1BCUH 1MKWK 3EGKH 2QF0A 1A4WH 3RXTA 1BMLA 4D8NA 1FY1A 1NESE 1Z6JH 4BAHB 2P3FH 3HPTB 3UR6A 3UWIA 3LT3A 1TFXA 1A2CH 3M35A 4NIWA 3ATKA 1O2UA 1GMDG 2GCTC 1VZQH 3OYPA 3RC6A 2D1JA 1GBLA 1NRNH 1MTWA 1C5TA 1NFXA 3GDUA 3K2UA 4IC5A 1BTYA 1DFPA 2A7JA 1INCA 3DUXH 3OTJE 2XTTB 1GG6B 2B5TB 4WH6A 2ZKSA 3D49H 3FP6E 3RU4D 1KXCA 3LONA 3SU0A 1TB6H 2G00A 3TU7H 2F9BH 1JOUB 3VB7A 2FIRH 5FCRA 2F3CE 1RIWC 3V12A 1ZJDA 2BHGA 4FU8A 4NWLA 5AVDA 1GL0E 1FN8A 3SO3A 3P8NA 1GHVH 1PFXC 1YLNA 2P94A 5EODA 3WW7A 3SU4A 5A2MH 4B2CA 3U8OH 2VH6A 1QBOA 1MTNC 2D2DA 1IQLA 1BRUP 3KIDU 3ZV8A 5HM2A 1SGRE 2HNTF 3FOAA 3B9FH 1QRXA 1HXEH 2GDEH 1KY9A 1D9IA 2ZEBA 3O8BA 3MU5A 4GHTA 1K21H 1B5GH 4F49A 4B73A 2Y5HA 1P2IA 3A84A 3F6UH 1D3DB 1J15A 3RXDA 1C5YB 3ZVAA 3K6ZA 1FY5A 5KECA 3FO8D 2B7DH 2ILNA 3QGJA 4TPYA 1C2EA 3A81A 1K0HA 2V3MA 2ZNKH 1DSTA 1IQEA 1S5SA 2A32A 3JZ2B 1AVGH 2BTCE 2AMDA 4OS4A 1J14A 1DT2A 2WPJS 3PB1E 5IK2D 4NSYA 2P16A 1UTKA 3U98H 5DPAA 1SGNE 4A5TS 4GCHG 1C1OA 1AQ7A 1SGFA 1GI9B 1IHTH 1O3FA 1HAHH 3LKWA 4E06H 4YLQH 3IITA 1BT7A 1OWJA 1S85A 3LC3A 4HZHA 4OS7A 4BAOB 3S9BA 3HGPA 1QL7A 5DN6D 4NZQA 5CHBA 3MU1A 1S84A 1DITH 1SLUB 5AF9H 2O8LA 4UDWH 2IOTA 1C5OH 3ZZ6A 2TBSA 5C0TA 3PWCA 1C5WB 4YOGA 1YLCA 5A0AE 5KGOA 1KSNA 1TBRH 3MOCA 4IMZA 4RT1A 1NROH 5C1XA 3MU8A 1W2KH 3A88A 1O5CB 3A7WA 3OY6U 3QLPH 3BN9A 1W10U 2QXHA 5DGJA 1F92A 1MTNB 2PV9B 4J2YB 1KDQB 1ZHMA 1P12E 2WPMS 5ESBA 2TGPZ 3ZVBA 3ZIAD 3O8CA 1Z8RA 1HRTH 1D6WA 3UPEA 4BTTB 1Q3XA 1UJ1A 5FAHA 1ZMJA 2Y82A 4AYYB 4JYUH 2QXGA 1KLJH 1QIXB 3I29A 1NT1A 4MPWA 2DE9A 5EPYA 1SSXA 4RKOB 4ABBA 3W94A 1UCYK 1SBWA 1K22H 1SLVB 2KCPA 5HIYA 1O3MA 1Z8GA 2FI5E 4X6PA 2ZFTA 1B0EA 1FPHH 2UWLA 1LPKB 1ETTH 3A7YA 1SQTA 2AMPA 3C1KA 1YPGH 1AGJA 4HG6A 2UUJB 3UOPA 2C8WB 2JH0D 1GHAF 1BITA 3M5MA 3SOSA 3S0NA 4AGJA 4DIHH 1GBKA 4MPUA 1LMWB 1DWEH 1ESTA 3TVJB 1M9UA 1MKXH 1ZPCA 2A1DB 4I32A 2ZQ2A 3M3TA 1EJAA 3GCTG 3MI4A 3OAAD 4XE4A 3BTGE 4UD9H 1TGCA 1B0FA 5E0HA 3SJIA 1JBUH 1YY3A 5EJLA 2OC1A 3GICB 1QJ1B 1SFQB 2BX4A 3H5CB 1ZHRA 1BTWA 5GCHF 1C2FA 1HAIH 1XX9A 2VIOA 1GI8B 3TNSA 1A61H 3W1EA 3A7TA 5L2ZH 2AEIH 1KXAA 2OCVB 3RU4E 2A45B 3ATWA 5ESTE 4WWYA 1HAOH 3RXHA 3C27B 1C4Y2 4RN6A 2V7QD 1COWD 2LNCA 1O5EH 2JH5D 2BDYA 2I6QA 3BEIB 5EIYA 1C4V2 2XRCA 1CBWC 3ATLA 4ZXXH 1Y3VA 2YMSC 3UOUA 2VGCC 1GJ5H 4DVAU 3SV7A 2HLDD 3F2HA 3TGJE 4GLYA 1GI0A 1TALA 3GY4A 2ZGCA 1O2RA 2ANMH 3UWJH 4AN7A 2BLVA 2AGIX 2PTCE 4B74A 1HJAB 1K1MA 3PO1C 1TGNA 3D65E 1K1NA 1T4UH 4DCDA 4INHA 2FEQH 1C2GA 2ZA5A 4MNWA 3SUDA 3Q00A 3BSQA 3L6PA 3V7TA 1YC0A 1NPMA 1YBWA 4TYDA 3RC4A 1W7GH 6LPRA 7GCHF 1EZQA 2R3UA 1QBNA 4NZLA 7KMEH 3Q77A 4THNH 3ZZ3A 5JBAS 1XVMA 3NRLA 2GT8A 1CT0E 1GHBG 4ZKRU 1VJ9U 2BY9X 1GBBA 2ZHWH 1G3EA 2QF4A 3VGCC 4Y0ZE 1PQ7A 3RMMH 2QF3A 5DJ7A 2ZDNA 2Z94A 2J94A 1QJ7B 1WBGB 2IJOB 1O5GH 1ORFA 3FVFB 1BMAA 5ETXA 4IW4E 1W11U 3HK3B 1FIWA 6CHAB 2FOBA 2ZG0H 2GV7A 3SQHE 4YM9A 3T62A 4I8JA 1CGHA 1RJXB 2ZGXH 1ELGA 4WF8A 1C9TA 5AFYH 3KGPA 4AGKA 2FOGA 5B6LA 1HFDA 4FU9A 3LU9B 1FN6A 4DJZB 2XBVA 3NCLA 3PYHA 4IGDA 2A7CA 4NSVA 3VB3A 2BDCA 3ZZAA 4WY3A 2Z3DA 2BY8X 2FOAA 1O3OA 2RDEA 3IWMA 2Y7XA 4FUHA 3RXIA 4CHAB 1L2EA 1NTPA 3L3TA 5CMXH 3BTWE 1Q2WA 1KYNA 1O2LA 1ZPBA 1YGCH 1UO6A 4I8KA 4ISOA 2PTNA 1EAIA 1SGQE 1HPGA 1QCPA 1CU1A 1LPGB 1V2RT 2CV3A 3TGIE 1ARBA 3MU4A 4YT6H 4PROA 2CJIA 5G4BA 1S83A 2FX4A 2ZU4A 3DCLA 5HMAA 1TPAE 6ESTA 2A5AA 1DS2E 1D3PB 1YCPH 3FP7E 1GJ8B 1P8VC 1UHBA 4Q63A 4CH8B 2PGQB 4DOQA 3SUGA 4BNRA 3A7ZA 3BG4C 1YPHC 3E3TA 2SGQE 2M5TA 2G52A 4MVNA 1RRKA 1GI1A 3EA9A 1NFWA 2O8TA 2ZU3A 4MDSA 1TWXB 5EOKA 1XM1A 2CF8H 4Q7YA 3R0FA 4ASUD 3ZZ4A 2Q1JA 3SJ8A 3ZYDA 1D6RA 1MZDA 1VCPA 1LQEA 1C1PA 4X2WA 1TA2A 3UIRA 1V2OT 1TGSZ 3F2GA 4K69A 1MUEB 4NIXA 2O8WA 3LH3A 1RTKA 1WAYB 4WVPE 2ZDLA 1SGPE 2GCHF 3T29A 1TX7A 4OGYA 3ZZCA 2BDGA 4JZIA 1WTHD 4UONA 1BBRK 1A0LA 5E2OA 1MBMA 1FIZA 1U6QA 3EA7A 1QRWA 1SVPA 2NU2E 1ANCA 1HYLA 1O2IA 2J2UA 8LPRA 3MQKC 4YO9A 1MD8A 3M61U 1YP9A 2HGTH 3SJOA 1C2DA 3RXFA 2QXIA 4Q80A 1MAYA 2QCYA 2QYIA 2R2MB 5GPIB 4AG1A 3FANA 1KIGH 5JBTA 1G37A 2VGCB 1UVOA 4CRFA 3VPKA 2YMSB 3MH7A 2EI7A 1TOMH 1AZ8A 1BQYA 3SU3A 4FVBA 1DDJA 2A2QH 4BTIB 2TGDA 1HIAA 2ZC9H 2J38A 2GVFA 1TABE 5GIBA 5CDFE 2HWLB 4ZKSU 1C4U2 2A4RA 1V2PT 4XBCA 3FAOA 3QUMP 4KTUA 4JZEH 1TNIA 1BHXB 3I77A 2Z3EA 1CGIE 1ETRH 4XOJA 4AYVB 2BD7A 1SHHB 4ZH8A 3JZ1B 3Q76A 1W7XH 1TPOA 1C2HA 1AVXA 2OXSA 2Z3CA 1QTFA 1E35B 1ZYOA 3VGCB 3WWFA 3ZVFA 1HAVA 1SOZA 1BJVA 4B71A 4RT0A 2Y5GA 5GXPA 4AB9A 1SC8U 3OX7U 1O34A 4YT7H 4I8LA 1E79D 2EA3A 2XBWA 3QZRA 2KCYA 3AK5A 4ABFA 1TYNA 2J98A 1N8OC 1TNHA 3NZIA 4JK6A 1C5QA 4OM9A 3N7DA 7LPRA 3AAUA 5EJZA 2OD3B 3SI3H 1H8DH 1O5BB 4Y11E 2OUAA 4YOIA 1N1LA 5SGAE 4TT3D 3DSGA 1P0SH 3TIUA 1FDPA 2ULLA 2ASUB 3EE0B 3KN2A 1CT4E 4MNVA 1GJBB 1GMDF 2WPDD 4U2WA 1MAXA 1UTOA 2FS8A 1SLWB 3KF2A 1ESAA 3HATH 3LGWA 3DHKH 4X1NU 3A8CA 3RXAA 5K7RA 1TIOA 3S9CA 1ZMNA 2PUQH 1DWBH 2TPIZ 4IS5A 2WYJA 1UTQA 3PMHB 3MNSA 1GBAA 4RI0A 4D76A 1ZZZA 1OWKA 1SGCA 2ZGJA 1BJUA 1OWDA 5T3HA 8ESTE 3TJUA 3ESTA 2HLCA 5LPEA 2BQ6B 3RMLH 2HVXA 1H4WA 4ACBA 1J9CH 1GG6C 1TOCB 1MMJN 2XWAA 3KQEA 3M5NA 1NRQH 1HV7A 3STJA 2OC8A 1P09A 1XMNB 4ISNA 5FCKA 2BQWB 1O2MA 1GHWH 4NCYA 3RXMA 4X1QU 3FP8E 4A1XA 1O33A 2ZIQH 1C5MD 2ZO3H 3GCTF 2TRMA 4JYTA 5C17A 2J4IA 2JIZD 2AHME 2BY5X 3A85A 1GJ4H 3F68H 4KTSA 2RDLA 3PROA 2P93A 1P9UA 2QGRA 1UTMA 2BM2A 1HAGE 3SU5A 5GCHG 2ALVA 3DFJA 5FX6A 1SMFE 1W13U 5C5OA 4A1VA 2Y6TA 3GY3A 3U8RH 1AZZA 2QAAA 1SLXB 2F83A 1PJPA 5HM9A 3SNEA 3ODFA 2BOKA 1SQRA 1ABJH 2IJD1 4U32A 1P2MA 1JWTA 1O30A 4TY6A 1OYTH 4Z0KA 2KX4A 1DY9A 1KXFA 1PPHE 3HKIB 2VBCA 4ABGA 2CF9H 4ISLA 1AN1E 1KXEA 1WU1A 8GCHG 1AI8H 1OWEA 1O2GH 2G8TA 4Y0YE 3QDZB 4CRCA 1K1OA 1IQFA 1EAWA 1F2SE 3H09A 2GMTC 2VVVA 4K60A 3BF6H 4VGCB 2HOBA 1O2YA 2HNTC 3UB0A 3URDA 1ABIH 1ZPZA 4Y79A 2UUKB 4OGXA 3TJOA 4FUJA 4K1SA 1C5PA 3BTTE 2M2AA 1BRCE 4AOQA 1TX8A 4NIVA 2H6MA 2PKSC 2FYRA 3FZZA 3SJ9A 4NIYA 1ZLRA 2V35A 4MLFB 4ABHA 3A80A 3LGYA 3KQCA 2W3KA 4K5ZA 3DT0H 2CHAC 2A4QA 3ENSB 2GKVE 2STBE 3F9FA 1BTUA 1MCVA 4BXWA 1XVOA 4X0WU 1GDUA 2HRVA 1GMCG 1V2NT 1VGCB 3PLPA 2P59A 3TGKE 2JJ1D 1ELCA 3E6PH 1O5FH 2ZPQA 2JH6D 2K1QA 1S0RA 2PKAB 4FUEA 2WZQA 1GDQA 3T28A 2VVUA 3MHWU 3Q3YA 3A7VA 5HXFA 1CA0C 4GUXA 4H42U 4FUCA 4X1SU 1UK4A 2AGGX 4CRAA 3UUZA 4XDEA 1L1GA 4ABIA 1CHOG 1ELBA 4NWKA 4CRDA 1YCPM 1YKTA 4K8YA 4WXVA 4YESB 3UY9A 4ESTE 2TIOA 3BTQE 3KQDA 4YLUA 1AE5A 1O37A 2KAIB 3CS7A 3U1JB 1G3CA 2UWOA 2ANWA 2QY0B 1O3NA 4SGAE 2QA9E 1QY6A 1PQ5A 2GX4A 1GWAA 3GYLB 1FI8A 1LHEH 2F91A 5JPMH 2ANKH 3SUEA 3IG6B 1ZOMA 2Q6GA 1NS3A 2RCEA 1AVWA 3RXUA 5FHTA 5E0JA 1J8AA 3K9XB 1VJAU 2P3UB 2FODA 1Y5BT 1C5RA 3EQ0H 3SNBA 4H6TA 4OS5A 3F9HA 5T6FA 1HAPH 3RXVA 1W3CA 2A2XH 1DM4B 2B9LA 1C1MA 2W26A 4D9QA 3N99A 1HJ9A 1IQJA 1T31A 3DD2H 1DWCH 2FTMA 3BTDE 4DG4A 1IQKA 1CGJE 1UTPA 1E37B 4JMYA 4XBBA 1FLEE 1L1JA 1QBVH 1W14U 1MTUA 2Z9LA 1QB6A 2C8ZB 2H1UA 2ZU5A 4K2YA 4R8TB 4MNYA 3VB4A 2OQUA 2KAIA 1ZTKA 2G5NA 1T7CA 2Y81A 2FP7B 3LH1A 2WUBA 4X6MA 3SU1A 3BIVH 3DSPA 4YZUA 1BBRE 1S6HA 1GBFA 3KL6A 3GOVB 5FPSA 1ZRBA 2G4UA 4U30A 3TJVA 3NWUA 3SW2B 2IPQX 1QA0A 1DX5M 1GBCA 1ESBA 2DUCA 5FX5A 3NKKA 2BQ7B 1C5VA 3LDXH 2OINA 2FLBH 3OY5U 2NU1E 1WXRA 1IQNA 3SGQE 5A0BA 1HBTH 3AASA 1Y3XA 2LP6A 3U1IB 4KTCA 1EOJA 1V2TT 2O9QA 2WHXA 3A83A 4J1YA 2VWNA 1HLTH 5C94A 1RTLA 1MU8B 1PYTD 4ISIH 1XXFA 2TGTA 4GSOA 2G51A 1NU7B 4KP0A 3BTHE 2VIQA 2Y7ZA 2ZTXA 2GTBA 2KCAA 2EQNA 3T27A 5C3NA 3SU2A 1OP0A 1LHDH 2VWLA 1G2LA 1MTSA 1ZR0A 4JZFH 4O3UA 1BMNH 2SGFE 4RKJB 1IQGA 1QURH 3QK1A 2W7SA 1S82A 3P6ZB 1FNIA 3GY6A 4KKDA 3UNSA 3GDSA 1T8LA 3SNAA 2EI6A 4AC9A 1FX0B 1SL3A 3EDXB 2C4FH 4OS1A 3SJKA 3UQVA 2ALPA 1EUFA 3R3GB 4IBLH 3GCOA 2BDAA 5GWZA 5HKKD 4NA9H 1PPGE 3F0PA 5FPYA 3GS9A 3OE7D 3PLBA 2QN5T 2NU0E 1H1BA 1TE0A 1PQ8A 2STAE 1UTNA 2VNTA 1P2OA 1BA8B 1S6FA 4XD7D 2A4GA 1BRAA 4M7GA 1FY3A 1F5KU 1E0FD 1BOQA 2FOHA 1TMTH 2V6NA 3ZZDA 1VR1H 1VKYA 2Z9IA 5C1YA 1LDTT 4D7FA 1XKAC 2F9NA 4IMQA 4XFQA 2FTLE 2UWPA 1GBMA 2Z6BD 3RXCA 5EW2H 1EJNA 2WUCA 1GDNA 1HAZB 1IOEA 1AWHB 3RXGA 4Q7ZA 5E0GA 2ZFSA 2FDAA 5EG4A 2FS9A 3MTYA 4YOJA 4CR5A 1ZTLA 4B6EA 2H9HA 1O2XA 4X6NA 3SV9A 4WMEA 4FUDA 5DG6A 2F9VA 2PGBB 3LIWA 1VCWA 1C5XB 4M9FA 1O2JA 1T32A 4E7RG 1V2UT 1TAWA 2R3YA 1OPHB 1EX3A 4F55A 3LC5A 5JDUB 1K9OE 2IPHA 1NRPH 1AFEH 1O2QA 5C20A 4BXSA 1S6LA 1HAXB 1YCPK 3PRDA 3RXQA 5LPRA 1UTJA 3RXPA 2FM2A 3SU6A 1V2KT 3E90B 1AB9B 2BDHA 1NO9H 2C3SA 1O3GA 1NBMD 1E34B 4NA7A 1GJDB 3ZVDA 5JBCS 3GY5A 2IN2A 4FOUC 2NU3E 1SQOA 1TRNA 4VGCC 5KEDA 2EI8A 1SGTA 1KTSB 1P2JA 2WSSD 1PQAA 1TBQH 3BEUA 1O38A 1YPLH 2CN0H 3F9GA 1MZAA 1MBQA 3HGNA 4P00A 3A89A 2OP9A 4HGCA 3TH4H 5AFZH 1F0SA 1AUJA 3A8AA 1G3DA 2UUYA 2F9OA 1W0ZU 3ITIA 5LH8A 1HUTH 1Y8TA 3LGVA 1TBZH 1ZSJA 5IDKA 3BTEE 2V3HH 1EB2A 4HI3A 1S0QA 1DANH 1Y3WA 4GPGA 5F8ZA 1BTXA 2BLQA 2W6ID 3KCGH 2WPLS 3U9AH 2XCNA 2PHBA 3A87A 2CK3D 1P9SA 2VWMA 1H8IH 2ZDKA 1OS8A 3MH5A 3PV2A 3BV9B 4E05H 3NXPA 1CHGA 6GCHF 1C5ZB 1FY8E 1XUIA 1DUEA 1WDIA 3GY8A 2YMSD 4ZKOU 2JETB 2VIPA 1GMHF 4INKA 2VIVA 1W12U 3GCNA 4KELA 2FOMB 4TPIZ 4XRNA 1CHOF 1WTGH 5DK1A 2QIQA 1A0HB 9ESTA 3M5LA 4O97A 1K1PA 4TY7A 1HGTH 5DP6A 1Y5UT 2P8OB 4D9RA 3SZEA 1QQ4A 1Z7KA 1LVYA 1RIWB 2A5IA 1V2WT 2ZECA 3LPRA 3GCHC 2BLWA 3LOXA 1KXBA 4OS2A 1FONA 1WCZA 1MTVA 1OWIA 1HDTH 2QF5A 2ZU2A 5FBEA 1W0YH 3SN8A 1TRYA 3KEEA 3F9EA 1P06A 2ZDVH 5DP9A 1DUAA 2ZHEH 4FUIA 4GAWA 4X8UH 1MD7A 1XUHA 3NK8A 4AX9H 1L4ZA 5F03A 1E36B 4CHAC 5DKMA 2QC2A 2KFWA 1HJ8A 1AHTH 1GBTA 2G81E 3V3MA 1YLDA 3BTKE 1F5RA 3RXSA 2AH4X 1P2KA 1QL8A 3UTUH 2BLOA 2J98B 2EEKA 3MMGA 3PV4A 1YM0A 4TSFD 2SGDE 1NC6A 1EZUC 2B0FA 3QO6A 3GY2A 1ZGIA 1LQDB 1YF4A 1GJAB 1N6XA 1ZGVA 4I8GA 2BB4A 2W7UA 2ZF0H 4H6SB 2G4TA 4MNXA 3WWBA 4BAQB 1O2NA 5JB9S 3T26A 1WSSH 1L0ZA 5F8TA 1EZXC 4DT7B 1N8OB 1TQ0B 9LPRA 1GJ7B 4LXBH 1GHZA 4Y10E 1C9PA 1TMUH 2P8OC 3UQOA 3VB5A 3O8DA 1EP5A 2K0QA 1OOKB 3MWIU 1A7SA 1E38B 1VITH 1BTZA 1MQ5A 5I46H 5EW1H 4DGJA 1T8OA 3ZV9A 1V2VT 1YYY1 3LJOA 3BG4B 1A3BH 1C1TA 1XUJA 4AFUA 3TH2H 3MH6A 3ZVEA 1H8ED 3A82A 2PW8H 3OSYA 1MCTA 2PSYA 4JZ1A 4OS6A 1IQMA 2H9EH 2BDIA 1C2JA 2PFEA 2PLXA 1L4DA 3SUFA 1SGYE 2W3IA 5TCAA 5CHAB 4Y8YA 2Y80A 2ANYA 1YPKH 3UR9A 1KMHB 4WMFA 2BD9A 3O8RA 1EPTC 4AFQA 1TRMA 2B8OH 2TGAA 3DA9B 3L33A 2R0LA 4A7IB 2C8XB 3Q3KA 1O3AA 4CRGA 3AVZA 2ZCKP 1D3TB 2XBXA 2FPZA 2HNTE 3T25A 1GCDA 2J34A 3E16B 1O3BA 2JDID 2XC0A 2XOKD 1PPZA 1UCYH 4UFDH 2GZ7A 1FPCH 1TONA 1XUFA 3VEQB 1QFKH 2J97A 5DP3A 4AG2A 4BOHA 1QZ8A 1O2KA 6CHAC 3CNRA 1AD8H 1C2IA 5FPTA 2FI3E 1O2TA 3BIUH 1F7ZA 4ASHA 4BTUB 1P11E 2GMTB 1A46H 4ZKNU 4ABAA 4DW2U 1K2I1 4NG9H 4LK4A 4X6OA 3STIA 4XBDA 1AFQC 2BY6X 1C1UH 1DXPA 3LJJA 3QGNB 1SB1H 1SG8B 4RSPA 1QNJA 1OHHD 2PR3A 1ZRKA 3E91A 3ZZ8A 1G32B 1HXFH 2XWBI 4INLA 1C1NA 5BRRE 1EFRD 2PKAA 2FLRH 1H9LB 3TK5A 3M7TA 3VFEA 4GHQA 1QGFA 1O3EA 1AIXH 4CH2B 1QRZA 4B1TA 1O2WA 1V2JT 2GP9B 4LZ1H 1NM6A 1V2QT 1NY22 1YPHE 1SGDE 4I86A 4Y7AA 1DOJA 3D23A 3PMJA 1WYKA 2VU8E 4Q4LA 1TNGA 5LPFA 3A8BA 1FQ3A 1V3XA 1WUNH 3LGTA 1TX6A 2HPQH 3TITA 1UMAH 1XXDA 1MKWH 1P02A 3S9AA 4O3TA 4I33A 2NWNA 3PTNA 3RM2H 1GI4A 2HVYB 4B76A 1L1NA 2C90B 3ZZ9A 2V3OH 3QTOH 1FMGA 2F4LA 1N6YA 3NUMA 3RP2A 1BDAA 5DSFA 4YXWD 2ODPA 1C2KA 2PP6A 1GBIA 3P70B 4BANB 1BUIA 4Y71A 4AFZA 1J16A 3PRBA 1MQ6A 1JIMA 1CE5A 2BZAA 1DLKB 1MKXK 3M36A 1C5LH 1OP8A 1GVLA 2GT7A 3KQBA 2R0KA 1RXPA 2DE8A 3GCHB 4FUBA 1O3IA 1EB1H 1THPB 3MFJA 5TJXA 5FXLA 3F0OA 1C1QA 1DSUA 2ZFRH 2KZ4A 3TPIZ 1BIOA 1G2MA 2AIPA 1EZSC 1SPJA 4D7GA 5DP7A 3SV2H 2F9PA 1HCGA 5K0HA 3T2NA 3P8OA 3ATMA 2AERH 2BZ6H 1TA6A 4B2BA 4X8TH 1P3CA 4DY7B 3GY7A 2ZFFH 3B8JA 3MO9A 1Z1JA 1GCTB 1UVPA 1WQVH 3TH3H 3SHCH 3EAJA 1PYTC 1C2MA 3QTVH 1UCYE 2F43B 4X1RU 1IHSH 1GHAG 4IN2A 2P95A 1B7XB 2ZZUH 4YTAA 4AB8A 2XW9A 5GNDA 1LVMA 5GJ4B 2RFKC 2H5CA 4CRBA 4I31A 1IAUA 2FXRA 1TQ7B 4K1EA 1RFNA 2Z9GA 2ZGHA 2BD3A 4FETA 1C5UA 3HKJB 1PPCE 1ACBE 7ESTE 1A5HA 1XUKA 3NPSA 1O2PA 3QN7A 4FUFA 1NU9A 5E2PA 1NFUA 2AMQA 2XC5A 3RLWH 1EPTA 1GI5A 5FBIA 1GBDA 3W95A 1LCYA 3RXEA 1DE7H 2ESTE 1W0KD 3RXLA 3ZZ7A 3AW1A 5A0CA 2Y5FA 1O35A 2GGVB 1DY8A 3GDVA 5H4IB 4MG3A 1UVSH 3P92A 3SI4H 1O39A 4CBNA 4X8VH 3PV5A 3PTBA 1LVBA 3E0NB 2A7HA 3FFGA 5C0UA 5F6MA 3TK9A 1ZMLA 1EASA 1A1RA 1UW7A 1LO6A 2D8WA 4UFGH 3S69A 1AWFH 4WXIA 5I25A 1HB0B 1C2LA 2NU4E 4FUGA 1GCTC 4JYVH 1SOTA 5EPNA 2ZGBH 1DLEA 4QT8C 5DP5A 2AYWA 2P3TB 4JK5A 1YPJH 2R9PA 1LHGH 1SGFG 2BDBA 1D4PB 4X1PU 7GCHG 4A92A 3FKSD 5F8XA 1VITG 1EXFA 1QA7A 2SFAA 3GISB 4GVUA 3KHVA 1P57B 2SGPE 2OC7A 2BVXH 1FUJA 4A1TA 1SKYE 1F0UA 4B6FA 2BD4A 5GDSH 4K1TA 1O5DH 2BVSH 4P02A 3MNBA 2W6JD 2V0BA 2BOHB 3EA8A 1ELVA 1EATA 1GJ6A 1LKAA 5J4SA 4X2VA 3P17H 1YWUA 4FXGH 1RTFB 3SV8A 5PTPA 1FAKH 3DFLA 1SQAA 2ZWLH 3ZYEA 2ZPRA 3P8FA 4DIIH 4DURA 1LPZB 1VGCC 2VWOA 1BB0B 1UK2A 5HGGA 1O2HA 5EXMA 1GHXH 1LKBA 3M7QA 4TWWA 3LGIA 5T1VA 2LELA 1F5LA 1VCQA 3VXEH 1JXPA 1ANEA 2ZU1A 2D26C 3PMBB 2Z7FE 2KM0A 1SFIA 4WH8A 4AFSA 1EQ9A 3SGAE 1AO5A 2K8IA 1PPFE 1GMCF 1O3JA 2YNBA 4KGAA 1A3EH 3SZNA 4BAKB 2YNAA 1O3KA 1A0JA 3VG8A 1JRSA 5EU8A 2FI4E 3RXRA 3QWCH 3D62A 1GBHA 2G55A 1LHCH 4MPVA 1Z8IB 3ZZ5A 5A8YA 1O3CA 5B6OA 1GI7B 2KCOA 3RMOH 5HYOA 3RM0H 1ETSH 1GI3A 3HK6B 1GGDB 1UHBB 5C2ZA 1O2VA 1P2NA 3M3SA 1P03A 4Q7XA 1FV9A 1AUTC 4WJG2 1HAYB 3SHAH 1OXGA 4UFFH 2C8YB 4NA8A 1GMHG 3ATIA 2BXUH 1V2ST 4ABDA 1K28D 1GVZA 1KTTB 4GCHF 1OKXA 3AAVA 2AS9A 4F48B 3CENA
chains in the Genus database with same CATH topology
1P01A 3ELAH 1CA0B 2R2WU 2OLGA 1FY4A 4ABJA 1IQHA 1J17T 5C5NA 2AGEX 1UVTH 2YOLA 2BXTH 4X8SH 1DICA 2ZHDA 3OU0A 3UREA 3M3VA 1DWDH 1C1WH 1D3QB 1DXWA 1KLIH 3CP7A 2J92A 3P95A 3BEFB 3PWBA 2WPHS 1NZQH 3RDZA 1HNEE 3BG8A 1ZSLA 1NFYA 2WV5A 1EAXA 2ZQ1A 4ISHH 1O5AB 4XSKU 1TGBA 1BHXF 2BD5A 1C1RA 3PMAB 3MU0A 5J4QA 2AFQB 1BMMH 1V6DA 2QXJA 1XUGA 1QB1A 5E8EH 3E0PB 3K65B 3ZVGA 3S7KB 1CBWB 3MNCA 4MQAA 2VVCA 4LOYH 5L6NH 3GYMA 2BVRH 2ZPSA 1Z8JB 3MH4A 2FX6A 2OBOA 5EQSA 4ZMAH 4O03A 1LHFH 2VINA 2Z9JA 2GZ9A 2ZI2H 1T8MA 5T6DA 2J95A 2THFB 3P8GA 3URCA 2ZDAH 2VIWA 1OSSA 2Q6FA 1O32A 4Y8XA 1WOFA 1CO7E 1NN6A 1K1IA 1THSH 1NRRH 1DPOA 1OX1A 1GJ9B 4ZUHA 3M37A 3MO6A 2C93B 4U01A 1TNLA 3TNTA 3SNCA 2WINI 3H7TA 1T4VH 1ANBA 1RGQA 4B75A 1BRBE 1ELFA 1JMOH 5EGMA 2H2ZA 1CVWH 4UE7H 4B2AA 5CE1A 4A6LA 1C1SA 4X2YA 1HJAC 3PO1B 3U8TH 5DP8A 1UK3A 4Y76A 3MYWA 3ODDA 3A7XA 2A4OA 2OTVA 2FOCA 2SGEE 2XXLA 2OBQA 1AY6H 2FZZA 1G9IE 1G36A 3V0XA 1AKSA 3G01A 2FO9A 2ODQA 3SQEE 1A5GH 4AORA 1V2LT 1ZJKA 4AZ2B 5A09A 1QHRB 4UEHH 2GD4B 2G5VA 4Q2KA 4Z6AH 5A8XA 1O36A 1YPEH 2GCHG 2CMYA 3A8DA 1CA8B 5T6GA 1GBEA 5A8ZA 2GDDA 2ZCHP 2ZP0H 4R0IA 1S81A 2VJ1A 2WYGA 2BYAX 1ZSKA 1Y5AT 5JB8S 4NFEA 4K8BA 1P10A 4ABEA 8KME2 2ZTYA 2H9TH 3U69H 2ODYB 1GI6A 3N7OA 2Q6DA 4ZHLU 3WY8A 2RG3A 1C5SA 1O3PB 4IC6A 2H5DA 2OQ5A 2FOEA 2I6SA 2JETC 1SI5H 1OWHA 1SGIB 3Q3XA 4O9VA 8GCHF 1IQIA 1PPBH 3TK6A 1AE8H 1OP2A 1Q31A 3UNQA 2BMGB 1TPPA 3BTFE 4FVDA 3QZQA 4LZ4B 1OYQA 4WMDA 3SNDA 3SORA 2W5EA 2ZTZA 2BX3A 4H4FA 2VH0A 1MH0A 1QL9A 2XBYA 4X2XA 1THRH 1LVOA 1WQSA 1ZTJA 4UFEH 5C67A 2FOFA 3H7OA 1FZZA 4ZAEA 4NFFA 1EOLA 1H9IE 1HAVB 3AW0A 2LPRA 1RS0A 1P04A 1GI2A 4NGAH 3VXFH 1GGDC 1ELDE 3RXKA 1TNJA 5EQRA 3M7UA 3PM3A 2PSXA 2HPPH 1C1VH 1EP6A 3BTME 3SBKA 4CREA 1FAXA 1JRTA 1SGEE 2JKHA 3TLOA 1ANDA 3UFAA 3V13A 3B23B 3UNRA 3RU4T 1KXDA 3MO3A 5C1UA 3LGUA 4I8HA 2HALA 5BPEA 5JYIA 1FXYA 3K6YA 4FU7A 3QX5H 1HIAB 2XYAA 1O2ZA 2F9UA 1Y3UA 1EKBB 3RXOA 5EQQA 3PLKA 1QQUA 2ZHFH 2BY7X 4MTBA 1P3EA 2O8MA 2BD2A 2SGAA 1AB9C 2SNVA 3ZZBA 1BTPA 3RUOA 2VB0A 2ZCLP 3E1XB 1F0RA 1AKSB 2AIQA 2WV4A 4F4OC 1YPMH 5TCCA 1SR5C 5AHGH 3RC5A 2J9NA 3ZVCA 2CXVA 2WPKS 1EJMA 1P05A 1ELAA 1Z1IA 1W8BH 1TNKA 4HTCH 3A86A 1AFQB 1VITF 1ELEE 2O8UA 1O31A 3I78A 2UUFB 1T8NA 5EXNA 3RLYH 3RMNH 4ZROA 1C5NH 3SV6A 2RA0A 4SGBE 2QV1A 1LTOA 5LGOA 1ZHPA 2PWXA 1P2QA 1ARCA 2ZFQH 3E8LA 1QJ6B 1RD3B 3RXJA 3SGBE 1Z71A 1TLDA 1O3LA 3MNXA 5L2YH 2XCFA 1BTHH 1V2MT 3FZDA 4ZHAA 1O3DA 2A0QB 2EC9H 4CR9A 4I7YH 3TJNA 2ZHQH 1GHBF 1O2OA 1UVUH 4Y7BA 4TWYA 1UTLM 2XC4A 2SNWA 3M5OA 1ELTA 1TGTA 1SHYA 1PPEE 2FWWA 3EYDA 2A31A 1Z6EA 2CHAB 1BBRH 1K1LA 1Y59T 2A5KA 1QB9A 1NRSH 2CGAA 1AU8A 3F1SB 1A5IA 4HFPB 2BD8A 1CQQA 1QR3E 1GL1A 2XNIA 1GHYH 2PKSB 2ZDMA 4ZHMU 2WPIS 5JBBS 1TMBH 6GCHG 2RA3A 5ABWA 1H9HE 5EXLA 3VB6A 2GCTB 1WV7H 1ID5H 1O3HA 4JZDH 1TPSA 5DP4A 4IN1A 1O2SA 4JCNA 4Y8ZA 2GV6A 1O0DH 4K3JA 1EPTB 1AMHA 1GBJA 3S7HB 3CS0A 1MU6B 1F0TA 4E7NA 1CSOE 2Z9KA 1XKBC 2FYQA 4BAMB 3RXBA 5CHAC 2ZFPH 5DO4H 1G30B 1GVKB 5IYTA 1KDQA 4ZXYH 1JIRA 1Y3YA 2OC0A 2PUXB 3KNXA 1EAUA 1KLTA 1X7AC 2GZ8A 3T5FH 2FMJA 1CT2E 4CBOA 1DVAH 1FJSA 2VIDA 1G3BA 1GPZA 5L30H 4MPXA 4Y6DA 1BZXE 1K1JA 2FESH 1GJCB 1BCUH 1MKWK 3EGKH 2QF0A 1A4WH 3RXTA 1BMLA 4D8NA 1FY1A 1NESE 1Z6JH 4BAHB 2P3FH 3HPTB 3UR6A 3UWIA 3LT3A 1TFXA 1A2CH 3M35A 4NIWA 3ATKA 1O2UA 1GMDG 2GCTC 1VZQH 3OYPA 3RC6A 2D1JA 1GBLA 1NRNH 1MTWA 1C5TA 1NFXA 3GDUA 3K2UA 4IC5A 1BTYA 1DFPA 2A7JA 1INCA 3DUXH 3OTJE 2XTTB 1GG6B 2B5TB 4WH6A 2ZKSA 3D49H 3FP6E 3RU4D 1KXCA 3LONA 3SU0A 1TB6H 2G00A 3TU7H 2F9BH 1JOUB 3VB7A 2FIRH 5FCRA 2F3CE 1RIWC 3V12A 1ZJDA 2BHGA 4FU8A 4NWLA 5AVDA 1GL0E 1FN8A 3SO3A 3P8NA 1GHVH 1PFXC 2P94A 5EODA 5A2MH 3SU4A 4B2CA 3U8OH 2VH6A 1QBOA 1MTNC 2D2DA 1IQLA 1BRUP 3KIDU 3ZV8A 5HM2A 1SGRE 2HNTF 3B9FH 1QRXA 1HXEH 2GDEH 1KY9A 1D9IA 2ZEBA 3O8BA 3MU5A 4GHTA 1K21H 1B5GH 4F49A 4B73A 2Y5HA 1P2IA 3A84A 3F6UH 1D3DB 1J15A 3RXDA 1C5YB 3ZVAA 3K6ZA 1FY5A 2B7DH 2ILNA 3QGJA 4TPYA 1C2EA 3A81A 2ZNKH 1DSTA 1IQEA 1S5SA 2A32A 3JZ2B 1AVGH 2BTCE 2AMDA 4OS4A 1J14A 1DT2A 2WPJS 3PB1E 4NSYA 2P16A 1UTKA 3U98H 5DPAA 1SGNE 4A5TS 4GCHG 1C1OA 1AQ7A 1SGFA 1GI9B 1IHTH 1O3FA 1HAHH 3LKWA 4E06H 4YLQH 3IITA 1BT7A 1OWJA 1S85A 3LC3A 4HZHA 4OS7A 4BAOB 3S9BA 3HGPA 1QL7A 4NZQA 3MU1A 1S84A 1DITH 1SLUB 5AF9H 2O8LA 4UDWH 2IOTA 1C5OH 3ZZ6A 2TBSA 3PWCA 1C5WB 4YOGA 1YLCA 5A0AE 1KSNA 1TBRH 3MOCA 4IMZA 1NROH 5C1XA 3MU8A 1W2KH 3A88A 1O5CB 3A7WA 3OY6U 3QLPH 3BN9A 1W10U 2QXHA 5DGJA 1F92A 1MTNB 2PV9B 4J2YB 1KDQB 1ZHMA 1P12E 2WPMS 5ESBA 2TGPZ 3ZVBA 3O8CA 1Z8RA 1HRTH 1D6WA 3UPEA 4BTTB 1Q3XA 1UJ1A 5FAHA 1ZMJA 2Y82A 4AYYB 4JYUH 2QXGA 1KLJH 1QIXB 3I29A 1NT1A 4MPWA 2DE9A 5EPYA 1SSXA 4RKOB 4ABBA 3W94A 1UCYK 1SBWA 1K22H 1SLVB 1O3MA 1Z8GA 2FI5E 4X6PA 2ZFTA 1B0EA 1FPHH 2UWLA 1LPKB 1ETTH 3A7YA 1SQTA 2AMPA 3C1KA 1YPGH 1AGJA 2UUJB 3UOPA 2C8WB 2JH0D 1GHAF 1BITA 3M5MA 3SOSA 3S0NA 4AGJA 4DIHH 1GBKA 4MPUA 1LMWB 1DWEH 1ESTA 3TVJB 1M9UA 1MKXH 1ZPCA 2A1DB 4I32A 2ZQ2A 3M3TA 1EJAA 3GCTG 3MI4A 4XE4A 3BTGE 4UD9H 1TGCA 1B0FA 5E0HA 3SJIA 1JBUH 2OC1A 3GICB 1QJ1B 1SFQB 2BX4A 3H5CB 1ZHRA 1BTWA 5GCHF 1C2FA 1HAIH 1XX9A 2VIOA 1GI8B 3TNSA 1A61H 3A7TA 5L2ZH 2AEIH 1KXAA 2OCVB 3RU4E 2A45B 3ATWA 5ESTE 4WWYA 1HAOH 3RXHA 3C27B 1C4Y2 4RN6A 2LNCA 1O5EH 2JH5D 2BDYA 2I6QA 3BEIB 1C4V2 2XRCA 1CBWC 3ATLA 4ZXXH 1Y3VA 3UOUA 2VGCC 1GJ5H 4DVAU 3SV7A 3TGJE 4GLYA 1GI0A 1TALA 3GY4A 2ZGCA 1O2RA 2ANMH 3UWJH 4AN7A 2BLVA 2AGIX 2PTCE 4B74A 1HJAB 1K1MA 3PO1C 1TGNA 3D65E 1K1NA 1T4UH 4DCDA 4INHA 2FEQH 1C2GA 2ZA5A 4MNWA 3SUDA 3Q00A 3BSQA 3L6PA 3V7TA 1YC0A 1NPMA 1YBWA 4TYDA 3RC4A 1W7GH 6LPRA 7GCHF 1EZQA 2R3UA 1QBNA 4NZLA 7KMEH 3Q77A 4THNH 3ZZ3A 5JBAS 1XVMA 2GT8A 1CT0E 1GHBG 4ZKRU 1VJ9U 2BY9X 1GBBA 2ZHWH 1G3EA 3VGCC 4Y0ZE 1PQ7A 3RMMH 2QF3A 5DJ7A 2ZDNA 2Z94A 2J94A 1QJ7B 1WBGB 2IJOB 1O5GH 1ORFA 3FVFB 1BMAA 5ETXA 4IW4E 1W11U 3HK3B 1FIWA 6CHAB 2FOBA 2ZG0H 2GV7A 3SQHE 4YM9A 3T62A 4I8JA 1CGHA 1RJXB 2ZGXH 1ELGA 4WF8A 1C9TA 5AFYH 3KGPA 4AGKA 2FOGA 1HFDA 4FU9A 3LU9B 1FN6A 4DJZB 2XBVA 3NCLA 3PYHA 4IGDA 2A7CA 4NSVA 3VB3A 2BDCA 3ZZAA 4WY3A 2Z3DA 2BY8X 2FOAA 1O3OA 4FUHA 3IWMA 2Y7XA 3RXIA 4CHAB 1L2EA 1NTPA 3L3TA 5CMXH 3BTWE 1Q2WA 1KYNA 1O2LA 1ZPBA 1YGCH 1UO6A 4I8KA 4ISOA 2PTNA 1EAIA 1SGQE 1HPGA 1QCPA 1CU1A 1LPGB 1V2RT 2CV3A 3TGIE 1ARBA 3MU4A 4YT6H 4PROA 2CJIA 5G4BA 1S83A 2FX4A 2ZU4A 5HMAA 1TPAE 6ESTA 2A5AA 1DS2E 1D3PB 1YCPH 3FP7E 1GJ8B 1P8VC 1UHBA 4CH8B 2PGQB 4DOQA 3SUGA 4BNRA 3A7ZA 3BG4C 1YPHC 3E3TA 2SGQE 2M5TA 2G52A 4MVNA 1RRKA 1GI1A 3EA9A 1NFWA 2O8TA 2ZU3A 4MDSA 1TWXB 5EOKA 1XM1A 2CF8H 4Q7YA 3R0FA 3ZZ4A 2Q1JA 3SJ8A 3ZYDA 1D6RA 1MZDA 1VCPA 1LQEA 1C1PA 4X2WA 1TA2A 3UIRA 1V2OT 1TGSZ 4K69A 1MUEB 4NIXA 2O8WA 3LH3A 1RTKA 1WAYB 4WVPE 2ZDLA 1SGPE 2GCHF 3T29A 1TX7A 4OGYA 3ZZCA 2BDGA 4JZIA 1WTHD 4UONA 1BBRK 1A0LA 5E2OA 1MBMA 1FIZA 1U6QA 3EA7A 1QRWA 1SVPA 2NU2E 1ANCA 1HYLA 1O2IA 2J2UA 8LPRA 4YO9A 1MD8A 3M61U 1YP9A 2HGTH 3SJOA 1C2DA 3RXFA 2QXIA 4Q80A 1MAYA 2QCYA 2QYIA 2R2MB 5GPIB 4AG1A 3FANA 1KIGH 5JBTA 1G37A 2VGCB 1UVOA 4CRFA 3VPKA 3MH7A 2EI7A 1TOMH 1AZ8A 1BQYA 3SU3A 4FVBA 1DDJA 2A2QH 4BTIB 2TGDA 1HIAA 2ZC9H 2J38A 2GVFA 1TABE 5GIBA 2HWLB 4ZKSU 1C4U2 2A4RA 1V2PT 4XBCA 3FAOA 3QUMP 4KTUA 4JZEH 1TNIA 1BHXB 3I77A 2Z3EA 1CGIE 1ETRH 4XOJA 4AYVB 2BD7A 1SHHB 4ZH8A 3JZ1B 3Q76A 1W7XH 1TPOA 1C2HA 1AVXA 2OXSA 2Z3CA 1QTFA 1E35B 1ZYOA 3VGCB 3ZVFA 1HAVA 1SOZA 1BJVA 4B71A 2Y5GA 5GXPA 4AB9A 1SC8U 3OX7U 1O34A 4YT7H 4I8LA 2EA3A 2XBWA 3QZRA 4ABFA 1TYNA 1N8OC 1TNHA 3NZIA 4JK6A 1C5QA 7LPRA 3AAUA 2OD3B 3SI3H 1H8DH 1O5BB 4Y11E 2OUAA 4YOIA 1N1LA 5SGAE 1P0SH 3TIUA 1FDPA 2ULLA 2ASUB 3EE0B 3KN2A 1CT4E 4MNVA 1GJBB 1GMDF 4U2WA 1MAXA 1UTOA 2FS8A 1SLWB 3KF2A 1ESAA 3HATH 3LGWA 3DHKH 4X1NU 3A8CA 3RXAA 5K7RA 1TIOA 3S9CA 1ZMNA 2PUQH 1DWBH 2TPIZ 4IS5A 2WYJA 1UTQA 3PMHB 3MNSA 1GBAA 4D76A 1ZZZA 1OWKA 1SGCA 2ZGJA 1BJUA 1OWDA 5T3HA 8ESTE 3TJUA 3ESTA 2HLCA 5LPEA 2BQ6B 3RMLH 2HVXA 1H4WA 1J9CH 1GG6C 1TOCB 1MMJN 2XWAA 3KQEA 3M5NA