4XBDA

1.45a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor (1r,2s)-2-({n-[(benzyloxy)carbonyl]-3-cyclohexyl-l-alanyl}amino)-1-hydroxy-3-[(3s)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid (orthorhombic p form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
163
Chain Sequence
b'HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATNTVVCAVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
total genus 40
structure length 163
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbdA01
3UTUH 1RGQA 1C1OA 3M5OA 1V2ST 4O3UA 1F7ZA 1O3HA 2ZDVH 2AFQB 5FAHA 4NCYA 1FN8A 4NWLA 3KEEA 1AZ8A 1BMNH 1QL8A 5CE1A 1ZMJA 1GI7B 2ZGXH 3KQBA 1YYY1 3SU2A 4NA8A 2GVFA 1FJSA 2Q1JA 2C8ZB 1YLDA 2O8MA 2ZHQH 2GTBA 3A87A 8GCHG 2ULLA 1GCDA 1O2ZA 1V2OT 1SVPA 3A85A 1G30B 2XNIA 3MWIU 1N1LA 3QUMP 2OD3B 4HGCA 1TNLA 1A2CH 1C2JA 3A8BA 6CHAB 1PYTC 1SPJA 1C4U2 3JZ1B 4ABIA 5FBEA 1EAIA 1A5IA 3M3SA 4WH8A 3R3GB 4FUFA 3RDZA 5DP4A 2UWPA 3PMHB 4LOYH 1FPCH 1BB0B 1EB2A 1QNJA 2Y5GA 2G81E 4I31A 5EXLA 4D76A 2D1JA 2TGAA 4K1EA 4DIHH 1RIWB 1A0JA 1AMHA 1VZQH 4KELA 4CRAA 5FPSA 1TPPA 1A46H 2R0LA 2F9BH 1QRXA 3KNXA 1NFWA 1O5AB 1KLTA 2C90B 3GY2A 1GDQA 2ZG0H 4YO9A 3M5LA 1S6FA 2VIDA 1KTSB 4X6MA 3UQVA 2ZFSA 1ANCA 1C5UA 1DSUA 1T7CA 1J17T 1ZOMA 1O39A 1ZYOA 1XXDA 4AG2A 2TIOA 4IC6A 6CHAC 4ABAA 1NRPH 3SV6A 4ISNA 4NA9H 1S83A 1SSXA 1MKXH 5GDSH 1WOFA 3TK5A 2EI7A 5E0GA 2FYRA 4NFEA 4UEHH 1O3KA 3TITA 2XW9A 5EXMA 4X8UH 3HATH 1GBHA 1SGNE 3A8DA 3QDZB 3QK1A 1JXPA 3UNSA 1RIWC 5JB9S 1O2OA 2AMDA 1C2IA 3SU3A 1IQJA 2SGFE 3SNBA 3ZZBA 1Y3XA 1C1NA 1HXEH 2PGQB 4ZKRU 2Z9GA 2ZKSA 2J94A 1TFXA 2ZU2A 4UONA 3GDSA 1QFKH 1YPHC 3ZV9A 2PHBA 1IQIA 1VITG 5E0HA 1PPFE 1P3CA 1P3EA 3NKKA 1EZQA 1D6RA 2WUBA 3D62A 1MAXA 2Q6GA 4MNWA 1SB1H 2Z9IA 3Q76A 2P3FH 1DS2E 4GHQA 3EA8A 3GDVA 3M3TA 2A5KA 2VWNA 1YGCH 1MTUA 4XBDA 2HPQH 1GJ5H 1PYTD 2ZDKA 1UVTH 4OS5A 3GY3A 4AX9H 1Y3UA 4JYTA 1O2WA 4MLFB 1P8VC 5EPNA 4A6LA 4NIWA 1LQDB 2ALPA 1P09A 2A31A 5K0HA 1AVXA 3GICB 2ZU5A 2FM2A 1C4Y2 3SW2B 1GHZA 2FMJA 1BITA 1MKWK 2BTCE 1KLIH 3M7UA 4BAHB 1CGIE 2G52A 3RXVA 4X1PU 4YOJA 5CMXH 4F49A 3E0PB 1YPKH 4MDSA 1EUFA 1A5HA 4DT7B 2ZHWH 3V12A 3CS0A 2CXVA 4GSOA 4DG4A 1UTLM 5GCHG 4X6PA 2HWLB 3M36A 4YLQH 3SU0A 1HUTH 3RXQA 1MQ5A 3PMBB 2Q6DA 1EPTB 5F6MA 1O3OA 3SV9A 1K28D 1QURH 1GBCA 3MI4A 3RXPA 1LCYA 1Z8IB 2P3UB 1AUJA 1GVLA 4WXVA 2GCHG 4MNYA 1EAXA 1ESTA 2OC0A 3GYMA 3OY6U 4AN7A 5C1UA 1SGFA 1SFIA 2HNTF 3LGIA 3Q3KA 1K1MA 5AHGH 1W2KH 3A7WA 2BXUH 1AN1E 1O3NA 3SNCA 1AB9B 1L1NA 5DKMA 4H6SB 4ISHH 1BBRK 5GXPA 1CA0C 3VB7A 1GHAG 1C1WH 1V2RT 2BM2A 2Z6BD 5LPRA 1V2QT 3UPEA 3A8AA 7GCHF 2GP9B 1TQ7B 5ABWA 4MVNA 2G4TA 5TJXA 1K1IA 1A61H 3ZZ9A 1C5LH 4WF8A 1O2QA 3LJOA 2OC7A 2BHGA 4TWWA 1LHDH 4KTCA 3GY8A 1QBOA 3LGVA 1FNIA 3PMJA 1P04A 1CQQA 2J2UA 1TALA 2CJIA 2ZCLP 3F1SB 3AAUA 1WSSH 5FX6A 5G4BA 5EOKA 4VGCC 4Q2KA 4R0IA 4O97A 1MKWH 2R2WU 1V6DA 4Y71A 4JCNA 1P01A 2B8OH 3T2NA 3E90B 3FZDA 1NRRH 3E91A 1P2NA 1OP8A 1AKSB 1EXFA 1LHCH 3A89A 1W10U 1XVMA 4YT7H 2ANYA 1Z8GA 2EI8A 3GY4A 3KHVA 1C5ZB 1EZSC 1ZRBA 3UR9A 1UK3A 2XBXA 1Y5BT 4INKA 1MUEB 1MZAA 3BEIB 2J38A 3LONA 1SC8U 1UHBB 3URCA 1DWCH 2VVUA 3GY5A 1AIXH 2ZU1A 3PLKA 3LH1A 4KTUA 3VGCC 1ELDE 1HIAB 1QTFA 5ESTE 1BDAA 2ZFTA 2BMGB 5FBIA 3L33A 1KTTB 2NU0E 2XBYA 2J34A 4GPGA 1C2LA 3FP8E 1N8OC 2C8XB 5T3HA 4XDEA 1TRYA 1QRWA 1UTQA 4TWYA 3ZVCA 5L2YH 4GAWA 1SGEE 3I78A 3LOXA 1IHSH 1GJBB 1E37B 1O5FH 2CN0H 8LPRA 3SQEE 1G2LA 4GCHF 5FHTA 1BRAA 1EX3A 2A5IA 1TLDA 1QB1A 1BTUA 1EJNA 1GI2A 5T6GA 3RMNH 1GBEA 4NFFA 2FX6A 2W7UA 2HLCA 1HJ9A 2ZU3A 1DWEH 2VINA 3QGNB 3T62A 5LH8A 1P2MA 1GJ9B 1GL0E 4CHAB 5C5NA 5I25A 3MTYA 5B6OA 5GPIB 4JZEH 3SU1A 3TJOA 1EOLA 1KXFA 1TGSZ 1UJ1A 3MO3A 3F9FA 1XUJA 1J8AA 4GUXA 1ZSKA 1D3PB 3ATKA 1ZHRA 2XWBI 1L4DA 1JOUB 2RA0A 1LPZB 1K1NA 2C93B 2A0QB 1TNKA 3RM0H 3RC6A 4F4OC 5TCCA 4WMEA 4D7FA 2F9PA 1ABJH 3TLOA 1O3IA 2VIVA 3QX5H 1DLKB 4E05H 1GI9B 4K8BA 4I32A 1C2HA 2ZFRH 1NS3A 1OPHB 1QJ7B 1T8NA 1ELTA 3RMOH 1JIMA 1GGDB 1P10A 4SGBE 4JK5A 3UFAA 3NUMA 1AHTH 3E0NB 4O9VA 2ZDAH 2ZTXA 1NFXA 2PGBB 4B2CA 3LU9B 1C1VH 3ZZ8A 1ZSLA 2TRMA 3RXHA 5BRRE 1YPEH 1A0HB 1FY5A 4AFSA 1TBQH 3FVFB 3U1JB 1MTNB 1CSOE 1IQMA 2JETB 4K5ZA 1WV7H 1ANDA 1UO6A 1UTNA 3ZYDA 4KP0A 8KME2 3RXJA 1GI8B 3U8TH 1IHTH 1EPTA 5EXNA 9LPRA 2ZQ2A 3IWMA 1RTFB 3ZZCA 1QHRB 4FUCA 1O31A 1P9SA 2PFEA 2UWLA 4AYYB 2BY5X 4XFQA 3BTQE 2BZAA 1TAWA 1NN6A 3QTOH 1ESBA 2D8WA 2FTLE 2BQWB 1LVMA 1VJAU 2LNCA 4JMYA 1XUKA 1T31A 2RDLA 1MTNC 5DP3A 1W0ZU 5FXLA 1SMFE 2OXSA 2J4IA 1WCZA 1SLXB 7GCHG 2JETC 4RSPA 3BTEE 1A3EH 4Y8ZA 1GCTB 1BT7A 1B0EA 4BTIB 5FCKA 3LKWA 1KYNA 1NRNH 2J92A 1W13U 2HNTE 2G5NA 3GCTF 1QB6A 1CGJE 3DHKH 1S85A 5DK1A 4AOQA 1VR1H 1GJ7B 1WYKA 1O3MA 3DUXH 5FX5A 1ETTH 1HDTH 3RXDA 4FU9A 1T32A 1O2MA 1GJ4H 2BY7X 3M37A 2BD8A 3H7TA 4Q7YA 1H4WA 4B73A 1BOQA 1DM4B 3U8RH 1PQ7A 1BMAA 2P93A 2FO9A 3GOVB 3VXFH 1DUAA 2IJOB 1JMOH 1TONA 1V2PT 1E0FD 2XYAA 3SN8A 3S69A 1TGCA 2G00A 3STIA 2BZ6H 1PPZA 2FODA 1V2WT 3A82A 3QZQA 3CENA 1C5WB 1OWHA 4IGDA 1GHYH 3S9BA 2BDYA 1P11E 4J1YA 3MO6A 3HK6B 4ZUHA 2AGGX 3ZVEA 2ZP0H 2F91A 5F8XA 3NK8A 3LGUA 4ZKOU 1GI3A 3BSQA 2BD2A 4IC5A 1GL1A 1AVGH 3RUOA 2Z94A 3KQCA 4GCHG 3U98H 3ZV8A 2Y7XA 1UCYE 1HAIH 3DFJA 1O0DH 3M35A 2ZNKH 3DT0H 1W3CA 2BD5A 2GMTB 1AUTC 1BTXA 1QJ6B 2QYIA 1O2GH 2UUFB 2FWWA 4U01A 1EJAA 2PV9B 3VB6A 1THPB 2QXJA 2GZ9A 2BQ7B 2QAAA 2C4FH 1BRCE 1Q31A 3ENSB 1Y8TA 1SL3A 3T25A 1NT1A 2BY6X 1H9LB 1K1LA 1RD3B 1Y3YA 2NU3E 3PWCA 1D9IA 3BTTE 1C2GA 1Q2WA 3VXEH 1O2UA 2OCVB 1GJDB 3P8FA 2A32A 2FXRA 4TYDA 4ZROA 1BHXB 3V13A 1DVAH 3PWBA 4DVAU 1QL7A 1YCPM 4Q7XA 2ZZUH 4I33A 2VWOA 1D6WA 1HRTH 1FQ3A 3W94A 2ZGCA 4QT8C 3ATMA 2V0BA 2P95A 4FUHA 5LPFA 1TRMA 2O8WA 2GMTC 3V3MA 2BVRH 5IYTA 1HYLA 1O3DA 1O2KA 2HVXA 5BPEA 1RRKA 2XRCA 4ZXYH 3RXTA 1O3AA 1O5CB 5AFYH 2BDGA 1QB9A 3PB1E 2BX4A 1YPHE 1SOZA 3UOPA 2W3KA 4A7IB 4IS5A 2RA3A 4CRGA 1SGCA 2Y5FA 5I46H 4ISIH 3G01A 2HALA 2FOMB 4WVPE 2B7DH 2A7HA 1AD8H 5LPEA 4INLA 5GWZA 1UK4A 4CH8B 3A81A 2B9LA 4BXWA 4AGKA 3SV2H 1B7XB 3W95A 1DY8A 4OGXA 1HV7A 1UVUH 1FDPA 1O5BB 1C2DA 3A83A 3MNCA 3KL6A 2JH5D 2A7CA 3ZVFA 3A80A 4SGAE 1H8IH 4H6TA 1BTHH 1SGTA 2Q6FA 5FPTA 3V7TA 1P2JA 1MAYA 3K65B 1C5XB 1HJAB 4X8SH 1K1PA 5GJ4B 1SOTA 1HLTH 2SNVA 1ZGVA 1EATA 1EASA 3GCNA 2GZ8A 1L2EA 2WYJA 5HM9A 1PQ8A 4DOQA 1Y5AT 1MZDA 1P2OA 1V2VT 2GDEH 3SJIA 1Z1IA 3BG8A 1TBRH 1KDQA 1TGNA 1SI5H 3SO3A 3MU4A 4U30A 1JBUH 1P9UA 3TGIE 1F5KU 1NO9H 1HB0B 1P2KA 5DJ7A 1QCPA 3SI3H 1AFQB 4WJG2 1HBTH 4AFQA 4NIVA 1A1RA 3K2UA 3BF6H 2F9VA 2UUKB 4D9QA 2PUXB 1UVSH 1J14A 4XE4A 2ZGJA 1BTYA 1HFDA 1AQ7A 3TGJE 1FN6A 2V35A 4FVBA 2ZECA 3RMMH 3VPKA 3AW1A 1Z8JB 3ZZ3A 3GCTG 2WPMS 1A0LA 3AAVA 3C1KA 4UE7H 2ESTE 1C2EA 4AFUA 1UTMA 2VWLA 3A84A 2BY8X 2QXIA 1GBTA 1T4UH 4ABDA 4OS1A 1DICA 3BEUA 4DIIH 4R8TB 1CHGA 3KF2A 4MQAA 3VB3A 5JB8S 3SZNA 2WPJS 3NPSA 4HFPB 4ABGA 1NFYA 1XUFA 3KQEA 3NXPA 1WAYB 4NZLA 1W0YH 2GKVE 1BRBE 1K9OE 4ZH8A 2OUAA 2BX3A 3A88A 3LT3A 1ZTLA 1BQYA 1TA2A 3RM2H 1HNEE 2UWOA 1ZZZA 3T28A 1BTZA 5A8ZA 1NRSH 1N6YA 1Z6JH 2SGQE 4FU7A 5EPYA 1FY8E 3SQHE 1Z7KA 2ZDLA 3ESTA 4Y6DA 1MU8B 3SJ8A 2H6MA 2AERH 2GGVB 1ID5H 1KSNA 3ZVAA 1S84A 2F9UA 4O3TA 1FIZA 4B75A 2H5CA 1TMBH 1TNJA 1O2VA 1Z1JA 4DY7B 3B23B 2PUQH 2K1QA 1CT2E 3SU5A 4K60A 1H9HE 2G8TA 3MYWA 2VIOA 1E38B 4JZFH 5HMAA 1O5GH 2ZU4A 4CRBA 4BANB 4X6OA 1O3LA 2Z3EA 2M5TA 4JZ1A 4A1TA 4MPUA 5T6DA 1KY9A 1PPCE 1KXDA 2W5EA 5AF9H 3S7HB 2SGDE 1ZR0A 1XUHA 3MH6A 1ZJDA 1LPKB 1SGRE 1SHYA 1O2RA 2TPIZ 4D7GA 1V2UT 1DE7H 2EI6A 2GD4B 1RFNA 3VB4A 2WPLS 4ISOA 4D9RA 2BLWA 1TYNA 2ZFFH 3DFLA 5EW1H 1ANEA 3S9AA 1O3GA 3UR6A 3RXLA 4X1SU 2D26C 1YLCA 2WV5A 1EP6A 1PPGE 1GMDF 3TPIZ 3TVJB 1YCPH 2P94A 1VITH 1JRSA 4NG9H 1TPOA 5JBCS 1LVYA 2OC1A 1OSSA 1TABE 3HKJB 2FOBA 1EPTC 1YF4A 5EG4A 2NU1E 1C9PA 1OWJA 2FDAA 2ZFQH 1DPOA 3SORA 2VWMA 1GWAA 2J95A 4K69A 3RXIA 1PQAA 2A5AA 4ESTE 1T8OA 4HZHA 3F9EA 1ELVA 2ZTYA 1Y59T 3MNSA 4ASHA 4X2XA 3UY9A 4WY3A 4A1VA 1BBRE 1HAGE 1AB9C 1HCGA 2ZDMA 1NTPA 2PW8H 4AYVB 1RXPA 5C2ZA 1C9TA 4TY6A 1HAOH 2OBOA 3EAJA 1INCA 5EODA 3EYDA 3BIUH 3RXUA 1ETSH 2JH6D 2R9PA 2ZCKP 1QGFA 3RC4A 1DLEA 5F8TA 1PPBH 4LZ4B 5A0AE 4ISLA 5EGMA 1G3CA 3EQ0H 1FY3A 1LHEH 4ZMAH 3BTWE 1DANH 2BDHA 1ZTKA 2ZGBH 2GV7A 1AFEH 1K1OA 1GBMA 2AEIH 3SUFA 5A0BA 1MTWA 1TWXB 1THRH 2IN2A 3LH3A 3MMGA 5HGGA 1UK2A 2ODYB 5JYIA 1L1JA 2BDAA 4UDWH 3ODFA 1O3BA 4KGAA 3UIRA 1JWTA 1GI0A 2SFAA 4OS4A 1LMWB 3MNXA 1S6HA 4NSVA 2BD7A 2SGEE 3F9HA 5A8YA 1ZPZA 3ZZ5A 2THFB 3V0XA 1MD8A 2FZZA 1O2JA 2V3HH 2QC2A 2P16A 1G32B 1BCUH 4B74A 1O2HA 2NWNA 3MNBA 3P8OA 4OS2A 1G37A 3SGAE 1C5VA 1V2LT 2ZI2H 1DWDH 2AGIX 2FX4A 3A8CA 4ZKSU 1NY22 3GYLB 1AO5A 3SBKA 3F9GA 4FUIA 4MG3A 3U69H 1E34B 3QZRA 5PTPA 1O34A 3DD2H 1PQ5A 1CBWB 1A5GH 1GJ8B 2FS8A 2GT8A 2SGPE 4Y11E 1ZPCA 3K6ZA 1AWHB 4AFZA 2PLXA 3A7ZA 1F0SA 4CHAC 2P59A 2AH4X 1YPJH 2AIQA 1J16A 1YPGH 4I8GA 1FLEE 1NRQH 3RXFA 4OGYA 4MPVA 3HK3B 2R3UA 2A4OA 1SQAA 3LGTA 2GT7A 2G51A 1AI8H 1SLUB 1TMTH 1S82A 8ESTE 3PLBA 4YT6H 1MH0A 2YOLA 1MTSA 2BOKA 1UTKA 1V2NT 1OWDA 1S0QA 2D2DA 1ZMLA 4U32A 4XSKU 5HM2A 1IOEA 1GG6B 2W26A 2WINI 4X2WA 3MH5A 1W7XH 3JZ2B 1SGDE 2BD3A 3UWJH 4UFDH 3TJNA 1PJPA 2H9EH 5K7RA 1Z6EA 1IQGA 1A7SA 5DP7A 1QBNA 1XUIA 1V2JT 1OWIA 1V2KT 2FESH 1DY9A 2Y6TA 3D65E 5FCRA 4Y0YE 3U1IB 5EU8A 1SHHB 3MFJA 2PKAA 1RS0A 1KDQB 4RKJB 1GGDC 2ZC9H 1GBJA 1H1BA 1FUJA 3MHWU 2XC5A 5JBAS 1Z71A 3GY6A 1P2IA 1GJCB 2OBQA 4FVDA 1BUIA 1U6QA 4I8JA 1GMDG 2GV6A 1O2SA 2TBSA 2B0FA 2EC9H 2F83A 1GG6C 4WMFA 4X1NU 1IQLA 1CA8B 2VNTA 3B9FH 4ZKNU 3RLWH 3RXGA 2QF0A 1LHFH 3E8LA 1GJAB 1HAVA 4TPIZ 4YESB 1B0FA 1L1GA 1XX9A 2BB4A 1L4ZA 5L30H 2FIRH 1YP9A 4RKOB 4E06H 3OSYA 3SOSA 1GBKA 1ZSJA 1SLWB 1YBWA 1C2MA 2WPKS 4MPWA 2TGPZ 2W7SA 1SGFG 5C67A 1IQKA 3VB5A 1AU8A 1O2PA 2P8OB 2O9QA 5C3NA 2STAE 5AVDA 1GDNA 4A1XA 1GBDA 1W8BH 3AVZA 1IAUA 3MU8A 3SNEA 1O3CA 2SGAA 1SFQB 2TGDA 1V2TT 1EZUC 1FONA 1V3XA 1TQ0B 3GDUA 1QJ1B 1FZZA 1J9CH 1DSTA 2AMQA 2BDBA 1BMMH 2GDDA 1GCTC 1EJMA 4YZUA 4BTTB 1THSH 5DPAA 1P03A 1JIRA 5DP8A 3I77A 1SGYE 3FANA 3KCGH 4Z0KA 3PLPA 3LGYA 3S7KB 1FXYA 3RLYH 1WBGB 3BEFB 1GMCF 1TPSA 4IMQA 3BIVH 3MH4A 3LDXH 4BOHA 3OY5U 2QF3A 4BTUB 1Y3WA 4CRCA 3FFGA 1TBZH 3LC5A 2AGEX 2Y82A 3ZYEA 4J2YB 4CRDA 1FIWA 2ZIQH 3ITIA 4Y7AA 2VH0A 1LQEA 1GHBF 2PSXA 4NIXA 1AE5A 2HOBA 4WMDA 1TRNA 4X6NA 4BXSA 3FP6E 4Y7BA 3RXAA 3SNDA 1N6XA 3PMAB 1MBMA 2ASUB 4ZHMU 3RU4T 2CGAA 2BLVA 4AORA 2I6SA 4CH2B 3SJKA 3P92A 1NC6A 3R0FA 1CHOF 3RXBA 1ESAA 4ABEA 1K21H 2A1DB 2BDIA 3KGPA 4DW2U 2ZDNA 4GHTA 3EDXB 5L6NH 4UFFH 3FZZA 4MNVA 2GX4A 1C2KA 2IOTA 2XTTB 4IBLH 3RXKA 4B2AA 1DX5M 1D3QB 1TIOA 2WPHS 7LPRA 1C1RA 1D3TB 1W14U 1G2MA 2Z9LA 4HI3A 1OX1A 1SG8B 1UVOA 3NWUA 3C27B 4Y76A 4ABBA 1GHWH 1PPHE 4I8KA 4B76A 1AWFH 1O35A 2FYQA 3UREA 3ZZDA 3MU5A 4AG1A 1TB6H 4ZHAA 3PTBA 2VVVA 4YTAA 4X2VA 1GVKB 1S5SA 3TU7H 6GCHF 2O8TA 4AZ2B 4X0WU 4CBNA 1W12U 3O8CA 3UUZA 3P70B 2FP7B 2G5VA 2WYGA 1NU7B 2FOHA 3QO6A 2OC8A 3M5NA 4H4FA 3BTGE 4JZIA 1UCYH 1CE5A 1J15A 3P6ZB 1K1JA 3PROA 2FLRH 4DGJA 1G3BA 2ANMH 4JYUH 5IDKA 2XBVA 4GLYA 2H9HA 2A4RA 1GI1A 1MCVA 3E6PH 1IQFA 5DGJA 2QIQA 1ELFA 1CT4E 2RCEA 3MH7A 1TX7A 3CP7A 1C1UH 2Z9KA 2ZPRA 1FMGA 3SGQE 4NWKA 4LZ1H 1WUNH 2CF9H 7ESTE 1IQEA 1ELEE 1UMAH 4PROA 1DITH 3F6UH 2A45B 1F0RA 1TMUH 2EA3A 4X8TH 3NCLA 1JRTA 1ELBA 1BZXE 5TCAA 1QA7A 4I8LA 2LPRA 2PR3A 1HAZB 2VGCB 1ETRH 3MU1A 1C1TA 3E3TA 3SUEA 1S0RA 4AGJA 2NU4E 1Z8RA 2DE8A 2Z9JA 1TE0A 4WXIA 1QIXB 1VCQA 2C8WB 1SLVB 4UFGH 3GISB 1CO7E 2R2MB 3NZIA 1XVOA 2STBE 1P2QA 3LPRA 2BD9A 2FTMA 1OP0A 4MNXA 2EEKA 1ELGA 1SQTA 2JKHA 5JDUB 4B2BA 1DWBH 1F0TA 3QWCH 1C2FA 3L3TA 4X8VH 3RXCA 3SUGA 5A2MH 2BY9X 4INHA 4Y8YA 4E7NA 4M7GA 1HJAC 2WUCA 2OINA 5JBBS 1O2LA 3IITA 1HAXB 1MBQA 4FUDA 5DG6A 1ZHPA 1TOCB 1DT2A 2VGCC 2JH0D 4IW4E 2KAIA 4BAMB 1G3DA 1P06A 5DP5A 1DUEA 1P0SH 3Q77A 2ZA5A 1PFXC 1NM6A 2ZCHP 1FAKH 4D8NA 3RP2A 1SBWA 1YCPK 5HXFA 5EQQA 1BMLA 1UVPA 1P12E 3SV7A 1AFQC 2VJ1A 2XCNA 2QGRA 2AIPA 1TNHA 2BDCA 4NGAH 5DP9A 1HPGA 2Y7ZA 5HYOA 2A4GA 2PTNA 3RU4D 2CMYA 4DCDA 1YPLH 2OP9A 2UUJB 3OU0A 1NFUA 1GVZA 4BAOB 3ZZAA 5E0JA 3DA9B 3ZVBA 4BAKB 5E2PA 1BJVA 1GMCG 5C20A 4MPXA 1FPHH 2ZQ1A 1IQHA 2PTCE 1O5EH 2ANWA 1M9UA 1C5NH 1LHGH 4OS7A 1FV9A 1HAHH 1LTOA 1O2TA 1WQSA 1WU1A 3HGPA 3ZZ7A 2IPHA 1F2SE 1GHBG 1E36B 1OXGA 1XKAC 2BVSH 2H9TH 3O8RA 1LVBA 1QQ4A 2W3IA 3ZZ4A 1O33A 1WQVH 4NSYA 3AW0A 1GPZA 1RTKA 1TX6A 2PKAB 1CA0B 1ZTJA 2R3YA 2PKSB 2ZTZA 3ZVDA 3ODDA 4IMZA 1AZZA 1QR3E 1CHOG 4NA7A 1YC0A 1MTVA 4Y8XA 1SR5C 5C1YA 4WWYA 2ZF0H 1ANBA 5GIBA 2A7JA 5F03A 2QA9E 5SGAE 2F9OA 2BQ6B 1OYQA 1WTGH 4VGCB 2ZPSA 1F92A 1RJXB 3M61U 3M7TA 1HAVB 1C5RA 2F3CE 1NROH 4IN2A 3S0NA 3QLPH 3SJ9A 3BG4B 3RXRA 4UFEH 1XUGA 3EE0B 3WY8A 4X1RU 1AVWA 4A92A 1VGCB 1LKBA 3SHCH 2OTVA 3IG6B 4HTCH 2PKSC 2HPPH 1ZJKA 2FEQH 2ODPA 3BTKE 1GBBA 3RMLH 1CGHA 5FPYA 3SJOA 1KXEA 1E35B 3PM3A 1YKTA 1UTJA 1ORFA 3LGWA 2H1UA 6GCHG 1EP5A 3A7XA 1ZGIA 4ABFA 1UTPA 2FS9A 3K6YA 4ZXXH 3UNRA 2FOFA 3PYHA 2Z3CA 3VGCB 5JPMH 1EKBB 1GMHF 4DJZB 1LO6A 4DURA 1KLJH 2PWXA 1WTHD 1N8OB 2QCYA 1MU6B 1GBAA 2AMPA 5T6FA 4FUJA 1P02A 2CHAB 4XBBA 3BG4C 1BHXF 1EQ9A 2ZHDA 1ZHMA 4FXGH 1ZPBA 3FAOA 1BIOA 3K9XB 1RTLA 1XMNB 2VB0A 1VGCC 2A4QA 3BV9B 3HKIB 3P17H 4X1QU 1P05A 4A5TS 1C1QA 1W11U 2Y81A 2R0KA 4E7RG 1F0UA 2DUCA 1ZLRA 5C1XA 2OLGA 2BVXH 1O2NA 5EQSA 2XWAA 4UD9H 2Y5HA 1NZQH 2XCFA 3TNTA 2QV1A 4XBCA 3TH4H 2VU8E 3A7YA 1O2IA 5ESBA 1CT0E 3T26A 1GDUA 4Y0ZE 2DE9A 4NIYA 2AYWA 1S81A 3GCOA 3U9AH 2ZO3H 4BNRA 4MTBA 4K1SA 2VVCA 1HXFH 2ZHFH 1EAUA 6ESTA 2UUYA 2GCTB 2ZEBA 1A4WH 1C1MA 1LVOA 1SQOA 1DDJA 2CHAC 5A8XA 2ALVA 1OKXA 1C5SA 2FOCA 3TIUA 4XOJA 1BBRH 1DXWA 3QTVH 2ZFPH 1QQUA 4ZAEA 1YPMH 1EAWA 1O30A 1C5PA 5F8ZA 2TGTA 3RC5A 3KQDA 1LKAA 3U8OH 2AS9A 4FUEA 1QRZA 1GBFA 2YNAA 1VCWA 4KKDA 2C3SA 2FOEA 4TPYA 1BA8B 3SHAH 1W7GH 1ELAA 2HRVA 1C1SA 1FY4A 1C5OH 3OX7U 3T29A 4YOGA 1F5RA 5A0CA 1HJ8A 2B5TB 1EOJA 3T5FH 2J9NA 2ILNA 4CRFA 3QN7A 1ABIH 2FPZA 4K8YA 3I29A 3BTME 2GCTC 1OS8A 5DP6A 1Y5UT 4ABHA 3Q3YA 2XC0A 4CR9A 1OWEA 1FY1A 4ABJA 1SGIB 3HGNA 2OQ5A 2CV3A 2V6NA 1H9IE 1GHXH 3P8GA 2ODQA 3VFEA 3F68H 1HAPH 1DFPA 1A3BH 1TPAE 3TGKE 4TY7A 1YM0A 5DO4H 4YM9A 4I7YH 1DOJA 1K22H 1O37A 1NESE 3EGKH 3UOUA 1GI5A 1V2MT 1C5TA 4X2YA 1O36A 1TNIA 2ZGHA 3PV4A 3TK9A 1T8MA 5JBTA 5AFZH 1BJUA 1CVWH 1FAXA 5ETXA 8GCHF 3ATLA 3L6PA 1EZXC 1HAYB 3M5MA 1CU1A 3A7TA 1QA0A 4K3JA 1CBWC 1O5DH 1DXPA 3ZVGA 6LPRA 2P3TB 4O03A 1Y3VA 5H4IB 3LJJA 3B8JA 2V3OH 3RXOA 1O3EA 2PSYA 2QY0B 3SV8A 1O2YA 3TH2H 4CR5A 2RG3A 1PPEE 7KMEH 1NU9A 4JK6A 1GJ6A 3SNAA 1QL9A 3BTHE 1B5GH 1OOKB 5CHAB 2GZ7A 1O2XA 2HGTH 1C5QA 3S9CA 4Y79A 2F9NA 1MMJN 3KIDU 3O8BA 3TH3H 3STJA 1AGJA 5LGOA 1O3JA 2XXLA 4JYVH 1TA6A 5EW2H 4K1TA 4YOIA 3RXMA 1OYTH 3BN9A 3LIWA 1C5YB 1EB1H 4RN6A 4AB8A 3Q00A 2FI5E 3M7QA 4Q7ZA 1TGTA 1SGQE 1XKBC 3Q3XA 3ELAH 3OYPA 4LXBH 2VH6A 1Q3XA 2SNWA 3PO1B 1TOMH 2BOHB 3H5CB 1KXAA 1ARBA 4BAQB 2OQUA 3ZZ6A 1TX8A 3BTFE 5L2ZH 2A2QH 5E2OA 1ARCA 2NU2E 2FI4E 3OTJE 1GBLA 4Y10E 5CHAC 3QGJA 4I8HA 2KAIB 2G4UA 3UNQA 2G55A 1C1PA 3A86A 1MCTA 2H2ZA 3TK6A 2O8LA 4CBOA 3VEQB 2FLBH 3H7OA 2I6QA 1HGTH 1OP2A 2FOAA 1C5MD 3RXSA 2VIQA 1OWKA 1D4PB 3RXEA 3UQOA 5EQRA 1F5LA 1LDTT 2ZPQA 1VITF 3MU0A 2CF8H 1GMHG 3PO1C 1UTOA 1D3DB 1G9IE 3GCHB 4CREA 4WH6A 3D23A 4U2WA 2XC4A 4KTSA 2ZHEH 1BRUP 3M3VA 3E16B 1QBVH 2H5DA 2O8UA 2QN5T 3E1XB 1TNGA 1GBIA 2VIWA 4B1TA 1SGPE 1AKSA 1AY6H 1O38A 3EA9A 2BLOA 1QY6A 2BLQA 3CS7A 1LPGB 3GY7A 3P95A 1MQ6A 3HPTB 3A7VA 1VCPA 2Z3DA 1XM1A 3TJUA 3ATWA 2P8OC 1TGBA 2YNBA 2Z7FE 4H42U 9ESTA 1UCYK 3EA7A 1MD7A 3SUDA 1ZRKA 1KIGH 1X7AC 1UHBA 2BYAX 1VJ9U 1NPMA 1KXCA 1XXFA 4GVUA 3URDA 1T4VH 3MO9A 4K2YA 4B71A 4Z6AH 1BTWA 1HIAA 1KXBA 1ACBE 3FP7E 3RU4E 3SI4H 3LC3A 3GCHC 3TJVA 3SU6A 4FU8A 2A2XH 2BD4A 2FI3E 3SGBE 4LK4A 2BXTH 3PTNA 1H8DH 5J4QA 5GCHF 3KN2A 1IQNA 1O32A 2C8YB 4Q80A 3P8NA 2Y80A 5J4SA 2FOGA 2ANKH 4JZDH 2QXGA 1O3FA 2ZWLH 3AASA 3SU4A 4YLUA 1O3PB 1G3EA 4AB9A 4FUGA 3D49H 1FI8A 2GCHF 2HNTC 3UWIA 1L0ZA 1GHVH 4NZQA 2QXHA 1ELCA 4FUBA 4OS6A 3BTDE 3MOCA 3O8DA 4IN1A 2VIPA 1GI4A 2WPIS 3T27A 1ZMNA 2XBWA 1P57B 3N7OA 4THNH 5E8EH 1BTPA 5A09A 1G36A 3ATIA 1GHAF 3TNSA 5C5OA 1GI6A 1K2I1 1T8LA 4ZHLU 2WV4A 1MKXK 1AE8H 1C4V2
chains in the Genus database with same CATH superfamily
3UTUH 1RGQA 1C1OA 3M5OA 1V2ST 4O3UA 1F7ZA 1O3HA 2ZDVH 2AFQB 5FAHA 4NCYA 1FN8A 4NWLA 3KEEA 1AZ8A 1BMNH 1QL8A 5CE1A 1ZMJA 1GI7B 2ZGXH 3KQBA 1YYY1 3SU2A 4NA8A 2GVFA 1FJSA 2Q1JA 2C8ZB 3PV2A 1YLDA 2LELA 2O8MA 2ZHQH 2GTBA 3A87A 8GCHG 2ULLA 1GCDA 1O2ZA 1V2OT 1SVPA 3A85A 1G30B 2XNIA 3MWIU 1N1LA 3QUMP 2OD3B 4HGCA 1TNLA 1A2CH 1C2JA 3A8BA 6CHAB 1PYTC 1SPJA 1C4U2 3JZ1B 4ABIA 5FBEA 1EAIA 1A5IA 3M3SA 4WH8A 2EQNA 3PRBA 3R3GB 4FUFA 3RDZA 2LP6A 5DP4A 2UWPA 3PMHB 4LOYH 1FPCH 1BB0B 1EB2A 1QNJA 2Y5GA 2G81E 4I31A 5EXLA 2IPQX 4D76A 2D1JA 2TGAA 4K1EA 4DIHH 1RIWB 1A0JA 1AMHA 1VZQH 2KM0A 4KELA 4CRAA 5FPSA 1TPPA 1A46H 2R0LA 1BMFD 2F9BH 1QRXA 3KNXA 1NFWA 1O5AB 1KLTA 2C90B 3GY2A 1GDQA 2ZG0H 4YO9A 3M5LA 1S6FA 2VIDA 1KTSB 4X6MA 3UQVA 2ZFSA 1ANCA 1C5UA 1DSUA 1T7CA 1J17T 1ZOMA 1O39A 1ZYOA 1XXDA 4AG2A 2TIOA 4IC6A 6CHAC 4ABAA 1NRPH 4F48B 3SV6A 3DSPA 4ISNA 4NA9H 1S83A 1SSXA 1MKXH 5GDSH 1WOFA 3TK5A 2EI7A 5E0GA 2FYRA 4NFEA 4UEHH 1O3KA 3TITA 2XW9A 5EXMA 4X8UH 3HATH 1GBHA 1SGNE 3A8DA 3QDZB 3QK1A 1JXPA 3UNSA 1RIWC 5JB9S 1O2OA 2AMDA 1C2IA 3SU3A 1IQJA 2SGFE 3SNBA 3ZZBA 1Y3XA 1C1NA 1HXEH 2PGQB 4ZKRU 2Z9GA 2ZKSA 2J94A 1TFXA 2ZU2A 4UONA 3GDSA 1QFKH 1YPHC 3ZV9A 2PHBA 1IQIA 1VITG 5E0HA 1PPFE 1FX0B 1P3CA 1P3EA 3NKKA 1EZQA 1D6RA 2WUBA 3D62A 1MAXA 3FOAA 2Q6GA 4MNWA 1SB1H 2Z9IA 3Q76A 2P3FH 1DS2E 4GHQA 2HVYB 3EA8A 3GDVA 3M3TA 2A5KA 2VWNA 1YGCH 1SQRA 1MTUA 4XBDA 2HPQH 1GJ5H 1PYTD 2ZDKA 1UVTH 4OS5A 3GY3A 4AX9H 1Y3UA 4JYTA 1O2WA 4MLFB 1P8VC 5EPNA 4A6LA 4NIWA 1LQDB 2ALPA 1P09A 2A31A 4M9FA 5K0HA 1AVXA 3GICB 2ZU5A 2FM2A 5DSFA 1C4Y2 3SW2B 1GHZA 2FMJA 1BITA 1MKWK 2BTCE 1KLIH 3M7UA 4BAHB 1CGIE 2G52A 3RXVA 5EJLA 4X1PU 4YOJA 5CMXH 4F49A 3E0PB 1YPKH 4MDSA 1EUFA 1A5HA 4DT7B 2ZHWH 3V12A 3CS0A 2CXVA 4GSOA 4DG4A 1UTLM 5GCHG 4X6PA 2HWLB 3M36A 4YLQH 3SU0A 1HUTH 3RXQA 1MQ5A 3PMBB 2K8IA 2Q6DA 1EPTB 5F6MA 1O3OA 3SV9A 1K28D 1QURH 2QF4A 1GBCA 3MI4A 3RXPA 3NRLA 1LCYA 1Z8IB 2P3UB 1AUJA 1GVLA 4WXVA 2GCHG 4MNYA 1EAXA 1ESTA 2OC0A 3GYMA 3OY6U 4AN7A 3DSGA 5C1UA 1SGFA 1SFIA 2HNTF 3LGIA 3Q3KA 1K1MA 5AHGH 1W2KH 3A7WA 2BXUH 1AN1E 1O3NA 3SNCA 1AB9B 1L1NA 5DKMA 4H6SB 4ISHH 1BBRK 5GXPA 1CA0C 3VB7A 1GHAG 1C1WH 1V2RT 2BM2A 2Z6BD 5LPRA 1V2QT 3UPEA 3A8AA 7GCHF 2GP9B 1TQ7B 5ABWA 4MVNA 2G4TA 5TJXA 1K1IA 1A61H 3ZZ9A 1C5LH 4WF8A 1O2QA 3LJOA 2OC7A 2BHGA 4TWWA 1LHDH 4KTCA 3GY8A 1QBOA 3LGVA 1FNIA 3PMJA 1P04A 1CQQA 2J2UA 1TALA 2CJIA 2ZCLP 3F1SB 3AAUA 1WSSH 5FX6A 5G4BA 3N7EA 5EOKA 4VGCC 4Q2KA 4R0IA 3SZEA 4O97A 1MKWH 2R2WU 1V6DA 4Y71A 4JCNA 1P01A 2B8OH 3T2NA 3E90B 3FZDA 1NRRH 3E91A 1P2NA 1OP8A 1AKSB 1EXFA 1LHCH 3A89A 1W10U 1XVMA 4YT7H 2ANYA 1Z8GA 2EI8A 3GY4A 3KHVA 1C5ZB 3OEHD 1EZSC 1ZRBA 3UR9A 1UK3A 2XBXA 1Y5BT 4INKA 1MUEB 1MZAA 3BEIB 2J38A 3LONA 1SC8U 1UHBB 3URCA 1DWCH 2VVUA 3GY5A 4Z1MD 1AIXH 2ZU1A 3PLKA 3LH1A 4KTUA 3VGCC 1ELDE 1HIAB 1QTFA 5ESTE 1BDAA 1S6LA 2ZFTA 2BMGB 5FBIA 3L33A 1KTTB 2NU0E 2XBYA 2J34A 2L6OA 4GPGA 1C2LA 3FP8E 1N8OC 2C8XB 5T3HA 4XDEA 1TRYA 1QRWA 1UTQA 4TWYA 3ZVCA 5L2YH 4GAWA 1SGEE 3I78A 3LOXA 1IHSH 1GJBB 1E37B 1O5FH 2CN0H 8LPRA 3SQEE 1G2LA 4GCHF 5FHTA 3UB0A 1BRAA 4I86A 1EX3A 2A5IA 1TLDA 1QB1A 1BTUA 1EJNA 1GI2A 5T6GA 3RMNH 1GBEA 4NFFA 2FX6A 2W7UA 2HLCA 1HJ9A 2ZU3A 1DWEH 2VINA 3QGNB 3T62A 5LH8A 5F53A 1P2MA 1GJ9B 1GL0E 4CHAB 5C5NA 5I25A 3MTYA 5B6OA 5GPIB 4JZEH 3SU1A 3TJOA 1EOLA 1KXFA 1TGSZ 1UJ1A 3MO3A 3F9FA 1XUJA 1J8AA 4GUXA 1ZSKA 1D3PB 3ATKA 1ZHRA 2XWBI 1L4DA 1JOUB 2RA0A 1LPZB 1K1NA 2C93B 2A0QB 1TNKA 2KFWA 3RM0H 3RC6A 4F4OC 5TCCA 4WMEA 4D7FA 2PP6A 2F9PA 1ABJH 3TLOA 1O3IA 2VIVA 3QX5H 1DLKB 4E05H 1GI9B 4K8BA 4I32A 4TT3D 1C2HA 2ZFRH 1NS3A 1OPHB 1QJ7B 1T8NA 1ELTA 3RMOH 1JIMA 1GGDB 1P10A 4SGBE 4JK5A 1EFRD 3UFAA 3NUMA 1AHTH 3E0NB 5B6LA 4O9VA 2ZDAH 2ZTXA 1NFXA 2PGBB 2QE7D 4B2CA 3LU9B 1C1VH 2KCYA 3ZZ8A 1ZSLA 2TRMA 3RXHA 5BRRE 1YPEH 1A0HB 1FY5A 4AFSA 1TBQH 3FVFB 3U1JB 1MTNB 1CSOE 1IQMA 5C0TA 2JETB 4K5ZA 1WV7H 1ANDA 1UO6A 1UTNA 3ZYDA 1W0KD 4KP0A 8KME2 3RXJA 1GI8B 3U8TH 1IHTH 1EPTA 5EXNA 9LPRA 2ZQ2A 3IWMA 3KYGA 1RTFB 3ZZCA 1QHRB 4FUCA 1O31A 1P9SA 2EY4C 2PFEA 2UWLA 4AYYB 3DCLA 2BY5X 4XFQA 2JJ1D 3BTQE 2BZAA 1TAWA 1NN6A 3QTOH 1ESBA 2D8WA 2FTLE 2BQWB 1LVMA 1VJAU 2LNCA 4JMYA 1XUKA 1T31A 3OEED 2RDLA 1MTNC 5DP3A 1W0ZU 5FXLA 1SMFE 2J4IA 2OXSA 1WCZA 1SLXB 7GCHG 2JETC 4RSPA 3BTEE 3W1EA 1A3EH 4Y8ZA 1GCTB 1BT7A 1B0EA 4BTIB 5FCKA 3LKWA 4DT4A 1KYNA 1NRNH 2J92A 1W13U 2HNTE 2G5NA 3GCTF 1QB6A 1CGJE 3DHKH 1S85A 5DK1A 4AOQA 1VR1H 1GJ7B 3GS9A 1WYKA 1O3MA 3DUXH 5FX5A 1ETTH 1HDTH 3RXDA 4FU9A 1T32A 1O2MA 1GJ4H 2BY7X 2F43B 3M37A 2BD8A 3H7TA 4Q7YA 1H4WA 4B73A 1BOQA 1DM4B 3U8RH 1PQ7A 1BMAA 2P93A 2FO9A 4P00A 3GOVB 3VXFH 3UAIC 1DUAA 2IJOB 1JMOH 1TONA 1V2PT 1E0FD 2XYAA 3SN8A 3S69A 1TGCA 2G00A 3STIA 2BZ6H 1PPZA 2FODA 2XNDD 1V2WT 3A82A 3QZQA 3CENA 4P02A 1C5WB 1OWHA 4IGDA 1GHYH 3S9BA 2BDYA 1P11E 4J1YA 3MO6A 3HK6B 4ZUHA 2AGGX 3ZVEA 3SYJA 2ZP0H 2F91A 5F8XA 3NK8A 3LGUA 4ZKOU 1GI3A 3BSQA 2BD2A 4IC5A 1GL1A 1AVGH 3RUOA 2Z94A 3KQCA 4GCHG 3U98H 3ZV8A 2Y7XA 1UCYE 1HAIH 3DFJA 1O0DH 3M35A 2ZNKH 2GJGA 3DT0H 1W3CA 2BD5A 2GMTB 1AUTC 1BTXA 1QJ6B 2QYIA 1O2GH 2UUFB 2FWWA 4U01A 1EJAA 2PV9B 3VB6A 1THPB 2QXJA 2GZ9A 2BQ7B 2QAAA 2C4FH 1BRCE 1Q31A 3ENSB 1Y8TA 1SL3A 3T25A 1NT1A 2BY6X 1H9LB 1K1LA 1RD3B 1Y3YA 2M2AA 2NU3E 3PWCA 1D9IA 3BTTE 1C2GA 1Q2WA 3VXEH 1O2UA 2OCVB 1GJDB 5KECA 3P8FA 2A32A 2FXRA 4TYDA 4XD7D 4ZROA 1BHXB 3U28C 3V13A 1DVAH 5FL7D 3PWBA 4DVAU 1QL7A 1YCPM 4Q7XA 2ZZUH 4I33A 2VWOA 1D6WA 1HRTH 1FQ3A 3W94A 2ZGCA 4QT8C 3ATMA 5C0UA 2V0BA 2P95A 4FUHA 5LPFA 1TRMA 2O8WA 2GMTC 3V3MA 2BVRH 5IYTA 1HYLA 1O3DA 1O2KA 2HVXA 5BPEA 1RRKA 2XRCA 4ZXYH 3RXTA 1O3AA 1O5CB 5AFYH 2BDGA 1QB9A 3PB1E 2BX4A 1YPHE 1SOZA 3UOPA 2W3KA 4A7IB 4IS5A 2RA3A 4CRGA 1SGCA 2Y5FA 5I46H 2QF5A 4ISIH 3G01A 2HALA 2FOMB 4WVPE 2B7DH 2A7HA 1AD8H 5LPEA 4INLA 5EJ1A 5GWZA 1UK4A 4CH8B 3A81A 2B9LA 4BXWA 4AGKA 3SV2H 1B7XB 3W95A 1DY8A 4OGXA 3WWBA 4B6FA 1HV7A 1UVUH 1FDPA 1O5BB 1C2DA 3A83A 3MNCA 3KL6A 2JH5D 2A7CA 3ZVFA 3A80A 4SGAE 1H8IH 4H6TA 1BTHH 1SGTA 2Q6FA 5FPTA 3V7TA 1P2JA 1MAYA 3K65B 1C5XB 1HJAB 4X8SH 1K1PA 5GJ4B 1SOTA 1HLTH 2SNVA 1ZGVA 1EATA 1EASA 3GCNA 2GZ8A 1L2EA 2WYJA 5HM9A 1PQ8A 4DOQA 1Y5AT 1MZDA 1P2OA 1V2VT 2GDEH 3SJIA 1Z1IA 3BG8A 1TBRH 1KDQA 1TGNA 1SI5H 3SO3A 3MU4A 4U30A 1JBUH 1P9UA 3TGIE 5EJZA 1F5KU 1NO9H 1HB0B 1P2KA 5DJ7A 1QCPA 3SI3H 1AFQB 4WJG2 1HBTH 4AFQA 4NIVA 1A1RA 3K2UA 3BF6H 2F9VA 2UUKB 4D9QA 2PUXB 1UVSH 1J14A 4XE4A 2ZGJA 1BTYA 1HFDA 1AQ7A 3TGJE 1FN6A 2V35A 4FVBA 2ZECA 3RMMH 3VPKA 3AW1A 1Z8JB 3ZZ3A 3GCTG 2WPMS 1A0LA 3AAVA 3C1KA 4UE7H 2ESTE 2KX4A 1C2EA 2AHME 4AFUA 1UTMA 2VWLA 3A84A 3N99A 2BY8X 2QXIA 1GBTA 1T4UH 4ABDA 4OS1A 1DICA 3BEUA 4DIIH 4R8TB 1CHGA 3KF2A 4MQAA 3VB3A 5JB8S 3SZNA 2WPJS 3NPSA 4HFPB 4ABGA 1NFYA 1XUFA 3KQEA 3NXPA 1WAYB 4NZLA 1W0YH 2GKVE 1BRBE 1K9OE 4ZH8A 2OUAA 2BX3A 3A88A 3LT3A 1ZTLA 1BQYA 1TA2A 3RM2H 1HNEE 2UWOA 1ZZZA 3T28A 1BTZA 5A8ZA 1NRSH 1N6YA 1Z6JH 2SGQE 4FU7A 5EPYA 1FY8E 2YMSB 3SQHE 1Z7KA 2ZDLA 3ESTA 4Y6DA 1MU8B 3SJ8A 2H6MA 2AERH 2GGVB 1ID5H 1KSNA 3ZVAA 1S84A 2F9UA 4O3TA 1FIZA 4B75A 2H5CA 1TMBH 1TNJA 1O2VA 1Z1JA 4DY7B 3B23B 2PUQH 2K1QA 1CT2E 3SU5A 4K60A 1H9HE 2G8TA 3MYWA 2VIOA 1E38B 4JZFH 5HMAA 1O5GH 2ZU4A 4CRBA 4BANB 4X6OA 1O3LA 2Z3EA 2M5TA 4JZ1A 4A1TA 2WV9A 4MPUA 5T6DA 1KY9A 1PPCE 1KXDA 2W5EA 5AF9H 3S7HB 2SGDE 1ZR0A 1XUHA 3MH6A 1ZJDA 1LPKB 1SGRE 1SHYA 1O2RA 2TPIZ 4D7GA 1V2UT 1DE7H 2EI6A 2GD4B 1RFNA 1YLNA 3VB4A 2WPLS 4ISOA 4D9RA 2BLWA 1TYNA 2ZFFH 3DFLA 5EW1H 1ANEA 3S9AA 1O3GA 3UR6A 3RXLA 4X1SU 2D26C 1YLCA 2WV5A 1EP6A 2KR7A 1PPGE 1GMDF 3TPIZ 3TVJB 1YCPH 2P94A 1VITH 1JRSA 4NG9H 1TPOA 5JBCS 1LVYA 2OC1A 1OSSA 1TABE 3HKJB 2FOBA 1EPTC 1YF4A 5EG4A 2NU1E 1C9PA 1OWJA 2FDAA 2ZFQH 1DPOA 3SORA 2VWMA 1GWAA 2J95A 4K69A 2JDID 3RXIA 1PQAA 2A5AA 4ESTE 1T8OA 4HZHA 3F9EA 1ELVA 2ZTYA 1Y59T 3MNSA 4ASHA 4X2XA 5CHBA 3UY9A 4WY3A 4A1VA 1BBRE 1HAGE 1AB9C 2KZ4A 1HCGA 3FN8A 2ZDMA 1NTPA 2PW8H 4AYVB 1RXPA 5C2ZA 3PRDA 2HLDD 1C9TA 2KCPA 4TY6A 1HAOH 2OBOA 3EAJA 1INCA 5EODA 3EYDA 3BIUH 3RXUA 1ETSH 2JH6D 2R9PA 2ZCKP 1QGFA 3RC4A 1DLEA 5F8TA 1PPBH 4LZ4B 5A0AE 4ISLA 5EGMA 5DN6D 1G3CA 3EQ0H 1FY3A 1LHEH 4ZMAH 3BTWE 1DANH 2BDHA 1ZTKA 2ZGBH 2GV7A 1AFEH 1K1OA 1GBMA 2AEIH 3SUFA 4YXWD 1MTWA 1TWXB 5A0BA 1THRH 2IN2A 3LH3A 3MMGA 5HGGA 1UK2A 2ODYB 5JYIA 1L1JA 2BDAA 4UDWH 3N7DA 3ODFA 1O3BA 4KGAA 3UIRA 1JWTA 1GI0A 2SFAA 4OS4A 1LMWB 3MNXA 2WPDD 3CNRA 1S6HA 4NSVA 2BD7A 1UW7A 2SGEE 3F9HA 5A8YA 1ZPZA 3ZZ5A 2THFB 1E1QD 3V0XA 1MD8A 2FZZA 1O2JA 2V3HH 2QC2A 2P16A 1G32B 1BCUH 4B74A 1O2HA 2NWNA 3MNBA 3P8OA 4OS2A 1G37A 3SGAE 1C5VA 1V2LT 2ZI2H 1DWDH 2AGIX 2FX4A 5IK2D 3A8CA 4ZKSU 1NY22 3GYLB 1AO5A 3SBKA 3F9GA 4FUIA 4MG3A 3U69H 1E34B 1NBMD 3QZRA 5PTPA 1O34A 3DD2H 1PQ5A 1CBWB 1A5GH 1GJ8B 2FS8A 2GT8A 2SGPE 4Y11E 1ZPCA 3K6ZA 4RT0A 1AWHB 4AFZA 2PLXA 3A7ZA 1F0SA 4CHAC 2P59A 2AH4X 1YPJH 2AIQA 1J16A 1YPGH 4I8GA 1FLEE 1NRQH 3RXFA 4OGYA 4MPVA 3HK3B 2R3UA 2A4OA 2J98A 1SQAA 3LGTA 2GT7A 2G51A 1AI8H 1SLUB 1H8HD 1TMTH 1S82A 8ESTE 3PLBA 4YT6H 1MH0A 2YOLA 1MTSA 2BOKA 1UTKA 1W0JD 1V2NT 1OWDA 1S0QA 2D2DA 1ZMLA 4U32A 4XSKU 5HM2A 1IOEA 1GG6B 2W26A 2WINI 4X2WA 3MH5A 1W7XH 5CDFE 3JZ2B 1COWD 1SGDE 2BD3A 3UWJH 4UFDH 3TJNA 1PJPA 2H9EH 5K7RA 1Z6EA 1IQGA 1A7SA 5DP7A 1QBNA 1XUIA 1V2JT 1OWIA 1V2KT 2FESH 1DY9A 2Y6TA 2K0QA 3D65E 5FCRA 4Y0YE 3U1IB 5EU8A 1SHHB 3MFJA 2PKAA 1RS0A 1KDQB 4RKJB 1GGDC 2ZC9H 1GBJA 1H1BA 1FUJA 3MHWU 2XC5A 5JBAS 5C94A 1Z71A 3GY6A 1P2IA 1GJCB 2OBQA 2J97A 4FVDA 1BUIA 1U6QA 4I8JA 1GMDG 2GV6A 1YY3A 1O2SA 2TBSA 1VKYA 2B0FA 2EC9H 2F83A 1GG6C 4WMFA 4X1NU 1IQLA 1CA8B 2VNTA 3B9FH 4ZKNU 3RLWH 3RXGA 2QF0A 1LHFH 3E8LA 1GJAB 1HAVA 4TPIZ 4YESB 1B0FA 1L1GA 1XX9A 2BB4A 1L4ZA 5L30H 2FIRH 1YP9A 4RKOB 4E06H 3OSYA 3SOSA 1GBKA 1ZSJA 1SLWB 1YBWA 1C2MA 2WPKS 4MPWA 2TGPZ 2W7SA 1SGFG 5C67A 1IQKA 3VB5A 1AU8A 1O2PA 2P8OB 2O9QA 5C3NA 2STAE 5AVDA 1GDNA 4A1XA 1GBDA 1W8BH 3AVZA 1IAUA 3MU8A 3SNEA 1O3CA 2SGAA 1SFQB 2TGDA 1V2TT 2XOKD 1EZUC 1FONA 1V3XA 1TQ0B 3GDUA 1QJ1B 1FZZA 1J9CH 1DSTA 2AMQA 2BDBA 1BMMH 2GDDA 3H09A 1GCTC 1EJMA 4YZUA 4BTTB 1THSH 5DPAA 1P03A 1JIRA 5DP8A 3I77A 1SGYE 3FANA 3KCGH 4Z0KA 3PLPA 3LGYA 2IJD1 3S7KB 1FXYA 3RLYH 1WBGB 3BEFB 3F0OA 1GMCF 1TPSA 4IMQA 3BIVH 3MH4A 3MQKC 3LDXH 4BOHA 3OY5U 2QF3A 4BTUB 1Y3WA 4CRCA 3FFGA 1TBZH 3LC5A 2AGEX 2Y82A 3ZYEA 4J2YB 4CRDA 1FIWA 2ZIQH 3ITIA 4Y7AA 2VH0A 1LQEA 1GHBF 2PSXA 4NIXA 1AE5A 2HOBA 4WMDA 1TRNA 4X6NA 4BXSA 3FP6E 4Y7BA 3RXAA 3SNDA 1N6XA 3PMAB 1MBMA 3OAAD 2ASUB 4ZHMU 3RU4T 2CGAA 2BLVA 4AORA 2I6SA 4CH2B 3SJKA 3P92A 1NC6A 3R0FA 1CHOF 3RXBA 1ESAA 4ABEA 1K21H 2A1DB 2BDIA 3KGPA 4DW2U 2ZDNA 4GHTA 3EDXB 3PV5A 5L6NH 4UFFH 3FZZA 4MNVA 2GX4A 1C2KA 2IOTA 2XTTB 4IBLH 3RXKA 4B2AA 1DX5M 1D3QB 1TIOA 2WPHS 7LPRA 1C1RA 4ACBA 1D3TB 1W14U 1G2MA 2Z9LA 4HI3A 1OX1A 1SG8B 1UVOA 3NWUA 3C27B 4Y76A 4ABBA 1GHWH 1PPHE 4I8KA 4B76A 1AWFH 1O35A 2FYQA 3UREA 3ZZDA 3MU5A 4AG1A 1TB6H 4ZHAA 3PTBA 2VVVA 4YTAA 4X2VA 1GVKB 1S5SA 3TU7H 6GCHF 2O8TA 4AZ2B 4Q63A 4X0WU 4CBNA 1W12U 5KEDA 3O8CA 3UUZA 3P70B 2FP7B 2G5VA 2WYGA 1NU7B 2FOHA 4ZCNA 3QO6A 2OC8A 3M5NA 4H4FA 3BTGE 4HG6A 4JZIA 1UCYH 1CE5A 1J15A 3P6ZB 1K1JA 3PROA 2FLRH 4DGJA 2RFKC 1G3BA 2ANMH 4JYUH 5IDKA 2XBVA 4GLYA 2H9HA 2A4RA 1GI1A 1MCVA 3E6PH 1IQFA 5DGJA 2QIQA 1ELFA 1CT4E 2RCEA 3MH7A 1TX7A 3CP7A 1C1UH 2Z9KA 2ZPRA 1FMGA 3SGQE 4NWKA 4LZ1H 1WUNH 2CF9H 7ESTE 1IQEA 1ELEE 1UMAH 4PROA 1DITH 3F6UH 2A45B 1F0RA 1TMUH 2EA3A 4X8TH 1K0HA 3NCLA 1JRTA 1ELBA 1BZXE 5TCAA 1QA7A 4I8LA 2LPRA 2PR3A 1HAZB 5HIYA 2VGCB 1ETRH 3MU1A 1C1TA 3E3TA 3SUEA 1S0RA 4AGJA 2NU4E 1Z8RA 2DE8A 2Z9JA 1TE0A 4WXIA 2W6ID 1QIXB 1VCQA 2C8WB 1SLVB 4UFGH 3GISB 1CO7E 2R2MB 4XRNA 3NZIA 3OE7D 1XVOA 2STBE 1P2QA 3LPRA 2BD9A 5KGOA 2FTMA 1OP0A 2V7QD 4MNXA 2EEKA 1ELGA 1SQTA 2JKHA 5JDUB 4B2BA 1DWBH 1F0TA 3F2FA 3QWCH 1C2FA 3L3TA 4X8VH 3RXCA 3SUGA 5A2MH 2BY9X 4INHA 4Y8YA 4E7NA 4ACAA 4M7GA 1HJAC 2WUCA 2OINA 5JBBS 1O2LA 3IITA 1HAXB 1MBQA 4FUDA 5DG6A 1ZHPA 1TOCB 1DT2A 2VGCC 2JH0D 4IW4E 1E79D 2KAIA 4BAMB 1G3DA 1P06A 5DP5A 1DUEA 1P0SH 3Q77A 2ZA5A 1PFXC 1NM6A 2ZCHP 1FAKH 4D8NA 4AC9A 3RP2A 1SBWA 1YCPK 1WXRA 5HXFA 5EQQA 1BMLA 1UVPA 1P12E 3OFND 3SV7A 1AFQC 2VJ1A 2XCNA 2QGRA 2AIPA 1TNHA 2BDCA 4NGAH 5DP9A 1HPGA 2Y7ZA 5HYOA 2A4GA 2WZQA 2PTNA 3RU4D 2CMYA 2KCAA 4DCDA 1YPLH 2J98B 2OP9A 2UUJB 3OU0A 1NFUA 1GVZA 4BAOB 3ZZAA 5E0JA 3DA9B 3ZVBA 4BAKB 1NBME 1E1RD 3EE7A 2J5UA 5E2PA 1BJVA 1GMCG 5C20A 4MPXA 1FPHH 2ZQ1A 1IQHA 2PTCE 1O5EH 2ANWA 1M9UA 1C5NH 1LHGH 4OS7A 1FV9A 1HAHH 1LTOA 1O2TA 1WQSA 1WU1A 3HGPA 3ZZ7A 2IPHA 1F2SE 4RT1A 1GHBG 1E36B 1OXGA 1XKAC 2BVSH 2H9TH 3O8RA 1LVBA 1QQ4A 2W3IA 3ZZ4A 1O33A 1WQVH 4NSYA 3AW0A 1GPZA 1RTKA 1TX6A 2PKAB 2WHXA 1CA0B 1ZTJA 2R3YA 2PKSB 2ZTZA 3ZVDA 3ODDA 4IMZA 2YMSC 1AZZA 1QR3E 1CHOG 4NA7A 1YC0A 1MTVA 4Y8XA 1SR5C 5C1YA 4WWYA 2ZF0H 1ANBA 1YWUA 4Q4LA 5GIBA 2A7JA 5F03A 2QA9E 5SGAE 2F9OA 2BQ6B 3KYFA 2RDEA 1OYQA 1WTGH 4VGCB 3F3BA 2ZPSA 1F92A 1RJXB 3M61U 3M7TA 5GNDA 1HAVB 1C5RA 2F3CE 1NROH 4IN2A 3S0NA 3QLPH 3SJ9A 3BG4B 3RXRA 4UFEH 2W6JD 1XUGA 3EE0B 3WY8A 4X1RU 1AVWA 4A92A 1VGCB 1LKBA 3SHCH 2OTVA 3IG6B 4HTCH 1MABB 2PKSC 2HPPH 1ZJKA 2FEQH 2ODPA 3BTKE 1GBBA 3RMLH 1CGHA 5FPYA 3SJOA 1KXEA 1E35B 3PM3A 1YKTA 1UTJA 1ORFA 3LGWA 2H1UA 6GCHG 1EP5A 3A7XA 1ZGIA 4ABFA 1UTPA 2FS9A 3K6YA 4ZXXH 3OTPA 3UNRA 2FOFA 3PYHA 3F2GA 4FETA 2Z3CA 3VGCB 5JPMH 2CK3D 1EKBB 3F0PA 1GMHF 4DJZB 1LO6A 4DURA 1KLJH 2PWXA 1WTHD 1N8OB 2QCYA 1MU6B 1GBAA 2AMPA 5T6FA 4FUJA 1P02A 2CHAB 4XBBA 3BG4C 1BHXF 1EQ9A 2ZHDA 1ZHMA 4FXGH 1ZPBA 3FAOA 1BIOA 3K9XB 1RTLA 1XMNB 2VB0A 1VGCC 2A4QA 3BV9B 3HKIB 3P17H 4X1QU 1P05A 4A5TS 1C1QA 1W11U 2Y81A 2R0KA 4E7RG 1F0UA 2DUCA 5EIYA 1ZLRA 5C1XA 2KCOA 2OLGA 2BVXH 4B6EA 1O2NA 5EQSA 2XWAA 4UD9H 2Y5HA 1NZQH 2XCFA 3TNTA 2QV1A 4XBCA 3TH4H 2VU8E 2YMSD 1O2IA 3A7YA 1CT0E 5ESBA 3T26A 1GDUA 4Y0ZE 2DE9A 4NIYA 2AYWA 1S81A 3GCOA 3U9AH 2ZO3H 4BNRA 4MTBA 4K1SA 2VVCA 1HXFH 2ZHFH 1EAUA 6ESTA 2UUYA 3F2HA 3KQ5A 2GCTB 2ZEBA 1A4WH 1C1MA 1LVOA 1SQOA 2JIZD 1DDJA 2CHAC 3ZIAD 5A8XA 2ALVA 2WSSD 1OKXA 1C5SA 2FOCA 3TIUA 4XOJA 1BBRH 1DXWA 3QTVH 2ZFPH 1QQUA 4ZAEA 1YPMH 2L74A 1EAWA 1O30A 1C5PA 5F8ZA 2TGTA 3RC5A 3KQDA 1LKAA 3U8OH 2AS9A 4FUEA 1QRZA 1GBFA 2YNAA 1VCWA 4KKDA 2C3SA 2FOEA 4TPYA 1BA8B 3SHAH 1W7GH 1ELAA 2HRVA 1C1SA 1FY4A 1C5OH 3OX7U 3T29A 4YOGA 1F5RA 5A0CA 1HJ8A 2B5TB 1EOJA 3T5FH 2J9NA 2ILNA 4CRFA 1QZ8A 3QN7A 1ABIH 2FPZA 4K8YA 3I29A 3BTME 2GCTC 1OS8A 5DP6A 1Y5UT 4ABHA 5HKKD 3Q3YA 2XC0A 4CR9A 1OWEA 1FY1A 4ABJA 5T1VA 1SGIB 3HGNA 2OQ5A 2CV3A 2V6NA 1H9IE 1GHXH 3P8GA 2ODQA 3VFEA 3F68H 1HAPH 1DFPA 1A3BH 1TPAE 3TGKE 4TY7A 1YM0A 5DO4H 4YM9A 4I7YH 1DOJA 1K22H 1O37A 1NESE 3EGKH 3UOUA 1GI5A 1V2MT 1C5TA 4X2YA 1O36A 1TNIA 4F55A 2ZGHA 3PV4A 3TK9A 1T8MA 5JBTA 5AFZH 2V3MA 1BJUA 1CVWH 1FAXA 2JJ2D 5ETXA 8GCHF 3ATLA 3L6PA 1EZXC 1HAYB 3M5MA 1CU1A 3A7TA 1QA0A 4K3JA 1CBWC 3VG8A 1O5DH 1DXPA 3ZVGA 6LPRA 2P3TB 4O03A 1Y3VA 5H4IB 3LJJA 3B8JA 2V3OH 3RXOA 1O3EA 2PSYA 2QY0B 3SV8A 1O2YA 3WW7A 3TH2H 4CR5A 2RG3A 1PPEE 3AK5A 7KMEH 1NU9A 4JK6A 1GJ6A 3SNAA 1QL9A 3BTHE 1B5GH 1OOKB 5CHAB 2GZ7A 1O2XA 2HGTH 1C5QA 5HIZA 3S9CA 4Y79A 2F9NA 1MMJN 1WDIA 3KIDU 3O8BA 3TH3H 3STJA 1AGJA 5LGOA 1O3JA 2XXLA 2F4LA 4JYVH 1TA6A 5EW2H 4K1TA 4YOIA 3RXMA 1H8ED 1OYTH 3BN9A 3LIWA 1C5YB 1EB1H 4RN6A 4AB8A 3Q00A 2FI5E 3M7QA 4Q7ZA 1TGTA 1SGQE 1XKBC 3Q3XA 4OM9A 3ELAH 3OYPA 4LXBH 2VH6A 1Q3XA 2SNWA 3PO1B 2OK5A 1TOMH 2BOHB 3H5CB 1KXAA 1ARBA 4BAQB 3FO8D 2OQUA 3ZZ6A 1TX8A 3BTFE 5L2ZH 2A2QH 5E2OA 1ARCA 2NU2E 2FI4E 3OTJE 1GBLA 4Y10E 5CHAC 3QGJA 4I8HA 2KAIB 2G4UA 3UNQA 2G55A 1C1PA 3A86A 1MCTA 2H2ZA 3TK6A 2O8LA 4CBOA 3VEQB 2FLBH 3H7OA 2I6QA 1HGTH 1OP2A 2FOAA 1C5MD 3RXSA 2VIQA 1OWKA 1D4PB 3RXEA 3UQOA 4RI0A 5EQRA 1F5LA 1LDTT 2ZPQA 1VITF 3MU0A 4FOUC 2CF8H 1GMHG 3PO1C 1UTOA 1D3DB 1G9IE 3GCHB 4CREA 4WH6A 3D23A 4U2WA 3FKSD 2XC4A 4KTSA 2ZHEH 4TSFD 5C17A 1BRUP 3M3VA 3E16B 1QBVH 2H5DA 2O8UA 2QN5T 3E1XB 1OHHD 1TNGA 1GBIA 2VIWA 4B1TA 1SGPE 1AKSA 1AY6H 1O38A 3DSOA 3EA9A 2BLOA 1QY6A 2BLQA 3CS7A 1LPGB 3GY7A 3P95A 1MQ6A 3HPTB 3A7VA 1VCPA 2Z3DA 1XM1A 3TJUA 3ATWA 2P8OC 1TGBA 1SKYE 2YNBA 2Z7FE 4H42U 9ESTA 1UCYK 3EA7A 1MD7A 3SUDA 1ZRKA 1KIGH 1X7AC 1UHBA 2BYAX 1VJ9U 1NPMA 1KXCA 1XXFA 4GVUA 3URDA 1T4VH 3MO9A 4K2YA 4B71A 4Z6AH 1BTWA 1HIAA 1KXBA 1ACBE 3FP7E 3RU4E 3SI4H 3LC3A 4ASUD 3GCHC 3TJVA 3SU6A 4FU8A 2A2XH 2BD4A 2FI3E 3SGBE 4LK4A 2BXTH 3PTNA 1H8DH 5J4QA 5GCHF 3KN2A 1IQNA 1O32A 2C8YB 4Q80A 3P8NA 2Y80A 5J4SA 2FOGA 3WWFA 2ANKH 4JZDH 2QXGA 1O3FA 2ZWLH 3AASA 3SU4A 4YLUA 1O3PB 1G3EA 4AB9A 4FUGA 2VBCA 3D49H 1FI8A 2GCHF 2HNTC 3UWIA 1L0ZA 1KMHB 1GHVH 4NZQA 2QXHA 1ELCA 4FUBA 4OS6A 3BTDE 3MOCA 3O8DA 4IN1A 2VIPA 1GI4A 2WPIS 3T27A 1ZMNA 2XBWA 1P57B 3N7OA 4THNH 5E8EH 1BTPA 5A09A 1G36A 3ATIA 1GHAF 3TNSA 5C5OA 1GI6A 1K2I1 1T8LA 4ZHLU 2WV4A 1MKXK 1AE8H 1C4V2
chains in the Genus database with same CATH topology
3UTUH 1RGQA 1C1OA 3M5OA 1V2ST 4O3UA 1F7ZA 1O3HA 2ZDVH 2AFQB 5FAHA 4NCYA 1FN8A 4NWLA 3KEEA 1AZ8A 1BMNH 1QL8A 5CE1A 1ZMJA 1GI7B 2ZGXH 3KQBA 1YYY1 3SU2A 4NA8A 2GVFA 1FJSA 2Q1JA 2C8ZB 1YLDA 2O8MA 2ZHQH 2GTBA 3A87A 8GCHG 2ULLA 1GCDA 1O2ZA 1V2OT 1SVPA 3A85A 1G30B 2XNIA 3MWIU 1N1LA 3QUMP 2OD3B 4HGCA 1TNLA 1A2CH 1C2JA 3A8BA 6CHAB 1PYTC 1SPJA 1C4U2 3JZ1B 4ABIA 5FBEA 1EAIA 1A5IA 3M3SA 4WH8A 3R3GB 4FUFA 3RDZA 5DP4A 2UWPA 3PMHB 4LOYH 1FPCH 1BB0B 1EB2A 1QNJA 2Y5GA 2G81E 4I31A 5EXLA 4D76A 2D1JA 2TGAA 4K1EA 4DIHH 1RIWB 1A0JA 1AMHA 1VZQH 4KELA 4CRAA 5FPSA 1TPPA 1A46H 2R0LA 2F9BH 1QRXA 3KNXA 1NFWA 1O5AB 1KLTA 2C90B 3GY2A 1GDQA 2ZG0H 4YO9A 3M5LA 1S6FA 2VIDA 1KTSB 4X6MA 3UQVA 2ZFSA 1ANCA 1C5UA 1DSUA 1T7CA 1J17T 1ZOMA 1O39A 1ZYOA 1XXDA 4AG2A 2TIOA 4IC6A 6CHAC 4ABAA 1NRPH 3SV6A 4ISNA 4NA9H 1S83A 1SSXA 1MKXH 5GDSH 1WOFA 3TK5A 2EI7A 5E0GA 2FYRA 4NFEA 4UEHH 1O3KA 3TITA 2XW9A 5EXMA 4X8UH 3HATH 1GBHA 1SGNE 3A8DA 3QDZB 3QK1A 1JXPA 3UNSA 1RIWC 5JB9S 1O2OA 2AMDA 1C2IA 3SU3A 1IQJA 2SGFE 3SNBA 3ZZBA 1Y3XA 1C1NA 1HXEH 2PGQB 4ZKRU 2Z9GA 2ZKSA 2J94A 1TFXA 2ZU2A 4UONA 3GDSA 1QFKH 1YPHC 3ZV9A 2PHBA 1IQIA 1VITG 5E0HA 1PPFE 1P3CA 1P3EA 3NKKA 1EZQA 1D6RA 2WUBA 3D62A 1MAXA 2Q6GA 4MNWA 1SB1H 2Z9IA 3Q76A 2P3FH 1DS2E 4GHQA 3EA8A 3GDVA 3M3TA 2A5KA 2VWNA 1YGCH 1MTUA 4XBDA 2HPQH 1GJ5H 1PYTD 2ZDKA 1UVTH 4OS5A 3GY3A 4AX9H 1Y3UA 4JYTA 1O2WA 4MLFB 1P8VC 5EPNA 4A6LA 4NIWA 1LQDB 2ALPA 1P09A 2A31A 5K0HA 1AVXA 3GICB 2ZU5A 2FM2A 1C4Y2 3SW2B 1GHZA 2FMJA 1BITA 1MKWK 2BTCE 1KLIH 3M7UA 4BAHB 1CGIE 2G52A 3RXVA 4X1PU 4YOJA 5CMXH 4F49A 3E0PB 1YPKH 4MDSA 1EUFA 1A5HA 4DT7B 2ZHWH 3V12A 3CS0A 2CXVA 4GSOA 4DG4A 1UTLM 5GCHG 4X6PA 2HWLB 3M36A 4YLQH 3SU0A 1HUTH 3RXQA 1MQ5A 3PMBB 2Q6DA 1EPTB 5F6MA 1O3OA 3SV9A 1K28D 1QURH 1GBCA 3MI4A 3RXPA 1LCYA 1Z8IB 2P3UB 1AUJA 1GVLA 4WXVA 2GCHG 4MNYA 1EAXA 1ESTA 2OC0A 3GYMA 3OY6U 4AN7A 5C1UA 1SGFA 1SFIA 2HNTF 3LGIA 3Q3KA 1K1MA 5AHGH 1W2KH 3A7WA 2BXUH 1AN1E 1O3NA 3SNCA 1AB9B 1L1NA 5DKMA 4H6SB 4ISHH 1BBRK 5GXPA 1CA0C 3VB7A 1GHAG 1C1WH 1V2RT 2BM2A 2Z6BD 5LPRA 1V2QT 3UPEA 3A8AA 7GCHF 2GP9B 1TQ7B 5ABWA 4MVNA 2G4TA 5TJXA 1K1IA 1A61H 3ZZ9A 1C5LH 4WF8A 1O2QA 3LJOA 2OC7A 2BHGA 4TWWA 1LHDH 4KTCA 3GY8A 1QBOA 3LGVA 1FNIA 3PMJA 1P04A 1CQQA 2J2UA 1TALA 2CJIA 2ZCLP 3F1SB 3AAUA 1WSSH 5FX6A 5G4BA 5EOKA 4VGCC 4Q2KA 4R0IA 4O97A 1MKWH 2R2WU 1V6DA 4Y71A 4JCNA 1P01A 2B8OH 3T2NA 3E90B 3FZDA 1NRRH 3E91A 1P2NA 1OP8A 1AKSB 1EXFA 1LHCH 3A89A 1W10U 1XVMA 4YT7H 2ANYA 1Z8GA 2EI8A 3GY4A 3KHVA 1C5ZB 1EZSC 1ZRBA 3UR9A 1UK3A 2XBXA 1Y5BT 4INKA 1MUEB 1MZAA 3BEIB 2J38A 3LONA 1SC8U 1UHBB 3URCA 1DWCH 2VVUA 3GY5A 1AIXH 2ZU1A 3PLKA 3LH1A 4KTUA 3VGCC 1ELDE 1HIAB 1QTFA 5ESTE 1BDAA 2ZFTA 2BMGB 5FBIA 3L33A 1KTTB 2NU0E 2XBYA 2J34A 4GPGA 1C2LA 3FP8E 1N8OC 2C8XB 5T3HA 4XDEA 1TRYA 1QRWA 1UTQA 4TWYA 3ZVCA 5L2YH 4GAWA 1SGEE 3I78A 3LOXA 1IHSH 1GJBB 1E37B 1O5FH 2CN0H 8LPRA 3SQEE 1G2LA 4GCHF 5FHTA 1BRAA 1EX3A 2A5IA 1TLDA 1QB1A 1BTUA 1EJNA 1GI2A 5T6GA 3RMNH 1GBEA 4NFFA 2FX6A 2W7UA 2HLCA 1HJ9A 2ZU3A 1DWEH 2VINA 3QGNB 3T62A 5LH8A 1P2MA 1GJ9B 1GL0E 4CHAB 5C5NA 5I25A 3MTYA 5B6OA 5GPIB 4JZEH 3SU1A 3TJOA 1EOLA 1KXFA 1TGSZ 1UJ1A 3MO3A 3F9FA 1XUJA 1J8AA 4GUXA 1ZSKA 1D3PB 3ATKA 1ZHRA 2XWBI 1L4DA 1JOUB 2RA0A 1LPZB 1K1NA 2C93B 2A0QB 1TNKA 3RM0H 3RC6A 4F4OC 5TCCA 4WMEA 4D7FA 2F9PA 1ABJH 3TLOA 1O3IA 2VIVA 3QX5H 1DLKB 4E05H 1GI9B 4K8BA 4I32A 1C2HA 2ZFRH 1NS3A 1OPHB 1QJ7B 1T8NA 1ELTA 3RMOH 1JIMA 1GGDB 1P10A 4SGBE 4JK5A 3UFAA 3NUMA 1AHTH 3E0NB 4O9VA 2ZDAH 2ZTXA 1NFXA 2PGBB 4B2CA 3LU9B 1C1VH 3ZZ8A 1ZSLA 2TRMA 3RXHA 5BRRE 1YPEH 1A0HB 1FY5A 4AFSA 1TBQH 3FVFB 3U1JB 1MTNB 1CSOE 1IQMA 2JETB 4K5ZA 1WV7H 1ANDA 1UO6A 1UTNA 3ZYDA 4KP0A 8KME2 3RXJA 1GI8B 3U8TH 1IHTH 1EPTA 5EXNA 9LPRA 2ZQ2A 3IWMA 1RTFB 3ZZCA 1QHRB 4FUCA 1O31A 1P9SA 2PFEA 2UWLA 4AYYB 2BY5X 4XFQA 3BTQE 2BZAA 1TAWA 1NN6A 3QTOH 1ESBA 2D8WA 2FTLE 2BQWB 1LVMA 1VJAU 2LNCA 4JMYA 1XUKA 1T31A 2RDLA 1MTNC 5DP3A 1W0ZU 5FXLA 1SMFE 2OXSA 2J4IA 1WCZA 1SLXB 7GCHG 2JETC 4RSPA 3BTEE 1A3EH 4Y8ZA 1GCTB 1BT7A 1B0EA 4BTIB 5FCKA 3LKWA 1KYNA 1NRNH 2J92A 1W13U 2HNTE 2G5NA 3GCTF 1QB6A 1CGJE 3DHKH 1S85A 5DK1A 4AOQA 1VR1H 1GJ7B 1WYKA 1O3MA 3DUXH 5FX5A 1ETTH 1HDTH 3RXDA 4FU9A 1T32A 1O2MA 1GJ4H 2BY7X 3M37A 2BD8A 3H7TA 4Q7YA 1H4WA 4B73A 1BOQA 1DM4B 3U8RH 1PQ7A 1BMAA 2P93A 2FO9A 3GOVB 3VXFH 1DUAA 2IJOB 1JMOH 1TONA 1V2PT 1E0FD 2XYAA 3SN8A 3S69A 1TGCA 2G00A 3STIA 2BZ6H 1PPZA 2FODA 1V2WT 3A82A 3QZQA 3CENA 1C5WB 1OWHA 4IGDA 1GHYH 3S9BA 2BDYA 1P11E 4J1YA 3MO6A 3HK6B 4ZUHA 2AGGX 3ZVEA 2ZP0H 2F91A 5F8XA 3NK8A 3LGUA 4ZKOU 1GI3A 3BSQA 2BD2A 4IC5A 1GL1A 1AVGH 3RUOA 2Z94A 3KQCA 4GCHG 3U98H 3ZV8A 2Y7XA 1UCYE 1HAIH 3DFJA 1O0DH 3M35A 2ZNKH 3DT0H 1W3CA 2BD5A 2GMTB 1AUTC 1BTXA 1QJ6B 2QYIA 1O2GH 2UUFB 2FWWA 4U01A 1EJAA 2PV9B 3VB6A 1THPB 2QXJA 2GZ9A 2BQ7B 2QAAA 2C4FH 1BRCE 1Q31A 3ENSB 1Y8TA 1SL3A 3T25A 1NT1A 2BY6X 1H9LB 1K1LA 1RD3B 1Y3YA 2NU3E 3PWCA 1D9IA 3BTTE 1C2GA 1Q2WA 3VXEH 1O2UA 2OCVB 1GJDB 3P8FA 2A32A 2FXRA 4TYDA 4ZROA 1BHXB 3V13A 1DVAH 3PWBA 4DVAU 1QL7A 1YCPM 4Q7XA 2ZZUH 4I33A 2VWOA 1D6WA 1HRTH 1FQ3A 3W94A 2ZGCA 4QT8C 3ATMA 2V0BA 2P95A 4FUHA 5LPFA 1TRMA 2O8WA 2GMTC 3V3MA 2BVRH 5IYTA 1HYLA 1O3DA 1O2KA 2HVXA 5BPEA 1RRKA 2XRCA 4ZXYH 3RXTA 1O3AA 1O5CB 5AFYH 2BDGA 1QB9A 3PB1E 2BX4A 1YPHE 1SOZA 3UOPA 2W3KA 4A7IB 4IS5A 2RA3A 4CRGA 1SGCA 2Y5FA 5I46H 4ISIH 3G01A 2HALA 2FOMB 4WVPE 2B7DH 2A7HA 1AD8H 5LPEA 4INLA 5GWZA 1UK4A 4CH8B 3A81A 2B9LA 4BXWA 4AGKA 3SV2H 1B7XB 3W95A 1DY8A 4OGXA 1HV7A 1UVUH 1FDPA 1O5BB 1C2DA 3A83A 3MNCA 3KL6A 2JH5D 2A7CA 3ZVFA 3A80A 4SGAE 1H8IH 4H6TA 1BTHH 1SGTA 2Q6FA 5FPTA 3V7TA 1P2JA 1MAYA 3K65B 1C5XB 1HJAB 4X8SH 1K1PA 5GJ4B 1SOTA 1HLTH 2SNVA 1ZGVA 1EATA 1EASA 3GCNA 2GZ8A 1L2EA 2WYJA 5HM9A 1PQ8A 4DOQA 1Y5AT 1MZDA 1P2OA 1V2VT 2GDEH 3SJIA 1Z1IA 3BG8A 1TBRH 1KDQA 1TGNA 1SI5H 3SO3A 3MU4A 4U30A 1JBUH 1P9UA 3TGIE 1F5KU 1NO9H 1HB0B 1P2KA 5DJ7A 1QCPA 3SI3H 1AFQB 4WJG2 1HBTH 4AFQA 4NIVA 1A1RA 3K2UA 3BF6H 2F9VA 2UUKB 4D9QA 2PUXB 1UVSH 1J14A 4XE4A 2ZGJA 1BTYA 1HFDA 1AQ7A 3TGJE 1FN6A 2V35A 4FVBA 2ZECA 3RMMH 3VPKA 3AW1A 1Z8JB 3ZZ3A 3GCTG 2WPMS 1A0LA 3AAVA 3C1KA 4UE7H 2ESTE 1C2EA 4AFUA 1UTMA 2VWLA 3A84A 2BY8X 2QXIA 1GBTA 1T4UH 4ABDA 4OS1A 1DICA 3BEUA 4DIIH 4R8TB 1CHGA 3KF2A 4MQAA 3VB3A 5JB8S 3SZNA 2WPJS 3NPSA 4HFPB 4ABGA 1NFYA 1XUFA 3KQEA 3NXPA 1WAYB 4NZLA 1W0YH 2GKVE 1BRBE 1K9OE 4ZH8A 2OUAA 2BX3A 3A88A 3LT3A 1ZTLA 1BQYA 1TA2A 3RM2H 1HNEE 2UWOA 1ZZZA 3T28A 1BTZA 5A8ZA 1NRSH 1N6YA 1Z6JH 2SGQE 4FU7A 5EPYA 1FY8E 3SQHE 1Z7KA 2ZDLA 3ESTA 4Y6DA 1MU8B 3SJ8A 2H6MA 2AERH 2GGVB 1ID5H 1KSNA 3ZVAA 1S84A 2F9UA 4O3TA 1FIZA 4B75A 2H5CA 1TMBH 1TNJA 1O2VA 1Z1JA 4DY7B 3B23B 2PUQH 2K1QA 1CT2E 3SU5A 4K60A 1H9HE 2G8TA 3MYWA 2VIOA 1E38B 4JZFH 5HMAA 1O5GH 2ZU4A 4CRBA 4BANB 4X6OA 1O3LA 2Z3EA 2M5TA 4JZ1A 4A1TA 4MPUA 5T6DA 1KY9A 1PPCE 1KXDA 2W5EA 5AF9H 3S7HB 2SGDE 1ZR0A 1XUHA 3MH6A 1ZJDA 1LPKB 1SGRE 1SHYA 1O2RA 2TPIZ 4D7GA 1V2UT 1DE7H 2EI6A 2GD4B 1RFNA 3VB4A 2WPLS 4ISOA 4D9RA 2BLWA 1TYNA 2ZFFH 3DFLA 5EW1H 1ANEA 3S9AA 1O3GA 3UR6A 3RXLA 4X1SU 2D26C 1YLCA 2WV5A 1EP6A 1PPGE 1GMDF 3TPIZ 3TVJB 1YCPH 2P94A 1VITH 1JRSA 4NG9H 1TPOA 5JBCS 1LVYA 2OC1A 1OSSA 1TABE 3HKJB 2FOBA 1EPTC 1YF4A 5EG4A 2NU1E 1C9PA 1OWJA 2FDAA 2ZFQH 1DPOA 3SORA 2VWMA 1GWAA 2J95A 4K69A 3RXIA 1PQAA 2A5AA 4ESTE 1T8OA 4HZHA 3F9EA 1ELVA 2ZTYA 1Y59T 3MNSA 4ASHA 4X2XA 3UY9A 4WY3A 4A1VA 1BBRE 1HAGE 1AB9C 1HCGA 2ZDMA 1NTPA 2PW8H 4AYVB 1RXPA 5C2ZA 1C9TA 4TY6A 1HAOH 2OBOA 3EAJA 1INCA 5EODA 3EYDA 3BIUH 3RXUA 1ETSH 2JH6D 2R9PA 2ZCKP 1QGFA 3RC4A 1DLEA 5F8TA 1PPBH 4LZ4B 5A0AE 4ISLA 5EGMA 1G3CA 3EQ0H 1FY3A 1LHEH 4ZMAH 3BTWE 1DANH 2BDHA 1ZTKA 2ZGBH 2GV7A 1AFEH 1K1OA 1GBMA 2AEIH 3SUFA 5A0BA 1MTWA 1TWXB 1THRH 2IN2A 3LH3A 3MMGA 5HGGA 1UK2A 2ODYB 5JYIA 1L1JA 2BDAA 4UDWH 3ODFA 1O3BA 4KGAA 3UIRA 1JWTA 1GI0A 2SFAA 4OS4A 1LMWB 3MNXA 1S6HA 4NSVA 2BD7A 2SGEE 3F9HA 5A8YA 1ZPZA 3ZZ5A 2THFB 3V0XA 1MD8A 2FZZA 1O2JA 2V3HH 2QC2A 2P16A 1