3VB5A

Crystal structure of sars-cov 3c-like protease with c4z
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
301
structure length
301
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb5A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb5A02
1BQYA 1JRSA 2ZPSA 4CBNA 1BMAA 3AAVA 1H1BA 1AFQB 2FLRH 3MO9A 4Y71A 7GCHF 3D62A 4INHA 2W7UA 5EXLA 1DVAH 2BDCA 2K7XA 4DIIH 1UTJA 1BRUP 1HIAB 1UK4A 1W7GH 1GI9B 1TYNA 1C2IA 5EQQA 3Q77A 1ZRKA 1W3CA 1A5IA 2FZZA 3SV9A 1A61H 1YPMH 1AHTH 1LHDH 3RXKA 1MCTA 2BDAA 2FO9A 5HM9A 3P8GA 2VIPA 3FZZA 4UONA 3TJNA 4O3TA 2SGPE 2J4IA 1ANEA 2JH0D 4ZHMU 1LVBA 4O97A 2J94A 3V12A 1MUEB 3SJIA 3SHAH 4VGCC 3ZYDA 1EJMA 1EKBB 3SGBE 4JYUH 1QRXA 1F5KU 1HXEH 1QL9A 5T6DA 1EZXC 4MPXA 3GICB 1O2QA 1XM1A 3EA9A 2FM2A 1D3TB 1FNIA 4ISNA 2QF0A 1SGNE 2ZI2H 2CN0H 5C1XA 1GI4A 4Y7BA 3RMMH 1EJAA 3BTFE 1C5OH 1MD7A 1TA2A 3GCTG 1UTOA 1TX6A 3SU5A 3DFLA 2SGDE 4Y7AA 8GCHF 5GXPA 2VGCB 1O5FH 4UE7H 1Z8IB 2XTTB 2ZWLH 1HAYB 3L6PA 3LOXA 2Y6TA 1K21H 4K60A 4JYTA 1P2JA 1KXDA 1O2OA 2UWPA 5FAHA 2G52A 3DD2H 1FJSA 5JB8S 3AASA 1DM4B 1UTMA 3OX7U 4ISIH 3OY5U 1V2NT 4DG4A 1RRKA 3TGIE 4WJG2 2QXHA 4DVAU 4I8LA 1PQAA 2BOHB 5DP4A 1ESAA 1LPZB 3JZ2B 2ANWA 5C1UA 6CHAC 3VB3A 1K9OE 4KTUA 3RXVA 2HALA 4TWYA 1GMCF 1BBRH 3KQCA 1TQ7B 4H6TA 3R0FA 1XUIA 1O2VA 1IQFA 1OS8A 2ZU1A 1HCGA 1NRSH 3S9AA 3PO1C 1NTPA 4HGCA 3BTKE 1C5MD 3HATH 4H6SB 5F03A 3TNSA 1HRTH 1V2KT 3RXIA 1EB2A 4AX9H 1HNEE 3FFGA 2VIQA 3GOVB 3ODFA 4D9QA 2BDBA 3WY8A 1EPTA 4JCNA 2H5DA 4A6LA 4UFFH 1HAVA 4AFQA 2R2MB 5EQRA 3OSYA 1Z1IA 2QA9E 4B76A 1O2UA 1GGDB 4I33A 2WUCA 4NFEA 3SORA 1JIMA 2K1QA 1NY22 3RXCA 4CHAB 3MH4A 3NUMA 1XUKA 1TRYA 4NGAH 3E1XB 2J38A 4YLUA 1TNKA 5DP3A 1HAXB 1DUAA 1MKXH 1RFNA 2ZIQH 1MBQA 1O2XA 5JB9S 1GHWH 1SVPA 4X1SU 1IQKA 3U9AH 3E0PB 1W12U 1OKXA 2PR3A 1T7CA 4IMQA 3UIRA 1MQ6A 3KQDA 1EJNA 4GCHF 3ATLA 1A0HB 1G37A 2A4GA 4KGAA 1V2WT 1GI3A 1DICA 5H4IB 4YT7H 1J15A 1MZDA 1ELVA 3QK1A 1UTKA 1O2NA 2ZGCA 2G5NA 1ZZZA 3T2NA 4K1TA 2A7CA 1EQ9A 2H9TH 3K6ZA 3SV8A 3UUZA 3QZRA 1DLKB 1KLTA 3MU4A 1A1RA 1KXCA 1P2MA 1SGYE 1ZSLA 2QGRA 2ZU5A 2FOHA 1L2EA 3BEFB 2G8TA 1QBNA 1P09A 3A83A 3PMAB 4ABIA 4FUCA 4FUJA 1CSOE 1GHVH 4H42U 1D9IA 1O2KA 1WSSH 1YM0A 3A85A 3LC3A 3PWCA 4BTTB 1QBOA 4NIXA 5J4QA 5DK1A 4FUFA 3M7QA 4Y6DA 3UQOA 6GCHG 4X6NA 1TBRH 2SGFE 6ESTA 1GHBF 2BY6X 3H7TA 3MU5A 3KN2A 1CA0B 2GV7A 3BF6H 1O34A 4MLFB 3SU3A 1MMJN 1GJ6A 5EODA 3TJVA 1TGSZ 4IN2A 3GY4A 1AN1E 1PQ7A 2BQWB 2PTNA 1O35A 3VXFH 5DP5A 1QBVH 1GHYH 1O3PB 2UUFB 4NSVA 4X1QU 3Q00A 2WPMS 3I78A 5ESBA 2WPHS 1QA0A 1BMLA 1BIOA 4JZ1A 2F3CE 2D8WA 3ZV9A 2Z3CA 1JXPA 4ZXYH 6LPRA 2BZ6H 1C5RA 5E0HA 2FOAA 3RM0H 1FY1A 3PYHA 1SFQB 1SGTA 1HV7A 1NFXA 4GSOA 4KELA 1AVXA 1H9HE 4SGAE 1ABIH 1ZRBA 2Z3DA 2OTVA 4K8YA 2H9HA 1V3XA 2TRMA 1C4V2 1QL7A 2HNTE 2DE9A 1YPJH 5FPYA 1CQQA 1ZMLA 4OGXA 1JIRA 1O3IA 3URCA 4AORA 1ANDA 3QTOH 2Y5HA 3A7WA 1PPBH 1CVWH 4KTSA 3RU4D 3SW2B 1PPEE 1C2DA 3TH2H 1BTWA 1C5ZB 5JBAS 4ZROA 3SV6A 1P11E 1ZPCA 3MO6A 1V2ST 1N6XA 1FAXA 2RA3A 2P93A 5JDUB 2BY8X 2ZZUH 1OWIA 5EPNA 1SQOA 1S0RA 2AIQA 2W3KA 5C3NA 1KLIH 2ZHQH 2OCVB 1SGQE 3CS0A 1LQEA 5EW2H 2C8XB 1S5SA 3ZZDA 3QX5H 1XKBC 1TMTH 1GHAF 2A4RA 4LZ1H 1EZQA 3RXGA 1SHHB 1QTFA 1UVOA 1V2JT 1O36A 2ZFRH 2FS8A 3ELAH 3M35A 3W94A 1L4DA 2WINI 4DURA 3A8AA 2VVCA 3AW0A 3SUDA 5HXFA 1P02A 1V2LT 3MWIU 2BVSH 4R0IA 3ZVDA 4FUEA 3QWCH 3PROA 4IC6A 1ZPZA 2SNVA 1W7XH 1Z6EA 1CGIE 2GCHG 1BBRK 2ODQA 4X8SH 3UREA 2B5TB 1E37B 1DXWA 3U8OH 1NRQH 4YM9A 3TGKE 4BOHA 3D65E 4X2YA 4D8NA 2ZDNA 1AUJA 1LVOA 2UUYA 1A5HA 4GUXA 4XBBA 1QA7A 4AG2A 2ZPRA 1LO6A 3ZVEA 1IQIA 2BX3A 3DT0H 7GCHG 1HJ9A 1O2TA 1G3CA 1QB1A 3NPSA 1ZLRA 2RCEA 5FCRA 3B23B 4E7RG 4AYVB 4DJZB 9ESTA 5GCHF 3SU2A 3TVJB 2A5KA 3FZDA 1UCYE 4MNVA 5E0GA 1VGCB 1GJ4H 1P3EA 2ZPQA 3GY7A 1ZYOA 2BY7X 2AMPA 2OBOA 1C9PA 1N8OB 1GI5A 1BMNH 2PUQH 1K28D 2SNWA 3PLPA 5HMAA 4Y0YE 2A31A 4X6OA 5IDKA 1FLEE 4O3UA 3VPKA 1V2VT 8KME2 4DIHH 4I7YH 3OY6U 4CRAA 1MKXK 2AFQB 3RC5A 2Y7ZA 1GWAA 3L33A 5AHGH 3TNTA 1HAHH 2BXTH 5EG4A 3SV2H 3RXEA 1O2HA 1W11U 4B74A 1SOTA 2BOKA 1SI5H 3LU9B 1LVMA 1O2MA 2XWAA 1IOEA 4YTAA 1HLTH 2Z9GA 2VH0A 5TCAA 1CGHA 5DGJA 2SFAA 1GBLA 8GCHG 1GDUA 1Y3XA 3CENA 3SGQE 3BIUH 1XXFA 1SGDE 2ZFPH 1C2MA 1ZPBA 1O2WA 3GCNA 3HGPA 4U30A 1V2OT 2QXGA 1VCPA 4K2YA 1TFXA 3PB1E 4ABJA 3GCHB 1FN8A 1EXFA 1BHXB 3C27B 1ZHPA 3SN8A 5AF9H 2RDLA 1P10A 2IN2A 1SLXB 4DOQA 3RXQA 1WOFA 3NXPA 2G51A 1O2ZA 3O8DA 2NU4E 2J95A 3CS7A 2C8YB 3S9BA 1GMCG 4FU8A 2ZFTA 1OWEA 1O33A 1FPHH 4Z0KA 1MZAA 5BPEA 1S81A 1CGJE 2W3IA 2ZCKP 3VB4A 4Y0ZE 3FP7E 1QQUA 4KP0A 4ABAA 4M7GA 2VJ1A 3EE0B 3MI4A 3NKKA 4BANB 1O32A 1CBWC 2BDYA 1IQEA 3MO3A 1E38B 3UWJH 1AB9B 7LPRA 1NM6A 1V2MT 1TE0A 5L30H 4DT7B 2CHAC 4B71A 1DX5M 4XBCA 3SHCH 3TJOA 5HM2A 2Y80A 1L1JA 1YPKH 3E90B 1Y3YA 3QUMP 3FVFB 1K1OA 1O5EH 5EW1H 4FUHA 5FBEA 3M5NA 3KL6A 1A0JA 1ELDE 2B9LA 4MTBA 1UVPA 2KAIA 1AZ8A 3A7YA 1ZTJA 1LPKB 2FDAA 1BA8B 2FX6A 3E16B 4IN1A 4XE4A 2G81E 4BAOB 1K2I1 4B2AA 1QR3E 1FY4A 1ZR0A 2FEQH 5JBTA 1SR5C 5L2ZH 5DP9A 4FU7A 1MTWA 1BJVA 4X8VH 3UWIA 4X1RU 2NWNA 1F5LA 1O5AB 1HAZB 1WTGH 4K1SA 4GCHG 1EUFA 3DA9B 4A92A 3RXDA 2ZDAH 3MNSA 3SUEA 4FVDA 4ABBA 1KYNA 1SB1H 3EA7A 2A5IA 1DXPA 4AZ2B 4UEHH 3R3GB 2DE8A 1L4ZA 4MPUA 5I46H 2F9BH 1AU8A 1GMDF 2F9PA 3BTWE 1GCDA 1H8IH 1GI6A 4BXSA 3PM3A 3MH7A 2TPIZ 1NFUA 1FV9A 4UFDH 2WV4A 4BXWA 1C5NH 1P04A 3EAJA 1BBRE 1UJ1A 1MAXA 4NFFA 3S0NA 3A7VA 1GBCA 1P57B 3PMHB 1AUTC 2THFB 2HWLB 2TBSA 1O2LA 3KNXA 1C4U2 1G9IE 1Z8JB 2QV1A 3MNCA 1GBJA 2FI5E 2TIOA 3Q76A 2WPKS 2FX4A 3KCGH 2PTCE 3A84A 2HPPH 1GHBG 2FLBH 2VIDA 1TMUH 2PWXA 4ZXXH 3FANA 1LTOA 1V2QT 1F0RA 3I29A 2CGAA 4MNXA 1NO9H 3NZIA 2IOTA 1Y3WA 1NT1A 1TPSA 4I32A 1C1WH 2STAE 1WQVH 5A0CA 3EGKH 5HGGA 1V2PT 1MTNC 1QL8A 4JZFH 2A4QA 4X1NU 3VB6A 1KXAA 6CHAB 4AB8A 2VINA 1PQ5A 1AFEH 2FI3E 2ODYB 3KQBA 2QY0B 1T32A 1OP8A 1BITA 2GZ7A 4X2XA 2G5VA 1S6HA 1O3OA 2FYQA 2OQUA 3LIWA 1O5DH 1BTUA 1GCTC 1O3NA 1VCWA 2PGQB 2GGVB 1O31A 4A5TS 3QN7A 1T8NA 4Y79A 1PPFE 3RU4E 1GI7B 2A5AA 1EPTB 2AYWA 3IITA 2M5TA 1OX1A 4NZLA 5JPMH 3RXJA 1HAVB 2O8UA 1GBBA 4RKOB 3S69A 4I8JA 3UR6A 1EAXA 2J2UA 2P3FH 2GKVE 2OC8A 3LJJA 2EEKA 1A7SA 3GDVA 3LKWA 3AVZA 1C5SA 1K1PA 1KY9A 3M3VA 1DOJA 2XC0A 1PPGE 2FI4E 1OSSA 1TNJA 4AN7A 1QY6A 2VWMA 4ESTE 4FXGH 1NRRH 2QXIA 3A88A 4DW2U 3QZQA 2YNBA 1B0FA 1K1IA 3SZNA 1C2JA 2Q6GA 1P2KA 2ZFFH 1Q2WA 1ARBA 1Z71A 1QNJA 3LGTA 1O3KA 1AVGH 2HLCA 2FTLE 1BOQA 2J9NA 4LXBH 4YOJA 2WPIS 1HAGE 2ZTXA 2P8OB 1SGRE 2EA3A 3LPRA 1C2HA 1GHZA 9LPRA 1OOKB 2QN5T 3UOPA 1F7ZA 1TWXB 2A4OA 1W10U 4ZAEA 1OXGA 3U8RH 1GHAG 2VGCC 1RXPA 4U32A 3A8BA 1B5GH 3RC6A 5A0BA 1C4Y2 1CT2E 1P06A 3EDXB 4ABHA 1Y5BT 1CE5A 3RXAA 4RSPA 1TOMH 2F9NA 2GCTB 3TIUA 2RG3A 4MPVA 3MOCA 4KTCA 3MYWA 4SGBE 1H9IE 3OTJE 1A46H 1C2FA 2GMTB 4Y10E 2HRVA 5LPEA 1GBTA 3K6YA 2AH4X 3GYMA 4WH6A 1ELFA 3GDSA 2V6NA 1NRNH 2F9VA 3IG6B 3A8DA 4FVBA 1ANBA 4J1YA 1SLUB 3ESTA 1KTTB 2CJIA 8ESTE 1O0DH 3S7KB 1Y3VA 2HGTH 1TPPA 3ZV8A 4NIYA 3GY5A 2VU8E 1E36B 1GDQA 2O8WA 1DS2E 1ESBA 4NCYA 5GCHG 1OP0A 1P2NA 2XWBI 1JMOH 1OYQA 2OINA 3A7XA 3PMJA 3SJ9A 3TPIZ 2XRCA 1C1TA 4Y8ZA 1L1GA 3STIA 1O3JA 3RXHA 3SU4A 5DKMA 1S84A 3S7HB 2G55A 1ELEE 3A89A 1UTQA 3RXFA 1O3DA 1BTZA 1ZMNA 3SNAA 5FBIA 3URDA 1LKAA 1TBZH 2ZDKA 1TX8A 1RD3B 2Y5FA 1K1LA 2BVRH 3SNBA 3ZZ7A 1LVYA 2XBXA 3LGYA 5I25A 3F6UH 3E91A 1W14U 2EI6A 2JH5D 4B75A 5DPAA 2C90B 2R3UA 1W2KH 4AOQA 1SBWA 2VB0A 1ZHRA 3UQVA 1SG8B 5L2YH 1ZJDA 1HAPH 3ZVBA 2TGTA 1E0FD 5LH8A 2OBQA 4NSYA 1MKWK 2BY9X 3TH3H 3B9FH 3ZYEA 4IMZA 1O37A 4K69A 4ABGA 1ZTKA 1AD8H 1YYY1 4JYVH 1C5XB 3LH1A 2BY5X 4B1TA 2VIOA 3LGUA 2FTMA 1MU6B 2ALVA 1L0ZA 1V2RT 1K1MA 4CH8B 4TPYA 1ETTH 3SI4H 5C1YA 1O2GH 2WYJA 3T28A 1IQNA 3U98H 1QJ7B 3EBNA 4BNRA 1ESTA 1NN6A 1XVMA 2FOFA 3UOUA 3BTDE 3RXOA 1DLEA 1K1NA 1ZTLA 3EQ0H 1TOCB 1SGEE 3TJUA 2ZGHA 2F9OA 1O5GH 4JK6A 2B8OH 5K0HA 1ELTA 2AEIH 3KF2A 5E8EH 3RUOA 3SNCA 2P3UB 3T5FH 1QGFA 3O8RA 1O38A 2FESH 4WXIA 2JKHA 4GLYA 3BG4C 1RTFB 1TNGA 1TPOA 1E34B 1J17T 1UMAH 1WAYB 3RDZA 3QLPH 3RXSA 1UVSH 1LPGB 4DCDA 1PPCE 1Y5UT 1X7AC 4Y8YA 1PPZA 4Q7XA 3ENSB 3EYDA 1CA0C 3E8LA 2Z6BD 1P01A 1JRTA 1P3CA 2ODPA 1BTXA 3QTVH 1QHRB 4ASHA 2Y81A 3VEQB 5FPTA 4ZKSU 2BD2A 2GX4A 3U1IB 2VWNA 5AFYH 1LCYA 1GVZA 1BZXE 3QGNB 2IPHA 4H4FA 1C9TA 1SOZA 1QRWA 1XUFA 4RKJB 1J9CH 1EATA 2LIZA 3SU0A 1DWEH 4WF8A 4CRBA 1P0SH 1G3BA 2ZP0H 1RS0A 1C1PA 2A2QH 2XXLA 1GJ7B 4THNH 1F0UA 5LPRA 1QURH 1MQ5A 1OWKA 1HXFH 1AY6H 2ZHFH 1S82A 1C1QA 2R0LA 5DO4H 3HKIB 2ZO3H 3RLWH 5A09A 1FMGA 5A2MH 1YPGH 1JOUB 1MTUA 2QIQA 2ASUB 1AKSA 1B0EA 2ANMH 5T3HA 3TU7H 4CRFA 1INCA 1DWBH 2Z3EA 1EX3A 1IAUA 1AO5A 1ARCA 1F0TA 1DY9A 2ZCLP 1BRBE 4LOYH 1O2YA 1GMDG 4FUIA 4BAMB 1G32B 1HJAC 1PFXC 1J16A 1QIXB 1CT0E 1SGFA 2FOGA 3SOSA 4RN6A 5IYTA 3VB7A 1P03A 3A7TA 3T62A 2G4UA 1DSTA 2PFEA 1BCUH 3ATMA 3MU1A 1FI8A 4X0WU 2C93B 1NS3A 1VZQH 2ZG0H 1P12E 4WMFA 2CMYA 2BTCE 4E05H 2JETC 5F8TA 4ZKNU 3AAUA 3MNXA 2A32A 5F6MA 5HYOA 4AGKA 4OS1A 1Y5AT 3TGJE 3P8NA 1ZOMA 3DUXH 3O8CA 2I6QA 2PW8H 3LGIA 3RMNH 2JH6D 2Y7XA 2H2ZA 2VIWA 4GAWA 3BTME 1Z7KA 4I31A 1VITF 2TGPZ 5TCCA 1O2PA 2EI7A 1VITH 2BDIA 3RMOH 2FXRA 1UVUH 1CA8B 1TABE 2A45B 3Q3KA 1CT4E 1NC6A 1RIWC 1C2GA 1P2OA 2ANKH 3LGVA 4ZMAH 4DGJA 4ISOA 1O3CA 3GY6A 4FUDA 1NFYA 1Y3UA 2BQ7B 2OLGA 2ZU3A 1XX9A 3TK9A 1FONA 1DWCH 4NG9H 2A7JA 7ESTE 4A1TA 5K7RA 2ZU2A 4LZ4B 3PLBA 1AE5A 2Z9LA 1AVWA 1SPJA 1SQAA 5AVDA 3HKJB 2AGGX 3FAOA 1WQSA 4WMDA 3SUGA 1SHYA 1CBWB 2PKSC 1T8MA 4TY6A 1VGCC 1P2IA 2Z94A 2V35A 2CV3A 1AZZA 2CHAB 3M3SA 1U6QA 1YKTA 4NIWA 5CHAB 2GZ9A 4I8KA 1Q31A 1FIWA 3Q3YA 3UNQA 2KAIB 1GMHF 2ZHWH 3AW1A 1ELAA 2XC4A 1HDTH 1O3FA 2BLWA 2ZC9H 3LH3A 2VWOA 5JBCS 1GBIA 4JZDH 4MQAA 1GHXH 1OPHB 1FY5A 5LGOA 2PUXB 4WXVA 1TA6A 2VVUA 1V2UT 1FY8E 4HTCH 3BV9B 3QGJA 3M5LA 1H4WA 3E0NB 1NZQH 3FP8E 5FPSA 1GG6C 1HAIH 2XYAA 3A82A 2O8TA 1GJ5H 1T4UH 1BTYA 4D7GA 2D2DA 3E3TA 3F9EA 1AI8H 5FCKA 1A0LA 2WPJS 3VGCB 2BVXH 1YPLH 1ID5H 2C3SA 2Z7FE 4K1EA 5PTPA 5CE1A 3LGWA 1NU9A 1BRCE 1UCYH 1HJ8A 3W95A 3P92A 4R8TB 1TQ0B 4NIVA 4TYDA 4CRDA 1C5PA 1EZSC 2GDEH 2ZA5A 4YZUA 4NWLA 2FOMB 3GCHC 1KDQA 1S85A 2PLXA 3ZZ8A 3ZZ6A 2G00A 4JMYA 4ABEA 1PPHE 4GVUA 2WV5A 2XW9A 3BSQA 5A8XA 1HGTH 1SQTA 5ABWA 3L3TA 2BLVA 5JBBS 1SGIB 1MKWH 1MAYA 1FPCH 3VB5A 4OS2A 5GIBA 3ATIA 2UWOA 3STJA 5EU8A 2O8MA 1WBGB 1PQ8A 5ESTE 1C1OA 5ETXA 2Z9KA 1AWHB 1THPB 4YOGA 2BMGB 4VGCB 4A1VA 5L6NH 4E06H 1O3BA 2XNIA 1ELGA 3F9HA 2GV6A 1HPGA 1CHOF 3TK6A 2BYAX 4BTUB 2QCYA 2PKAB 1YGCH 1GBEA 3ATWA 1UTPA 1AWFH 3B8JA 3F68H 3ZZAA 1UK3A 3SO3A 3A87A 4J2YB 2F9UA 1GCTB 2STBE 1NFWA 1P05A 1NU7B 2FP7B 3ZZ4A 2SGEE 2FMJA 1OWDA 3P8FA 3I77A 2V3OH 3F9GA 1AMHA 3D49H 1EP6A 2OQ5A 1THRH 1SFIA 2BB4A 1JWTA 2ZECA 5FXLA 1W0ZU 1BT7A 3RXLA 1T8OA 2BD7A 1TB6H 4OS7A 5J4SA 3SU6A 1LHFH 1S83A 1F0SA 4XDEA 1C1MA 3RM2H 2AMDA 3M5OA 2A7HA 1ZJKA 2AGEX 2XCFA 3V13A 4X8UH 5GPIB 4YOIA 2W7SA 1IQHA 1FY3A 1HFDA 1T8LA 1HB0B 3TK5A 2PKAA 1ETRH 1ZSJA 5C67A 3BTQE 1JBUH 2ALPA 4UFGH 1Z8RA 1MCVA 1TGNA 1O2SA 1ELBA 2GD4B 3SGAE 1TPAE 2W26A 1AFQC 1SGPE 2UUJB 1WV7H 5TJXA 2BQ6B 3PO1B 5BRRE 3S9CA 1Y59T 4X8TH 4HZHA 2NU2E 2ZGBH 3C1KA 1C5TA 1ZMJA 3U1JB 1O3HA 2GT7A 1QJ1B 1W0YH 4Q7YA 1XUJA 1EASA 4AFSA 5AFZH 3MNBA 4GHTA 3MTYA 1C5LH 1HIAA 5C5OA 3SI3H 5GJ4B 1ACBE 3NK8A 4OS4A 4OS6A 1HYLA 2YOLA 1KXBA 1D4PB 4D7FA 1DWDH 1C5VA 1DITH 1GJBB 4NA8A 3MH6A 1QCPA 4ZH8A 3GDUA 1GI8B 1MU8B 4K5ZA 3K2UA 3RLYH 3T29A 4DY7B 2R3YA 3VXEH 2OC7A 3N7OA 2FOCA 2HNTC 1GVKB 4CRCA 4LK4A 4IW4E 2GTBA 3M37A 4D9RA 4MPWA 5LPFA 4MVNA 4D76A 1D6WA 2GVFA 5GDSH 1PYTD 3ZVGA 3G01A 1O2JA 2XBVA 3T25A 3SQEE 3A80A 3O8BA 2BX4A 2P16A 1WTHD 1ORFA 1UO6A 2ZDLA 1GI1A 2ZU4A 1P8VC 1TRNA 2G4TA 1C2EA 2B7DH 4ZHAA 2VVVA 1DDJA 1F2SE 1P2QA 2ZFQH 3OU0A 4TY7A 5B6OA 5F8ZA 2HVXA 1GBDA 2EC9H 4MDSA 4AGJA 3SJOA 1V6DA 5E0JA 1AE8H 4F49A 1VCQA 4E7NA 3VFEA 1EPTC 2BDGA 2ZQ1A 2Q6FA 1IQGA 1J14A 1TGCA 2F83A 1KSNA 5EQSA 3SJKA 3OYPA 1KTSB 3M36A 1ZHMA 2BXUH 1Z6JH 1XUHA 4XOJA 1SGCA 1D6RA 3BTGE 2DUCA 2GZ8A 2NU0E 4GHQA 1S6FA 1EAIA 3H5CB 2VNTA 3GISB 3UNSA 1GVLA 1NRPH 2BZAA 1AQ7A 2FIRH 3ZVFA 1UHBB 4F4OC 2GT8A 5FX6A 1GBMA 3EA8A 2XBWA 4ZKRU 1O3AA 4NWKA 3P95A 1TGTA 1EAUA 2XBYA 3Q3XA 3KHVA 3GCOA 1RGQA 1KXEA 1HUTH 2CF8H 1N6YA 2NU1E 4I8GA 1XKAC 3PTNA 2P8OC 1UCYK 5FX5A 3LT3A 2V0BA 3PMBB 1ANCA 1GBHA 1C5YB 3BEIB 1B7XB 2AERH 3ZVCA 2A0QB 2R9PA 3SJ8A 2PGBB 3TH4H 3RXTA 2H9EH 3UY9A 1YCPK 4B2BA 3UNRA 5T6GA 1MH0A 2ESTE 3LJOA 1DSUA 2LNCA 1RTLA 1TNIA 1YPHC 2QF3A 1GGDC 5CMXH 2P95A 2UUKB 4WWYA 4X1PU 1GL1A 1UTNA 1VITG 1EOLA 2GCTC 1VJAU 3BTEE 4CHAC 4CBOA 1BJUA 2BLQA 1GJCB 1UHBA 3BG8A 2GMTC 1OWJA 2H6MA 3MHWU 2FWWA 2V3HH 3UFAA 1K22H 2UWLA 1KLJH 2GP9B 2OXSA 1LHGH 1VR1H 5A8YA 2EI8A 3BG4B 3KQEA 4FU9A 1BRAA 1DANH 1O39A 3U8TH 1MTVA 3QDZB 3M7UA 1GJDB 1SMFE 3JZ1B 2BD5A 1KXFA 2O8LA 2W5EA 3K9XB 2PSYA 1F5RA 4NA9H 4O9VA 3UPEA 1YPEH 1PYTC 4XSKU 4K3JA 4MG3A 4K8BA 5GWZA 3QO6A 1G2LA 1OP2A 2VH6A 1OYTH 1UVTH 1BHXF 1E35B 2CXVA 2WUBA 3BEUA 3PWBA 5DJ7A 1TONA 2NU3E 3MU8A 4XFQA 2QYIA 3RP2A 2BLOA 2Z9IA 2BD4A 2P94A 2WYGA 3CP7A 3DFJA 2BD3A 1GMHG 1THSH 1QRZA 4WY3A 1HBTH 4BAQB 1FIZA 7KMEH 2ZHEH 3GCTF 4ABFA 2ZGXH 1BDAA 4JZEH 2FYRA 3MH5A 4UD9H 5DP8A 1C2LA 1FZZA 1YLCA 2ZTZA 1QJ6B 2FS9A 1YCPM 1CU1A 1C5UA 1FUJA 4WMEA 8LPRA 4X2WA 4Z6AH 3KGPA 4UFEH 1AKSB 4OS5A 3GY3A 3HK3B 4CR9A 3KEEA 1Z8GA 3A7ZA 4I8HA 2Z9JA 4IS5A 1GBKA 1IHSH 2D26C 1C1NA 3P8OA 2SGAA 3ZZ5A 3V0XA 5E2PA 1H8DH 5EOKA 1O5BB 4XBDA 4Y8XA 2YNAA 1BTHH 1WUNH 3P6ZB 1LMWB 2GDDA 4X6MA 1HJAB 2OC1A 3ODDA 2ZDVH 2ZNKH 3PTBA 3NCLA 2QAAA 1T31A 4PROA 1L1NA 1LQDB 2ZCHP 1TBQH 1D3DB 2PHBA 1NROH 3T26A 4O03A 3HGNA 1IQJA 2OUAA 1G30B 2R0KA 2ZGJA 1YBWA 1TMBH 3GY8A 4QT8C 4IC5A 5EXMA 4AFZA 2JETB 1GPZA 2TGDA 1MTSA 1QFKH 4Q80A 5FHTA 3BTHE 2BD9A 4TWWA 1CHGA 1GI2A 2C4FH 1FQ3A 4YLQH 1TAWA 4CRGA 2IJOB 2AMQA 4FUGA 2HOBA 3M5MA 1EB1H 4ABDA 1O3MA 4A1XA 1V2TT 1NESE 4WVPE 2A2XH 1YF4A 1ELCA 2VWLA 2ZQ2A 3BIVH 1G3EA 1CHOG 1GDNA 3V7TA 1IQMA 1ZGIA 1F92A 3RMLH 1NPMA 1RIWB 5T6FA 1SL3A 1M9UA 1TRMA 1C5QA 2BD8A 3ATKA 3GYLB 2ILNA 3SBKA 1A4WH 3T27A 3M7TA 2OC0A 1J8AA 2D1JA 5E2OA 5DP7A 1TNHA 1SC8U 1FAKH 4BTIB 5DP6A 1O5CB 1N1LA 1YC0A 1O3GA 1Y8TA 2H5CA 1O2RA 5EXNA 1BTPA 3GY2A 1SLWB 5C5NA 2R2WU 3RC4A 1C1RA 3UR9A 1C2KA 1XVOA 1TGBA 3ZZBA 5F8XA 2OP9A 1ETSH 2HNTF 4AFUA 3NWUA 1XMNB 5A0AE 1EP5A 1DFPA 2PKSB 1BUIA 1D3PB 1YPHE 4NZQA 1P9UA 4BAKB 1LHCH 4X2VA 1G2MA 1WCZA 2A1DB 4AB9A 1DY8A 2Y5GA 4Q7ZA 1WU1A 2HPQH 1W8BH 4B73A 1MD8A 1A2CH 5EGMA 1Z1JA 1DUEA 1SLVB 1O3LA 1TALA 4JZIA 1TIOA 1W13U 4X6PA 1O30A 1UTLM 1YP9A 1GJ9B 1GJ8B 2Q6DA 3SNEA 3PLKA 1K1JA 4IBLH 1G36A 2ZFSA 3RXRA 2PSXA 3KIDU 3UTUH 3TITA 3K65B 3M3TA 4A7IB 4ZUHA 5SGAE 4CH2B 2PV9B 1QB9A 6GCHF 2AIPA 4ZKOU 2VIVA 4Q2KA 1GG6B 3D23A 2FOBA 5EPYA 1EAWA 3V3MA 1DT2A 2J92A 3PV4A 3MU0A 4AYYB 2ZKSA 4JK5A 2I6SA 1N8OC 1TX7A 2P59A 3ZZCA 2SGQE 3P17H 1BMMH 2LPRA 4FUBA 2H1UA 1SGFG 3SV7A 1EZUC 4YO9A 3ZVAA 3MFJA 1ZSKA 1C5WB 1KDQB 4MNYA 3DHKH 3F9FA 2QXJA 1C1UH 1T4VH 1EOJA 1A3BH 4HI3A 4YT6H 2F91A 1FDPA 2ULLA 2ZEBA 4ISHH 3ZZ9A 3BN9A 3HK6B 1P9SA 3H7OA 1BB0B 3M61U 1LDTT 2J34A 1O3EA 3F1SB 2WPLS 3SQHE 5G4BA 2ZF0H 1SSXA 3FP6E 2XCNA 4CREA 1LHEH 4U2WA 5A8ZA 2OD3B 1FXYA 1IHTH 4ZHLU 3RU4T 1UK2A 4INLA 1Q3XA 2B0FA 2TGAA 2ANYA 3IWMA 3LONA 3A81A 3U69H 4AG1A 1C1VH 4INKA 3ZZ3A 1A5GH 1VJ9U 1A3EH 4KKDA 5DG6A 1H9LB 1S0QA 1KIGH 3A86A 3E6PH 4UDWH 3RXPA 5C20A 1QQ4A 1YCPH 2Q1JA 2C8WB 4WH8A 4IGDA 1XUGA 1ABJH 3LC5A 3HPTB 1WYKA 3ITIA 3RXMA 2C8ZB 5CHAC 1QB6A 1TLDA 4B2CA 2ZTYA 4Y76A 4YESB 1CO7E 1DPOA 1GBFA 4GPGA 2XC5A 2BDHA 3SUFA 1PJPA 5JYIA 2FOEA 1IQLA 2Y82A 2ZDMA 2O9QA 1OWHA 1XXDA 5C2ZA 3A8CA 2ZHDA 1HAOH 1MBMA 1G3DA 4MNWA 4NA7A 2AS9A 3LDXH 3RXUA 2QC2A 3P70B 1GL0E 1C1SA 4U01A 2FPZA 1FN6A 2P3TB 4OGYA 1AGJA 4HFPB 1DE7H 1O2IA 1AB9C 1YLDA 1ZGVA 2FODA 3BTTE 3SU1A 3MMGA 3VGCC 2CF9H 3TLOA 1LKBA 1TNLA 4TPIZ 4Y11E 2BHGA 4ISLA 2AGIX 3RXBA 1GI0A 1GBAA 2GCHF 1RTKA 1AIXH 2RA0A 1D3QB 4CR5A 4BAHB 1MTNB 2BM2A 1RJXB 1GJAB 3SNDA
chains in the Genus database with same CATH superfamily
1BQYA 5CHBA 1JRSA 2ZPSA 4CBNA 1BMAA 3AAVA 1H1BA 1AFQB 2FLRH 3MO9A 4Y71A 7GCHF 3D62A 4INHA 2W7UA 5EXLA 1DVAH 2BDCA 2K7XA 4DIIH 1UTJA 1BRUP 1HIAB 1UK4A 1W7GH 1GI9B 1TYNA 1C2IA 5EQQA 3Q77A 1ZRKA 1W3CA 1A5IA 2FZZA 3SV9A 1A61H 1YPMH 1AHTH 1LHDH 3RXKA 1MCTA 2BDAA 2FO9A 5HM9A 3P8GA 2VIPA 3FZZA 4UONA 3TJNA 4O3TA 2SGPE 2J4IA 1ANEA 2JH0D 4ZHMU 1LVBA 3OEHD 4O97A 2J94A 4P02A 1MUEB 3V12A 3SJIA 3SHAH 4VGCC 3ZYDA 1EJMA 1EKBB 3SGBE 4JYUH 1QRXA 1F5KU 1HXEH 1QL9A 5T6DA 1EZXC 4MPXA 3GICB 1O2QA 4TSFD 1XM1A 3EA9A 2FM2A 1D3TB 1FNIA 4ISNA 2QF0A 1SGNE 2ZI2H 2CN0H 5C1XA 1GI4A 4Y7BA 3RMMH 1EJAA 3BTFE 1C5OH 1MD7A 1TA2A 3GCTG 1UTOA 1TX6A 3SU5A 3DFLA 2SGDE 4Y7AA 8GCHF 5GXPA 2VGCB 1O5FH 4UE7H 1Z8IB 2XTTB 2ZWLH 1HAYB 3L6PA 3LOXA 2Y6TA 1K21H 4K60A 4JYTA 1P2JA 1KXDA 1O2OA 2UWPA 5FAHA 2G52A 3DD2H 1FJSA 5JB8S 3AASA 1DM4B 1UTMA 3OX7U 4ISIH 3OY5U 1V2NT 4DG4A 1RRKA 3TGIE 4WJG2 2QXHA 4DVAU 4I8LA 1PQAA 2BOHB 5DP4A 1ESAA 5IK2D 1LPZB 3JZ2B 2ANWA 5C1UA 6CHAC 3VB3A 1K9OE 4KTUA 3RXVA 2HALA 4TWYA 1GMCF 1BBRH 3KQCA 3F0PA 1TQ7B 4H6TA 3R0FA 1XUIA 1O2VA 1IQFA 1OS8A 1S6LA 2ZU1A 1HCGA 1NRSH 3S9AA 3PO1C 1NTPA 4HGCA 3BTKE 1C5MD 3HATH 4H6SB 5F03A 3TNSA 4P00A 1HRTH 1V2KT 3RXIA 1EB2A 4I86A 4AX9H 1HNEE 3FFGA 2VIQA 3GOVB 2QE7D 3ODFA 4D9QA 2BDBA 3WY8A 1EPTA 4JCNA 2H5DA 4A6LA 1FX0B 4UFFH 1HAVA 4AFQA 2R2MB 5EQRA 3OSYA 1Z1IA 2QA9E 4B76A 1O2UA 1GGDB 4I33A 2WUCA 4NFEA 3SORA 1JIMA 2K1QA 1NY22 3RXCA 4CHAB 3MH4A 3NUMA 1XUKA 1TRYA 4NGAH 3E1XB 2J38A 4B6EA 3OFND 4YLUA 1TNKA 5DP3A 1HAXB 1DUAA 1MKXH 1RFNA 2ZIQH 1MBQA 1O2XA 5JB9S 1GHWH 1SVPA 4X1SU 1IQKA 3U9AH 3E0PB 1W12U 1OKXA 2PR3A 1T7CA 4IMQA 3UIRA 1MQ6A 3KQDA 1EJNA 4GCHF 3ATLA 1A0HB 1G37A 2A4GA 4KGAA 1V2WT 4YXWD 1GI3A 4AC9A 1DICA 5H4IB 4YT7H 1J15A 1MZDA 1ELVA 3QK1A 3U28C 1UTKA 1O2NA 2ZGCA 2G5NA 1ZZZA 3T2NA 4K1TA 2A7CA 1EQ9A 2H9TH 3K6ZA 3SV8A 3UUZA 3QZRA 1DLKB 1KLTA 3MU4A 1A1RA 1KXCA 1P2MA 1SGYE 1ZSLA 2QGRA 2ZU5A 2FOHA 1L2EA 3BEFB 3FOAA 2HVYB 2G8TA 1QBNA 1P09A 3A83A 3PMAB 4ABIA 4FUCA 4FUJA 1CSOE 1GHVH 4H42U 4RT1A 1D9IA 1O2KA 1WSSH 1YM0A 3A85A 3LC3A 3PWCA 4BTTB 1QBOA 4NIXA 5J4QA 2JJ2D 5DK1A 4FUFA 3M7QA 2EQNA 4Y6DA 3UQOA 6GCHG 4X6NA 1TBRH 2SGFE 3F3BA 6ESTA 1GHBF 2BY6X 2OK5A 3H7TA 3MU5A 3KN2A 1CA0B 2GV7A 3BF6H 1O34A 4MLFB 3SU3A 1MMJN 1GJ6A 5EODA 3TJVA 1TGSZ 4IN2A 3GY4A 1AN1E 1PQ7A 2BQWB 2PTNA 1O35A 3VXFH 5DP5A 1QBVH 1GHYH 1O3PB 2UUFB 4NSVA 2JJ1D 3Q00A 4X1QU 2WPMS 3I78A 5ESBA 2WPHS 1QA0A 2KR7A 1BMLA 1BIOA 2K8IA 4JZ1A 2F3CE 2D8WA 3ZV9A 4ACAA 2Z3CA 1JXPA 4ZXYH 4ZCNA 2BZ6H 6LPRA 1C5RA 2XOKD 5E0HA 2FOAA 3RM0H 1FY1A 3PYHA 3OTPA 1SFQB 1SGTA 1HV7A 1NFXA 1NBMD 4GSOA 4KELA 1AVXA 1H9HE 4SGAE 1ABIH 1ZRBA 2Z3DA 2OTVA 4K8YA 2H9HA 1V3XA 2TRMA 2AHME 1C4V2 1QL7A 2HNTE 2DE9A 1YPJH 5FPYA 1CQQA 1ZMLA 4OGXA 1JIRA 1O3IA 3URCA 4AORA 1ANDA 3QTOH 2Y5HA 3A7WA 1PPBH 3DSOA 5EJ1A 1CVWH 1E1RD 4KTSA 3RU4D 3SW2B 1PPEE 1C2DA 2J5UA 3TH2H 1BTWA 1C5ZB 5JBAS 4ZROA 3SV6A 1P11E 1ZPCA 3MO6A 1V2ST 1N6XA 1FAXA 2JDID 2RA3A 2P93A 5JDUB 2BY8X 2ZZUH 1OWIA 4RI0A 5EPNA 1SQOA 1S0RA 2AIQA 2W3KA 5C3NA 1KLIH 2ZHQH 2OCVB 1SGQE 3CS0A 1LQEA 5EW2H 2C8XB 1S5SA 3ZZDA 3QX5H 1XKBC 1TMTH 1GHAF 2A4RA 4LZ1H 1EZQA 3RXGA 1SHHB 1QTFA 1UVOA 1V2JT 1O36A 2ZFRH 2FS8A 3ELAH 3M35A 3W94A 2V7QD 1L4DA 2WINI 4DURA 3A8AA 2VVCA 3AW0A 3SUDA 5HXFA 1P02A 1V2LT 2HLDD 3MWIU 2BVSH 4R0IA 3ZVDA 4FUEA 3QWCH 3PROA 4IC6A 1ZPZA 2SNVA 1W7XH 1Z6EA 1CGIE 2GCHG 1BBRK 2ODQA 4X8SH 3UREA 2B5TB 1E37B 1DXWA 3U8OH 1NRQH 4YM9A 3TGKE 4BOHA 3D65E 4X2YA 4D8NA 2ZDNA 1AUJA 1LVOA 2UUYA 1A5HA 4GUXA 5C94A 4XBBA 1QA7A 4AG2A 2ZPRA 1LO6A 3ZVEA 1IQIA 2BX3A 5KGOA 3DT0H 2VBCA 7GCHG 1HJ9A 2KZ4A 1O2TA 1G3CA 1QB1A 3NPSA 1ZLRA 2RCEA 5FCRA 3B23B 4E7RG 4AYVB 4DJZB 9ESTA 5GCHF 3SU2A 3TVJB 2A5KA 3FZDA 1UCYE 4MNVA 5E0GA 1VGCB 1GJ4H 1P3EA 1BMFD 2ZPQA 3GY7A 1ZYOA 2BY7X 2AMPA 2OBOA 1C9PA 1N8OB 1GI5A 1BMNH 2PUQH 1K28D 2SNWA 3PLPA 5HMAA 3OAAD 4Y0YE 2A31A 4X6OA 5IDKA 1FLEE 4O3UA 3VPKA 2EY4C 1V2VT 8KME2 4DIHH 4I7YH 3OY6U 4CRAA 2QF5A 1MKXK 2AFQB 3RC5A 2Y7ZA 1GWAA 3L33A 5AHGH 3TNTA 1HAHH 1VKYA 2BXTH 5EG4A 3SV2H 3RXEA 1O2HA 1W11U 4DT4A 4B74A 1SOTA 2BOKA 1SI5H 3LU9B 1LVMA 1O2MA 2XWAA 1IOEA 4YTAA 1HLTH 2Z9GA 2VH0A 5TCAA 1CGHA 5DGJA 2SFAA 1GBLA 8GCHG 1GDUA 1Y3XA 1E1QD 3CENA 5KEDA 3SGQE 3BIUH 1XXFA 1SGDE 2ZFPH 1C2MA 1ZPBA 1O2WA 3GCNA 3HGPA 4U30A 1V2OT 2QXGA 2LELA 1VCPA 4K2YA 1TFXA 3PB1E 4ABJA 3GCHB 1FN8A 1EXFA 1BHXB 3C27B 1ZHPA 3SN8A 5AF9H 2RDLA 1P10A 2IN2A 1SLXB 3SZEA 4DOQA 3RXQA 1WOFA 3NXPA 2WHXA 2G51A 2J98B 1O2ZA 3O8DA 2NU4E 2J95A 3CS7A 2C8YB 3S9BA 1GMCG 5EIYA 4FU8A 2ZFTA 1OWEA 1O33A 1FPHH 4Z0KA 1MZAA 2L6OA 5BPEA 1S81A 1CGJE 2W3IA 2ZCKP 3VB4A 4Y0ZE 3FP7E 1QQUA 4KP0A 4ABAA 4M7GA 2VJ1A 3EE0B 3MI4A 3NKKA 4BANB 1O32A 1CBWC 2BDYA 1IQEA 3MO3A 1E38B 3UWJH 1AB9B 7LPRA 1NM6A 1V2MT 1TE0A 5L30H 4DT7B 2CHAC 4B71A 1DX5M 4XBCA 3SHCH 3TJOA 5HM2A 3N99A 2Y80A 1L1JA 1YPKH 3E90B 1Y3YA 3QUMP 3FVFB 1K1OA 1O5EH 5EW1H 4FUHA 5C0UA 5FBEA 3M5NA 2KCAA 3KL6A 1A0JA 1ELDE 2B9LA 4MTBA 1UVPA 2KAIA 1AZ8A 3A7YA 1ZTJA 1LPKB 2FDAA 1BA8B 2FX6A 3E16B 4IN1A 2J98A 4XE4A 2G81E 4BAOB 1K2I1 4B2AA 1QR3E 1FY4A 1ZR0A 2FEQH 5JBTA 1SR5C 5L2ZH 5DP9A 4FU7A 1MTWA 1BJVA 4X8VH 3UWIA 4X1RU 2NWNA 1F5LA 1O5AB 1HAZB 1WTGH 2IPQX 4K1SA 4GCHG 1EUFA 3DA9B 4A92A 3AK5A 3RXDA 2ZDAH 3MNSA 3SUEA 2J97A 4FVDA 4ABBA 1H8ED 1KYNA 1SB1H 3EA7A 2A5IA 1DXPA 4AZ2B 4UEHH 3R3GB 2DE8A 1L4ZA 4MPUA 5I46H 1QZ8A 2F9BH 1AU8A 1GMDF 2F9PA 3BTWE 3FN8A 1GCDA 1H8IH 5EJZA 1GI6A 4BXSA 3PM3A 3MH7A 2TPIZ 1NFUA 1FV9A 4UFDH 2WV4A 4BXWA 1C5NH 1P04A 3EAJA 1BBRE 1UJ1A 1MAXA 4NFFA 3S0NA 2PP6A 3A7VA 1GBCA 1P57B 3PMHB 1AUTC 2THFB 2HWLB 2TBSA 1O2LA 3KNXA 1C4U2 3N7EA 1G9IE 1Z8JB 2QV1A 3MNCA 1GBJA 2FI5E 3WWFA 2TIOA 3Q76A 2WPKS 2FX4A 3KCGH 2PTCE 3A84A 2HPPH 1GHBG 2FLBH 2VIDA 1TMUH 2PWXA 4ZXXH 3FANA 1LTOA 1V2QT 1F0RA 3I29A 2CGAA 4MNXA 1NO9H 3NZIA 2IOTA 1Y3WA 1NT1A 1TPSA 2IJD1 4I32A 1C1WH 2STAE 1WQVH 5A0CA 3EGKH 5HGGA 1V2PT 1MTNC 1QL8A 4JZFH 2A4QA 4X1NU 3VB6A 1KXAA 6CHAB 5T1VA 4AB8A 2VINA 1PQ5A 1AFEH 2FI3E 2ODYB 3KQBA 2QY0B 1T32A 1OP8A 1BITA 2GZ7A 4X2XA 2G5VA 1S6HA 1O3OA 2FYQA 2OQUA 3LIWA 1O5DH 1BTUA 1GCTC 1O3NA 1VCWA 2PGQB 2GGVB 1O31A 4A5TS 3QN7A 1T8NA 4Y79A 1PPFE 3RU4E 1GI7B 2A5AA 1EPTB 2AYWA 3IITA 2M5TA 1OX1A 4NZLA 5JPMH 3RXJA 1HAVB 2O8UA 1GBBA 4RKOB 3S69A 4I8JA 3UR6A 2CK3D 1EAXA 2J2UA 2P3FH 2GKVE 2OC8A 3LJJA 2EEKA 1A7SA 3GDVA 3LKWA 3AVZA 1C5SA 1K1PA 1KY9A 3M3VA 1DOJA 2XC0A 1PPGE 2FI4E 1OSSA 1TNJA 4AN7A 1QY6A 2VWMA 4ESTE 4FXGH 1NRRH 2QXIA 3A88A 4DW2U 3QZQA 2YNBA 1B0FA 2K0QA 1K1IA 3SZNA 1C2JA 2Q6GA 1P2KA 2ZFFH 1Q2WA 1ARBA 1Z71A 1QNJA 3LGTA 1O3KA 1AVGH 2HLCA 2FTLE 3ZIAD 1BOQA 2J9NA 4LXBH 4YOJA 2WPIS 1HAGE 2ZTXA 5HIZA 2P8OB 1SGRE 2EA3A 3LPRA 1C2HA 1GHZA 9LPRA 1OOKB 2QN5T 3UOPA 1F7ZA 1TWXB 2A4OA 1W10U 4ZAEA 1OXGA 3U8RH 1GHAG 2L74A 2VGCC 1RXPA 4U32A 3A8BA 2WZQA 3GS9A 1B5GH 3RC6A 5A0BA 1C4Y2 1CT2E 1P06A 3EDXB 4ABHA 1Y5BT 1YWUA 1CE5A 3RXAA 4RSPA 1TOMH 2F9NA 2GCTB 3TIUA 2RG3A 4MPVA 3MOCA 4KTCA 3MYWA 4SGBE 1H9IE 3OTJE 1A46H 1C2FA 1W0JD 2GMTB 4Y10E 2KCPA 2HRVA 5LPEA 1GBTA 3K6YA 2AH4X 3GYMA 4WH6A 1ELFA 3GDSA 2V6NA 1NRNH 2F9VA 3IG6B 3A8DA 4FVBA 1ANBA 4J1YA 1SLUB 3ESTA 1KTTB 2CJIA 8ESTE 1O0DH 3S7KB 1Y3VA 2HGTH 1TPPA 3ZV8A 4NIYA 3GY5A 2VU8E 1E36B 1GDQA 2O8WA 1DS2E 1ESBA 4NCYA 3FO8D 5GCHG 1OP0A 1P2NA 3VG8A 2XWBI 1JMOH 1OYQA 2OINA 3A7XA 3PMJA 3SJ9A 3TPIZ 2XRCA 1C1TA 4Y8ZA 1L1GA 3STIA 1O3JA 3RXHA 3SU4A 4FETA 3PV2A 5DKMA 1S84A 3S7HB 2G55A 1ELEE 3A89A 1UTQA 3RXFA 1O3DA 1BTZA 1ZMNA 3SNAA 5FBIA 3URDA 1LKAA 1TBZH 2ZDKA 2LP6A 1TX8A 1RD3B 2Y5FA 1K1LA 2BVRH 3SNBA 3ZZ7A 1LVYA 2XBXA 3LGYA 5I25A 3F6UH 3E91A 1W14U 2EI6A 2JH5D 4B75A 5DPAA 2C90B 2R3UA 1W2KH 4AOQA 1SBWA 2VB0A 1ZHRA 3UQVA 1SG8B 5L2YH 1ZJDA 1HAPH 3ZVBA 2TGTA 1E0FD 5LH8A 2OBQA 4RT0A 4NSYA 1MKWK 2BY9X 3TH3H 3B9FH 3ZYEA 4IMZA 1O37A 4K69A 4ABGA 1ZTKA 1AD8H 1YYY1 4JYVH 1C5XB 3LH1A 2BY5X 4B1TA 2VIOA 3DSGA 3LGUA 2FTMA 1MU6B 2ALVA 1L0ZA 1V2RT 1K1MA 4CH8B 4TPYA 1ETTH 3SI4H 5C1YA 1O2GH 2GJGA 2WYJA 3T28A 1IQNA 3U98H 1QJ7B 3EBNA 4BNRA 1ESTA 1NN6A 1XVMA 2FOFA 3UOUA 3BTDE 3RXOA 1DLEA 1K1NA 1ZTLA 3EQ0H 1TOCB 1SGEE 3TJUA 2ZGHA 2F9OA 1O5GH 3N7DA 4JK6A 2B8OH 5K0HA 1ELTA 2AEIH 3KF2A 5E8EH 1YLNA 3RUOA 3SNCA 2P3UB 3T5FH 1QGFA 3O8RA 1O38A 2FESH 4WXIA 2JKHA 4GLYA 3BG4C 1RTFB 1TNGA 1TPOA 1E34B 1J17T 1UMAH 1WAYB 3RDZA 3QLPH 3RXSA 1UVSH 1LPGB 4DCDA 1PPCE 1Y5UT 1X7AC 4Y8YA 1PPZA 4Q7XA 3ENSB 3EYDA 1CA0C 3E8LA 2Z6BD 1P01A 1JRTA 1P3CA 2ODPA 1BTXA 3QTVH 1QHRB 4ASHA 2Y81A 3VEQB 5FPTA 4ZKSU 2BD2A 2GX4A 2XNDD 3U1IB 2VWNA 5AFYH 1LCYA 1GVZA 1BZXE 3QGNB 2IPHA 4H4FA 1C9TA 1SOZA 4XD7D 1QRWA 1XUFA 4RKJB 1J9CH 1EATA 2LIZA 4Q63A 3NRLA 3SU0A 1DWEH 4WF8A 2KX4A 4CRBA 1P0SH 1G3BA 2ZP0H 1RS0A 1C1PA 2A2QH 2XXLA 1GJ7B 4THNH 1F0UA 5LPRA 1QURH 1MQ5A 1OWKA 1HXFH 1AY6H 2ZHFH 1S82A 1C1QA 2R0LA 5DO4H 2F4LA 2ZO3H 3HKIB 3RLWH 5A09A 1FMGA 5A2MH 1YPGH 1JOUB 1MTUA 2QIQA 2ASUB 1AKSA 1B0EA 2ANMH 5T3HA 3TU7H 1UW7A 4CRFA 1INCA 1DWBH 2Z3EA 1EX3A 1IAUA 1AO5A 1ARCA 1F0TA 1DY9A 2ZCLP 1BRBE 4LOYH 1O2YA 1GMDG 4FUIA 4BAMB 1G32B 1HJAC 1PFXC 1J16A 1QIXB 1CT0E 1SGFA 2FOGA 3SOSA 4RN6A 5IYTA 3VB7A 1P03A 3A7TA 3T62A 2G4UA 1DSTA 2PFEA 1BCUH 2WPDD 3ATMA 3MU1A 1FI8A 3PV5A 4X0WU 2C93B 1NS3A 3OE7D 1VZQH 2ZG0H 1P12E 4WMFA 2CMYA 2BTCE 3FKSD 4E05H 2JETC 5F8TA 4ZKNU 3AAUA 3MNXA 2A32A 5F6MA 5HYOA 4AGKA 4OS1A 1Y5AT 3TGJE 3P8NA 4OM9A 1ZOMA 3DUXH 3O8CA 2I6QA 2PW8H 3LGIA 3RMNH 2JH6D 2Y7XA 2H2ZA 2VIWA 4GAWA 3BTME 1Z7KA 4Q4LA 4I31A 1VITF 2TGPZ 5TCCA 1O2PA 2EI7A 1VITH 2BDIA 2RDEA 3RMOH 2FXRA 3H09A 1UVUH 1CA8B 1TABE 2A45B 3Q3KA 1CT4E 1NC6A 1RIWC 1C2GA 1P2OA 2ANKH 2KCOA 3LGVA 4ZMAH 4DGJA 4ISOA 1O3CA 3GY6A 4FUDA 1NFYA 1Y3UA 2BQ7B 2OLGA 2ZU3A 1XX9A 3TK9A 1FONA 4HG6A 1DWCH 4NG9H 2A7JA 3PRDA 7ESTE 4A1TA 5HIYA 5K7RA 2ZU2A 4LZ4B 3PLBA 1AE5A 2Z9LA 1AVWA 1SPJA 1SQAA 5AVDA 3HKJB 2AGGX 3FAOA 1WQSA 4WMDA 3SUGA 1K0HA 1SHYA 1CBWB 2PKSC 1T8MA 4TY6A 1VGCC 1P2IA 2Z94A 2V35A 3KYGA 2CV3A 1AZZA 2CHAB 2V3MA 3M3SA 1U6QA 3F2HA 1YKTA 4NIWA 5CHAB 2GZ9A 4I8KA 1Q31A 1FIWA 3Q3YA 3UNQA 2KAIB 1GMHF 3F2GA 2ZHWH 3AW1A 1ELAA 2XC4A 5HKKD 1HDTH 1O3FA 2BLWA 2ZC9H 2F43B 3LH3A 2YMSD 2VWOA 5JBCS 1GBIA 4JZDH 4MQAA 2WV9A 1GHXH 1OPHB 1FY5A 5LGOA 2PUXB 4WXVA 1TA6A 2VVUA 1OHHD 1V2UT 1FY8E 4HTCH 3BV9B 3QGJA 3M5LA 1H4WA 3E0NB 1NZQH 3FP8E 5FPSA 1GG6C 1HAIH 2XYAA 3A82A 2O8TA 1GJ5H 1T4UH 1BTYA 4D7GA 2D2DA 3E3TA 3F9EA 1AI8H 5FCKA 1A0LA 2WPJS 3VGCB 2BVXH 1YPLH 1ID5H 2C3SA 2Z7FE 4K1EA 5PTPA 5CE1A 3LGWA 1NU9A 1BRCE 1UCYH 1HJ8A 3KYFA 1COWD 3W95A 3P92A 4R8TB 1TQ0B 4NIVA 4TYDA 4CRDA 1C5PA 1EZSC 2GDEH 2ZA5A 4YZUA 4NWLA 2FOMB 3GCHC 1KDQA 1S85A 2PLXA 3ZZ8A 5KECA 3ZZ6A 2G00A 4JMYA 4ABEA 1PPHE 4GVUA 2WV5A 2XW9A 3BSQA 5A8XA 1HGTH 1SQTA 5ABWA 3L3TA 2BLVA 5JBBS 1SGIB 1MKWH 1MAYA 1FPCH 3VB5A 4OS2A 5GIBA 3ATIA 2UWOA 3STJA 5EU8A 2O8MA 1WBGB 1PQ8A 5ESTE 1C1OA 5ETXA 2Z9KA 1AWHB 1THPB 4YOGA 2BMGB 4VGCB 4A1VA 5L6NH 4E06H 1O3BA 2XNIA 1ELGA 3F9HA 2GV6A 1HPGA 1CHOF 3TK6A 2BYAX 4BTUB 2QCYA 2PKAB 1YGCH 1GBEA 3ATWA 1UTPA 1AWFH 3B8JA 3F68H 3ZZAA 1UK3A 1WDIA 3SO3A 3A87A 4J2YB 2F9UA 1GCTB 4XRNA 2STBE 1NFWA 1P05A 1NU7B 2FP7B 3ZZ4A 5FL7D 2SGEE 2FMJA 1OWDA 3P8FA 3I77A 2V3OH 3F9GA 1AMHA 3D49H 4B6FA 1EP6A 2OQ5A 1THRH 1SFIA 2BB4A 1JWTA 2ZECA 5FXLA 1W0ZU 1BT7A 3RXLA 1T8OA 2BD7A 1TB6H 4OS7A 3UB0A 5J4SA 3SU6A 1LHFH 1S83A 1F0SA 2YMSC 1NBME 1C1MA 4XDEA 3RM2H 2AMDA 3M5OA 2A7HA 1ZJKA 2AGEX 2XCFA 3V13A 4X8UH 5GPIB 4YOIA 2W7SA 1IQHA 1FY3A 1HFDA 1T8LA 1HB0B 3TK5A 2PKAA 1ETRH 1ZSJA 5C67A 3BTQE 1JBUH 2ALPA 4UFGH 1Z8RA 1MCVA 1TGNA 1O2SA 1ELBA 2GD4B 3SGAE 1TPAE 2W26A 1AFQC 1SGPE 2UUJB 1WV7H 5TJXA 2BQ6B 3PO1B 5BRRE 3S9CA 1Y59T 4X8TH 4HZHA 2NU2E 2ZGBH 3C1KA 1C5TA 1ZMJA 3U1JB 1O3HA 2GT7A 1QJ1B 1W0YH 4Q7YA 1XUJA 1EASA 4AFSA 5AFZH 3MNBA 4GHTA 2JIZD 3MTYA 1C5LH 1HIAA 5C5OA 3SI3H 5GJ4B 1ACBE 3NK8A 4OS4A 4OS6A 1HYLA 2YOLA 1KXBA 1D4PB 4D7FA 1DWDH 1C5VA 1DITH 1GJBB 4NA8A 3MH6A 1QCPA 4ZH8A 3GDUA 1GI8B 1MU8B 4K5ZA 3K2UA 3RLYH 3T29A 4DY7B 2R3YA 3VXEH 2OC7A 3N7OA 2FOCA 2HNTC 1GVKB 4CRCA 4LK4A 4IW4E 2GTBA 3M37A 4D9RA 4MPWA 5LPFA 4MVNA 4D76A 1D6WA 2GVFA 5GDSH 1PYTD 3ZVGA 3CNRA 1O2JA 3G01A 2XBVA 3T25A 3SQEE 3A80A 3O8BA 2BX4A 2P16A 5F53A 1WTHD 1ORFA 1UO6A 2ZDLA 1GI1A 2ZU4A 1P8VC 1TRNA 2G4TA 3DCLA 1C2EA 2B7DH 4ZHAA 2VVVA 1DDJA 1F2SE 1P2QA 2ZFQH 3OU0A 4TY7A 5B6OA 5F8ZA 2HVXA 1GBDA 2EC9H 4MDSA 4AGJA 3SJOA 1V6DA 5E0JA 1AE8H 4F49A 1VCQA 4E7NA 3VFEA 1EPTC 2BDGA 2ZQ1A 2Q6FA 1IQGA 1J14A 1TGCA 2F83A 1KSNA 5EQSA 3SJKA 3OYPA 1KTSB 3M36A 1ZHMA 2BXUH 1Z6JH 1XUHA 4XOJA 1SGCA 1D6RA 3BTGE 2DUCA 2GZ8A 2NU0E 3UAIC 4GHQA 1S6FA 1EAIA 3H5CB 2VNTA 3GISB 3UNSA 1GVLA 1NRPH 2BZAA 1AQ7A 2FIRH 3ZVFA 1UHBB 4F4OC 2GT8A 5FX6A 1GBMA 3EA8A 2XBWA 4ZKRU 1O3AA 4NWKA 3P95A 1TGTA 1EAUA 2XBYA 3Q3XA 3KHVA 3GCOA 1RGQA 1KXEA 1HUTH 2CF8H 1N6YA 2NU1E 4I8GA 1XKAC 3PTNA 2P8OC 1UCYK 5FX5A 3LT3A 2V0BA 3PMBB 1ANCA 1GBHA 1C5YB 3BEIB 1B7XB 2AERH 3ZVCA 2A0QB 2R9PA 3SJ8A 2PGBB 3TH4H 3RXTA 2H9EH 3UY9A 1YCPK 4B2BA 3UNRA 5T6GA 1MH0A 2ESTE 3LJOA 1DSUA 2LNCA 1RTLA 1TNIA 1YPHC 2QF3A 1GGDC 5CMXH 2KM0A 2P95A 2UUKB 4WWYA 4X1PU 1GL1A 1UTNA 1VITG 1EOLA 2GCTC 1VJAU 3BTEE 4CHAC 4CBOA 1BJUA 2BLQA 2RFKC 1GJCB 3WW7A 1UHBA 3BG8A 2GMTC 1OWJA 2H6MA 3MHWU 2FWWA 2V3HH 3UFAA 1K22H 2UWLA 1KLJH 2GP9B 2OXSA 1LHGH 1VR1H 5A8YA 2EI8A 3BG4B 3KQEA 4FU9A 1BRAA 1DANH 1O39A 3U8TH 1MTVA 3QDZB 3M7UA 1GJDB 1SMFE 3JZ1B 2BD5A 1KXFA 2O8LA 2W5EA 3K9XB 2PSYA 1F5RA 2M2AA 4NA9H 4O9VA 1MABB 3F0OA 3UPEA 1YPEH 1PYTC 4XSKU 4K3JA 4MG3A 4K8BA 5GWZA 3DSPA 3QO6A 1G2LA 1OP2A 2VH6A 1OYTH 1UVTH 1BHXF 1E35B 2CXVA 2WUBA 3BEUA 3PWBA 5DJ7A 1TONA 1EFRD 2NU3E 3MU8A 4XFQA 2QYIA 3RP2A 2BLOA 2Z9IA 2BD4A 2P94A 2WYGA 3CP7A 3DFJA 2BD3A 1GMHG 1THSH 1QRZA 4WY3A 1HBTH 4BAQB 1FIZA 4TT3D 2W6JD 2ZHEH 3GCTF 4ABFA 7KMEH 2ZGXH 1BDAA 4JZEH 2FYRA 3MH5A 4UD9H 5DP8A 1C2LA 1FZZA 1YLCA 2ZTZA 3PRBA 3W1EA 5C17A 1QJ6B 2FS9A 1SKYE 3F2FA 1YCPM 1CU1A 1C5UA 1FUJA 4WMEA 8LPRA 4X2WA 4Z6AH 3KGPA 4UFEH 1AKSB 4OS5A 3GY3A 3HK3B 4CR9A 3KEEA 1Z8GA 3A7ZA 4I8HA 2Z9JA 4IS5A 5B6LA 2WSSD 1GBKA 1IHSH 2D26C 1C1NA 3P8OA 2SGAA 3ZZ5A 3V0XA 5E2PA 1H8DH 5EOKA 1O5BB 4XBDA 4Y8XA 2YNAA 5C0TA 1BTHH 1WUNH 3P6ZB 1LMWB 2GDDA 4X6MA 1HJAB 2OC1A 3ODDA 2ZDVH 1KMHB 2ZNKH 3PTBA 3NCLA 2QAAA 1T31A 4PROA 1L1NA 1LQDB 2ZCHP 1TBQH 1D3DB 2PHBA 1NROH 3T26A 4O03A 3HGNA 1IQJA 2OUAA 1G30B 2R0KA 2ZGJA 1YBWA 1TMBH 3GY8A 4QT8C 4IC5A 5EXMA 4AFZA 1WXRA 2JETB 1GPZA 2TGDA 1MTSA 1QFKH 4Q80A 5FHTA 3BTHE 2BD9A 4TWWA 1CHGA 1GI2A 2C4FH 1FQ3A 4YLQH 1TAWA 1SQRA 4CRGA 2IJOB 2AMQA 4FUGA 2HOBA 3M5MA 1EB1H 4ABDA 1O3MA 4A1XA 1V2TT 1NESE 4WVPE 2A2XH 1YF4A 1ELCA 2VWLA 5DN6D 2ZQ2A 3BIVH 1G3EA 1CHOG 1GDNA 3V7TA 1IQMA 1ZGIA 1F92A 3RMLH 1NPMA 1RIWB 5T6FA 1SL3A 1M9UA 1TRMA 1C5QA 2BD8A 3ATKA 3GYLB 2ILNA 3SBKA 1W0KD 1A4WH 3T27A 3M7TA 2OC0A 1J8AA 2D1JA 5E2OA 5DP7A 1TNHA 1SC8U 1FAKH 4BTIB 5DP6A 1O5CB 1N1LA 1YC0A 1O3GA 1Y8TA 2H5CA 3KQ5A 1O2RA 5EXNA 1BTPA 3GY2A 3MQKC 1SLWB 5C5NA 2R2WU 3RC4A 1C1RA 3UR9A 1C2KA 1XVOA 1TGBA 3ZZBA 5F8XA 2OP9A 1ETSH 2HNTF 4AFUA 3NWUA 2W6ID 1XMNB 5A0AE 1EP5A 1DFPA 2PKSB 1BUIA 1D3PB 1YPHE 4NZQA 1P9UA 4BAKB 1LHCH 4X2VA 4F55A 1G2MA 1WCZA 2A1DB 4AB9A 1E79D 1DY8A 2Y5GA 4Q7ZA 3OEED 1WU1A 2HPQH 1W8BH 4B73A 1MD8A 1A2CH 5EGMA 1Z1JA 1DUEA 1SLVB 1O3LA 4ASUD 1TALA 4JZIA 1TIOA 1W13U 4X6PA 1O30A 1UTLM 1YP9A 1GJ9B 1GJ8B 2Q6DA 3SNEA 3PLKA 1K1JA 4IBLH 1G36A 2ZFSA 3RXRA 2PSXA 3KIDU 4ACBA 3UTUH 3TITA 3K65B 3M3TA 4A7IB 4ZUHA 5SGAE 4CH2B 2PV9B 1QB9A 6GCHF 2AIPA 4ZKOU 2VIVA 4Q2KA 1GG6B 3D23A 2FOBA 5EPYA 1EAWA 3V3MA 1DT2A 2J92A 3PV4A 3MU0A 4AYYB 2ZKSA 4JK5A 2I6SA 1N8OC 1TX7A 2P59A 3ZZCA 4F48B 2SGQE 3P17H 1BMMH 2LPRA 4M9FA 4FUBA 2H1UA 5DSFA 1SGFG 3SV7A 1EZUC 4YO9A 3ZVAA 3MFJA 1ZSKA 1C5WB 1KDQB 4MNYA 3DHKH 3F9FA 2QXJA 1C1UH 5EJLA 1T4VH 1EOJA 1A3BH 4HI3A 4YT6H 2F91A 1FDPA 2ULLA 2ZEBA 4ISHH 3ZZ9A 3BN9A 3HK6B 4FOUC 1P9SA 3H7OA 1BB0B 3M61U 1LDTT 2J34A 1O3EA 3F1SB 2WPLS 2KCYA 3SQHE 5G4BA 2ZF0H 1SSXA 3FP6E 2XCNA 4CREA 1LHEH 4U2WA 5A8ZA 2OD3B 1FXYA 1IHTH 4ZHLU 3RU4T 1UK2A 4INLA 1Q3XA 2B0FA 2TGAA 2ANYA 3IWMA 3LONA 3A81A 3U69H 4AG1A 1C1VH 4INKA 3ZZ3A 1A5GH 1VJ9U 1A3EH 4KKDA 5DG6A 1H9LB 1S0QA 1KIGH 3A86A 3E6PH 4UDWH 3RXPA 5C20A 1QQ4A 1YCPH 2Q1JA 2C8WB 4WH8A 4IGDA 1XUGA 1ABJH 3LC5A 3HPTB 1WYKA 3ITIA 3RXMA 2C8ZB 5CHAC 1QB6A 1TLDA 4B2CA 2ZTYA 2KFWA 4Y76A 1CO7E 1DPOA 1GBFA 4GPGA 4YESB 2XC5A 2BDHA 3SUFA 1PJPA 5JYIA 2FOEA 1IQLA 5GNDA 2Y82A 2ZDMA 2O9QA 1OWHA 1XXDA 5C2ZA 3A8CA 2ZHDA 5CDFE 1MBMA 3SYJA 1HAOH 1G3DA 4MNWA 4NA7A 3WWBA 2AS9A 3EE7A 3LDXH 2QF4A 3RXUA 2QC2A 3P70B 1GL0E 1C1SA 4U01A 2FPZA 1FN6A 2P3TB 4OGYA 1AGJA 4HFPB 1DE7H 1O2IA 1AB9C 1YLDA 1ZGVA 2FODA 3BTTE 3SU1A 3MMGA 3VGCC 2CF9H 3TLOA 1LKBA 1TNLA 2YMSB 4TPIZ 1YY3A 4Y11E 2BHGA 4ISLA 2AGIX 3RXBA 1GI0A 1GBAA 2GCHF 1RTKA 1AIXH 2RA0A 1D3QB 4CR5A 1H8HD 4Z1MD 4BAHB 1MTNB 2BM2A 1RJXB 1GJAB 3SNDA
chains in the Genus database with same CATH topology
1BQYA 1JRSA 2ZPSA 4CBNA 1BMAA 3AAVA 1H1BA 1AFQB 2FLRH 3MO9A 4Y71A 7GCHF 3D62A 4INHA 2W7UA 5EXLA 1DVAH 2BDCA 2K7XA 4DIIH 1UTJA 1BRUP 1HIAB 1UK4A 1W7GH 1GI9B 1TYNA 1C2IA 5EQQA 3Q77A 1ZRKA 1W3CA 1A5IA 2FZZA 3SV9A 1A61H 1YPMH 1AHTH 1LHDH 3RXKA 1MCTA 2BDAA 2FO9A 5HM9A 3P8GA 2VIPA 3FZZA 4UONA 3TJNA 4O3TA 2SGPE 2J4IA 1ANEA 2JH0D 4ZHMU 1LVBA 4O97A 2J94A 3V12A 1MUEB 3SJIA 3SHAH 4VGCC 3ZYDA 1EJMA 1EKBB 3SGBE 4JYUH 1QRXA 1F5KU 1HXEH 1QL9A 5T6DA 1EZXC 4MPXA 3GICB 1O2QA 1XM1A 3EA9A 2FM2A 1D3TB 1FNIA 4ISNA 2QF0A 1SGNE 2ZI2H 2CN0H 5C1XA 1GI4A 4Y7BA 3RMMH 1EJAA 3BTFE 1C5OH 1MD7A 1TA2A 3GCTG 1UTOA 1TX6A 3SU5A 3DFLA 2SGDE 4Y7AA 8GCHF 5GXPA 2VGCB 1O5FH 4UE7H 1Z8IB 2XTTB 2ZWLH 1HAYB 3L6PA 3LOXA 2Y6TA 1K21H 4K60A 4JYTA 1P2JA 1KXDA 1O2OA 2UWPA 5FAHA 2G52A 3DD2H 1FJSA 5JB8S 3AASA 1DM4B 1UTMA 3OX7U 4ISIH 3OY5U 1V2NT 4DG4A 1RRKA 3TGIE 4WJG2 2QXHA 4DVAU 4I8LA 1PQAA 2BOHB 5DP4A 1ESAA 1LPZB 3JZ2B 2ANWA 5C1UA 6CHAC 3VB3A 1K9OE 4KTUA 3RXVA 2HALA 4TWYA 1GMCF 1BBRH 3KQCA 1TQ7B 4H6TA 3R0FA 1XUIA 1O2VA 1IQFA 1OS8A 2ZU1A 1HCGA 1NRSH 3S9AA 3PO1C 1NTPA 4HGCA 3BTKE 1C5MD 3HATH 4H6SB 5F03A 3TNSA 1HRTH 1V2KT 3RXIA 1EB2A 4AX9H 1HNEE 3FFGA 2VIQA 3GOVB 3ODFA 4D9QA 2BDBA 3WY8A 1EPTA 4JCNA 2H5DA 4A6LA 4UFFH 1HAVA 4AFQA 2R2MB 5EQRA 3OSYA 1Z1IA 2QA9E 4B76A 1O2UA 1GGDB 4I33A 2WUCA 4NFEA 3SORA 1JIMA 2K1QA 1NY22 3RXCA 4CHAB 3MH4A 3NUMA 1XUKA 1TRYA 4NGAH 3E1XB 2J38A 4YLUA 1TNKA 5DP3A 1HAXB 1DUAA 1MKXH 1RFNA 2ZIQH 1MBQA 1O2XA 5JB9S 1GHWH 1SVPA 4X1SU 1IQKA 3U9AH 3E0PB 1W12U 1OKXA 2PR3A 1T7CA 4IMQA 3UIRA 1MQ6A 3KQDA 1EJNA 4GCHF 3ATLA 1A0HB 1G37A 2A4GA 4KGAA 1V2WT 1GI3A 1DICA 5H4IB 4YT7H 1J15A 1MZDA 1ELVA 3QK1A 1UTKA 1O2NA 2ZGCA 2G5NA 1ZZZA 3T2NA 4K1TA 2A7CA 1EQ9A 2H9TH 3K6ZA 3SV8A 3UUZA 3QZRA 1DLKB 1KLTA 3MU4A 1A1RA 1KXCA 1P2MA 1SGYE 1ZSLA 2QGRA 2ZU5A 2FOHA 1L2EA 3BEFB 2G8TA 1QBNA 1P09A 3A83A 3PMAB 4ABIA 4FUCA 4FUJA 1CSOE 1GHVH 4H42U 1D9IA 1O2KA 1WSSH 1YM0A 3A85A 3LC3A 3PWCA 4BTTB 1QBOA 4NIXA 5J4QA 5DK1A 4FUFA 3M7QA 4Y6DA 3UQOA 6GCHG 4X6NA 1TBRH 2SGFE 6ESTA 1GHBF 2BY6X 3H7TA 3MU5A 3KN2A 1CA0B 2GV7A 3BF6H 1O34A 4MLFB 3SU3A 1MMJN 1GJ6A 5EODA 3TJVA 1TGSZ 4IN2A 3GY4A 1AN1E 1PQ7A 2BQWB 2PTNA 1O35A 3VXFH 5DP5A 1QBVH 1GHYH 1O3PB 2UUFB 4NSVA 4X1QU 3Q00A 2WPMS 3I78A 5ESBA 2WPHS 1QA0A 1BMLA 1BIOA 4JZ1A 2F3CE 2D8WA 3ZV9A 2Z3CA 1JXPA 4ZXYH 6LPRA 2BZ6H 1C5RA 5E0HA 2FOAA 3RM0H 1FY1A 3PYHA 1SFQB 1SGTA 1HV7A 1NFXA 4GSOA 4KELA 1AVXA 1H9HE 4SGAE 1ABIH 1ZRBA 2Z3DA 2OTVA 4K8YA 2H9HA 1V3XA 2TRMA 1C4V2 1QL7A 2HNTE 2DE9A 1YPJH 5FPYA 1CQQA 1ZMLA 4OGXA 1JIRA 1O3IA 3URCA 4AORA 1ANDA 3QTOH 2Y5HA 3A7WA 1PPBH 1CVWH 4KTSA 3RU4D 3SW2B 1PPEE 1C2DA 3TH2H 1BTWA 1C5ZB 5JBAS 4ZROA 3SV6A 1P11E 1ZPCA 3MO6A 1V2ST 1N6XA 1FAXA 2RA3A 2P93A 5JDUB 2BY8X 2ZZUH 1OWIA 5EPNA 1SQOA 1S0RA 2AIQA 2W3KA 5C3NA 1KLIH 2ZHQH 2OCVB 1SGQE 3CS0A 1LQEA 5EW2H 2C8XB 1S5SA 3ZZDA 3QX5H 1XKBC 1TMTH 1GHAF 2A4RA 4LZ1H 1EZQA 3RXGA 1SHHB 1QTFA 1UVOA 1V2JT 1O36A 2ZFRH 2FS8A 3ELAH 3M35A 3W94A 1L4DA 2WINI 4DURA 3A8AA 2VVCA 3AW0A 3SUDA 5HXFA 1P02A 1V2LT 3MWIU 2BVSH 4R0IA 3ZVDA 4FUEA 3QWCH 3PROA 4IC6A 1ZPZA 2SNVA 1W7XH 1Z6EA 1CGIE 2GCHG 1BBRK 2ODQA 4X8SH 3UREA 2B5TB 1E37B 1DXWA 3U8OH 1NRQH 4YM9A 3TGKE 4BOHA 3D65E 4X2YA 4D8NA 2ZDNA 1AUJA 1LVOA 2UUYA 1A5HA 4GUXA 4XBBA 1QA7A 4AG2A 2ZPRA 1LO6A 3ZVEA 1IQIA 2BX3A 3DT0H 7GCHG 1HJ9A 1O2TA 1G3CA 1QB1A 3NPSA 1ZLRA 2RCEA 5FCRA 3B23B 4E7RG 4AYVB 4DJZB 9ESTA 5GCHF 3SU2A 3TVJB 2A5KA 3FZDA 1UCYE 4MNVA 5E0GA 1VGCB 1GJ4H 1P3EA 2ZPQA 3GY7A 1ZYOA 2BY7X 2AMPA 2OBOA 1C9PA 1N8OB 1GI5A 1BMNH 2PUQH 1K28D 2SNWA 3PLPA 5HMAA 4Y0YE 2A31A 4X6OA 5IDKA 1FLEE 4O3UA 3VPKA 1V2VT 8KME2 4DIHH 4I7YH 3OY6U 4CRAA 1MKXK 2AFQB 3RC5A 2Y7ZA 1GWAA 3L33A 5AHGH 3TNTA 1HAHH 2BXTH 5EG4A 3SV2H 3RXEA 1O2HA 1W11U 4B74A 1SOTA 2BOKA 1SI5H 3LU9B 1LVMA 1O2MA 2XWAA 1IOEA 4YTAA 1HLTH 2Z9GA 2VH0A 5TCAA 1CGHA 5DGJA 2SFAA 1GBLA 8GCHG 1GDUA 1Y3XA 3CENA 3SGQE 3BIUH 1XXFA 1SGDE 2ZFPH 1C2MA 1ZPBA 1O2WA 3GCNA 3HGPA 4U30A 1V2OT 2QXGA 1VCPA 4K2YA 1TFXA 3PB1E 4ABJA 3GCHB 1FN8A 1EXFA 1BHXB 3C27B 1ZHPA 3SN8A 5AF9H 2RDLA 1P10A 2IN2A 1SLXB 4DOQA 3RXQA 1WOFA 3NXPA 2G51A 1O2ZA 3O8DA 2NU4E 2J95A 3CS7A 2C8YB 3S9BA 1GMCG 4FU8A 2ZFTA 1OWEA 1O33A 1FPHH 4Z0KA 1MZAA 5BPEA 1S81A 1CGJE 2W3IA 2ZCKP 3VB4A 4Y0ZE 3FP7E 1QQUA 4KP0A 4ABAA 4M7GA 2VJ1A 3EE0B 3MI4A 3NKKA 4BANB 1O32A 1CBWC 2BDYA 1IQEA 3MO3A 1E38B 3UWJH 1AB9B 7LPRA 1NM6A 1V2MT 1TE0A 5L30H 4DT7B 2CHAC 4B71A 1DX5M 4XBCA 3SHCH 3TJOA 5HM2A 2Y80A 1L1JA 1YPKH 3E90B 1Y3YA 3QUMP 3FVFB 1K1OA 1O5EH 5EW1H 4FUHA 5FBEA 3M5NA 3KL6A 1A0JA 1ELDE 2B9LA 4MTBA 1UVPA 2KAIA 1AZ8A 3A7YA 1ZTJA 1LPKB 2FDAA 1BA8B 2FX6A 3E16B 4IN1A 4XE4A 2G81E 4BAOB 1K2I1 4B2AA 1QR3E 1FY4A 1ZR0A 2FEQH 5JBTA 1SR5C 5L2ZH 5DP9A 4FU7A 1MTWA 1BJVA 4X8VH 3UWIA 4X1RU 2NWNA 1F5LA 1O5AB 1HAZB 1WTGH 4K1SA 4GCHG 1EUFA 3DA9B 4A92A 3RXDA 2ZDAH 3MNSA 3SUEA 4FVDA 4ABBA 1KYNA 1SB1H 3EA7A 2A5IA 1DXPA 4AZ2B 4UEHH 3R3GB 2DE8A 1L4ZA 4MPUA 5I46H 2F9BH 1AU8A 1GMDF 2F9PA 3BTWE 1GCDA 1H8IH 1GI6A 4BXSA 3PM3A 3MH7A 2TPIZ 1NFUA 1FV9A 4UFDH 2WV4A 4BXWA 1C5NH 1P04A 3EAJA 1BBRE 1UJ1A 1MAXA 4NFFA 3S0NA 3A7VA 1GBCA 1P57B 3PMHB 1AUTC 2THFB 2HWLB 2TBSA 1O2LA 3KNXA 1C4U2 1G9IE 1Z8JB 2QV1A 3MNCA 1GBJA 2FI5E 2TIOA 3Q76A 2WPKS 2FX4A 3KCGH 2PTCE 3A84A 2HPPH 1GHBG 2FLBH 2VIDA 1TMUH 2PWXA 4ZXXH 3FANA 1LTOA 1V2QT 1F0RA 3I29A 2CGAA 4MNXA 1NO9H 3NZIA 2IOTA 1Y3WA 1NT1A 1TPSA 4I32A 1C1WH 2STAE 1WQVH 5A0CA 3EGKH 5HGGA 1V2PT 1MTNC 1QL8A 4JZFH 2A4QA 4X1NU 3VB6A 1KXAA 6CHAB 4AB8A 2VINA 1PQ5A 1AFEH 2FI3E 2ODYB 3KQBA 2QY0B 1T32A 1OP8A 1BITA 2GZ7A 4X2XA 2G5VA 1S6HA 1O3OA 2FYQA 2OQUA 3LIWA 1O5DH 1BTUA 1GCTC 1O3NA 1VCWA 2PGQB 2GGVB 1O31A 4A5TS 3QN7A 1T8NA 4Y79A 1PPFE 3RU4E 1GI7B 2A5AA 1EPTB 2AYWA 3IITA 2M5TA 1OX1A 4NZLA 5JPMH 3RXJA 1HAVB 2O8UA 1GBBA 4RKOB 3S69A 4I8JA 3UR6A 1EAXA 2J2UA 2P3FH 2GKVE 2OC8A 3LJJA 2EEKA 1A7SA 3GDVA 3LKWA 3AVZA 1C5SA 1K1PA 1KY9A 3M3VA 1DOJA 2XC0A 1PPGE 2FI4E 1OSSA 1TNJA 4AN7A 1QY6A 2VWMA 4ESTE 4FXGH 1NRRH 2QXIA 3A88A 4DW2U 3QZQA 2YNBA 1B0FA 1K1IA 3SZNA 1C2JA 2Q6GA 1P2KA 2ZFFH 1Q2WA 1ARBA 1Z71A 1QNJA 3LGTA 1O3KA 1AVGH 2HLCA 2FTLE 1BOQA 2J9NA 4LXBH 4YOJA 2WPIS 1HAGE 2ZTXA 2P8OB 1SGRE 2EA3A 3LPRA 1C2HA 1GHZA 9LPRA 1OOKB 2QN5T 3UOPA 1F7ZA 1TWXB 2A4OA 1W10U 4ZAEA 1OXGA 3U8RH 1GHAG 2VGCC 1RXPA 4U32A 3A8BA 1B5GH 3RC6A 5A0BA 1C4Y2 1CT2E 1P06A 3EDXB 4ABHA 1Y5BT 1CE5A 3RXAA 4RSPA 1TOMH 2F9NA 2GCTB 3TIUA 2RG3A 4MPVA 3MOCA 4KTCA 3MYWA 4SGBE 1H9IE 3OTJE 1A46H 1C2FA 2GMTB 4Y10E 2HRVA 5LPEA 1GBTA 3K6YA 2AH4X 3GYMA 4WH6A 1ELFA 3GDSA 2V6NA 1NRNH 2F9VA 3IG6B 3A8DA 4FVBA 1ANBA 4J1YA 1SLUB 3ESTA 1KTTB 2CJIA 8ESTE 1O0DH 3S7KB 1Y3VA 2HGTH 1TPPA 3ZV8A 4NIYA 3GY5A 2VU8E 1E36B 1GDQA 2O8WA 1DS2E 1ESBA 4NCYA 5GCHG 1OP0A 1P2NA 2XWBI 1JMOH 1OYQA 2OINA 3A7XA 3PMJA 3SJ9A 3TPIZ 2XRCA 1C1TA 4Y8ZA 1L1GA 3STIA 1O3JA 3RXHA 3SU4A 5DKMA 1S84A 3S7HB 2G55A 1ELEE 3A89A 1UTQA 3RXFA 1O3DA 1BTZA 1ZMNA 3SNAA 5FBIA 3URDA 1LKAA 1TBZH 2ZDKA 1TX8A 1RD3B 2Y5FA 1K1LA 2BVRH 3SNBA 3ZZ7A 1LVYA 2XBXA 3LGYA 5I25A 3F6UH 3E91A 1W14U 2EI6A 2JH5D 4B75A 5DPAA 2C90B 2R3UA 1W2KH 4AOQA 1SBWA 2VB0A 1ZHRA 3UQVA 1SG8B 5L2YH 1ZJDA 1HAPH 3ZVBA 2TGTA 1E0FD 5LH8A 2OBQA 4NSYA 1MKWK 2BY9X 3TH3H 3B9FH 3ZYEA 4IMZA 1O37A 4K69A 4ABGA 1ZTKA 1AD8H 1YYY1 4JYVH 1C5XB 3LH1A 2BY5X 4B1TA 2VIOA 3LGUA 2FTMA 1MU6B 2ALVA 1L0ZA 1V2RT 1K1MA 4CH8B 4TPYA 1ETTH 3SI4H 5C1YA 1O2GH 2WYJA 3T28A 1IQNA 3U98H 1QJ7B 3EBNA 4BNRA 1ESTA 1NN6A 1XVMA 2FOFA 3UOUA 3BTDE 3RXOA 1DLEA 1K1NA 1ZTLA 3EQ0H 1TOCB 1SGEE 3TJUA 2ZGHA 2F9OA 1O5GH 4JK6A 2B8OH 5K0HA 1ELTA 2AEIH 3KF2A 5E8EH 3RUOA 3SNCA 2P3UB 3T5FH 1QGFA 3O8RA 1O38A 2FESH 4WXIA 2JKHA 4GLYA 3BG4C 1RTFB 1TNGA 1TPOA 1E34B 1J17T 1UMAH 1WAYB 3RDZA 3QLPH 3RXSA 1UVSH 1LPGB 4DCDA 1PPCE 1Y5UT 1X7AC 4Y8YA 1PPZA 4Q7XA 3ENSB 3EYDA 1CA0C 3E8LA 2Z6BD 1P01A 1JRTA 1P3CA 2ODPA 1BTXA 3QTVH 1QHRB 4ASHA 2Y81A 3VEQB 5FPTA 4ZKSU 2BD2A 2GX4A 3U1IB