3VB5A

Crystal structure of sars-cov 3c-like protease with c4z
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
total genus 85
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb5A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb5A02
1GI9B 1ELCA 4ZXYH 1V2LT 1BCUH 1GBHA 1SGFG 1TMTH 4HZHA 3KEEA 4TWWA 1QQUA 1MBMA 2FESH 1O2YA 1CA0C 3O8BA 1MZAA 1V2TT 4GUXA 1EX3A 3OSYA 1ZTKA 3A89A 3TVJB 2GVFA 4UFGH 4TPIZ 4X1SU 2ZEBA 2VJ1A 3ZZ7A 1UK3A 3DFJA 1BTZA 3SU4A 3BF6H 1MQ5A 2Y7XA 4UEHH 2R0KA 1ETSH 4I8LA 2JH5D 2A4GA 2Z3DA 2PKSB 1AVWA 1INCA 3PM3A 5DP6A 1O2ZA 1GMCF 5DP8A 5IYTA 1BRCE 1GG6B 3SN8A 4ZH8A 1C1TA 2DE8A 2GV6A 5A8ZA 4DJZB 4GPGA 1YYY1 1P04A 2P8OC 5GJ4B 2WPJS 4FUDA 3SHAH 1SLVB 5F8ZA 5FAHA 4AG2A 1K1MA 3BSQA 1E0FD 1ZHPA 3U8OH 1DM4B 4I8KA 1QTFA 5A2MH 1H8IH 2G55A 2GZ7A 1AFQB 1CHOG 1N6XA 1OKXA 2XTTB 2UWPA 1FN6A 4I31A 2ZP0H 4Y7BA 3E0PB 3QWCH 3TH4H 4MPVA 2G52A 1JRTA 3KGPA 4ISHH 3UQOA 1EZUC 4D8NA 4M7GA 3H7TA 1O5CB 1C2IA 3VEQB 4NG9H 5K7RA 2D8WA 5BRRE 2IN2A 1OXGA 3NWUA 4GCHF 1UCYE 2XRCA 2PR3A 2C90B 1UTJA 4QT8C 5HXFA 3V12A 4CBNA 3MO3A 2JETB 3RLYH 4IMZA 3RXLA 3BTKE 4TPYA 2ZA5A 1EASA 4YESB 1XKAC 1AI8H 3Q76A 4K8YA 2BY6X 4OS1A 4NA8A 2HNTF 4NZLA 2FOEA 1YPGH 2BDCA 3UWIA 3BTEE 2FLRH 1G3DA 4PROA 3DT0H 2HPPH 3KQBA 3U1JB 3M5OA 1DY9A 3SU6A 2AS9A 3RU4D 2Z7FE 2WPLS 4ZKRU 1NRNH 3O8RA 3MU4A 4ISNA 1YGCH 1JIMA 3SUFA 2CHAC 2QGRA 1ZZZA 5JBTA 1X7AC 3NK8A 1C5RA 1C5LH 5IDKA 4O9VA 3W95A 1VGCB 3S0NA 1NESE 2UUYA 3Q3KA 1P2KA 2G00A 3HKIB 1GJ7B 2ODQA 2EC9H 4MLFB 3M7UA 1VZQH 1TRYA 2FOGA 3SGQE 1GHZA 4HI3A 1QBVH 1ZSKA 2OINA 3JZ2B 5T3HA 5F8XA 1NPMA 4YLQH 3W94A 1T8MA 4Y10E 1QL8A 5LPFA 1RTLA 1MZDA 1N8OC 2D2DA 1O5FH 2P93A 1PQ5A 1TA2A 3SZNA 2VIOA 4U30A 9ESTA 4CH8B 1ANCA 2CF9H 2QF3A 2P16A 1EJAA 2ZTZA 2AGGX 3OU0A 4IN1A 2B8OH 1GVKB 4MPWA 3GDSA 3ENSB 1G2LA 3RXBA 4UONA 5PTPA 1BTWA 1AB9C 1W2KH 4SGAE 1FQ3A 1FMGA 3AAVA 4CRBA 3QX5H 1S84A 3RC5A 1MKWK 5FX5A 3PB1E 3O8CA 1P06A 3L3TA 1BMMH 5FCRA 3ZYEA 4FXGH 1GI7B 1QB9A 1O31A 4WF8A 3NZIA 2B0FA 3GY4A 3UNRA 3TLOA 5HYOA 3RXEA 2BLWA 3ATMA 5E2PA 1ARBA 3P6ZB 1P9SA 2J38A 1GMHG 3MI4A 5ESBA 1A0HB 3O8DA 3LGTA 1C1VH 1MAXA 4DIHH 3BEFB 4BAMB 1FIWA 4D9QA 1TB6H 1HAIH 1TGSZ 1T8LA 2SGAA 1AE8H 1UHBB 2WV4A 1Z6EA 4Y7AA 2TGTA 5CMXH 1YPHE 2D1JA 2P3UB 3N7OA 3NPSA 1OYTH 1Y3XA 1OWIA 3B8JA 5L2ZH 2BB4A 1TQ0B 8GCHG 1ZRBA 2GD4B 2P3FH 4RSPA 5C1XA 3ATLA 2GTBA 1BRBE 1P2NA 1ANEA 3BTQE 7GCHF 4K69A 3K9XB 3ZVEA 1C5MD 1KIGH 2FOBA 1VITG 2M5TA 3KQDA 2B9LA 2F83A 1V2MT 1O32A 3FFGA 4WH6A 3MOCA 1MKWH 1BJUA 1ANDA 1MTNC 1BTYA 3RXSA 1BZXE 2QCYA 1NRPH 1NFXA 5E0HA 2IOTA 3BV9B 1DVAH 1NFWA 2ZPSA 1GJCB 2BXUH 1NZQH 3BTHE 2G8TA 1EB2A 2G5VA 3IWMA 1L1JA 5F03A 1GBFA 1ABJH 1K28D 1C2EA 1GG6C 1CBWC 2BDAA 2FOFA 4Q7YA 3RM0H 1VITH 1XUHA 2J92A 1SGTA 2BDYA 1LO6A 3MNCA 3M7QA 1QGFA 3SNAA 1JXPA 1MU6B 3UPEA 2FWWA 3PO1B 5T6DA 2PFEA 2G51A 1HJAC 1IQIA 1UTNA 3MHWU 2ZDVH 1TX7A 1GI2A 2XWAA 5DP4A 3GCOA 2VU8E 1LVMA 4LZ4B 3IITA 1QURH 1A3BH 1DT2A 1C1SA 3A7WA 3SUDA 3UR9A 2ZQ1A 2J95A 3HGNA 4UFEH 2YOLA 3UUZA 3VXEH 4CRAA 1GJ6A 3F1SB 2GX4A 1DWEH 3RMLH 1K9OE 1S0RA 4KP0A 2QXJA 1C2LA 5AFZH 1RXPA 2RG3A 2GCHF 1W3CA 1CGJE 2JETC 2AMPA 1GCDA 3LGVA 3LPRA 2IJOB 4I33A 1SMFE 3V7TA 1BTHH 1HAYB 1P05A 5ABWA 4ISIH 2ZG0H 2ZHDA 1RIWB 2ZDAH 2ZFQH 1QB1A 1QL9A 1HDTH 5I46H 3PLBA 1ESTA 4AX9H 1THRH 2VIDA 3QK1A 1Z71A 1K1PA 1GMDF 2PKAA 1O3GA 2PKAB 2FOAA 2GT7A 1MD8A 1V2VT 2EEKA 1OWKA 3KNXA 2OC0A 1GMCG 2TGDA 1AQ7A 1BTUA 1KXEA 3D65E 1DUEA 2XBWA 1C5ZB 3KL6A 3F6UH 2A2XH 3SNEA 1FZZA 2Z3EA 1HIAA 1TRMA 1SB1H 3T29A 1C1MA 1ZMNA 1IQJA 4NIVA 3LIWA 4CRFA 1O3EA 2OBOA 1ANBA 5JBAS 1OYQA 3EA7A 5EXMA 2XC0A 4AORA 4NSVA 2YNBA 1BTXA 1TBZH 3RXGA 4AFUA 4ZKOU 4ZKNU 3M3TA 5JDUB 4RKJB 3EGKH 1J17T 1MCTA 1C5TA 3D49H 4K2YA 1O2NA 5GPIB 3M61U 1TQ7B 1B0FA 2ZC9H 1SFIA 4JMYA 2NU2E 3BIUH 3CP7A 4H6TA 1KLIH 1NU9A 1ZSLA 1XVMA 1DS2E 4GCHG 1GVLA 1AZ8A 3MH5A 1V2JT 4NIYA 4Y8XA 1BHXB 4DIIH 2W7SA 3TPIZ 3RXAA 1T4UH 3TH2H 3RC4A 5G4BA 2SGQE 1J16A 1HPGA 3TK9A 2WPIS 1IQKA 1BA8B 3UQVA 4Y71A 1ZYOA 1ELAA 1KXBA 1ELGA 3A88A 1GBAA 1GPZA 4I8GA 1GDQA 4Y8ZA 4NFEA 2HWLB 3PROA 4WJG2 8GCHF 1AWFH 1AGJA 2O9QA 1TALA 2XBYA 1IQMA 3A87A 1F0RA 1KTSB 3KN2A 3ZVFA 1YCPM 1UVSH 3GISB 1Z7KA 3WY8A 1H1BA 1TOCB 4XBBA 3GY3A 1TRNA 2FYRA 4WVPE 4LZ1H 2HGTH 1YPHC 4IC6A 3UY9A 5EGMA 1NFYA 1C2FA 1J9CH 5T6FA 1NROH 3SQHE 2KAIA 2KAIB 3VPKA 3LC3A 3TJUA 1PQAA 4FUBA 3LGIA 5DK1A 2Y7ZA 5JPMH 3ZZDA 4F4OC 1RS0A 5FX6A 3TH3H 5FPYA 2PW8H 1FN8A 4CRDA 3SUEA 4JZEH 1GBLA 7LPRA 1SHHB 1XUGA 2BQ7B 1AIXH 1YKTA 2PWXA 5A8YA 4H42U 1BDAA 1ZGIA 1Y3WA 4NZQA 4FUIA 2SGPE 2FYQA 2CN0H 2Q1JA 3BG4B 5TJXA 3A7YA 1JOUB 1F0SA 1V2ST 1P8VC 1T8OA 5JB9S 3M3SA 4OS6A 2ZCHP 5C1YA 3SO3A 5EODA 4AYVB 1IQHA 1W13U 1UK4A 2GT8A 1O35A 1HAXB 1O37A 1G36A 2A31A 3SU2A 3FP7E 1O33A 1ETRH 3M37A 2B7DH 6CHAC 1TNIA 1MUEB 4B74A 1ZOMA 3RM2H 2ODYB 1C2GA 3STJA 1EPTC 4KTSA 1S5SA 4GVUA 4O3TA 3BIVH 1HYLA 1O2RA 4R8TB 5LGOA 2F9PA 3PO1C 1UTLM 2FOCA 4O03A 3DA9B 1RTKA 3EA8A 2ZNKH 2A5IA 1WTGH 2VWNA 1WQVH 2O8WA 4CBOA 2C8WB 1UTOA 3FP8E 1PQ7A 3VB6A 1GBKA 3GICB 2H2ZA 4X2XA 1S85A 1VR1H 1EP5A 3GYLB 3A7XA 2JH0D 3ZZBA 4JCNA 5FXLA 2BXTH 2AMDA 4CH2B 4O3UA 3RU4T 3MH7A 2PUQH 1DANH 3AASA 2FX4A 3QN7A 1Y3UA 4KELA 4YM9A 1P2MA 1EAUA 1LQEA 1MKXH 3VGCB 2QA9E 2J94A 7GCHG 2H1UA 2AYWA 3KF2A 1PJPA 1C1NA 1EZSC 4Q2KA 4K1TA 2VIQA 1UK2A 1NTPA 3SV2H 1V6DA 3ATIA 2BDHA 1CT4E 1BRAA 4TYDA 2HNTC 4JYUH 2ZDMA 4ZKSU 3CENA 4YO9A 1CGIE 1XUIA 4OGXA 2BD8A 1MTUA 1GGDC 1DSTA 5E0JA 1EOJA 1JMOH 4JZ1A 1PPBH 1HAHH 3ZVGA 3F9EA 1ZGVA 2QIQA 1BTPA 1SG8B 4ABDA 1GI8B 4Q7XA 5JB8S 1AZZA 2PV9B 1ETTH 2VIPA 4IGDA 3BTFE 2OP9A 1LPZB 4YLUA 4NA7A 5EW1H 5FBIA 3E16B 1C9TA 1EAXA 5T6GA 2ZGJA 1TNGA 1IQFA 2WINI 1V2NT 1DE7H 3E3TA 3A83A 5BPEA 1TE0A 3NXPA 1A61H 1AE5A 3U98H 2ANYA 3A8AA 3GCTF 2Q6GA 1YLCA 4Y79A 2V0BA 4INKA 4R0IA 2HLCA 2FI5E 5EU8A 3A7TA 1C1OA 1WV7H 1Y8TA 1MQ6A 1C5PA 1NS3A 1E36B 4U32A 3ZZ5A 1W0ZU 1HJ8A 2BVSH 5C1UA 2Y81A 3E0NB 3PYHA 3SNDA 3M5LA 4Y0ZE 2QXGA 2AFQB 1O38A 3RLWH 1H9IE 4F49A 1EP6A 1TPSA 4JZFH 5L2YH 1LKBA 2OQ5A 1F2SE 4FUJA 1DWBH 3LC5A 2ZFRH 5SGAE 1A7SA 4BAOB 2GCHG 1AVGH 2Z9LA 1O2GH 2FS9A 4Y0YE 5C3NA 1S6HA 2H9EH 1FJSA 1WQSA 2NWNA 4YZUA 1VCPA 1WAYB 2GCTB 5LPEA 1ELVA 1KLJH 1T32A 1V2UT 1EJMA 1F92A 1SOZA 3KQCA 2BDBA 5EQSA 4ZHAA 1N1LA 3K6YA 2ESTE 3RXRA 3QUMP 2BOKA 1YPKH 1SHYA 5GIBA 1A1RA 2WPKS 3QTVH 3QTOH 1FY3A 1ELEE 2BDIA 4NWKA 1XMNB 1BOQA 1GMDG 1KSNA 1GBCA 1FDPA 1ZJDA 1C2DA 4MG3A 4CREA 4IN2A 1WU1A 1F0UA 7KMEH 1SQAA 5DPAA 4TY6A 3T2NA 1SGCA 1ZMLA 2FTLE 5EXLA 4AN7A 2BY9X 2GDEH 2AIQA 5DO4H 2RA0A 1ABIH 2LPRA 2ZDLA 2ULLA 1GBDA 1UTMA 4JYVH 1LPGB 1V2KT 1KLTA 1W7XH 2ZKSA 4MNWA 1PPEE 4X1QU 3F9FA 1F7ZA 1AKSA 1L4ZA 2Q6FA 1AKSB 1DLKB 4KTUA 1GJBB 4WY3A 1OP8A 1P10A 3T26A 2QN5T 1SSXA 2Y80A 1ELBA 2FMJA 1GI4A 2GGVB 2QYIA 2FP7B 3MNSA 2ZCKP 2GMTC 1BHXF 4TWYA 1A5IA 1O5EH 5C5OA 2ZFSA 1TBQH 4YT6H 3LH1A 1CT2E 3HK6B 4NIWA 2PSYA 2VB0A 3EAJA 1BQYA 3I77A 2BD7A 1GHAF 5A09A 5TCCA 1GDUA 3MYWA 2EI6A 2XBVA 3LONA 2H9HA 1O3OA 3DUXH 3MMGA 1XUJA 3T62A 2C8ZB 3M5NA 2ZIQH 1OP2A 3ZZ9A 1KY9A 3U69H 1NM6A 4B71A 2BQWB 2QF0A 2FIRH 1KTTB 1AUJA 1Y3YA 2BD5A 3E6PH 3SV6A 1O39A 2ZHFH 4OGYA 1D3PB 2ZU4A 1K1IA 4AG1A 2FOHA 4GHQA 3UNQA 3UTUH 1KXFA 1SQOA 5EXNA 1UTKA 1K22H 1QIXB 3OY6U 4MNYA 5CHAC 1GJ8B 2A7CA 4XBDA 1OWEA 3SU5A 2OD3B 1GHXH 3K6ZA 3V3MA 3MO9A 1O3IA 2AH4X 1Z6JH 1AUTC 3RC6A 2VNTA 3I78A 1C2JA 2WUBA 1YPEH 1GJ4H 2SNWA 2RA3A 3SNCA 3T25A 1WUNH 2R9PA 8KME2 2UUJB 1MBQA 4WMDA 1SLUB 2A32A 3V13A 2QV1A 1LQDB 1DPOA 2F3CE 1YF4A 5FPTA 1ZPCA 5DJ7A 2AEIH 3MNXA 5FBEA 3UOPA 2A45B 2VWOA 4MVNA 1O5BB 1FY1A 1AO5A 1SLWB 2HPQH 4AB8A 2H6MA 2NU4E 2ZFPH 1OSSA 1TNLA 3VGCC 3VXFH 3S7HB 2PKSC 3HK3B 3P8NA 5LPRA 1GHBF 1G37A 2BMGB 4IC5A 1OOKB 6LPRA 4A7IB 1P01A 1C1UH 2C8YB 5K0HA 1TX6A 3BTGE 2RDLA 3ODDA 2WV5A 3QLPH 4X6NA 1EB1H 2GP9B 4ZMAH 3E8LA 1IQGA 7ESTE 3A8DA 2FO9A 3TGKE 3ZZ4A 1CVWH 4MTBA 3E91A 2ZPQA 3GY7A 3TU7H 3QZRA 3VB5A 3DHKH 1AFQC 3GY2A 4X6MA 1L1NA 4RN6A 1HLTH 4BXWA 3RMMH 3HKJB 1C1QA 2FPZA 3A80A 2W7UA 3UIRA 1E34B 2V3HH 1LPKB 2ZHQH 2SGEE 2ZO3H 3PV4A 3RP2A 3PWBA 1O5AB 3M5MA 4ZXXH 4U2WA 1ZSJA 1EAWA 2IPHA 1T31A 1FAXA 3RDZA 2QXIA 5LH8A 1UO6A 1TGCA 4ABEA 2H9TH 3SJ8A 4AGKA 1E37B 1V2QT 4X1RU 1QJ7B 3OYPA 5F6MA 2C93B 1YC0A 1QRWA 3LU9B 1WOFA 1CA0B 2Y5HA 1K21H 1QCPA 1SI5H 3SJIA 5A0BA 1HGTH 5EPNA 1QJ6B 4VGCB 1HXFH 1BBRK 2HNTE 4X1NU 4MNXA 3SNBA 1FI8A 1TNHA 3CS0A 4BTTB 3V0XA 2EI8A 1SL3A 2Y6TA 2BY7X 2ZHEH 1J15A 1ZPZA 4MDSA 1K2I1 4ZUHA 4FU7A 2BM2A 1OP0A 2D26C 1OWDA 3IG6B 4A1VA 2ASUB 3AW1A 1MTSA 3G01A 1RD3B 3SQEE 5B6OA 3PLKA 1C4Y2 2BX3A 2A7HA 1QY6A 3PMJA 3LKWA 1GCTB 2CGAA 1MU8B 2ANWA 4XE4A 1O3PB 2P94A 4GLYA 2YNAA 3RXOA 3FZDA 2EA3A 4X8UH 3HATH 3AAUA 2GCTC 3PTBA 4SGBE 1BJVA 3QGJA 3BTME 1FUJA 1VGCC 2XCFA 4UD9H 1A0JA 1P57B 4X6OA 5ESTE 1HIAB 3SJKA 1KDQA 1C4V2 4DGJA 1KDQB 3NCLA 5L6NH 3LJJA 1P0SH 4XSKU 1TAWA 1O2UA 1QB6A 1HJ9A 1NC6A 4FUEA 1PYTC 4ISLA 4A6LA 1OPHB 1P2QA 1QQ4A 4FVDA 1YPJH 3UOUA 4CR9A 1AFEH 1H8DH 5EQRA 4CR5A 2PSXA 3U1IB 1QA0A 1O30A 3ZVAA 1D6WA 2Y82A 3C1KA 3P8GA 8ESTE 2OTVA 1BBRH 5JBCS 2GV7A 4LXBH 2ZDNA 1O3MA 1QA7A 4YOGA 4ZAEA 2WPHS 1Z8GA 1O2KA 5E8EH 3SOSA 1F5RA 3S69A 1LHFH 1HAVA 2ZTXA 1G3BA 1PPFE 4B2AA 1TPPA 1GHYH 2F9NA 1CHGA 4UFFH 2OC1A 3GCTG 3PMAB 4AB9A 5A0CA 2NU3E 3A84A 4BTUB 1XVOA 2W26A 3P70B 2OQUA 4B2CA 3E90B 1QFKH 3TNTA 1G9IE 3MU8A 1V3XA 4WMEA 4DURA 1O3NA 2HALA 2W3KA 3TITA 5E2OA 2TGPZ 4BOHA 3H7OA 3ZVDA 4UDWH 2VWLA 4FUCA 1TYNA 1EZXC 1SOTA 1AY6H 2VGCB 5EG4A 5DP9A 2G4TA 1GHVH 1MTWA 3RXKA 1A3EH 1O2XA 3URCA 1BMAA 4Y8YA 2NU0E 4I32A 3FZZA 4ISOA 1ZTLA 1PQ8A 2CHAB 4CRGA 1QBOA 1P3EA 3F9HA 3OX7U 1GBTA 4B73A 1EKBB 1OX1A 4DCDA 1DXPA 2C8XB 2TPIZ 1C4U2 1O3FA 1A46H 1GBJA 1A2CH 4Z0KA 3PLPA 1GI3A 1GBMA 1DLEA 2A2QH 2CXVA 2UUKB 4NGAH 1LTOA 5C2ZA 5JBBS 1HV7A 1LHEH 1LVYA 1QR3E 1PPGE 1C5YB 2FX6A 1GI0A 3SGBE 1A4WH 2Z6BD 4O97A 4BTIB 1FXYA 3SBKA 2CF8H 1O3JA 2R3YA 1V2OT 6GCHG 2ANMH 1O34A 1BIOA 2O8LA 2FZZA 1YCPK 3A85A 3GCNA 3RXUA 3MU0A 2AMQA 1U6QA 1IAUA 2AGIX 1JIRA 2ZWLH 3D23A 2XNIA 1TIOA 3KIDU 1KXCA 1W7GH 1RGQA 1MKXK 2XWBI 3SU1A 3L6PA 1AB9B 2SNVA 4X8SH 1SPJA 3ZZCA 1SGNE 1FLEE 3ESTA 4MPUA 4X0WU 1DWDH 3GOVB 1H9LB 1E35B 3FAOA 4X2VA 1DICA 1O2QA 3GY8A 1HFDA 3GY6A 4HTCH 1MTVA 3LH3A 3S7KB 2A5KA 5GCHF 1O2TA 2F9VA 3ATWA 4B76A 1TNJA 1GHAG 1V2RT 1S83A 3TJVA 3FVFB 3ZZ3A 3GY5A 2ALVA 3QGNB 6ESTA 5C20A 2BLVA 5HMAA 2BHGA 1LDTT 1Q31A 4KTCA 1YPLH 1YCPH 1LVOA 1MCVA 2Z9GA 1E38B 1O2PA 1OWJA 1RRKA 1UVOA 2WYGA 2ZF0H 3T27A 1C1RA 9LPRA 3SI3H 2XC5A 1P03A 5JYIA 1O2MA 3ZZ8A 2TBSA 1O5GH 5AF9H 2SGFE 2PHBA 2EI7A 2FEQH 4BAHB 1C1WH 1K1JA 1FONA 3HPTB 1FPCH 1DSUA 1O3CA 2VVCA 1XKBC 1MTNB 1VCQA 2XBXA 3RXDA 2BYAX 4VGCC 5C5NA 4UFDH 1RTFB 1Y5BT 2QAAA 3RMOH 4JZDH 1D9IA 4BXSA 3PTNA 2BLOA 3UWJH 1HNEE 3TK5A 1RIWC 2UWLA 1ZHRA 2XXLA 4DW2U 4CHAB 2R3UA 4E7NA 4WMFA 2Z9JA 4B1TA 1O0DH 2B5TB 1P02A 1SGQE 1GDNA 1XUKA 5EPYA 4K8BA 1L0ZA 1Z1JA 2QY0B 3H5CB 4JK6A 2ZFTA 1GHBG 1TPAE 1CBWB 1SLXB 1ZTJA 3ZV8A 1NT1A 1GCTC 3PMHB 2R2WU 5HM9A 3BTTE 4K3JA 1IQEA 1S6FA 3TGJE 5EW2H 1UJ1A 2OBQA 4NSYA 1BT7A 5A0AE 1CU1A 2ZZUH 1HJAB 2QXHA 1W12U 1WBGB 2OUAA 4DOQA 2BVRH 1NRRH 1SQTA 4ZHLU 1S81A 3UFAA 3STIA 1NU7B 2HRVA 2STAE 3I29A 1DY8A 1AD8H 4A1XA 1O2WA 5J4SA 2TGAA 2F9UA 2G4UA 3ATKA 1QL7A 3P8OA 1OWHA 3QDZB 2GDDA 2VH0A 2I6QA 4BAQB 4HGCA 3JZ1B 2J4IA 5ETXA 1V2PT 3TNSA 2A0QB 3T5FH 1XUFA 1GBEA 4ASHA 5HGGA 1FY4A 1TOMH 3ZV9A 4BAKB 2PUXB 1HCGA 1NY22 2Z9KA 1YBWA 2FTMA 2OXSA 2BD2A 2WPMS 2DE9A 2XCNA 4AOQA 1BUIA 2FODA 3ODFA 3TGIE 1QNJA 4XFQA 1KXAA 4X2WA 1YPMH 3AW0A 1O3KA 1GHWH 3MH4A 1AVXA 1L2EA 1LMWB 2ZGHA 1ESBA 2TRMA 1YLDA 1AMHA 1NO9H 2A4OA 4XBCA 2FXRA 1A0LA 2NU1E 3L33A 5AHGH 4DT7B 2VGCC 3E1XB 4U01A 3A7ZA 4AYYB 3LOXA 3RXVA 1D6RA 4JYTA 2VINA 4X6PA 1HAGE 2O8UA 1O2VA 1B5GH 2Z3CA 1EZQA 1GVZA 3RMNH 4WWYA 1VCWA 1Q2WA 2I6SA 4Y6DA 2CMYA 6GCHF 3GCHB 1O3DA 1W0YH 3EE0B 3BEUA 2A4RA 2WUCA 3TJNA 1SGEE 1W14U 1TX8A 1GJ5H 2PLXA 3Q77A 4B75A 4MQAA 1T8NA 4X2YA 3LDXH 1BMLA 1GWAA 1C2HA 3BG8A 2OCVB 3SV8A 5HM2A 4ABBA 2AIPA 1UCYK 1B7XB 2HOBA 1UMAH 1CO7E 2J2UA 1IQNA 2V35A 1ESAA 2FS8A 3KCGH 3QO6A 3MH6A 2XYAA 4FUFA 1W11U 1ID5H 5F8TA 1CT0E 1MAYA 2K7XA 1ZPBA 2F9BH 4NIXA 1AN1E 1ZJKA 1P2OA 3KHVA 2ZI2H 3ZZ6A 2DUCA 4H4FA 2BZAA 4YOJA 2P59A 4DY7B 3AVZA 4INLA 4ABJA 2ZPRA 1W10U 3P8FA 2ZGBH 3R3GB 2VIWA 3BG4C 1LHCH 1GJAB 5L30H 1K1LA 1EAIA 2PGQB 3A7VA 1TLDA 1SVPA 1A5GH 2J34A 3P95A 2A7JA 3QZQA 1DOJA 2ANKH 1H9HE 2AGEX 2BLQA 2ZFFH 4YT7H 5E0GA 3SUGA 2GZ9A 4BANB 1XXFA 1PPZA 1G2MA 1O3HA 3U8TH 3LGWA 1FV9A 4RKOB 5FCKA 1BMNH 4MNVA 2A1DB 3S9BA 4AFZA 3ZVCA 1BB0B 1D4PB 1ELTA 1LVBA 2TIOA 3LJOA 4ABGA 1HAPH 1AHTH 1UHBA 3S9CA 4A1TA 1UVPA 3BEIB 1CE5A 3U8RH 1PFXC 1M9UA 3RXMA 1PPCE 4ABIA 1UCYH 3OY5U 2K1QA 1FY8E 5DP3A 1O2SA 1TBRH 2H5CA 1C5WB 4YTAA 2J9NA 3A8CA 1GI6A 2V3OH 4BNRA 1JBUH 2BX4A 1GI1A 3DFLA 4OS5A 1HXEH 3SHCH 1TWXB 4ZROA 4KGAA 1A5HA 2P95A 2BVXH 1L4DA 4TY7A 2Z9IA 1Y5AT 3MNBA 4I7YH 4K60A 1RJXB 4IMQA 2VVUA 4WH8A 1EQ9A 3TK6A 4OS2A 3B23B 4D7GA 2A5AA 1PPHE 1BBRE 2BD3A 3SJ9A 1Z8JB 2THFB 1GBBA 1O5DH 1VJ9U 4KKDA 1EUFA 1TFXA 4Q7ZA 1Z8RA 2W3IA 3EBNA 1C5SA 2FI3E 3S9AA 3Q3YA 4D9RA 4FUGA 1S82A 1KXDA 3B9FH 4X1PU 4CHAC 4H6SB 1CHOF 3RXHA 2G81E 3VB3A 2XC4A 1TABE 3PWCA 5I25A 4I8JA 1GL1A 3RXJA 1MH0A 2ALPA 1THPB 3SORA 4AZ2B 6CHAB 3ELAH 1IHTH 3RXPA 2ZECA 2ZGXH 1EPTA 1EPTB 3RXCA 1QHRB 2ZDKA 1F5KU 3TIUA 1IHSH 2A4QA 5DP7A 1J14A 1Z1IA 3M3VA 1UTQA 1TGTA 5GCHG 4E06H 3PMBB 2Y5FA 1T7CA 1C5NH 3K65B 1DUAA 1UTPA 4DVAU 1LHDH 1SFQB 1F0TA 2BD4A 4K5ZA 2OC8A 3VB4A 3M36A 3P92A 1IQLA 1GL0E 1KYNA 2AERH 3LT3A 1NRSH 3OTJE 3VFEA 5GWZA 1ARCA 1GBIA 2LIZA 3UREA 3MTYA 1FPHH 2O8MA 1IOEA 1GJ9B 3FANA 2ZTYA 1K1OA 1ZMJA 1QBNA 1SR5C 2FLBH 1ELFA 4FUHA 1T4VH 3UR6A 3LGUA 4OS7A 1P2JA 5GXPA 2VIVA 1ACBE 8LPRA 3MFJA 3SV9A 4YOIA 3Q00A 1HB0B 2ZHWH 5DG6A 1HRTH 1P11E 5DGJA 3ZVBA 3DD2H 2ILNA 4THNH 4AGJA 4AFSA 1CA8B 5J4QA 1O2LA 2F91A 2BZ6H 2W5EA 1NRQH 1G3EA 3ZZAA 2QC2A 1O36A 1C5QA 1TGNA 4WXIA 1LHGH 2P8OB 1GGDB 1WTHD 1TPOA 3VB7A 1DX5M 1N6YA 2ZGCA 1TGBA 4FVBA 3EDXB 2FDAA 1LKAA 1BRUP 1O2OA 1QRZA 1K1NA 2GZ8A 2XW9A 1OS8A 2JKHA 5DKMA 3KQEA 2Z94A 1JRSA 1B0EA 4E05H 1ELDE 4NFFA 1C9PA 1ZLRA 1C2KA 3GCHC 1Y5UT 1RFNA 1W8BH 2V6NA 4ESTE 3BTDE 1ORFA 2RCEA 3MU1A 2Q6DA 3F68H 3RU4E 1SGYE 1G32B 2ZU3A 1BITA 2BTCE 4GHTA 4AFQA 3BTWE 4NA9H 3EA9A 3SV7A 1C5OH 2HVXA 1C2MA 4K1SA 1EOLA 1O2IA 4X8TH 2STBE 1HAVB 4D76A 3RXIA 1O3BA 3SJOA 3Q3XA 2VWMA 5AFYH 5FPSA 4I8HA 2C3SA 1P3CA 1SGIB 2BDGA 1TNKA 1WYKA 1PYTD 5EQQA 1P2IA 3D62A 1O3LA 2F9OA 2O8TA 4DG4A 1P09A 1TONA 2PTCE 4GAWA 1GMHF 3SU3A 1C5VA 4OS4A 1DWCH 3K2UA 4UE7H 5AVDA 3TJOA 1MD7A 1SGPE 3RXQA 1Q3XA 1CGHA 2ZU5A 2ZQ2A 1Z8IB 1CQQA 4JK5A 4A92A 1DXWA 3MO6A 4FU9A 5EOKA 1H4WA 2WYJA 4LOYH 1EXFA 2SGDE 3URDA 2G5NA 4Z6AH 2FOMB 4ABFA 3M7TA 1THSH 5C67A 3F9GA 1EATA 1AU8A 2R0LA 1FNIA 3MU5A 1ZRKA 2BQ6B 4FU8A 3EYDA 1QJ1B 3P17H 2OLGA 1G3CA 4XDEA 4MPXA 2H5DA 1S0QA 1Y3VA 2BOHB 4LK4A 4E7RG 3A8BA 1L1GA 1O2JA 2GKVE 3GYMA 1QRXA 2UWOA 1SGFA 1VITF 3A82A 1TA6A 1CSOE 3T28A 4D7FA 3UNSA 1O3AA 2BY5X 1J8AA 2LNCA 4ABAA 1HAOH 2JH6D 2FI4E 2FM2A 1V2WT 1ZR0A 2ODPA 5DP5A 3ZYDA 2BY8X 3BN9A 1VJAU 1N8OB 4JZIA 3EQ0H 1XXDA 2BD9A 1HBTH 1ZHMA 1FY5A 1O2HA 2ZU2A 4A5TS 2VH6A 2UUFB 3RXTA 1WCZA 5H4IB 1FIZA 3M35A 1C5XB 5CE1A 3NUMA 1F5LA 3SW2B 1GJDB 2GMTB 4B2BA 1JWTA 4GSOA 1HUTH 4IW4E 1D3TB 2PGBB 1GI5A 1XX9A 1C5UA 3SGAE 5A8XA 1LCYA 4ZHMU 1D3QB 1TMUH 2Y5GA 4K1EA 1HAZB 1TMBH 3C27B 3RXFA 2PTNA 4NWLA 1P9UA 1SGDE 1NN6A 3MWIU 1DITH 3GDUA 3GDVA 1UVTH 2R2MB 2CJIA 2ZU1A 3CS7A 4INHA 1DDJA 1D3DB 3HGPA 1AWHB 2CV3A 2SFAA 5FHTA 3FP6E 3LGYA 2VVVA 1SC8U 2OC7A 3R0FA 4XOJA 1UVUH 3SU0A 1G30B 5TCAA 1YP9A 4Q80A 1WSSH 4HFPB 1NFUA 1P12E 4IS5A 4WXVA 1SGRE 2P3TB 3A86A 4J1YA 1XM1A 3SI4H 1FAKH 4NCYA 1EJNA 4IBLH 2ZCLP 4Y11E 1DFPA 1YM0A 4CRCA 2C4FH 5CHAB 3NKKA 5GDSH 1Y59T 1MMJN 1SBWA 3U9AH 3RUOA 3ITIA 3A81A 4X8VH 4J2YB 4Y76A 4ABHA 1C1PA
chains in the Genus database with same CATH superfamily
1GI9B 1ELCA 4ZXYH 1V2LT 1BCUH 3SZEA 1GBHA 1SGFG 1TMTH 4HZHA 4TSFD 3KEEA 4TWWA 1QQUA 1MBMA 3ZIAD 2FESH 1O2YA 1CA0C 3F2GA 3O8BA 1MZAA 1V2TT 4GUXA 1EX3A 3OSYA 1ZTKA 3A89A 3TVJB 2GVFA 4UFGH 4TPIZ 4X1SU 2ZEBA 2VJ1A 1UW7A 3ZZ7A 1UK3A 3DFJA 1BTZA 3SU4A 3BF6H 1MQ5A 2Y7XA 4UEHH 2R0KA 1ETSH 4I8LA 2JH5D 2A4GA 2Z3DA 2PKSB 1AVWA 1INCA 3PM3A 5DP6A 1O2ZA 1GMCF 3FKSD 5DP8A 5IYTA 1BRCE 1GG6B 3SN8A 4ZH8A 1C1TA 5EJ1A 2DE8A 2GV6A 5A8ZA 4DJZB 4GPGA 1YYY1 1P04A 2P8OC 5GJ4B 2WPJS 4FUDA 3SHAH 1WDIA 1SLVB 5F8ZA 3DSOA 5FAHA 4AG2A 1K1MA 3BSQA 1E0FD 1ZHPA 3U8OH 1DM4B 4I8KA 1QTFA 5A2MH 1H8IH 2G55A 2GZ7A 1AFQB 1CHOG 2WV9A 1N6XA 1OKXA 2XTTB 2UWPA 1FN6A 4I31A 2ZP0H 4Y7BA 3N7EA 3E0PB 3QWCH 3TH4H 4MPVA 2G52A 1JRTA 3KGPA 4ISHH 3UQOA 1EZUC 4D8NA 4M7GA 3H7TA 1O5CB 1C2IA 3VEQB 4NG9H 5K7RA 2D8WA 5BRRE 2IN2A 1OXGA 3NWUA 4GCHF 4F48B 1UCYE 2XRCA 2PR3A 2C90B 1UTJA 4QT8C 5HXFA 3V12A 4CBNA 3MO3A 2JETB 3RLYH 4IMZA 3RXLA 3BTKE 4TPYA 2ZA5A 1EASA 4YESB 1XKAC 1AI8H 3Q76A 4K8YA 2BY6X 4OS1A 4NA8A 2HNTF 2F4LA 4NZLA 2FOEA 1YPGH 2BDCA 3UWIA 3BTEE 2FLRH 1G3DA 4XRNA 4PROA 3DT0H 2HPPH 3KQBA 3U1JB 3M5OA 1DY9A 3SU6A 2AS9A 3RU4D 2Z7FE 2WPLS 4ZKRU 1NRNH 4ZCNA 3O8RA 3MU4A 4ISNA 1W0JD 1YGCH 1JIMA 3N99A 3SUFA 2CHAC 2QGRA 1ZZZA 5JBTA 1X7AC 3NK8A 1C5RA 1C5LH 5IDKA 4O9VA 3W95A 1VGCB 3S0NA 1NESE 2UUYA 3Q3KA 1P2KA 2G00A 3HKIB 1GJ7B 3PV2A 2ODQA 2EC9H 4MLFB 3M7UA 1VZQH 1TRYA 2XNDD 2FOGA 3SGQE 1GHZA 4HI3A 2QF5A 1QBVH 1ZSKA 2OINA 3JZ2B 5T3HA 5F8XA 1NPMA 4YLQH 3W94A 1T8MA 4Y10E 1QL8A 5LPFA 1RTLA 1MZDA 1N8OC 2D2DA 1O5FH 2P93A 1PQ5A 1TA2A 3SZNA 2VIOA 4U30A 9ESTA 4CH8B 1ANCA 2CF9H 2QF3A 2P16A 1EJAA 2ZTZA 2AGGX 3OU0A 4IN1A 2B8OH 1GVKB 4MPWA 3GDSA 3ENSB 1G2LA 3RXBA 4UONA 5PTPA 1BTWA 1AB9C 1W2KH 4SGAE 1FQ3A 1FMGA 3AAVA 4CRBA 3QX5H 1S84A 3RC5A 1MKWK 5FX5A 3PB1E 3O8CA 1P06A 3L3TA 1BMMH 5FCRA 3ZYEA 4FXGH 1GI7B 1QB9A 1O31A 4WF8A 3NZIA 2B0FA 3GY4A 3UNRA 3TLOA 5HYOA 3FN8A 5HIZA 3RXEA 2BLWA 3ATMA 5F53A 5E2PA 3F3BA 1ARBA 3P6ZB 1P9SA 2J38A 1GMHG 3MI4A 5ESBA 1FX0B 1A0HB 3O8DA 3LGTA 1C1VH 1MAXA 4DIHH 3BEFB 4BAMB 1FIWA 2WZQA 4D9QA 1TB6H 1HAIH 1TGSZ 5IK2D 1T8LA 2SGAA 1AE8H 1UHBB 2WV4A 1Z6EA 4Y7AA 2TGTA 5CMXH 1YPHE 2D1JA 4ACBA 2P3UB 5B6LA 3N7OA 3NPSA 1OYTH 1Y3XA 1OWIA 3B8JA 5L2ZH 4TT3D 2BB4A 1TQ0B 8GCHG 1ZRBA 2GD4B 2P3FH 4RSPA 5C1XA 3ATLA 2GTBA 1BRBE 1P2NA 1ANEA 3BTQE 7GCHF 4K69A 3K9XB 3ZVEA 1C5MD 1KIGH 2FOBA 1VITG 2M5TA 3KQDA 2B9LA 5EJLA 2F83A 1V2MT 1O32A 3FFGA 4WH6A 3MOCA 1MKWH 2QF4A 1BJUA 1ANDA 4RI0A 1MTNC 1BTYA 3RXSA 1BZXE 2QCYA 1NRPH 1NFXA 5E0HA 2IOTA 3BV9B 1DVAH 1NFWA 2ZPSA 1GJCB 2BXUH 1NZQH 3BTHE 5HIYA 2G8TA 2KM0A 1EB2A 2G5VA 4M9FA 3H09A 3IWMA 1L1JA 5F03A 1GBFA 1ABJH 1K28D 1C2EA 1GG6C 1COWD 2JJ1D 1CBWC 3DSGA 2BDAA 2FOFA 4Q7YA 3RM0H 1VITH 1XUHA 2J92A 3VG8A 2KCAA 1SGTA 2BDYA 1LO6A 3MNCA 3M7QA 1QGFA 4Q63A 3SNAA 1JXPA 2J97A 1MU6B 3UPEA 2FWWA 3PO1B 5T6DA 2PFEA 2G51A 1HJAC 1IQIA 1UTNA 3F2FA 3MHWU 2ZDVH 3CNRA 1TX7A 1GI2A 2XWAA 5DP4A 3GCOA 2VU8E 1LVMA 4LZ4B 3IITA 1QURH 1A3BH 1DT2A 1C1SA 3A7WA 3SUDA 3UR9A 2ZQ1A 2J95A 3HGNA 4UFEH 2YOLA 3UUZA 3VXEH 4CRAA 1GJ6A 3F1SB 2GX4A 1DWEH 3RMLH 1K9OE 1S0RA 4KP0A 2QXJA 1C2LA 5AFZH 1RXPA 2RG3A 2GCHF 1W3CA 1CGJE 3EE7A 2JETC 2AMPA 1GCDA 3LGVA 3LPRA 2IJOB 4I33A 1SMFE 3V7TA 4RT0A 1BTHH 1HAYB 1P05A 5ABWA 4ISIH 2ZG0H 2ZHDA 1RIWB 2ZDAH 2ZFQH 1QB1A 1QL9A 1HDTH 5I46H 3PLBA 1ESTA 4AX9H 1THRH 2VIDA 3QK1A 1Z71A 1K1PA 1GMDF 2PKAA 1O3GA 2PKAB 2FOAA 2GT7A 1MD8A 1V2VT 2EEKA 1OWKA 3KNXA 2OC0A 1GMCG 2TGDA 1AQ7A 1BTUA 1BMFD 1KXEA 3D65E 1DUEA 2XBWA 3OFND 1C5ZB 3KL6A 3F6UH 2A2XH 3SNEA 1FZZA 2Z3EA 1HIAA 2K8IA 1TRMA 1SB1H 3T29A 1C1MA 1ZMNA 1IQJA 4NIVA 3LIWA 4CRFA 1O3EA 2OBOA 1ANBA 5JBAS 1OYQA 3EA7A 2KR7A 2KFWA 5EXMA 2XC0A 1NBME 4AORA 4NSVA 2YNBA 1BTXA 1TBZH 3RXGA 4AFUA 4ZKOU 4ZKNU 3M3TA 5JDUB 4RKJB 3EGKH 1J17T 1MCTA 1C5TA 3D49H 2M2AA 4K2YA 1O2NA 5GPIB 2PP6A 2J5UA 3M61U 1TQ7B 1B0FA 2ZC9H 5FL7D 1SFIA 4JMYA 2NU2E 3BIUH 3CP7A 4H6TA 2KCOA 1KLIH 1NU9A 1ZSLA 2J98A 1XVMA 2J98B 1DS2E 4GCHG 1GVLA 1AZ8A 3MH5A 1V2JT 2IPQX 4NIYA 4Y8XA 1BHXB 4DIIH 2W7SA 3TPIZ 3RXAA 1T4UH 3TH2H 3RC4A 5G4BA 2SGQE 2V3MA 1J16A 1HPGA 3TK9A 2WPIS 1IQKA 1BA8B 3UQVA 4Y71A 1ZYOA 1ELAA 1KXBA 1ELGA 3A88A 1GBAA 1GPZA 4I8GA 1GDQA 4Y8ZA 4NFEA 2HWLB 3PROA 4WJG2 8GCHF 1AWFH 1AGJA 2O9QA 1TALA 2XBYA 1IQMA 3A87A 1F0RA 2K0QA 1KTSB 3KN2A 3ZVFA 1YCPM 1UVSH 3GISB 1Z7KA 3WY8A 1H1BA 1TOCB 4XBBA 3GY3A 1TRNA 2FYRA 4WVPE 4LZ1H 2HGTH 1YPHC 4IC6A 3UY9A 4B6EA 5EGMA 1NFYA 1C2FA 2AHME 1J9CH 5T6FA 1NROH 3SQHE 2KAIA 2KAIB 3VPKA 3LC3A 3TJUA 1PQAA 4FUBA 3LGIA 5DK1A 2Y7ZA 5JPMH 3ZZDA 4F4OC 1RS0A 5FX6A 3TH3H 5FPYA 2PW8H 1FN8A 4CRDA 3SUEA 4JZEH 1GBLA 7LPRA 1SHHB 1XUGA 2BQ7B 1AIXH 1YKTA 2PWXA 5A8YA 4H42U 1BDAA 1ZGIA 1Y3WA 4NZQA 4FUIA 2SGPE 2FYQA 2CN0H 2Q1JA 3BG4B 5TJXA 3A7YA 1JOUB 1F0SA 1V2ST 1P8VC 1T8OA 5JB9S 3M3SA 1OHHD 2ZCHP 4OS6A 5C1YA 3SO3A 5EODA 4AYVB 1IQHA 1W13U 1UK4A 2GT8A 1O35A 1HAXB 1O37A 1G36A 2A31A 3SU2A 3FP7E 1O33A 1ETRH 3KYFA 3M37A 2B7DH 6CHAC 1TNIA 1MUEB 4B74A 1ZOMA 3RM2H 2ODYB 1C2GA 3STJA 3WWBA 1EPTC 4KTSA 1S5SA 4GVUA 4O3TA 3BIVH 1YY3A 1HYLA 1O2RA 4R8TB 5LGOA 2F9PA 4HG6A 3PO1C 1UTLM 2FOCA 4O03A 3DA9B 1RTKA 3EA8A 2ZNKH 2A5IA 1WTGH 5HKKD 2VWNA 3OEED 1WQVH 3F2HA 2O8WA 4CBOA 2C8WB 1UTOA 3FP8E 1PQ7A 3VB6A 1GBKA 3GICB 2H2ZA 4X2XA 1S85A 1VR1H 1EP5A 3GYLB 3A7XA 2JH0D 3ZZBA 4JCNA 5FXLA 2BXTH 2AMDA 4CH2B 5EIYA 4O3UA 3RU4T 3MH7A 2PUQH 1DANH 3AASA 2FX4A 3QN7A 1Y3UA 4KELA 4YM9A 1P2MA 1EAUA 1LQEA 1MKXH 3VGCB 2QA9E 2J94A 7GCHG 2H1UA 2AYWA 3KF2A 1PJPA 1C1NA 1EZSC 4Q2KA 4K1TA 2VIQA 1UK2A 1NTPA 3SV2H 1V6DA 3U28C 3ATIA 2BDHA 5DSFA 1CT4E 1BRAA 4TYDA 2HNTC 4JYUH 2ZDMA 4ZKSU 3CENA 4YO9A 1CGIE 1XUIA 4OGXA 2BD8A 1MTUA 1GGDC 1DSTA 5E0JA 1EOJA 1JMOH 4JZ1A 1PPBH 2L74A 1HAHH 3ZVGA 3F9EA 1ZGVA 1YLNA 2QIQA 1BTPA 1SG8B 4ABDA 1GI8B 4Q7XA 5JB8S 2JIZD 1AZZA 2PV9B 1ETTH 2VIPA 4IGDA 3BTFE 2OP9A 1LPZB 4YLUA 4NA7A 5EW1H 5FBIA 3E16B 1C9TA 1EAXA 5T6GA 2ZGJA 4P02A 1TNGA 1IQFA 2WINI 1V2NT 1DE7H 4FOUC 3E3TA 3A83A 5BPEA 1TE0A 3NXPA 1A61H 1AE5A 3U98H 2ANYA 3A8AA 3GCTF 2Q6GA 1YLCA 4Y79A 2V0BA 4INKA 4R0IA 2HLCA 2FI5E 5EU8A 3A7TA 1C1OA 1WV7H 1Y8TA 1MQ6A 1C5PA 1NS3A 1E36B 4U32A 3ZZ5A 1W0ZU 1HJ8A 2BVSH 5C1UA 2Y81A 3E0NB 3PYHA 3SNDA 3M5LA 4Y0ZE 2QXGA 2AFQB 1O38A 3RLWH 1H9IE 4F49A 1EP6A 1TPSA 4JZFH 5GNDA 5L2YH 1LKBA 2OQ5A 1F2SE 4FUJA 1DWBH 3LC5A 2ZFRH 5SGAE 1A7SA 4BAOB 2GCHG 1AVGH 2Z9LA 1O2GH 2FS9A 4Y0YE 1NBMD 5C3NA 1S6HA 2H9EH 1FJSA 1WQSA 2NWNA 4YZUA 1VCPA 1WAYB 2GCTB 5LPEA 1ELVA 1KLJH 1T32A 1V2UT 1EJMA 5DN6D 1F92A 1SOZA 3KQCA 2BDBA 5EQSA 4ZHAA 1N1LA 3K6YA 2ESTE 3RXRA 3QUMP 2BOKA 1YPKH 1SHYA 5GIBA 1A1RA 2WPKS 3QTVH 3QTOH 1FY3A 1ELEE 2BDIA 4NWKA 1XMNB 1BOQA 1GMDG 1KSNA 1GBCA 3DSPA 1FDPA 1ZJDA 2W6JD 1C2DA 4MG3A 4CREA 4IN2A 1WU1A 1F0UA 7KMEH 1SQAA 5DPAA 4TY6A 3T2NA 1SGCA 1ZMLA 2FTLE 5EXLA 4AN7A 2BY9X 2GDEH 2AIQA 5DO4H 2RA0A 1ABIH 2LPRA 2ZDLA 2ULLA 1GBDA 1UTMA 4JYVH 1LPGB 1V2KT 1KLTA 1W7XH 2ZKSA 4MNWA 1PPEE 4X1QU 5CHBA 3F9FA 1F7ZA 5KGOA 1AKSA 1L4ZA 2Q6FA 1AKSB 1DLKB 4KTUA 1GJBB 4WY3A 1OP8A 1P10A 3T26A 2QN5T 1SSXA 2Y80A 1ELBA 2FMJA 1GI4A 2GGVB 2QYIA 2FP7B 3MNSA 2ZCKP 2GMTC 1BHXF 2V7QD 2YMSB 3OTPA 4TWYA 1A5IA 1O5EH 5C5OA 2ZFSA 1TBQH 4YT6H 3LH1A 1CT2E 3HK6B 4NIWA 2PSYA 2VB0A 3EAJA 1BQYA 3I77A 2BD7A 1GHAF 5A09A 5TCCA 1GDUA 3UAIC 3MYWA 2EI6A 2XBVA 3LONA 2H9HA 1O3OA 3DUXH 3MMGA 1XUJA 3T62A 2C8ZB 3M5NA 2ZIQH 1OP2A 3ZZ9A 1KY9A 3U69H 1NM6A 4B71A 2BQWB 2QF0A 2FIRH 1KTTB 1AUJA 1Y3YA 2BD5A 3E6PH 3SV6A 1O39A 2ZHFH 4OGYA 1D3PB 2ZU4A 1K1IA 4AG1A 2FOHA 2JJ2D 2RDEA 4GHQA 3UNQA 3UTUH 4XD7D 1KXFA 1SQOA 5EXNA 1UTKA 1K22H 1QIXB 1SQRA 3OY6U 4MNYA 5CHAC 1GJ8B 2A7CA 4XBDA 1OWEA 3SU5A 2OD3B 1GHXH 3K6ZA 3V3MA 3MO9A 1O3IA 2AH4X 5C94A 1Z6JH 1AUTC 3RC6A 2VNTA 3I78A 1C2JA 2WUBA 1YPEH 1GJ4H 2SNWA 1KMHB 2RA3A 3SNCA 3T25A 1WUNH 2R9PA 8KME2 2UUJB 1MBQA 4WMDA 1SLUB 2A32A 3V13A 5C0TA 2QV1A 1LQDB 1DPOA 3W1EA 2F3CE 1YF4A 5FPTA 3UB0A 2XOKD 1ZPCA 5DJ7A 2AEIH 3MNXA 5FBEA 3UOPA 2A45B 2VWOA 4MVNA 1O5BB 1FY1A 1AO5A 1SLWB 2HPQH 4AB8A 2H6MA 2NU4E 2ZFPH 1OSSA 1TNLA 3VGCC 3VXFH 3S7HB 2PKSC 3HK3B 3P8NA 5LPRA 1GHBF 1G37A 2BMGB 4IC5A 1OOKB 6LPRA 4A7IB 1P01A 1C1UH 2C8YB 5K0HA 1TX6A 3BTGE 2RDLA 3ODDA 2WV5A 3QLPH 4X6NA 1EB1H 2GP9B 2KCYA 3F0OA 4ZMAH 3E8LA 1IQGA 7ESTE 3A8DA 2FO9A 3TGKE 3ZZ4A 1CVWH 4MTBA 3E91A 2ZPQA 3GY7A 3TU7H 3QZRA 3VB5A 3DHKH 1AFQC 3GY2A 4X6MA 1L1NA 4RN6A 1HLTH 4BXWA 3RMMH 3HKJB 1C1QA 2FPZA 3A80A 2W7UA 3UIRA 1E34B 2V3HH 1WXRA 1LPKB 2ZHQH 2SGEE 2ZO3H 3PV4A 3RP2A 3PWBA 1O5AB 3M5MA 4ZXXH 4U2WA 1ZSJA 1EAWA 2IPHA 5KEDA 1T31A 1FAXA 3RDZA 2QXIA 5LH8A 1UO6A 1TGCA 4ABEA 2H9TH 3SJ8A 4AGKA 1E37B 1V2QT 4X1RU 1QJ7B 3OYPA 5F6MA 2C93B 1YC0A 1QRWA 3LU9B 1WOFA 1CA0B 2Y5HA 1K21H 1QCPA 1SI5H 3SJIA 5A0BA 1HGTH 5EPNA 1QJ6B 4VGCB 1HXFH 1BBRK 2W6ID 2HNTE 4X1NU 4MNXA 3SNBA 1FI8A 1TNHA 2GJGA 3CS0A 4BTTB 3V0XA 2EI8A 1SL3A 2Y6TA 2BY7X 2ZHEH 1J15A 1ZPZA 4MDSA 1K2I1 4ZUHA 1YWUA 4FU7A 2BM2A 1OP0A 2D26C 1OWDA 3IG6B 4A1VA 2ASUB 3AW1A 1MTSA 3G01A 1RD3B 3SQEE 5B6OA 3PLKA 1C4Y2 2BX3A 2A7HA 1QY6A 3PMJA 3LKWA 4ASUD 1GCTB 2CGAA 1MU8B 2ANWA 4XE4A 1O3PB 2P94A 4GLYA 2YNAA 3RXOA 3FZDA 2EA3A 4X8UH 3HATH 3AAUA 2GCTC 3PTBA 4SGBE 1BJVA 3QGJA 3BTME 1FUJA 1VGCC 2XCFA 4UD9H 1A0JA 1P57B 4X6OA 5ESTE 1HIAB 3SJKA 1KDQA 1C4V2 4DGJA 1KDQB 3NCLA 5L6NH 3LJJA 1P0SH 4XSKU 1TAWA 1O2UA 1QB6A 1HJ9A 1NC6A 4FUEA 1PYTC 4ISLA 4A6LA 1OPHB 1P2QA 1QQ4A 2RFKC 4FVDA 1YPJH 4YXWD 3UOUA 4CR9A 1AFEH 1H8DH 5EQRA 4CR5A 2PSXA 3U1IB 1QA0A 1O30A 2VBCA 3ZVAA 1D6WA 2Y82A 3C1KA 3P8GA 8ESTE 2OTVA 1BBRH 5JBCS 2GV7A 2EQNA 1W0KD 4LXBH 2ZDNA 1O3MA 2KZ4A 1QA7A 4YOGA 4ZAEA 2WPHS 1Z8GA 1O2KA 5E8EH 3SOSA 1F5RA 3S69A 1LHFH 1HAVA 2ZTXA 1G3BA 1PPFE 4B2AA 1TPPA 2LELA 1GHYH 2F9NA 1CHGA 3OEHD 2OC1A 3GCTG 3PMAB 4UFFH 4AB9A 2NU3E 5A0CA 3A84A 4BTUB 1XVOA 2W26A 1S6LA 3P70B 2OQUA 4B2CA 2YMSC 3E90B 1QFKH 3TNTA 1G9IE 3MU8A 1V3XA 4WMEA 4DURA 1O3NA 2HALA 2W3KA 3TITA 5E2OA 2TGPZ 4BOHA 3H7OA 3ZVDA 4UDWH 2VWLA 4FUCA 1E1QD 1TYNA 2KX4A 1EZXC 1SOTA 1AY6H 2VGCB 3SYJA 5EG4A 5DP9A 2G4TA 1GHVH 1MTWA 3RXKA 1A3EH 1O2XA 4AC9A 3URCA 1BMAA 4Y8YA 2NU0E 4I32A 3FZZA 4ISOA 1ZTLA 1PQ8A 2CHAB 4CRGA 1QBOA 1P3EA 3F9HA 3OX7U 1GBTA 4B73A 1EKBB 2LP6A 1OX1A 4DCDA 1DXPA 2C8XB 2TPIZ 1C4U2 1O3FA 1A46H 1GBJA 1A2CH 4Z0KA 3PLPA 1GI3A 1GBMA 1DLEA 2A2QH 2CXVA 2UUKB 4NGAH 1LTOA 5C2ZA 5JBBS 1HV7A 1LHEH 1LVYA 1QR3E 1PPGE 1C5YB 2FX6A 1GI0A 3SGBE 1A4WH 2Z6BD 4O97A 3KYGA 4BTIB 1FXYA 3SBKA 5KECA 2CF8H 1O3JA 2R3YA 1V2OT 6GCHG 2ANMH 1O34A 1BIOA 2O8LA 2FZZA 1YCPK 3A85A 3GCNA 3RXUA 3WWFA 3MU0A 2AMQA 1U6QA 3F0PA 1IAUA 2AGIX 1JIRA 2ZWLH 3D23A 2XNIA 1TIOA 3KIDU 1KXCA 1W7GH 1RGQA 1MKXK 2XWBI 3SU1A 3N7DA 3L6PA 1AB9B 2SNVA 4X8SH 1SPJA 3ZZCA 1SGNE 1FLEE 3ESTA 3DCLA 3OAAD 4MPUA 4X0WU 1DWDH 3GOVB 1H9LB 1E35B 3FAOA 5C0UA 4X2VA 1DICA 1O2QA 3GY8A 1HFDA 3GY6A 1EFRD 4HTCH 1MTVA 3LH3A 3S7KB 2A5KA 5GCHF 1O2TA 2F9VA 3ATWA 4B76A 1TNJA 1GHAG 1V2RT 1S83A 3TJVA 3FVFB 3ZZ3A 3GY5A 2ALVA 3QGNB 6ESTA 5C20A 2BLVA 5HMAA 2BHGA 3KQ5A 1LDTT 1Q31A 4KTCA 1YPLH 1YCPH 1LVOA 1MCVA 2Z9GA 1E38B 1O2PA 1OWJA 1RRKA 1UVOA 2WYGA 2ZF0H 3T27A 1C1RA 9LPRA 3SI3H 2XC5A 1P03A 5JYIA 1O2MA 3ZZ8A 2TBSA 1O5GH 5AF9H 2SGFE 2PHBA 2EI7A 2FEQH 4BAHB 1C1WH 1K1JA 1FONA 3HPTB 4RT1A 1FPCH 1DSUA 4I86A 1O3CA 2VVCA 1XKBC 1MTNB 1VCQA 2XBXA 3RXDA 2BYAX 4VGCC 5C5NA 4UFDH 1RTFB 1Y5BT 2QAAA 3RMOH 4JZDH 1D9IA 4BXSA 3PTNA 2BLOA 3UWJH 1HNEE 3TK5A 1RIWC 5CDFE 2UWLA 1ZHRA 2XXLA 4DW2U 4CHAB 2R3UA 4E7NA 4WMFA 2Z9JA 4B1TA 1O0DH 2B5TB 1P02A 1SGQE 2WPDD 1GDNA 1XUKA 5EPYA 4K8BA 1L0ZA 1Z1JA 2QY0B 3H5CB 4JK6A 2ZFTA 1GHBG 1TPAE 1CBWB 1SLXB 1ZTJA 3ZV8A 1NT1A 1GCTC 3PMHB 2R2WU 3OE7D 5HM9A 3BTTE 4K3JA 1IQEA 1S6FA 3TGJE 5EW2H 1UJ1A 2OBQA 4NSYA 1BT7A 5A0AE 1CU1A 2ZZUH 1HJAB 2QXHA 1W12U 1WBGB 2JDID 2OUAA 4DOQA 2BVRH 1NRRH 1SQTA 4ZHLU 1S81A 3UFAA 3STIA 1NU7B 2HRVA 2STAE 3I29A 1DY8A 1AD8H 4A1XA 1O2WA 5J4SA 2TGAA 2F9UA 2G4UA 3ATKA 1QL7A 3P8OA 1OWHA 1QZ8A 2GDDA 3QDZB 2VH0A 5T1VA 2I6QA 4BAQB 4HGCA 3JZ1B 2J4IA 5ETXA 1V2PT 3TNSA 2A0QB 3T5FH 1XUFA 1GBEA 4ASHA 5HGGA 1FY4A 1TOMH 3ZV9A 4BAKB 2PUXB 1HCGA 1NY22 2Z9KA 1YBWA 2FTMA 2OXSA 2BD2A 2WPMS 2DE9A 2XCNA 4AOQA 1BUIA 2FODA 3ODFA 3TGIE 1H8HD 1QNJA 4XFQA 1KXAA 4X2WA 1YPMH 3AW0A 1O3KA 1GHWH 3MH4A 1AVXA 1L2EA 1LMWB 2WSSD 2ZGHA 1ESBA 2TRMA 1YLDA 1AMHA 1NO9H 2A4OA 4XBCA 2FXRA 1A0LA 2NU1E 3L33A 5AHGH 4DT7B 2VGCC 3E1XB 4U01A 3A7ZA 4AYYB 3LOXA 3RXVA 1D6RA 4JYTA 2VINA 4X6PA 1HAGE 2O8UA 1O2VA 1B5GH 2Z3CA 1EZQA 1GVZA 3RMNH 4WWYA 1VCWA 1Q2WA 2I6SA 4Y6DA 2CMYA 6GCHF 3GCHB 1O3DA 1W0YH 3EE0B 3BEUA 2A4RA 2WUCA 3TJNA 1SGEE 1W14U 1TX8A 1E1RD 1GJ5H 2PLXA 3Q77A 4B75A 4MQAA 1T8NA 4X2YA 3LDXH 1BMLA 1GWAA 1C2HA 3BG8A 2OCVB 3SV8A 5HM2A 4ABBA 2AIPA 1UCYK 1B7XB 2HOBA 1UMAH 1CO7E 2J2UA 1IQNA 2V35A 1ESAA 2FS8A 3KCGH 3WW7A 3QO6A 3MH6A 2XYAA 2HVYB 4FUFA 1W11U 1ID5H 5F8TA 1CT0E 1MAYA 2K7XA 1ZPBA 2F9BH 4NIXA 1AN1E 1ZJKA 1P2OA 3KHVA 2ZI2H 3ZZ6A 2DUCA 4H4FA 2BZAA 4YOJA 2P59A 4DY7B 2KCPA 3AVZA 4INLA 4ABJA 2ZPRA 1W10U 2QE7D 3P8FA 2ZGBH 3R3GB 2VIWA 3BG4C 1LHCH 1GJAB 5L30H 1K1LA 1EAIA 2PGQB 3A7VA 1TLDA 1SVPA 3FO8D 1A5GH 2J34A 3P95A 2A7JA 3QZQA 1DOJA 2ANKH 1H9HE 2AGEX 2BLQA 2ZFFH 4YT7H 5E0GA 3SUGA 2GZ9A 4BANB 1XXFA 1PPZA 1G2MA 1O3HA 3U8TH 3LGWA 3GS9A 1FV9A 4RKOB 5FCKA 1BMNH 4MNVA 2A1DB 3S9BA 4AFZA 3ZVCA 1BB0B 1D4PB 1ELTA 1LVBA 2TIOA 3LJOA 4ABGA 1HAPH 1AHTH 1UHBA 1SKYE 4A1TA 3S9CA 1UVPA 3BEIB 1CE5A 3U8RH 1PFXC 1M9UA 2EY4C 1PPCE 3RXMA 4ABIA 1UCYH 3OY5U 2K1QA 1FY8E 5DP3A 1O2SA 2OK5A 1TBRH 2H5CA 1C5WB 4YTAA 2J9NA 3A8CA 1GI6A 2V3OH 4BNRA 1JBUH 2BX4A 4Z1MD 1GI1A 3DFLA 4OS5A 1HXEH 3SHCH 1TWXB 4ZROA 4KGAA 1A5HA 2P95A 2BVXH 1L4DA 4TY7A 2Z9IA 1Y5AT 3MNBA 4I7YH 4K60A 1RJXB 4IMQA 2VVUA 4WH8A 1EQ9A 3TK6A 4OS2A 3B23B 4P00A 4D7GA 2A5AA 1PPHE 1BBRE 2BD3A 3SJ9A 1Z8JB 2THFB 1GBBA 1O5DH 1VJ9U 4KKDA 1EUFA 1TFXA 4Q7ZA 1Z8RA 2W3IA 3EBNA 1C5SA 2FI3E 3S9AA 3Q3YA 4D9RA 4FUGA 1S82A 1KXDA 3B9FH 4X1PU 4CHAC 4H6SB 1CHOF 3RXHA 2G81E 3VB3A 2XC4A 1TABE 3PWCA 5I25A 4I8JA 4OM9A 1GL1A 3RXJA 1MH0A 2ALPA 1THPB 1VKYA 3SORA 4AZ2B 6CHAB 3ELAH 1IHTH 3RXPA 2ZECA 2ZGXH 1EPTA 1EPTB 3RXCA 1QHRB 2ZDKA 1F5KU 3TIUA 3PV5A 1IHSH 2A4QA 5DP7A 1J14A 1Z1IA 3M3VA 1UTQA 1TGTA 5GCHG 4E06H 3PMBB 2Y5FA 1T7CA 1C5NH 3K65B 1DUAA 1UTPA 4DVAU 1LHDH 1SFQB 1F0TA 2BD4A 4K5ZA 2OC8A 3VB4A 3M36A 3P92A 1IQLA 1GL0E 1KYNA 2AERH 3LT3A 1NRSH 3OTJE 3VFEA 5GWZA 1ARCA 1GBIA 2LIZA 3UREA 3MTYA 1FPHH 2O8MA 1IOEA 1GJ9B 3FANA 2ZTYA 1K1OA 1ZMJA 1QBNA 1SR5C 2FLBH 1ELFA 4FUHA 1T4VH 3UR6A 3LGUA 4OS7A 1P2JA 5GXPA 2VIVA 1ACBE 8LPRA 2WHXA 3MFJA 3SV9A 4YOIA 3Q00A 1HB0B 2ZHWH 5DG6A 1HRTH 1P11E 5DGJA 3ZVBA 3DD2H 2ILNA 4THNH 4AGJA 4AFSA 1CA8B 5J4QA 1O2LA 2F91A 2BZ6H 2W5EA 3PRDA 1NRQH 1G3EA 3ZZAA 2QC2A 1O36A 1C5QA 1TGNA 4WXIA 1LHGH 2P8OB 1GGDB 1WTHD 1TPOA 3VB7A 1DX5M 1N6YA 2ZGCA 1TGBA 4FVBA 3EDXB 2FDAA 2L6OA 2CK3D 1LKAA 1BRUP 1O2OA 1QRZA 1K1NA 2GZ8A 2XW9A 1OS8A 2JKHA 5DKMA 3KQEA 2Z94A 1JRSA 1B0EA 4E05H 1ELDE 4NFFA 1C9PA 1ZLRA 1C2KA 3GCHC 1Y5UT 1RFNA 1W8BH 2V6NA 1H8ED 3PRBA 4ESTE 3BTDE 1ORFA 2RCEA 3MU1A 2Q6DA 3F68H 2HLDD 3RU4E 1SGYE 1G32B 2ZU3A 4Q4LA 1BITA 2BTCE 4GHTA 4F55A 4AFQA 3BTWE 4NA9H 3EA9A 3SV7A 1C5OH 2HVXA 1C2MA 4K1SA 1EOLA 1O2IA 4X8TH 2STBE 1HAVB 4D76A 3RXIA 1O3BA 3SJOA 3Q3XA 2VWMA 5AFYH 5FPSA 4I8HA 2C3SA 1P3CA 1SGIB 2BDGA 1TNKA 1WYKA 1PYTD 5EQQA 1P2IA 3D62A 1O3LA 2F9OA 2O8TA 4DG4A 1P09A 1TONA 2PTCE 4GAWA 1GMHF 3SU3A 1C5VA 4OS4A 1DWCH 3K2UA 4UE7H 5AVDA 3TJOA 1MABB 1MD7A 5C17A 1SGPE 3RXQA 1Q3XA 1CGHA 2ZU5A 2ZQ2A 1Z8IB 1CQQA 4JK5A 4A92A 1DXWA 3MO6A 4B6FA 4ACAA 4FU9A 5EOKA 1H4WA 2WYJA 4LOYH 1EXFA 2SGDE 3URDA 2G5NA 4Z6AH 2FOMB 2IJD1 4ABFA 3M7TA 1THSH 5C67A 3F9GA 1EATA 1AU8A 2R0LA 2YMSD 1FNIA 3MU5A 1ZRKA 2BQ6B 4FU8A 3EYDA 1QJ1B 3P17H 2OLGA 1G3CA 4XDEA 4MPXA 2H5DA 1S0QA 1Y3VA 2BOHB 4LK4A 4E7RG 3A8BA 1L1GA 1O2JA 2GKVE 3GYMA 1QRXA 2UWOA 1SGFA 1VITF 3A82A 1TA6A 1CSOE 3T28A 4D7FA 3UNSA 1O3AA 2BY5X 1J8AA 2LNCA 3NRLA 4ABAA 1HAOH 2JH6D 2FI4E 2FM2A 1V2WT 1ZR0A 2ODPA 5DP5A 3ZYDA 2BY8X 3BN9A 1VJAU 1N8OB 4JZIA 3EQ0H 1XXDA 2BD9A 1HBTH 1ZHMA 1FY5A 1O2HA 2ZU2A 4A5TS 2VH6A 2UUFB 3RXTA 1WCZA 5H4IB 1FIZA 3M35A 1C5XB 5CE1A 3NUMA 3FOAA 1F5LA 1E79D 3SW2B 1GJDB 2GMTB 4B2BA 1JWTA 4GSOA 1HUTH 4IW4E 1D3TB 2PGBB 1GI5A 1XX9A 1C5UA 3SGAE 5A8XA 1LCYA 4ZHMU 1D3QB 1TMUH 2Y5GA 4K1EA 1HAZB 1TMBH 3C27B 3RXFA 2PTNA 4NWLA 1P9UA 1SGDE 1NN6A 3MWIU 1DITH 3GDUA 3GDVA 1UVTH 2R2MB 1K0HA 2CJIA 2ZU1A 3CS7A 4INHA 1DDJA 1D3DB 3HGPA 1AWHB 2CV3A 2SFAA 5FHTA 3FP6E 3LGYA 2VVVA 1SC8U 2OC7A 3R0FA 4XOJA 1UVUH 3SU0A 1G30B 3MQKC 5TCAA 1YP9A 4Q80A 1WSSH 4HFPB 1NFUA 1P12E 4IS5A 4WXVA 2F43B 1SGRE 2P3TB 3A86A 4J1YA 1XM1A 3SI4H 1FAKH 4NCYA 1EJNA 4IBLH 2ZCLP 4Y11E 1DFPA 4FETA 1YM0A 4CRCA 2C4FH 5CHAB 3NKKA 4DT4A 5EJZA 5GDSH 1Y59T 1MMJN 1SBWA 3AK5A 3U9AH 3RUOA 3ITIA 3A81A 4X8VH 4J2YB 4Y76A 4ABHA 1C1PA
chains in the Genus database with same CATH topology
1GI9B 1ELCA 4ZXYH 1V2LT 1BCUH 1GBHA 1SGFG 1TMTH 4HZHA 3KEEA 4TWWA 1QQUA 1MBMA 2FESH 1O2YA 1CA0C 3O8BA 1MZAA 1V2TT 4GUXA 1EX3A 3OSYA 1ZTKA 3A89A 3TVJB 2GVFA 4UFGH 4TPIZ 4X1SU 2ZEBA 2VJ1A 3ZZ7A 1UK3A 3DFJA 1BTZA 3SU4A 3BF6H 1MQ5A 2Y7XA 4UEHH 2R0KA 1ETSH 4I8LA 2JH5D 2A4GA 2Z3DA 2PKSB 1AVWA 1INCA 3PM3A 5DP6A 1O2ZA 1GMCF 5DP8A 5IYTA 1BRCE 1GG6B 3SN8A 4ZH8A 1C1TA 2DE8A 2GV6A 5A8ZA 4DJZB 4GPGA 1YYY1 1P04A 2P8OC 5GJ4B 2WPJS 4FUDA 3SHAH 1SLVB 5F8ZA 5FAHA 4AG2A 1K1MA 3BSQA 1E0FD 1ZHPA 3U8OH 1DM4B 4I8KA 1QTFA 5A2MH 1H8IH 2G55A 2GZ7A 1AFQB 1CHOG 1N6XA 1OKXA 2XTTB 2UWPA 1FN6A 4I31A 2ZP0H 4Y7BA 3E0PB 3QWCH 3TH4H 4MPVA 2G52A 1JRTA 3KGPA 4ISHH 3UQOA 1EZUC 4D8NA 4M7GA 3H7TA 1O5CB 1C2IA 3VEQB 4NG9H 5K7RA 2D8WA 5BRRE 2IN2A 1OXGA 3NWUA 4GCHF 1UCYE 2XRCA 2PR3A 2C90B 1UTJA 4QT8C 5HXFA 3V12A 4CBNA 3MO3A 2JETB 3RLYH 4IMZA 3RXLA 3BTKE 4TPYA 2ZA5A 1EASA 4YESB 1XKAC 1AI8H 3Q76A 4K8YA 2BY6X 4OS1A 4NA8A 2HNTF 4NZLA 2FOEA 1YPGH 2BDCA 3UWIA 3BTEE 2FLRH 1G3DA 4PROA 3DT0H 2HPPH 3KQBA 3U1JB 3M5OA 1DY9A 3SU6A 2AS9A 3RU4D 2Z7FE 2WPLS 4ZKRU 1NRNH 3O8RA 3MU4A 4ISNA 1YGCH 1JIMA 3SUFA 2CHAC 2QGRA 1ZZZA 5JBTA 1X7AC 3NK8A 1C5RA 1C5LH 5IDKA 4O9VA 3W95A 1VGCB 3S0NA 1NESE 2UUYA 3Q3KA 1P2KA 2G00A 3HKIB 1GJ7B 2ODQA 2EC9H 4MLFB 3M7UA 1VZQH 1TRYA 2FOGA 3SGQE 1GHZA 4HI3A 1QBVH 1ZSKA 2OINA 3JZ2B 5T3HA 5F8XA 1NPMA 4YLQH 3W94A 1T8MA 4Y10E 1QL8A 5LPFA 1RTLA 1MZDA 1N8OC 2D2DA 1O5FH 2P93A 1PQ5A 1TA2A 3SZNA 2VIOA 4U30A 9ESTA 4CH8B 1ANCA 2CF9H 2QF3A 2P16A 1EJAA 2ZTZA 2AGGX 3OU0A 4IN1A 2B8OH 1GVKB 4MPWA 3GDSA 3ENSB 1G2LA 3RXBA 4UONA 5PTPA 1BTWA 1AB9C 1W2KH 4SGAE 1FQ3A 1FMGA 3AAVA 4CRBA 3QX5H 1S84A 3RC5A 1MKWK 5FX5A 3PB1E 3O8CA 1P06A 3L3TA 1BMMH 5FCRA 3ZYEA 4FXGH 1GI7B 1QB9A 1O31A 4WF8A 3NZIA 2B0FA 3GY4A 3UNRA 3TLOA 5HYOA 3RXEA 2BLWA 3ATMA 5E2PA 1ARBA 3P6ZB 1P9SA 2J38A 1GMHG 3MI4A 5ESBA 1A0HB 3O8DA 3LGTA 1C1VH 1MAXA 4DIHH 3BEFB 4BAMB 1FIWA 4D9QA 1TB6H 1HAIH 1TGSZ 1T8LA 2SGAA 1AE8H 1UHBB 2WV4A 1Z6EA 4Y7AA 2TGTA 5CMXH 1YPHE 2D1JA 2P3UB 3N7OA 3NPSA 1OYTH 1Y3XA 1OWIA 3B8JA 5L2ZH 2BB4A 1TQ0B 8GCHG 1ZRBA 2GD4B 2P3FH 4RSPA 5C1XA 3ATLA 2GTBA 1BRBE 1P2NA 1ANEA 3BTQE 7GCHF 4K69A 3K9XB 3ZVEA 1C5MD 1KIGH 2FOBA 1VITG 2M5TA 3KQDA 2B9LA 2F83A 1V2MT 1O32A 3FFGA 4WH6A 3MOCA 1MKWH 1BJUA 1ANDA 1MTNC 1BTYA 3RXSA 1BZXE 2QCYA 1NRPH 1NFXA 5E0HA 2IOTA 3BV9B 1DVAH 1NFWA 2ZPSA 1GJCB 2BXUH 1NZQH 3BTHE 2G8TA 1EB2A 2G5VA 3IWMA 1L1JA 5F03A 1GBFA 1ABJH 1K28D 1C2EA 1GG6C 1CBWC 2BDAA 2FOFA 4Q7YA 3RM0H 1VITH 1XUHA 2J92A 1SGTA 2BDYA 1LO6A 3MNCA 3M7QA 1QGFA 3SNAA 1JXPA 1MU6B 3UPEA 2FWWA 3PO1B 5T6DA 2PFEA 2G51A 1HJAC 1IQIA 1UTNA 3MHWU 2ZDVH 1TX7A 1GI2A 2XWAA 5DP4A 3GCOA 2VU8E 1LVMA 4LZ4B 3IITA 1QURH 1A3BH 1DT2A 1C1SA 3A7WA 3SUDA 3UR9A 2ZQ1A 2J95A 3HGNA 4UFEH 2YOLA 3UUZA 3VXEH 4CRAA 1GJ6A 3F1SB 2GX4A 1DWEH 3RMLH 1K9OE 1S0RA 4KP0A 2QXJA 1C2LA 5AFZH 1RXPA 2RG3A 2GCHF 1W3CA 1CGJE 2JETC 2AMPA 1GCDA 3LGVA 3LPRA 2IJOB 4I33A 1SMFE 3V7TA 1BTHH 1HAYB 1P05A 5ABWA 4ISIH 2ZG0H 2ZHDA 1RIWB 2ZDAH 2ZFQH 1QB1A 1QL9A 1HDTH 5I46H 3PLBA 1ESTA 4AX9H 1THRH 2VIDA 3QK1A 1Z71A 1K1PA 1GMDF 2PKAA 1O3GA 2PKAB 2FOAA 2GT7A 1MD8A 1V2VT 2EEKA 1OWKA 3KNXA 2OC0A 1GMCG 2TGDA 1AQ7A 1BTUA 1KXEA 3D65E 1DUEA 2XBWA 1C5ZB 3KL6A 3F6UH 2A2XH 3SNEA 1FZZA 2Z3EA 1HIAA 1TRMA 1SB1H 3T29A 1C1MA 1ZMNA 1IQJA 4NIVA 3LIWA 4CRFA 1O3EA 2OBOA 1ANBA 5JBAS 1OYQA 3EA7A 5EXMA 2XC0A 4AORA 4NSVA 2YNBA 1BTXA 1TBZH 3RXGA 4AFUA 4ZKOU 4ZKNU 3M3TA 5JDUB 4RKJB 3EGKH 1J17T 1MCTA 1C5TA 3D49H 4K2YA 1O2NA 5GPIB 3M61U 1TQ7B 1B0FA 2ZC9H 1SFIA 4JMYA 2NU2E 3BIUH 3CP7A 4H6TA 1KLIH 1NU9A 1ZSLA 1XVMA 1DS2E 4GCHG 1GVLA 1AZ8A 3MH5A 1V2JT 4NIYA 4Y8XA 1BHXB 4DIIH 2W7SA 3TPIZ 3RXAA 1T4UH 3TH2H 3RC4A 5G4BA 2SGQE 1J16A 1HPGA 3TK9A 2WPIS 1IQKA 1BA8B 3UQVA 4Y71A 1ZYOA 1ELAA 1KXBA 1ELGA 3A88A 1GBAA 1GPZA 4I8GA 1GDQA 4Y8ZA 4NFEA 2HWLB 3PROA 4WJG2 8GCHF 1AWFH 1AGJA 2O9QA 1TALA 2XBYA 1IQMA 3A87A 1F0RA 1KTSB 3KN2A 3ZVFA 1YCPM 1UVSH 3GISB 1Z7KA 3WY8A 1H1BA 1TOCB 4XBBA 3GY3A 1TRNA 2FYRA 4WVPE 4LZ1H 2HGTH 1YPHC 4IC6A 3UY9A 5EGMA 1NFYA 1C2FA 1J9CH 5T6FA 1NROH 3SQHE 2KAIA 2KAIB 3VPKA 3LC3A 3TJUA 1PQAA 4FUBA 3LGIA 5DK1A 2Y7ZA 5JPMH 3ZZDA 4F4OC 1RS0A 5FX6A 3TH3H 5FPYA 2PW8H 1FN8A 4CRDA 3SUEA 4JZEH 1GBLA 7LPRA 1SHHB 1XUGA 2BQ7B 1AIXH 1YKTA 2PWXA 5A8YA 4H42U 1BDAA 1ZGIA 1Y3WA 4NZQA 4FUIA 2SGPE 2FYQA 2CN0H 2Q1JA 3BG4B 5TJXA 3A7YA 1JOUB 1F0SA 1V2ST 1P8VC 1T8OA 5JB9S 3M3SA 4OS6A 2ZCHP 5C1YA 3SO3A 5EODA 4AYVB 1IQHA 1W13U 1UK4A 2GT8A 1O35A 1HAXB 1O37A 1G36A 2A31A 3SU2A 3FP7E 1O33A 1ETRH 3M37A 2B7DH 6CHAC 1TNIA 1MUEB 4B74A 1ZOMA 3RM2H 2ODYB 1C2GA 3STJA 1EPTC 4KTSA 1S5SA 4GVUA 4O3TA 3BIVH 1HYLA 1O2RA 4R8TB 5LGOA 2F9PA 3PO1C 1UTLM 2FOCA 4O03A 3DA9B 1RTKA 3EA8A 2ZNKH 2A5IA 1WTGH 2VWNA 1WQVH 2O8WA 4CBOA 2C8WB 1UTOA 3FP8E 1PQ7A 3VB6A 1GBKA 3GICB 2H2ZA 4X2XA 1S85A 1VR1H 1EP5A 3GYLB 3A7XA 2JH0D 3ZZBA 4JCNA 5FXLA 2BXTH 2AMDA 4CH2B 4O3UA 3RU4T 3MH7A 2PUQH 1DANH 3AASA 2FX4A 3QN7A 1Y3UA 4KELA 4YM9A 1P2MA 1EAUA 1LQEA 1MKXH 3VGCB 2QA9E 2J94A 7GCHG 2H1UA 2AYWA 3KF2A 1PJPA 1C1NA 1EZSC 4Q2KA 4K1TA 2VIQA 1UK2A 1NTPA 3SV2H 1V6DA 3ATIA 2BDHA 1CT4E 1BRAA 4TYDA 2HNTC 4JYUH 2ZDMA 4ZKSU 3CENA 4YO9A 1CGIE 1XUIA 4OGXA 2BD8A 1MTUA 1GGDC 1DSTA 5E0JA 1EOJA 1JMOH 4JZ1A 1PPBH 1HAHH 3ZVGA 3F9EA 1ZGVA 2QIQA 1BTPA 1SG8B 4ABDA 1GI8B 4Q7XA 5JB8S 1AZZA 2PV9B 1ETTH 2VIPA 4IGDA 3BTFE 2OP9A 1LPZB 4YLUA 4NA7A 5EW1H 5FBIA 3E16B 1C9TA 1EAXA 5T6GA 2ZGJA 1TNGA 1IQFA 2WINI 1V2NT 1DE7H 3E3TA 3A83A 5BPEA 1TE0A 3NXPA 1A61H 1AE5A 3U98H 2ANYA 3A8AA 3GCTF 2Q6GA 1YLCA 4Y79A 2V0BA 4INKA 4R0IA 2HLCA 2FI5E 5EU8A 3A7TA 1C1OA 1WV7H 1Y8TA 1MQ6A 1C5PA 1NS3A 1E36B 4U32A 3ZZ5A 1W0ZU 1HJ8A 2BVSH 5C1UA 2Y81A 3E0NB 3PYHA 3SNDA 3M5LA 4Y0ZE 2QXGA 2AFQB 1O38A 3RLWH 1H9IE 4F49A 1EP6A 1TPSA 4JZFH 5L2YH 1LKBA 2OQ5A 1F2SE 4FUJA 1DWBH 3LC5A 2ZFRH 5SGAE 1A7SA 4BAOB 2GCHG 1AVGH 2Z9LA 1O2GH 2FS9A 4Y0YE 5C3NA 1S6HA 2H9EH 1FJSA 1WQSA 2NWNA 4YZUA 1VCPA 1WAYB 2GCTB 5LPEA 1ELVA 1KLJH 1T32A 1V2UT 1EJMA 1F92A 1SOZA 3KQCA 2BDBA 5EQSA 4ZHAA 1N1LA 3K6YA 2ESTE 3RXRA 3QUMP 2BOKA 1YPKH 1SHYA 5GIBA 1A1RA 2WPKS 3QTVH 3QTOH 1FY3A 1ELEE 2BDIA 4NWKA 1XMNB 1BOQA 1GMDG 1KSNA 1GBCA 1FDPA 1ZJDA 1C2DA 4MG3A 4CREA 4IN2A 1WU1A 1F0UA 7KMEH 1SQAA 5DPAA 4TY6A 3T2NA 1SGCA 1ZMLA 2FTLE 5EXLA 4AN7A 2BY9X 2GDEH 2AIQA 5DO4H 2RA0A 1ABIH 2LPRA 2ZDLA 2ULLA 1GBDA 1UTMA 4JYVH 1LPGB 1V2KT 1KLTA 1W7XH 2ZKSA 4MNWA 1PPEE 4X1QU 3F9FA 1F7ZA 1AKSA 1L4ZA 2Q6FA 1AKSB 1DLKB 4KTUA 1GJBB 4WY3A 1OP8A 1P10A 3T26A 2QN5T 1SSXA 2Y80A 1ELBA 2FMJA 1GI4A 2GGVB 2QYIA 2FP7B 3MNSA 2ZCKP 2GMTC 1BHXF 4TWYA 1A5IA 1O5EH 5C5OA 2ZFSA 1TBQH 4YT6H 3LH1A 1CT2E 3HK6B 4NIWA 2PSYA 2VB0A 3EAJA 1BQYA 3I77A 2BD7A 1GHAF 5A09A 5TCCA 1GDUA 3MYWA 2EI6A 2XBVA 3LONA 2H9HA 1O3OA 3DUXH 3MMGA 1XUJA 3T62A 2C8ZB 3M5NA 2ZIQH 1OP2A 3ZZ9A 1KY9A 3U69H 1NM6A 4B71A 2BQWB 2QF0A 2FIRH 1KTTB 1AUJA 1Y3YA 2BD5A 3E6PH 3SV6A 1O39A 2ZHFH 4OGYA 1D3PB 2ZU4A 1K1IA 4AG1A 2FOHA 4GHQA 3UNQA 3UTUH 1KXFA 1SQOA 5EXNA 1UTKA 1K22H 1QIXB 3OY6U 4MNYA 5CHAC 1GJ8B 2A7CA 4XBDA 1OWEA 3SU5A 2OD3B 1GHXH 3K6ZA 3V3MA 3MO9A 1O3IA 2AH4X 1Z6JH 1AUTC 3RC6A 2VNTA 3I78A 1C2JA 2WUBA 1YPEH 1GJ4H 2SNWA 2RA3A 3SNCA 3T25A 1WUNH 2R9PA 8KME2 2UUJB 1MBQA 4WMDA 1SLUB 2A32A 3V13A 2QV1A 1LQDB 1DPOA 2F3CE 1YF4A 5FPTA 1ZPCA 5DJ7A 2AEIH 3MNXA 5FBEA 3UOPA 2A45B 2VWOA 4MVNA 1O5BB 1FY1A 1AO5A 1SLWB 2HPQH 4AB8A 2H6MA 2NU4E 2ZFPH 1OSSA 1TNLA 3VGCC 3VXFH 3S7HB 2PKSC 3HK3B 3P8NA 5LPRA 1GHBF 1G37A 2BMGB 4IC5A 1OOKB 6LPRA 4A7IB 1P01A 1C1UH 2C8YB 5K0HA 1TX6A 3BTGE 2RDLA 3ODDA 2WV5A 3QLPH 4X6NA 1EB1H 2GP9B 4ZMAH 3E8LA 1IQGA 7ESTE 3A8DA 2FO9A 3TGKE 3ZZ4A 1CVWH 4MTBA 3E91A 2ZPQA 3GY7A 3TU7H 3QZRA 3VB5A 3DHKH 1AFQC 3GY2A 4X6MA 1L1NA 4RN6A 1HLTH 4BXWA 3RMMH 3HKJB 1C1QA 2FPZA 3A80A 2W7UA 3UIRA 1E34B 2V3HH 1LPKB 2ZHQH 2SGEE 2ZO3H 3PV4A 3RP2A 3PWBA 1O5AB 3M5MA 4ZXXH 4U2WA 1ZSJA 1EAWA 2IPHA 1T31A 1FAXA 3RDZA 2QXIA 5LH8A 1UO6A 1TGCA