3VB7A

Crystal structure of sars-cov 3c-like protease with m4z
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
total genus 80
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb7A02
5GCHG 2WV4A 3ZVBA 1OWHA 2ASUB 2RA3A 2A4GA 2IJOB 4NFEA 5ESBA 3RLWH 4FUCA 1V2MT 4IBLH 1SVPA 3L6PA 3TGIE 3ZZ5A 4Z6AH 5TCAA 1SFQB 1SQTA 4NFFA 1SQOA 1C2KA 5HM9A 1OWIA 2VIPA 1NFXA 3ENSB 2ZWLH 1EJNA 3BTGE 4CRAA 1Y3XA 2BY8X 1YPGH 2R0KA 2THFB 3QGNB 3CS0A 1TOMH 1HPGA 5E2PA 1EAWA 1QB6A 1ZSKA 1J15A 5G4BA 1EZXC 1CT4E 1AHTH 1BRAA 1O3HA 1QQ4A 4X6OA 1O2LA 2A2QH 3SBKA 5EXNA 2VNTA 1SGEE 3PWCA 4GCHG 1T8NA 1C2LA 2ZFFH 1MBQA 1YPHE 1QJ7B 1OS8A 2OXSA 1CT0E 1LMWB 1HRTH 1F0SA 1NTPA 3ZVEA 1C1MA 1GJAB 4OS4A 1PQ8A 1L1JA 4X6MA 1S85A 4FUIA 3SUEA 1BTHH 1EKBB 2A5IA 1YBWA 1PPFE 1ETTH 1GMDG 1A61H 1Z1JA 2AIPA 5T3HA 4ZHMU 3ZZAA 2XBVA 4CHAB 2A7HA 4O3TA 1DICA 2UWLA 4I33A 4A6LA 4JYTA 1O3IA 3A8AA 3SOSA 3VB5A 1T8OA 3AASA 2OC1A 3ESTA 1AO5A 5EXLA 2ZDNA 2ZO3H 2A4QA 1BMMH 5HXFA 1A5IA 5FCRA 3MWIU 3BG8A 1QBOA 1ZTJA 1FIWA 1L4DA 4IMZA 4ABFA 4A1XA 1PPHE 1MQ5A 5FCKA 2FX6A 3LJOA 1LTOA 4ABAA 1RXPA 3S7KB 1ZHRA 3MU8A 4Y8ZA 1A5HA 4X6NA 3M5LA 4AGJA 2TGPZ 2ZKSA 4IN1A 1IHSH 1O2GH 3F9GA 1TNGA 2EI8A 1P9SA 2CGAA 3RXMA 1FNIA 3SU3A 1O31A 3SV6A 3MH5A 3T2NA 1LCYA 3S9CA 2F3CE 4AFUA 1GHWH 1D9IA 2SFAA 1HCGA 1X7AC 4KKDA 3BEUA 4AYVB 1W13U 1NRRH 3E16B 1ZJKA 4WMDA 2F9BH 4PROA 1UK3A 1TNIA 3ITIA 5L30H 1Z1IA 1GBCA 1KSNA 2ZNKH 1GHBG 5EW1H 2ZDAH 1F92A 1CBWC 1FY1A 1HDTH 3U98H 1AUJA 1Z71A 1BZXE 3RC5A 3MOCA 1YKTA 2A45B 2UUFB 3RC4A 2OCVB 1Z6JH 1UO6A 3TGKE 4AYYB 1F5LA 1NROH 2Y7ZA 2FS8A 3URDA 1ARCA 1YPMH 4CRBA 3T62A 4JCNA 3T29A 1ELCA 3BN9A 1L4ZA 1RGQA 1GHXH 1H8DH 1ELEE 1SMFE 4OS1A 5GIBA 4MNWA 5HM2A 1E34B 1QTFA 2P94A 2W7SA 5ABWA 2GKVE 2XBWA 2VIVA 4NG9H 1G3CA 4YTAA 1O3JA 1XUFA 2B7DH 1LHDH 1M9UA 2CF9H 1VCPA 1O5GH 1JRSA 3BTME 1J8AA 1ANEA 1TX8A 5GPIB 4IS5A 4E7RG 3A8BA 2ZF0H 4ABGA 5A0AE 1V2UT 3GOVB 3RXSA 3AW0A 1KXFA 1K22H 2ZECA 2Z9GA 2WUBA 1DANH 1ELVA 1GI4A 2GCTC 3D23A 1LPKB 2BZ6H 1G30B 1EAIA 4HZHA 1VZQH 3HATH 2ZFSA 1LHEH 1MUEB 1AB9B 1OYTH 1ZHMA 4X8TH 1DPOA 1P2MA 1RTKA 1P2OA 5LPRA 4JK5A 1UCYE 3S0NA 2AFQB 1D3PB 3A88A 4DVAU 3KHVA 4HI3A 2GDDA 1L0ZA 4A92A 1C2MA 3BEIB 4GPGA 2K1QA 2XC0A 3GICB 2QF0A 1W7GH 1YCPM 2ZDMA 2BMGB 1YPJH 2VJ1A 4K8YA 4K3JA 4F49A 1N6YA 1WTGH 3NWUA 5F8ZA 3NXPA 4Y11E 1C5MD 3B9FH 1GGDB 1TX7A 2VGCB 2R3UA 1MKWH 1GCTB 1KYNA 3MNBA 3SU4A 5JBCS 5EPNA 2FTMA 1V3XA 1RFNA 3T26A 3ZVAA 1QRZA 6CHAC 4CRCA 1HAHH 3LGUA 2Z94A 1CA0B 2FOMB 1K1NA 2NU3E 3LKWA 1GG6B 1WCZA 4LOYH 1XM1A 2TPIZ 1PJPA 2B0FA 1MMJN 1Y3WA 5AF9H 3RXRA 1TOCB 4JYVH 2RCEA 1GI7B 3GCTF 4KTSA 3UWJH 1AWHB 1AFQC 5EG4A 2H9EH 1IOEA 1C2GA 1P57B 1HB0B 2QY0B 2Z9KA 2CXVA 1TBZH 1QR3E 1ZLRA 3SV9A 2BVRH 2WV5A 3LDXH 4AGKA 4DT7B 2SGPE 3SNCA 3A7XA 1O2UA 4DIHH 1DXPA 1GL1A 1O5DH 3RU4T 2BDHA 1TGCA 3F1SB 1EPTB 5JBBS 2LNCA 3M5OA 4J2YB 2P8OC 4ZUHA 3MMGA 3P8GA 3A8DA 2V6NA 4ABDA 5A8ZA 1HNEE 2G8TA 4NZQA 2ZHWH 1B0EA 1ZPBA 1S5SA 1NS3A 4BNRA 1D6RA 4Q7ZA 4UEHH 3ZZCA 3MH6A 1N8OB 1H1BA 3GDSA 1O5AB 3SJ9A 1PPZA 3K2UA 1CGIE 3AW1A 3RMLH 2Z9JA 3LC3A 2A5AA 1JIRA 1CA8B 1XUKA 3JZ2B 1AIXH 2Y81A 4ISHH 1WQSA 1A0JA 4ESTE 1K2I1 5IDKA 4A1VA 4I8JA 2ZG0H 1UCYH 5LPFA 1YP9A 3AAUA 3VGCC 3GCNA 1RD3B 3PM3A 3H7TA 3SV7A 1ZMLA 1GI5A 4O3UA 2ESTE 4FUBA 3MYWA 4NIXA 1ZSJA 1O3FA 3D62A 1W12U 2BM2A 3I78A 4MNXA 1O0DH 3E0NB 3HKJB 2GD4B 4OS5A 3UOPA 3I29A 1V2WT 4UONA 1F5KU 1CHOF 1P02A 4MPUA 2FIRH 4INLA 1OP0A 4Q7XA 4ZKNU 4D8NA 2FYQA 3NUMA 2XBYA 4BXWA 1TMUH 4ISOA 3BTFE 1SLUB 3PLBA 2A32A 1O5CB 4KP0A 5L2YH 2PKAA 3ODFA 4ABEA 1SGPE 4K5ZA 5JB8S 2ZCHP 1F0TA 2HNTE 2WPIS 3IWMA 2FXRA 1ANCA 3QDZB 1MU8B 3M7UA 1O5EH 2ZU1A 3LGVA 2FZZA 1GMCF 3BG4C 4WY3A 3A82A 2G81E 1MCTA 1TA2A 1IAUA 2PGQB 1JMOH 3FZDA 2WPMS 3RXIA 1C1NA 1PPGE 4A5TS 5JYIA 2ODYB 1AN1E 4QT8C 4ABJA 2GZ9A 3V13A 2ZGBH 1LHGH 1QGFA 3A83A 1QJ1B 2FYRA 3BIUH 3OSYA 1BMAA 3FFGA 2ODPA 2CN0H 1FY4A 1MKXK 4AB9A 1BTUA 1TPSA 4DGJA 1KXBA 2XXLA 5T6DA 1SGIB 1ARBA 1GDNA 3QX5H 3M7QA 3PLKA 3EA8A 4TPYA 1AI8H 3V3MA 3SGQE 3U8RH 1S82A 2ODQA 1ZTLA 3LJJA 4B74A 2XTTB 3BTWE 2ZU3A 4NWLA 1ZPZA 2ZDKA 1IQGA 1XXDA 1H9LB 1P09A 4CREA 1IQMA 1CGJE 1HAVB 1Z8JB 3A87A 1G3DA 2FESH 5CMXH 4WVPE 1O2WA 3CENA 5DP7A 1O3EA 1DUEA 3K6ZA 3VPKA 2XCNA 2OC0A 1V2PT 3S9BA 1BMNH 4IW4E 4B2CA 4NIVA 1KXEA 3GYMA 5C1UA 7ESTE 1A46H 1C1VH 1BTXA 2SGFE 9ESTA 1FAKH 3M61U 3PMBB 1OP8A 4WWYA 1TONA 1SB1H 3DD2H 1O5FH 3EGKH 1SSXA 2XC4A 1CBWB 3SNEA 2FOHA 5EGMA 2AGGX 2VWLA 1G3BA 1GBBA 1W7XH 5GJ4B 3RDZA 4X1PU 3TH2H 1TWXB 3KIDU 8KME2 3S69A 3PMAB 4BAOB 4JYUH 4O97A 1AU8A 3RM0H 3NZIA 1EB1H 3ZVGA 4A7IB 3C1KA 3LT3A 4X2YA 3SJOA 2WINI 2BOKA 2QXIA 1CGHA 3FZZA 1B7XB 4LXBH 5DPAA 3AVZA 1TNJA 2VVUA 1MCVA 3TNTA 2SNWA 3MU5A 4MTBA 3KQEA 1ETSH 5DP3A 2BY9X 1IQFA 1LVBA 1C5ZB 4NCYA 1BTZA 4X8VH 1QB1A 3GCTG 4AG1A 3K65B 1QY6A 3SHCH 4WH6A 2TGDA 1J14A 3SU0A 1GJDB 4AFQA 2QCYA 1D4PB 1HJ9A 1A4WH 3RLYH 2BQWB 3SORA 5C1XA 3SU6A 1TLDA 3KGPA 4JMYA 4YM9A 1FV9A 1T31A 2BLWA 2BDIA 1ESAA 1NU9A 2D8WA 2GGVB 1FY3A 1LQEA 1RIWC 1YC0A 4OS7A 4OS2A 1QQUA 3KQDA 4NGAH 2BX3A 1D3QB 1MH0A 1N6XA 3PB1E 1AKSB 3P8FA 2CMYA 2GCTB 2W3IA 1ELGA 3M3TA 3O8DA 1NC6A 4DCDA 1FI8A 2BY5X 1SOZA 1GVLA 2O8MA 1DVAH 3L3TA 5FPSA 1VITF 1S0RA 1HAOH 1O2PA 1VCQA 4DIIH 1AWFH 2G5VA 2J4IA 4X2VA 1O3NA 3VEQB 3HKIB 3PMHB 1OPHB 2C3SA 3T5FH 1ZGIA 1TPPA 4M7GA 3SI4H 1UTQA 1HLTH 1GI0A 3OYPA 4NIYA 1P04A 4ZROA 1BRUP 1UHBA 1FY8E 1ZMNA 1GBLA 2OP9A 3QUMP 1GHYH 3BTHE 1UVOA 3SJKA 4YT7H 1GJ4H 2ZFPH 1Y3YA 1AGJA 1D6WA 4Y6DA 1ZZZA 1QFKH 6CHAB 4GSOA 1AQ7A 2NU1E 3RXPA 3RXOA 4UFDH 3MU0A 2LIZA 3SQHE 4SGBE 5A8XA 1W8BH 3RXAA 1F5RA 1XUHA 1ELDE 3HGNA 1UTOA 1JIMA 1MQ6A 3M3SA 1CHOG 3PTBA 1EZSC 1O39A 4B2AA 3DA9B 1CU1A 4X6PA 3TVJB 2P95A 2XW9A 1AFQB 4AX9H 3GY3A 1PYTD 3LOXA 2G4UA 1INCA 1C5XB 1FLEE 1C4Y2 3RXJA 3RP2A 2GVFA 3ZZ8A 4CRFA 2BD8A 1WYKA 2F9VA 3FANA 3RXDA 1NPMA 4INKA 1O5BB 2WUCA 3RXCA 1K9OE 1OWEA 2AIQA 4BTIB 1E36B 2Z6BD 3UR9A 5DP9A 5CHAC 3VB7A 1CHGA 2P8OB 5IYTA 3HGPA 4MPVA 2G51A 1GMCG 2IN2A 4WXIA 3EDXB 1CSOE 5DJ7A 3PMJA 4F4OC 4ZMAH 5DP4A 1BTWA 3I77A 2XCFA 1OXGA 1CQQA 1ZJDA 1IQHA 4TY6A 2DE8A 1G37A 2OINA 5TJXA 3A86A 3Q77A 1S81A 3ZYDA 2Y80A 1C1QA 1ELTA 2OQ5A 2J2UA 3RM2H 4AZ2B 1YCPK 2ZPRA 1LPZB 1B0FA 2ZGHA 2W5EA 3GCHC 3SU5A 1XX9A 3G01A 4E06H 1DWCH 1TBQH 4IC5A 4I8GA 1UK2A 2XWBI 4U01A 2FI4E 4B73A 1FMGA 2O8TA 3PROA 3TH3H 3VGCB 2A4OA 4MPXA 4Y8YA 1L2EA 4VGCC 3RXKA 1ZPCA 1ETRH 3QTVH 5J4SA 1LQDB 1EOJA 2F91A 2UUJB 1TRNA 2Y5GA 3E0PB 4UFFH 1LVMA 2AYWA 3MTYA 4MNYA 1C4V2 2VINA 2XC5A 1SQAA 1SLVB 3ZZ9A 2VH6A 3UY9A 1C5SA 3RXEA 2BDAA 2AMDA 1BBRK 3LH3A 1Y5UT 1XXFA 2BTCE 3A80A 3PO1C 2XYAA 4MG3A 4XBDA 4ABHA 5JBTA 3MH7A 2GV7A 3BTTE 2ZGJA 1NFUA 1T7CA 3A84A 1O35A 1GI6A 1C9PA 2Q6FA 2ALVA 2QF3A 1DOJA 1P2KA 4D7GA 1O2JA 3BG4B 3F68H 4YO9A 1GPZA 1HFDA 1L1GA 2FWWA 3E3TA 4FU9A 2H1UA 1MTVA 1G2MA 2DE9A 1HIAA 4YESB 1KLIH 4U32A 1SGFA 2OC7A 2ULLA 4CBNA 2A0QB 4WXVA 2Y6TA 1GL0E 2BYAX 1THRH 3SGBE 1YPKH 1SFIA 1GJ8B 1RJXB 1HJ8A 2AGEX 2R3YA 4TY7A 1G32B 4B71A 1SGCA 3S9AA 1GBMA 2BY7X 5EOKA 2IPHA 1HAPH 1ZRBA 2J95A 1TGNA 4BTUB 4K60A 1XUGA 1YLCA 4OGYA 2ZTZA 2ZZUH 4U30A 1RTFB 1MTWA 1UVPA 1WSSH 1GBKA 1O3PB 2FEQH 1A3EH 3Q3KA 2ZU4A 3GY8A 1ZHPA 3TU7H 5B6OA 1P03A 3MNCA 2F9UA 3P6ZB 1GMHF 1PQ7A 6LPRA 1SHYA 1SGNE 3T27A 2OC8A 4B2BA 3E6PH 1S83A 2HALA 2PTNA 1WTHD 1HGTH 3RXTA 1O2RA 4X2XA 3M3VA 1ESTA 2ZPSA 4Y0ZE 5FXLA 2VIWA 1KTTB 1IHTH 3BTKE 1SPJA 1H4WA 1FIZA 1MTNC 2FDAA 2ZEBA 4Q7YA 5JDUB 1NFWA 1VITG 3VB3A 1TMBH 3EBNA 1HAIH 4KTCA 4FUDA 1O2HA 1BTPA 3UOUA 3TPIZ 4ZKSU 2NU4E 2ANKH 1IQIA 1C2EA 1DY9A 2D26C 1JOUB 2WPHS 4AG2A 1K1OA 4JZDH 1WOFA 2BDBA 5FBIA 1JWTA 1GHAF 2PR3A 4AOQA 3M5MA 1DLKB 2BD5A 1YPEH 4AFZA 1QBNA 4K1EA 3GISB 1IQJA 2W26A 1TGSZ 1DFPA 3RXBA 3U1JB 2BOHB 2ZTYA 5AFZH 1DSUA 1JRTA 1A3BH 1G3EA 4NSVA 2AEIH 4RKOB 1O2OA 2WPKS 4JZIA 3UR6A 1ACBE 5JBAS 1C1WH 1KXDA 1TBRH 1MTSA 1UVUH 2FLRH 2ZDLA 2ZI2H 2GZ7A 3EA7A 1JBUH 3N7OA 5DGJA 1K1LA 1QBVH 1EUFA 1AD8H 1KDQA 1YGCH 2I6QA 2HPPH 1PQ5A 1P2JA 1NT1A 2GMTC 4FUHA 4CH8B 3ZZ6A 2B9LA 1E37B 3ZVDA 3M7TA 1RIWB 1Y3VA 2BQ6B 5BRRE 3A8CA 3P70B 1GJCB 1QNJA 2QXJA 3TJVA 1BHXB 5BPEA 1DWBH 1P05A 2B8OH 2R2WU 2W3KA 3ZZBA 1W11U 3A89A 3RU4D 1TQ7B 5AFYH 2BD3A 3K9XB 4WMEA 1DITH 2FX4A 2Q6DA 2EC9H 3TIUA 3HK3B 1EJAA 3GY4A 4K8BA 4X0WU 4H42U 3PYHA 2ZC9H 3OU0A 4I8HA 5DP5A 2P93A 3GCOA 3OY5U 3P95A 2V3OH 2QV1A 4K1TA 1QL7A 2WPLS 2G5NA 1W2KH 5T6GA 3MI4A 4NZLA 3EAJA 1TNLA 2ZFRH 1EOLA 5E0JA 1EX3A 2O8WA 3STIA 2G00A 2J92A 2ZGXH 5LGOA 3MFJA 1U6QA 1EPTA 1TPAE 1BRCE 1MZAA 3ATLA 1GBHA 3TLOA 2KAIB 1AE8H 2PKAB 2TIOA 1SGQE 4JZEH 5LPEA 3EYDA 1FXYA 2A31A 3FP6E 1VJAU 4D9RA 2K7XA 2VU8E 4AFSA 2BDYA 2SGAA 2ANMH 1OYQA 3S7HB 4KELA 3SJ8A 2BXTH 3A7TA 1H9IE 1S84A 4XSKU 5FPTA 4YOJA 1Y59T 1Y8TA 4LZ4B 3E91A 1FN8A 2CV3A 2EI7A 1MBMA 1F0UA 4BXSA 1TIOA 4D7FA 1ELFA 5DP6A 4HTCH 3BV9B 1MD7A 4XDEA 4JZ1A 2YNBA 1PYTC 3NPSA 1SBWA 5C20A 2P3TB 2TBSA 3PWBA 2ZFTA 3KNXA 1OKXA 1G9IE 5DKMA 7GCHF 5EU8A 1HV7A 4LK4A 1BQYA 1NESE 4WF8A 3TJOA 1V2TT 1E35B 3QZQA 1GCDA 2IOTA 3Q3XA 1H9HE 1GJ7B 4YOGA 4THNH 5FX5A 2OQUA 1SC8U 1O2IA 3MO6A 5CHAB 4ISNA 3E8LA 2FPZA 1V2JT 2A5KA 1HUTH 2ANYA 1JXPA 4ISIH 5JPMH 4H6SB 5L2ZH 2ZHQH 5C5NA 2ALPA 1BOQA 2VIQA 1OSSA 5F8TA 2Y5HA 5A0BA 3PTNA 1O30A 2VB0A 3H5CB 1B5GH 3DUXH 1EP6A 2VIDA 2H9TH 1AVWA 5FAHA 5J4QA 2XWAA 3ATIA 1UJ1A 1AUTC 1TNHA 1HBTH 1Q2WA 4YT6H 1SGTA 4FUEA 3GCHB 2P3FH 3TK6A 2OUAA 3K6YA 5A09A 3LIWA 3LGIA 3Q76A 2VIOA 1BITA 5GWZA 1NRSH 3GYLB 1UVTH 1AVGH 2I6SA 1O2ZA 4ZXXH 2FOBA 4NWKA 4VGCB 4BTTB 4FVBA 5ESTE 1C5OH 5DO4H 1C5WB 5EQRA 1QHRB 2Y5FA 2P16A 1E38B 2Z3CA 3A7WA 3SI3H 2VWOA 1TAWA 1ZRKA 4JK6A 1HJAC 1BB0B 1WV7H 1GBJA 1O3CA 1GMHG 6GCHF 1G36A 1BIOA 1C5NH 1DY8A 2FMJA 3UREA 2QA9E 2C90B 3JZ1B 3SNBA 3U9AH 3O8RA 2J38A 3BIVH 3TH4H 3DHKH 1T8LA 5DK1A 3F9FA 3W94A 1UTKA 1O2MA 2VWMA 1UTLM 2SNVA 3BTEE 4I8LA 4IC6A 1C5YB 1O33A 2ZIQH 3PO1B 3ZZ3A 4ZHAA 3VXEH 3RXVA 1GI9B 2AS9A 3AAVA 1O2SA 3MH4A 2GV6A 3KEEA 1P11E 1BJUA 4I8KA 3ATKA 3O8CA 1XUIA 4OS6A 1GBIA 4MVNA 2QIQA 1EZUC 1WUNH 1MKXH 1OWKA 5A8YA 1PPBH 2ZHEH 3UNRA 1GHAG 2GT7A 3M35A 1LO6A 2V3HH 2AH4X 3R0FA 1A0HB 1FJSA 2H5CA 2G55A 4H4FA 3SW2B 3QO6A 5SGAE 2YOLA 5DP8A 4DG4A 4DJZB 4B1TA 3SQEE 4JZFH 1GJ9B 1W0ZU 2WYJA 1UTMA 1EP5A 2HOBA 2PFEA 3P8NA 4YZUA 1SGRE 3UWIA 1FN6A 1TX6A 2BZAA 2J34A 1C5RA 3QN7A 4MDSA 2VVVA 1QURH 1C5QA 2BLVA 1GI8B 3ZV9A 1IQLA 3CS7A 3PV4A 3RMNH 3KF2A 4DY7B 2BDCA 2V0BA 1XVMA 3O8BA 5C3NA 1VGCC 1O2QA 3RMMH 5L6NH 3B8JA 2WPJS 4GLYA 3U8TH 3QWCH 1UHBB 1MAXA 1GJ6A 2J9NA 2G4TA 1SR5C 4DURA 3A7VA 2C93B 4Y10E 1O2XA 4NA9H 4BAQB 3ZZ7A 1TGTA 5EQQA 3GY5A 1C1PA 4ISLA 1MTNB 5FX6A 1F0RA 2FOGA 1EXFA 3QK1A 2FTLE 3ATWA 1GVZA 1DX5M 2BD4A 4FU7A 4FUJA 2Z9IA 4R0IA 5E2OA 3UIRA 2ZU5A 1UVSH 3F9HA 3KCGH 3RUOA 1ORFA 1ABIH 2SGQE 1ZMJA 4CR9A 1XMNB 1IQNA 1BA8B 2BVSH 4GHQA 3SV8A 4I7YH 1LPGB 1C2DA 4GHTA 1LHFH 1SGFG 3UPEA 2A4RA 2CF8H 1P01A 1QRXA 1AFEH 1A1RA 2PGBB 1ZYOA 2PSXA 3SV2H 1WQVH 1O3KA 3ZZ4A 1QL8A 3KQCA 1G2LA 1ANBA 1TYNA 1DLEA 1O34A 3TITA 1P8VC 2B5TB 1W14U 1Y3UA 1EASA 3LGYA 1A0LA 1GDQA 3MO9A 2PSYA 2ZDVH 1SLWB 8LPRA 1TPOA 4UE7H 4B75A 2FP7B 1C5UA 1CE5A 4U2WA 1O3DA 1LVOA 1LDTT 1GBEA 2GMTB 4DOQA 7GCHG 7KMEH 1EB2A 2BXUH 2UUYA 4ZXYH 1O3AA 1CO7E 2A1DB 3F9EA 2ZHDA 3VB6A 3R3GB 1GVKB 2A2XH 1VITH 2PKSC 5GDSH 4MLFB 2Y7XA 5E0HA 1DT2A 3QTOH 4ZKRU 2D1JA 2HGTH 1PPCE 2D2DA 3ZVCA 4D76A 2W7UA 2F9OA 2OBOA 3DT0H 3M5NA 1NZQH 1Z8GA 4XE4A 1QA7A 3VB4A 1BBRE 2AMQA 3LONA 3VFEA 2Z9LA 1T4UH 3Q00A 3NCLA 1TNKA 5EODA 1GDUA 1QRWA 2H2ZA 1C9TA 3MNSA 4RSPA 4XBCA 5F6MA 1P2IA 2UWOA 4IMQA 2JETC 4GAWA 1LKAA 1AZZA 1P9UA 1Z7KA 2HWLB 1O3GA 1ELBA 4K2YA 4E7NA 2QN5T 3OY6U 4IGDA 1OWDA 1MZDA 1T8MA 1V2NT 1VCWA 1KY9A 3QLPH 3SUFA 2BHGA 2FO9A 3UFAA 1NFYA 4I32A 2G52A 5H4IB 1YPHC 4HGCA 3RXLA 1NO9H 1YLDA 3CP7A 3NKKA 3UNSA 4LZ1H 1A2CH 1K1MA 2EA3A 9LPRA 6GCHG 1V2VT 1GBTA 3BF6H 1UTNA 1HIAB 1MD8A 2QXGA 1Z8RA 1W10U 4Y71A 3BSQA 2Z3DA 1DWDH 3B23B 1K1IA 5LH8A 1Y5BT 4RN6A 6ESTA 1A5GH 2GTBA 1RS0A 4ASHA 3GY7A 1PFXC 3UTUH 5JB9S 1HAZB 2BQ7B 1YYY1 1TB6H 3P92A 1C5TA 2M5TA 5HGGA 5T6FA 4X1SU 2FOAA 1L1NA 2ILNA 2P3UB 1J16A 2UWPA 1P3CA 2QC2A 4I31A 4ABBA 1YCPH 1ZR0A 1C4U2 5DG6A 2FI5E 1UTJA 2DUCA 3URCA 2ZHFH 5FPYA 4X2WA 5K7RA 4ZH8A 1FY5A 2WYGA 1EAXA 2CJIA 1K21H 1AZ8A 2BD7A 3TJUA 1MKWK 5ETXA 1T4VH 2FODA 4X1QU 4CBOA 3RXHA 2VH0A 1TE0A 2GDEH 3P8OA 4NA8A 3SUGA 4Y8XA 1D3DB 4K1SA 4OGXA 1O3MA 4O9VA 2PUXB 3SHAH 1GI2A 1S0QA 1GHVH 3DFLA 3RC6A 1HXFH 3MO3A 1XKAC 1O38A 1TQ0B 2BX4A 3UNQA 1HXEH 3SGAE 1RTLA 2R2MB 1XVOA 1SHHB 1AMHA 3D49H 2QXHA 1BBRH 2OBQA 1EZQA 1LKBA 1YF4A 2XNIA 3UQOA 2F9NA 3FP8E 1HJAB 4X1NU 1WAYB 1V2OT 4UFEH 1C2FA 4YOIA 1Q3XA 2GX4A 1THSH 3U1IB 2EEKA 1IQEA 3SO3A 3W95A 1C1OA 2CHAC 2BDGA 1BDAA 4Y7AA 1T32A 3RMOH 5F8XA 1C5PA 2Q1JA 1OWJA 3A7ZA 1GI1A 5E0GA 1P3EA 1BJVA 1FPHH 1S6HA 1Z6EA 1AY6H 8GCHF 1ESBA 3EA9A 3M36A 4XOJA 1LVYA 3SNAA 1MAYA 4INHA 5HYOA 2OTVA 1UMAH 2FS9A 1FQ3A 1ELAA 1P2QA 2YNAA 3C27B 4H6TA 5CE1A 4CRDA 1KDQB 1WBGB 1TRMA 1MU6B 4BAKB 3RXUA 1C2IA 1O2TA 1O3LA 2ZA5A 1C1UH 1V2ST 1OOKB 4GUXA 1QJ6B 1UCYK 1P10A 2FOEA 2Z3EA 1O3BA 3QZRA 4UD9H 1FPCH 3BTDE 2J94A 2NU0E 4UFGH 4X8UH 3H7OA 2HVXA 3GDVA 5C67A 1NY22 5HMAA 4CH2B 3TK9A 2ZQ1A 1IQKA 2JKHA 4MPWA 4NA7A 1DDJA 5A2MH 2HPQH 3VXFH 4MQAA 4RKJB 1CVWH 5I46H 2Q6GA 1FUJA 2HRVA 1EAUA 4BAMB 5K0HA 2FOFA 1ABJH 1PQAA 1O2KA 1FAXA 1W3CA 3A81A 3LGWA 2NWNA 1BCUH 2P59A 3A7YA 5C5OA 2QGRA 1S6FA 1TRYA 1C2HA 1SOTA 1SL3A 1VGCB 2R9PA 3ZVFA 2RDLA 2ZFQH 1ZSLA 3UQVA 7LPRA 2GCHF 3LU9B 1OP2A 3WY8A 1QL9A 2NU2E 4KGAA 2H5DA 1VR1H 1C1SA 2O8LA 1ZOMA 2ZCKP 4CHAC 5AVDA 2R0LA 1Y5AT 1J17T 1AE5A 2STBE 1EJMA 4Y0YE 2RA0A 4XBBA 2O8UA 1ID5H 3MU4A 5A0CA 1BUIA 1TALA 2V35A 1DSTA 4Y76A 2PHBA 1Q31A 2JH0D 5AHGH 2SGDE 1C2JA 1NN6A 1F7ZA 3E90B 1NU7B 2C8XB 3P17H 3V12A 5GCHF 1EATA 4A1TA 4K69A 5EW2H 1EQ9A 3OX7U 1NRPH 2VWNA 1DS2E 1HAXB 3U8OH 3ZYEA 1O3OA 1NRNH 1SG8B 3LGTA 1KLTA 2TGTA 4NIWA 4ABIA 2C8YB 2BLQA 4BOHA 1GJBB 1SGYE 1NRQH 3HPTB 1MTUA 2LPRA 1C1TA 1GBDA 2HLCA 4X8SH 2PWXA 1QA0A 4R8TB 3RXQA 3RXFA 1NM6A 4FU8A 3GDUA 1BMLA 3BEFB 2A7JA 4TYDA 1V2RT 3DFJA 4WMFA 1HYLA 1TMTH 2KAIA 2GT8A 3M37A 4AB8A 3D65E 3NK8A 4X1RU 1GHZA 4GCHF 4YLQH 3MNXA 2ZCLP 2GZ8A 2GP9B 1O2VA 4D9QA 1OX1A 2C8WB 3UUZA 1VJ9U 5E8EH 3SU2A 2VVCA 4Y7BA 1CT2E 5I25A 5FBEA 4ZHLU 3FAOA 1FONA 3HK6B 2PKSB 2Z7FE 2AMPA 4XFQA 1K1JA 1GMDF 1XUJA 1GBAA 2FM2A 4GVUA 1DE7H 5PTPA 5TCCA 1UTPA 4DW2U 2BVXH 3KL6A 2C4FH 3MU1A 4FUFA 3T25A 3V7TA 3L33A 3ATMA 1O32A 1A7SA 4Y79A 3SN8A 1F2SE 3SNDA 4FVDA 3TK5A 2F83A 3F6UH 2HNTF 2A7CA 2ZPQA 3GY6A 4WH8A 1SLXB 1GWAA 1KXAA 2O9QA 3OTJE 3ELAH 2SGEE 4CR5A 5FHTA 3TJNA 2JETB 1KXCA 1GBFA 8ESTE 1O2YA 2QAAA 3KN2A 1LHCH 2FOCA 2TGAA 3EQ0H 2HNTC 2XRCA 2AERH 3BTQE 1HAGE 3A85A 2PTCE 5C1YA 1PPEE 2XBXA 1AB9C 1TA6A 3IITA 4FXGH 3LH1A 1BTYA 1ANDA 3RXGA 3SUDA 4MNVA 5EQSA 1V6DA 2PUQH 2ZU2A 3GY2A 2OD3B 3V0XA 3MHWU 4WJG2 2JH6D 4YLUA 1O36A 4UDWH 1V2KT 1GHBF 2ANWA 3KQBA 1DM4B 2EI6A 3ZV8A 2QYIA 2PV9B 1GGDC 8GCHG 4E05H 1HAVA 3TNSA 2VGCC 4J1YA 1GCTC 4Z0KA 3E1XB 4NSYA 2ZP0H 1CA0C 2JH5D 2AGIX 2BY6X 1FDPA 1QCPA 4HFPB 1E0FD 3FP7E 1GG6C 4SGAE 3LC5A 1AVXA 1DXWA 2H9HA 1ZTKA 1C5VA 1P12E 1BRBE 4FUGA 1QIXB 1P0SH 2STAE 3PLPA 4KTUA 4TPIZ 3TGJE 1DUAA 1K1PA 1ZGVA 2BLOA 2UUKB 1TFXA 1XKBC 4IN2A 3SJIA 1N1LA 1W0YH 2PLXA 2ZTXA 2FLBH 3EE0B 3U69H 2FI3E 1THPB 1V2QT 1BHXF 4Q2KA 5EXMA 4AORA 4CRGA 3LPRA 1KIGH 1EPTC 4Q80A 1KLJH 1TABE 1P06A 1D3TB 1TGBA 2RG3A 4TWYA 1C1RA 3ODDA 3Q3YA 1KTSB 1YPLH 1DWEH 4BAHB 2BD2A 1Z8IB 5GXPA 2C8ZB 1WU1A 1V2LT 1BT7A 3ZZDA 2PW8H 4O03A 1P2NA 1SGDE 2GCHG 3QGJA 2CHAB 2ZGCA 1K28D 1N8OC 1GI3A 3STJA 4AN7A 1UK4A 1C5LH 3FVFB 1GJ5H 2H6MA 4TWWA 2BD9A 1H8IH 2F9PA 2Y82A 4ZAEA 3SU1A 1J9CH 4ZKOU 1RRKA 3IG6B 5F03A 3SZNA 1SI5H 5EPYA 4B76A 5C2ZA 1HAYB 3T28A 2BB4A 1O37A 1QB9A 1YM0A 1AKSA 2TRMA 1FZZA 4BANB 1O2NA 2ZQ2A 3RU4E 2OLGA
chains in the Genus database with same CATH superfamily
5GCHG 5HIYA 2WV4A 3ZVBA 1OWHA 2ASUB 2RA3A 2A4GA 2IJOB 4NFEA 5ESBA 3OFND 3RLWH 4FUCA 1W0KD 1V2MT 4IBLH 1SVPA 3L6PA 3TGIE 3ZZ5A 4Z6AH 5TCAA 1SFQB 1SQTA 4NFFA 1SQOA 1C2KA 5HM9A 1OWIA 2VIPA 1NFXA 3ENSB 2ZWLH 1EJNA 3BTGE 4CRAA 1Y3XA 2BY8X 1YPGH 2R0KA 2THFB 3QGNB 3CS0A 1TOMH 1HPGA 5E2PA 1EAWA 1QB6A 1ZSKA 1J15A 5G4BA 1EZXC 1CT4E 1AHTH 1BRAA 1O3HA 1QQ4A 4X6OA 1O2LA 2A2QH 3SBKA 5EXNA 2VNTA 1SGEE 3PWCA 4GCHG 1T8NA 1C2LA 2ZFFH 1MBQA 1YPHE 1QJ7B 1OS8A 2OXSA 1CT0E 1LMWB 1HRTH 1F0SA 1NTPA 3ZVEA 1C1MA 1GJAB 4OS4A 1PQ8A 1L1JA 4X6MA 1S85A 4FUIA 3SUEA 1BTHH 1EKBB 2KCPA 2A5IA 1YBWA 1PPFE 1ETTH 1GMDG 1A61H 1Z1JA 2AIPA 5T3HA 4ZHMU 3ZZAA 2XBVA 4CHAB 2A7HA 4O3TA 1EFRD 1DICA 2UWLA 4I33A 4A6LA 4JYTA 1O3IA 3A8AA 3SOSA 3VB5A 1T8OA 3AASA 2OC1A 3ESTA 1AO5A 5EXLA 2ZDNA 5C0UA 2ZO3H 2A4QA 5HKKD 2J98B 1BMMH 5HXFA 1A5IA 5FCRA 3MWIU 3BG8A 1QBOA 1ZTJA 1FIWA 1L4DA 4IMZA 4ABFA 4RI0A 4A1XA 1PPHE 1MQ5A 5FCKA 2FX6A 3LJOA 1LTOA 4ABAA 1RXPA 3S7KB 1ZHRA 3MU8A 4Y8ZA 1A5HA 4X6NA 3M5LA 4AGJA 2TGPZ 5GNDA 2ZKSA 4IN1A 1IHSH 1O2GH 3F9GA 1TNGA 2EI8A 1P9SA 2CGAA 3RXMA 2PP6A 1FNIA 3SU3A 1O31A 3SV6A 3MH5A 3T2NA 1LCYA 3S9CA 2F3CE 4AFUA 4TSFD 1GHWH 1D9IA 2SFAA 2HLDD 1HCGA 1X7AC 4KKDA 3BEUA 4AYVB 1W13U 1NRRH 3E16B 1ZJKA 3WWFA 4WMDA 2F9BH 4PROA 1UK3A 1TNIA 3ITIA 5L30H 1Z1IA 1GBCA 1KSNA 2ZNKH 1GHBG 5EW1H 3F0OA 2ZDAH 1F92A 1CBWC 1FY1A 1HDTH 3U98H 1AUJA 1Z71A 1BZXE 3RC5A 3MOCA 1YKTA 2A45B 2UUFB 3RC4A 2OCVB 1Z6JH 1UO6A 3TGKE 4AYYB 1F5LA 5F53A 1NROH 2Y7ZA 2FS8A 3URDA 1ARCA 1YPMH 4CRBA 3T62A 4JCNA 3T29A 1ELCA 3BN9A 1L4ZA 5DN6D 1RGQA 1GHXH 1H8DH 1ELEE 1SMFE 4OS1A 5GIBA 4MNWA 5HM2A 1E34B 1QTFA 2P94A 2W7SA 5ABWA 2GKVE 2XBWA 2VIVA 4NG9H 1G3CA 4YTAA 1O3JA 1XUFA 2B7DH 1LHDH 1M9UA 2CF9H 1VCPA 1O5GH 1JRSA 3BTME 1J8AA 1ANEA 1TX8A 5GPIB 4IS5A 4E7RG 3A8BA 2ZF0H 4ABGA 5A0AE 1V2UT 3GOVB 3RXSA 3AW0A 1KXFA 2QE7D 1K22H 2ZECA 2Z9GA 2WUBA 1DANH 1ELVA 1GI4A 2GCTC 3D23A 1LPKB 2BZ6H 1G30B 1EAIA 4HZHA 1VZQH 3HATH 2ZFSA 1LHEH 1MUEB 1AB9B 1OYTH 1ZHMA 4X8TH 1DPOA 1P2MA 1RTKA 1P2OA 5LPRA 4JK5A 1UCYE 3S0NA 2AFQB 1D3PB 3A88A 4DVAU 3KHVA 4HI3A 2GDDA 1L0ZA 3PV5A 4A92A 1C2MA 3BEIB 4GPGA 2K1QA 2XC0A 3GICB 2QF0A 1W7GH 1YCPM 2ZDMA 2BMGB 1YPJH 2VJ1A 4K8YA 4K3JA 4F49A 1N6YA 1WTGH 3NWUA 5F8ZA 3NXPA 4Y11E 1C5MD 3B9FH 1GGDB 1TX7A 2VGCB 2R3UA 1MKWH 1GCTB 1KYNA 3MNBA 3SU4A 5JBCS 5EPNA 2FTMA 3SYJA 1V3XA 1RFNA 3T26A 3ZVAA 1QRZA 6CHAC 4CRCA 1HAHH 3LGUA 2Z94A 1CA0B 2FOMB 1K1NA 2NU3E 3LKWA 1GG6B 1WCZA 4LOYH 1XM1A 2TPIZ 2CK3D 1PJPA 2B0FA 1MMJN 1Y3WA 5AF9H 3RXRA 1TOCB 4JYVH 2RCEA 1GI7B 3GCTF 4KTSA 3UWJH 1AWHB 1AFQC 5EG4A 2H9EH 5HIZA 1IOEA 1C2GA 1P57B 1YY3A 1HB0B 2QY0B 2Z9KA 2CXVA 1TBZH 1QR3E 1ZLRA 3SV9A 2BVRH 2WV5A 3LDXH 4AGKA 4DT7B 2SGPE 3SNCA 3A7XA 4AC9A 1O2UA 4DIHH 1DXPA 1GL1A 1O5DH 3RU4T 2BDHA 1TGCA 3F1SB 1EPTB 5JBBS 2LNCA 3M5OA 4J2YB 2P8OC 4ZUHA 3MMGA 1E79D 3P8GA 4P00A 3A8DA 2V6NA 5T1VA 4ABDA 2QF4A 5A8ZA 4OM9A 1HNEE 2G8TA 4NZQA 2ZHWH 1B0EA 1ZPBA 1S5SA 1NS3A 4BNRA 1D6RA 4Q7ZA 4UEHH 3ZZCA 3MH6A 1N8OB 1H1BA 3GDSA 1O5AB 3SJ9A 1PPZA 3K2UA 1CGIE 3AW1A 3RMLH 2Z9JA 3LC3A 2A5AA 1JIRA 1CA8B 1XUKA 3JZ2B 1AIXH 2Y81A 4ISHH 1WQSA 2F4LA 1A0JA 4ESTE 1K2I1 5IDKA 4A1VA 4I8JA 2ZG0H 1UCYH 5LPFA 1YP9A 3AAUA 3VGCC 3GCNA 1RD3B 3PM3A 3H7TA 3SV7A 1ZMLA 1GI5A 4O3UA 5B6LA 2ESTE 4FUBA 3MYWA 4NIXA 1ZSJA 1O3FA 3D62A 1W12U 2BM2A 3I78A 4MNXA 1O0DH 3E0NB 3HKJB 2GD4B 4OS5A 3UOPA 3I29A 1V2WT 4UONA 1F5KU 1CHOF 1P02A 4MPUA 2FIRH 4INLA 1OP0A 4Q7XA 4ZKNU 4D8NA 2FYQA 3NUMA 2XBYA 4BXWA 1TMUH 4ISOA 3BTFE 1SLUB 3PLBA 2A32A 1O5CB 4KP0A 5L2YH 2PKAA 3ODFA 4ABEA 1SGPE 4K5ZA 5JB8S 2ZCHP 1F0TA 2HNTE 2WPIS 3IWMA 2FXRA 1ANCA 3QDZB 1MU8B 3M7UA 1O5EH 2ZU1A 3LGVA 2FZZA 1GMCF 3BG4C 4WY3A 2W6ID 3A82A 2G81E 1MCTA 1TA2A 1IAUA 2PGQB 1JMOH 3FZDA 1NBMD 2WPMS 3RXIA 1C1NA 1PPGE 4A5TS 5JYIA 2ODYB 1AN1E 4QT8C 4ABJA 2GZ9A 3V13A 2ZGBH 1LHGH 1QGFA 3A83A 1QJ1B 2FYRA 3BIUH 3OSYA 1BMAA 3FFGA 2ODPA 2CN0H 1FY4A 1MKXK 4AB9A 1BTUA 1TPSA 4DGJA 1KXBA 2XXLA 5T6DA 1SGIB 1ARBA 1GDNA 3QX5H 3M7QA 3PLKA 3EA8A 4TPYA 1AI8H 3V3MA 3SGQE 3U8RH 1S82A 2ODQA 1ZTLA 3LJJA 4B74A 2XTTB 3BTWE 2ZU3A 4NWLA 1ZPZA 2ZDKA 1IQGA 1XXDA 1H9LB 1P09A 4CREA 1IQMA 1CGJE 1HAVB 1Z8JB 3A87A 1G3DA 2FESH 5CMXH 4WVPE 1O2WA 3CENA 5DP7A 1O3EA 1DUEA 3K6ZA 3VPKA 2XCNA 2OC0A 1V2PT 3S9BA 1BMNH 4IW4E 4B2CA 4NIVA 1KXEA 3GYMA 5C1UA 1E1QD 7ESTE 1A46H 1C1VH 1BTXA 2SGFE 9ESTA 1FAKH 3M61U 3PMBB 1OP8A 4WWYA 1TONA 1SB1H 3DD2H 1O5FH 3EGKH 1SSXA 2XC4A 1CBWB 3SNEA 2FOHA 5EGMA 2AGGX 2VWLA 1G3BA 1GBBA 1W7XH 5GJ4B 3RDZA 4X1PU 3TH2H 2QF5A 1TWXB 3KIDU 8KME2 3S69A 3PMAB 4BAOB 4FOUC 4JYUH 4O97A 1AU8A 3RM0H 3NZIA 1EB1H 3ZVGA 4A7IB 3C1KA 3LT3A 4X2YA 3SJOA 2WINI 2BOKA 2QXIA 1CGHA 3FZZA 1B7XB 4FETA 4LXBH 5DPAA 3AVZA 1TNJA 2VVUA 1MCVA 3TNTA 2SNWA 3MU5A 4MTBA 3KQEA 1ETSH 5DP3A 2BY9X 1IQFA 1LVBA 1C5ZB 4NCYA 1BTZA 4X8VH 1QB1A 3GCTG 4AG1A 3K65B 1QY6A 2KCAA 3SHCH 4WH6A 2TGDA 1J14A 3SU0A 1GJDB 4AFQA 2QCYA 1D4PB 1HJ9A 1A4WH 3RLYH 2BQWB 2L6OA 3SORA 5C1XA 3SU6A 1TLDA 3KGPA 4JMYA 4YM9A 1FV9A 1T31A 2BLWA 2BDIA 1ESAA 1NU9A 2D8WA 2GGVB 1FY3A 1LQEA 1RIWC 1YC0A 4OS7A 4OS2A 1QQUA 3KQDA 4NGAH 2BX3A 1D3QB 1MH0A 1N6XA 3PB1E 1AKSB 3OEHD 3P8FA 2CMYA 2GCTB 2W3IA 1ELGA 3M3TA 3O8DA 1NC6A 3KYFA 4DCDA 1KMHB 1FI8A 2BY5X 1SOZA 1GVLA 2O8MA 1DVAH 3L3TA 5FPSA 1VITF 1S0RA 1BMFD 1HAOH 1OHHD 1O2PA 1VCQA 4DIIH 1AWFH 2G5VA 2J4IA 4X2VA 1O3NA 3VEQB 1SKYE 3HKIB 3PMHB 1OPHB 2C3SA 3T5FH 1ZGIA 1TPPA 4M7GA 3SI4H 1UTQA 2LELA 1HLTH 1GI0A 3OYPA 4NIYA 1P04A 4ZROA 1BRUP 1UHBA 1FY8E 1ZMNA 1GBLA 2OP9A 3QUMP 1GHYH 3BTHE 1UVOA 3SJKA 4YT7H 1GJ4H 2ZFPH 1Y3YA 1AGJA 1D6WA 4Y6DA 1ZZZA 1QFKH 6CHAB 4GSOA 1AQ7A 2NU1E 3RXPA 3RXOA 4UFDH 3MU0A 2LIZA 3SQHE 2XNDD 4SGBE 5A8XA 1W8BH 3RXAA 4DT4A 1F5RA 1XUHA 1ELDE 3HGNA 1UTOA 1JIMA 1MQ6A 3M3SA 1CHOG 3PTBA 1EZSC 1O39A 4B2AA 3DA9B 1CU1A 4X6PA 3TVJB 2P95A 2XW9A 1AFQB 2RFKC 4AX9H 3GY3A 1PYTD 3LOXA 2G4UA 1INCA 1C5XB 1FLEE 1C4Y2 3RXJA 3RP2A 2GVFA 3ZZ8A 4CRFA 2BD8A 3SZEA 1WYKA 2F9VA 3FANA 3GS9A 3RXDA 1NPMA 4INKA 1O5BB 2WUCA 3RXCA 1K9OE 1OWEA 2AIQA 4BTIB 1E36B 2Z6BD 3UR9A 4YXWD 5CHAC 3VB7A 4B6FA 5DP9A 1CHGA 2P8OB 5IYTA 3HGPA 4MPVA 2G51A 1GMCG 2IN2A 4WXIA 3EDXB 1CSOE 5DJ7A 3PMJA 4F4OC 4ZMAH 5DP4A 1BTWA 3I77A 5KECA 2XCFA 1OXGA 1CQQA 1ZJDA 1IQHA 4TY6A 2DE8A 1G37A 2OINA 5TJXA 3A86A 3Q77A 1S81A 4ASUD 3ZYDA 3UB0A 2Y80A 1C1QA 1ELTA 2OQ5A 2J2UA 3RM2H 4AZ2B 1YCPK 2ZPRA 1LPZB 1B0FA 2ZGHA 2W5EA 3GCHC 3SU5A 1XX9A 2WZQA 4Q4LA 3G01A 4E06H 3W1EA 1DWCH 1TBQH 4IC5A 4I8GA 1UK2A 2XWBI 4U01A 2FI4E 4B73A 1FMGA 2O8TA 2KCOA 3PROA 3TH3H 3VGCB 2A4OA 4MPXA 4Y8YA 1L2EA 4VGCC 3RXKA 1ZPCA 3FOAA 1ETRH 3QTVH 3OTPA 5J4SA 1LQDB 1EOJA 2F91A 2UUJB 1TRNA 2Y5GA 3E0PB 4UFFH 1LVMA 2AYWA 3MTYA 4MNYA 1C4V2 2VINA 2XC5A 1SQAA 1SLVB 3ZZ9A 2VH6A 3UY9A 1C5SA 3RXEA 3N99A 2BDAA 2AMDA 1BBRK 3LH3A 1Y5UT 1XXFA 2BTCE 3A80A 3PO1C 2XYAA 4MG3A 4XBDA 4ABHA 5JBTA 3MH7A 2GV7A 3BTTE 2ZGJA 1NFUA 3N7DA 1T7CA 3A84A 1O35A 1GI6A 1C9PA 2Q6FA 2ALVA 2QF3A 1DOJA 1P2KA 4D7GA 1O2JA 1VKYA 3BG4B 3F68H 4YO9A 1GPZA 2LP6A 1HFDA 1L1GA 2FWWA 3VG8A 3E3TA 4FU9A 1QZ8A 2H1UA 1MTVA 1G2MA 2DE9A 1HIAA 4YESB 1KLIH 4U32A 1SGFA 2OK5A 2OC7A 2ULLA 4CBNA 2A0QB 3AK5A 4WXVA 2Y6TA 1GL0E 2BYAX 1K0HA 1THRH 3SGBE 2J5UA 1YPKH 1SFIA 2GJGA 1GJ8B 1RJXB 5CDFE 1HJ8A 2AGEX 2R3YA 4TY7A 1G32B 4B71A 1SGCA 2KR7A 3S9AA 1GBMA 2BY7X 5EOKA 2IPHA 1HAPH 1ZRBA 2J95A 1TGNA 3DCLA 4BTUB 4K60A 1XUGA 1YLCA 4OGYA 2ZTZA 2ZZUH 4U30A 1RTFB 1MTWA 1UVPA 1WSSH 1GBKA 1O3PB 2FEQH 1A3EH 3Q3KA 2ZU4A 3GY8A 1ZHPA 3TU7H 5B6OA 1P03A 3MNCA 2F9UA 3P6ZB 1GMHF 1PQ7A 6LPRA 1SHYA 1SGNE 3T27A 2OC8A 4B2BA 3E6PH 1S83A 2HALA 2PTNA 1WTHD 1HGTH 1WXRA 3RXTA 1O2RA 4X2XA 3M3VA 1ESTA 2ZPSA 5EJ1A 4Y0ZE 5FXLA 2VIWA 1KTTB 1IHTH 3BTKE 1SPJA 1H4WA 1FIZA 1MTNC 2FDAA 2ZEBA 4Q7YA 5JDUB 1NFWA 1VITG 3VB3A 1TMBH 3EBNA 1HAIH 4KTCA 4FUDA 1O2HA 1BTPA 3UOUA 3TPIZ 4ZKSU 2NU4E 2ANKH 1IQIA 1C2EA 1DY9A 2D26C 1JOUB 2WPHS 4AG2A 1K1OA 4JZDH 1WOFA 2BDBA 5FBIA 1JWTA 1GHAF 2PR3A 4AOQA 3M5MA 1DLKB 2BD5A 1YPEH 4AFZA 1QBNA 4K1EA 3GISB 2JJ1D 2VBCA 1IQJA 2W26A 1TGSZ 1DFPA 3F2HA 3RXBA 3U1JB 2BOHB 2ZTYA 5AFZH 1DSUA 1JRTA 1A3BH 1G3EA 4NSVA 2AEIH 4RKOB 1O2OA 2WPKS 4JZIA 3UR6A 1ACBE 5JBAS 1C1WH 1KXDA 1TBRH 1MTSA 1UVUH 2FLRH 2ZDLA 2ZI2H 2GZ7A 3EA7A 1JBUH 3N7OA 5DGJA 2EY4C 1K1LA 1QBVH 2JIZD 1EUFA 1AD8H 1KDQA 1YGCH 2I6QA 2HPPH 1PQ5A 1P2JA 1NT1A 2GMTC 4FUHA 4CH8B 3ZZ6A 2B9LA 2KM0A 1E37B 3ZVDA 1YWUA 3M7TA 1RIWB 1Y3VA 2BQ6B 5BRRE 2F43B 3A8CA 3P70B 1GJCB 1QNJA 2QXJA 3DSPA 1BHXB 3TJVA 5BPEA 1DWBH 1P05A 2B8OH 2R2WU 2W3KA 3ZZBA 1W11U 3A89A 3RU4D 2EQNA 1TQ7B 5AFYH 2BD3A 3K9XB 4WMEA 1DITH 2FX4A 2Q6DA 2W6JD 2EC9H 3TIUA 3HK3B 2AHME 1EJAA 3GY4A 4K8BA 3OEED 4X0WU 4P02A 4H42U 3PYHA 2ZC9H 3OU0A 4I8HA 4I86A 5DP5A 2P93A 3GCOA 3OY5U 3P95A 2V3OH 2QV1A 4K1TA 1QL7A 2WPLS 2G5NA 1W2KH 5T6GA 3MI4A 4NZLA 3EAJA 1TNLA 2ZFRH 1EOLA 5E0JA 1EX3A 2O8WA 4Q63A 3STIA 2G00A 2J92A 2ZGXH 5LGOA 3MFJA 1U6QA 1EPTA 1TPAE 1BRCE 1MZAA 3ATLA 1GBHA 3OAAD 3TLOA 2KAIB 1AE8H 2PKAB 2TIOA 1SGQE 4JZEH 5LPEA 3EYDA 1FXYA 2A31A 3FP6E 1VJAU 4D9RA 2K7XA 2VU8E 4AFSA 2BDYA 2SGAA 2ANMH 1W0JD 1OYQA 4ZCNA 4KELA 4RT1A 3SJ8A 3S7HB 2BXTH 3A7TA 1H9IE 1S84A 4XSKU 4F48B 5FPTA 4YOJA 4F55A 1Y59T 1Y8TA 4LZ4B 3E91A 1FN8A 2CV3A 2EI7A 1MBMA 1F0UA 4BXSA 1TIOA 5EJZA 4D7FA 5KEDA 1ELFA 5DP6A 4RT0A 4HTCH 3BV9B 2KFWA 2YMSD 1MD7A 4XDEA 4JZ1A 1YLNA 2YNBA 1PYTC 3NPSA 1SBWA 5C20A 2P3TB 2TBSA 3PWBA 3F2GA 2ZFTA 3KNXA 1OKXA 1G9IE 5DKMA 7GCHF 5EU8A 1HV7A 4LK4A 1BQYA 1NESE 4WF8A 3TJOA 1V2TT 1E35B 3QZQA 1GCDA 2IOTA 3Q3XA 1H9HE 1GJ7B 4YOGA 4THNH 5FX5A 2OQUA 2WSSD 1SC8U 1O2IA 3MO6A 5CHAB 4ISNA 3E8LA 2FPZA 1V2JT 2A5KA 1HUTH 2ANYA 1JXPA 4ISIH 5JPMH 4H6SB 5L2ZH 2ZHQH 5C5NA 2ALPA 1BOQA 2VIQA 1OSSA 5F8TA 2Y5HA 5A0BA 1COWD 1O30A 2VB0A 3PTNA 3H5CB 1B5GH 3DUXH 1EP6A 2VIDA 2H9TH 1AVWA 5FAHA 5DSFA 5J4QA 2XWAA 3ATIA 1UJ1A 1AUTC 1TNHA 1HBTH 1Q2WA 4YT6H 1SGTA 4FUEA 3GCHB 2P3FH 3TK6A 2OUAA 3K6YA 5A09A 3LIWA 3LGIA 3Q76A 2VIOA 1BITA 5GWZA 3KQ5A 1NRSH 3GYLB 1UVTH 1AVGH 2I6SA 1O2ZA 4ZXXH 2FOBA 4NWKA 4VGCB 4BTTB 4FVBA 5ESTE 1C5OH 5DO4H 1C5WB 5EQRA 1QHRB 2Y5FA 2P16A 1E38B 2Z3CA 3A7WA 3SI3H 2VWOA 1TAWA 1ZRKA 4JK6A 1HJAC 1BB0B 1WV7H 1GBJA 1O3CA 1GMHG 6GCHF 1G36A 1BIOA 1C5NH 1DY8A 2FMJA 3UREA 3KYGA 2QA9E 2C90B 3JZ1B 3SNBA 3U9AH 3O8RA 2J38A 3BIVH 3TH4H 3DHKH 1T8LA 5DK1A 3F9FA 3W94A 1UTKA 1O2MA 2VWMA 1UTLM 2SNVA 3BTEE 4I8LA 4IC6A 1C5YB 1O33A 3ZIAD 2ZIQH 3PO1B 3ZZ3A 4ZHAA 3VXEH 3RXVA 1GI9B 2AS9A 3AAVA 1O2SA 3MH4A 2GV6A 3KEEA 1P11E 2KX4A 1BJUA 4I8KA 3ATKA 3O8CA 1XUIA 4OS6A 1GBIA 4MVNA 2QIQA 1EZUC 1WUNH 1MKXH 3MQKC 1OWKA 5A8YA 1PPBH 2ZHEH 3UNRA 1GHAG 3FO8D 5KGOA 2GT7A 3M35A 1LO6A 2V3HH 2AH4X 3R0FA 1A0HB 1FJSA 2H5CA 2G55A 4H4FA 3SW2B 3QO6A 5SGAE 2YOLA 5DP8A 4DG4A 4DJZB 4B1TA 3SQEE 4JZFH 1GJ9B 1W0ZU 2WYJA 1UTMA 1EP5A 2HOBA 2PFEA 3P8NA 4YZUA 1SGRE 3UWIA 1FN6A 1TX6A 2BZAA 2J34A 1C5RA 3QN7A 4MDSA 2VVVA 1QURH 1C5QA 2BLVA 1GI8B 3ZV9A 1IQLA 3CS7A 3PV4A 3RMNH 3KF2A 4DY7B 2BDCA 2V0BA 1XVMA 3O8BA 5C3NA 1VGCC 1O2QA 3RMMH 5L6NH 3B8JA 2WPJS 3DSGA 4GLYA 3U8TH 3QWCH 1UHBB 1MAXA 1GJ6A 2J9NA 2G4TA 1SR5C 4DURA 3A7VA 2C93B 4Y10E 1O2XA 2KZ4A 2XOKD 4NA9H 4BAQB 3ZZ7A 2J97A 1TGTA 5EQQA 3GY5A 5EJLA 1C1PA 4ISLA 1S6LA 1MTNB 5FX6A 2L74A 1F0RA 2FOGA 4XD7D 1EXFA 3QK1A 2FTLE 3ATWA 1GVZA 1DX5M 2BD4A 4FU7A 4FUJA 2Z9IA 4R0IA 5E2OA 3UIRA 2ZU5A 1UVSH 3F9HA 3KCGH 3RUOA 5C94A 1ORFA 1ABIH 2SGQE 1ZMJA 4CR9A 1XMNB 1IQNA 1BA8B 2BVSH 4GHQA 3SV8A 4I7YH 2V7QD 1LPGB 1C2DA 4GHTA 1LHFH 1SGFG 3UPEA 2A4RA 2CF8H 1P01A 1QRXA 1AFEH 1A1RA 2PGBB 1ZYOA 2PSXA 3SV2H 1WQVH 1O3KA 3ZZ4A 1QL8A 3KQCA 1G2LA 1ANBA 1TYNA 1DLEA 3F0PA 1O34A 3TITA 1P8VC 2B5TB 1W14U 1Y3UA 1EASA 2JDID 1A0LA 1GDQA 3LGYA 2PSYA 3MO9A 2ZDVH 1SLWB 8LPRA 1TPOA 4UE7H 4B75A 2FP7B 1C5UA 1CE5A 4U2WA 1O3DA 1LVOA 1LDTT 1GBEA 2GMTB 4DOQA 7GCHG 7KMEH 2IJD1 1EB2A 2BXUH 2UUYA 4ZXYH 1O3AA 1CO7E 2A1DB 3F9EA 2ZHDA 3VB6A 5C17A 3R3GB 1GVKB 2A2XH 1VITH 2PKSC 5GDSH 4MLFB 2Y7XA 5E0HA 1DT2A 3QTOH 4ZKRU 2D1JA 2HGTH 1PPCE 3PRBA 2D2DA 3ZVCA 4D76A 2W7UA 2F9OA 2OBOA 5C0TA 3DT0H 3M5NA 1NZQH 1Z8GA 4XE4A 1QA7A 3VB4A 1BBRE 2AMQA 3LONA 3VFEA 2Z9LA 1T4UH 3Q00A 3NCLA 1TNKA 5EODA 1GDUA 1QRWA 2H2ZA 1C9TA 3MNSA 4RSPA 4XBCA 2KCYA 1P2IA 5F6MA 2UWOA 4IMQA 2JETC 4GAWA 1NBME 1LKAA 1AZZA 1P9UA 1Z7KA 2HWLB 1O3GA 1ELBA 2WPDD 4K2YA 4E7NA 2QN5T 3OY6U 4IGDA 1OWDA 1MZDA 1T8MA 1V2NT 1VCWA 1KY9A 3QLPH 1E1RD 3SUFA 2BHGA 2FO9A 3UFAA 1NFYA 4I32A 2G52A 5H4IB 1YPHC 4HGCA 3RXLA 1NO9H 1YLDA 3CP7A 3NKKA 3UNSA 4LZ1H 1A2CH 1K1MA 2EA3A 9LPRA 6GCHG 1V2VT 1GBTA 2YMSC 3BF6H 1UTNA 1HIAB 1MD8A 2QXGA 1Z8RA 1W10U 4Y71A 3BSQA 2Z3DA 1DWDH 3B23B 1K1IA 5LH8A 2J98A 1Y5BT 4RN6A 6ESTA 1A5GH 2GTBA 1RS0A 4ASHA 3GY7A 1PFXC 2RDEA 3UTUH 5JB9S 1HAZB 2JJ2D 2BQ7B 1YYY1 1TB6H 3P92A 1C5TA 2M5TA 5HGGA 5T6FA 1UW7A 4X1SU 2FOAA 1L1NA 2ILNA 2P3UB 1J16A 2UWPA 1P3CA 4XRNA 2QC2A 4I31A 4ABBA 1YCPH 1ZR0A 1C4U2 5DG6A 2FI5E 1UTJA 2DUCA 3URCA 2ZHFH 5FPYA 4X2WA 3N7EA 5K7RA 4ZH8A 1FY5A 2WYGA 1EAXA 2CJIA 1K21H 1AZ8A 2BD7A 3TJUA 1MKWK 5ETXA 1T4VH 2FODA 4X1QU 4CBOA 3RXHA 2VH0A 2K8IA 1TE0A 2GDEH 3P8OA 4NA8A 3SUGA 4Y8XA 1D3DB 4K1SA 4OGXA 1O3MA 4O9VA 2PUXB 3SHAH 1GI2A 1S0QA 1GHVH 3DFLA 3RC6A 1HXFH 3MO3A 3WWBA 1XKAC 1O38A 1TQ0B 2BX4A 3F3BA 1HXEH 3UNQA 3SGAE 4ACBA 1RTLA 2R2MB 1XVOA 1SHHB 1AMHA 3D49H 2QXHA 1BBRH 2OBQA 1EZQA 1LKBA 1YF4A 2XNIA 1H8ED 3UQOA 2F9NA 3FP8E 1HJAB 4X1NU 1WAYB 1V2OT 4UFEH 1C2FA 4YOIA 1Q3XA 2GX4A 1THSH 3U1IB 2EEKA 1IQEA 3SO3A 3W95A 1C1OA 2CHAC 2V3MA 2BDGA 1BDAA 4Y7AA 1T32A 3RMOH 5F8XA 1C5PA 2Q1JA 1OWJA 3A7ZA 1GI1A 5E0GA 1P3EA 1BJVA 1FPHH 1S6HA 1Z6EA 1AY6H 3U28C 8GCHF 1ESBA 3EA9A 2HVYB 3CNRA 3M36A 4XOJA 1LVYA 3SNAA 1MAYA 4INHA 5HYOA 2OTVA 1UMAH 2FS9A 1FQ3A 1ELAA 1P2QA 2YNAA 3C27B 4H6TA 5CE1A 4CRDA 1KDQB 1WBGB 1TRMA 1MU6B 4BAKB 3RXUA 1C2IA 1O2TA 1O3LA 2ZA5A 1C1UH 1V2ST 1OOKB 4GUXA 1QJ6B 4Z1MD 1UCYK 1P10A 2FOEA 2Z3EA 1O3BA 3QZRA 4UD9H 1FPCH 3BTDE 2J94A 2NU0E 4UFGH 4X8UH 3H7OA 2HVXA 3GDVA 5C67A 1NY22 5HMAA 4CH2B 3TK9A 2ZQ1A 1IQKA 2JKHA 4MPWA 4NA7A 1DDJA 5A2MH 2HPQH 3VXFH 4MQAA 4RKJB 1CVWH 5I46H 2Q6GA 1FUJA 2WV9A 2HRVA 1EAUA 4BAMB 5K0HA 2FOFA 1ABJH 1PQAA 1MABB 1O2KA 1FAXA 1W3CA 3WW7A 3A81A 3LGWA 2NWNA 1BCUH 2P59A 3A7YA 5C5OA 2QGRA 1S6FA 1TRYA 1C2HA 1SOTA 1SL3A 1VGCB 2R9PA 1H8HD 2K0QA 3ZVFA 2RDLA 2ZFQH 1ZSLA 3UQVA 7LPRA 2GCHF 4M9FA 3LU9B 1OP2A 3WY8A 1QL9A 2NU2E 4KGAA 2H5DA 1VR1H 1C1SA 2O8LA 1ZOMA 2ZCKP 4CHAC 5AVDA 2R0LA 1Y5AT 1J17T 1AE5A 2STBE 1EJMA 4Y0YE 2RA0A 4XBBA 2O8UA 1ID5H 3MU4A 5A0CA 1BUIA 1TALA 2V35A 1DSTA 4Y76A 2PHBA 1Q31A 2JH0D 5AHGH 2SGDE 1C2JA 1NN6A 1F7ZA 3E90B 1NU7B 5EIYA 2C8XB 3P17H 3V12A 5GCHF 5FL7D 1EATA 4A1TA 4K69A 5EW2H 1EQ9A 3OX7U 1NRPH 2VWNA 1DS2E 1HAXB 3U8OH 4ACAA 2IPQX 3ZYEA 1O3OA 1NRNH 1SG8B 3LGTA 1KLTA 2TGTA 4NIWA 4ABIA 2C8YB 2BLQA 4BOHA 1GJBB 1SGYE 1NRQH 3HPTB 1MTUA 2LPRA 1C1TA 1GBDA 2HLCA 4X8SH 2PWXA 1QA0A 4R8TB 3RXQA 3RXFA 1NM6A 4FU8A 3GDUA 1BMLA 3BEFB 2A7JA 4TYDA 1V2RT 3DFJA 4WMFA 1HYLA 1TMTH 2KAIA 2GT8A 3M37A 4AB8A 3D65E 3NK8A 4X1RU 1GHZA 4GCHF 4YLQH 3MNXA 2ZCLP 2GZ8A 2GP9B 1O2VA 4D9QA 1OX1A 2C8WB 3UUZA 1VJ9U 5E8EH 3SU2A 2VVCA 4Y7BA 1CT2E 5I25A 5FBEA 4ZHLU 3FAOA 1FONA 3HK6B 2PKSB 2Z7FE 2AMPA 4XFQA 1K1JA 1GMDF 1XUJA 1GBAA 2FM2A 4GVUA 1DE7H 5PTPA 5TCCA 1UTPA 4DW2U 2BVXH 3KL6A 2C4FH 3MU1A 4FUFA 3T25A 3V7TA 5IK2D 3L33A 3ATMA 1O32A 1A7SA 4Y79A 3SN8A 1F2SE 3SNDA 4FVDA 3TK5A 2F83A 3F6UH 2HNTF 2A7CA 2ZPQA 3GY6A 4WH8A 1SLXB 1GWAA 1KXAA 2O9QA 3OTJE 3ELAH 2SGEE 4CR5A 5FHTA 3TJNA 2JETB 1KXCA 1GBFA 8ESTE 1O2YA 2QAAA 3KN2A 1LHCH 2FOCA 2TGAA 3EE7A 3EQ0H 2HNTC 2XRCA 3PV2A 2AERH 3BTQE 1HAGE 3A85A 2PTCE 5C1YA 1PPEE 2XBXA 1AB9C 1TA6A 3IITA 4FXGH 3UAIC 3LH1A 1BTYA 2YMSB 1ANDA 3RXGA 3SUDA 4MNVA 5EQSA 1V6DA 2PUQH 2ZU2A 3GY2A 2OD3B 3V0XA 3MHWU 4WJG2 2JH6D 4YLUA 1O36A 4UDWH 1V2KT 1GHBF 2ANWA 3KQBA 1DM4B 2EI6A 3ZV8A 2QYIA 2PV9B 1GGDC 8GCHG 4E05H 1HAVA 3TNSA 2VGCC 4J1YA 3OE7D 1GCTC 4Z0KA 3E1XB 4NSYA 2WHXA 2ZP0H 1CA0C 2JH5D 2AGIX 2BY6X 1FX0B 1FDPA 1QCPA 4HFPB 1E0FD 3FP7E 1GG6C 4SGAE 3LC5A 1AVXA 1DXWA 4B6EA 2H9HA 1ZTKA 1C5VA 1P12E 1BRBE 3FN8A 4FUGA 1QIXB 1P0SH 2STAE 3PLPA 4KTUA 4TPIZ 3TGJE 1DUAA 1K1PA 1WDIA 1ZGVA 2BLOA 2UUKB 1TFXA 1XKBC 4IN2A 3SJIA 1N1LA 1W0YH 2PLXA 2ZTXA 1SQRA 3FKSD 2FLBH 2M2AA 3EE0B 3U69H 2FI3E 1THPB 1V2QT 1BHXF 4Q2KA 5EXMA 4AORA 4CRGA 3LPRA 1KIGH 1EPTC 4Q80A 1KLJH 1TABE 1P06A 1D3TB 3NRLA 1TGBA 3PRDA 2RG3A 4TWYA 1C1RA 3ODDA 3DSOA 3F2FA 3Q3YA 1KTSB 1YPLH 1DWEH 4BAHB 2BD2A 5CHBA 1Z8IB 5GXPA 2C8ZB 1WU1A 1V2LT 4HG6A 1BT7A 3ZZDA 2PW8H 4O03A 1P2NA 1SGDE 2GCHG 3QGJA 2CHAB 2ZGCA 1K28D 1N8OC 1GI3A 3STJA 4AN7A 1UK4A 1C5LH 3FVFB 1GJ5H 2H6MA 4TWWA 2BD9A 1H8IH 2F9PA 2Y82A 4ZAEA 3SU1A 1J9CH 4ZKOU 1RRKA 3IG6B 5F03A 3SZNA 1SI5H 5EPYA 4B76A 5C2ZA 1HAYB 3T28A 2BB4A 1O37A 1QB9A 1YM0A 1AKSA 2TRMA 1FZZA 4TT3D 4BANB 1O2NA 2ZQ2A 3RU4E 2OLGA 3H09A
chains in the Genus database with same CATH topology
5GCHG 2WV4A 3ZVBA 1OWHA 2ASUB 2RA3A 2A4GA 2IJOB 4NFEA 5ESBA 3RLWH 4FUCA 1V2MT 4IBLH 1SVPA 3L6PA 3TGIE 3ZZ5A 4Z6AH 5TCAA 1SFQB 1SQTA 4NFFA 1SQOA 1C2KA 5HM9A 1OWIA 2VIPA 1NFXA 3ENSB 2ZWLH 1EJNA 3BTGE 4CRAA 1Y3XA 2BY8X 1YPGH 2R0KA 2THFB 3QGNB 3CS0A 1TOMH 1HPGA 5E2PA 1EAWA 1QB6A 1ZSKA 1J15A 5G4BA 1EZXC 1CT4E 1AHTH 1BRAA 1O3HA 1QQ4A 4X6OA 1O2LA 2A2QH 3SBKA 5EXNA 2VNTA 1SGEE 3PWCA 4GCHG 1T8NA 1C2LA 2ZFFH 1MBQA 1YPHE 1QJ7B 1OS8A 2OXSA 1CT0E 1LMWB 1HRTH 1F0SA 1NTPA 3ZVEA 1C1MA 1GJAB 4OS4A 1PQ8A 1L1JA 4X6MA 1S85A 4FUIA 3SUEA 1BTHH 1EKBB 2A5IA 1YBWA 1PPFE 1ETTH 1GMDG 1A61H 1Z1JA 2AIPA 5T3HA 4ZHMU 3ZZAA 2XBVA 4CHAB 2A7HA 4O3TA 1DICA 2UWLA 4I33A 4A6LA 4JYTA 1O3IA 3A8AA 3SOSA 3VB5A 1T8OA 3AASA 2OC1A 3ESTA 1AO5A 5EXLA 2ZDNA 2ZO3H 2A4QA 1BMMH 5HXFA 1A5IA 5FCRA 3MWIU 3BG8A 1QBOA 1ZTJA 1FIWA 1L4DA 4IMZA 4ABFA 4A1XA 1PPHE 1MQ5A 5FCKA 2FX6A 3LJOA 1LTOA 4ABAA 1RXPA 3S7KB 1ZHRA 3MU8A 4Y8ZA 1A5HA 4X6NA 3M5LA 4AGJA 2TGPZ 2ZKSA 4IN1A 1IHSH 1O2GH 3F9GA 1TNGA 2EI8A 1P9SA 2CGAA 3RXMA 1FNIA 3SU3A 1O31A 3SV6A 3MH5A 3T2NA 1LCYA 3S9CA 2F3CE 4AFUA 1GHWH 1D9IA 2SFAA 1HCGA 1X7AC 4KKDA 3BEUA 4AYVB 1W13U 1NRRH 3E16B 1ZJKA 4WMDA 2F9BH 4PROA 1UK3A 1TNIA 3ITIA 5L30H 1Z1IA 1GBCA 1KSNA 2ZNKH 1GHBG 5EW1H 2ZDAH 1F92A 1CBWC 1FY1A 1HDTH 3U98H 1AUJA 1Z71A 1BZXE 3RC5A 3MOCA 1YKTA 2A45B 2UUFB 3RC4A 2OCVB 1Z6JH 1UO6A 3TGKE 4AYYB 1F5LA 1NROH 2Y7ZA 2FS8A 3URDA 1ARCA 1YPMH 4CRBA 3T62A 4JCNA 3T29A 1ELCA 3BN9A 1L4ZA 1RGQA 1GHXH 1H8DH 1ELEE 1SMFE 4OS1A 5GIBA 4MNWA 5HM2A 1E34B 1QTFA 2P94A 2W7SA 5ABWA 2GKVE 2XBWA 2VIVA 4NG9H 1G3CA 4YTAA 1O3JA 1XUFA 2B7DH 1LHDH 1M9UA 2CF9H 1VCPA 1O5GH 1JRSA 3BTME 1J8AA 1ANEA 1TX8A 5GPIB 4IS5A 4E7RG 3A8BA 2ZF0H 4ABGA 5A0AE 1V2UT 3GOVB 3RXSA 3AW0A 1KXFA 1K22H 2ZECA 2Z9GA 2WUBA 1DANH 1ELVA 1GI4A 2GCTC 3D23A 1LPKB 2BZ6H 1G30B 1EAIA 4HZHA 1VZQH 3HATH 2ZFSA 1LHEH 1MUEB 1AB9B 1OYTH 1ZHMA 4X8TH 1DPOA 1P2MA 1RTKA 1P2OA 5LPRA 4JK5A 1UCYE 3S0NA 2AFQB 1D3PB 3A88A 4DVAU 3KHVA 4HI3A 2GDDA 1L0ZA 4A92A 1C2MA 3BEIB 4GPGA 2K1QA 2XC0A 3GICB 2QF0A 1W7GH 1YCPM 2ZDMA 2BMGB 1YPJH 2VJ1A 4K8YA 4K3JA 4F49A 1N6YA 1WTGH 3NWUA 5F8ZA 3NXPA 4Y11E 1C5MD 3B9FH 1GGDB 1TX7A 2VGCB 2R3UA 1MKWH 1GCTB 1KYNA 3MNBA 3SU4A 5JBCS 5EPNA 2FTMA 1V3XA 1RFNA 3T26A 3ZVAA 1QRZA 6CHAC 4CRCA 1HAHH 3LGUA 2Z94A 1CA0B 2FOMB 1K1NA 2NU3E 3LKWA 1GG6B 1WCZA 4LOYH 1XM1A 2TPIZ 1PJPA 2B0FA 1MMJN 1Y3WA 5AF9H 3RXRA 1TOCB 4JYVH 2RCEA 1GI7B 3GCTF 4KTSA 3UWJH 1AWHB 1AFQC 5EG4A 2H9EH 1IOEA 1C2GA 1P57B 1HB0B 2QY0B 2Z9KA 2CXVA 1TBZH 1QR3E 1ZLRA 3SV9A 2BVRH 2WV5A 3LDXH 4AGKA 4DT7B 2SGPE 3SNCA 3A7XA 1O2UA 4DIHH 1DXPA 1GL1A 1O5DH 3RU4T 2BDHA 1TGCA 3F1SB 1EPTB 5JBBS 2LNCA 3M5OA 4J2YB 2P8OC 4ZUHA 3MMGA 3P8GA 3A8DA 2V6NA 4ABDA 5A8ZA 1HNEE 2G8TA 4NZQA 2ZHWH 1B0EA 1ZPBA 1S5SA 1NS3A 4BNRA 1D6RA 4Q7ZA 4UEHH 3ZZCA 3MH6A 1N8OB 1H1BA 3GDSA 1O5AB 3SJ9A 1PPZA 3K2UA 1CGIE 3AW1A 3RMLH 2Z9JA 3LC3A 2A5AA 1JIRA 1CA8B 1XUKA 3JZ2B 1AIXH 2Y81A 4ISHH 1WQSA 1A0JA 4ESTE 1K2I1 5IDKA 4A1VA 4I8JA 2ZG0H 1UCYH 5LPFA 1YP9A 3AAUA 3VGCC 3GCNA 1RD3B 3PM3A 3H7TA 3SV7A 1ZMLA 1GI5A 4O3UA 2ESTE 4FUBA 3MYWA 4NIXA 1ZSJA 1O3FA 3D62A 1W12U 2BM2A 3I78A 4MNXA 1O0DH 3E0NB 3HKJB 2GD4B 4OS5A 3UOPA 3I29A 1V2WT 4UONA 1F5KU 1CHOF 1P02A 4MPUA 2FIRH 4INLA 1OP0A 4Q7XA 4ZKNU 4D8NA 2FYQA 3NUMA 2XBYA 4BXWA 1TMUH 4ISOA 3BTFE 1SLUB 3PLBA 2A32A 1O5CB 4KP0A 5L2YH 2PKAA 3ODFA 4ABEA 1SGPE 4K5ZA 5JB8S 2ZCHP 1F0TA 2HNTE 2WPIS 3IWMA 2FXRA 1ANCA 3QDZB 1MU8B 3M7UA 1O5EH 2ZU1A 3LGVA 2FZZA 1GMCF 3BG4C 4WY3A 3A82A 2G81E 1MCTA 1TA2A 1IAUA 2PGQB 1JMOH 3FZDA 2WPMS 3RXIA 1C1NA 1PPGE 4A5TS 5JYIA 2ODYB 1AN1E 4QT8C 4ABJA 2GZ9A 3V13A 2ZGBH 1LHGH 1QGFA 3A83A 1QJ1B 2FYRA 3BIUH 3OSYA 1BMAA 3FFGA 2ODPA 2CN0H 1FY4A 1MKXK 4AB9A 1BTUA 1TPSA 4DGJA 1KXBA 2XXLA 5T6DA 1SGIB 1ARBA 1GDNA 3QX5H 3M7QA 3PLKA 3EA8A 4TPYA 1AI8H 3V3MA 3SGQE 3U8RH 1S82A 2ODQA 1ZTLA 3LJJA 4B74A 2XTTB 3BTWE 2ZU3A 4NWLA 1ZPZA 2ZDKA 1IQGA 1XXDA 1H9LB 1P09A 4CREA 1IQMA 1CGJE 1HAVB 1Z8JB 3A87A 1G3DA 2FESH 5CMXH 4WVPE 1O2WA 3CENA 5DP7A 1O3EA 1DUEA 3K6ZA 3VPKA 2XCNA 2OC0A 1V2PT 3S9BA 1BMNH 4IW4E 4B2CA 4NIVA 1KXEA 3GYMA 5C1UA 7ESTE 1A46H 1C1VH 1BTXA 2SGFE 9ESTA 1FAKH 3M61U 3PMBB 1OP8A 4WWYA 1TONA 1SB1H 3DD2H 1O5FH 3EGKH 1SSXA 2XC4A 1CBWB 3SNEA 2FOHA 5EGMA 2AGGX 2VWLA 1G3BA 1GBBA 1W7XH 5GJ4B 3RDZA 4X1PU 3TH2H 1TWXB 3KIDU 8KME2 3S69A 3PMAB 4BAOB 4JYUH 4O97A 1AU8A 3RM0H 3NZIA 1EB1H 3ZVGA 4A7IB 3C1KA 3LT3A 4X2YA 3SJOA 2WINI 2BOKA 2QXIA 1CGHA 3FZZA 1B7XB 4LXBH 5DPAA 3AVZA 1TNJA 2VVUA 1MCVA 3TNTA 2SNWA 3MU5A 4MTBA 3KQEA 1ETSH 5DP3A 2BY9X 1IQFA 1LVBA 1C5ZB 4NCYA 1BTZA 4X8VH 1QB1A 3GCTG 4AG1A 3K65B 1QY6A 3SHCH 4WH6A 2TGDA 1J14A 3SU0A 1GJDB 4AFQA 2QCYA 1D4PB 1HJ9A 1A4WH 3RLYH 2BQWB 3SORA 5C1XA 3SU6A 1TLDA 3KGPA 4JMYA 4YM9A 1FV9A 1T31A 2BLWA 2BDIA 1ESAA 1NU9A 2D8WA 2GGVB 1FY3A 1LQEA 1RIWC 1YC0A 4OS7A 4OS2A 1QQUA 3KQDA 4NGAH 2BX3A 1D3QB 1MH0A 1N6XA 3PB1E 1AKSB 3P8FA 2CMYA 2GCTB 2W3IA 1ELGA 3M3TA 3O8DA 1NC6A 4DCDA 1FI8A 2BY5X 1SOZA 1GVLA 2O8MA 1DVAH 3L3TA 5FPSA 1VITF 1S0RA 1HAOH 1O2PA 1VCQA 4DIIH 1AWFH 2G5VA 2J4IA 4X2VA 1O3NA 3VEQB 3HKIB 3PMHB 1OPHB 2C3SA 3T5FH 1ZGIA 1TPPA 4M7GA 3SI4H 1UTQA 1HLTH 1GI0A 3OYPA 4NIYA 1P04A 4ZROA 1BRUP 1UHBA 1FY8E 1ZMNA 1GBLA 2OP9A 3QUMP 1GHYH 3BTHE 1UVOA 3SJKA 4YT7H 1GJ4H 2ZFPH 1Y3YA 1AGJA 1D6WA 4Y6DA 1ZZZA 1QFKH 6CHAB 4GSOA 1AQ7A 2NU1E 3RXPA 3RXOA 4UFDH 3MU0A 2LIZA 3SQHE 4SGBE 5A8XA 1W8BH 3RXAA 1F5RA 1XUHA 1ELDE 3HGNA 1UTOA 1JIMA 1MQ6A 3M3SA 1CHOG 3PTBA 1EZSC 1O39A 4B2AA 3DA9B 1CU1A 4X6PA 3TVJB 2P95A 2XW9A 1AFQB 4AX9H 3GY3A 1PYTD 3LOXA 2G4UA 1INCA 1C5XB 1FLEE 1C4Y2 3RXJA 3RP2A 2GVFA 3ZZ8A 4CRFA 2BD8A 1WYKA 2F9VA 3FANA 3RXDA 1NPMA 4INKA 1O5BB 2WUCA 3RXCA 1K9OE 1OWEA 2AIQA 4BTIB 1E36B 2Z6BD 3UR9A 5DP9A 5CHAC 3VB7A 1CHGA 2P8OB 5IYTA 3HGPA 4MPVA 2G51A 1GMCG 2IN2A 4WXIA 3EDXB 1CSOE 5DJ7A 3PMJA 4F4OC 4ZMAH 5DP4A 1BTWA 3I77A 2XCFA 1OXGA 1CQQA 1ZJDA 1IQHA 4TY6A 2DE8A 1G37A 2OINA 5TJXA 3A86A 3Q77A 1S81A 3ZYDA 2Y80A 1C1QA 1ELTA 2OQ5A 2J2UA 3RM2H 4AZ2B 1YCPK 2ZPRA 1LPZB 1B0FA 2ZGHA 2W5EA 3GCHC 3SU5A 1XX9A 3G01A 4E06H 1DWCH 1TBQH 4IC5A 4I8GA 1UK2A 2XWBI 4U01A 2FI4E 4B73A 1FMGA 2O8TA 3PROA 3TH3H 3VGCB 2A4OA 4MPXA 4Y8YA 1L2EA 4VGCC 3RXKA 1ZPCA 1ETRH 3QTVH 5J4SA 1LQDB 1EOJA 2F91A 2UUJB 1TRNA 2Y5GA 3E0PB 4UFFH 1LVMA 2AYWA 3MTYA 4MNYA 1C4V2 2VINA 2XC5A 1SQAA 1SLVB 3ZZ9A 2VH6A 3UY9A 1C5SA 3RXEA 2BDAA 2AMDA 1BBRK 3LH3A 1Y5UT 1XXFA 2BTCE 3A80A 3PO1C 2XYAA 4MG3A 4XBDA 4ABHA 5JBTA 3MH7A 2GV7A 3BTTE 2ZGJA 1NFUA 1T7CA 3A84A 1O35A 1GI6A 1C9PA 2Q6FA 2ALVA 2QF3A 1DOJA 1P2KA 4D7GA 1O2JA 3BG4B 3F68H 4YO9A 1GPZA 1HFDA 1L1GA 2FWWA 3E3TA 4FU9A 2H1UA 1MTVA 1G2MA 2DE9A 1HIAA 4YESB 1KLIH 4U32A 1SGFA 2OC7A 2ULLA 4CBNA 2A0QB 4WXVA 2Y6TA 1GL0E 2BYAX 1THRH 3SGBE 1YPKH 1SFIA 1GJ8B 1RJXB 1HJ8A 2AGEX 2R3YA 4TY7A 1G32B 4B71A 1SGCA 3S9AA 1GBMA 2BY7X 5EOKA 2IPHA 1HAPH 1ZRBA 2J95A 1TGNA 4BTUB 4K60A 1XUGA 1YLCA 4OGYA 2ZTZA 2ZZUH 4U30A 1RTFB 1MTWA 1UVPA 1WSSH 1GBKA 1O3PB 2FEQH 1A3EH 3Q3KA 2ZU4A 3GY8A 1ZHPA 3TU7H 5B6OA 1P03A 3MNCA 2F9UA 3P6ZB 1GMHF 1PQ7A 6LPRA 1SHYA 1SGNE 3T27A 2OC8A 4B2BA 3E6PH 1S83A 2HALA 2PTNA 1WTHD 1HGTH 3RXTA 1O2RA 4X2XA 3M3VA 1ESTA 2ZPSA 4Y0ZE 5FXLA 2VIWA 1KTTB 1IHTH 3BTKE 1SPJA 1H4WA 1FIZA 1MTNC 2FDAA 2ZEBA 4Q7YA 5JDUB 1NFWA 1VITG 3VB3A 1TMBH 3EBNA 1HAIH 4KTCA 4FUDA 1O2HA 1BTPA 3UOUA 3TPIZ 4ZKSU 2NU4E 2ANKH 1IQIA 1C2EA 1DY9A 2D26C 1JOUB 2WPHS 4AG2A 1K1OA 4JZDH 1WOFA 2BDBA 5FBIA 1JWTA 1GHAF 2PR3A 4AOQA 3M5MA 1DLKB 2BD5A 1YPEH 4AFZA 1QBNA 4K1EA 3GISB 1IQJA 2W26A 1TGSZ 1DFPA 3RXBA 3U1JB 2BOHB 2ZTYA 5AFZH 1DSUA 1JRTA 1A3BH 1G3EA 4NSVA 2AEIH 4RKOB 1O2OA 2WPKS 4JZIA 3UR6A 1ACBE 5JBAS 1C1WH 1KXDA 1TBRH 1MTSA 1UVUH 2FLRH 2ZDLA 2ZI2H 2GZ7A 3EA7A 1JBUH 3N7OA 5DGJA 1K1LA 1QBVH 1EUFA 1AD8H 1KDQA 1YGCH 2I6QA 2HPPH 1PQ5A 1P2JA 1NT1A 2GMTC 4FUHA 4CH8B 3ZZ6A 2B9LA 1E37B 3ZVDA 3M7TA 1RIWB 1Y3VA 2BQ6B 5BRRE 3A8CA 3P70B 1GJCB 1QNJA 2QXJA