2KX4A

Solution structure of bacteriophage lambda gpfii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phages have adapted the same protein fold to fulfill multiple functions in virion assembly.
pubmed doi rcsb
source organism Bacteriophage lambda
molecule tags Viral protein
molecule keywords Tail attachment protein
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 2kx4A01
1K0HA 2KX4A
chains in the Genus database with same CATH superfamily
2R2MB 2GX4A 2XNDD 1UTOA 1C4Y2 1P2JA 1W0JD 2FX4A 2NU3E 2ZGBH 4PROA 3TNTA 3RXUA 3PLPA 4Y79A 2ZFPH 1C9TA 3RXRA 1V2RT 1L0ZA 4KKDA 1DVAH 5JB8S 4XD7D 1O2LA 3ZZDA 4IBLH 5A0AE 3EQ0H 4I8LA 1BMLA 4Y8XA 4HZHA 1T8LA 4CRFA 3H7OA 2G4UA 4WMDA 1S6FA 1ZMJA 1GBBA 3VEQB 3UAIC 4B76A 3A84A 1QNJA 4SGAE 1TOMH 3H5CB 4YT6H 3BTHE 4Z1MD 1AFEH 1OPHB 2B8OH 2A7JA 3BSQA 2ZU1A 1T8OA 4X8UH 1BJUA 3FOAA 1Y3VA 1GBAA 3PMJA 1YBWA 3NUMA 4IMZA 1SC8U 2EC9H 4XRNA 2W3IA 2PW8H 2P8OC 1YPJH 3F3BA 1MZDA 2A45B 2LELA 3F68H 1OWDA 3GCHC 1DPOA 3T27A 1SGFG 2TGDA 3U28C 3ZZ6A 3SU5A 2ZDMA 3HK6B 4BNRA 2GMTC 4LK4A 1GVLA 3LGWA 3TGJE 5EQQA 4ZKNU 1VITF 1P12E 4A92A 3SGQE 3KIDU 2BM2A 1SGPE 2BD9A 2A2QH 1ZTKA 5C0UA 3F9HA 1EAUA 3HATH 4CR9A 3ESTA 1CE5A 2WV5A 2ZNKH 1ZGVA 3K65B 1BZXE 1T31A 2OXSA 2VIDA 1UK3A 1IHTH 4U2WA 2P3FH 3BG8A 1NU9A 4D7GA 5HMAA 5GPIB 5I25A 5HIZA 3SQEE 1MCVA 1TBZH 3RP2A 3UREA 3UY9A 2OUAA 1F0UA 1W7XH 4NZLA 1AE8H 4CH2B 3QGNB 1UCYE 4THNH 3ZVEA 1JBUH 1ZPBA 3NWUA 1ZMLA 2PTCE 4UD9H 3PV4A 4ABGA 2C8XB 4U32A 1C2GA 2UUJB 1NROH 3TLOA 4E7RG 2GZ9A 1RJXB 1W0KD 1HXFH 5CHAB 1IQMA 1P8VC 3SU0A 1EASA 1LHFH 4UE7H 1SGDE 1AZZA 1A0LA 4JCNA 3UQOA 3KL6A 1XUKA 2Q6DA 1SGNE 1HAXB 3BTME 1O3BA 3RXMA 1O3JA 1HUTH 2AMQA 2CHAB 3UUZA 3U1JB 3A86A 2OQ5A 8GCHG 1NFYA 2JH0D 1P9SA 4E7NA 1F7ZA 1C5RA 1CHOF 1A4WH 5DP6A 2VNTA 3FP6E 1O3CA 3SU6A 1AN1E 4CBNA 3A7XA 3U69H 1GPZA 2ZU3A 5FBEA 4B74A 2CF9H 2ODPA 2BLQA 2O9QA 1AY6H 4AGKA 4X1NU 3MMGA 1MZAA 5FXLA 3E91A 2OC1A 1Y59T 4ZHLU 1HXEH 3AVZA 4ISIH 3PMHB 2OC8A 1OWKA 5FHTA 2SGDE 3OU0A 1O5GH 5FAHA 2AIPA 4OGYA 2H6MA 3SORA 1Z6JH 3SU2A 1GBCA 1FUJA 2F91A 1O2QA 2Q6FA 2ODQA 2PUQH 5BRRE 1A5IA 1EJNA 1OWHA 2GT8A 2RG3A 1EATA 1NY22 3GY5A 1SLUB 4D9RA 2WYGA 3DSPA 1O3EA 2UWPA 1BDAA 1O3NA 1E34B 1Z7KA 3DT0H 3S7HB 5ESBA 3RXHA 1S6LA 2R2WU 3LJJA 4K1EA 2CMYA 1P02A 4X1PU 1YPHC 3DHKH 4KELA 4FUGA 1C1OA 1KSNA 2OD3B 1UK4A 1C1UH 2OINA 1KMHB 1WAYB 3KNXA 1E79D 1K28D 6CHAC 1FN8A 2ZGXH 1OWIA 1M9UA 2BX3A 3SO3A 4B6FA 1HBTH 2J97A 1VCQA 4O03A 1HJ8A 2M2AA 1G3CA 1QL9A 3NCLA 1TYNA 5T6FA 1PPFE 4YM9A 3GY7A 1UTMA 1WDIA 4MPXA 3ZVAA 4RT0A 1TNHA 2BQWB 1QB1A 2FS8A 3KYGA 3PO1B 2KM0A 3GICB 4SGBE 2SGEE 3P92A 2G55A 2BDAA 1YPLH 2GCHF 5GDSH 2PKSB 3UQVA 4B2CA 1QURH 1GDUA 3UOPA 4HGCA 1ZHMA 2FI5E 2P3TB 3RXGA 1GBIA 1GHZA 2THFB 1DANH 1FN6A 2ZCLP 3OEED 5DP9A 2ZHWH 2XCFA 3P8GA 5C0TA 1P2OA 3C27B 1C2JA 5GWZA 5JBAS 3ZZAA 3OAAD 2BQ7B 5JBCS 2Y5FA 3K6ZA 1QB6A 2ZDLA 3MNXA 3V12A 2JETC 4YESB 2K0QA 3P17H 4Y0ZE 2R0KA 2ZHDA 2FOFA 2CXVA 5EU8A 1SOZA 1FV9A 3DCLA 4RKOB 1GCDA 1QQ4A 1RFNA 1V2TT 1NRQH 3NK8A 4RKJB 2BD3A 3FP8E 1G32B 1GI5A 3T28A 2Y5HA 1UTNA 1GBMA 4F48B 3LH3A 1F0SA 4JZDH 3U8TH 2J2UA 2QY0B 1C4U2 1YPGH 1TGBA 2WV4A 3RXEA 4BTIB 2GDDA 4JK5A 1SI5H 2JJ1D 1S85A 2XYAA 4E06H 1WBGB 1O3DA 2A7CA 1V2UT 2XBWA 1TPAE 2ZU2A 2IOTA 2VH0A 2UWOA 1GL0E 3TJNA 1O2JA 2A0QB 5C5NA 3ATMA 3E8LA 1N8OC 1OKXA 3SUEA 2AFQB 1EB2A 2A5AA 1K9OE 1GHXH 3EE0B 2C4FH 1GHVH 1ETSH 2QYIA 1N8OB 2WV9A 1UK2A 4WH6A 3MH4A 3PWBA 4KTSA 3VB6A 4ZXYH 3AW1A 5DG6A 1AU8A 2ZFFH 5EXLA 2PFEA 3P70B 3GS9A 1PYTC 2BHGA 4BOHA 1F5RA 4GHQA 4P02A 2F9NA 1NRSH 1SVPA 3QX5H 1C2HA 4NIYA 3TNSA 2ZEBA 4OS1A 1IHSH 3A80A 4TPIZ 2QV1A 1AIXH 2QCYA 3VGCB 4A1TA 3MWIU 2ZTZA 3P6ZB 1K22H 1GJCB 2FMJA 3HGNA 1XUIA 3ZYDA 2H9EH 3SI4H 3MU0A 3M7TA 2PP6A 1L4ZA 1ZLRA 3KCGH 4KTCA 1EZQA 1LO6A 1HNEE 2YMSB 3VGCC 5L6NH 1P0SH 2C8WB 5T6GA 4FUJA 1TA6A 1C1VH 4OS4A 5EJ1A 1HCGA 1O32A 1C2LA 4K1SA 1ELDE 1ELCA 1HPGA 1B7XB 3FKSD 1YPEH 1MH0A 2ZF0H 1J16A 3SV6A 2FOCA 1LKAA 3U8OH 1EZUC 1NM6A 4YT7H 7GCHG 2FOBA 2F3CE 3RXBA 4Q2KA 1C5TA 1YCPH 2GMTB 1ANBA 1Z1IA 3ZZ3A 1T7CA 4AOQA 4WXIA 5DO4H 1WUNH 1XVOA 1A3BH 4Z6AH 4Y71A 5TCAA 1RGQA 1ID5H 4XE4A 3QWCH 3FZZA 2ZDAH 1H9IE 1H8DH 1W0YH 3RXKA 3D65E 2FX6A 2BVRH 1QJ7B 1SB1H 1ZMNA 3A8AA 1O3KA 1LVYA 1C5SA 1QHRB 5LH8A 1ANEA 3H09A 1QL7A 3A7WA 3LGVA 2QXHA 3PV5A 2VB0A 3SV8A 1P2IA 4BTTB 3ATLA 2B7DH 2Z3DA 2FLBH 2BD2A 4NA8A 2XCNA 3F9EA 4Y76A 1EJMA 3RUOA 5T6DA 4INHA 2ZWLH 3UTUH 1QIXB 1WCZA 3M7UA 4IC6A 4TT3D 2BY8X 3WWFA 1EAWA 3A7YA 1A1RA 1JIRA 2WPMS 4X6PA 1A5HA 2TRMA 3VFEA 1JMOH 3LJOA 1TX8A 3SU3A 2QA9E 1AI8H 1T8MA 1K1NA 3K6YA 1LVOA 5DP3A 2VIWA 2V3HH 1MU8B 2BVSH 1G2LA 2FOHA 4GPGA 2F9VA 2GV6A 1CGJE 2VGCC 5EJLA 1GMHG 1UJ1A 4FUIA 1TABE 1C9PA 1ZHRA 2FLRH 4I8GA 5C1UA 2BD8A 3SW2B 1FY1A 2A4OA 1QY6A 2PKSC 2FYQA 3ZZ7A 2GP9B 1E35B 3MO3A 1SLWB 3A7ZA 1Q31A 3SGBE 1YPKH 3ZIAD 5K7RA 1GJ7B 2SNWA 3U8RH 1EOLA 4NGAH 4IS5A 1QCPA 2C8YB 2G00A 2F9PA 1LDTT 4X6MA 4DURA 5FPTA 4MDSA 1V2JT 1BRAA 1QB9A 4ISOA 2IJD1 5ABWA 2J4IA 5HIYA 3T26A 2JKHA 4RI0A 2ZFRH 1DY8A 3SYJA 1Y3UA 2IPHA 1JRTA 1TX7A 3RMMH 1GBDA 5ESTE 3MFJA 4HFPB 1H1BA 1HAHH 3L6PA 3Q00A 1FI8A 5F8ZA 3RXCA 3QZQA 2Z3EA 1RIWC 2BYAX 3DFLA 1OWJA 2PSYA 1TX6A 2XC0A 1SGYE 3V0XA 2OK5A 2FXRA 2FO9A 5FPYA 2BY5X 3B23B 1QTFA 1AVGH 1E36B 1KTTB 2BZAA 4AGJA 1ZZZA 3RLYH 1FAKH 1T8NA 3A88A 3T2NA 1QRWA 3UPEA 1FXYA 1XUGA 1CT2E 4XBCA 3VXEH 3A83A 1BUIA 3VB7A 2ZKSA 1B0FA 4JYTA 1F92A 1ETTH 2XRCA 1TGNA 2SNVA 1AWHB 3BIUH 1OX1A 2B9LA 1UVSH 2AMDA 2J92A 3LT3A 4DVAU 1PPZA 4DOQA 2LNCA 2SGQE 4X6OA 4MNXA 1C4V2 1AFQB 3HPTB 3N7DA 4ABBA 2FTMA 1O2TA 8KME2 5HXFA 1FNIA 1MABB 1LKBA 4B75A 3NZIA 1DWCH 4X2VA 2ZI2H 2ZP0H 1HAYB 2FYRA 1LTOA 3MH6A 3LOXA 1DE7H 2KR7A 2BLOA 3SZNA 5JBTA 1T4VH 1PQ5A 2V3MA 5FCKA 3GOVB 1FY4A 1J14A 1IQEA 4JYVH 2PUXB 2FP7B 4ACAA 4D7FA 1N6XA 1KY9A 1GMDF 3RXFA 5FX6A 1D6WA 1BCUH 5TJXA 4I31A 1NT1A 2Z9IA 4MPWA 4K8YA 1A5GH 1NS3A 5FL7D 3CS0A 1SHYA 2FDAA 3K2UA 3RC4A 5PTPA 3PTNA 2TPIZ 1DLEA 2XC5A 5KEDA 1GJDB 3I77A 1TNKA 1BQYA 3F2HA 3EDXB 1WXRA 3UR9A 2TGPZ 1B0EA 3MTYA 1UCYH 2GT7A 1GGDC 3LC3A 2Z6BD 2GKVE 1AGJA 3SNAA 1SFIA 2ZCKP 3F0PA 4R0IA 5L30H 5TCCA 1LPKB 1F5LA 1O2YA 1GDQA 1EKBB 2AS9A 3LGIA 1FY5A 3ZZ8A 1GBEA 2JETB 1BTWA 1XM1A 1ELEE 1H8ED 2QAAA 2RA3A 2TBSA 1YC0A 4AORA 3RXTA 3TK5A 3STIA 2SGPE 2HGTH 3RC5A 2P95A 1VZQH 3BG4B 1GMHF 1C5WB 3TU7H 4M9FA 4JMYA 1EQ9A 1HB0B 2O8UA 2UWLA 4TWYA 3SU1A 2VWOA 1MKWH 3MH5A 1E0FD 2AGEX 3RMOH 1W14U 1ZYOA 1AB9B 5HGGA 3FVFB 3GYMA 2JDID 3EE7A 1C1NA 1V2ST 2P59A 1EP5A 4ZMAH 2Y5GA 4YO9A 1UTLM 3UIRA 1TRNA 4AZ2B 1DOJA 2QXIA 3Q3XA 1YM0A 1O2NA 1QJ6B 2L74A 2Z9GA 4KTUA 4B71A 4KGAA 4JZIA 4X1RU 3F9FA 1G36A 1SHHB 1XVMA 1H8HD 5B6OA 2SFAA 1GI3A 3A82A 2HLCA 2J98B 1O0DH 4ABFA 2O8WA 4IGDA 2EA3A 3ZVDA 4Z0KA 1GI9B 1W8BH 2VVVA 1Q3XA 3CNRA 1LQEA 4LOYH 4NSYA 3SZEA 1FMGA 2F43B 3KGPA 1L1NA 1YP9A 4X2YA 2B5TB 1TGCA 4U01A 1EOJA 1TIOA 3SUGA 2VIQA 3VG8A 1F0RA 1AWFH 1EPTC 3EA7A 4Q7YA 1IOEA 1GI1A 3E1XB 2P93A 1THPB 1MAXA 1CHOG 3LGYA 2KCPA 3MNBA 4CRCA 1K1MA 4CRBA 5DP5A 2BD4A 3F2GA 5AHGH 1THRH 1NPMA 1JWTA 1LPGB 1BHXB 4WJG2 3MOCA 3MHWU 1O3HA 1O3LA 1JXPA 5A0BA 2RDLA 4FVDA 1BTZA 2VJ1A 4ZKOU 2OBOA 1BMAA 1FAXA 1TA2A 1RIWB 3D23A 3R0FA 2A4GA 1L1JA 2AEIH 1IQIA 3GDSA 1O2XA 1PFXC 1BITA 4FOUC 1TNLA 5HM9A 5E2PA 4BAHB 3SQHE 5T1VA 1C5UA 1MQ5A 3PLKA 5C20A 2C8ZB 1TRYA 4ZKRU 2BXUH 5FCRA 1MTNC 1W13U 2Q6GA 1QGFA 3BIVH 1IAUA 5C1XA 5DKMA 4ABJA 2CV3A 4INLA 1WV7H 4ZAEA 3ATIA 5EXMA 1Z8IB 1GJ6A 4MQAA 1D6RA 2P3UB 8ESTE 3S0NA 2YOLA 4K3JA 1EPTA 5DP7A 2G5VA 2H9HA 2Z3CA 1C5LH 3OEHD 2Y82A 1WQVH 3MO6A 2Y6TA 4AG2A 5C2ZA 3MO9A 1DXWA 2LPRA 4JK6A 3RXIA 3AK5A 1O35A 4INKA 5EJZA 3I78A 4JZ1A 3SNDA 4F49A 5L2ZH 5CMXH 1DY9A 1O5DH 1AUTC 3LGTA 4ESTE 3EGKH 1WSSH 3GCNA 3PO1C 1PYTD 4DG4A 2J34A 1UHBA 1E38B 1FPCH 2OTVA 4K2YA 3R3GB 1MKXH 1W0ZU 1S0RA 1DWDH 1YYY1 4OS6A 4BAQB 2GGVB 2WZQA 3KQCA 1ELGA 1KLJH 2KFWA 1D9IA 1YLCA 4AFZA 1QRZA 3OSYA 3TH4H 4X8VH 1FIWA 2ZHFH 1HAVA 1GJ4H 1UVTH 2FM2A 1TBQH 2C90B 1XKAC 3GY8A 3Q3KA 1C5NH 2J5UA 1V2QT 2DE8A 1S83A 4NWLA 4R8TB 6GCHG 3A85A 1T4UH 2BDYA 1C1TA 1HGTH 4YTAA 1MTSA 3BTEE 1TAWA 3STJA 2XBXA 5DK1A 5CE1A 1LHCH 5GCHF 1AQ7A 2QN5T 3BN9A 1CGHA 1G9IE 3GY4A 4ZXXH 4I7YH 4Q80A 5EGMA 2ZGCA 1C1PA 4I8KA 4CHAC 3GCTG 3MI4A 1O38A 2FESH 2XTTB 1QBOA 3TK9A 4Q7XA 3ELAH 4B6EA 3RXAA 3S9AA 4UFFH 4DCDA 4FU9A 1RRKA 3QN7A 5DN6D 5E8EH 3W94A 2W26A 3W95A 4TSFD 1L2EA 3QTVH 1TPOA 4MNYA 1UMAH 5DP4A 1P57B 1GI2A 1D3DB 1ESTA 1HYLA 1O39A 1EFRD 2PKAB 1K21H 2FPZA 4ISLA 3T5FH 2AGGX 1KLIH 3BV9B 2GD4B 1O2IA 2VIVA 2ZTYA 3F9GA 4GCHG 4NA9H 3U1IB 3A7VA 4X8TH 1VCPA 4NZQA 5A2MH 1ESAA 2OC0A 3MNCA 2ZQ1A 4NFFA 4ABIA 4CREA 1UCYK 3FO8D 5HM2A 1AHTH 4BAKB 4MPUA 1C5YB 1NBME 3A87A 1RTKA 5F53A 2ZGJA 1O2OA 3QK1A 5A8YA 1LHGH 1IQJA 2BOHB 3L3TA 3LONA 1BRCE 2UUYA 2VVCA 1Y3YA 3OY5U 1OYTH 3BTGE 1C5QA 1E37B 1RS0A 4B1TA 1HV7A 2VIPA 4CRDA 3ATWA 1O2PA 1MBMA 2PWXA 1SGFA 3VB3A 5DPAA 4A6LA 5IK2D 1V2LT 2CHAC 1TQ7B 1IQKA 1QBVH 1KLTA 2ALPA 1D4PB 1DS2E 1Y5BT 2GCTB 1KYNA 2ILNA 5K0HA 1GI7B 1MD8A 2AH4X 2QF4A 1BBRH 2G81E 1RTFB 4WMFA 3MU5A 3M3TA 4HI3A 2L6OA 4I8JA 3M61U 1GJAB 1KXFA 2ZFTA 4WH8A 3FANA 1PQ8A 1HAIH 9ESTA 3A7TA 5AFZH 4H6SB 2IJOB 2AIQA 2EI8A 2G5NA 2ZHQH 4H6TA 1UO6A 1DDJA 1V2NT 4FUFA 3SHCH 4NIWA 1EXFA 5J4SA 4UEHH 1ELFA 3P8NA 2HLDD 1P3EA 3Q77A 1LMWB 1NFWA 2FOEA 2KAIB 3ZZ4A 4AX9H 1BTHH 4I32A 3GDVA 5ETXA 4WY3A 1TPPA 3JZ2B 3NKKA 2NU4E 2OC7A 1SKYE 2KCAA 4UFDH 1CQQA 1XUJA 3S9CA 4JZFH 5EW2H 1GJ9B 1COWD 2F9BH 2FOMB 1ZRKA 2WPKS 1BTPA 1W7GH 4YLQH 1TRMA 1OYQA 5JBBS 1GGDB 1AZ8A 2O8MA 1UTPA 2Z9JA 3F0OA 1D3TB 3MNSA 5EIYA 1GHAG 3S9BA 4FU8A 4KP0A 5EQSA 4WF8A 2BDBA 5GXPA 3DD2H 5I46H 2CJIA 7KMEH 3W1EA 3AAVA 1ZPCA 4B2AA 4AG1A 1ABIH 3PTBA 1DM4B 3QO6A 1GVZA 1MUEB 3BTQE 2BD7A 4MNVA 4ABHA 1V2MT 7LPRA 2OQUA 3RXJA 2G4TA 1S5SA 3U98H 3SGAE 3ODDA 1AO5A 3WW7A 4BAMB 2Z7FE 1VJAU 3SNCA 4ACBA 5EQRA 3MYWA 1G3DA 2JH6D 1HLTH 3ZVFA 1BTUA 5CDFE 3FZDA 4NFEA 1NC6A 4MLFB 1ORFA 3URDA 1FY8E 3GY3A 4F55A 1MU6B 1P11E 1MMJN 2Z94A 1JIMA 2JIZD 1GBFA 1O2HA 2ZIQH 3RMNH 2ZPRA 1ARBA 1EPTB 1O2KA 2F9UA 4RN6A 3SV2H 4K5ZA 1C5ZB 1O5EH 2F4LA 1TQ0B 2KZ4A 1HAZB 3BTWE 1ZRBA 2ZU4A 2DE9A 1G3BA 4FXGH 1W2KH 3IG6B 3TK6A 1E1QD 4NA7A 2BDHA 3A89A 4A1VA 3KN2A 4OS2A 5JPMH 2PV9B 4CH8B 2A32A 4OS5A 3RMLH 1P04A 1GG6C 1MBQA 1UHBB 1A46H 1OHHD 1A0HB 1VJ9U 3SJKA 3VB4A 2STAE 3GCOA 1BMFD 4Y6DA 3NPSA 1F0TA 1GG6B 2O8LA 1P09A 1QA0A 2GZ7A 4TWWA 2GJGA 4BTUB 3D62A 1OP2A 4DJZB 1P01A 1SGRE 2D8WA 3IWMA 1S6HA 1C1WH 4GAWA 4TPYA 4YZUA 2PHBA 1K2I1 1G3EA 1O2ZA 1HAVB 2G8TA 2CF8H 1AFQC 1C2FA 1ZGIA 2Y81A 5H4IB 4FVBA 1ARCA 1AMHA 1HAOH 1K1LA 3HKIB 1OXGA 1S84A 1V6DA 4FUCA 4WXVA 1L4DA 2A7HA 4Y7AA 1HFDA 1SL3A 1WU1A 4A7IB 1QFKH 3F6UH 3OE7D 4BXSA 1CA8B 1IQHA 1C5MD 4D9QA 4XOJA 4CRAA 1QQUA 1DSTA 1ZSJA 3A8DA 4AFSA 1P2KA 5FX5A 1Y3XA 1KTSB 2TGTA 2ANWA 3DSGA 3KHVA 2J9NA 1UVPA 1GI4A 3NXPA 1GHYH 5DJ7A 2OBQA 2ZCHP 4F4OC 1C5PA 2WPLS 2FZZA 1ZSLA 3RXLA 5C94A 2BVXH 3QZRA 1P3CA 2VINA 2QIQA 3SNBA 2K8IA 2VVUA 3GY2A 1HAPH 2AERH 1GVKB 1TOCB 4VGCC 1K1PA 4ZHMU 1EZSC 1BHXF 1YPHE 1O5BB 1W3CA 2BZ6H 3GY6A 3TGIE 1KDQB 3ZVGA 3ZV9A 4XSKU 1RD3B 3OTPA 1O36A 4IC5A 1EP6A 4BANB 5DP8A 4DIIH 3RXSA 3UR6A 1G2MA 1O34A 1SSXA 1K1IA 1LHEH 2FEQH 2XBYA 1UVUH 1A0JA 2HOBA 3BG4C 2PKAA 3QGJA 6GCHF 2RA0A 1LVBA 1QR3E 3ZV8A 3LC5A 1MKWK 2V0BA 2WINI 1XKBC 1DWEH 1Z8JB 4Q7ZA 1K1OA 2WYJA 3O8RA 5EPYA 1MTWA 4UDWH 4XDEA 4YOGA 2AYWA 1VKYA 4X8SH 4DY7B 4Y8YA 2R3UA 4WVPE 1TMUH 2R3YA 5A8ZA 4GHTA 2H5CA 1S0QA 1QBNA 1P9UA 4GVUA 1EAIA 4XBBA 4UFEH 2QF3A 5L2YH 1CA0B 1Y8TA 1UTJA 2GCHG 1O31A 1V2WT 1N6YA 4Q63A 5EODA 4K69A 1HJAC 1YF4A 2R9PA 1EAXA 1TGTA 5E0JA 1O3MA 1SBWA 3ZVBA 1GCTC 1GI6A 2NU2E 1ESBA 1ZJKA 2OLGA 1O5AB 3SN8A 1O3IA 1BBRK 1CO7E 5AFYH 1C1SA 3Q3YA 2BLWA 3P8FA 3RXDA 1SR5C 3UWIA 1TNIA 4H4FA 3M35A 3PLBA 4HTCH 2QF5A 2V7QD 5LPFA 2LP6A 2VWLA 2M5TA 9LPRA 3VPKA 1O5FH 3KF2A 1NTPA 3BTTE 3N7OA 4TYDA 2SGAA 3LU9B 3QTOH 3QLPH 1ZHPA 2QE7D 1RXPA 1NRNH 4Q4LA 3A8CA 1XUHA 1HIAB 1P06A 1IQNA 1EJAA 1SFQB 1WTGH 5BPEA 4D76A 5E0HA 2I6SA 2BDIA 3TJVA 1DX5M 1SPJA 1DFPA 4AN7A 5KECA 1J8AA 2KAIA 1GWAA 3U9AH 2PLXA 3E0NB 3M5OA 1XMNB 2VH6A 3AASA 1L1GA 1VCWA 3HKJB 2ZECA 5A09A 3PMAB 1KXEA 1Z1JA 2WUBA 1CBWC 3CS7A 4NCYA 1NESE 1CVWH 4OM9A 4UFGH 3A81A 2GCTC 1GBLA 1EB1H 4ZCNA 5JB9S 5DSFA 4GCHF 1BRUP 3ZVCA 3SJ8A 3SUFA 1VR1H 1O3GA 3PRBA 4AB8A 1LCYA 3MQKC 1WTHD 5B6LA 1VGCC 3P8OA 2WPDD 1O5CB 3TIUA 1MTUA 1O3PB 2ZDVH 1H8IH 2HNTE 4NSVA 1CU1A 1EX3A 3GDUA 2ZDNA 3M3SA 1O2MA 3SV7A 2RFKC 1C5XB 3LGUA 1LQDB 2GZ8A 1DSUA 1G37A 4XBDA 3TITA 3FFGA 3L33A 2W5EA 4X6NA 2IN2A 3SV9A 2D26C 5A0CA 2ALVA 3TVJB 2BDCA 1SMFE 3PROA 3URCA 1KIGH 1C1QA 1TE0A 2WPJS 1V3XA 1AD8H 1U6QA 4FETA 2H1UA 4MG3A 5G4BA 5IYTA 3SJIA 2J94A 4X2XA 4IN2A 4ISNA 3KYFA 1DICA 1SG8B 1G30B 3LIWA 1NBMD 1SQRA 4O9VA 4NWKA 2HVYB 1TMBH 4GUXA 3RLWH 1GBHA 2QF0A 1P2MA 2ZPQA 2BXTH 5E2OA 1XXDA 1YGCH 5EG4A 2GV7A 2NU1E 1YKTA 3M5MA 2CGAA 1ELVA 2DUCA 1HRTH 3DUXH 2ODYB 4U30A 4B2BA 1T32A 3BTDE 5LGOA 4DT7B 1SOTA 1C1RA 1SGTA 3SU4A 1FIZA 2A4QA 1GMCF 3QDZB 1PPEE 2QC2A 3QUMP 4Y7BA 4MNWA 1TWXB 2FOGA 1C1MA 3E90B 4AFUA 1Y5AT 4WWYA 4ASUD 2BOKA 2ZO3H 2P16A 2ZG0H 4ABDA 2ULLA 5E0GA 1UVOA 5C3NA 4UONA 1MTVA 2FI3E 1IQLA 1NRPH 3TJUA 4VGCB 2WHXA 1GBJA 1TNJA 5LPRA 1ELAA 3DFJA 1E1RD 1ELTA 1DUAA 2XWAA 1NO9H 4DW2U 2Z9LA 5SGAE 4TY7A 1PPGE 2XW9A 2J38A 2ZPSA 1BMNH 2CN0H 2NU0E 2FOAA 1OWEA 2A5IA 5DGJA 4CHAB 1GL1A 1BOQA 1NFXA 3NRLA 4ASHA 3PM3A 1CA0C 3B9FH 6ESTA 1O3OA 2A1DB 2IPQX 1A2CH 3ATKA 1PPHE 3MU4A 5C67A 3BTKE 1OOKB 8GCHF 3M5LA 2ZZUH 1FPHH 2VIOA 1ELBA 3RC6A 3RXQA 4AYYB 2VWNA 1QJ1B 3LPRA 3PB1E 2Y7ZA 2YNAA 7ESTE 1Q2WA 1YCPK 2QXGA 2HRVA 1BMMH 1ZJDA 3O8DA 1AKSB 2GVFA 3VB5A 4DT4A 1Y3WA 1CSOE 1W12U 3EA8A 1KXAA 1GBKA 1MQ6A 3E3TA 4ZHAA 5F6MA 3H7TA 1PQAA 1OS8A 1A3EH 1Z8RA 2XXLA 4RT1A 1SGEE 1KDQA 3MU8A 3PWCA 3AAUA 3ODFA 3CENA 3MU1A 3UNQA 5IDKA 3OYPA 5LPEA 1ACBE 1FQ3A 1NRRH 1V2OT 2W6ID 2ZHEH 1KXCA 1TB6H 1TLDA 1XUFA 1BA8B 2WSSD 1GHWH 4IN1A 2Q1JA 2JJ2D 1YLNA 2VWMA 8LPRA 1MTNB 4AFQA 4DGJA 1ETRH 1RTLA 4J1YA 4XFQA 5J4QA 2ZQ2A 2HPPH 1D3QB 1X7AC 2HPQH 1CGIE 1Z6EA 4JYUH 1AE5A 2EY4C 1GDNA 3SHAH 3N7EA 1BBRE 3AW0A 4NG9H 2H2ZA 4X1SU 3GYLB 2G52A 2W7SA 1LPZB 1GI0A 1C2IA 2FWWA 2GDEH 2A4RA 2HALA 2W6JD 2B0FA 2KCOA 1TBRH 1GBTA 1O3FA 4I8HA 2XWBI 1PPBH 2G51A 1ZTJA 3VXFH 1GJ8B 1HDTH 2EQNA 3BEIB 2BDGA 1FONA 1JOUB 2STBE 5FPSA 3SBKA 3E16B 3N99A 2CK3D 4X0WU 3O8CA 6LPRA 2O8TA 4MPVA 1C5OH 1WYKA 4IW4E 1FDPA 1W11U 1O2UA 4BXWA 1ABJH 2D1JA 5AF9H 1ZOMA 1CT4E 1CT0E 1OP0A 2PSXA 3RXOA 1O2VA 1QL8A 7GCHF 2TGAA 5GJ4B 3RM2H 2V35A 4CRGA 1EUFA 3RU4D 3S69A 5HYOA 2EI7A 4ZROA 1WOFA 2C3SA 4O3UA 2HNTF 2A2XH 2XNIA 1TGSZ 2WPHS 1PJPA 1NU7B 1IQFA 3TPIZ 2OCVB 1C2KA 2Y80A 2OP9A 1THSH 1VITH 1GI8B 1UW7A 2KCYA 1O37A 5AVDA 1AB9C 1HIAA 4YOJA 1J15A 3KQDA 3T25A 2P94A 4ZH8A 1P03A 2FODA 3D49H 3OX7U 2V3OH 1MCTA 3C1KA 2H9TH 3OY6U 1J17T 2RCEA 1H9LB 2A5KA 4CBOA 1LHDH 2PR3A 1C5VA 1ZPZA 3RDZA 4P00A 3SUDA 1FX0B 1P2QA 4K8BA 3BEFB 3EA9A 1SGCA 5C5OA 3TH3H 1GMCG 1HJ9A 3ITIA 4BAOB 1J9CH 3KQ5A 4K1TA 5CHAC 4LZ1H 1SGQE 3B8JA 2F9OA 3IITA 1O2WA 2RDEA 2ASUB 2UUKB 1TONA 2A31A 1O2GH 2ZFQH 3G01A 3RM0H 2ESTE 4B73A 4ZUHA 2NWNA 3F1SB 2HWLB 2C93B 2YNBA 3UOUA 1TPSA 2VU8E 1V2VT 1QZ8A 5GNDA 3KEEA 5HKKD 2BX4A 4O3TA 1MD7A 3WWBA 3K9XB 3UFAA 3ZZBA 1KXBA 1QRXA 1UTKA 2VBCA 4Y0YE 5GCHG 1V2PT 1SQTA 4OGXA 3EYDA 1FLEE 3WY8A 1OP8A 4NIVA 2YMSC 4A1XA 5T3HA 2BD5A 3JZ1B 4FUDA 1Y5UT 1FY3A 1A7SA 1GHBF 2W3KA 4OS7A 1Z71A 1QA7A 2VGCB 2XBVA 3P95A 4WMEA 1BB0B 1NFUA 1EZXC 3M7QA 1N1LA 1FJSA 1GMDG 3ZZ5A 4A5TS 1DXPA 1ZTLA 3HK3B 1W10U 2BY7X 1S82A 2KX4A 3MH7A 1A61H 1VGCB 1YY3A 1TNGA 3LH1A 1SGIB 3M36A 2FTLE 4J2YB 3V3MA 5EPNA 2XOKD 1NZQH 3OTJE 5A8XA 2AMPA 3Q76A 1IQGA 3E6PH 1AVWA 2ANMH 2ZU5A 2W7UA 1TALA 1LVMA 4NIXA 5CHBA 1GJ5H 1ZR0A 3T29A 2HNTC 2BTCE 3EAJA 4QT8C 1O3AA 2EI6A 2FI4E 3GISB 3TGKE 3UNRA 4E05H 1SQOA 1C2DA 1O2RA 3F2FA 2ZC9H 1BJVA 1P2NA 1PQ7A 2PGQB 2AHME 2FIRH 2J98A 2Z9KA 4Y10E 5JYIA 1KXDA 2BB4A 3SI3H 5C17A 3RU4E 3FAOA 3RXPA 1P05A 1YLDA 2P8OB 1DLKB 5EXNA 2ANKH 3S7KB 4FUBA 2YMSD 1GHAF 3PMBB 4YOIA 4JZEH 3GCHB 1BTXA 4HG6A 3RXVA 1DT2A 1XXFA 1ANDA 1TMTH 2ZGHA 2UUFB 2Y7XA 3BF6H 3V13A 3ZYEA 4YXWD 3LDXH 4I86A 4ISHH 1INCA 1MKXK 4O97A 1OSSA 1ZSKA 3M5NA 3TH2H 1F5KU 2PGBB 3DSOA 3LKWA 2ZA5A 1DUEA 4Y8ZA 1AUJA 3ZZ9A 4GSOA 2K1QA 2GTBA 1AKSA 1XX9A 1O2SA 4GLYA 4FUHA 1SLVB 1O33A 2HVXA 3KQEA 3OFND 1BRBE 1DWBH 2TIOA 4FUEA 4K60A 4X2WA 3UB0A 1D3PB 1Z8GA 1F2SE 2ZTXA 2ZFSA 3RU4T 4D8NA 3FP7E 1B5GH 2EEKA 3KQBA 4CR5A 2BY9X 1YWUA 4H42U 4ABEA 3M3VA 1FZZA 1TFXA 3SJOA 3UNSA 1BT7A 1WQSA 1HJAB 2ANYA 5FBIA 1YCPM 3SNEA 1NN6A 4I33A 2ZDKA 2F83A 1SLXB 3UWJH 3V7TA 2WUCA 3PRDA 4FU7A 5F8XA 2BQ6B 2XC4A 4ZKSU 4AC9A 4TY6A 1V2KT 4Y11E 2I6QA 3BEUA 1DITH 3TJOA 1MAYA 2BMGB 3A8BA 4LXBH 4AB9A 1VITG 1UTQA 3GCTF 2QXJA 3PYHA 1ANCA 1P10A 1BTYA 1K1JA 4RSPA 2QGRA 2JH5D 5EW1H 1HAGE 1C2MA 2AGIX 1PPCE 1S81A 3FN8A 2BLVA 3T62A 3ENSB 5GIBA 1CHGA 5F03A 2V6NA 2FS9A 1C2EA 1H9HE 4M7GA 2R0LA 4X1QU 1GCTB 4MTBA 6CHAB 2BY6X 2WPIS 2PTNA 5JDUB 3SJ9A 1O30A 3E0PB 2SGFE 3M37A 3PV2A 3SOSA 1YPMH 1H4WA 3I29A 2D2DA 4MVNA 2J95A 4LZ4B 1SQAA 4AYVB 4ABAA 3O8BA 4YLUA 5EOKA 2H5DA 3HGPA 3ZZCA 1K0HA 3BTFE 1CBWB 1AVXA 4IMQA 4DIHH 1GHBG 5C1YA 5F8TA 1JRSA 1BIOA 1GJBB 5KGOA 3CP7A 3DA9B
chains in the Genus database with same CATH topology
1K0HA 2KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0H A;  2KX4 A; 
#chains in the Genus database with same CATH topology
 2R2M B;  2GX4 A;  2XND D;  1UTO A;  1C4Y 2;  1P2J A;  1W0J D;  2FX4 A;  2NU3 E;  2ZGB H;  4PRO A;  3TNT A;  3RXU A;  3PLP A;  4Y79 A;  2ZFP H;  1C9T A;  3RXR A;  1V2R T;  1L0Z A;  4KKD A;  1DVA H;  5JB8 S;  4XD7 D;  1O2L A;  3ZZD A;  4IBL H;  5A0A E;  3EQ0 H;  4I8L A;  1BML A;  4Y8X A;  4HZH A;  1T8L A;  4CRF A;  3H7O A;  2G4U A;  4WMD A;  1S6F A;  1ZMJ A;  1GBB A;  3VEQ B;  3UAI C;  4B76 A;  3A84 A;  1QNJ A;  4SGA E;  1TOM H;  3H5C B;  4YT6 H;  3BTH E;  4Z1M D;  1AFE H;  1OPH B;  2B8O H;  2A7J A;  3BSQ A;  2ZU1 A;  1T8O A;  4X8U H;  1BJU A;  3FOA A;  1Y3V A;  1GBA A;  3PMJ A;  1YBW A;  3NUM A;  4IMZ A;  1SC8 U;  2EC9 H;  4XRN A;  2W3I A;  2PW8 H;  2P8O C;  1YPJ H;  3F3B A;  1MZD A;  2A45 B;  2LEL A;  3F68 H;  1OWD A;  3GCH C;  1DPO A;  3T27 A;  1SGF G;  2TGD A;  3U28 C;  3ZZ6 A;  3SU5 A;  2ZDM A;  3HK6 B;  4BNR A;  2GMT C;  4LK4 A;  1GVL A;  3LGW A;  3TGJ E;  5EQQ A;  4ZKN U;  1VIT F;  1P12 E;  4A92 A;  3SGQ E;  3KID U;  2BM2 A;  1SGP E;  2BD9 A;  2A2Q H;  1ZTK A;  5C0U A;  3F9H A;  1EAU A;  3HAT H;  4CR9 A;  3EST A;  1CE5 A;  2WV5 A;  2ZNK H;  1ZGV A;  3K65 B;  1BZX E;  1T31 A;  2OXS A;  2VID A;  1UK3 A;  1IHT H;  4U2W A;  2P3F H;  3BG8 A;  1NU9 A;  4D7G A;  5HMA A;  5GPI B;  5I25 A;  5HIZ A;  3SQE E;  1MCV A;  1TBZ H;  3RP2 A;  3URE A;  3UY9 A;  2OUA A;  1F0U A;  1W7X H;  4NZL A;  1AE8 H;  4CH2 B;  3QGN B;  1UCY E;  4THN H;  3ZVE A;  1JBU H;  1ZPB A;  3NWU A;  1ZML A;  2PTC E;  4UD9 H;  3PV4 A;  4ABG A;  2C8X B;  4U32 A;  1C2G A;  2UUJ B;  1NRO H;  3TLO A;  4E7R G;  2GZ9 A;  1RJX B;  1W0K D;  1HXF H;  5CHA B;  1IQM A;  1P8V C;  3SU0 A;  1EAS A;  1LHF H;  4UE7 H;  1SGD E;  1AZZ A;  1A0L A;  4JCN A;  3UQO A;  3KL6 A;  1XUK A;  2Q6D A;  1SGN E;  1HAX B;  3BTM E;  1O3B A;  3RXM A;  1O3J A;  1HUT H;  2AMQ A;  2CHA B;  3UUZ A;  3U1J B;  3A86 A;  2OQ5 A;  8GCH G;  1NFY A;  2JH0 D;  1P9S A;  4E7N A;  1F7Z A;  1C5R A;  1CHO F;  1A4W H;  5DP6 A;  2VNT A;  3FP6 E;  1O3C A;  3SU6 A;  1AN1 E;  4CBN A;  3A7X A;  3U69 H;  1GPZ A;  2ZU3 A;  5FBE A;  4B74 A;  2CF9 H;  2ODP A;  2BLQ A;  2O9Q A;  1AY6 H;  4AGK A;  4X1N U;  3MMG A;  1MZA A;  5FXL A;  3E91 A;  2OC1 A;  1Y59 T;  4ZHL U;  1HXE H;  3AVZ A;  4ISI H;  3PMH B;  2OC8 A;  1OWK A;  5FHT A;  2SGD E;  3OU0 A;  1O5G H;  5FAH A;  2AIP A;  4OGY A;  2H6M A;  3SOR A;  1Z6J H;  3SU2 A;  1GBC A;  1FUJ A;  2F91 A;  1O2Q A;  2Q6F A;  2ODQ A;  2PUQ H;  5BRR E;  1A5I A;  1EJN A;  1OWH A;  2GT8 A;  2RG3 A;  1EAT A;  1NY2 2;  3GY5 A;  1SLU B;  4D9R A;  2WYG A;  3DSP A;  1O3E A;  2UWP A;  1BDA A;  1O3N A;  1E34 B;  1Z7K A;  3DT0 H;  3S7H B;  5ESB A;  3RXH A;  1S6L A;  2R2W U;  3LJJ A;  4K1E A;  2CMY A;  1P02 A;  4X1P U;  1YPH C;  3DHK H;  4KEL A;  4FUG A;  1C1O A;  1KSN A;  2OD3 B;  1UK4 A;  1C1U H;  2OIN A;  1KMH B;  1WAY B;  3KNX A;  1E79 D;  1K28 D;  6CHA C;  1FN8 A;  2ZGX H;  1OWI A;  1M9U A;  2BX3 A;  3SO3 A;  4B6F A;  1HBT H;  2J97 A;  1VCQ A;  4O03 A;  1HJ8 A;  2M2A A;  1G3C A;  1QL9 A;  3NCL A;  1TYN A;  5T6F A;  1PPF E;  4YM9 A;  3GY7 A;  1UTM A;  1WDI A;  4MPX A;  3ZVA A;  4RT0 A;  1TNH A;  2BQW B;  1QB1 A;  2FS8 A;  3KYG A;  3PO1 B;  2KM0 A;  3GIC B;  4SGB E;  2SGE E;  3P92 A;  2G55 A;  2BDA A;  1YPL H;  2GCH F;  5GDS H;  2PKS B;  3UQV A;  4B2C A;  1QUR H;  1GDU A;  3UOP A;  4HGC A;  1ZHM A;  2FI5 E;  2P3T B;  3RXG A;  1GBI A;  1GHZ A;  2THF B;  1DAN H;  1FN6 A;  2ZCL P;  3OEE D;  5DP9 A;  2ZHW H;  2XCF A;  3P8G A;  5C0T A;  1P2O A;  3C27 B;  1C2J A;  5GWZ A;  5JBA S;  3ZZA A;  3OAA D;  2BQ7 B;  5JBC S;  2Y5F A;  3K6Z A;  1QB6 A;  2ZDL A;  3MNX A;  3V12 A;  2JET C;  4YES B;  2K0Q A;  3P17 H;  4Y0Z E;  2R0K A;  2ZHD A;  2FOF A;  2CXV A;  5EU8 A;  1SOZ A;  1FV9 A;  3DCL A;  4RKO B;  1GCD A;  1QQ4 A;  1RFN A;  1V2T T;  1NRQ H;  3NK8 A;  4RKJ B;  2BD3 A;  3FP8 E;  1G32 B;  1GI5 A;  3T28 A;  2Y5H A;  1UTN A;  1GBM A;  4F48 B;  3LH3 A;  1F0S A;  4JZD H;  3U8T H;  2J2U A;  2QY0 B;  1C4U 2;  1YPG H;  1TGB A;  2WV4 A;  3RXE A;  4BTI B;  2GDD A;  4JK5 A;  1SI5 H;  2JJ1 D;  1S85 A;  2XYA A;  4E06 H;  1WBG B;  1O3D A;  2A7C A;  1V2U T;  2XBW A;  1TPA E;  2ZU2 A;  2IOT A;  2VH0 A;  2UWO A;  1GL0 E;  3TJN A;  1O2J A;  2A0Q B;  5C5N A;  3ATM A;  3E8L A;  1N8O C;  1OKX A;  3SUE A;  2AFQ B;  1EB2 A;  2A5A A;  1K9O E;  1GHX H;  3EE0 B;  2C4F H;  1GHV H;  1ETS H;  2QYI A;  1N8O B;  2WV9 A;  1UK2 A;  4WH6 A;  3MH4 A;  3PWB A;  4KTS A;  3VB6 A;  4ZXY H;  3AW1 A;  5DG6 A;  1AU8 A;  2ZFF H;  5EXL A;  2PFE A;  3P70 B;  3GS9 A;  1PYT C;  2BHG A;  4BOH A;  1F5R A;  4GHQ A;  4P02 A;  2F9N A;  1NRS H;  1SVP A;  3QX5 H;  1C2H A;  4NIY A;  3TNS A;  2ZEB A;  4OS1 A;  1IHS H;  3A80 A;  4TPI Z;  2QV1 A;  1AIX H;  2QCY A;  3VGC B;  4A1T A;  3MWI U;  2ZTZ A;  3P6Z B;  1K22 H;  1GJC B;  2FMJ A;  3HGN A;  1XUI A;  3ZYD A;  2H9E H;  3SI4 H;  3MU0 A;  3M7T A;  2PP6 A;  1L4Z A;  1ZLR A;  3KCG H;  4KTC A;  1EZQ A;  1LO6 A;  1HNE E;  2YMS B;  3VGC C;  5L6N H;  1P0S H;  2C8W B;  5T6G A;  4FUJ A;  1TA6 A;  1C1V H;  4OS4 A;  5EJ1 A;  1HCG A;  1O32 A;  1C2L A;  4K1S A;  1ELD E;  1ELC A;  1HPG A;  1B7X B;  3FKS D;  1YPE H;  1MH0 A;  2ZF0 H;  1J16 A;  3SV6 A;  2FOC A;  1LKA A;  3U8O H;  1EZU C;  1NM6 A;  4YT7 H;  7GCH G;  2FOB A;  2F3C E;  3RXB A;  4Q2K A;  1C5T A;  1YCP H;  2GMT B;  1ANB A;  1Z1I A;  3ZZ3 A;  1T7C A;  4AOQ A;  4WXI A;  5DO4 H;  1WUN H;  1XVO A;  1A3B H;  4Z6A H;  4Y71 A;  5TCA A;  1RGQ A;  1ID5 H;  4XE4 A;  3QWC H;  3FZZ A;  2ZDA H;  1H9I E;  1H8D H;  1W0Y H;  3RXK A;  3D65 E;  2FX6 A;  2BVR H;  1QJ7 B;  1SB1 H;  1ZMN A;  3A8A A;  1O3K A;  1LVY A;  1C5S A;  1QHR B;  5LH8 A;  1ANE A;  3H09 A;  1QL7 A;  3A7W A;  3LGV A;  2QXH A;  3PV5 A;  2VB0 A;  3SV8 A;  1P2I A;  4BTT B;  3ATL A;  2B7D H;  2Z3D A;  2FLB H;  2BD2 A;  4NA8 A;  2XCN A;  3F9E A;  4Y76 A;  1EJM A;  3RUO A;  5T6D A;  4INH A;  2ZWL H;  3UTU H;  1QIX B;  1WCZ A;  3M7U A;  4IC6 A;  4TT3 D;  2BY8 X;  3WWF A;  1EAW A;  3A7Y A;  1A1R A;  1JIR A;  2WPM S;  4X6P A;  1A5H A;  2TRM A;  3VFE A;  1JMO H;  3LJO A;  1TX8 A;  3SU3 A;  2QA9 E;  1AI8 H;  1T8M A;  1K1N A;  3K6Y A;  1LVO A;  5DP3 A;  2VIW A;  2V3H H;  1MU8 B;  2BVS H;  1G2L A;  2FOH A;  4GPG A;  2F9V A;  2GV6 A;  1CGJ E;  2VGC C;  5EJL A;  1GMH G;  1UJ1 A;  4FUI A;  1TAB E;  1C9P A;  1ZHR A;  2FLR H;  4I8G A;  5C1U A;  2BD8 A;  3SW2 B;  1FY1 A;  2A4O A;  1QY6 A;  2PKS C;  2FYQ A;  3ZZ7 A;  2GP9 B;  1E35 B;  3MO3 A;  1SLW B;  3A7Z A;  1Q31 A;  3SGB E;  1YPK H;  3ZIA D;  5K7R A;  1GJ7 B;  2SNW A;  3U8R H;  1EOL A;  4NGA H;  4IS5 A;  1QCP A;  2C8Y B;  2G00 A;  2F9P A;  1LDT T;  4X6M A;  4DUR A;  5FPT A;  4MDS A;  1V2J T;  1BRA A;  1QB9 A;  4ISO A;  2IJD 1;  5ABW A;  2J4I A;  5HIY A;  3T26 A;  2JKH A;  4RI0 A;  2ZFR H;  1DY8 A;  3SYJ A;  1Y3U A;  2IPH A;  1JRT A;  1TX7 A;  3RMM H;  1GBD A;  5EST E;  3MFJ A;  4HFP B;  1H1B A;  1HAH H;  3L6P A;  3Q00 A;  1FI8 A;  5F8Z A;  3RXC A;  3QZQ A;  2Z3E A;  1RIW C;  2BYA X;  3DFL A;  1OWJ A;  2PSY A;  1TX6 A;  2XC0 A;  1SGY E;  3V0X A;  2OK5 A;  2FXR A;  2FO9 A;  5FPY A;  2BY5 X;  3B23 B;  1QTF A;  1AVG H;  1E36 B;  1KTT B;  2BZA A;  4AGJ A;  1ZZZ A;  3RLY H;  1FAK H;  1T8N A;  3A88 A;  3T2N A;  1QRW A;  3UPE A;  1FXY A;  1XUG A;  1CT2 E;  4XBC A;  3VXE H;  3A83 A;  1BUI A;  3VB7 A;  2ZKS A;  1B0F A;  4JYT A;  1F92 A;  1ETT H;  2XRC A;  1TGN A;  2SNV A;  1AWH B;  3BIU H;  1OX1 A;  2B9L A;  1UVS H;  2AMD A;  2J92 A;  3LT3 A;  4DVA U;  1PPZ A;  4DOQ A;  2LNC A;  2SGQ E;  4X6O A;  4MNX A;  1C4V 2;  1AFQ B;  3HPT B;  3N7D A;  4ABB A;  2FTM A;  1O2T A;  8KME 2;  5HXF A;  1FNI A;  1MAB B;  1LKB A;  4B75 A;  3NZI A;  1DWC H;  4X2V A;  2ZI2 H;  2ZP0 H;  1HAY B;  2FYR A;  1LTO A;  3MH6 A;  3LOX A;  1DE7 H;  2KR7 A;  2BLO A;  3SZN A;  5JBT A;  1T4V H;  1PQ5 A;  2V3M A;  5FCK A;  3GOV B;  1FY4 A;  1J14 A;  1IQE A;  4JYV H;  2PUX B;  2FP7 B;  4ACA A;  4D7F A;  1N6X A;  1KY9 A;  1GMD F;  3RXF A;  5FX6 A;  1D6W A;  1BCU H;  5TJX A;  4I31 A;  1NT1 A;  2Z9I A;  4MPW A;  4K8Y A;  1A5G H;  1NS3 A;  5FL7 D;  3CS0 A;  1SHY A;  2FDA A;  3K2U A;  3RC4 A;  5PTP A;  3PTN A;  2TPI Z;  1DLE A;  2XC5 A;  5KED A;  1GJD B;  3I77 A;  1TNK A;  1BQY A;  3F2H A;  3EDX B;  1WXR A;  3UR9 A;  2TGP Z;  1B0E A;  3MTY A;  1UCY H;  2GT7 A;  1GGD C;  3LC3 A;  2Z6B D;  2GKV E;  1AGJ A;  3SNA A;  1SFI A;  2ZCK P;  3F0P A;  4R0I A;  5L30 H;  5TCC A;  1LPK B;  1F5L A;  1O2Y A;  1GDQ A;  1EKB B;  2AS9 A;  3LGI A;  1FY5 A;  3ZZ8 A;  1GBE A;  2JET B;  1BTW A;  1XM1 A;  1ELE E;  1H8E D;  2QAA A;  2RA3 A;  2TBS A;  1YC0 A;  4AOR A;  3RXT A;  3TK5 A;  3STI A;  2SGP E;  2HGT H;  3RC5 A;  2P95 A;  1VZQ H;  3BG4 B;  1GMH F;  1C5W B;  3TU7 H;  4M9F A;  4JMY A;  1EQ9 A;  1HB0 B;  2O8U A;  2UWL A;  4TWY A;  3SU1 A;  2VWO A;  1MKW H;  3MH5 A;  1E0F D;  2AGE X;  3RMO H;  1W14 U;  1ZYO A;  1AB9 B;  5HGG A;  3FVF B;  3GYM A;  2JDI D;  3EE7 A;  1C1N A;  1V2S T;  2P59 A;  1EP5 A;  4ZMA H;  2Y5G A;  4YO9 A;  1UTL M;  3UIR A;  1TRN A;  4AZ2 B;  1DOJ A;  2QXI A;  3Q3X A;  1YM0 A;  1O2N A;  1QJ6 B;  2L74 A;  2Z9G A;  4KTU A;  4B71 A;  4KGA A;  4JZI A;  4X1R U;  3F9F A;  1G36 A;  1SHH B;  1XVM A;  1H8H D;  5B6O A;  2SFA A;  1GI3 A;  3A82 A;  2HLC A;  2J98 B;  1O0D H;  4ABF A;  2O8W A;  4IGD A;  2EA3 A;  3ZVD A;  4Z0K A;  1GI9 B;  1W8B H;  2VVV A;  1Q3X A;  3CNR A;  1LQE A;  4LOY H;  4NSY A;  3SZE A;  1FMG A;  2F43 B;  3KGP A;  1L1N A;  1YP9 A;  4X2Y A;  2B5T B;  1TGC A;  4U01 A;  1EOJ A;  1TIO A;  3SUG A;  2VIQ A;  3VG8 A;  1F0R A;  1AWF H;  1EPT C;  3EA7 A;  4Q7Y A;  1IOE A;  1GI1 A;  3E1X B;  2P93 A;  1THP B;  1MAX A;  1CHO G;  3LGY A;  2KCP A;  3MNB A;  4CRC A;  1K1M A;  4CRB A;  5DP5 A;  2BD4 A;  3F2G A;  5AHG H;  1THR H;  1NPM A;  1JWT A;  1LPG B;  1BHX B;  4WJG 2;  3MOC A;  3MHW U;  1O3H A;  1O3L A;  1JXP A;  5A0B A;  2RDL A;  4FVD A;  1BTZ A;  2VJ1 A;  4ZKO U;  2OBO A;  1BMA A;  1FAX A;  1TA2 A;  1RIW B;  3D23 A;  3R0F A;  2A4G A;  1L1J A;  2AEI H;  1IQI A;  3GDS A;  1O2X A;  1PFX C;  1BIT A;  4FOU C;  1TNL A;  5HM9 A;  5E2P A;  4BAH B;  3SQH E;  5T1V A;  1C5U A;  1MQ5 A;  3PLK A;  5C20 A;  2C8Z B;  1TRY A;  4ZKR U;  2BXU H;  5FCR A;  1MTN C;  1W13 U;  2Q6G A;  1QGF A;  3BIV H;  1IAU A;  5C1X A;  5DKM A;  4ABJ A;  2CV3 A;  4INL A;  1WV7 H;  4ZAE A;  3ATI A;  5EXM A;  1Z8I B;  1GJ6 A;  4MQA A;  1D6R A;  2P3U B;  8EST E;  3S0N A;  2YOL A;  4K3J A;  1EPT A;  5DP7 A;  2G5V A;  2H9H A;  2Z3C A;  1C5L H;  3OEH D;  2Y82 A;  1WQV H;  3MO6 A;  2Y6T A;  4AG2 A;  5C2Z A;  3MO9 A;  1DXW A;  2LPR A;  4JK6 A;  3RXI A;  3AK5 A;  1O35 A;  4INK A;  5EJZ A;  3I78 A;  4JZ1 A;  3SND A;  4F49 A;  5L2Z H;  5CMX H;  1DY9 A;  1O5D H;  1AUT C;  3LGT A;  4EST E;  3EGK H;  1WSS H;  3GCN A;  3PO1 C;  1PYT D;  4DG4 A;  2J34 A;  1UHB A;  1E38 B;  1FPC H;  2OTV A;  4K2Y A;  3R3G B;  1MKX H;  1W0Z U;  1S0R A;  1DWD H;  1YYY 1;  4OS6 A;  4BAQ B;  2GGV B;  2WZQ A;  3KQC A;  1ELG A;  1KLJ H;  2KFW A;  1D9I A;  1YLC A;  4AFZ A;  1QRZ A;  3OSY A;  3TH4 H;  4X8V H;  1FIW A;  2ZHF H;  1HAV A;  1GJ4 H;  1UVT H;  2FM2 A;  1TBQ H;  2C90 B;  1XKA C;  3GY8 A;  3Q3K A;  1C5N H;  2J5U A;  1V2Q T;  2DE8 A;  1S83 A;  4NWL A;  4R8T B;  6GCH G;  3A85 A;  1T4U H;  2BDY A;  1C1T A;  1HGT H;  4YTA A;  1MTS A;  3BTE E;  1TAW A;  3STJ A;  2XBX A;  5DK1 A;  5CE1 A;  1LHC H;  5GCH F;  1AQ7 A;  2QN5 T;  3BN9 A;  1CGH A;  1G9I E;  3GY4 A;  4ZXX H;  4I7Y H;  4Q80 A;  5EGM A;  2ZGC A;  1C1P A;  4I8K A;  4CHA C;  3GCT G;  3MI4 A;  1O38 A;  2FES H;  2XTT B;  1QBO A;  3TK9 A;  4Q7X A;  3ELA H;  4B6E A;  3RXA A;  3S9A A;  4UFF H;  4DCD A;  4FU9 A;  1RRK A;  3QN7 A;  5DN6 D;  5E8E H;  3W94 A;  2W26 A;  3W95 A;  4TSF D;  1L2E A;  3QTV H;  1TPO A;  4MNY A;  1UMA H;  5DP4 A;  1P57 B;  1GI2 A;  1D3D B;  1EST A;  1HYL A;  1O39 A;  1EFR D;  2PKA B;  1K21 H;  2FPZ A;  4ISL A;  3T5F H;  2AGG X;  1KLI H;  3BV9 B;  2GD4 B;  1O2I A;  2VIV A;  2ZTY A;  3F9G A;  4GCH G;  4NA9 H;  3U1I B;  3A7V A;  4X8T H;  1VCP A;  4NZQ A;  5A2M H;  1ESA A;  2OC0 A;  3MNC A;  2ZQ1 A;  4NFF A;  4ABI A;  4CRE A;  1UCY K;  3FO8 D;  5HM2 A;  1AHT H;  4BAK B;  4MPU A;  1C5Y B;  1NBM E;  3A87 A;  1RTK A;  5F53 A;  2ZGJ A;  1O2O A;  3QK1 A;  5A8Y A;  1LHG H;  1IQJ A;  2BOH B;  3L3T A;  3LON A;  1BRC E;  2UUY A;  2VVC A;  1Y3Y A;  3OY5 U;  1OYT H;  3BTG E;  1C5Q A;  1E37 B;  1RS0 A;  4B1T A;  1HV7 A;  2VIP A;  4CRD A;  3ATW A;  1O2P A;  1MBM A;  2PWX A;  1SGF A;  3VB3 A;  5DPA A;  4A6L A;  5IK2 D;  1V2L T;  2CHA C;  1TQ7 B;  1IQK A;  1QBV H;  1KLT A;  2ALP A;  1D4P B;  1DS2 E;  1Y5B T;  2GCT B;  1KYN A;  2ILN A;  5K0H A;  1GI7 B;  1MD8 A;  2AH4 X;  2QF4 A;  1BBR H;  2G81 E;  1RTF B;  4WMF A;  3MU5 A;  3M3T A;  4HI3 A;  2L6O A;  4I8J A;  3M61 U;  1GJA B;  1KXF A;  2ZFT A;  4WH8 A;  3FAN A;  1PQ8 A;  1HAI H;  9EST A;  3A7T A;  5AFZ H;  4H6S B;  2IJO B;  2AIQ A;  2EI8 A;  2G5N A;  2ZHQ H;  4H6T A;  1UO6 A;  1DDJ A;  1V2N T;  4FUF A;  3SHC H;  4NIW A;  1EXF A;  5J4S A;  4UEH H;  1ELF A;  3P8N A;  2HLD D;  1P3E A;  3Q77 A;  1LMW B;  1NFW A;  2FOE A;  2KAI B;  3ZZ4 A;  4AX9 H;  1BTH H;  4I32 A;  3GDV A;  5ETX A;  4WY3 A;  1TPP A;  3JZ2 B;  3NKK A;  2NU4 E;  2OC7 A;  1SKY E;  2KCA A;  4UFD H;  1CQQ A;  1XUJ A;  3S9C A;  4JZF H;  5EW2 H;  1GJ9 B;  1COW D;  2F9B H;  2FOM B;  1ZRK A;  2WPK S;  1BTP A;  1W7G H;  4YLQ H;  1TRM A;  1OYQ A;  5JBB S;  1GGD B;  1AZ8 A;  2O8M A;  1UTP A;  2Z9J A;  3F0O A;  1D3T B;  3MNS A;  5EIY A;  1GHA G;  3S9B A;  4FU8 A;  4KP0 A;  5EQS A;  4WF8 A;  2BDB A;  5GXP A;  3DD2 H;  5I46 H;  2CJI A;  7KME H;  3W1E A;  3AAV A;  1ZPC A;  4B2A A;  4AG1 A;  1ABI H;  3PTB A;  1DM4 B;  3QO6 A;  1GVZ A;  1MUE B;  3BTQ E;  2BD7 A;  4MNV A;  4ABH A;  1V2M T;  7LPR A;  2OQU A;  3RXJ A;  2G4T A;  1S5S A;  3U98 H;  3SGA E;  3ODD A;  1AO5 A;  3WW7 A;  4BAM B;  2Z7F E;  1VJA U;  3SNC A;  4ACB A;  5EQR A;  3MYW A;  1G3D A;  2JH6 D;  1HLT H;  3ZVF A;  1BTU A;  5CDF E;  3FZD A;  4NFE A;  1NC6 A;  4MLF B;  1ORF A;  3URD A;  1FY8 E;  3GY3 A;  4F55 A;  1MU6 B;  1P11 E;  1MMJ N;  2Z94 A;  1JIM A;  2JIZ D;  1GBF A;  1O2H A;  2ZIQ H;  3RMN H;  2ZPR A;  1ARB A;  1EPT B;  1O2K A;  2F9U A;  4RN6 A;  3SV2 H;  4K5Z A;  1C5Z B;  1O5E H;  2F4L A;  1TQ0 B;  2KZ4 A;  1HAZ B;  3BTW E;  1ZRB A;  2ZU4 A;  2DE9 A;  1G3B A;  4FXG H;  1W2K H;  3IG6 B;  3TK6 A;  1E1Q D;  4NA7 A;  2BDH A;  3A89 A;  4A1V A;  3KN2 A;  4OS2 A;  5JPM H;  2PV9 B;  4CH8 B;  2A32 A;  4OS5 A;  3RML H;  1P04 A;  1GG6 C;  1MBQ A;  1UHB B;  1A46 H;  1OHH D;  1A0H B;  1VJ9 U;  3SJK A;  3VB4 A;  2STA E;  3GCO A;  1BMF D;  4Y6D A;  3NPS A;  1F0T A;  1GG6 B;  2O8L A;  1P09 A;  1QA0 A;  2GZ7 A;  4TWW A;  2GJG A;  4BTU B;  3D62 A;  1OP2 A;  4DJZ B;  1P01 A;  1SGR E;  2D8W A;  3IWM A;  1S6H A;  1C1W H;  4GAW A;  4TPY A;  4YZU A;  2PHB A;  1K2I 1;  1G3E A;  1O2Z A;  1HAV B;  2G8T A;  2CF8 H;  1AFQ C;  1C2F A;  1ZGI A;  2Y81 A;  5H4I B;  4FVB A;  1ARC A;  1AMH A;  1HAO H;  1K1L A;  3HKI B;  1OXG A;  1S84 A;  1V6D A;  4FUC A;  4WXV A;  1L4D A;  2A7H A;  4Y7A A;  1HFD A;  1SL3 A;  1WU1 A;  4A7I B;  1QFK H;  3F6U H;  3OE7 D;  4BXS A;  1CA8 B;  1IQH A;  1C5M D;  4D9Q A;  4XOJ A;  4CRA A;  1QQU A;  1DST A;  1ZSJ A;  3A8D A;  4AFS A;  1P2K A;  5FX5 A;  1Y3X A;  1KTS B;  2TGT A;  2ANW A;  3DSG A;  3KHV A;  2J9N A;  1UVP A;  1GI4 A;  3NXP A;  1GHY H;  5DJ7 A;  2OBQ A;  2ZCH P;  4F4O C;  1C5P A;  2WPL S;  2FZZ A;  1ZSL A;  3RXL A;  5C94 A;  2BVX H;  3QZR A;  1P3C A;  2VIN A;  2QIQ A;  3SNB A;  2K8I A;  2VVU A;  3GY2 A;  1HAP H;  2AER H;  1GVK B;  1TOC B;  4VGC C;  1K1P A;  4ZHM U;  1EZS C;  1BHX F;  1YPH E;  1O5B B;  1W3C A;  2BZ6 H;  3GY6 A;  3TGI E;  1KDQ B;  3ZVG A;  3ZV9 A;  4XSK U;  1RD3 B;  3OTP A;  1O36 A;  4IC5 A;  1EP6 A;  4BAN B;  5DP8 A;  4DII H;  3RXS A;  3UR6 A;  1G2M A;  1O34 A;  1SSX A;  1K1I A;  1LHE H;  2FEQ H;  2XBY A;  1UVU H;  1A0J A;  2HOB A;  3BG4 C;  2PKA A;  3QGJ A;  6GCH F;  2RA0 A;  1LVB A;  1QR3 E;  3ZV8 A;  3LC5 A;  1MKW K;  2V0B A;  2WIN I;  1XKB C;  1DWE H;  1Z8J B;  4Q7Z A;  1K1O A;  2WYJ A;  3O8R A;  5EPY A;  1MTW A;  4UDW H;  4XDE A;  4YOG A;  2AYW A;  1VKY A;  4X8S H;  4DY7 B;  4Y8Y A;  2R3U A;  4WVP E;  1TMU H;  2R3Y A;  5A8Z A;  4GHT A;  2H5C A;  1S0Q A;  1QBN A;  1P9U A;  4GVU A;  1EAI A;  4XBB A;  4UFE H;  2QF3 A;  5L2Y H;  1CA0 B;  1Y8T A;  1UTJ A;  2GCH G;  1O31 A;  1V2W T;  1N6Y A;  4Q63 A;  5EOD A;  4K69 A;  1HJA C;  1YF4 A;  2R9P A;  1EAX A;  1TGT A;  5E0J A;  1O3M A;  1SBW A;  3ZVB A;  1GCT C;  1GI6 A;  2NU2 E;  1ESB A;  1ZJK A;  2OLG A;  1O5A B;  3SN8 A;  1O3I A;  1BBR K;  1CO7 E;  5AFY H;  1C1S A;  3Q3Y A;  2BLW A;  3P8F A;  3RXD A;  1SR5 C;  3UWI A;  1TNI A;  4H4F A;  3M35 A;  3PLB A;  4HTC H;  2QF5 A;  2V7Q D;  5LPF A;  2LP6 A;  2VWL A;  2M5T A;  9LPR A;  3VPK A;  1O5F H;  3KF2 A;  1NTP A;  3BTT E;  3N7O A;  4TYD A;  2SGA A;  3LU9 B;  3QTO H;  3QLP H;  1ZHP A;  2QE7 D;  1RXP A;  1NRN H;  4Q4L A;  3A8C A;  1XUH A;  1HIA B;  1P06 A;  1IQN A;  1EJA A;  1SFQ B;  1WTG H;  5BPE A;  4D76 A;  5E0H A;  2I6S A;  2BDI A;  3TJV A;  1DX5 M;  1SPJ A;  1DFP A;  4AN7 A;  5KEC A;  1J8A A;  2KAI A;  1GWA A;  3U9A H;  2PLX A;  3E0N B;  3M5O A;  1XMN B;  2VH6 A;  3AAS A;  1L1G A;  1VCW A;  3HKJ B;  2ZEC A;  5A09 A;  3PMA B;  1KXE A;  1Z1J A;  2WUB A;  1CBW C;  3CS7 A;  4NCY A;  1NES E;  1CVW H;  4OM9 A;  4UFG H;  3A81 A;  2GCT C;  1GBL A;  1EB1 H;  4ZCN A;  5JB9 S;  5DSF A;  4GCH F;  1BRU P;  3ZVC A;  3SJ8 A;  3SUF A;  1VR1 H;  1O3G A;  3PRB A;  4AB8 A;  1LCY A;  3MQK C;  1WTH D;  5B6L A;  1VGC C;  3P8O A;  2WPD D;  1O5C B;  3TIU A;  1MTU A;  1O3P B;  2ZDV H;  1H8I H;  2HNT E;  4NSV A;  1CU1 A;  1EX3 A;  3GDU A;  2ZDN A;  3M3S A;  1O2M A;  3SV7 A;  2RFK C;  1C5X B;  3LGU A;  1LQD B;  2GZ8 A;  1DSU A;  1G37 A;  4XBD A;  3TIT A;  3FFG A;  3L33 A;  2W5E A;  4X6N A;  2IN2 A;  3SV9 A;  2D26 C;  5A0C A;  2ALV A;  3TVJ B;  2BDC A;  1SMF E;  3PRO A;  3URC A;  1KIG H;  1C1Q A;  1TE0 A;  2WPJ S;  1V3X A;  1AD8 H;  1U6Q A;  4FET A;  2H1U A;  4MG3 A;  5G4B A;  5IYT A;  3SJI A;  2J94 A;  4X2X A;  4IN2 A;  4ISN A;  3KYF A;  1DIC A;  1SG8 B;  1G30 B;  3LIW A;  1NBM D;  1SQR A;  4O9V A;  4NWK A;  2HVY B;  1TMB H;  4GUX A;  3RLW H;  1GBH A;  2QF0 A;  1P2M A;  2ZPQ A;  2BXT H;  5E2O A;  1XXD A;  1YGC H;  5EG4 A;  2GV7 A;  2NU1 E;  1YKT A;  3M5M A;  2CGA A;  1ELV A;  2DUC A;  1HRT H;  3DUX H;  2ODY B;  4U30 A;  4B2B A;  1T32 A;  3BTD E;  5LGO A;  4DT7 B;  1SOT A;  1C1R A;  1SGT A;  3SU4 A;  1FIZ A;  2A4Q A;  1GMC F;  3QDZ B;  1PPE E;  2QC2 A;  3QUM P;  4Y7B A;  4MNW A;  1TWX B;  2FOG A;  1C1M A;  3E90 B;  4AFU A;  1Y5A T;  4WWY A;  4ASU D;  2BOK A;  2ZO3 H;  2P16 A;  2ZG0 H;  4ABD A;  2ULL A;  5E0G A;  1UVO A;  5C3N A;  4UON A;  1MTV A;  2FI3 E;  1IQL A;  1NRP H;  3TJU A;  4VGC B;  2WHX A;  1GBJ A;  1TNJ A;  5LPR A;  1ELA A;  3DFJ A;  1E1R D;  1ELT A;  1DUA A;  2XWA A;  1NO9 H;  4DW2 U;  2Z9L A;  5SGA E;  4TY7 A;  1PPG E;  2XW9 A;  2J38 A;  2ZPS A;  1BMN H;  2CN0 H;  2NU0 E;  2FOA A;  1OWE A;  2A5I A;  5DGJ A;  4CHA B;  1GL1 A;  1BOQ A;  1NFX A;  3NRL A;  4ASH A;  3PM3 A;  1CA0 C;  3B9F H;  6EST A;  1O3O A;  2A1D B;  2IPQ X;  1A2C H;  3ATK A;  1PPH E;  3MU4 A;  5C67 A;  3BTK E;  1OOK B;  8GCH F;  3M5L A;  2ZZU H;  1FPH H;  2VIO A;  1ELB A;  3RC6 A;  3RXQ A;  4AYY B;  2VWN A;  1QJ1 B;  3LPR A;  3PB1 E;  2Y7Z A;  2YNA A;  7EST E;  1Q2W A;  1YCP K;  2QXG A;  2HRV A;  1BMM H;  1ZJD A;  3O8D A;  1AKS B;  2GVF A;  3VB5 A;  4DT4 A;  1Y3W A;  1CSO E;  1W12 U;  3EA8 A;  1KXA A;  1GBK A;  1MQ6 A;  3E3T A;  4ZHA A;  5F6M A;  3H7T A;  1PQA A;  1OS8 A;  1A3E H;  1Z8R A;  2XXL A;  4RT1 A;  1SGE E;  1KDQ A;  3MU8 A;  3PWC A;  3AAU A;  3ODF A;  3CEN A;  3MU1 A;  3UNQ A;  5IDK A;  3OYP A;  5LPE A;  1ACB E;  1FQ3 A;  1NRR H;  1V2O T;  2W6I D;  2ZHE H;  1KXC A;  1TB6 H;  1TLD A;  1XUF A;  1BA8 B;  2WSS D;  1GHW H;  4IN1 A;  2Q1J A;  2JJ2 D;  1YLN A;  2VWM A;  8LPR A;  1MTN B;  4AFQ A;  4DGJ A;  1ETR H;  1RTL A;  4J1Y A;  4XFQ A;  5J4Q A;  2ZQ2 A;  2HPP H;  1D3Q B;  1X7A C;  2HPQ H;  1CGI E;  1Z6E A;  4JYU H;  1AE5 A;  2EY4 C;  1GDN A;  3SHA H;  3N7E A;  1BBR E;  3AW0 A;  4NG9 H;  2H2Z A;  4X1S U;  3GYL B;  2G52 A;  2W7S A;  1LPZ B;  1GI0 A;  1C2I A;  2FWW A;  2GDE H;  2A4R A;  2HAL A;  2W6J D;  2B0F A;  2KCO A;  1TBR H;  1GBT A;  1O3F A;  4I8H A;  2XWB I;  1PPB H;  2G51 A;  1ZTJ A;  3VXF H;  1GJ8 B;  1HDT H;  2EQN A;  3BEI B;  2BDG A;  1FON A;  1JOU B;  2STB E;  5FPS A;  3SBK A;  3E16 B;  3N99 A;  2CK3 D;  4X0W U;  3O8C A;  6LPR A;  2O8T A;  4MPV A;  1C5O H;  1WYK A;  4IW4 E;  1FDP A;  1W11 U;  1O2U A;  4BXW A;  1ABJ H;  2D1J A;  5AF9 H;  1ZOM A;  1CT4 E;  1CT0 E;  1OP0 A;  2PSX A;  3RXO A;  1O2V A;  1QL8 A;  7GCH F;  2TGA A;  5GJ4 B;  3RM2 H;  2V35 A;  4CRG A;  1EUF A;  3RU4 D;  3S69 A;  5HYO A;  2EI7 A;  4ZRO A;  1WOF A;  2C3S A;  4O3U A;  2HNT F;  2A2X H;  2XNI A;  1TGS Z;  2WPH S;  1PJP A;  1NU7 B;  1IQF A;  3TPI Z;  2OCV B;  1C2K A;  2Y80 A;  2OP9 A;  1THS H;  1VIT H;  1GI8 B;  1UW7 A;  2KCY A;  1O37 A;  5AVD A;  1AB9 C;  1HIA A;  4YOJ A;  1J15 A;  3KQD A;  3T25 A;  2P94 A;  4ZH8 A;  1P03 A;  2FOD A;  3D49 H;  3OX7 U;  2V3O H;  1MCT A;  3C1K A;  2H9T H;  3OY6 U;  1J17 T;  2RCE A;  1H9L B;  2A5K A;  4CBO A;  1LHD H;  2PR3 A;  1C5V A;  1ZPZ A;  3RDZ A;  4P00 A;  3SUD A;  1FX0 B;  1P2Q A;  4K8B A;  3BEF B;  3EA9 A;  1SGC A;  5C5O A;  3TH3 H;  1GMC G;  1HJ9 A;  3ITI A;  4BAO B;  1J9C H;  3KQ5 A;  4K1T A;  5CHA C;  4LZ1 H;  1SGQ E;  3B8J A;  2F9O A;  3IIT A;  1O2W A;  2RDE A;  2ASU B;  2UUK B;  1TON A;  2A31 A;  1O2G H;  2ZFQ H;  3G01 A;  3RM0 H;  2EST E;  4B73 A;  4ZUH A;  2NWN A;  3F1S B;  2HWL B;  2C93 B;  2YNB A;  3UOU A;  1TPS A;  2VU8 E;  1V2V T;  1QZ8 A;  5GND A;  3KEE A;  5HKK D;  2BX4 A;  4O3T A;  1MD7 A;  3WWB A;  3K9X B;  3UFA A;  3ZZB A;  1KXB A;  1QRX A;  1UTK A;  2VBC A;  4Y0Y E;  5GCH G;  1V2P T;  1SQT A;  4OGX A;  3EYD A;  1FLE E;  3WY8 A;  1OP8 A;  4NIV A;  2YMS C;  4A1X A;  5T3H A;  2BD5 A;  3JZ1 B;  4FUD A;  1Y5U T;  1FY3 A;  1A7S A;  1GHB F;  2W3K A;  4OS7 A;  1Z71 A;  1QA7 A;  2VGC B;  2XBV A;  3P95 A;  4WME A;  1BB0 B;  1NFU A;  1EZX C;  3M7Q A;  1N1L A;  1FJS A;  1GMD G;  3ZZ5 A;  4A5T S;  1DXP A;  1ZTL A;  3HK3 B;  1W10 U;  2BY7 X;  1S82 A;  2KX4 A;  3MH7 A;  1A61 H;  1VGC B;  1YY3 A;  1TNG A;  3LH1 A;  1SGI B;  3M36 A;  2FTL E;  4J2Y B;  3V3M A;  5EPN A;  2XOK D;  1NZQ H;  3OTJ E;  5A8X A;  2AMP A;  3Q76 A;  1IQG A;  3E6P H;  1AVW A;  2ANM H;  2ZU5 A;  2W7U A;  1TAL A;  1LVM A;  4NIX A;  5CHB A;  1GJ5 H;  1ZR0 A;  3T29 A;  2HNT C;  2BTC E;  3EAJ A;  4QT8 C;  1O3A A;  2EI6 A;  2FI4 E;  3GIS B;  3TGK E;  3UNR A;  4E05 H;  1SQO A;  1C2D A;  1O2R A;  3F2F A;  2ZC9 H;  1BJV A;  1P2N A;  1PQ7 A;  2PGQ B;  2AHM E;  2FIR H;  2J98 A;  2Z9K A;  4Y10 E;  5JYI A;  1KXD A;  2BB4 A;  3SI3 H;  5C17 A;  3RU4 E;  3FAO A;  3RXP A;  1P05 A;  1YLD A;  2P8O B;  1DLK B;  5EXN A;  2ANK H;  3S7K B;  4FUB A;  2YMS D;  1GHA F;  3PMB B;  4YOI A;  4JZE H;  3GCH B;  1BTX A;  4HG6 A;  3RXV A;  1DT2 A;  1XXF A;  1AND A;  1TMT H;  2ZGH A;  2UUF B;  2Y7X A;  3BF6 H;  3V13 A;  3ZYE A;  4YXW D;  3LDX H;  4I86 A;  4ISH H;  1INC A;  1MKX K;  4O97 A;  1OSS A;  1ZSK A;  3M5N A;  3TH2 H;  1F5K U;  2PGB B;  3DSO A;  3LKW A;  2ZA5 A;  1DUE A;  4Y8Z A;  1AUJ A;  3ZZ9 A;  4GSO A;  2K1Q A;  2GTB A;  1AKS A;  1XX9 A;  1O2S A;  4GLY A;  4FUH A;  1SLV B;  1O33 A;  2HVX A;  3KQE A;  3OFN D;  1BRB E;  1DWB H;  2TIO A;  4FUE A;  4K60 A;  4X2W A;  3UB0 A;  1D3P B;  1Z8G A;  1F2S E;  2ZTX A;  2ZFS A;  3RU4 T;  4D8N A;  3FP7 E;  1B5G H;  2EEK A;  3KQB A;  4CR5 A;  2BY9 X;  1YWU A;  4H42 U;  4ABE A;  3M3V A;  1FZZ A;  1TFX A;  3SJO A;  3UNS A;  1BT7 A;  1WQS A;  1HJA B;  2ANY A;  5FBI A;  1YCP M;  3SNE A;  1NN6 A;  4I33 A;  2ZDK A;  2F83 A;  1SLX B;  3UWJ H;  3V7T A;  2WUC A;  3PRD A;  4FU7 A;  5F8X A;  2BQ6 B;  2XC4 A;  4ZKS U;  4AC9 A;  4TY6 A;  1V2K T;  4Y11 E;  2I6Q A;  3BEU A;  1DIT H;  3TJO A;  1MAY A;  2BMG B;  3A8B A;  4LXB H;  4AB9 A;  1VIT G;  1UTQ A;  3GCT F;  2QXJ A;  3PYH A;  1ANC A;  1P10 A;  1BTY A;  1K1J A;  4RSP A;  2QGR A;  2JH5 D;  5EW1 H;  1HAG E;  1C2M A;  2AGI X;  1PPC E;  1S81 A;  3FN8 A;  2BLV A;  3T62 A;  3ENS B;  5GIB A;  1CHG A;  5F03 A;  2V6N A;  2FS9 A;  1C2E A;  1H9H E;  4M7G A;  2R0L A;  4X1Q U;  1GCT B;  4MTB A;  6CHA B;  2BY6 X;  2WPI S;  2PTN A;  5JDU B;  3SJ9 A;  1O30 A;  3E0P B;  2SGF E;  3M37 A;  3PV2 A;  3SOS A;  1YPM H;  1H4W A;  3I29 A;  2D2D A;  4MVN A;  2J95 A;  4LZ4 B;  1SQA A;  4AYV B;  4ABA A;  3O8B A;  4YLU A;  5EOK A;  2H5D A;  3HGP A;  3ZZC A;  1K0H A;  3BTF E;  1CBW B;  1AVX A;  4IMQ A;  4DIH H;  1GHB G;  5C1Y A;  5F8T A;  1JRS A;  1BIO A;  1GJB B;  5KGO A;  3CP7 A;  3DA9 B; 
#chains in the Genus database with same CATH homology
 1K0H A;  2KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...