2KX4A

Solution structure of bacteriophage lambda gpfii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tail attachment protein
publication title Phages have adapted the same protein fold to fulfill multiple functions in virion assembly.
pubmed doi rcsb
source organism Bacteriophage lambda
molecule tags Viral protein
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 2kx4A01
2KX4A 1K0HA
chains in the Genus database with same CATH superfamily
1C1TA 1G37A 1JRTA 2AS9A 3N7EA 2ZCHP 1G30B 1P9SA 4AG2A 1K1PA 3A7VA 4BTTB 3LH1A 3AK5A 3ZZ3A 4A6LA 1IQGA 2HALA 5A0AE 1EP5A 3MO6A 4RN6A 1QGFA 2SGDE 1V2MT 5A0BA 1DWDH 4HZHA 3QTOH 1ABIH 1GI4A 1RS0A 2PWXA 3OEHD 1PQAA 4LOYH 3BTME 2Z9JA 3LC5A 4INKA 1CT4E 4CREA 4XSKU 1K9OE 2A0QB 2ZU4A 4IGDA 5IK2D 1AMHA 4FUBA 1PPFE 1O2GH 4FUEA 1BJUA 5A8ZA 3ENSB 3A7YA 3A87A 1MABB 4X1QU 1SI5H 5C0TA 1FUJA 2G81E 4CRBA 4H4FA 2ALPA 2C8XB 2TRMA 4GVUA 1W7XH 1L2EA 2ZPRA 8GCHG 2OC0A 3ATWA 1O2ZA 2AMQA 4CBOA 3Q00A 1C2IA 3P92A 1QA7A 4J1YA 3TK6A 3UWIA 5E8EH 3P8FA 1ZPCA 2H9EH 2G5NA 2LP6A 3BF6H 3PO1B 3TJVA 3OE7D 2GVFA 4ASHA 1K1JA 3GY4A 1TPPA 2V6NA 2ZU2A 1TOCB 1MQ6A 1GI8B 1SLXB 3KHVA 1DFPA 1O2KA 1BITA 1GGDB 1GI2A 2PKAA 5ETXA 4X2XA 2ZPSA 5A2MH 1UTPA 1V2UT 2HLCA 2ZC9H 4BAKB 1AUTC 4I86A 2ZHWH 1SB1H 1HAIH 2CGAA 2OLGA 1CVWH 2P59A 3MU5A 2YMSB 4U30A 1AI8H 3SN8A 2A5AA 2QXIA 3B8JA 4SGBE 1GCTC 4WMFA 2AHME 1Y5BT 1E1QD 3BTQE 1FY4A 2FP7B 1UHBB 3NKKA 3E16B 1EAWA 1G2LA 2FOGA 2XCFA 3RC4A 4INHA 1QJ7B 3D65E 2V3OH 2A7HA 1AKSA 2ZGCA 4IN1A 4ISNA 1UCYH 3TJOA 4JYVH 3SZNA 4GUXA 1GJBB 5DG6A 2CF8H 5HMAA 4LZ4B 1A2CH 4NZLA 4CHAC 3RUOA 5GJ4B 1Y8TA 2ZU1A 2RA3A 2C8ZB 2WPMS 1WUNH 1GBIA 1YC0A 4FUIA 1C5SA 3A8DA 1SR5C 2SGQE 3OY6U 2IJD1 1DDJA 2BDHA 3ZVFA 1WQSA 2LELA 1P2MA 3K2UA 1ZGIA 1AWFH 2FM2A 5FHTA 8ESTE 4NCYA 3FVFB 3P8GA 4ABBA 1TFXA 3LONA 4Q7XA 1HV7A 3P70B 1D3TB 3RXCA 4FUCA 1FN8A 1SGTA 1YLDA 2R0LA 2XW9A 4GPGA 2ZQ1A 1C2GA 4K1EA 4P02A 2O8TA 2EI6A 2J95A 1K0HA 1XUJA 1Q3XA 2BLWA 2WUBA 4XBDA 1K1NA 1V2TT 6GCHG 1GHVH 1P2QA 2YOLA 2AH4X 3SYJA 1SGYE 1GDQA 3T26A 3ZVEA 3UQVA 5FPSA 1ETSH 1OYQA 3LJJA 1LTOA 2V0BA 4R0IA 3T27A 1TMTH 1NS3A 2QV1A 1O3KA 3SV8A 5C17A 2F43B 2ODQA 4ZXXH 3FO8D 1SC8U 1SHHB 4GAWA 4UD9H 1E36B 1DLKB 3VFEA 2AMDA 1O3DA 1TA6A 1MH0A 2VNTA 3A86A 2R2WU 3CNRA 4HTCH 2XWAA 1C1WH 5EXNA 4B2CA 4AYVB 4BTUB 3L3TA 3RP2A 1H1BA 4FUHA 1Z8IB 4Q7ZA 1MTUA 1NRNH 1XMNB 1Z8GA 4UFEH 1CBWB 3BEFB 4TYDA 4RT1A 1C1MA 1Y3WA 3A88A 3LDXH 4B71A 1BRUP 1DLEA 1AZZA 3LGUA 3PRBA 5C5OA 2QY0B 3AAVA 5ESBA 2EC9H 1SGFG 2F9NA 1O2IA 1TOMH 2VWMA 3RU4E 3TH3H 4Y10E 1ABJH 2OP9A 1V2QT 3DSOA 1QBOA 2JH5D 1O35A 2KR7A 2ALVA 4CR9A 3EDXB 1HIAB 3KYFA 1EX3A 2W5EA 1FNIA 3M3VA 2ZDKA 5F8TA 3UUZA 1MTWA 3F9FA 4ZXYH 1K1OA 5DP4A 1YPKH 1FJSA 2G5VA 3CP7A 1C5XB 1NRSH 1C1VH 3QUMP 1D6WA 4XRNA 1O2XA 1OWJA 2QE7D 4E06H 1J15A 1O2VA 1O3PB 2ZO3H 1B0EA 3UWJH 1NM6A 5GIBA 1RJXB 1W0YH 3NZIA 3E8LA 5CDFE 2JKHA 4X2WA 1V2WT 3SZEA 1FPHH 1O5DH 1GG6C 1D9IA 3M7TA 3ZZ4A 5GXPA 4RKJB 1O2TA 1Z1IA 2BVXH 1Z6JH 3M5NA 1MZAA 4AGKA 1H9IE 2UWPA 1PPHE 1NT1A 7GCHF 2OBQA 3FKSD 3UFAA 3HKJB 4CR5A 1TBRH 2ZIQH 3DD2H 3RMLH 1TRYA 4RKOB 1QIXB 3R0FA 3T62A 1JXPA 5DP7A 3KL6A 2THFB 2TIOA 4ASUD 3A81A 4ISLA 2GD4B 3S0NA 2NU2E 6ESTA 2TBSA 1O34A 4OGXA 3S7HB 4F55A 1S81A 2FOAA 2WPLS 1OYTH 1C1RA 2M2AA 3UREA 4O3TA 3OYPA 5JDUB 2O8LA 1W3CA 1Q31A 2BY6X 2CK3D 2ZU3A 1GJ7B 3Q3YA 1MCTA 5T1VA 3VXEH 1FX0B 2Y7XA 3PLPA 3V7TA 5GCHG 5B6OA 5C20A 4DJZB 1GCTB 4I8KA 1TNGA 2GP9B 1TX8A 3QTVH 2W7SA 1GBLA 1GVZA 2ZDMA 1ELEE 4AC9A 1BOQA 1W7GH 4UFFH 4CRCA 1SGIB 1EAUA 4XE4A 4NFEA 4TY6A 3MHWU 1QB6A 1S6HA 3AW1A 2FOEA 4MLFB 4XFQA 1NBMD 2PKSB 3DFLA 2VGCC 5HGGA 5EXMA 1BQYA 1S82A 1O3FA 1C5ZB 4X1SU 2BQWB 4ISIH 1AKSB 2BVSH 2K1QA 1QR3E 3T29A 1AVGH 4WJG2 4O97A 3MOCA 3ODDA 4NA9H 1W0KD 1HB0B 4Y11E 4MVNA 2Y7ZA 2J98B 2Y82A 4CHAB 5SGAE 5EJZA 1H8ED 1TGSZ 3F2GA 3MO9A 1ZZZA 4YTAA 3GY7A 1E34B 1K28D 2IPHA 5EJLA 2J4IA 2UUKB 3A85A 5FBIA 1AFQC 4ISHH 1EP6A 1EAXA 1C1PA 3LPRA 2IJOB 1C5RA 1S6LA 1ZR0A 4NIXA 4AFZA 1GI6A 2GMTC 2WPJS 1AO5A 2A7CA 3UAIC 1HCGA 2J92A 4HFPB 1COWD 1BA8B 1VZQH 3BTDE 1BUIA 2XYAA 1MQ5A 2B8OH 2ZG0H 3LGVA 1HAOH 1HAZB 1ESAA 2BX4A 2UWOA 4X6PA 5FXLA 4YT6H 4JK6A 3LGYA 3QN7A 2SNWA 2STAE 4IC5A 1UTQA 4BANB 2FPZA 2F3CE 5JBTA 2OINA 1MU6B 1O2YA 3GCTG 3L33A 5AVDA 2EY4C 1FLEE 1ZJKA 1IOEA 1NESE 5EOKA 4OS6A 3MWIU 4H6SB 3SJIA 4NFFA 2VIVA 1INCA 1Y3XA 3A83A 1KXCA 1HUTH 3SW2B 3Q3KA 3GISB 1AD8H 2KAIB 4XD7D 1G9IE 2ZFFH 4DIHH 3RC6A 3W94A 4DIIH 4MPWA 3TH4H 4DCDA 1UHBA 1YCPH 5F03A 3T25A 1BMNH 1DSUA 4WY3A 1A3BH 2CV3A 2Y5FA 5DN6D 1TPOA 1C2MA 1NROH 1RRKA 1YLCA 1DS2E 2Z9IA 1L1GA 1ZRBA 4CH2B 3BEIB 3SV6A 1XKBC 1KXAA 2FYQA 1PPZA 2C8YB 2GCTC 5FX6A 2AGGX 4O9VA 1VCWA 1ACBE 1GHXH 1GBTA 2PP6A 5EQQA 4NA8A 2G51A 2Z6BD 1O2JA 3RM2H 3U8OH 1SQOA 2PUXB 1Y59T 3JZ1B 2J9NA 3ZVAA 5C3NA 1O3AA 1CHOG 1HJ9A 2ZFPH 4B6FA 4NG9H 1SKYE 2RG3A 3SUEA 3SOSA 5CMXH 1MKXK 5AF9H 1XXFA 2GKVE 1PYTD 2W6ID 4U32A 3D49H 1TGBA 1OX1A 1K1LA 3E1XB 3M3TA 2UUFB 1A0JA 2OQ5A 4BTIB 1P3EA 1GI5A 4ZHMU 2CXVA 1MKWK 1MD8A 1VGCC 2IOTA 4U01A 2JJ1D 1PQ8A 1W11U 2A5IA 2O8MA 1GJ9B 1ZTJA 1XUHA 4K1SA 3WWFA 1GG6B 1TRMA 5FL7D 4BAQB 2FOMB 1O5AB 3U8RH 2ZHEH 1LPGB 3GICB 3RXLA 2KCOA 2TGPZ 3HK3B 1GJDB 1BCUH 2F9VA 1H8HD 1MU8B 1C1NA 3RXAA 2JIZD 4A1VA 1ETTH 1HNEE 3GCOA 4MG3A 1CE5A 1GHBF 5DJ7A 1LVYA 1KTSB 1LHFH 3H7TA 2W6JD 2ODPA 2QC2A 2YNBA 3U8TH 1O3CA 1QZ8A 5IYTA 1HAHH 3PM3A 1SBWA 1GMHF 4X8UH 3NPSA 3FZZA 4OS7A 3O8CA 1SOTA 1RFNA 3SBKA 1DY9A 3QLPH 3MH4A 1TGTA 4A1TA 1T8LA 2ZGXH 2ZTYA 2XC4A 3TGKE 2GT7A 1AE5A 1E1RD 1LVOA 4TT3D 1NY22 2AFQB 2GJGA 3E0NB 2Q6FA 1KXBA 3U98H 2ESTE 4OS2A 3ITIA 4I31A 1OP2A 3F1SB 3HATH 1O2LA 1HDTH 2FI3E 3WWBA 4ACAA 5BPEA 1EATA 1HIAA 2A45B 1C1QA 3T5FH 1RD3B 5DP8A 2BTCE 3M37A 3URDA 1TE0A 2J34A 1BRCE 3ZZ9A 2PTNA 1ELVA 3UNSA 2GDEH 2Z94A 4Y0ZE 3PMBB 2OBOA 1GL1A 2QGRA 1VCPA 2LNCA 2VGCB 4BNRA 3ESTA 4ZKNU 2JDID 1ELBA 1C4Y2 1OOKB 1KYNA 2J2UA 1K1MA 4NZQA 1D3QB 4D8NA 5IDKA 1EZXC 3EQ0H 1HLTH 2ZKSA 3QO6A 2OC7A 5HIZA 3UR6A 3SU3A 2CF9H 4DG4A 5A8XA 1ANBA 2BY9X 1GPZA 1C2EA 4KELA 5FCRA 2ZFTA 4GCHG 4XBCA 1TNHA 3SI3H 1V2KT 2QA9E 4SGAE 3RDZA 3MH5A 2KX4A 1O2PA 5LPFA 2J97A 2HPQH 3GYLB 2KCYA 4UFGH 1YGCH 3A84A 5J4SA 2VVCA 2XC0A 3E91A 4YOIA 1AFQB 2AGIX 2KZ4A 3UNQA 1ZTKA 4DGJA 3GS9A 1NN6A 1H8DH 2ZDAH 2BD2A 4X8SH 2GMTB 2TGAA 1O3MA 4ABJA 1WYKA 2FYRA 3FP6E 3SORA 1Z71A 2O8UA 1ZMLA 1FXYA 2P8OC 3OEED 3MNXA 1KSNA 1ZPBA 4I32A 2GCHG 4VGCC 2Z9LA 4WXVA 1S0RA 1O2HA 1KLTA 4TSFD 1LQEA 2FEQH 1GMDG 3FN8A 3I77A 4INLA 2Q6GA 1E35B 2ZFRH 1O30A 4JK5A 4KP0A 1BMFD 4CRGA 1SOZA 1O2RA 3CENA 5DP3A 2FTMA 2Q1JA 3KNXA 1TQ0B 1W12U 3E6PH 1V2ST 5ABWA 1GJ6A 2BX3A 1XUFA 2K8IA 1FV9A 3RXSA 2PGBB 3GYMA 5BRRE 4AOQA 1LVBA 4FUJA 3RXRA 1WV7H 3KQEA 3VB6A 1Z7KA 5T6FA 3KCGH 1Z1JA 1J17T 2OK5A 4GLYA 1GBDA 2PHBA 4ABDA 1TPAE 1DXPA 1DX5M 4UONA 1UTLM 2BOHB 5DO4H 4Y7AA 2VB0A 2FI5E 2Z9KA 4X0WU 3SJOA 2ZPQA 1FONA 1FY1A 1QL9A 2G4UA 7ESTE 3NXPA 1LVMA 2HLDD 1HBTH 3A7XA 3O8RA 2KM0A 4J2YB 1MTNC 3OX7U 2PKSC 1RGQA 3PYHA 1V2PT 4FVDA 3GY8A 1VKYA 1LQDB 1GBEA 3SU1A 1QL7A 3KQCA 2PFEA 2GCTB 1AE8H 2ZECA 2ZF0H 2J98A 4IW4E 2AIQA 3TK9A 1P2JA 8GCHF 2W26A 2FTLE 5I25A 1LO6A 3F0PA 5T3HA 3VGCC 2P3TB 2AEIH 2QF5A 1YF4A 4K2YA 4BXWA 3EA8A 5F53A 1YBWA 3MNCA 3PLKA 1GI9B 4YO9A 1GBMA 1SG8B 1TBQH 1CU1A 3ZZBA 1HAGE 3GCHC 1UTNA 4GHQA 3ZZ6A 4OS5A 2TGDA 3P8NA 1T4UH 2BY5X 1G3DA 5JB8S 1O36A 3MO3A 2FLRH 3TVJB 1F5KU 1VGCB 3G01A 1EZUC 3N99A 4HG6A 4YM9A 1GJCB 1N6XA 3IG6B 3ODFA 2F9OA 4HI3A 2P3UB 4JZ1A 5HYOA 1YM0A 1BTXA 1LHEH 1YPJH 2A4GA 1CA8B 3PLBA 1CQQA 2BDYA 2BY8X 1P8VC 1C5YB 4TWYA 1BHXF 2AGEX 3MH7A 3ZVDA 5EQRA 4YOJA 1PQ5A 2JETC 4I8LA 2ZI2H 4K1TA 2VWNA 3DSGA 1ZYOA 1GBHA 3SGQE 4Q80A 2KAIA 4DY7B 2FS9A 1HAYB 2ZHDA 2GT8A 1A0LA 2WV5A 1AU8A 4Q4LA 2H6MA 2GGVB 1CHGA 4Y71A 2XBWA 3MU1A 1GBJA 1GI3A 3OAAD 2FWWA 3SJ8A 1SPJA 1P03A 1WSSH 3BN9A 1CSOE 1ESTA 2B5TB 4XOJA 1MTSA 1E0FD 3RMOH 4Y79A 1SGQE 1HAVB 1E79D 2F83A 1C5UA 4MNXA 3IWMA 4WF8A 2Y5HA 1P2NA 4K3JA 4NIYA 3TLOA 5EJ1A 1AN1E 1G2MA 1GVKB 1P11E 3P6ZB 1OS8A 4B6EA 5C0UA 2ZTXA 1AUJA 2BDBA 5KECA 1C2LA 1ZHMA 5JB9S 3DFJA 5LPRA 6GCHF 1J14A 1DITH 4Z0KA 3M7QA 4R8TB 2Z3DA 2H1UA 5A09A 5K0HA 1GHAG 1A5IA 1T8MA 3RU4T 2W7UA 4NWKA 2OCVB 3P17H 4XDEA 3M5MA 4A7IB 4FUDA 5TCCA 3ZZ7A 5C1YA 3RMMH 2BD4A 1H9LB 1B5GH 1O5GH 2G55A 3TGIE 2TPIZ 2V3MA 1WTGH 1ZMNA 1DY8A 1QQUA 2BD9A 2F9PA 4FU9A 4X6MA 4FUGA 2WINI 4WH8A 5AFZH 2WPDD 1BTHH 4X1RU 4F4OC 1ZSKA 4A5TS 3SJ9A 4CBNA 1JWTA 3D23A 3SU4A 1O3BA 3NRLA 1GI0A 1UVPA 1EFRD 3RXMA 4K5ZA 1FI8A 1S85A 1QB9A 2XNIA 1QJ1B 4BXSA 2Y80A 4ABIA 4ZUHA 1BIOA 3GDUA 3QZQA 1QNJA 1SGDE 5DK1A 3RC5A 1CGJE 2FOBA 4PROA 1E37B 1UK2A 1UTOA 1ELFA 4WVPE 2VBCA 1YPGH 2PTCE 1MCVA 3ZV8A 2P8OB 1FAXA 1C5PA 1C5VA 3GDVA 2BHGA 4AX9H 3KYGA 4VGCB 3VPKA 4NGAH 6LPRA 1DPOA 1TX7A 9ESTA 1EJNA 2BD7A 2ZQ2A 1W10U 1EUFA 4IMQA 3RXIA 3QX5H 5GWZA 2ZDVH 4K60A 1VCQA 1CO7E 1QY6A 2ZWLH 1A46H 4X8TH 4AB9A 1ZLRA 2BD5A 9LPRA 2FZZA 3ZYEA 1HXFH 3MMGA 2OC1A 1F5RA 1O0DH 3RXVA 2GZ8A 2XBYA 1SHYA 3JZ2B 1BB0B 3LT3A 1UTMA 3CS7A 1MAXA 3FOAA 3UIRA 1ORFA 4MNYA 3BG4C 2QF3A 3BTGE 3RXTA 3SU0A 4H6TA 2WHXA 3SNDA 3OU0A 2R0KA 1UK4A 1W8BH 3U1JB 4WWYA 1ELCA 2PW8H 3BIUH 1CT2E 2CHAC 1MTNB 1AQ7A 1KY9A 2A4QA 3KEEA 3UY9A 2QIQA 1UVTH 4D9RA 1D4PB 3PMHB 4TPIZ 3TU7H 1ZPZA 2WYJA 5CHBA 1FY3A 1DUEA 3BV9B 5EU8A 1D3PB 1SLVB 3PTNA 1EQ9A 5JPMH 3O8BA 3DSPA 2I6QA 2R2MB 1KTTB 2ZFQH 3VGCB 3DUXH 1BBRE 1KXFA 2HPPH 1ZSLA 3PWBA 1YPEH 4B76A 3EA9A 3SV2H 1QA0A 1V2OT 2HGTH 4K8BA 2OUAA 2VH6A 3M36A 2F9BH 2ANMH 1HJAC 4CRAA 2BLVA 3GCHB 1D3DB 3HGNA 3S9CA 3PTBA 3A8CA 1EOJA 2W3KA 1KXDA 1RTKA 3MFJA 3A7TA 2J5UA 1XKAC 1YPLH 4OS4A 2BDIA 2FI4E 4ISOA 1FAKH 2DE8A 3W1EA 1KMHB 5GCHF 2D1JA 1LPZB 2G8TA 1PYTC 4ZAEA 3RMNH 3SJKA 2HRVA 3M61U 1GDNA 1ZHPA 1YYY1 1TMUH 4XBBA 2BQ6B 1VITG 4AFQA 1H4WA 1ZRKA 1O3NA 5F6MA 2WZQA 2C90B 1IQEA 1F7ZA 3MNSA 2NU1E 1O37A 5T6DA 2JETB 3K9XB 3RXBA 1SFQB 2WSSD 1AWHB 3B9FH 5B6LA 2AYWA 1QBNA 1OPHB 3K65B 1WDIA 3EA7A 4TY7A 4RT0A 2G00A 1IQNA 2BZ6H 3MTYA 2JJ2D 3ATKA 1FY8E 1AIXH 1VR1H 1L0ZA 3ZZ8A 4OS1A 1C5QA 1GBBA 1OWDA 4ZHAA 3E90B 3HK6B 3VG8A 1NTPA 4BAHB 2Z7FE 3ZIAD 1QRXA 1G32B 5DP5A 4MQAA 1V2VT 5A0CA 5HM2A 4A92A 2D8WA 2A4RA 1S83A 3UB0A 1GBFA 1O3HA 4RSPA 1O2NA 1HAXB 5FX5A 3M3SA 1GBCA 1C1UH 1BTWA 1TNJA 4JZDH 2BQ7B 3UR9A 1OKXA 3DHKH 4ABAA 1C2JA 1MUEB 1YKTA 2A5KA 4E7RG 3ZYDA 1W14U 4AFSA 2C8WB 3SNEA 3F9EA 1QBVH 1F0RA 3KQBA 1SGEE 1W0ZU 3RLWH 3WY8A 1UJ1A 2SFAA 4Y7BA 2VWLA 1P12E 3SV7A 1QFKH 1QURH 1T8OA 3AASA 1YY3A 1EKBB 3SI4H 2IPQX 4X2YA 4D7GA 2IN2A 3GCTF 2ZP0H 2BB4A 1IQFA 3F2FA 1C5MD 4HGCA 4KTCA 2VJ1A 3Q76A 1NFWA 1T31A 1L4ZA 4DT7B 1UCYE 2SGFE 1XXDA 3MI4A 3OY5U 3BTEE 1EPTB 2J38A 2YNAA 1UO6A 2QXHA 1BBRK 1CGIE 4IS5A 4ZHLU 1DOJA 2H5CA 2UUJB 3DA9B 3T2NA 5EG4A 2PV9B 1GWAA 2ZCLP 3UOUA 1DM4B 4LK4A 4UE7H 4X6OA 2PSXA 1KXEA 1PPGE 3TNSA 1Z8RA 3LJOA 3QWCH 2GTBA 2XC5A 1BT7A 3K6YA 1O3EA 3ZZDA 1P2KA 1UW7A 3GY5A 2FS8A 1O2OA 4Z1MD 4ESTE 3GCNA 1ZMJA 2ANYA 3F6UH 3VEQB 1BHXB 3MH6A 3RU4D 1FN6A 1GI1A 1WCZA 4B1TA 1GMCG 2GZ9A 1O3JA 1UVSH 3LIWA 1O2SA 1EAIA 1C5LH 1OSSA 3ZVCA 3SNAA 4WH6A 1WOFA 3PV5A 2EQNA 1GBKA 3A82A 2RFKC 3NK8A 3SQEE 5EGMA 2VH0A 2VVVA 1BTPA 1SGNE 2YMSD 3I78A 1OP0A 1CHOF 1HAVA 1PFXC 4JMYA 1SGPE 2BXUH 2H9HA 4NSYA 1DE7H 1G3EA 1P10A 2JH0D 1MZDA 1O2UA 3H7OA 3KIDU 1TGCA 3TPIZ 1XUKA 1IQLA 1RTFB 1ELGA 1Q2WA 2WV4A 2CMYA 1JMOH 3BTHE 1F92A 1P2OA 1YCPM 2FXRA 1FIWA 3BG4B 3QDZB 1T7CA 3ZVBA 3K6ZA 1QCPA 1ANCA 3SNBA 3WW7A 4MPXA 2FODA 3UTUH 2I6SA 1F0TA 4TPYA 2A4OA 1EJMA 1GJ5H 1P01A 1O33A 2PLXA 3RXDA 1WAYB 4P00A 3NUMA 4AB8A 1NO9H 1IQHA 2GX4A 3A8BA 4TWWA 1NRQH 3BTTE 5C94A 1EZSC 2CHAB 3Q77A 4ZH8A 4NWLA 1MKXH 2ZNKH 1MBQA 1VJ9U 1ZOMA 6CHAC 1F0SA 2EI8A 1IQMA 2NU4E 1QB1A 5HM9A 1VITH 4YESB 1P04A 3QGNB 2FIRH 1UTKA 3I29A 5GNDA 1MKWH 2A7JA 2HVYB 2A31A 1HRTH 4Q2KA 1C5WB 3OFND 4Y8YA 5DGJA 2RCEA 3ZZCA 3A80A 4FXGH 2HNTF 5EODA 2PGQB 1ESBA 1AFEH 1BRAA 1LPKB 2SNVA 3BG8A 1TLDA 2ZDLA 1UCYK 1HJAB 4DVAU 5J4QA 5KGOA 5C67A 3RXEA 2HWLB 1P3CA 4GSOA 2BM2A 1NFYA 3FZDA 5JBCS 3EGKH 5C5NA 1DWBH 5C1UA 3NCLA 5LH8A 2FLBH 2SGEE 3PV4A 1ETRH 4YLUA 3KQ5A 1L4DA 4M9FA 3VXFH 2ZHFH 3A89A 2W3IA 3QZRA 4F49A 5G4BA 1TNLA 3A8AA 4B74A 1NBME 2ULLA 1JIRA 2BD8A 2B9LA 4ZKSU 3LGWA 5FPYA 4LZ1H 1C2DA 5AFYH 3EAJA 3P95A 5DKMA 1GI7B 4KTSA 4FU7A 2J94A 1J8AA 3Q3XA 4WXIA 2WPIS 4AG1A 1TNIA 1TIOA 4OGYA 2NU3E 3F9HA 1LHDH 2KFWA 4YZUA 1TQ7B 3FFGA 1V2LT 2Z9GA 4X1NU 2BOKA 2D26C 2V3HH 3ATMA 4CRDA 1OWIA 3TH2H 2BLQA 1W2KH 2OTVA 3F9GA 4GCHF 1NRRH 4FOUC 2VINA 1K2I1 2QF0A 1DSTA 3E0PB 4X8VH 3HPTB 3MNBA 3VB7A 1NC6A 1ARBA 1Y3UA 1O39A 1ZJDA 1DANH 2WV9A 1DXWA 3PV2A 2ZCKP 1MBMA 2LPRA 1TA2A 5CE1A 3KF2A 2BLOA 2BZAA 1NPMA 1ZHRA 1S6FA 3UQOA 4FVBA 4Y6DA 3A7ZA 2GCHF 3FANA 2FOHA 2F4LA 1YPMH 3RXJA 1LHCH 1V2NT 3ATLA 1GMDF 3VB5A 4A1XA 5DP9A 4THNH 2EEKA 1EB1H 3FAOA 2WYGA 1ZGVA 1V3XA 2BXTH 2ZTZA 2KCPA 4DOQA 1DUAA 3ELAH 1O38A 1BJVA 4MTBA 4BAOB 3F68H 1C2FA 4Y76A 2HNTC 1TB6H 1RXPA 1K1IA 4ZMAH 3BTFE 2FX6A 4JYTA 1SLUB 3N7DA 2A2XH 2R3YA 1O2WA 1EZQA 4BOHA 1TWXB 1PQ7A 4O3UA 1W13U 1BTUA 1SL3A 4ABEA 4I7YH 2F9UA 1YPHC 1S5SA 3PROA 4AZ2B 1BDAA 3MYWA 4LXBH 5EW2H 3ZV9A 5L6NH 1CA0C 1IQKA 1BMLA 5F8ZA 1N8OC 2EA3A 3GY6A 1SQRA 3AW0A 1C9PA 2VIQA 3PMAB 3QK1A 1BRBE 2XCNA 1KLIH 4AN7A 1GJ4H 1MD7A 5FCKA 2Z3CA 4RI0A 5JYIA 3E3TA 4AYYB 1QL8A 1BZXE 1ARCA 1SLWB 2H2ZA 1KDQB 1P9UA 2BYAX 1XVMA 5A8YA 1TNKA 4Y8XA 3FP8E 3M7UA 3OTPA 4Q63A 2R3UA 1N1LA 1AB9C 3SUDA 2XTTB 2BDGA 3UOPA 2HOBA 2XXLA 3ZZAA 1A5GH 1O3GA 1P09A 1VJAU 4I8JA 1IHTH 5F8XA 3PMJA 1DICA 1C2HA 4D7FA 4I8HA 1ELAA 1P2IA 1Y5AT 4CH8B 2AIPA 3S9AA 3L6PA 1V6DA 3U1IB 3S9BA 2R9PA 1RIWC 2FO9A 5E0JA 4AORA 4UFDH 2ASUB 3RM0H 2OQUA 3PWCA 4NA7A 1F0UA 3BSQA 2ANWA 1FPCH 2FOFA 4ABFA 3M35A 5T6GA 2ZA5A 1A61H 1T8NA 1C4U2 3H5CB 5FPTA 1K22H 1O3LA 1HYLA 1TGNA 1PPBH 3TK5A 1YP9A 1EOLA 1J9CH 3SGBE 7GCHG 4F48B 5DPAA 1GL0E 1A5HA 1FY5A 1AY6H 3S7KB 1B0FA 3V3MA 1Z8JB 4JCNA 1QRZA 2FDAA 6CHAB 4B2AA 1ANDA 1O2MA 3MU0A 2QN5T 4IN2A 1EPTA 1GJAB 3SUFA 3LGTA 1ZTLA 3T28A 2ZFSA 1EPTC 3VB4A 3TGJE 4IBLH 1DWCH 1DWEH 1IHSH 3SU2A 2TGTA 3LKWA 3MU8A 3F3BA 3PRDA 3BIVH 1ANEA 1C9TA 1MAYA 5E2PA 3SUGA 1P02A 1OP8A 2A32A 1HAPH 3RXHA 2VIDA 2P93A 1JRSA 2QAAA 3FP7E 2K0QA 4AFUA 2ZHQH 5JBBS 3V12A 1QJ6B 1YLNA 2AERH 1C2KA 4DW2U 3STIA 3C1KA 2QXGA 4ZCNA 4IMZA 3F0OA 8KME2 2OC8A 2Z3EA 1TYNA 4B73A 4ABGA 1A4WH 5CHAC 4UDWH 2G52A 3GDSA 1S84A 1JOUB 1AHTH 2VIOA 1QQ4A 3BTWE 3V0XA 1HXEH 3S69A 1GHAF 5EXLA 2GZ7A 5C2ZA 2ZGBH 2QYIA 7LPRA 1FMGA 5KEDA 1NU9A 3C27B 5LGOA 5LPEA 3RXQA 5PTPA 2OXSA 2XWBI 2ZU5A 5E0GA 5K7RA 7KMEH 2DE9A 1T4VH 1B7XB 3CS0A 3HGPA 5E0HA 2XRCA 5GPIB 3SV9A 1AVWA 4K69A 1HPGA 1XVOA 3LOXA 5C1XA 3P8OA 2XOKD 2ZGJA 5HXFA 4DURA 2XBVA 3RXOA 4I33A 1PJPA 1LMWB 2L74A 2B0FA 1C4V2 2A2QH 2WUCA 1MTVA 1OXGA 2ZEBA 1L1NA 2UWLA 1TX6A 1IAUA 4YLQH 1MMJN 3RXKA 2PKAB 1TPSA 1AGJA 5FBEA 1C1SA 5L2YH 2FX4A 4FU8A 2V35A 5L2ZH 2ANKH 1YCPK 2RDLA 2GV6A 4ZROA 2B7DH 3GOVB 2BVRH 1Y3VA 1C1OA 3BTKE 3HKIB 4FETA 1Z6EA 2D2DA 1YWUA 2P95A 3OTJE 4WMEA 4JYUH 2ODYB 5FAHA 2AMPA 1BMAA 1XX9A 2M5TA 1A3EH 1GCDA 1G3BA 2CN0H 1OWEA 1O31A 1BMMH 2JH6D 1TAWA 1C5OH 4DT4A 2BDCA 1BTYA 5E2OA 3D62A 3M5LA 1OWKA 2H5DA 1M9UA 1WXRA 5DP6A 2QXJA 1O5BB 2P94A 1C5TA 1SGFA 4GHTA 3RXUA 1O5CB 1X7AC 5EQSA 3RLYH 1EJAA 1O3OA 1SQAA 2KCAA 4JZEH 3B23B 1FZZA 1DVAH 1C5NH 1K21H 1UK3A 4YT7H 1UMAH 2HVXA 2P16A 3EE7A 1THSH 1PPEE 1SMFE 1TBZH 4QT8C 1SVPA 2G4TA 1N6YA 1GHWH 1CT0E 5HIYA 1CA0B 3LH3A 2VIPA 4MNWA 4NSVA 1WU1A 1A0HB 1N8OB 4KTUA 2C93B 3TJUA 1EB2A 3MQKC 1WBGB 1TALA 2Y5GA 2F91A 2BDAA 3ZVGA 1PPCE 3V13A 1GVLA 3OSYA 1O2QA 5AHGH 3UPEA 2BY7X 2Y81A 4KKDA 3RXFA 5DSFA 2RA0A 4JZIA 4OM9A 2WPKS 1ELTA 1NFXA 1A1RA 1AB9B 2C4FH 1SSXA 4E7NA 1RTLA 1OWHA 2FESH 1S0QA 1U6QA 1Y3YA 1L1JA 1GDUA 1QTFA 3EYDA 3PO1C 3QGJA 5EPNA 1O5FH 1AVXA 2A1DB 4Y8ZA 3TJNA 3EE0B 1GGDC 4Q7YA 1V2JT 4X1PU 4JZFH 1RIWB 2VIWA 1NU7B 3SHAH 1TABE 3KGPA 2WPHS 1H8IH 3PB1E 1SFIA 2P3FH 2NU0E 3GY3A 2DUCA 1GBAA 3AAUA 4I8GA 2YMSC 1W0JD 1JIMA 1GHYH 4BAMB 1WTHD 2BD3A 1LHGH 1SQTA 1TONA 3U9AH 4FUFA 5TCAA 1KLJH 1UVOA 2PSYA 2PUQH 2STBE 1F2SE 1V2RT 1GJ8B 4MDSA 5EPYA 5HKKD 2SGPE 1VITF 3TIUA 1A7SA 3LGIA 3SU5A 1D6RA 1LKBA 5H4IB 1EASA 2GV7A 2FMJA 2OD3B 1GHBG 4X2VA 1P05A 1LDTT 4B2BA 3SO3A 4ACBA 1FDPA 2NWNA 5ESTE 3GY2A 1EXFA 1GMHG 2XNDD 1O3IA 1G36A 1P0SH 4B75A 1KIGH 1Y5UT 1G3CA 4ZKOU 4KGAA 1THPB 4Y0YE 2UUYA 1GHZA 3KQDA 3F2HA 1FQ3A 1BTZA 4MPUA 2L6OA 5I46H 3TNTA 1HJ8A 3SU6A 3ATIA 3LC3A 3DCLA 2XBXA 2O8WA 3RXGA 4H42U 2ZGHA 3UNRA 4ZKRU 1TRNA 5GDSH 1KDQA 1FIZA 2HNTE 2SGAA 2VWOA 2RDEA 3SNCA 1SGRE 1UVUH 1P57B 3KN2A 4M7GA 1F5LA 5CHAB 8LPRA 1O32A 1TMBH 2O9QA 1CGHA 1NZQH 1YPHE 1NFUA 3DT0H 1XUIA 3LU9B 4NIVA 1QHRB 1WQVH 4IC6A 1O5EH 1XM1A 3R3GB 2Q6DA 2Y6TA 1E38B 4CRFA 4YXWD 5JBAS 3U69H 3MU4A 2ZDNA 2GDDA 4U2WA 2ILNA 4E05H 1HGTH 3SHCH 2QF4A 1IQIA 2BMGB 4YOGA 1OHHD 3A7WA 1ID5H 4X6NA 2V7QD 5EIYA 3SGAE 1T32A 4MPVA 1SGCA 3URCA 3ZZ5A 1CBWC 1QRWA 4AGJA 1THRH 1NRPH 3BEUA 1LKAA 1UTJA 2VVUA 4UEHH 1DT2A 3STJA 5L30H 2PR3A 1AZ8A 1JBUH 2H9TH 3W95A 3SQHE 3M5OA 5EW1H 3VB3A 4ABHA 3O8DA 1IQJA 2CJIA 2QCYA 4O03A 3AVZA 2ZZUH 4K8YA 4NIWA 4WMDA 1J16A 3TITA 4D76A 3N7OA 3NWUA 3U28C 1ELDE 1LCYA 1XUGA 3IITA 5TJXA 1GMCF 3H09A 4Z6AH 2C3SA 2VU8E 2FOCA 2EI7A 1HFDA 3RXPA 1P06A 4MNVA 1BBRH 1ZSJA 4D9QA 1H9HE
chains in the Genus database with same CATH topology
2KX4A 1K0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX4 A;  1K0H A; 
#chains in the Genus database with same CATH topology
 1C1T A;  1G37 A;  1JRT A;  2AS9 A;  3N7E A;  2ZCH P;  1G30 B;  1P9S A;  4AG2 A;  1K1P A;  3A7V A;  4BTT B;  3LH1 A;  3AK5 A;  3ZZ3 A;  4A6L A;  1IQG A;  2HAL A;  5A0A E;  1EP5 A;  3MO6 A;  4RN6 A;  1QGF A;  2SGD E;  1V2M T;  5A0B A;  1DWD H;  4HZH A;  3QTO H;  1ABI H;  1GI4 A;  1RS0 A;  2PWX A;  3OEH D;  1PQA A;  4LOY H;  3BTM E;  2Z9J A;  3LC5 A;  4INK A;  1CT4 E;  4CRE A;  4XSK U;  1K9O E;  2A0Q B;  2ZU4 A;  4IGD A;  5IK2 D;  1AMH A;  4FUB A;  1PPF E;  1O2G H;  4FUE A;  1BJU A;  5A8Z A;  3ENS B;  3A7Y A;  3A87 A;  1MAB B;  4X1Q U;  1SI5 H;  5C0T A;  1FUJ A;  2G81 E;  4CRB A;  4H4F A;  2ALP A;  2C8X B;  2TRM A;  4GVU A;  1W7X H;  1L2E A;  2ZPR A;  8GCH G;  2OC0 A;  3ATW A;  1O2Z A;  2AMQ A;  4CBO A;  3Q00 A;  1C2I A;  3P92 A;  1QA7 A;  4J1Y A;  3TK6 A;  3UWI A;  5E8E H;  3P8F A;  1ZPC A;  2H9E H;  2G5N A;  2LP6 A;  3BF6 H;  3PO1 B;  3TJV A;  3OE7 D;  2GVF A;  4ASH A;  1K1J A;  3GY4 A;  1TPP A;  2V6N A;  2ZU2 A;  1TOC B;  1MQ6 A;  1GI8 B;  1SLX B;  3KHV A;  1DFP A;  1O2K A;  1BIT A;  1GGD B;  1GI2 A;  2PKA A;  5ETX A;  4X2X A;  2ZPS A;  5A2M H;  1UTP A;  1V2U T;  2HLC A;  2ZC9 H;  4BAK B;  1AUT C;  4I86 A;  2ZHW H;  1SB1 H;  1HAI H;  2CGA A;  2OLG A;  1CVW H;  2P59 A;  3MU5 A;  2YMS B;  4U30 A;  1AI8 H;  3SN8 A;  2A5A A;  2QXI A;  3B8J A;  4SGB E;  1GCT C;  4WMF A;  2AHM E;  1Y5B T;  1E1Q D;  3BTQ E;  1FY4 A;  2FP7 B;  1UHB B;  3NKK A;  3E16 B;  1EAW A;  1G2L A;  2FOG A;  2XCF A;  3RC4 A;  4INH A;  1QJ7 B;  3D65 E;  2V3O H;  2A7H A;  1AKS A;  2ZGC A;  4IN1 A;  4ISN A;  1UCY H;  3TJO A;  4JYV H;  3SZN A;  4GUX A;  1GJB B;  5DG6 A;  2CF8 H;  5HMA A;  4LZ4 B;  1A2C H;  4NZL A;  4CHA C;  3RUO A;  5GJ4 B;  1Y8T A;  2ZU1 A;  2RA3 A;  2C8Z B;  2WPM S;  1WUN H;  1GBI A;  1YC0 A;  4FUI A;  1C5S A;  3A8D A;  1SR5 C;  2SGQ E;  3OY6 U;  2IJD 1;  1DDJ A;  2BDH A;  3ZVF A;  1WQS A;  2LEL A;  1P2M A;  3K2U A;  1ZGI A;  1AWF H;  2FM2 A;  5FHT A;  8EST E;  4NCY A;  3FVF B;  3P8G A;  4ABB A;  1TFX A;  3LON A;  4Q7X A;  1HV7 A;  3P70 B;  1D3T B;  3RXC A;  4FUC A;  1FN8 A;  1SGT A;  1YLD A;  2R0L A;  2XW9 A;  4GPG A;  2ZQ1 A;  1C2G A;  4K1E A;  4P02 A;  2O8T A;  2EI6 A;  2J95 A;  1K0H A;  1XUJ A;  1Q3X A;  2BLW A;  2WUB A;  4XBD A;  1K1N A;  1V2T T;  6GCH G;  1GHV H;  1P2Q A;  2YOL A;  2AH4 X;  3SYJ A;  1SGY E;  1GDQ A;  3T26 A;  3ZVE A;  3UQV A;  5FPS A;  1ETS H;  1OYQ A;  3LJJ A;  1LTO A;  2V0B A;  4R0I A;  3T27 A;  1TMT H;  1NS3 A;  2QV1 A;  1O3K A;  3SV8 A;  5C17 A;  2F43 B;  2ODQ A;  4ZXX H;  3FO8 D;  1SC8 U;  1SHH B;  4GAW A;  4UD9 H;  1E36 B;  1DLK B;  3VFE A;  2AMD A;  1O3D A;  1TA6 A;  1MH0 A;  2VNT A;  3A86 A;  2R2W U;  3CNR A;  4HTC H;  2XWA A;  1C1W H;  5EXN A;  4B2C A;  4AYV B;  4BTU B;  3L3T A;  3RP2 A;  1H1B A;  4FUH A;  1Z8I B;  4Q7Z A;  1MTU A;  1NRN H;  1XMN B;  1Z8G A;  4UFE H;  1CBW B;  3BEF B;  4TYD A;  4RT1 A;  1C1M A;  1Y3W A;  3A88 A;  3LDX H;  4B71 A;  1BRU P;  1DLE A;  1AZZ A;  3LGU A;  3PRB A;  5C5O A;  2QY0 B;  3AAV A;  5ESB A;  2EC9 H;  1SGF G;  2F9N A;  1O2I A;  1TOM H;  2VWM A;  3RU4 E;  3TH3 H;  4Y10 E;  1ABJ H;  2OP9 A;  1V2Q T;  3DSO A;  1QBO A;  2JH5 D;  1O35 A;  2KR7 A;  2ALV A;  4CR9 A;  3EDX B;  1HIA B;  3KYF A;  1EX3 A;  2W5E A;  1FNI A;  3M3V A;  2ZDK A;  5F8T A;  3UUZ A;  1MTW A;  3F9F A;  4ZXY H;  1K1O A;  5DP4 A;  1YPK H;  1FJS A;  2G5V A;  3CP7 A;  1C5X B;  1NRS H;  1C1V H;  3QUM P;  1D6W A;  4XRN A;  1O2X A;  1OWJ A;  2QE7 D;  4E06 H;  1J15 A;  1O2V A;  1O3P B;  2ZO3 H;  1B0E A;  3UWJ H;  1NM6 A;  5GIB A;  1RJX B;  1W0Y H;  3NZI A;  3E8L A;  5CDF E;  2JKH A;  4X2W A;  1V2W T;  3SZE A;  1FPH H;  1O5D H;  1GG6 C;  1D9I A;  3M7T A;  3ZZ4 A;  5GXP A;  4RKJ B;  1O2T A;  1Z1I A;  2BVX H;  1Z6J H;  3M5N A;  1MZA A;  4AGK A;  1H9I E;  2UWP A;  1PPH E;  1NT1 A;  7GCH F;  2OBQ A;  3FKS D;  3UFA A;  3HKJ B;  4CR5 A;  1TBR H;  2ZIQ H;  3DD2 H;  3RML H;  1TRY A;  4RKO B;  1QIX B;  3R0F A;  3T62 A;  1JXP A;  5DP7 A;  3KL6 A;  2THF B;  2TIO A;  4ASU D;  3A81 A;  4ISL A;  2GD4 B;  3S0N A;  2NU2 E;  6EST A;  2TBS A;  1O34 A;  4OGX A;  3S7H B;  4F55 A;  1S81 A;  2FOA A;  2WPL S;  1OYT H;  1C1R A;  2M2A A;  3URE A;  4O3T A;  3OYP A;  5JDU B;  2O8L A;  1W3C A;  1Q31 A;  2BY6 X;  2CK3 D;  2ZU3 A;  1GJ7 B;  3Q3Y A;  1MCT A;  5T1V A;  3VXE H;  1FX0 B;  2Y7X A;  3PLP A;  3V7T A;  5GCH G;  5B6O A;  5C20 A;  4DJZ B;  1GCT B;  4I8K A;  1TNG A;  2GP9 B;  1TX8 A;  3QTV H;  2W7S A;  1GBL A;  1GVZ A;  2ZDM A;  1ELE E;  4AC9 A;  1BOQ A;  1W7G H;  4UFF H;  4CRC A;  1SGI B;  1EAU A;  4XE4 A;  4NFE A;  4TY6 A;  3MHW U;  1QB6 A;  1S6H A;  3AW1 A;  2FOE A;  4MLF B;  4XFQ A;  1NBM D;  2PKS B;  3DFL A;  2VGC C;  5HGG A;  5EXM A;  1BQY A;  1S82 A;  1O3F A;  1C5Z B;  4X1S U;  2BQW B;  4ISI H;  1AKS B;  2BVS H;  2K1Q A;  1QR3 E;  3T29 A;  1AVG H;  4WJG 2;  4O97 A;  3MOC A;  3ODD A;  4NA9 H;  1W0K D;  1HB0 B;  4Y11 E;  4MVN A;  2Y7Z A;  2J98 B;  2Y82 A;  4CHA B;  5SGA E;  5EJZ A;  1H8E D;  1TGS Z;  3F2G A;  3MO9 A;  1ZZZ A;  4YTA A;  3GY7 A;  1E34 B;  1K28 D;  2IPH A;  5EJL A;  2J4I A;  2UUK B;  3A85 A;  5FBI A;  1AFQ C;  4ISH H;  1EP6 A;  1EAX A;  1C1P A;  3LPR A;  2IJO B;  1C5R A;  1S6L A;  1ZR0 A;  4NIX A;  4AFZ A;  1GI6 A;  2GMT C;  2WPJ S;  1AO5 A;  2A7C A;  3UAI C;  1HCG A;  2J92 A;  4HFP B;  1COW D;  1BA8 B;  1VZQ H;  3BTD E;  1BUI A;  2XYA A;  1MQ5 A;  2B8O H;  2ZG0 H;  3LGV A;  1HAO H;  1HAZ B;  1ESA A;  2BX4 A;  2UWO A;  4X6P A;  5FXL A;  4YT6 H;  4JK6 A;  3LGY A;  3QN7 A;  2SNW A;  2STA E;  4IC5 A;  1UTQ A;  4BAN B;  2FPZ A;  2F3C E;  5JBT A;  2OIN A;  1MU6 B;  1O2Y A;  3GCT G;  3L33 A;  5AVD A;  2EY4 C;  1FLE E;  1ZJK A;  1IOE A;  1NES E;  5EOK A;  4OS6 A;  3MWI U;  4H6S B;  3SJI A;  4NFF A;  2VIV A;  1INC A;  1Y3X A;  3A83 A;  1KXC A;  1HUT H;  3SW2 B;  3Q3K A;  3GIS B;  1AD8 H;  2KAI B;  4XD7 D;  1G9I E;  2ZFF H;  4DIH H;  3RC6 A;  3W94 A;  4DII H;  4MPW A;  3TH4 H;  4DCD A;  1UHB A;  1YCP H;  5F03 A;  3T25 A;  1BMN H;  1DSU A;  4WY3 A;  1A3B H;  2CV3 A;  2Y5F A;  5DN6 D;  1TPO A;  1C2M A;  1NRO H;  1RRK A;  1YLC A;  1DS2 E;  2Z9I A;  1L1G A;  1ZRB A;  4CH2 B;  3BEI B;  3SV6 A;  1XKB C;  1KXA A;  2FYQ A;  1PPZ A;  2C8Y B;  2GCT C;  5FX6 A;  2AGG X;  4O9V A;  1VCW A;  1ACB E;  1GHX H;  1GBT A;  2PP6 A;  5EQQ A;  4NA8 A;  2G51 A;  2Z6B D;  1O2J A;  3RM2 H;  3U8O H;  1SQO A;  2PUX B;  1Y59 T;  3JZ1 B;  2J9N A;  3ZVA A;  5C3N A;  1O3A A;  1CHO G;  1HJ9 A;  2ZFP H;  4B6F A;  4NG9 H;  1SKY E;  2RG3 A;  3SUE A;  3SOS A;  5CMX H;  1MKX K;  5AF9 H;  1XXF A;  2GKV E;  1PYT D;  2W6I D;  4U32 A;  3D49 H;  1TGB A;  1OX1 A;  1K1L A;  3E1X B;  3M3T A;  2UUF B;  1A0J A;  2OQ5 A;  4BTI B;  1P3E A;  1GI5 A;  4ZHM U;  2CXV A;  1MKW K;  1MD8 A;  1VGC C;  2IOT A;  4U01 A;  2JJ1 D;  1PQ8 A;  1W11 U;  2A5I A;  2O8M A;  1GJ9 B;  1ZTJ A;  1XUH A;  4K1S A;  3WWF A;  1GG6 B;  1TRM A;  5FL7 D;  4BAQ B;  2FOM B;  1O5A B;  3U8R H;  2ZHE H;  1LPG B;  3GIC B;  3RXL A;  2KCO A;  2TGP Z;  3HK3 B;  1GJD B;  1BCU H;  2F9V A;  1H8H D;  1MU8 B;  1C1N A;  3RXA A;  2JIZ D;  4A1V A;  1ETT H;  1HNE E;  3GCO A;  4MG3 A;  1CE5 A;  1GHB F;  5DJ7 A;  1LVY A;  1KTS B;  1LHF H;  3H7T A;  2W6J D;  2ODP A;  2QC2 A;  2YNB A;  3U8T H;  1O3C A;  1QZ8 A;  5IYT A;  1HAH H;  3PM3 A;  1SBW A;  1GMH F;  4X8U H;  3NPS A;  3FZZ A;  4OS7 A;  3O8C A;  1SOT A;  1RFN A;  3SBK A;  1DY9 A;  3QLP H;  3MH4 A;  1TGT A;  4A1T A;  1T8L A;  2ZGX H;  2ZTY A;  2XC4 A;  3TGK E;  2GT7 A;  1AE5 A;  1E1R D;  1LVO A;  4TT3 D;  1NY2 2;  2AFQ B;  2GJG A;  3E0N B;  2Q6F A;  1KXB A;  3U98 H;  2EST E;  4OS2 A;  3ITI A;  4I31 A;  1OP2 A;  3F1S B;  3HAT H;  1O2L A;  1HDT H;  2FI3 E;  3WWB A;  4ACA A;  5BPE A;  1EAT A;  1HIA A;  2A45 B;  1C1Q A;  3T5F H;  1RD3 B;  5DP8 A;  2BTC E;  3M37 A;  3URD A;  1TE0 A;  2J34 A;  1BRC E;  3ZZ9 A;  2PTN A;  1ELV A;  3UNS A;  2GDE H;  2Z94 A;  4Y0Z E;  3PMB B;  2OBO A;  1GL1 A;  2QGR A;  1VCP A;  2LNC A;  2VGC B;  4BNR A;  3EST A;  4ZKN U;  2JDI D;  1ELB A;  1C4Y 2;  1OOK B;  1KYN A;  2J2U A;  1K1M A;  4NZQ A;  1D3Q B;  4D8N A;  5IDK A;  1EZX C;  3EQ0 H;  1HLT H;  2ZKS A;  3QO6 A;  2OC7 A;  5HIZ A;  3UR6 A;  3SU3 A;  2CF9 H;  4DG4 A;  5A8X A;  1ANB A;  2BY9 X;  1GPZ A;  1C2E A;  4KEL A;  5FCR A;  2ZFT A;  4GCH G;  4XBC A;  1TNH A;  3SI3 H;  1V2K T;  2QA9 E;  4SGA E;  3RDZ A;  3MH5 A;  2KX4 A;  1O2P A;  5LPF A;  2J97 A;  2HPQ H;  3GYL B;  2KCY A;  4UFG H;  1YGC H;  3A84 A;  5J4S A;  2VVC A;  2XC0 A;  3E91 A;  4YOI A;  1AFQ B;  2AGI X;  2KZ4 A;  3UNQ A;  1ZTK A;  4DGJ A;  3GS9 A;  1NN6 A;  1H8D H;  2ZDA H;  2BD2 A;  4X8S H;  2GMT B;  2TGA A;  1O3M A;  4ABJ A;  1WYK A;  2FYR A;  3FP6 E;  3SOR A;  1Z71 A;  2O8U A;  1ZML A;  1FXY A;  2P8O C;  3OEE D;  3MNX A;  1KSN A;  1ZPB A;  4I32 A;  2GCH G;  4VGC C;  2Z9L A;  4WXV A;  1S0R A;  1O2H A;  1KLT A;  4TSF D;  1LQE A;  2FEQ H;  1GMD G;  3FN8 A;  3I77 A;  4INL A;  2Q6G A;  1E35 B;  2ZFR H;  1O30 A;  4JK5 A;  4KP0 A;  1BMF D;  4CRG A;  1SOZ A;  1O2R A;  3CEN A;  5DP3 A;  2FTM A;  2Q1J A;  3KNX A;  1TQ0 B;  1W12 U;  3E6P H;  1V2S T;  5ABW A;  1GJ6 A;  2BX3 A;  1XUF A;  2K8I A;  1FV9 A;  3RXS A;  2PGB B;  3GYM A;  5BRR E;  4AOQ A;  1LVB A;  4FUJ A;  3RXR A;  1WV7 H;  3KQE A;  3VB6 A;  1Z7K A;  5T6F A;  3KCG H;  1Z1J A;  1J17 T;  2OK5 A;  4GLY A;  1GBD A;  2PHB A;  4ABD A;  1TPA E;  1DXP A;  1DX5 M;  4UON A;  1UTL M;  2BOH B;  5DO4 H;  4Y7A A;  2VB0 A;  2FI5 E;  2Z9K A;  4X0W U;  3SJO A;  2ZPQ A;  1FON A;  1FY1 A;  1QL9 A;  2G4U A;  7EST E;  3NXP A;  1LVM A;  2HLD D;  1HBT H;  3A7X A;  3O8R A;  2KM0 A;  4J2Y B;  1MTN C;  3OX7 U;  2PKS C;  1RGQ A;  3PYH A;  1V2P T;  4FVD A;  3GY8 A;  1VKY A;  1LQD B;  1GBE A;  3SU1 A;  1QL7 A;  3KQC A;  2PFE A;  2GCT B;  1AE8 H;  2ZEC A;  2ZF0 H;  2J98 A;  4IW4 E;  2AIQ A;  3TK9 A;  1P2J A;  8GCH F;  2W26 A;  2FTL E;  5I25 A;  1LO6 A;  3F0P A;  5T3H A;  3VGC C;  2P3T B;  2AEI H;  2QF5 A;  1YF4 A;  4K2Y A;  4BXW A;  3EA8 A;  5F53 A;  1YBW A;  3MNC A;  3PLK A;  1GI9 B;  4YO9 A;  1GBM A;  1SG8 B;  1TBQ H;  1CU1 A;  3ZZB A;  1HAG E;  3GCH C;  1UTN A;  4GHQ A;  3ZZ6 A;  4OS5 A;  2TGD A;  3P8N A;  1T4U H;  2BY5 X;  1G3D A;  5JB8 S;  1O36 A;  3MO3 A;  2FLR H;  3TVJ B;  1F5K U;  1VGC B;  3G01 A;  1EZU C;  3N99 A;  4HG6 A;  4YM9 A;  1GJC B;  1N6X A;  3IG6 B;  3ODF A;  2F9O A;  4HI3 A;  2P3U B;  4JZ1 A;  5HYO A;  1YM0 A;  1BTX A;  1LHE H;  1YPJ H;  2A4G A;  1CA8 B;  3PLB A;  1CQQ A;  2BDY A;  2BY8 X;  1P8V C;  1C5Y B;  4TWY A;  1BHX F;  2AGE X;  3MH7 A;  3ZVD A;  5EQR A;  4YOJ A;  1PQ5 A;  2JET C;  4I8L A;  2ZI2 H;  4K1T A;  2VWN A;  3DSG A;  1ZYO A;  1GBH A;  3SGQ E;  4Q80 A;  2KAI A;  4DY7 B;  2FS9 A;  1HAY B;  2ZHD A;  2GT8 A;  1A0L A;  2WV5 A;  1AU8 A;  4Q4L A;  2H6M A;  2GGV B;  1CHG A;  4Y71 A;  2XBW A;  3MU1 A;  1GBJ A;  1GI3 A;  3OAA D;  2FWW A;  3SJ8 A;  1SPJ A;  1P03 A;  1WSS H;  3BN9 A;  1CSO E;  1EST A;  2B5T B;  4XOJ A;  1MTS A;  1E0F D;  3RMO H;  4Y79 A;  1SGQ E;  1HAV B;  1E79 D;  2F83 A;  1C5U A;  4MNX A;  3IWM A;  4WF8 A;  2Y5H A;  1P2N A;  4K3J A;  4NIY A;  3TLO A;  5EJ1 A;  1AN1 E;  1G2M A;  1GVK B;  1P11 E;  3P6Z B;  1OS8 A;  4B6E A;  5C0U A;  2ZTX A;  1AUJ A;  2BDB A;  5KEC A;  1C2L A;  1ZHM A;  5JB9 S;  3DFJ A;  5LPR A;  6GCH F;  1J14 A;  1DIT H;  4Z0K A;  3M7Q A;  4R8T B;  2Z3D A;  2H1U A;  5A09 A;  5K0H A;  1GHA G;  1A5I A;  1T8M A;  3RU4 T;  2W7U A;  4NWK A;  2OCV B;  3P17 H;  4XDE A;  3M5M A;  4A7I B;  4FUD A;  5TCC A;  3ZZ7 A;  5C1Y A;  3RMM H;  2BD4 A;  1H9L B;  1B5G H;  1O5G H;  2G55 A;  3TGI E;  2TPI Z;  2V3M A;  1WTG H;  1ZMN A;  1DY8 A;  1QQU A;  2BD9 A;  2F9P A;  4FU9 A;  4X6M A;  4FUG A;  2WIN I;  4WH8 A;  5AFZ H;  2WPD D;  1BTH H;  4X1R U;  4F4O C;  1ZSK A;  4A5T S;  3SJ9 A;  4CBN A;  1JWT A;  3D23 A;  3SU4 A;  1O3B A;  3NRL A;  1GI0 A;  1UVP A;  1EFR D;  3RXM A;  4K5Z A;  1FI8 A;  1S85 A;  1QB9 A;  2XNI A;  1QJ1 B;  4BXS A;  2Y80 A;  4ABI A;  4ZUH A;  1BIO A;  3GDU A;  3QZQ A;  1QNJ A;  1SGD E;  5DK1 A;  3RC5 A;  1CGJ E;  2FOB A;  4PRO A;  1E37 B;  1UK2 A;  1UTO A;  1ELF A;  4WVP E;  2VBC A;  1YPG H;  2PTC E;  1MCV A;  3ZV8 A;  2P8O B;  1FAX A;  1C5P A;  1C5V A;  3GDV A;  2BHG A;  4AX9 H;  3KYG A;  4VGC B;  3VPK A;  4NGA H;  6LPR A;  1DPO A;  1TX7 A;  9EST A;  1EJN A;  2BD7 A;  2ZQ2 A;  1W10 U;  1EUF A;  4IMQ A;  3RXI A;  3QX5 H;  5GWZ A;  2ZDV H;  4K60 A;  1VCQ A;  1CO7 E;  1QY6 A;  2ZWL H;  1A46 H;  4X8T H;  4AB9 A;  1ZLR A;  2BD5 A;  9LPR A;  2FZZ A;  3ZYE A;  1HXF H;  3MMG A;  2OC1 A;  1F5R A;  1O0D H;  3RXV A;  2GZ8 A;  2XBY A;  1SHY A;  3JZ2 B;  1BB0 B;  3LT3 A;  1UTM A;  3CS7 A;  1MAX A;  3FOA A;  3UIR A;  1ORF A;  4MNY A;  3BG4 C;  2QF3 A;  3BTG E;  3RXT A;  3SU0 A;  4H6T A;  2WHX A;  3SND A;  3OU0 A;  2R0K A;  1UK4 A;  1W8B H;  3U1J B;  4WWY A;  1ELC A;  2PW8 H;  3BIU H;  1CT2 E;  2CHA C;  1MTN B;  1AQ7 A;  1KY9 A;  2A4Q A;  3KEE A;  3UY9 A;  2QIQ A;  1UVT H;  4D9R A;  1D4P B;  3PMH B;  4TPI Z;  3TU7 H;  1ZPZ A;  2WYJ A;  5CHB A;  1FY3 A;  1DUE A;  3BV9 B;  5EU8 A;  1D3P B;  1SLV B;  3PTN A;  1EQ9 A;  5JPM H;  3O8B A;  3DSP A;  2I6Q A;  2R2M B;  1KTT B;  2ZFQ H;  3VGC B;  3DUX H;  1BBR E;  1KXF A;  2HPP H;  1ZSL A;  3PWB A;  1YPE H;  4B76 A;  3EA9 A;  3SV2 H;  1QA0 A;  1V2O T;  2HGT H;  4K8B A;  2OUA A;  2VH6 A;  3M36 A;  2F9B H;  2ANM H;  1HJA C;  4CRA A;  2BLV A;  3GCH B;  1D3D B;  3HGN A;  3S9C A;  3PTB A;  3A8C A;  1EOJ A;  2W3K A;  1KXD A;  1RTK A;  3MFJ A;  3A7T A;  2J5U A;  1XKA C;  1YPL H;  4OS4 A;  2BDI A;  2FI4 E;  4ISO A;  1FAK H;  2DE8 A;  3W1E A;  1KMH B;  5GCH F;  2D1J A;  1LPZ B;  2G8T A;  1PYT C;  4ZAE A;  3RMN H;  3SJK A;  2HRV A;  3M61 U;  1GDN A;  1ZHP A;  1YYY 1;  1TMU H;  4XBB A;  2BQ6 B;  1VIT G;  4AFQ A;  1H4W A;  1ZRK A;  1O3N A;  5F6M A;  2WZQ A;  2C90 B;  1IQE A;  1F7Z A;  3MNS A;  2NU1 E;  1O37 A;  5T6D A;  2JET B;  3K9X B;  3RXB A;  1SFQ B;  2WSS D;  1AWH B;  3B9F H;  5B6L A;  2AYW A;  1QBN A;  1OPH B;  3K65 B;  1WDI A;  3EA7 A;  4TY7 A;  4RT0 A;  2G00 A;  1IQN A;  2BZ6 H;  3MTY A;  2JJ2 D;  3ATK A;  1FY8 E;  1AIX H;  1VR1 H;  1L0Z A;  3ZZ8 A;  4OS1 A;  1C5Q A;  1GBB A;  1OWD A;  4ZHA A;  3E90 B;  3HK6 B;  3VG8 A;  1NTP A;  4BAH B;  2Z7F E;  3ZIA D;  1QRX A;  1G32 B;  5DP5 A;  4MQA A;  1V2V T;  5A0C A;  5HM2 A;  4A92 A;  2D8W A;  2A4R A;  1S83 A;  3UB0 A;  1GBF A;  1O3H A;  4RSP A;  1O2N A;  1HAX B;  5FX5 A;  3M3S A;  1GBC A;  1C1U H;  1BTW A;  1TNJ A;  4JZD H;  2BQ7 B;  3UR9 A;  1OKX A;  3DHK H;  4ABA A;  1C2J A;  1MUE B;  1YKT A;  2A5K A;  4E7R G;  3ZYD A;  1W14 U;  4AFS A;  2C8W B;  3SNE A;  3F9E A;  1QBV H;  1F0R A;  3KQB A;  1SGE E;  1W0Z U;  3RLW H;  3WY8 A;  1UJ1 A;  2SFA A;  4Y7B A;  2VWL A;  1P12 E;  3SV7 A;  1QFK H;  1QUR H;  1T8O A;  3AAS A;  1YY3 A;  1EKB B;  3SI4 H;  2IPQ X;  4X2Y A;  4D7G A;  2IN2 A;  3GCT F;  2ZP0 H;  2BB4 A;  1IQF A;  3F2F A;  1C5M D;  4HGC A;  4KTC A;  2VJ1 A;  3Q76 A;  1NFW A;  1T31 A;  1L4Z A;  4DT7 B;  1UCY E;  2SGF E;  1XXD A;  3MI4 A;  3OY5 U;  3BTE E;  1EPT B;  2J38 A;  2YNA A;  1UO6 A;  2QXH A;  1BBR K;  1CGI E;  4IS5 A;  4ZHL U;  1DOJ A;  2H5C A;  2UUJ B;  3DA9 B;  3T2N A;  5EG4 A;  2PV9 B;  1GWA A;  2ZCL P;  3UOU A;  1DM4 B;  4LK4 A;  4UE7 H;  4X6O A;  2PSX A;  1KXE A;  1PPG E;  3TNS A;  1Z8R A;  3LJO A;  3QWC H;  2GTB A;  2XC5 A;  1BT7 A;  3K6Y A;  1O3E A;  3ZZD A;  1P2K A;  1UW7 A;  3GY5 A;  2FS8 A;  1O2O A;  4Z1M D;  4EST E;  3GCN A;  1ZMJ A;  2ANY A;  3F6U H;  3VEQ B;  1BHX B;  3MH6 A;  3RU4 D;  1FN6 A;  1GI1 A;  1WCZ A;  4B1T A;  1GMC G;  2GZ9 A;  1O3J A;  1UVS H;  3LIW A;  1O2S A;  1EAI A;  1C5L H;  1OSS A;  3ZVC A;  3SNA A;  4WH6 A;  1WOF A;  3PV5 A;  2EQN A;  1GBK A;  3A82 A;  2RFK C;  3NK8 A;  3SQE E;  5EGM A;  2VH0 A;  2VVV A;  1BTP A;  1SGN E;  2YMS D;  3I78 A;  1OP0 A;  1CHO F;  1HAV A;  1PFX C;  4JMY A;  1SGP E;  2BXU H;  2H9H A;  4NSY A;  1DE7 H;  1G3E A;  1P10 A;  2JH0 D;  1MZD A;  1O2U A;  3H7O A;  3KID U;  1TGC A;  3TPI Z;  1XUK A;  1IQL A;  1RTF B;  1ELG A;  1Q2W A;  2WV4 A;  2CMY A;  1JMO H;  3BTH E;  1F92 A;  1P2O A;  1YCP M;  2FXR A;  1FIW A;  3BG4 B;  3QDZ B;  1T7C A;  3ZVB A;  3K6Z A;  1QCP A;  1ANC A;  3SNB A;  3WW7 A;  4MPX A;  2FOD A;  3UTU H;  2I6S A;  1F0T A;  4TPY A;  2A4O A;  1EJM A;  1GJ5 H;  1P01 A;  1O33 A;  2PLX A;  3RXD A;  1WAY B;  4P00 A;  3NUM A;  4AB8 A;  1NO9 H;  1IQH A;  2GX4 A;  3A8B A;  4TWW A;  1NRQ H;  3BTT E;  5C94 A;  1EZS C;  2CHA B;  3Q77 A;  4ZH8 A;  4NWL A;  1MKX H;  2ZNK H;  1MBQ A;  1VJ9 U;  1ZOM A;  6CHA C;  1F0S A;  2EI8 A;  1IQM A;  2NU4 E;  1QB1 A;  5HM9 A;  1VIT H;  4YES B;  1P04 A;  3QGN B;  2FIR H;  1UTK A;  3I29 A;  5GND A;  1MKW H;  2A7J A;  2HVY B;  2A31 A;  1HRT H;  4Q2K A;  1C5W B;  3OFN D;  4Y8Y A;  5DGJ A;  2RCE A;  3ZZC A;  3A80 A;  4FXG H;  2HNT F;  5EOD A;  2PGQ B;  1ESB A;  1AFE H;  1BRA A;  1LPK B;  2SNV A;  3BG8 A;  1TLD A;  2ZDL A;  1UCY K;  1HJA B;  4DVA U;  5J4Q A;  5KGO A;  5C67 A;  3RXE A;  2HWL B;  1P3C A;  4GSO A;  2BM2 A;  1NFY A;  3FZD A;  5JBC S;  3EGK H;  5C5N A;  1DWB H;  5C1U A;  3NCL A;  5LH8 A;  2FLB H;  2SGE E;  3PV4 A;  1ETR H;  4YLU A;  3KQ5 A;  1L4D A;  4M9F A;  3VXF H;  2ZHF H;  3A89 A;  2W3I A;  3QZR A;  4F49 A;  5G4B A;  1TNL A;  3A8A A;  4B74 A;  1NBM E;  2ULL A;  1JIR A;  2BD8 A;  2B9L A;  4ZKS U;  3LGW A;  5FPY A;  4LZ1 H;  1C2D A;  5AFY H;  3EAJ A;  3P95 A;  5DKM A;  1GI7 B;  4KTS A;  4FU7 A;  2J94 A;  1J8A A;  3Q3X A;  4WXI A;  2WPI S;  4AG1 A;  1TNI A;  1TIO A;  4OGY A;  2NU3 E;  3F9H A;  1LHD H;  2KFW A;  4YZU A;  1TQ7 B;  3FFG A;  1V2L T;  2Z9G A;  4X1N U;  2BOK A;  2D26 C;  2V3H H;  3ATM A;  4CRD A;  1OWI A;  3TH2 H;  2BLQ A;  1W2K H;  2OTV A;  3F9G A;  4GCH F;  1NRR H;  4FOU C;  2VIN A;  1K2I 1;  2QF0 A;  1DST A;  3E0P B;  4X8V H;  3HPT B;  3MNB A;  3VB7 A;  1NC6 A;  1ARB A;  1Y3U A;  1O39 A;  1ZJD A;  1DAN H;  2WV9 A;  1DXW A;  3PV2 A;  2ZCK P;  1MBM A;  2LPR A;  1TA2 A;  5CE1 A;  3KF2 A;  2BLO A;  2BZA A;  1NPM A;  1ZHR A;  1S6F A;  3UQO A;  4FVB A;  4Y6D A;  3A7Z A;  2GCH F;  3FAN A;  2FOH A;  2F4L A;  1YPM H;  3RXJ A;  1LHC H;  1V2N T;  3ATL A;  1GMD F;  3VB5 A;  4A1X A;  5DP9 A;  4THN H;  2EEK A;  1EB1 H;  3FAO A;  2WYG A;  1ZGV A;  1V3X A;  2BXT H;  2ZTZ A;  2KCP A;  4DOQ A;  1DUA A;  3ELA H;  1O38 A;  1BJV A;  4MTB A;  4BAO B;  3F68 H;  1C2F A;  4Y76 A;  2HNT C;  1TB6 H;  1RXP A;  1K1I A;  4ZMA H;  3BTF E;  2FX6 A;  4JYT A;  1SLU B;  3N7D A;  2A2X H;  2R3Y A;  1O2W A;  1EZQ A;  4BOH A;  1TWX B;  1PQ7 A;  4O3U A;  1W13 U;  1BTU A;  1SL3 A;  4ABE A;  4I7Y H;  2F9U A;  1YPH C;  1S5S A;  3PRO A;  4AZ2 B;  1BDA A;  3MYW A;  4LXB H;  5EW2 H;  3ZV9 A;  5L6N H;  1CA0 C;  1IQK A;  1BML A;  5F8Z A;  1N8O C;  2EA3 A;  3GY6 A;  1SQR A;  3AW0 A;  1C9P A;  2VIQ A;  3PMA B;  3QK1 A;  1BRB E;  2XCN A;  1KLI H;  4AN7 A;  1GJ4 H;  1MD7 A;  5FCK A;  2Z3C A;  4RI0 A;  5JYI A;  3E3T A;  4AYY B;  1QL8 A;  1BZX E;  1ARC A;  1SLW B;  2H2Z A;  1KDQ B;  1P9U A;  2BYA X;  1XVM A;  5A8Y A;  1TNK A;  4Y8X A;  3FP8 E;  3M7U A;  3OTP A;  4Q63 A;  2R3U A;  1N1L A;  1AB9 C;  3SUD A;  2XTT B;  2BDG A;  3UOP A;  2HOB A;  2XXL A;  3ZZA A;  1A5G H;  1O3G A;  1P09 A;  1VJA U;  4I8J A;  1IHT H;  5F8X A;  3PMJ A;  1DIC A;  1C2H A;  4D7F A;  4I8H A;  1ELA A;  1P2I A;  1Y5A T;  4CH8 B;  2AIP A;  3S9A A;  3L6P A;  1V6D A;  3U1I B;  3S9B A;  2R9P A;  1RIW C;  2FO9 A;  5E0J A;  4AOR A;  4UFD H;  2ASU B;  3RM0 H;  2OQU A;  3PWC A;  4NA7 A;  1F0U A;  3BSQ A;  2ANW A;  1FPC H;  2FOF A;  4ABF A;  3M35 A;  5T6G A;  2ZA5 A;  1A61 H;  1T8N A;  1C4U 2;  3H5C B;  5FPT A;  1K22 H;  1O3L A;  1HYL A;  1TGN A;  1PPB H;  3TK5 A;  1YP9 A;  1EOL A;  1J9C H;  3SGB E;  7GCH G;  4F48 B;  5DPA A;  1GL0 E;  1A5H A;  1FY5 A;  1AY6 H;  3S7K B;  1B0F A;  3V3M A;  1Z8J B;  4JCN A;  1QRZ A;  2FDA A;  6CHA B;  4B2A A;  1AND A;  1O2M A;  3MU0 A;  2QN5 T;  4IN2 A;  1EPT A;  1GJA B;  3SUF A;  3LGT A;  1ZTL A;  3T28 A;  2ZFS A;  1EPT C;  3VB4 A;  3TGJ E;  4IBL H;  1DWC H;  1DWE H;  1IHS H;  3SU2 A;  2TGT A;  3LKW A;  3MU8 A;  3F3B A;  3PRD A;  3BIV H;  1ANE A;  1C9T A;  1MAY A;  5E2P A;  3SUG A;  1P02 A;  1OP8 A;  2A32 A;  1HAP H;  3RXH A;  2VID A;  2P93 A;  1JRS A;  2QAA A;  3FP7 E;  2K0Q A;  4AFU A;  2ZHQ H;  5JBB S;  3V12 A;  1QJ6 B;  1YLN A;  2AER H;  1C2K A;  4DW2 U;  3STI A;  3C1K A;  2QXG A;  4ZCN A;  4IMZ A;  3F0O A;  8KME 2;  2OC8 A;  2Z3E A;  1TYN A;  4B73 A;  4ABG A;  1A4W H;  5CHA C;  4UDW H;  2G52 A;  3GDS A;  1S84 A;  1JOU B;  1AHT H;  2VIO A;  1QQ4 A;  3BTW E;  3V0X A;  1HXE H;  3S69 A;  1GHA F;  5EXL A;  2GZ7 A;  5C2Z A;  2ZGB H;  2QYI A;  7LPR A;  1FMG A;  5KED A;  1NU9 A;  3C27 B;  5LGO A;  5LPE A;  3RXQ A;  5PTP A;  2OXS A;  2XWB I;  2ZU5 A;  5E0G A;  5K7R A;  7KME H;  2DE9 A;  1T4V H;  1B7X B;  3CS0 A;  3HGP A;  5E0H A;  2XRC A;  5GPI B;  3SV9 A;  1AVW A;  4K69 A;  1HPG A;  1XVO A;  3LOX A;  5C1X A;  3P8O A;  2XOK D;  2ZGJ A;  5HXF A;  4DUR A;  2XBV A;  3RXO A;  4I33 A;  1PJP A;  1LMW B;  2L74 A;  2B0F A;  1C4V 2;  2A2Q H;  2WUC A;  1MTV A;  1OXG A;  2ZEB A;  1L1N A;  2UWL A;  1TX6 A;  1IAU A;  4YLQ H;  1MMJ N;  3RXK A;  2PKA B;  1TPS A;  1AGJ A;  5FBE A;  1C1S A;  5L2Y H;  2FX4 A;  4FU8 A;  2V35 A;  5L2Z H;  2ANK H;  1YCP K;  2RDL A;  2GV6 A;  4ZRO A;  2B7D H;  3GOV B;  2BVR H;  1Y3V A;  1C1O A;  3BTK E;  3HKI B;  4FET A;  1Z6E A;  2D2D A;  1YWU A;  2P95 A;  3OTJ E;  4WME A;  4JYU H;  2ODY B;  5FAH A;  2AMP A;  1BMA A;  1XX9 A;  2M5T A;  1A3E H;  1GCD A;  1G3B A;  2CN0 H;  1OWE A;  1O31 A;  1BMM H;  2JH6 D;  1TAW A;  1C5O H;  4DT4 A;  2BDC A;  1BTY A;  5E2O A;  3D62 A;  3M5L A;  1OWK A;  2H5D A;  1M9U A;  1WXR A;  5DP6 A;  2QXJ A;  1O5B B;  2P94 A;  1C5T A;  1SGF A;  4GHT A;  3RXU A;  1O5C B;  1X7A C;  5EQS A;  3RLY H;  1EJA A;  1O3O A;  1SQA A;  2KCA A;  4JZE H;  3B23 B;  1FZZ A;  1DVA H;  1C5N H;  1K21 H;  1UK3 A;  4YT7 H;  1UMA H;  2HVX A;  2P16 A;  3EE7 A;  1THS H;  1PPE E;  1SMF E;  1TBZ H;  4QT8 C;  1SVP A;  2G4T A;  1N6Y A;  1GHW H;  1CT0 E;  5HIY A;  1CA0 B;  3LH3 A;  2VIP A;  4MNW A;  4NSV A;  1WU1 A;  1A0H B;  1N8O B;  4KTU A;  2C93 B;  3TJU A;  1EB2 A;  3MQK C;  1WBG B;  1TAL A;  2Y5G A;  2F91 A;  2BDA A;  3ZVG A;  1PPC E;  3V13 A;  1GVL A;  3OSY A;  1O2Q A;  5AHG H;  3UPE A;  2BY7 X;  2Y81 A;  4KKD A;  3RXF A;  5DSF A;  2RA0 A;  4JZI A;  4OM9 A;  2WPK S;  1ELT A;  1NFX A;  1A1R A;  1AB9 B;  2C4F H;  1SSX A;  4E7N A;  1RTL A;  1OWH A;  2FES H;  1S0Q A;  1U6Q A;  1Y3Y A;  1L1J A;  1GDU A;  1QTF A;  3EYD A;  3PO1 C;  3QGJ A;  5EPN A;  1O5F H;  1AVX A;  2A1D B;  4Y8Z A;  3TJN A;  3EE0 B;  1GGD C;  4Q7Y A;  1V2J T;  4X1P U;  4JZF H;  1RIW B;  2VIW A;  1NU7 B;  3SHA H;  1TAB E;  3KGP A;  2WPH S;  1H8I H;  3PB1 E;  1SFI A;  2P3F H;  2NU0 E;  3GY3 A;  2DUC A;  1GBA A;  3AAU A;  4I8G A;  2YMS C;  1W0J D;  1JIM A;  1GHY H;  4BAM B;  1WTH D;  2BD3 A;  1LHG H;  1SQT A;  1TON A;  3U9A H;  4FUF A;  5TCA A;  1KLJ H;  1UVO A;  2PSY A;  2PUQ H;  2STB E;  1F2S E;  1V2R T;  1GJ8 B;  4MDS A;  5EPY A;  5HKK D;  2SGP E;  1VIT F;  3TIU A;  1A7S A;  3LGI A;  3SU5 A;  1D6R A;  1LKB A;  5H4I B;  1EAS A;  2GV7 A;  2FMJ A;  2OD3 B;  1GHB G;  4X2V A;  1P05 A;  1LDT T;  4B2B A;  3SO3 A;  4ACB A;  1FDP A;  2NWN A;  5EST E;  3GY2 A;  1EXF A;  1GMH G;  2XND D;  1O3I A;  1G36 A;  1P0S H;  4B75 A;  1KIG H;  1Y5U T;  1G3C A;  4ZKO U;  4KGA A;  1THP B;  4Y0Y E;  2UUY A;  1GHZ A;  3KQD A;  3F2H A;  1FQ3 A;  1BTZ A;  4MPU A;  2L6O A;  5I46 H;  3TNT A;  1HJ8 A;  3SU6 A;  3ATI A;  3LC3 A;  3DCL A;  2XBX A;  2O8W A;  3RXG A;  4H42 U;  2ZGH A;  3UNR A;  4ZKR U;  1TRN A;  5GDS H;  1KDQ A;  1FIZ A;  2HNT E;  2SGA A;  2VWO A;  2RDE A;  3SNC A;  1SGR E;  1UVU H;  1P57 B;  3KN2 A;  4M7G A;  1F5L A;  5CHA B;  8LPR A;  1O32 A;  1TMB H;  2O9Q A;  1CGH A;  1NZQ H;  1YPH E;  1NFU A;  3DT0 H;  1XUI A;  3LU9 B;  4NIV A;  1QHR B;  1WQV H;  4IC6 A;  1O5E H;  1XM1 A;  3R3G B;  2Q6D A;  2Y6T A;  1E38 B;  4CRF A;  4YXW D;  5JBA S;  3U69 H;  3MU4 A;  2ZDN A;  2GDD A;  4U2W A;  2ILN A;  4E05 H;  1HGT H;  3SHC H;  2QF4 A;  1IQI A;  2BMG B;  4YOG A;  1OHH D;  3A7W A;  1ID5 H;  4X6N A;  2V7Q D;  5EIY A;  3SGA E;  1T32 A;  4MPV A;  1SGC A;  3URC A;  3ZZ5 A;  1CBW C;  1QRW A;  4AGJ A;  1THR H;  1NRP H;  3BEU A;  1LKA A;  1UTJ A;  2VVU A;  4UEH H;  1DT2 A;  3STJ A;  5L30 H;  2PR3 A;  1AZ8 A;  1JBU H;  2H9T H;  3W95 A;  3SQH E;  3M5O A;  5EW1 H;  3VB3 A;  4ABH A;  3O8D A;  1IQJ A;  2CJI A;  2QCY A;  4O03 A;  3AVZ A;  2ZZU H;  4K8Y A;  4NIW A;  4WMD A;  1J16 A;  3TIT A;  4D76 A;  3N7O A;  3NWU A;  3U28 C;  1ELD E;  1LCY A;  1XUG A;  3IIT A;  5TJX A;  1GMC F;  3H09 A;  4Z6A H;  2C3S A;  2VU8 E;  2FOC A;  2EI7 A;  1HFD A;  3RXP A;  1P06 A;  4MNV A;  1BBR H;  1ZSJ A;  4D9Q A;  1H9H E; 
#chains in the Genus database with same CATH homology
 2KX4 A;  1K0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...