2KX4A

Solution structure of bacteriophage lambda gpfii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phages have adapted the same protein fold to fulfill multiple functions in virion assembly.
pubmed doi rcsb
source organism Bacteriophage lambda
molecule tags Viral protein
molecule keywords Tail attachment protein
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 2kx4A01
1K0HA 2KX4A
chains in the Genus database with same CATH superfamily
3ZZAA 2J92A 2GCTB 3E8LA 2ZHEH 3V13A 4F48B 3UNRA 4AX9H 1SGNE 1WUNH 2GCHG 5A8ZA 3BTGE 3DSOA 4J2YB 3MU0A 3M61U 1AE8H 1GBEA 2PSXA 2JETC 2R9PA 5SGAE 2A7HA 5JBTA 2DUCA 1YY3A 1EASA 1CQQA 4TPYA 1O3MA 3TGIE 3A80A 1O3DA 2OTVA 1DT2A 4I8KA 2BY7X 3A8DA 2VIOA 5J4SA 4O97A 2J97A 2BZAA 2R3YA 3SGAE 4HI3A 1LVBA 1ZPZA 2WZQA 3ZZ9A 3ZYDA 5LGOA 2V3HH 1GBKA 2F9OA 2FLBH 4X8SH 3PRBA 3HATH 2BZ6H 3M3VA 3P17H 3SBKA 1EZXC 2V3MA 4KELA 1LQEA 1SPJA 4O3TA 1P12E 1O37A 1TBZH 2VIQA 2QGRA 4B73A 3OX7U 5DKMA 2O8UA 3UAIC 7GCHF 4CBNA 2DE8A 3RXDA 1TRNA 3M5OA 4GLYA 3GCOA 1AO5A 3A7WA 4NWKA 3I77A 4KTUA 1DX5M 4F55A 2ALVA 1MKWH 4JZEH 5FPSA 1S84A 1SGTA 3MH4A 4YLQH 2RA3A 4GCHG 1L1NA 3DFLA 1F0TA 4THNH 4X8TH 1BJUA 1AWHB 3BIVH 4M9FA 1QJ7B 1TX6A 3A7YA 5HM9A 1O2NA 3UR9A 5DN6D 3A8BA 1D9IA 1HYLA 3LGTA 1HAGE 1PPBH 1TFXA 3NKKA 3P95A 4Y0YE 4AG2A 5JDUB 3UQVA 1G9IE 1UTJA 2JH0D 5HKKD 1UHBB 1FY8E 1C5UA 5DG6A 1H9HE 3UFAA 1RJXB 1C5SA 1YPHE 4CRGA 1UO6A 2VH0A 2Z6BD 1LVOA 2F3CE 1GCDA 1CT0E 1Y3YA 1O2UA 3F2FA 1UMAH 1ZMLA 4B2AA 3E16B 1C9PA 1O3LA 3W94A 1D4PB 3SW2B 1FY4A 8LPRA 4PROA 2ZU2A 4Y8YA 1S83A 2ZFRH 1QHRB 2AMPA 3JZ1B 1GCTC 2WHXA 2CHAC 3MMGA 4FETA 3MH5A 4ZHAA 1K1IA 2UUFB 5BPEA 2WPIS 2ZHQH 1KLIH 3GCNA 3Q00A 2OCVB 2IPQX 2J94A 3UREA 4SGBE 1FI8A 1UTOA 2AGEX 2VVCA 3HK6B 4TWWA 3TVJB 1P0SH 1Y3VA 1UTLM 6CHAB 2AEIH 3N7DA 3AK5A 1ZZZA 2KM0A 5K7RA 2IJOB 1HAPH 1FV9A 2OC7A 4MPVA 4XFQA 3A8AA 1TOCB 1AWFH 1C5QA 2FIRH 1SSXA 4FVDA 1GBMA 1VCPA 3GY4A 4HZHA 4NFFA 5AFYH 4ABFA 2A5IA 2FX4A 1TONA 1OWEA 4RN6A 1QCPA 4TYDA 1BTYA 1MD7A 1NTPA 2XYAA 4CRCA 2OBOA 1MKXK 2UWPA 4U30A 1V6DA 5EXNA 4ZXYH 1NZQH 3OY6U 1GI5A 4K3JA 3KYGA 3P70B 2Y6TA 2ZFSA 3A7VA 3MQKC 5E0HA 2Z9IA 1GPZA 1MTVA 2XWAA 2UUYA 1K1OA 1O2WA 2G8TA 1DLKB 3V3MA 1O3AA 1WSSH 1FIWA 1BTPA 1LMWB 1V2JT 2BX3A 3PWBA 2AERH 1GJ8B 4Y7BA 3P8GA 1C5WB 2L6OA 2BY8X 2LNCA 1C2HA 3QTVH 3VXEH 2A2XH 2VWLA 1GJAB 1O5DH 2G52A 2GMTC 2J2UA 1SB1H 3AW1A 1O3FA 1RRKA 2ZI2H 3OSYA 2VIPA 1AVWA 5C67A 1KSNA 2KCYA 3SQHE 2KCPA 1FLEE 4M7GA 1W12U 2VIWA 2ZO3H 4IN2A 1P10A 1SHHB 1C5YB 4ABDA 3S9AA 3ZZ8A 2Z9KA 2JH6D 3ELAH 4YO9A 4XDEA 3ZVCA 3RXIA 1C5OH 2XTTB 3BEIB 4ASUD 2QAAA 1HAXB 1IQGA 1O3BA 2K1QA 4X2YA 5EIYA 5K0HA 2R2WU 1LKBA 4AFUA 4YZUA 1NBMD 2XCNA 3BTHE 4B75A 1HCGA 3UUZA 3VEQB 3UOPA 1BJVA 1JWTA 1P11E 1UK2A 2A4RA 1SGYE 4NSVA 1F5LA 4UFDH 1NRNH 2FLRH 1EOJA 2A7JA 1ESTA 2THFB 1HIAA 5TCCA 1YPLH 1HJAC 4AN7A 1JOUB 1HJ8A 1A4WH 2V6NA 2VGCB 3ATMA 3S9CA 5ESTE 1A5HA 1QQ4A 3O8RA 1MTNB 2Z9JA 3RXLA 1ZHPA 3NRLA 1VR1H 1TAWA 5A2MH 1AZZA 2D8WA 1C1OA 1C5VA 4O3UA 1K21H 1S0QA 1Y5UT 1DWCH 2ZEBA 3KQBA 3LC3A 2XNDD 1BOQA 1EFRD 2O8WA 8KME2 2WUCA 1RIWC 1VGCC 1E1RD 1VITH 1CU1A 3M7TA 1YPJH 2ZU5A 1SQTA 1OP2A 2FX6A 4ABGA 4X6PA 3QZRA 2D2DA 4X6MA 3SORA 5KEDA 1CHOF 1O3KA 1AUJA 3ZZ7A 1B7XB 3TNTA 5DGJA 3SJ8A 4K8YA 3F0PA 3U8TH 1O2JA 4H6SB 1A46H 2J98B 2GTBA 3LGYA 5EQQA 3FOAA 1C2JA 1ZHRA 4DY7B 3RXVA 1O2QA 3ATIA 1GI9B 3H7TA 1THPB 4WXVA 2AS9A 2VWNA 4FUEA 5DPAA 1ZYOA 2V7QD 3U8RH 4D76A 1O2PA 1QQUA 2BHGA 3MNSA 4K60A 5FAHA 4ASHA 2PR3A 2Y7ZA 1WU1A 2CXVA 1KTTB 4MQAA 1SHYA 1L4DA 1NPMA 4B71A 4X8VH 4NIYA 1TWXB 1DWBH 1GVLA 3RC5A 1C5ZB 3BG4B 3OE7D 1C4U2 1KDQA 1T32A 2CMYA 2GT7A 1SBWA 2F43B 5EPYA 3ZVDA 4NCYA 4WJG2 1BRUP 1C1UH 1SLWB 2ZPSA 1OX1A 3T62A 2BD8A 1TNJA 1F0RA 3MU4A 4P00A 1EQ9A 1PFXC 3ATLA 3GS9A 3D23A 1QIXB 3LPRA 4IC5A 3MNBA 1SGCA 1DS2E 1OWIA 3TH2H 2H9HA 5AFZH 5EG4A 1O3NA 2GMTB 2A2QH 1GBFA 3PTBA 1V2KT 1P2NA 2AHME 1KDQB 1VITF 4BAKB 3UWJH 4DJZB 3RXTA 5L2YH 1EOLA 3SNCA 1FXYA 1GMHF 1AFQC 3OEHD 1HFDA 1LPGB 2FYRA 2VINA 5B6OA 5BRRE 2XC5A 2ZDVH 2GDEH 1P2IA 3ZZ6A 4A1XA 4ABEA 1GI6A 1BRCE 3DHKH 3AAVA 4OS5A 1DANH 1GHXH 4DGJA 1BTUA 4JZDH 1YCPK 1C2IA 1J9CH 4I32A 3S9BA 2R2MB 5FX5A 3H7OA 2Y5FA 2IOTA 5CHAC 2ZGBH 2Y81A 1C5LH 2BX4A 4K2YA 4GCHF 1A7SA 1P02A 1T4UH 6LPRA 2Y5GA 4FUFA 5EGMA 2A1DB 5C5OA 1THSH 3PLBA 2W7SA 8GCHF 2YNBA 2FESH 1BTWA 4FUBA 2BQ7B 2PTNA 3KIDU 1O2TA 1C5PA 3GOVB 2GVFA 2WYGA 1G3CA 2KZ4A 5HIZA 1ZMJA 1PYTD 4HG6A 1GHAG 3L3TA 4ZROA 1IQKA 1YLNA 1K1JA 2ZA5A 7ESTE 1SGEE 2TGTA 3QX5H 3CS7A 1IQJA 1D3TB 4NZQA 1BIOA 1EB1H 1GJ6A 1UK3A 5DJ7A 4NFEA 2WYJA 5ETXA 1EAIA 3AW0A 1VJAU 2CHAB 3MO9A 3TK9A 4KP0A 2G4UA 1J8AA 2PLXA 1DSUA 2WPLS 1J17T 3DCLA 3EE7A 3E0PB 4Z0KA 4RKJB 3RXUA 2ZU3A 3MFJA 3PMJA 5DSFA 5C20A 1FQ3A 1V2NT 2VJ1A 2Z9GA 2ZTYA 3PV2A 2ZFPH 2XXLA 4Q80A 1VZQH 2BYAX 2AYWA 1UTMA 3GCTG 5L2ZH 3KQEA 4INKA 2WPKS 4Y71A 1T8OA 5F6MA 1FAXA 2F9UA 3PMAB 3QTOH 5DP6A 3SI3H 2WPJS 3PM3A 5E0JA 2ZCLP 3STJA 5CMXH 4ABJA 2KAIB 3P92A 2PUXB 2Q6GA 2PV9B 3SUFA 2WINI 2R3UA 1S5SA 5GCHF 3RP2A 2UUKB 1IQEA 3HKJB 4YM9A 1GMCG 7KMEH 3GYMA 2F9BH 2BQ6B 6GCHF 2F83A 2ZFTA 1SLUB 2BDBA 1AB9B 1C1RA 1FPHH 3U69H 2G4TA 1NS3A 3PMHB 4RI0A 2CN0H 3TJUA 1D3DB 6ESTA 1GBIA 3FO8D 4FXGH 5DP7A 3RMOH 1XMNB 1DWEH 4OS6A 1P3CA 4ABAA 2WV4A 2OC0A 1AKSA 5C0TA 1FDPA 3SV2H 3U9AH 3LT3A 1HLTH 3GY5A 3SJOA 2ZG0H 1RS0A 2K8IA 4I8GA 2EI6A 1C1MA 2FYQA 2Z9LA 3ZZCA 1P03A 1GI8B 2GV7A 1KXCA 2XBVA 1KLTA 1PPGE 1KXBA 2EI7A 2XBWA 2F9NA 4AGKA 4A5TS 1MAXA 4D8NA 2PGBB 3AASA 2YOLA 4X1QU 3UNSA 2ANWA 5F8XA 1EJNA 3NXPA 5C1XA 4MNXA 1YPGH 2HVXA 4BAQB 1WYKA 3RXFA 1C5RA 1WOFA 1IQFA 3SGQE 2AIPA 2CJIA 2W5EA 2NWNA 2XBYA 1QB6A 1ZTLA 1O2GH 2EQNA 1H8DH 3LH1A 3OYPA 3OFND 2KFWA 3SJ9A 2ODQA 1EPTB 2D26C 1G2MA 5GDSH 3A81A 4ZXXH 4MPUA 3BTWE 1PPZA 1RTLA 1O34A 2RG3A 3VB3A 1J14A 4DT7B 1QBNA 1GL0E 3GY6A 1Y3UA 2SGDE 2QYIA 2A5KA 3F0OA 1TX7A 3P8FA 5JBCS 2BDHA 2QF4A 1HDTH 5EQRA 3UQOA 2FPZA 3T26A 1AB9C 3ITIA 1BHXF 1DOJA 1YBWA 2JJ1D 5H4IB 2AMDA 4UDWH 1VCQA 1NT1A 1P06A 1O39A 2B5TB 2SGEE 2FOFA 1EAWA 3LDXH 3QN7A 3PLPA 3URDA 4UEHH 3ZVGA 3RXJA 3RMNH 5FXLA 2ZPRA 3UPEA 2ZCHP 1Y5BT 2HPQH 3SZNA 2LP6A 4BNRA 3RXPA 2JETB 1QL8A 5JYIA 1F2SE 1FONA 1KLJH 4FOUC 4CREA 1S81A 3RUOA 2QN5T 5A0AE 3LC5A 1GMDF 5EJLA 1V3XA 4HFPB 1WAYB 4WMDA 2WPHS 5GIBA 3F9GA 3ZV9A 3DA9B 3MH6A 3MU1A 3SNBA 2PKAA 5EXMA 3SNDA 3EYDA 3M5LA 3RXHA 1Y5AT 1MCVA 1S6FA 5DP4A 1LHCH 1NESE 1G3DA 5I46H 5DP5A 4SGAE 3ZZ4A 1DWDH 1Y8TA 3URCA 1FN8A 3R3GB 3VB5A 3BTFE 1O33A 3FVFB 2VIVA 1AZ8A 4Y10E 2PKSC 1EZQA 1PQ7A 2ASUB 1IHTH 4DT4A 1MU6B 4IC6A 3SU3A 5T6GA 3SHAH 3LGUA 1P01A 5F53A 1NU7B 1FUJA 3ATKA 1BRBE 1TQ0B 2P3FH 1E35B 4NG9H 1SQRA 1Z8IB 2I6QA 1TPOA 3SNAA 1VCWA 4B6EA 3T29A 5EPNA 1HB0B 2XWBI 2ZGJA 4DURA 3B23B 1GG6B 2W6ID 1NRPH 1SL3A 4FUDA 5FPYA 1W7XH 2QC2A 4OGYA 2STAE 1O3EA 1NRSH 3BG4C 4ISLA 1O2KA 1HRTH 1TMBH 2JJ2D 2J4IA 5T6FA 4AG1A 1RGQA 1BMNH 1VITG 4KKDA 1WTGH 5C3NA 2BY6X 3V7TA 1H8ED 1XUFA 2ZC9H 3S7KB 2Y5HA 1TNLA 2SGQE 1EZUC 4J1YA 1Z8JB 2EI8A 3DSPA 3QLPH 1C1NA 2LELA 4I7YH 2FOAA 1YPKH 3GY8A 1MCTA 1GHWH 4YESB 4XBDA 3AVZA 1J16A 1ZJKA 1ZRKA 2J98A 3T2NA 4GSOA 2BLOA 2BQWB 1Z1JA 4MTBA 1CO7E 1C1QA 1GHBF 1HAZB 1TNHA 1Y3XA 2Q6DA 5A0CA 2AFQB 4YOJA 4Q63A 1O3HA 1YPHC 1E1QD 1HGTH 2QXHA 1KXEA 2C8YB 1XM1A 4E7NA 5JB8S 1SOZA 4CH8B 1ANBA 2FOBA 2ZTXA 2EC9H 2KCOA 2UWOA 7GCHG 3SQEE 2W6JD 4E7RG 2BLQA 2V0BA 3BTEE 2BDGA 8GCHG 1ORFA 2FOGA 1AE5A 3HKIB 1QURH 2G00A 1NRRH 1HPGA 2BY5X 3SU1A 4TPIZ 1W14U 1YF4A 1UVSH 3NZIA 1QRXA 3A88A 1SQOA 3TJNA 1ZPCA 1X7AC 4VGCC 1S0RA 2J9NA 4FU8A 3S69A 4CR5A 3LH3A 1LVYA 5HXFA 1ELAA 4NSYA 4FUGA 3D62A 1V2WT 2C90B 4ABHA 2K0QA 1IAUA 2ZDKA 2ZHDA 3K2UA 1CA8B 1YM0A 1GJ4H 1FNIA 4ZMAH 1BITA 2FWWA 2XC4A 2GZ9A 1YYY1 3EDXB 2PGQB 1ZOMA 2Y82A 1QBVH 3S0NA 1Z6JH 4B1TA 3RU4E 1Q2WA 4FU7A 4FUCA 2TIOA 4ZHLU 1KYNA 2ZECA 4O03A 1D3PB 1A0HB 4A92A 2HVYB 3FP6E 1UTNA 3GCTF 1ZGIA 4XD7D 1TALA 1FX0B 3M3SA 1H1BA 1GG6C 1XVMA 1TLDA 1MMJN 3SN8A 5CDFE 1O3CA 4NIVA 2QF0A 1G36A 2YNAA 4D7GA 1DDJA 1WV7H 4WMFA 1BMMH 1K2I1 1HAVA 4I8LA 2YMSC 1HJAB 1HXEH 4I86A 3QGJA 3RXMA 2Z7FE 1B0FA 1CVWH 2P94A 4ZKNU 3A85A 3A7TA 5HM2A 1AN1E 2XBXA 1UCYE 2NU3E 1C5XB 2HOBA 2HNTF 1QBOA 4NIWA 1NU9A 1GDUA 3TLOA 2WSSD 2FOEA 2W3IA 3PWCA 3M36A 2PTCE 5HGGA 1MTSA 2PKAB 3IITA 4ESTE 4MPWA 1EZSC 2OXSA 3M5MA 1GBTA 3KQDA 2OLGA 2OBQA 2A4QA 3BTME 3EA9A 2NU1E 1H8IH 1XVOA 2P3TB 4X1NU 3KN2A 4AOQA 1DY9A 1O3OA 1MTNC 4OS7A 3BTDE 1W0ZU 4A7IB 5JB9S 1P05A 4OS2A 2C4FH 3UIRA 3L33A 1OHHD 4CBOA 2VU8E 1W2KH 1O5GH 4B6FA 1ZR0A 2AIQA 5E8EH 2AMQA 4Y6DA 1O2LA 1F5KU 3RLYH 3SJIA 1G32B 3SV6A 1TPPA 2C8ZB 3DSGA 1G3BA 5TJXA 2HWLB 2J95A 1P9SA 4ZH8A 3LU9B 3MNXA 3SO3A 2PHBA 5DP3A 3FP7E 1W0JD 3D65E 2SGPE 2FM2A 3R0FA 3IWMA 4UFGH 1LHDH 1O3JA 2IPHA 1IOEA 3SU5A 4AYYB 1T7CA 1GI0A 2TRMA 3JZ2B 4X6OA 2ZZUH 3GDVA 1OXGA 5GJ4B 2BLVA 1PPEE 2XCFA 3K9XB 3CENA 1S82A 3N99A 4X1SU 4BANB 3LJOA 3VGCC 1LHGH 3QO6A 2VB0A 2CK3D 1K1PA 1D6WA 3RMMH 1SMFE 1YLDA 1SLVB 1ANEA 1ESBA 2QF3A 1N6YA 2P8OC 1A3BH 4YT7H 2F91A 1DM4B 3GY2A 5HIYA 2GX4A 3U98H 5DP9A 2ZU1A 4LZ4B 2XRCA 2ZQ2A 3ZVAA 2ZDLA 3MO3A 5EW1H 2Z3EA 1PJPA 3GY3A 2WUBA 3SUEA 1C1PA 2Z94A 3GY7A 3WW7A 4X2WA 2BXUH 1CSOE 1OOKB 1MBQA 2GV6A 1K1LA 4FUHA 1HAHH 3VB6A 5L6NH 4TSFD 1ELDE 3K6ZA 4JMYA 3BTKE 2BTCE 4WH6A 4CHAC 3C1KA 4OS4A 2TGAA 1RTFB 3GICB 2HPPH 2OQ5A 1ZLRA 4A1VA 1O2OA 3M7UA 3HGNA 2VNTA 3TJOA 1Y3WA 3ZIAD 1YCPH 3SU0A 2L74A 4X6NA 1O5AB 1H9LB 2I6SA 3LGWA 4RSPA 2GKVE 2BD7A 4JYUH 1TGSZ 1UVUH 6CHAC 2QXGA 1GHVH 2GZ8A 2BVRH 2QF5A 1ANDA 9ESTA 1MABB 3FAOA 3MWIU 3VGCB 1TPSA 2HLDD 2AGIX 1O5BB 4BTUB 1MKWK 3O8CA 3C27B 3PV4A 1W13U 3VB7A 5EXLA 4XSKU 3TGJE 4LOYH 1SGQE 1W3CA 3HK3B 4NZLA 2GP9B 5EU8A 1C1SA 2CV3A 4GAWA 1LDTT 1BA8B 1A1RA 1A61H 3ESTA 1NFUA 4CRBA 2OC8A 3BTQE 1INCA 2BY9X 1WBGB 5TCAA 4CHAB 4WWYA 4MPXA 3L6PA 4ABIA 4BAMB 2AH4X 4HTCH 1S85A 1GI2A 1A3EH 4ZAEA 1C5NH 1UVTH 1MU8B 1TYNA 1QZ8A 1O5EH 1QL7A 3RU4T 5FX6A 1O30A 1YP9A 1FIZA 1C2DA 3NK8A 2GZ7A 1HAOH 5C94A 3EA7A 5GXPA 1GBLA 1YLCA 3EA8A 3NCLA 1V2PT 4Q7XA 1IQNA 5I25A 1NM6A 1DPOA 4Y76A 1A2CH 5JPMH 1AVXA 3KYFA 1O2VA 4UONA 3RM2H 4B76A 1G30B 3EE0B 1E79D 3WWFA 1GMHG 1K0HA 1SGFG 2ZGCA 2TBSA 1C4V2 1SGIB 3U8OH 3P6ZB 3ENSB 1EJMA 1TBRH 2XW9A 3RLWH 3KNXA 3GDUA 1CA0B 1QY6A 4ISOA 1OP0A 4TY6A 1TRYA 2PW8H 4NA8A 2TGPZ 3RDZA 1JRSA 2R0LA 1AVGH 2FMJA 3ZZ3A 2SNWA 2OC1A 2ZIQH 2BD5A 1GBDA 4YOGA 5F8ZA 4DW2U 3OU0A 4DIHH 4DIIH 1T8LA 1QA7A 2BB4A 1HXFH 2FI5E 3TNSA 3VPKA 4ZCNA 2BDYA 2BD9A 1O0DH 2ESTE 5T1VA 3OEED 4ISHH 4TY7A 3PMBB 1NROH 5AVDA 2F4LA 4GHTA 1ZRBA 1YGCH 3LJJA 4DVAU 1K22H 1FAKH 2H9TH 2O8MA 3WY8A 1UCYH 3UR6A 1DXPA 1BMLA 2CGAA 2B9LA 2QY0B 1C2EA 2PFEA 4XE4A 2DE9A 1XKAC 1P2QA 1AFQB 4U2WA 3U28C 2IN2A 4F49A 1GMCF 1SG8B 1N8OB 3KQCA 1N1LA 2OP9A 3F9HA 3Q76A 1MD8A 2W7UA 3NWUA 2EA3A 2FI3E 3CP7A 4NGAH 1QB9A 1BMFD 1W7GH 2PUQH 3FN8A 1PPCE 2Y80A 1O5FH 1RFNA 1ZGVA 4INHA 2J5UA 1DVAH 1XUGA 4ACAA 2M2AA 4AFQA 1JMOH 3PO1B 3K6YA 1C1WH 4ISNA 2H9EH 1TMTH 2P95A 1GBHA 3PROA 1GI1A 4IBLH 3A86A 1MTWA 3GCHB 3IG6B 3O8DA 2FEQH 2VWOA 2RDEA 2BD2A 1KTSB 2EEKA 1TGTA 3PO1C 3RXKA 1V2ST 3SHCH 3RM0H 3BIUH 4I33A 5A09A 2H5DA 4LZ1H 2VIDA 4ACBA 2AGGX 1EATA 1FY5A 4BTTB 1BT7A 7LPRA 1Z1IA 3PB1E 5J4QA 1O3PB 3MO6A 1MQ6A 2P3UB 3BG8A 3FKSD 2HNTE 3SUGA 1WDIA 3MTYA 4K1EA 2BVSH 1C2GA 1QJ6B 3SU4A 1W0KD 2RFKC 2KX4A 5DP8A 2FS8A 1GCTB 4K1SA 4MVNA 1F0SA 4R0IA 1F0UA 1SI5H 3DD2H 6GCHG 1LHEH 3KCGH 4NIXA 2WV9A 5C2ZA 1P8VC 1ESAA 2LPRA 4CRAA 4H4FA 1ELGA 1HNEE 2ZKSA 1O32A 4F4OC 1NFXA 2O8TA 1BTXA 1ZSLA 4ZHMU 4VGCB 2G55A 1O2HA 1E38B 1OKXA 1DITH 1O3GA 1EKBB 3S7HB 4DOQA 2OD3B 2GGVB 1XUHA 4K69A 1TQ7B 3A84A 1TMUH 1TOMH 1ABIH 1CHOG 4Q4LA 1GGDC 3SNEA 4BTIB 3P8NA 3FFGA 1V2TT 1A5GH 1QJ1B 3T27A 4AZ2B 4E06H 2FXRA 1ZMNA 2ALPA 4JZ1A 3QUMP 1AKSB 3W1EA 1GI3A 1BBRK 1A5IA 1WCZA 3B9FH 1KXDA 3FZDA 2QXJA 1CGHA 3RC4A 1DICA 1GJ5H 2W3KA 1GI4A 1TABE 2QE7D 2GD4B 2YMSB 2ANYA 3B8JA 3G01A 2ZWLH 5B6LA 3F9FA 5A8YA 5A8XA 1ELTA 2KAIA 5FHTA 1GBAA 1FN6A 5CHAB 2UUJB 1EX3A 3ZYEA 1B5GH 1P3EA 5GPIB 5PTPA 1SKYE 1T4VH 5AF9H 2F9PA 2G5VA 4GVUA 3Q3XA 1QRZA 3HPTB 1PYTC 2GCHF 1LQDB 3ZVFA 4HGCA 2XNIA 3D49H 5C0UA 1GBJA 2RCEA 3A7XA 3DFJA 4X8UH 3MYWA 2PWXA 1XUJA 2H5CA 1RTKA 1NC6A 4OS1A 3TU7H 1ABJH 1GDQA 1SGDE 3SZEA 2Q6FA 4WH8A 3RXQA 4X2VA 5E0GA 1XX9A 1W10U 2BMGB 2VVVA 3N7OA 1TB6H 1P2KA 3E91A 1P57B 4NWLA 1LPKB 1PQAA 4FUIA 3T28A 1EJAA 1QR3E 1SLXB 1YPEH 2V3OH 5KGOA 1C1TA 1CGJE 1ZSKA 1BZXE 3A83A 1C2FA 3U1IB 1XKBC 3SGBE 4Z6AH 1C1VH 2HRVA 4I8HA 3RXRA 1AUTC 5EODA 3E1XB 3I78A 9LPRA 2D1JA 1YC0A 4WY3A 1RIWB 1LPZB 4H6TA 2ZP0H 1O3IA 5AHGH 5EOKA 4CRDA 1JIRA 1H8HD 1ELCA 1C2LA 2P8OB 1EPTC 2BOHB 3BEUA 1QRWA 2FOHA 3F2GA 3RXSA 1QA0A 2M5TA 2FI4E 3F3BA 1CHGA 3VB4A 2XC0A 1CE5A 1Z6EA 1THRH 3MU8A 1UCYK 5L30H 3MNCA 3F9EA 2FOCA 3STIA 3BTTE 1TIOA 2TGDA 3SUDA 3SJKA 4OGXA 3UOUA 1BQYA 3T25A 1W0YH 1P2OA 1P9UA 2H2ZA 4B2CA 1V2QT 2W26A 1DY8A 3RXCA 3KEEA 3MH7A 1K9OE 3RXGA 1EUFA 1EPTA 3RU4D 1O35A 2G51A 3RXOA 1BTZA 3RXEA 1HAVB 1BCUH 1GJCB 1MUEB 3TK5A 1LTOA 1VKYA 1RD3B 2Q1JA 1FY1A 1EP6A 1SQAA 1AQ7A 3ZVEA 1ZJDA 3WWBA 2G5NA 5EQSA 1TGBA 4D9QA 1TGCA 4H42U 1NRQH 4JK5A 4RT0A 1SGRE 1GVKB 3F68H 1GHZA 1SGPE 5CE1A 2ZGXH 2GCTC 1KXAA 1TA6A 3ZZDA 1D3QB 4WMEA 2STBE 4R8TB 1GGDB 1B0EA 2SGAA 5GCHG 1EAXA 1T31A 4MLFB 2NU0E 5DK1A 2JH5D 5E2OA 5C1UA 4ZKSU 2FO9A 3M5NA 1L1GA 3OAAD 2BXTH 1V2RT 4LXBH 1S6LA 3UB0A 1NBME 4RKOB 2P16A 1GI7B 1HV7A 3NPSA 2OUAA 1HJ9A 2BM2A 3A87A 1KXFA 1Z8GA 1JIMA 1AIXH 2P93A 2BD3A 5C5NA 2BVXH 2A7CA 1EXFA 2A0QB 1SC8U 2VGCC 1C5MD 1Y59T 4XBCA 1C9TA 5EJ1A 3UNQA 4I8JA 1EAUA 3E0NB 2A4OA 2QCYA 1G2LA 2R0KA 2ZCKP 4GHQA 2HALA 1PPHE 3OTPA 1ELFA 1H9IE 2FP7B 3RXAA 3M35A 5LPRA 3E90B 1O36A 1MTUA 5C17A 4NA7A 1E0FD 4K5ZA 1EB2A 2GT8A 4IS5A 1SOTA 2FZZA 3UY9A 1TX8A 1GDNA 1RXPA 3RXBA 4TWYA 4JYVH 1UK4A 3SOSA 2YMSD 2FS9A 5ABWA 4I31A 1GJ9B 3SV8A 1BHXB 2HLCA 3TGKE 1V2UT 2PSYA 1GWAA 3A7ZA 1BRAA 4DCDA 2ZFFH 1D6RA 4Q7YA 8ESTE 1P2JA 3TH4H 5FCKA 2QIQA 3QK1A 3KHVA 1E37B 4B74A 1AGJA 2A31A 3FP8E 4XOJA 2ZPQA 3OY5U 2OQUA 3NUMA 4BXWA 1O2IA 2QV1A 1ETTH 3T5FH 4AFSA 1N6XA 2VVUA 1HBTH 1UTQA 1KY9A 1ZSJA 3Q77A 1ELBA 1ID5H 2ILNA 1FMGA 1O38A 2GDDA 4YXWD 1F92A 2RA0A 2ZTZA 4BOHA 3PYHA 2TPIZ 1L2EA 1O2XA 3A82A 2F9VA 2SNVA 1M9UA 2B8OH 4INLA 3H5CB 1G37A 3MI4A 4ZKOU 4E05H 2A45B 2JIZD 1HAYB 4IN1A 1NO9H 3ZZ5A 1WQSA 1ELVA 5A0BA 1DXWA 4JYTA 1NFYA 3QDZB 5EJZA 5LPFA 3MU5A 3ODDA 1CGIE 1O31A 1K1MA 2FTMA 1BMAA 4Y8XA 1UVOA 3GDSA 1AD8H 3LOXA 2C8XB 1UJ1A 1V2VT 3MOCA 1JBUH 4CR9A 1QTFA 2J34A 4OM9A 4KTSA 4U32A 3A8CA 1QL9A 1KIGH 4IMZA 1Z8RA 4Y0ZE 4IMQA 4A1TA 3E6PH 4IGDA 3F1SB 4YLUA 1TNGA 1U6QA 2C3SA 3M7QA 1HUTH 1TRMA 5CHBA 2BOKA 1O2MA 3PRDA 1H4WA 2GJGA 2JDID 4BXSA 4ABBA 2VH6A 2CF9H 3M3TA 2FOMB 1UHBA 4QT8C 1LCYA 5FPTA 3PTNA 1VJ9U 2A4GA 3FANA 3PV5A 4BAHB 1SR5C 4Y11E 1GMDG 1MZAA 4GPGA 5FBIA 1AI8H 3RC6A 1PQ5A 3F6UH 3KQ5A 1OP8A 4K1TA 3UTUH 1QNJA 2ZNKH 1SFIA 3QWCH 2WPMS 1IQHA 3ATWA 1YWUA 2QA9E 1NY22 1XXFA 1ZTJA 4Y8ZA 3LGIA 1P04A 3TPIZ 1BDAA 4AB9A 1GHAF 2B7DH 3ODFA 1BTHH 5C1YA 2OK5A 4RT1A 1LKAA 1IHSH 3TIUA 4D9RA 2Z3CA 2HGTH 1ZHMA 5LPEA 4ZUHA 4BAOB 4KTCA 5F8TA 4YTAA 1E36B 1OSSA 4JK6A 1UVPA 5JBBS 1DLEA 1V2MT 3EAJA 3DUXH 1TNIA 1C2KA 3AAUA 5LH8A 1AMHA 1C4Y2 4AB8A 2ZHWH 1A0JA 1ELEE 5IDKA 1IQLA 4AC9A 1OWKA 1TGNA 1DFPA 4XRNA 1WQVH 3LONA 1VGCB 4CH2B 3KL6A 4D7FA 1UTPA 1CA0C 3TJVA 1AU8A 1QFKH 3BSQA 3K65B 2XOKD 2P59A 1DSTA 1OS8A 4X2XA 4X0WU 4Z1MD 3EQ0H 1UW7A 1O2SA 3SV7A 2B0FA 3TK6A 4IW4E 1JRTA 3LGVA 2FTLE 1AY6H 1MBMA 4UD9H 5T3HA 1TPAE 5HMAA 5HYOA 1IQMA 2QXIA 3OTJE 1GBBA 4JZIA 3SYJA 1C2MA 1YKTA 3ZVBA 1N8OC 1GHBG 4TT3D 1TA2A 5EW2H 1WTHD 4DG4A 1CBWB 1K28D 1BBRH 1ACBE 2BD4A 2O8LA 1Q31A 1P09A 1ANCA 2FODA 2ZDNA 3SV9A 3F2HA 4XBBA 4YOIA 5KECA 1NN6A 1Q3XA 2J38A 2ODYB 4GUXA 1IQIA 1P2MA 3W95A 1FPCH 1L4ZA 2H1UA 3LKWA 1FJSA 4P02A 4AORA 5FL7D 5IK2D 3ZV8A 3CNRA 4ISIH 1GJBB 1O2ZA 3N7EA 4Y79A 2SGFE 1Z71A 1F5RA 4MNWA 4JZFH 1SGFA 3Q3KA 2VBCA 2WPDD 2ZGHA 3QGNB 2NU4E 2ULLA 2ZDMA 4FVBA 1SFQB 3LIWA 5FCRA 4MG3A 1BBRE 1LVMA 1OWJA 5F03A 4A6LA 3TITA 1ARBA 5JBAS 3I29A 3VG8A 2WV5A 1QGFA 4B2BA 3U1JB 1JXPA 1T8NA 1CBWC 3UWIA 1O5CB 1NFWA 2NU2E 2A5AA 3EGKH 1GJ7B 3RMLH 2PP6A 1BUIA 5GNDA 1T8MA 1KMHB 3GCHC 1HIAB 1S6HA 4UFEH 2A32A 2ZU4A 3BV9B 1MQ5A 1XUIA 4X1RU 1F7ZA 1GJDB 1TNKA 4WVPE 3ZZBA 2ANMH 1OYTH 2JKHA 1UTKA 2UWLA 2BLWA 2C8WB 2G81E 3O8BA 5DO4H 1FZZA 1G3EA 1LO6A 1WXRA 1XUKA 1ARCA 1V2LT 1YPMH 3M37A 3SI4H 2ANKH 4MNYA 4Q7ZA 2VWMA 3Q3YA 1GHYH 1XXDA 3KGPA 5ESBA 1DUEA 1LHFH 1PQ8A 2H6MA 3CS0A 4WF8A 1COWD 4MNVA 1GVZA 1MKXH 2ZDAH 2CF8H 1MH0A 5FBEA 4AFZA 2BDIA 3BF6H 4AYVB 1C5TA 2Z3DA 2BDCA 2KCAA 3A89A 1EP5A 2OINA 4WXIA 2C93B 3V12A 3DT0H 4X1PU 4AGJA 1DE7H 3H09A 4ZKRU 1AFEH 1GBCA 1ETRH 2ZFQH 1TE0A 3GYLB 1FY3A 1OWHA 1PPFE 2ZQ1A 2BDAA 3SU2A 3SU6A 1Z7KA 1DUAA 5GWZA 2FDAA 4YT6H 1ZTKA 1CT4E 3VXFH 1CT2E 3TH3H 4FU9A 1L1JA 3MHWU 3VFEA 4JCNA 3PLKA 1QB1A 2O9QA 3HGPA 1HAIH 1YCPM 2KR7A 4K8BA 1ZPBA 4UFFH 2RDLA 4CRFA 5G4BA 1W11U 1AHTH 3GISB 4U01A 3V0XA 2ODPA 1W8BH 1J15A 5E2PA 2PKSB 2EY4C 4Y7AA 4LK4A 5IYTA 1GL1A 1K1NA 2ZF0H 1L0ZA 1SVPA 1BB0B 3KF2A 4Q2KA 1V2OT 1OPHB 3BEFB 4NA9H 2Y7XA 1MZDA 2ZHFH 3P8OA 3BN9A 2V35A 4O9VA 4UE7H 1MAYA 2HNTC 2IJD1 1OYQA 1A0LA 3E3TA 4MDSA 1ETSH 1O2YA 3FZZA 3QZQA 4KGAA 1TBQH 4FUJA 1O2RA 5T6DA 1E34B 2SFAA 1OWDA
chains in the Genus database with same CATH topology
1K0HA 2KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0H A;  2KX4 A; 
#chains in the Genus database with same CATH topology
 3ZZA A;  2J92 A;  2GCT B;  3E8L A;  2ZHE H;  3V13 A;  4F48 B;  3UNR A;  4AX9 H;  1SGN E;  1WUN H;  2GCH G;  5A8Z A;  3BTG E;  3DSO A;  4J2Y B;  3MU0 A;  3M61 U;  1AE8 H;  1GBE A;  2PSX A;  2JET C;  2R9P A;  5SGA E;  2A7H A;  5JBT A;  2DUC A;  1YY3 A;  1EAS A;  1CQQ A;  4TPY A;  1O3M A;  3TGI E;  3A80 A;  1O3D A;  2OTV A;  1DT2 A;  4I8K A;  2BY7 X;  3A8D A;  2VIO A;  5J4S A;  4O97 A;  2J97 A;  2BZA A;  2R3Y A;  3SGA E;  4HI3 A;  1LVB A;  1ZPZ A;  2WZQ A;  3ZZ9 A;  3ZYD A;  5LGO A;  2V3H H;  1GBK A;  2F9O A;  2FLB H;  4X8S H;  3PRB A;  3HAT H;  2BZ6 H;  3M3V A;  3P17 H;  3SBK A;  1EZX C;  2V3M A;  4KEL A;  1LQE A;  1SPJ A;  4O3T A;  1P12 E;  1O37 A;  1TBZ H;  2VIQ A;  2QGR A;  4B73 A;  3OX7 U;  5DKM A;  2O8U A;  3UAI C;  7GCH F;  4CBN A;  2DE8 A;  3RXD A;  1TRN A;  3M5O A;  4GLY A;  3GCO A;  1AO5 A;  3A7W A;  4NWK A;  3I77 A;  4KTU A;  1DX5 M;  4F55 A;  2ALV A;  1MKW H;  4JZE H;  5FPS A;  1S84 A;  1SGT A;  3MH4 A;  4YLQ H;  2RA3 A;  4GCH G;  1L1N A;  3DFL A;  1F0T A;  4THN H;  4X8T H;  1BJU A;  1AWH B;  3BIV H;  4M9F A;  1QJ7 B;  1TX6 A;  3A7Y A;  5HM9 A;  1O2N A;  3UR9 A;  5DN6 D;  3A8B A;  1D9I A;  1HYL A;  3LGT A;  1HAG E;  1PPB H;  1TFX A;  3NKK A;  3P95 A;  4Y0Y E;  4AG2 A;  5JDU B;  3UQV A;  1G9I E;  1UTJ A;  2JH0 D;  5HKK D;  1UHB B;  1FY8 E;  1C5U A;  5DG6 A;  1H9H E;  3UFA A;  1RJX B;  1C5S A;  1YPH E;  4CRG A;  1UO6 A;  2VH0 A;  2Z6B D;  1LVO A;  2F3C E;  1GCD A;  1CT0 E;  1Y3Y A;  1O2U A;  3F2F A;  1UMA H;  1ZML A;  4B2A A;  3E16 B;  1C9P A;  1O3L A;  3W94 A;  1D4P B;  3SW2 B;  1FY4 A;  8LPR A;  4PRO A;  2ZU2 A;  4Y8Y A;  1S83 A;  2ZFR H;  1QHR B;  2AMP A;  3JZ1 B;  1GCT C;  2WHX A;  2CHA C;  3MMG A;  4FET A;  3MH5 A;  4ZHA A;  1K1I A;  2UUF B;  5BPE A;  2WPI S;  2ZHQ H;  1KLI H;  3GCN A;  3Q00 A;  2OCV B;  2IPQ X;  2J94 A;  3URE A;  4SGB E;  1FI8 A;  1UTO A;  2AGE X;  2VVC A;  3HK6 B;  4TWW A;  3TVJ B;  1P0S H;  1Y3V A;  1UTL M;  6CHA B;  2AEI H;  3N7D A;  3AK5 A;  1ZZZ A;  2KM0 A;  5K7R A;  2IJO B;  1HAP H;  1FV9 A;  2OC7 A;  4MPV A;  4XFQ A;  3A8A A;  1TOC B;  1AWF H;  1C5Q A;  2FIR H;  1SSX A;  4FVD A;  1GBM A;  1VCP A;  3GY4 A;  4HZH A;  4NFF A;  5AFY H;  4ABF A;  2A5I A;  2FX4 A;  1TON A;  1OWE A;  4RN6 A;  1QCP A;  4TYD A;  1BTY A;  1MD7 A;  1NTP A;  2XYA A;  4CRC A;  2OBO A;  1MKX K;  2UWP A;  4U30 A;  1V6D A;  5EXN A;  4ZXY H;  1NZQ H;  3OY6 U;  1GI5 A;  4K3J A;  3KYG A;  3P70 B;  2Y6T A;  2ZFS A;  3A7V A;  3MQK C;  5E0H A;  2Z9I A;  1GPZ A;  1MTV A;  2XWA A;  2UUY A;  1K1O A;  1O2W A;  2G8T A;  1DLK B;  3V3M A;  1O3A A;  1WSS H;  1FIW A;  1BTP A;  1LMW B;  1V2J T;  2BX3 A;  3PWB A;  2AER H;  1GJ8 B;  4Y7B A;  3P8G A;  1C5W B;  2L6O A;  2BY8 X;  2LNC A;  1C2H A;  3QTV H;  3VXE H;  2A2X H;  2VWL A;  1GJA B;  1O5D H;  2G52 A;  2GMT C;  2J2U A;  1SB1 H;  3AW1 A;  1O3F A;  1RRK A;  2ZI2 H;  3OSY A;  2VIP A;  1AVW A;  5C67 A;  1KSN A;  2KCY A;  3SQH E;  2KCP A;  1FLE E;  4M7G A;  1W12 U;  2VIW A;  2ZO3 H;  4IN2 A;  1P10 A;  1SHH B;  1C5Y B;  4ABD A;  3S9A A;  3ZZ8 A;  2Z9K A;  2JH6 D;  3ELA H;  4YO9 A;  4XDE A;  3ZVC A;  3RXI A;  1C5O H;  2XTT B;  3BEI B;  4ASU D;  2QAA A;  1HAX B;  1IQG A;  1O3B A;  2K1Q A;  4X2Y A;  5EIY A;  5K0H A;  2R2W U;  1LKB A;  4AFU A;  4YZU A;  1NBM D;  2XCN A;  3BTH E;  4B75 A;  1HCG A;  3UUZ A;  3VEQ B;  3UOP A;  1BJV A;  1JWT A;  1P11 E;  1UK2 A;  2A4R A;  1SGY E;  4NSV A;  1F5L A;  4UFD H;  1NRN H;  2FLR H;  1EOJ A;  2A7J A;  1EST A;  2THF B;  1HIA A;  5TCC A;  1YPL H;  1HJA C;  4AN7 A;  1JOU B;  1HJ8 A;  1A4W H;  2V6N A;  2VGC B;  3ATM A;  3S9C A;  5EST E;  1A5H A;  1QQ4 A;  3O8R A;  1MTN B;  2Z9J A;  3RXL A;  1ZHP A;  3NRL A;  1VR1 H;  1TAW A;  5A2M H;  1AZZ A;  2D8W A;  1C1O A;  1C5V A;  4O3U A;  1K21 H;  1S0Q A;  1Y5U T;  1DWC H;  2ZEB A;  3KQB A;  3LC3 A;  2XND D;  1BOQ A;  1EFR D;  2O8W A;  8KME 2;  2WUC A;  1RIW C;  1VGC C;  1E1R D;  1VIT H;  1CU1 A;  3M7T A;  1YPJ H;  2ZU5 A;  1SQT A;  1OP2 A;  2FX6 A;  4ABG A;  4X6P A;  3QZR A;  2D2D A;  4X6M A;  3SOR A;  5KED A;  1CHO F;  1O3K A;  1AUJ A;  3ZZ7 A;  1B7X B;  3TNT A;  5DGJ A;  3SJ8 A;  4K8Y A;  3F0P A;  3U8T H;  1O2J A;  4H6S B;  1A46 H;  2J98 B;  2GTB A;  3LGY A;  5EQQ A;  3FOA A;  1C2J A;  1ZHR A;  4DY7 B;  3RXV A;  1O2Q A;  3ATI A;  1GI9 B;  3H7T A;  1THP B;  4WXV A;  2AS9 A;  2VWN A;  4FUE A;  5DPA A;  1ZYO A;  2V7Q D;  3U8R H;  4D76 A;  1O2P A;  1QQU A;  2BHG A;  3MNS A;  4K60 A;  5FAH A;  4ASH A;  2PR3 A;  2Y7Z A;  1WU1 A;  2CXV A;  1KTT B;  4MQA A;  1SHY A;  1L4D A;  1NPM A;  4B71 A;  4X8V H;  4NIY A;  1TWX B;  1DWB H;  1GVL A;  3RC5 A;  1C5Z B;  3BG4 B;  3OE7 D;  1C4U 2;  1KDQ A;  1T32 A;  2CMY A;  2GT7 A;  1SBW A;  2F43 B;  5EPY A;  3ZVD A;  4NCY A;  4WJG 2;  1BRU P;  1C1U H;  1SLW B;  2ZPS A;  1OX1 A;  3T62 A;  2BD8 A;  1TNJ A;  1F0R A;  3MU4 A;  4P00 A;  1EQ9 A;  1PFX C;  3ATL A;  3GS9 A;  3D23 A;  1QIX B;  3LPR A;  4IC5 A;  3MNB A;  1SGC A;  1DS2 E;  1OWI A;  3TH2 H;  2H9H A;  5AFZ H;  5EG4 A;  1O3N A;  2GMT B;  2A2Q H;  1GBF A;  3PTB A;  1V2K T;  1P2N A;  2AHM E;  1KDQ B;  1VIT F;  4BAK B;  3UWJ H;  4DJZ B;  3RXT A;  5L2Y H;  1EOL A;  3SNC A;  1FXY A;  1GMH F;  1AFQ C;  3OEH D;  1HFD A;  1LPG B;  2FYR A;  2VIN A;  5B6O A;  5BRR E;  2XC5 A;  2ZDV H;  2GDE H;  1P2I A;  3ZZ6 A;  4A1X A;  4ABE A;  1GI6 A;  1BRC E;  3DHK H;  3AAV A;  4OS5 A;  1DAN H;  1GHX H;  4DGJ A;  1BTU A;  4JZD H;  1YCP K;  1C2I A;  1J9C H;  4I32 A;  3S9B A;  2R2M B;  5FX5 A;  3H7O A;  2Y5F A;  2IOT A;  5CHA C;  2ZGB H;  2Y81 A;  1C5L H;  2BX4 A;  4K2Y A;  4GCH F;  1A7S A;  1P02 A;  1T4U H;  6LPR A;  2Y5G A;  4FUF A;  5EGM A;  2A1D B;  5C5O A;  1THS H;  3PLB A;  2W7S A;  8GCH F;  2YNB A;  2FES H;  1BTW A;  4FUB A;  2BQ7 B;  2PTN A;  3KID U;  1O2T A;  1C5P A;  3GOV B;  2GVF A;  2WYG A;  1G3C A;  2KZ4 A;  5HIZ A;  1ZMJ A;  1PYT D;  4HG6 A;  1GHA G;  3L3T A;  4ZRO A;  1IQK A;  1YLN A;  1K1J A;  2ZA5 A;  7EST E;  1SGE E;  2TGT A;  3QX5 H;  3CS7 A;  1IQJ A;  1D3T B;  4NZQ A;  1BIO A;  1EB1 H;  1GJ6 A;  1UK3 A;  5DJ7 A;  4NFE A;  2WYJ A;  5ETX A;  1EAI A;  3AW0 A;  1VJA U;  2CHA B;  3MO9 A;  3TK9 A;  4KP0 A;  2G4U A;  1J8A A;  2PLX A;  1DSU A;  2WPL S;  1J17 T;  3DCL A;  3EE7 A;  3E0P B;  4Z0K A;  4RKJ B;  3RXU A;  2ZU3 A;  3MFJ A;  3PMJ A;  5DSF A;  5C20 A;  1FQ3 A;  1V2N T;  2VJ1 A;  2Z9G A;  2ZTY A;  3PV2 A;  2ZFP H;  2XXL A;  4Q80 A;  1VZQ H;  2BYA X;  2AYW A;  1UTM A;  3GCT G;  5L2Z H;  3KQE A;  4INK A;  2WPK S;  4Y71 A;  1T8O A;  5F6M A;  1FAX A;  2F9U A;  3PMA B;  3QTO H;  5DP6 A;  3SI3 H;  2WPJ S;  3PM3 A;  5E0J A;  2ZCL P;  3STJ A;  5CMX H;  4ABJ A;  2KAI B;  3P92 A;  2PUX B;  2Q6G A;  2PV9 B;  3SUF A;  2WIN I;  2R3U A;  1S5S A;  5GCH F;  3RP2 A;  2UUK B;  1IQE A;  3HKJ B;  4YM9 A;  1GMC G;  7KME H;  3GYM A;  2F9B H;  2BQ6 B;  6GCH F;  2F83 A;  2ZFT A;  1SLU B;  2BDB A;  1AB9 B;  1C1R A;  1FPH H;  3U69 H;  2G4T A;  1NS3 A;  3PMH B;  4RI0 A;  2CN0 H;  3TJU A;  1D3D B;  6EST A;  1GBI A;  3FO8 D;  4FXG H;  5DP7 A;  3RMO H;  1XMN B;  1DWE H;  4OS6 A;  1P3C A;  4ABA A;  2WV4 A;  2OC0 A;  1AKS A;  5C0T A;  1FDP A;  3SV2 H;  3U9A H;  3LT3 A;  1HLT H;  3GY5 A;  3SJO A;  2ZG0 H;  1RS0 A;  2K8I A;  4I8G A;  2EI6 A;  1C1M A;  2FYQ A;  2Z9L A;  3ZZC A;  1P03 A;  1GI8 B;  2GV7 A;  1KXC A;  2XBV A;  1KLT A;  1PPG E;  1KXB A;  2EI7 A;  2XBW A;  2F9N A;  4AGK A;  4A5T S;  1MAX A;  4D8N A;  2PGB B;  3AAS A;  2YOL A;  4X1Q U;  3UNS A;  2ANW A;  5F8X A;  1EJN A;  3NXP A;  5C1X A;  4MNX A;  1YPG H;  2HVX A;  4BAQ B;  1WYK A;  3RXF A;  1C5R A;  1WOF A;  1IQF A;  3SGQ E;  2AIP A;  2CJI A;  2W5E A;  2NWN A;  2XBY A;  1QB6 A;  1ZTL A;  1O2G H;  2EQN A;  1H8D H;  3LH1 A;  3OYP A;  3OFN D;  2KFW A;  3SJ9 A;  2ODQ A;  1EPT B;  2D26 C;  1G2M A;  5GDS H;  3A81 A;  4ZXX H;  4MPU A;  3BTW E;  1PPZ A;  1RTL A;  1O34 A;  2RG3 A;  3VB3 A;  1J14 A;  4DT7 B;  1QBN A;  1GL0 E;  3GY6 A;  1Y3U A;  2SGD E;  2QYI A;  2A5K A;  3F0O A;  1TX7 A;  3P8F A;  5JBC S;  2BDH A;  2QF4 A;  1HDT H;  5EQR A;  3UQO A;  2FPZ A;  3T26 A;  1AB9 C;  3ITI A;  1BHX F;  1DOJ A;  1YBW A;  2JJ1 D;  5H4I B;  2AMD A;  4UDW H;  1VCQ A;  1NT1 A;  1P06 A;  1O39 A;  2B5T B;  2SGE E;  2FOF A;  1EAW A;  3LDX H;  3QN7 A;  3PLP A;  3URD A;  4UEH H;  3ZVG A;  3RXJ A;  3RMN H;  5FXL A;  2ZPR A;  3UPE A;  2ZCH P;  1Y5B T;  2HPQ H;  3SZN A;  2LP6 A;  4BNR A;  3RXP A;  2JET B;  1QL8 A;  5JYI A;  1F2S E;  1FON A;  1KLJ H;  4FOU C;  4CRE A;  1S81 A;  3RUO A;  2QN5 T;  5A0A E;  3LC5 A;  1GMD F;  5EJL A;  1V3X A;  4HFP B;  1WAY B;  4WMD A;  2WPH S;  5GIB A;  3F9G A;  3ZV9 A;  3DA9 B;  3MH6 A;  3MU1 A;  3SNB A;  2PKA A;  5EXM A;  3SND A;  3EYD A;  3M5L A;  3RXH A;  1Y5A T;  1MCV A;  1S6F A;  5DP4 A;  1LHC H;  1NES E;  1G3D A;  5I46 H;  5DP5 A;  4SGA E;  3ZZ4 A;  1DWD H;  1Y8T A;  3URC A;  1FN8 A;  3R3G B;  3VB5 A;  3BTF E;  1O33 A;  3FVF B;  2VIV A;  1AZ8 A;  4Y10 E;  2PKS C;  1EZQ A;  1PQ7 A;  2ASU B;  1IHT H;  4DT4 A;  1MU6 B;  4IC6 A;  3SU3 A;  5T6G A;  3SHA H;  3LGU A;  1P01 A;  5F53 A;  1NU7 B;  1FUJ A;  3ATK A;  1BRB E;  1TQ0 B;  2P3F H;  1E35 B;  4NG9 H;  1SQR A;  1Z8I B;  2I6Q A;  1TPO A;  3SNA A;  1VCW A;  4B6E A;  3T29 A;  5EPN A;  1HB0 B;  2XWB I;  2ZGJ A;  4DUR A;  3B23 B;  1GG6 B;  2W6I D;  1NRP H;  1SL3 A;  4FUD A;  5FPY A;  1W7X H;  2QC2 A;  4OGY A;  2STA E;  1O3E A;  1NRS H;  3BG4 C;  4ISL A;  1O2K A;  1HRT H;  1TMB H;  2JJ2 D;  2J4I A;  5T6F A;  4AG1 A;  1RGQ A;  1BMN H;  1VIT G;  4KKD A;  1WTG H;  5C3N A;  2BY6 X;  3V7T A;  1H8E D;  1XUF A;  2ZC9 H;  3S7K B;  2Y5H A;  1TNL A;  2SGQ E;  1EZU C;  4J1Y A;  1Z8J B;  2EI8 A;  3DSP A;  3QLP H;  1C1N A;  2LEL A;  4I7Y H;  2FOA A;  1YPK H;  3GY8 A;  1MCT A;  1GHW H;  4YES B;  4XBD A;  3AVZ A;  1J16 A;  1ZJK A;  1ZRK A;  2J98 A;  3T2N A;  4GSO A;  2BLO A;  2BQW B;  1Z1J A;  4MTB A;  1CO7 E;  1C1Q A;  1GHB F;  1HAZ B;  1TNH A;  1Y3X A;  2Q6D A;  5A0C A;  2AFQ B;  4YOJ A;  4Q63 A;  1O3H A;  1YPH C;  1E1Q D;  1HGT H;  2QXH A;  1KXE A;  2C8Y B;  1XM1 A;  4E7N A;  5JB8 S;  1SOZ A;  4CH8 B;  1ANB A;  2FOB A;  2ZTX A;  2EC9 H;  2KCO A;  2UWO A;  7GCH G;  3SQE E;  2W6J D;  4E7R G;  2BLQ A;  2V0B A;  3BTE E;  2BDG A;  8GCH G;  1ORF A;  2FOG A;  1AE5 A;  3HKI B;  1QUR H;  2G00 A;  1NRR H;  1HPG A;  2BY5 X;  3SU1 A;  4TPI Z;  1W14 U;  1YF4 A;  1UVS H;  3NZI A;  1QRX A;  3A88 A;  1SQO A;  3TJN A;  1ZPC A;  1X7A C;  4VGC C;  1S0R A;  2J9N A;  4FU8 A;  3S69 A;  4CR5 A;  3LH3 A;  1LVY A;  5HXF A;  1ELA A;  4NSY A;  4FUG A;  3D62 A;  1V2W T;  2C90 B;  4ABH A;  2K0Q A;  1IAU A;  2ZDK A;  2ZHD A;  3K2U A;  1CA8 B;  1YM0 A;  1GJ4 H;  1FNI A;  4ZMA H;  1BIT A;  2FWW A;  2XC4 A;  2GZ9 A;  1YYY 1;  3EDX B;  2PGQ B;  1ZOM A;  2Y82 A;  1QBV H;  3S0N A;  1Z6J H;  4B1T A;  3RU4 E;  1Q2W A;  4FU7 A;  4FUC A;  2TIO A;  4ZHL U;  1KYN A;  2ZEC A;  4O03 A;  1D3P B;  1A0H B;  4A92 A;  2HVY B;  3FP6 E;  1UTN A;  3GCT F;  1ZGI A;  4XD7 D;  1TAL A;  1FX0 B;  3M3S A;  1H1B A;  1GG6 C;  1XVM A;  1TLD A;  1MMJ N;  3SN8 A;  5CDF E;  1O3C A;  4NIV A;  2QF0 A;  1G36 A;  2YNA A;  4D7G A;  1DDJ A;  1WV7 H;  4WMF A;  1BMM H;  1K2I 1;  1HAV A;  4I8L A;  2YMS C;  1HJA B;  1HXE H;  4I86 A;  3QGJ A;  3RXM A;  2Z7F E;  1B0F A;  1CVW H;  2P94 A;  4ZKN U;  3A85 A;  3A7T A;  5HM2 A;  1AN1 E;  2XBX A;  1UCY E;  2NU3 E;  1C5X B;  2HOB A;  2HNT F;  1QBO A;  4NIW A;  1NU9 A;  1GDU A;  3TLO A;  2WSS D;  2FOE A;  2W3I A;  3PWC A;  3M36 A;  2PTC E;  5HGG A;  1MTS A;  2PKA B;  3IIT A;  4EST E;  4MPW A;  1EZS C;  2OXS A;  3M5M A;  1GBT A;  3KQD A;  2OLG A;  2OBQ A;  2A4Q A;  3BTM E;  3EA9 A;  2NU1 E;  1H8I H;  1XVO A;  2P3T B;  4X1N U;  3KN2 A;  4AOQ A;  1DY9 A;  1O3O A;  1MTN C;  4OS7 A;  3BTD E;  1W0Z U;  4A7I B;  5JB9 S;  1P05 A;  4OS2 A;  2C4F H;  3UIR A;  3L33 A;  1OHH D;  4CBO A;  2VU8 E;  1W2K H;  1O5G H;  4B6F A;  1ZR0 A;  2AIQ A;  5E8E H;  2AMQ A;  4Y6D A;  1O2L A;  1F5K U;  3RLY H;  3SJI A;  1G32 B;  3SV6 A;  1TPP A;  2C8Z B;  3DSG A;  1G3B A;  5TJX A;  2HWL B;  2J95 A;  1P9S A;  4ZH8 A;  3LU9 B;  3MNX A;  3SO3 A;  2PHB A;  5DP3 A;  3FP7 E;  1W0J D;  3D65 E;  2SGP E;  2FM2 A;  3R0F A;  3IWM A;  4UFG H;  1LHD H;  1O3J A;  2IPH A;  1IOE A;  3SU5 A;  4AYY B;  1T7C A;  1GI0 A;  2TRM A;  3JZ2 B;  4X6O A;  2ZZU H;  3GDV A;  1OXG A;  5GJ4 B;  2BLV A;  1PPE E;  2XCF A;  3K9X B;  3CEN A;  1S82 A;  3N99 A;  4X1S U;  4BAN B;  3LJO A;  3VGC C;  1LHG H;  3QO6 A;  2VB0 A;  2CK3 D;  1K1P A;  1D6W A;  3RMM H;  1SMF E;  1YLD A;  1SLV B;  1ANE A;  1ESB A;  2QF3 A;  1N6Y A;  2P8O C;  1A3B H;  4YT7 H;  2F91 A;  1DM4 B;  3GY2 A;  5HIY A;  2GX4 A;  3U98 H;  5DP9 A;  2ZU1 A;  4LZ4 B;  2XRC A;  2ZQ2 A;  3ZVA A;  2ZDL A;  3MO3 A;  5EW1 H;  2Z3E A;  1PJP A;  3GY3 A;  2WUB A;  3SUE A;  1C1P A;  2Z94 A;  3GY7 A;  3WW7 A;  4X2W A;  2BXU H;  1CSO E;  1OOK B;  1MBQ A;  2GV6 A;  1K1L A;  4FUH A;  1HAH H;  3VB6 A;  5L6N H;  4TSF D;  1ELD E;  3K6Z A;  4JMY A;  3BTK E;  2BTC E;  4WH6 A;  4CHA C;  3C1K A;  4OS4 A;  2TGA A;  1RTF B;  3GIC B;  2HPP H;  2OQ5 A;  1ZLR A;  4A1V A;  1O2O A;  3M7U A;  3HGN A;  2VNT A;  3TJO A;  1Y3W A;  3ZIA D;  1YCP H;  3SU0 A;  2L74 A;  4X6N A;  1O5A B;  1H9L B;  2I6S A;  3LGW A;  4RSP A;  2GKV E;  2BD7 A;  4JYU H;  1TGS Z;  1UVU H;  6CHA C;  2QXG A;  1GHV H;  2GZ8 A;  2BVR H;  2QF5 A;  1AND A;  9EST A;  1MAB B;  3FAO A;  3MWI U;  3VGC B;  1TPS A;  2HLD D;  2AGI X;  1O5B B;  4BTU B;  1MKW K;  3O8C A;  3C27 B;  3PV4 A;  1W13 U;  3VB7 A;  5EXL A;  4XSK U;  3TGJ E;  4LOY H;  1SGQ E;  1W3C A;  3HK3 B;  4NZL A;  2GP9 B;  5EU8 A;  1C1S A;  2CV3 A;  4GAW A;  1LDT T;  1BA8 B;  1A1R A;  1A61 H;  3EST A;  1NFU A;  4CRB A;  2OC8 A;  3BTQ E;  1INC A;  2BY9 X;  1WBG B;  5TCA A;  4CHA B;  4WWY A;  4MPX A;  3L6P A;  4ABI A;  4BAM B;  2AH4 X;  4HTC H;  1S85 A;  1GI2 A;  1A3E H;  4ZAE A;  1C5N H;  1UVT H;  1MU8 B;  1TYN A;  1QZ8 A;  1O5E H;  1QL7 A;  3RU4 T;  5FX6 A;  1O30 A;  1YP9 A;  1FIZ A;  1C2D A;  3NK8 A;  2GZ7 A;  1HAO H;  5C94 A;  3EA7 A;  5GXP A;  1GBL A;  1YLC A;  3EA8 A;  3NCL A;  1V2P T;  4Q7X A;  1IQN A;  5I25 A;  1NM6 A;  1DPO A;  4Y76 A;  1A2C H;  5JPM H;  1AVX A;  3KYF A;  1O2V A;  4UON A;  3RM2 H;  4B76 A;  1G30 B;  3EE0 B;  1E79 D;  3WWF A;  1GMH G;  1K0H A;  1SGF G;  2ZGC A;  2TBS A;  1C4V 2;  1SGI B;  3U8O H;  3P6Z B;  3ENS B;  1EJM A;  1TBR H;  2XW9 A;  3RLW H;  3KNX A;  3GDU A;  1CA0 B;  1QY6 A;  4ISO A;  1OP0 A;  4TY6 A;  1TRY A;  2PW8 H;  4NA8 A;  2TGP Z;  3RDZ A;  1JRS A;  2R0L A;  1AVG H;  2FMJ A;  3ZZ3 A;  2SNW A;  2OC1 A;  2ZIQ H;  2BD5 A;  1GBD A;  4YOG A;  5F8Z A;  4DW2 U;  3OU0 A;  4DIH H;  4DII H;  1T8L A;  1QA7 A;  2BB4 A;  1HXF H;  2FI5 E;  3TNS A;  3VPK A;  4ZCN A;  2BDY A;  2BD9 A;  1O0D H;  2EST E;  5T1V A;  3OEE D;  4ISH H;  4TY7 A;  3PMB B;  1NRO H;  5AVD A;  2F4L A;  4GHT A;  1ZRB A;  1YGC H;  3LJJ A;  4DVA U;  1K22 H;  1FAK H;  2H9T H;  2O8M A;  3WY8 A;  1UCY H;  3UR6 A;  1DXP A;  1BML A;  2CGA A;  2B9L A;  2QY0 B;  1C2E A;  2PFE A;  4XE4 A;  2DE9 A;  1XKA C;  1P2Q A;  1AFQ B;  4U2W A;  3U28 C;  2IN2 A;  4F49 A;  1GMC F;  1SG8 B;  1N8O B;  3KQC A;  1N1L A;  2OP9 A;  3F9H A;  3Q76 A;  1MD8 A;  2W7U A;  3NWU A;  2EA3 A;  2FI3 E;  3CP7 A;  4NGA H;  1QB9 A;  1BMF D;  1W7G H;  2PUQ H;  3FN8 A;  1PPC E;  2Y80 A;  1O5F H;  1RFN A;  1ZGV A;  4INH A;  2J5U A;  1DVA H;  1XUG A;  4ACA A;  2M2A A;  4AFQ A;  1JMO H;  3PO1 B;  3K6Y A;  1C1W H;  4ISN A;  2H9E H;  1TMT H;  2P95 A;  1GBH A;  3PRO A;  1GI1 A;  4IBL H;  3A86 A;  1MTW A;  3GCH B;  3IG6 B;  3O8D A;  2FEQ H;  2VWO A;  2RDE A;  2BD2 A;  1KTS B;  2EEK A;  1TGT A;  3PO1 C;  3RXK A;  1V2S T;  3SHC H;  3RM0 H;  3BIU H;  4I33 A;  5A09 A;  2H5D A;  4LZ1 H;  2VID A;  4ACB A;  2AGG X;  1EAT A;  1FY5 A;  4BTT B;  1BT7 A;  7LPR A;  1Z1I A;  3PB1 E;  5J4Q A;  1O3P B;  3MO6 A;  1MQ6 A;  2P3U B;  3BG8 A;  3FKS D;  2HNT E;  3SUG A;  1WDI A;  3MTY A;  4K1E A;  2BVS H;  1C2G A;  1QJ6 B;  3SU4 A;  1W0K D;  2RFK C;  2KX4 A;  5DP8 A;  2FS8 A;  1GCT B;  4K1S A;  4MVN A;  1F0S A;  4R0I A;  1F0U A;  1SI5 H;  3DD2 H;  6GCH G;  1LHE H;  3KCG H;  4NIX A;  2WV9 A;  5C2Z A;  1P8V C;  1ESA A;  2LPR A;  4CRA A;  4H4F A;  1ELG A;  1HNE E;  2ZKS A;  1O32 A;  4F4O C;  1NFX A;  2O8T A;  1BTX A;  1ZSL A;  4ZHM U;  4VGC B;  2G55 A;  1O2H A;  1E38 B;  1OKX A;  1DIT H;  1O3G A;  1EKB B;  3S7H B;  4DOQ A;  2OD3 B;  2GGV B;  1XUH A;  4K69 A;  1TQ7 B;  3A84 A;  1TMU H;  1TOM H;  1ABI H;  1CHO G;  4Q4L A;  1GGD C;  3SNE A;  4BTI B;  3P8N A;  3FFG A;  1V2T T;  1A5G H;  1QJ1 B;  3T27 A;  4AZ2 B;  4E06 H;  2FXR A;  1ZMN A;  2ALP A;  4JZ1 A;  3QUM P;  1AKS B;  3W1E A;  1GI3 A;  1BBR K;  1A5I A;  1WCZ A;  3B9F H;  1KXD A;  3FZD A;  2QXJ A;  1CGH A;  3RC4 A;  1DIC A;  1GJ5 H;  2W3K A;  1GI4 A;  1TAB E;  2QE7 D;  2GD4 B;  2YMS B;  2ANY A;  3B8J A;  3G01 A;  2ZWL H;  5B6L A;  3F9F A;  5A8Y A;  5A8X A;  1ELT A;  2KAI A;  5FHT A;  1GBA A;  1FN6 A;  5CHA B;  2UUJ B;  1EX3 A;  3ZYE A;  1B5G H;  1P3E A;  5GPI B;  5PTP A;  1SKY E;  1T4V H;  5AF9 H;  2F9P A;  2G5V A;  4GVU A;  3Q3X A;  1QRZ A;  3HPT B;  1PYT C;  2GCH F;  1LQD B;  3ZVF A;  4HGC A;  2XNI A;  3D49 H;  5C0U A;  1GBJ A;  2RCE A;  3A7X A;  3DFJ A;  4X8U H;  3MYW A;  2PWX A;  1XUJ A;  2H5C A;  1RTK A;  1NC6 A;  4OS1 A;  3TU7 H;  1ABJ H;  1GDQ A;  1SGD E;  3SZE A;  2Q6F A;  4WH8 A;  3RXQ A;  4X2V A;  5E0G A;  1XX9 A;  1W10 U;  2BMG B;  2VVV A;  3N7O A;  1TB6 H;  1P2K A;  3E91 A;  1P57 B;  4NWL A;  1LPK B;  1PQA A;  4FUI A;  3T28 A;  1EJA A;  1QR3 E;  1SLX B;  1YPE H;  2V3O H;  5KGO A;  1C1T A;  1CGJ E;  1ZSK A;  1BZX E;  3A83 A;  1C2F A;  3U1I B;  1XKB C;  3SGB E;  4Z6A H;  1C1V H;  2HRV A;  4I8H A;  3RXR A;  1AUT C;  5EOD A;  3E1X B;  3I78 A;  9LPR A;  2D1J A;  1YC0 A;  4WY3 A;  1RIW B;  1LPZ B;  4H6T A;  2ZP0 H;  1O3I A;  5AHG H;  5EOK A;  4CRD A;  1JIR A;  1H8H D;  1ELC A;  1C2L A;  2P8O B;  1EPT C;  2BOH B;  3BEU A;  1QRW A;  2FOH A;  3F2G A;  3RXS A;  1QA0 A;  2M5T A;  2FI4 E;  3F3B A;  1CHG A;  3VB4 A;  2XC0 A;  1CE5 A;  1Z6E A;  1THR H;  3MU8 A;  1UCY K;  5L30 H;  3MNC A;  3F9E A;  2FOC A;  3STI A;  3BTT E;  1TIO A;  2TGD A;  3SUD A;  3SJK A;  4OGX A;  3UOU A;  1BQY A;  3T25 A;  1W0Y H;  1P2O A;  1P9U A;  2H2Z A;  4B2C A;  1V2Q T;  2W26 A;  1DY8 A;  3RXC A;  3KEE A;  3MH7 A;  1K9O E;  3RXG A;  1EUF A;  1EPT A;  3RU4 D;  1O35 A;  2G51 A;  3RXO A;  1BTZ A;  3RXE A;  1HAV B;  1BCU H;  1GJC B;  1MUE B;  3TK5 A;  1LTO A;  1VKY A;  1RD3 B;  2Q1J A;  1FY1 A;  1EP6 A;  1SQA A;  1AQ7 A;  3ZVE A;  1ZJD A;  3WWB A;  2G5N A;  5EQS A;  1TGB A;  4D9Q A;  1TGC A;  4H42 U;  1NRQ H;  4JK5 A;  4RT0 A;  1SGR E;  1GVK B;  3F68 H;  1GHZ A;  1SGP E;  5CE1 A;  2ZGX H;  2GCT C;  1KXA A;  1TA6 A;  3ZZD A;  1D3Q B;  4WME A;  2STB E;  4R8T B;  1GGD B;  1B0E A;  2SGA A;  5GCH G;  1EAX A;  1T31 A;  4MLF B;  2NU0 E;  5DK1 A;  2JH5 D;  5E2O A;  5C1U A;  4ZKS U;  2FO9 A;  3M5N A;  1L1G A;  3OAA D;  2BXT H;  1V2R T;  4LXB H;  1S6L A;  3UB0 A;  1NBM E;  4RKO B;  2P16 A;  1GI7 B;  1HV7 A;  3NPS A;  2OUA A;  1HJ9 A;  2BM2 A;  3A87 A;  1KXF A;  1Z8G A;  1JIM A;  1AIX H;  2P93 A;  2BD3 A;  5C5N A;  2BVX H;  2A7C A;  1EXF A;  2A0Q B;  1SC8 U;  2VGC C;  1C5M D;  1Y59 T;  4XBC A;  1C9T A;  5EJ1 A;  3UNQ A;  4I8J A;  1EAU A;  3E0N B;  2A4O A;  2QCY A;  1G2L A;  2R0K A;  2ZCK P;  4GHQ A;  2HAL A;  1PPH E;  3OTP A;  1ELF A;  1H9I E;  2FP7 B;  3RXA A;  3M35 A;  5LPR A;  3E90 B;  1O36 A;  1MTU A;  5C17 A;  4NA7 A;  1E0F D;  4K5Z A;  1EB2 A;  2GT8 A;  4IS5 A;  1SOT A;  2FZZ A;  3UY9 A;  1TX8 A;  1GDN A;  1RXP A;  3RXB A;  4TWY A;  4JYV H;  1UK4 A;  3SOS A;  2YMS D;  2FS9 A;  5ABW A;  4I31 A;  1GJ9 B;  3SV8 A;  1BHX B;  2HLC A;  3TGK E;  1V2U T;  2PSY A;  1GWA A;  3A7Z A;  1BRA A;  4DCD A;  2ZFF H;  1D6R A;  4Q7Y A;  8EST E;  1P2J A;  3TH4 H;  5FCK A;  2QIQ A;  3QK1 A;  3KHV A;  1E37 B;  4B74 A;  1AGJ A;  2A31 A;  3FP8 E;  4XOJ A;  2ZPQ A;  3OY5 U;  2OQU A;  3NUM A;  4BXW A;  1O2I A;  2QV1 A;  1ETT H;  3T5F H;  4AFS A;  1N6X A;  2VVU A;  1HBT H;  1UTQ A;  1KY9 A;  1ZSJ A;  3Q77 A;  1ELB A;  1ID5 H;  2ILN A;  1FMG A;  1O38 A;  2GDD A;  4YXW D;  1F92 A;  2RA0 A;  2ZTZ A;  4BOH A;  3PYH A;  2TPI Z;  1L2E A;  1O2X A;  3A82 A;  2F9V A;  2SNV A;  1M9U A;  2B8O H;  4INL A;  3H5C B;  1G37 A;  3MI4 A;  4ZKO U;  4E05 H;  2A45 B;  2JIZ D;  1HAY B;  4IN1 A;  1NO9 H;  3ZZ5 A;  1WQS A;  1ELV A;  5A0B A;  1DXW A;  4JYT A;  1NFY A;  3QDZ B;  5EJZ A;  5LPF A;  3MU5 A;  3ODD A;  1CGI E;  1O31 A;  1K1M A;  2FTM A;  1BMA A;  4Y8X A;  1UVO A;  3GDS A;  1AD8 H;  3LOX A;  2C8X B;  1UJ1 A;  1V2V T;  3MOC A;  1JBU H;  4CR9 A;  1QTF A;  2J34 A;  4OM9 A;  4KTS A;  4U32 A;  3A8C A;  1QL9 A;  1KIG H;  4IMZ A;  1Z8R A;  4Y0Z E;  4IMQ A;  4A1T A;  3E6P H;  4IGD A;  3F1S B;  4YLU A;  1TNG A;  1U6Q A;  2C3S A;  3M7Q A;  1HUT H;  1TRM A;  5CHB A;  2BOK A;  1O2M A;  3PRD A;  1H4W A;  2GJG A;  2JDI D;  4BXS A;  4ABB A;  2VH6 A;  2CF9 H;  3M3T A;  2FOM B;  1UHB A;  4QT8 C;  1LCY A;  5FPT A;  3PTN A;  1VJ9 U;  2A4G A;  3FAN A;  3PV5 A;  4BAH B;  1SR5 C;  4Y11 E;  1GMD G;  1MZA A;  4GPG A;  5FBI A;  1AI8 H;  3RC6 A;  1PQ5 A;  3F6U H;  3KQ5 A;  1OP8 A;  4K1T A;  3UTU H;  1QNJ A;  2ZNK H;  1SFI A;  3QWC H;  2WPM S;  1IQH A;  3ATW A;  1YWU A;  2QA9 E;  1NY2 2;  1XXF A;  1ZTJ A;  4Y8Z A;  3LGI A;  1P04 A;  3TPI Z;  1BDA A;  4AB9 A;  1GHA F;  2B7D H;  3ODF A;  1BTH H;  5C1Y A;  2OK5 A;  4RT1 A;  1LKA A;  1IHS H;  3TIU A;  4D9R A;  2Z3C A;  2HGT H;  1ZHM A;  5LPE A;  4ZUH A;  4BAO B;  4KTC A;  5F8T A;  4YTA A;  1E36 B;  1OSS A;  4JK6 A;  1UVP A;  5JBB S;  1DLE A;  1V2M T;  3EAJ A;  3DUX H;  1TNI A;  1C2K A;  3AAU A;  5LH8 A;  1AMH A;  1C4Y 2;  4AB8 A;  2ZHW H;  1A0J A;  1ELE E;  5IDK A;  1IQL A;  4AC9 A;  1OWK A;  1TGN A;  1DFP A;  4XRN A;  1WQV H;  3LON A;  1VGC B;  4CH2 B;  3KL6 A;  4D7F A;  1UTP A;  1CA0 C;  3TJV A;  1AU8 A;  1QFK H;  3BSQ A;  3K65 B;  2XOK D;  2P59 A;  1DST A;  1OS8 A;  4X2X A;  4X0W U;  4Z1M D;  3EQ0 H;  1UW7 A;  1O2S A;  3SV7 A;  2B0F A;  3TK6 A;  4IW4 E;  1JRT A;  3LGV A;  2FTL E;  1AY6 H;  1MBM A;  4UD9 H;  5T3H A;  1TPA E;  5HMA A;  5HYO A;  1IQM A;  2QXI A;  3OTJ E;  1GBB A;  4JZI A;  3SYJ A;  1C2M A;  1YKT A;  3ZVB A;  1N8O C;  1GHB G;  4TT3 D;  1TA2 A;  5EW2 H;  1WTH D;  4DG4 A;  1CBW B;  1K28 D;  1BBR H;  1ACB E;  2BD4 A;  2O8L A;  1Q31 A;  1P09 A;  1ANC A;  2FOD A;  2ZDN A;  3SV9 A;  3F2H A;  4XBB A;  4YOI A;  5KEC A;  1NN6 A;  1Q3X A;  2J38 A;  2ODY B;  4GUX A;  1IQI A;  1P2M A;  3W95 A;  1FPC H;  1L4Z A;  2H1U A;  3LKW A;  1FJS A;  4P02 A;  4AOR A;  5FL7 D;  5IK2 D;  3ZV8 A;  3CNR A;  4ISI H;  1GJB B;  1O2Z A;  3N7E A;  4Y79 A;  2SGF E;  1Z71 A;  1F5R A;  4MNW A;  4JZF H;  1SGF A;  3Q3K A;  2VBC A;  2WPD D;  2ZGH A;  3QGN B;  2NU4 E;  2ULL A;  2ZDM A;  4FVB A;  1SFQ B;  3LIW A;  5FCR A;  4MG3 A;  1BBR E;  1LVM A;  1OWJ A;  5F03 A;  4A6L A;  3TIT A;  1ARB A;  5JBA S;  3I29 A;  3VG8 A;  2WV5 A;  1QGF A;  4B2B A;  3U1J B;  1JXP A;  1T8N A;  1CBW C;  3UWI A;  1O5C B;  1NFW A;  2NU2 E;  2A5A A;  3EGK H;  1GJ7 B;  3RML H;  2PP6 A;  1BUI A;  5GND A;  1T8M A;  1KMH B;  3GCH C;  1HIA B;  1S6H A;  4UFE H;  2A32 A;  2ZU4 A;  3BV9 B;  1MQ5 A;  1XUI A;  4X1R U;  1F7Z A;  1GJD B;  1TNK A;  4WVP E;  3ZZB A;  2ANM H;  1OYT H;  2JKH A;  1UTK A;  2UWL A;  2BLW A;  2C8W B;  2G81 E;  3O8B A;  5DO4 H;  1FZZ A;  1G3E A;  1LO6 A;  1WXR A;  1XUK A;  1ARC A;  1V2L T;  1YPM H;  3M37 A;  3SI4 H;  2ANK H;  4MNY A;  4Q7Z A;  2VWM A;  3Q3Y A;  1GHY H;  1XXD A;  3KGP A;  5ESB A;  1DUE A;  1LHF H;  1PQ8 A;  2H6M A;  3CS0 A;  4WF8 A;  1COW D;  4MNV A;  1GVZ A;  1MKX H;  2ZDA H;  2CF8 H;  1MH0 A;  5FBE A;  4AFZ A;  2BDI A;  3BF6 H;  4AYV B;  1C5T A;  2Z3D A;  2BDC A;  2KCA A;  3A89 A;  1EP5 A;  2OIN A;  4WXI A;  2C93 B;  3V12 A;  3DT0 H;  4X1P U;  4AGJ A;  1DE7 H;  3H09 A;  4ZKR U;  1AFE H;  1GBC A;  1ETR H;  2ZFQ H;  1TE0 A;  3GYL B;  1FY3 A;  1OWH A;  1PPF E;  2ZQ1 A;  2BDA A;  3SU2 A;  3SU6 A;  1Z7K A;  1DUA A;  5GWZ A;  2FDA A;  4YT6 H;  1ZTK A;  1CT4 E;  3VXF H;  1CT2 E;  3TH3 H;  4FU9 A;  1L1J A;  3MHW U;  3VFE A;  4JCN A;  3PLK A;  1QB1 A;  2O9Q A;  3HGP A;  1HAI H;  1YCP M;  2KR7 A;  4K8B A;  1ZPB A;  4UFF H;  2RDL A;  4CRF A;  5G4B A;  1W11 U;  1AHT H;  3GIS B;  4U01 A;  3V0X A;  2ODP A;  1W8B H;  1J15 A;  5E2P A;  2PKS B;  2EY4 C;  4Y7A A;  4LK4 A;  5IYT A;  1GL1 A;  1K1N A;  2ZF0 H;  1L0Z A;  1SVP A;  1BB0 B;  3KF2 A;  4Q2K A;  1V2O T;  1OPH B;  3BEF B;  4NA9 H;  2Y7X A;  1MZD A;  2ZHF H;  3P8O A;  3BN9 A;  2V35 A;  4O9V A;  4UE7 H;  1MAY A;  2HNT C;  2IJD 1;  1OYQ A;  1A0L A;  3E3T A;  4MDS A;  1ETS H;  1O2Y A;  3FZZ A;  3QZQ A;  4KGA A;  1TBQ H;  4FUJ A;  1O2R A;  5T6D A;  1E34 B;  2SFA A;  1OWD A; 
#chains in the Genus database with same CATH homology
 1K0H A;  2KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...