2KX4A

Solution structure of bacteriophage lambda gpfii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Tail attachment protein
publication title Phages have adapted the same protein fold to fulfill multiple functions in virion assembly.
pubmed doi rcsb
source organism Bacteriophage lambda
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 2kx4A01
2KX4A 1K0HA
chains in the Genus database with same CATH superfamily
1C5TA 1C5VA 1O2MA 1QURH 4ZKNU 4MLFB 1NBME 3ATMA 3ZVAA 1E36B 1WU1A 2G4UA 5IDKA 3LGWA 4F4OC 2GP9B 2QF5A 4HGCA 4INLA 3TH4H 1A0HB 5BPEA 1THRH 3V0XA 4DT7B 2H9EH 4XSKU 1O2UA 5EU8A 1GJAB 1TAWA 2FPZA 3WW7A 4NSVA 1GMHF 2P3UB 2P3FH 1O32A 3MHWU 3RC6A 1LO6A 1CA0C 2VWMA 3ESTA 3T2NA 1TIOA 4ABGA 1O5EH 1TA6A 4CH8B 3KEEA 4H6TA 4RKJB 5FX5A 2K0QA 3VB6A 4FUFA 1B0EA 1LMWB 2VGCB 5EXMA 1LQDB 4HZHA 1LTOA 2W7SA 2ZEBA 3AW0A 4U01A 1P9UA 2ZGHA 4X1RU 2ZHDA 3RXMA 1C5SA 2FYRA 3S69A 1D6WA 1SBWA 4K2YA 2ZGJA 1P3EA 1IQIA 1BA8B 1O5FH 2R2MB 3A7YA 1LHFH 5GPIB 5J4QA 2IJD1 1W13U 1O2OA 3HKJB 3M36A 1ELFA 1Y8TA 7GCHG 3PMHB 1DUEA 5DP5A 4MPUA 1ELAA 3ZYDA 1FV9A 1BBRE 1C5QA 4B76A 2RDLA 2FLBH 5EXNA 3MH5A 3A8AA 4JYUH 4O3TA 1PPZA 3SW2B 2CK3D 2YNBA 5DGJA 4DGJA 1GDNA 1JOUB 1VZQH 3S9CA 1Y59T 1MKWH 1EAIA 1CU1A 4AN7A 1HXFH 2FEQH 1GBCA 1ZJDA 4YOIA 2F4LA 1SGEE 3BTGE 1MTSA 3RC4A 1C1QA 2ZFPH 1HAVB 4FU7A 3T26A 1OS8A 2A31A 5TCAA 3GY3A 3KF2A 6ESTA 1T8OA 4ABFA 4ABBA 4I7YH 2OUAA 1TMUH 2A2XH 2WYJA 2ZU3A 3E8LA 1IOEA 1ESTA 6CHAB 3DHKH 4RN6A 2FODA 1TNIA 1YWUA 4AB9A 2C4FH 5C1YA 1MU6B 4FUCA 3SJ9A 1E37B 1L4ZA 2JH6D 1LKBA 3DT0H 3A8DA 1GI6A 3RP2A 3UNSA 4AGKA 3SU6A 1N8OB 4BXSA 3LGTA 3GICB 5T6DA 2BLVA 4WH6A 5HIZA 1BRUP 3KYGA 5E0GA 1TPSA 2QAAA 4ABEA 4D9QA 4WF8A 5AFZH 5L2ZH 3FAOA 4THNH 2FZZA 2FX6A 3PLPA 2KAIB 1G2MA 4IMQA 1UVOA 2P8OB 3ZZ4A 1C5OH 5EW1H 1XM1A 4ISHH 3DSGA 2V7QD 2L74A 4MNXA 5JYIA 2Y80A 2ZPSA 3H7TA 4HI3A 2ZHFH 1GBMA 1LQEA 2QXGA 2TGTA 1CVWH 1P10A 4DY7B 2GDDA 4Y8YA 5L2YH 1EOJA 2WV9A 3KL6A 4AFSA 2BLOA 5JBTA 1MCTA 1C5PA 3VG8A 1HCGA 4U30A 1H8IH 1PQ7A 2OK5A 4AC9A 3BEUA 4X6PA 4Y76A 1LVOA 3F9EA 1THPB 3OTJE 4WMDA 1RRKA 4XOJA 3KQEA 2ZECA 4NIYA 1GBHA 1F0TA 2A4RA 3T25A 1GVLA 2CXVA 3AAUA 2W6JD 2J98B 2J94A 4JMYA 4TYDA 4CRGA 4ABJA 1QBVH 4DW2U 1W0JD 3SU0A 1L1JA 2ANKH 2K1QA 1Z6EA 5CE1A 1C1NA 3M7QA 4X6NA 4ZROA 1RD3B 2ASUB 4DG4A 4YOJA 4OM9A 5F8XA 1SGDE 1AUJA 1PPEE 2GZ9A 4A1TA 3RUOA 1O5AB 4P00A 1EZXC 1ELVA 3LC3A 2B8OH 2KCOA 3UR6A 1AMHA 3GYMA 5DN6D 1P2JA 5F6MA 1O3NA 4FUEA 4KGAA 1Z8JB 1AKSA 1IQFA 2HALA 4A6LA 2SGEE 2FTLE 4X0WU 1O35A 3NPSA 4JK5A 2BQWB 1TONA 1DY8A 4YLQH 4O9VA 2ZGBH 1AE5A 3LU9B 3GY4A 2Q1JA 2UUJB 3M3SA 4AFZA 1T4VH 2H9TH 1UHBB 2ZCHP 1P2QA 2Y5HA 3A7VA 2OQUA 4RT0A 4O3UA 5SGAE 1FN8A 1O31A 2Q6FA 2VINA 1EATA 2A32A 4XBBA 3RDZA 3PRDA 1AFEH 2ZQ2A 4YT6H 5EODA 6GCHF 4OGYA 1THSH 3EDXB 3L3TA 2GZ8A 3E91A 2XBVA 2ZGXH 1GJ4H 1NFWA 1ELBA 2FXRA 1XUKA 1TE0A 1V2WT 5DP8A 1FY8E 2C8YB 1NRNH 1O30A 4KTUA 5GCHF 2TPIZ 1GBEA 2ZF0H 1QL8A 1VITF 3B9FH 3OY5U 1ELGA 3BTDE 3F68H 1SSXA 1H9IE 5T6GA 1YLDA 2G8TA 5DJ7A 1DITH 1TABE 3TNTA 1OX1A 1GMCF 1P3CA 3SUEA 1OWDA 4Z0KA 3UAIC 4JZDH 1LDTT 2C90B 4Y8ZA 2BTCE 4HFPB 3GY6A 1UTMA 2BLQA 1ZPBA 3H09A 5TJXA 2C3SA 1A7SA 4ISLA 1GBIA 3A80A 3RU4T 1QY6A 1O0DH 1LHCH 3D65E 3A7XA 1P01A 1EP6A 1W7XH 4NIVA 3OE7D 3TGIE 1CHOF 1MKXK 1W10U 1TB6H 2A5AA 4MNVA 3NUMA 3RXOA 2W6ID 4AGJA 5GXPA 1P02A 4B73A 3I29A 1HYLA 1TNGA 1K28D 1HIAB 2PKSC 2QF0A 4MTBA 1P2OA 3SU4A 1BCUH 1CT4E 2EQNA 1DOJA 4ABIA 5DP7A 4NG9H 1GGDC 4CR5A 5L6NH 3QZQA 3MYWA 1IQHA 1HAZB 1QZ8A 3S7HB 3TK6A 1FY4A 2AEIH 3SV8A 1W12U 3KQBA 3T62A 1BBRH 1AVGH 1P09A 3AVZA 1J17T 3ODDA 2ZGCA 3PTNA 4ZH8A 2A4OA 3SZNA 1LHGH 1FLEE 2UWOA 1XUJA 1YBWA 3D49H 2XTTB 4X6MA 3M3TA 2AIQA 3IWMA 4LOYH 1DDJA 1C2HA 2GCHG 2ZKSA 3OFND 3T28A 2P16A 4NWLA 1K1PA 1Y3UA 2FLRH 3MOCA 1OWJA 1WAYB 5FXLA 1BJVA 3SQEE 4AORA 3UPEA 4YM9A 2Y82A 1FIWA 1BRAA 1CBWB 3RXCA 4RKOB 3PO1B 4WJG2 3UNRA 1G3BA 3BTWE 2BY9X 1K0HA 1LVMA 4Y6DA 1QFKH 1GHAG 1DICA 4WH8A 1O3JA 1C1TA 2G55A 1FZZA 1W14U 2B0FA 1GJCB 4BAHB 4E7NA 1B0FA 4XE4A 1UTJA 2ZQ1A 1W8BH 5EJ1A 1OWIA 2Z3DA 1G3CA 1EAWA 5JBAS 1AUTC 4BAOB 3UQOA 2PSYA 4ABHA 5JPMH 4CBNA 2KZ4A 4UFFH 1S83A 5EJZA 4D76A 1C9PA 3ZVDA 2XRCA 3V12A 2H9HA 1IQNA 4IBLH 2VIQA 1PYTC 2XWAA 2UUYA 3RXBA 3S0NA 3U8OH 3TK5A 1HJAB 4J2YB 1P57B 1PQAA 4HG6A 1C2IA 2ZCKP 3IITA 4B2AA 1C1WH 2ZHQH 1NFUA 1FNIA 1Z71A 1S6LA 1C1SA 3PV5A 3DCLA 1GHYH 1TBQH 1SGCA 1V6DA 3MI4A 3BG4B 3M3VA 1WTHD 3W1EA 1XKAC 2XCNA 3TGJE 2FOCA 1TPPA 1EUFA 1C5WB 1KXFA 1U6QA 4ESTE 1HAYB 1F0UA 5A8ZA 1QB1A 1NROH 2BDHA 1F7ZA 1ZMLA 1MQ5A 7LPRA 2ODPA 3RXLA 5DK1A 4LZ4B 4X1QU 1MCVA 1O5GH 2YOLA 3DUXH 4LZ1H 2IOTA 3R3GB 4UFGH 4AZ2B 1TGSZ 3S9AA 2DE8A 3Q3XA 2ZU1A 4ACBA 5FL7D 1IQEA 1L2EA 2Y6TA 4BTIB 2RCEA 1YPHC 4Q4LA 1AQ7A 1QRWA 1Y3YA 1AB9B 3C27B 3P8FA 3M5NA 2J95A 4TPIZ 1BMLA 1KSNA 3KN2A 1INCA 3A89A 1ESBA 2YMSB 1SOTA 4FVBA 2QV1A 2ZFRH 3GY5A 2BD4A 1KYNA 3RXPA 3SJ8A 3SU2A 2PFEA 5JBCS 1UJ1A 5CHAB 2G5VA 1HV7A 5HMAA 2RA0A 3BV9B 4WXVA 5LH8A 1VCPA 5F8ZA 4CR9A 4WVPE 3RXDA 2AERH 2OC7A 2ZPRA 4CHAC 1D3TB 4I8LA 1C2EA 1NFYA 1O2YA 2ZDAH 3UNQA 3RMNH 3O8DA 3JZ2B 3SO3A 1HAPH 3NZIA 4R8TB 3ZVFA 4JZFH 2FOBA 1C5XB 1QBNA 3SNCA 1GVZA 2FESH 3U9AH 1GG6B 5CHBA 2PR3A 1RTKA 3LGYA 4I33A 1XMNB 2V3OH 2F9BH 2WUCA 3ENSB 4FUGA 1GJDB 4ISOA 1ZYOA 3LC5A 1MQ6A 4AYVB 1NC6A 1HLTH 2ZI2H 1KLTA 1N6XA 5HM2A 5DP6A 5HM9A 5LGOA 1ID5H 1IHTH 1C1MA 2Z3CA 2ZC9H 3AAVA 1O3FA 3HGPA 1ZSKA 4OS7A 2Q6GA 2GMTB 1QA7A 1ZHRA 2A7HA 3SU5A 3TU7H 3A84A 2O8MA 3QLPH 1EPTB 1UK4A 2BDGA 4B75A 1KDQA 1M9UA 5FX6A 3KQ5A 2EI8A 1K22H 3P8OA 5L30H 1RXPA 3Q3YA 3TIUA 4UDWH 3SNBA 3MU0A 3PLBA 2VIPA 4ACAA 2ALPA 2JETC 1V2RT 3BTQE 1GBFA 3E16B 4D9RA 5K0HA 2TGPZ 2VBCA 1UHBA 2UUFB 5DO4H 3LH1A 1RIWC 2OTVA 3VGCB 2CF9H 5GJ4B 2AHME 1BMAA 1MTVA 1S6FA 1UW7A 1C2LA 1SGTA 2ZPQA 1LCYA 1FPCH 3BTME 1C5NH 3BIVH 4K3JA 3F2FA 2WPIS 3A8BA 2J34A 1JRTA 2BXUH 2PTNA 1ETRH 4Q7YA 3T5FH 2BQ6B 1EP5A 1A46H 1MZAA 2VIWA 1TNJA 2ODQA 2FOFA 4X2WA 2FIRH 4GUXA 1ZSLA 5C94A 3P70B 1A3BH 3GCHC 2DE9A 1O2LA 5GWZA 3U98H 2LPRA 1TNHA 4F48B 8LPRA 2TBSA 3F2GA 2QXJA 2YMSD 3DA9B 4CH2B 3MH6A 1DWCH 4ISNA 1P2IA 5A2MH 1TYNA 1WQSA 4B74A 4K1EA 4X8TH 2BDBA 2WPLS 5EXLA 3WWFA 3I78A 3UY9A 1RTFB 5E8EH 1CSOE 1D9IA 5F03A 3U8TH 4B2BA 1UO6A 3MFJA 2YNAA 2QGRA 1P03A 4A1VA 3MU1A 1NU9A 1UVPA 2WYGA 4X1PU 9LPRA 5ABWA 2ZTZA 1O3CA 1SGRE 3ATIA 1CGHA 5JB8S 1IAUA 8KME2 1ANCA 1VGCB 3M7TA 3M5LA 4JCNA 4MNYA 6GCHG 1TRYA 1T8NA 1V2TT 3GCNA 1DX5M 3NXPA 4KELA 1T32A 1O2XA 3SUGA 1FDPA 3MTYA 2EI7A 3SUFA 1UTNA 2FOEA 1V2ST 2OC8A 2XWBI 3GISB 2XBXA 4Y79A 1Q31A 8GCHF 1Q2WA 2OQ5A 5JB9S 3GY7A 1A4WH 1O3DA 2OCVB 3ATKA 1XXFA 3QTOH 4OS6A 1E79D 1SFQB 2K8IA 1Z1JA 3E0PB 1S0QA 1W0ZU 1GHWH 1BRCE 1D6RA 1JIRA 3EA8A 1GPZA 1O34A 2JDID 1G32B 3MNSA 4K1SA 1GMCG 4Y8XA 2CF8H 1ETTH 1J8AA 2PKAB 4F49A 2F43B 1BITA 1P04A 3ZIAD 1SQOA 3P8GA 2ZFSA 3RXTA 2F91A 1J9CH 1BTPA 2Z6BD 1PJPA 1P05A 1KY9A 4FUJA 5FHTA 1GI9B 2CHAC 1OWHA 1TGBA 1GJ7B 3GY2A 1LPKB 2GDEH 1NS3A 1QGFA 2HNTC 2VH6A 1CHOG 5ETXA 1OPHB 1TRMA 2KFWA 5I46H 1J14A 2D8WA 1BTUA 2Y5GA 1ZRKA 4INHA 2FI3E 4PROA 2IJOB 2AS9A 2B5TB 5C1XA 3S9BA 5AF9H 1W7GH 4IS5A 3LGVA 2O8WA 5EQSA 1QQ4A 1ANBA 1SHHB 2RG3A 4XFQA 1MTNC 1A3EH 1O5BB 2QE7D 4MG3A 2P3TB 3W94A 1SGPE 2J9NA 2OC1A 4B6EA 4NGAH 1N6YA 2ANWA 4SGAE 4AFQA 2H5DA 1KXBA 1BMFD 3PMAB 5CMXH 1O2WA 1TRNA 2R2WU 2HRVA 1JMOH 2ZDKA 4YLUA 2V0BA 2ZP0H 3HGNA 1UVSH 1YLNA 3SJOA 1MTUA 1NY22 2BY6X 2UUKB 3LPRA 3UR9A 5DP9A 4K60A 3GOVB 4VGCB 1GHBF 3P92A 4FUBA 3KYFA 2XNDD 1GVKB 2BDCA 4DVAU 2BY8X 1A5IA 1YM0A 3NKKA 3MH4A 4DT4A 1ETSH 2WINI 3RM2H 2A7CA 2XC0A 4ZKOU 2HVXA 3MH7A 1OYQA 1GCTC 2V3HH 2QXHA 1KIGH 2JJ2D 3PROA 1L0ZA 1LPGB 1QJ7B 1YPMH 1YCPK 3A85A 3ATLA 3WWBA 5HIYA 1O3LA 1YF4A 1A5HA 1ZRBA 4Q63A 1C1OA 4FUIA 1Z7KA 1XXDA 5T3HA 4E05H 1V2LT 5G4BA 1PPHE 1RGQA 1V2UT 2PUXB 5A0BA 3KHVA 1O2PA 5A8YA 2GCTC 3K6ZA 3ZZDA 4ZAEA 3PMJA 1O3EA 2TIOA 3ZV9A 2NU2E 4IMZA 1GMDF 1EJAA 2BX4A 1YCPM 1V2VT 3ZZ6A 3ZVEA 1ZOMA 1WXRA 2QY0B 1AFQC 1UCYK 4X1SU 2ANYA 2ZDMA 1QR3E 3W95A 1NM6A 2ZTXA 1WSSH 1E1QD 1MUEB 3CP7A 1GCDA 1TNLA 1GDQA 2BD9A 2PGQB 2PTCE 4BTUB 1QL7A 4NIXA 1DVAH 2XC4A 1K9OE 2Z9KA 1E38B 3FFGA 4KP0A 1F2SE 4I31A 2W26A 1GI7B 1IQGA 3O8RA 1PQ8A 1RFNA 1TFXA 1BUIA 1F5RA 4H4FA 1C5YB 1YPGH 3M5OA 2PUQH 1ARCA 2Z3EA 1G36A 2FP7B 1CO7E 3SV9A 1Z8GA 4UFEH 5FPSA 3R0FA 3SOSA 1ZJKA 4XD7D 1SLUB 2FTMA 3BTEE 3MU4A 7KMEH 2A1DB 2F83A 3LJJA 7GCHF 4ZHLU 1SFIA 1Y5AT 5I25A 2W7UA 3GCTG 4JZIA 4X2YA 1HAXB 1QB9A 3IG6B 4AG1A 2I6QA 3RU4D 1YGCH 1C2MA 4NA7A 4Y7AA 5A0AE 1DS2E 1GJ6A 1YC0A 1SGQE 1ZLRA 1Y5UT 1YPLH 3OEHD 1JXPA 1C1PA 1FY5A 2BX3A 4KTCA 3Q76A 3PV2A 3K2UA 1BMNH 2BM2A 3I77A 2ZHWH 1CA0B 2VU8E 1C5UA 1RTLA 3F9GA 5FCKA 2BD5A 1EZSC 2OD3B 4CRDA 1EB1H 3CENA 1E34B 2G52A 4D7GA 1GBJA 5DKMA 5KEDA 1YP9A 1C1VH 4MVNA 4AOQA 3B8JA 1Y3VA 3QN7A 1GI1A 2W3IA 3OAAD 1OP2A 4M9FA 1GBBA 2FI5E 3HK6B 4Q7ZA 4RT1A 2PW8H 1ELEE 3GY8A 1OP8A 1SL3A 1BHXF 1FUJA 1SB1H 2BD8A 4GPGA 2O8LA 4X2VA 2BYAX 2TGAA 3STIA 1MKXH 1PFXC 1W0YH 1EQ9A 2ILNA 3PLKA 1AVWA 3H5CB 5DPAA 1TBZH 1FY3A 1NRRH 2G00A 5FBEA 2SGQE 3MNBA 3P6ZB 2Z9GA 2SGPE 2VGCC 1UTOA 4GVUA 2FOAA 3KGPA 1H4WA 5KECA 1K1IA 2AMQA 1ZMNA 1T8MA 1AN1E 2OC0A 3RXIA 1GDUA 1O3IA 2FYQA 4OS4A 4TY7A 3M35A 2HVYB 3QWCH 3QX5H 4CRFA 3CS0A 1EZUC 4XRNA 4Q80A 2XW9A 4TY6A 2FS9A 1GI3A 4DURA 4I8JA 1XVMA 1H8ED 1DLKB 2AIPA 4ISIH 3VB7A 1NU7B 2CJIA 1O5CB 3F1SB 1FY1A 2RDEA 2TGDA 1T31A 2CV3A 3URDA 2ZTYA 4NZQA 3OY6U 1EXFA 2CGAA 5FPYA 1J15A 1ZTLA 1HBTH 5AFYH 4FETA 5C5OA 3KQDA 2KCAA 3ZVGA 4YT7H 1BRBE 1PPGE 3RXVA 3RXJA 2V3MA 2A45B 3E90B 1SGFG 1ZSJA 1HNEE 1WOFA 3LH3A 4UFDH 1O3HA 5E0JA 3U8RH 3QK1A 4DIHH 1WDIA 2ZZUH 3QGJA 2NU4E 2P59A 1NO9H 4I8GA 1OWKA 3LOXA 1QBOA 3LONA 4RI0A 1EFRD 1O2VA 3V7TA 4IW4E 1QB6A 2O8UA 2THFB 4ZCNA 1OOKB 3AW1A 1GMHG 4XDEA 3SNDA 1FMGA 3UUZA 2OINA 3SBKA 1HAVA 1O3MA 3P95A 1W11U 2BD3A 1DSUA 1F5LA 3OSYA 5A8XA 2JIZD 1AWFH 1D3QB 3MMGA 1IQKA 1NT1A 3F3BA 3M7UA 1HJ8A 3TVJB 3STJA 1TX6A 3HKIB 2J5UA 3RXHA 1Y3XA 2VVUA 3MO6A 3AK5A 6CHAC 1BIOA 1ELTA 1ZGVA 3EYDA 3L6PA 1GI5A 1RS0A 3M61U 1GI8B 3UQVA 2EA3A 3A82A 4WMEA 4YO9A 2BZ6H 4U32A 4NA8A 3GS9A 1N8OC 1K1LA 6LPRA 4Y0YE 2ZG0H 1P0SH 4GHQA 3FO8D 2EI6A 1ELDE 2D2DA 4OGXA 2P94A 2QF4A 3ZZ9A 2GX4A 2SNWA 5C1UA 3SZEA 3HPTB 4Z1MD 5B6OA 3V3MA 3KNXA 2KAIA 1UTPA 1NPMA 1K21H 1J16A 2P8OC 1G3EA 1BTZA 1K1MA 4NCYA 1P8VC 1PPCE 1A2CH 1SGNE 1ZHMA 1QCPA 3OU0A 4BNRA 2HGTH 2SGFE 1ELCA 2GT7A 8GCHG 3A83A 1MU8B 1GBAA 1S82A 4INKA 1ANEA 1V2KT 1BTYA 2LNCA 2VIOA 1AI8H 3ZZAA 4GCHF 1LPZB 4WXIA 2H5CA 3FP8E 2BQ7B 3SV7A 3TJOA 4IN2A 1FAKH 3SGBE 4JYTA 1C5ZB 1FXYA 1SVPA 3T29A 1CT2E 2ZFQH 3ZZ5A 3BEFB 1ZMJA 4I32A 1TPAE 1VR1H 2BVRH 4ZUHA 1L4DA 2PP6A 4ZHAA 1DUAA 5JBBS 2WZQA 1V2NT 2J98A 3OX7U 3RXKA 3T27A 3JZ1B 1O2NA 2BDAA 5T1VA 1DLEA 1LVYA 2VWLA 1S84A 3UTUH 1MBMA 3LIWA 2SGDE 1C2GA 1SC8U 2J97A 2A4GA 1QJ6B 1BMMH 4A5TS 5DP4A 5CDFE 3EA9A 1AKSB 1GWAA 2WPMS 4RSPA 1NRQH 3ODFA 1OHHD 1GJ9B 1SGFA 1HFDA 3SV6A 1MH0A 2Y5FA 4BAQB 1HGTH 5EG4A 1L1GA 1F5KU 1SI5H 1SQTA 1FONA 4ZHMU 1AY6H 2W5EA 4A7IB 1LHDH 4LXBH 2J4IA 4GAWA 3VFEA 2F9OA 4WMFA 4WWYA 1UCYE 5ESTE 1BHXB 1S81A 4UEHH 5J4SA 1VJ9U 5FCRA 3URCA 1HRTH 4BAMB 1DWBH 1JIMA 1KLJH 2IPQX 3OEED 1NTPA 4K8BA 2A5KA 3E6PH 2BOHB 1SGYE 4NZLA 1TLDA 3BIUH 1TMTH 1XUHA 1ESAA 1PPBH 5FPTA 1UMAH 3TH2H 1BJUA 3RXEA 1S0RA 2GCHF 2BMGB 3SI3H 1MAXA 1BDAA 3PRBA 3TGKE 4HTCH 2ZA5A 4BXWA 4R0IA 1ABJH 1CE5A 4I86A 4MPWA 4FUHA 3Q77A 1ANDA 1TPOA 2EY4C 3MQKC 4MNWA 3PB1E 3A8CA 3TH3H 4X6OA 2FX4A 5PTPA 2BY7X 2A7JA 4E7RG 1EB2A 4DIIH 2QIQA 3UREA 1KXCA 4K1TA 1UVUH 3E3TA 2WPHS 1RJXB 3FN8A 1P2KA 2A2QH 3MNCA 5AVDA 1C4V2 3SU1A 3SU3A 1MAYA 2Z9LA 1C9TA 2PKSB 5F53A 3P8NA 1TBRH 4OS2A 5DSFA 1DANH 2OXSA 3SI4H 1CA8B 1GMDG 1KLIH 1A0LA 3GDSA 1O3OA 1GBKA 2KM0A 4ZKRU 4UD9H 1GGDB 1C5LH 1Y3WA 4YESB 3SN8A 3EAJA 3OTPA 2H1UA 1AIXH 4J1YA 1NESE 1A1RA 4YXWD 1X7AC 1ZZZA 1T7CA 3PYHA 1XKBC 4Y10E 1PPFE 1S85A 2BLWA 3K65B 3KQCA 3A7WA 3NK8A 2CN0H 1F0RA 5GIBA 2R0KA 1EZQA 1VCQA 1MABB 2ZDNA 1G3DA 8ESTE 1HIAA 3RXGA 3UIRA 2GVFA 4NFFA 3VXFH 4SGBE 1G37A 2WUBA 4TWYA 1KTTB 1V2MT 2GZ7A 2UWLA 3HATH 3N7EA 3C1KA 1QRZA 1FN6A 1TNKA 3F9HA 4NSYA 1UTLM 3VB4A 3ZVCA 1ZTJA 5C17A 1HAGE 2BVSH 3EGKH 1MD8A 3D23A 2Q6DA 3M37A 2C8ZB 3O8CA 4ZMAH 1AHTH 1MKWK 1SLVB 2G81E 2LELA 4Q7XA 1AGJA 2FMJA 5GCHG 2Z7FE 4O97A 2ESTE 1G2LA 2WHXA 1VITG 1QJ1B 2VWOA 1HAOH 1A0JA 2GTBA 2ZIQH 1C2FA 1Y5BT 2F9VA 3VB3A 2ZU4A 2EC9H 3BN9A 3TNSA 1MD7A 3RXFA 1DSTA 4K8YA 1O3PB 3QGNB 5HXFA 1UTKA 9ESTA 1KXEA 4Y0ZE 3SHCH 1C5RA 3A86A 2VNTA 4MPVA 3O8BA 2R0LA 5TCCA 1O33A 3V13A 2KX4A 1CBWC 2SGAA 4D8NA 1NFXA 2FS8A 1VCWA 1O36A 3PO1C 7ESTE 1QTFA 2QN5T 3N7DA 4QT8C 3U1JB 2AFQB 4CREA 3QO6A 1V3XA 2ZFTA 3BTHE 1W2KH 4LK4A 1CQQA 3DSOA 3F2HA 4B71A 1TGTA 2FDAA 2FOGA 1XUGA 2GT8A 5C3NA 4XBCA 2AYWA 2H6MA 1DFPA 1UTQA 1XUIA 1UVTH 4X8VH 1PQ5A 5H4IB 1NBMD 2BXTH 5C0TA 4X8UH 2QF3A 2NWNA 1F0SA 3PWCA 1BTXA 1AZZA 4ABAA 1H8HD 2EEKA 2R3UA 1Z1IA 5EQQA 1D3PB 1KXDA 1O38A 2ULLA 4JZEH 1GL1A 2PSXA 2JKHA 2VJ1A 3ATWA 4TWWA 3DD2H 2GV7A 1GJBB 1QNJA 2ZNKH 1O2GH 4UONA 2VH0A 4E06H 1O2KA 4XBDA 1SKYE 4TSFD 2W3KA 1AVXA 1HPGA 1HJAC 4NIWA 3ZZBA 4MQAA 4GLYA 1V2JT 1WBGB 2XYAA 1TALA 3U1IB 4KKDA 1KTSB 2NU3E 3RLYH 1HAIH 3BG4C 1SLXB 2B7DH 1O2TA 1SQAA 3RU4E 1O3BA 3H7OA 1C1RA 2XC5A 1FI8A 1GHVH 1T4UH 2XBWA 3SJKA 3OYPA 2O8TA 2Y7XA 2J2UA 4K69A 1OKXA 1GI2A 2M2AA 2I6SA 1O2IA 3FP6E 5LPRA 1FQ3A 2WPDD 3LKWA 5K7RA 3RXSA 3UFAA 2C93B 1O37A 4UE7H 2IN2A 2HNTF 1DPOA 2R3YA 1W0KD 1SG8B 3LGUA 1YPHE 1BOQA 2NU1E 4JZ1A 1C2JA 4FU8A 1SPJA 2PLXA 2UWPA 3FVFB 4Y7BA 5KGOA 4BOHA 4Y71A 4Z6AH 4NWKA 4DCDA 1NZQH 3BEIB 4H6SB 2BY5X 4A1XA 5ESBA 2BDIA 4CHAB 2OBOA 3N99A 1AB9C 1ZGIA 1QA0A 3SGAE 3U69H 4BANB 2GGVB 3U28C 3SHAH 2HLCA 3Q00A 3RXUA 1BB0B 3L33A 3AASA 1ZPZA 1VITH 1IQLA 2YMSC 1K1OA 3RXQA 4CRAA 3DFLA 4X1NU 1YPKH 3SYJA 2FOMB 1CGIE 3GDUA 5HKKD 2PV9B 3VEQB 1YCPH 2VVVA 3MWIU 3WY8A 5CHAC 1EX3A 1GBDA 1XVOA 1JRSA 1JBUH 1UK2A 4H42U 2WV4A 3MO3A 1KXAA 3RMOH 1QL9A 2BDYA 3BSQA 4K5ZA 1GI4A 1TOCB 1H9LB 1TQ7B 5EGMA 2OBQA 1EKBB 2KR7A 1YY3A 4I8HA 3MU5A 4YZUA 1GG6C 1PYTD 1UCYH 4O03A 3KCGH 5EPYA 3B23B 1C2DA 1ZR0A 3PMBB 2XBYA 3FZZA 1TOMH 4JYVH 2IPHA 1KDQB 2D26C 1TGCA 1DWEH 1MBQA 1WQVH 3CS7A 1O3AA 5F8TA 5EJLA 1XUFA 3D62A 2OP9A 2JETB 3S7KB 5A0CA 4AG2A 1NRPH 2HLDD 4CRCA 1RIWB 2QC2A 2ZCLP 2HOBA 1Q3XA 1FPHH 2GMTC 1HDTH 5IK2D 2VB0A 3EA7A 1DXWA 1C4U2 1P11E 3EE7A 1EPTA 1C2KA 1ARBA 2FWWA 4ZKSU 2NU0E 3TPIZ 1EPTC 1NRSH 3A81A 2VIVA 1AWHB 3GCOA 3BTKE 3E0NB 4GCHG 1YPEH 1ZTKA 1H8DH 2Y7ZA 4TPYA 4OS1A 1NN6A 4JK6A 2HWLB 2DUCA 3EQ0H 1GL0E 4CRBA 1T8LA 3GCHB 3UOPA 3VGCC 2B9LA 4DJZB 1EAXA 2SFAA 3SUDA 3M5MA 1QQUA 2KCPA 3SORA 3UWJH 5E2PA 5HGGA 2PWXA 1DM4B 3VB5A 1KMHB 3MNXA 2XCFA 2G4TA 3MO9A 5EW2H 3F9FA 4ASUD 3TJNA 1V2PT 1OYTH 2A4QA 3QZRA 3PTBA 5C20A 2AMDA 4WY3A 5AHGH 1EJMA 4IN1A 1TA2A 1CT0E 1DY9A 1BQYA 5EPNA 1IQJA 2PHBA 1BT7A 1D4PB 2CMYA 1P12E 2F9PA 1BTHH 2BOKA 1G9IE 1BBRK 2L6OA 2SNVA 1OSSA 3PM3A 4IC5A 1QHRB 2J38A 2ZU5A 4TT3D 3A88A 5EQRA 3BTTE 1O2ZA 5E2OA 2ZHEH 3RXAA 5IYTA 4U2WA 5C67A 3RC5A 1OP0A 4FUDA 5DP3A 2BHGA 4AFUA 2VIDA 3DFJA 3BG8A 1GBTA 1SMFE 4ZXYH 1P2NA 4ASHA 3K9XB 3NCLA 2A5IA 3PV4A 1DXPA 1LHEH 1A61H 2HPQH 1Z8RA 2STBE 1GHZA 3K6YA 1S5SA 1SGIB 1GI0A 3ITIA 3RMLH 1C5MD 2GKVE 1O3GA 3VPKA 2ODYB 5EOKA 4YTAA 1VGCC 1QRXA 3RXRA 3G01A 4AB8A 1MZDA 3UOUA 3ZZ7A 1EAUA 2Z9IA 1WV7H 3LDXH 1L1NA 2JH0D 3ZV8A 1N1LA 5BRRE 2CHAB 3SGQE 4AX9H 5HYOA 3DSPA 2QYIA 1TX7A 2BD2A 4M7GA 2F3CE 1UK3A 2O9QA 1HJ9A 3EE0B 1AO5A 1E35B 1YLCA 3FZDA 4GSOA 4IGDA 5FBIA 4AYYB 1V2OT 3UWIA 2ALVA 3ZYEA 3RLWH 2Z94A 2PKAA 1VJAU 1E1RD 3P17H 1TQ0B 3FP7E 5LPEA 2WSSD 2HNTE 1EASA 1MTNB 2VWNA 1VKYA 5EIYA 3SV2H 2ZU2A 2QA9E 1DWDH 1O3KA 3N7OA 1IHSH 2H2ZA 2GD4B 1BZXE 1W3CA 3VXEH 1SOZA 3FOAA 1WCZA 1CHGA 1TX8A 2WV5A 2V6NA 1Z8IB 4MPXA 4YOGA 4A92A 2ZDLA 1G30B 1HUTH 1HXEH 1P9SA 1WTGH 1COWD 2C8WB 4F55A 5B6LA 3KIDU 2AGEX 1H9HE 3SJIA 3TLOA 3TJUA 1FX0B 5FAHA 2OLGA 2ZDVH 3BTFE 4KTSA 1MTWA 1OWEA 1FJSA 1ZPCA 1YPJH 2Y81A 3GDVA 2XXLA 2P95A 2HPPH 1WUNH 2ANMH 5C5NA 1SHYA 2PGBB 3FKSD 1QIXB 1F92A 2JJ1D 4FXGH 1GHXH 2STAE 2FM2A 1ZHPA 2GV6A 1ACBE 1D3DB 3SNEA 1TMBH 1GCTB 4B6FA 2ZO3H 2BB4A 2FOHA 3TJVA 3TK9A 2GJGA 4P02A 4Q2KA 1HAHH 4DOQA 1E0FD 3F0PA 3HK3B 1H1BA 4NA9H 4ABDA 3GCTF 1FIZA 2AMPA 4VGCC 1HB0B 2BD7A 3A7TA 2P93A 4FVDA 2V35A 1GBLA 3SQHE 2WPJS 2LP6A 1SR5C 1YYY1 3CNRA 4IC6A 1O5DH 1WYKA 4BAKB 1O39A 2GCTB 1XX9A 5E0HA 1K1NA 2FO9A 4X2XA 1SLWB 2R9PA 5T6FA 3E1XB 2AGGX 4BTTB 1AFQB 3Q3KA 1AE8H 2QCYA 1B5GH 3MU8A 1FAXA 2BVXH 1ORFA 2FI4E 2KCYA 3ZVBA 3QTVH 1K1JA 2C8XB 4FU9A 4D7FA 5GDSH 3LJOA 1ABIH 5DG6A 1O2QA 1A5GH 3FANA 4FOUC 1MMJN 1S6HA 4ZXXH 1EOLA 2AGIX 1GJ8B 1O2SA 1DT2A 1C1UH 3GYLB 1C4Y2 3QDZB 2J92A 1TGNA 1LKAA 1V2QT 2VVCA 1B7XB 2RA3A 2TRMA 3QUMP 2A0QB 3PWBA 2JH5D 3F0OA 1OXGA 4NFEA 2ZWLH 2G5NA 3A87A 3A7ZA 3UB0A 1P06A 4MDSA 1GJ5H 2XOKD 3F6UH 3NRLA 1JWTA 1BTWA 1CGJE 1O2HA 2G51A 1O2JA 4GHTA 5LPFA 3RM0H 2AH4X 2XNIA 1IQMA 2M5TA 4X8SH 4B2CA 3RMMH 3TITA 1SQRA 4I8KA 1GHBG 4Y11E 3SNAA 3ZZ8A 4CBOA 1O2RA 2QXIA 1AZ8A 2BZAA 2F9UA 2F9NA 3NWUA 2RFKC 1AD8H 1P2MA 2ZFFH 2WPKS 1YKTA 5JDUB 3BF6H 2Z9JA 1LVBA 5A09A 1DE7H 3ZZ3A 1TWXB 5C0UA 3ZZCA 4B1TA 2D1JA 4OS5A 1EJNA 3LGIA 5GNDA 5C2ZA 1GHAF 1AU8A 1K2I1 1Z6JH 3LT3A 3ELAH
chains in the Genus database with same CATH topology
2KX4A 1K0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX4 A;  1K0H A; 
#chains in the Genus database with same CATH topology
 1C5T A;  1C5V A;  1O2M A;  1QUR H;  4ZKN U;  4MLF B;  1NBM E;  3ATM A;  3ZVA A;  1E36 B;  1WU1 A;  2G4U A;  5IDK A;  3LGW A;  4F4O C;  2GP9 B;  2QF5 A;  4HGC A;  4INL A;  3TH4 H;  1A0H B;  5BPE A;  1THR H;  3V0X A;  4DT7 B;  2H9E H;  4XSK U;  1O2U A;  5EU8 A;  1GJA B;  1TAW A;  2FPZ A;  3WW7 A;  4NSV A;  1GMH F;  2P3U B;  2P3F H;  1O32 A;  3MHW U;  3RC6 A;  1LO6 A;  1CA0 C;  2VWM A;  3EST A;  3T2N A;  1TIO A;  4ABG A;  1O5E H;  1TA6 A;  4CH8 B;  3KEE A;  4H6T A;  4RKJ B;  5FX5 A;  2K0Q A;  3VB6 A;  4FUF A;  1B0E A;  1LMW B;  2VGC B;  5EXM A;  1LQD B;  4HZH A;  1LTO A;  2W7S A;  2ZEB A;  3AW0 A;  4U01 A;  1P9U A;  2ZGH A;  4X1R U;  2ZHD A;  3RXM A;  1C5S A;  2FYR A;  3S69 A;  1D6W A;  1SBW A;  4K2Y A;  2ZGJ A;  1P3E A;  1IQI A;  1BA8 B;  1O5F H;  2R2M B;  3A7Y A;  1LHF H;  5GPI B;  5J4Q A;  2IJD 1;  1W13 U;  1O2O A;  3HKJ B;  3M36 A;  1ELF A;  1Y8T A;  7GCH G;  3PMH B;  1DUE A;  5DP5 A;  4MPU A;  1ELA A;  3ZYD A;  1FV9 A;  1BBR E;  1C5Q A;  4B76 A;  2RDL A;  2FLB H;  5EXN A;  3MH5 A;  3A8A A;  4JYU H;  4O3T A;  1PPZ A;  3SW2 B;  2CK3 D;  2YNB A;  5DGJ A;  4DGJ A;  1GDN A;  1JOU B;  1VZQ H;  3S9C A;  1Y59 T;  1MKW H;  1EAI A;  1CU1 A;  4AN7 A;  1HXF H;  2FEQ H;  1GBC A;  1ZJD A;  4YOI A;  2F4L A;  1SGE E;  3BTG E;  1MTS A;  3RC4 A;  1C1Q A;  2ZFP H;  1HAV B;  4FU7 A;  3T26 A;  1OS8 A;  2A31 A;  5TCA A;  3GY3 A;  3KF2 A;  6EST A;  1T8O A;  4ABF A;  4ABB A;  4I7Y H;  2OUA A;  1TMU H;  2A2X H;  2WYJ A;  2ZU3 A;  3E8L A;  1IOE A;  1EST A;  6CHA B;  3DHK H;  4RN6 A;  2FOD A;  1TNI A;  1YWU A;  4AB9 A;  2C4F H;  5C1Y A;  1MU6 B;  4FUC A;  3SJ9 A;  1E37 B;  1L4Z A;  2JH6 D;  1LKB A;  3DT0 H;  3A8D A;  1GI6 A;  3RP2 A;  3UNS A;  4AGK A;  3SU6 A;  1N8O B;  4BXS A;  3LGT A;  3GIC B;  5T6D A;  2BLV A;  4WH6 A;  5HIZ A;  1BRU P;  3KYG A;  5E0G A;  1TPS A;  2QAA A;  4ABE A;  4D9Q A;  4WF8 A;  5AFZ H;  5L2Z H;  3FAO A;  4THN H;  2FZZ A;  2FX6 A;  3PLP A;  2KAI B;  1G2M A;  4IMQ A;  1UVO A;  2P8O B;  3ZZ4 A;  1C5O H;  5EW1 H;  1XM1 A;  4ISH H;  3DSG A;  2V7Q D;  2L74 A;  4MNX A;  5JYI A;  2Y80 A;  2ZPS A;  3H7T A;  4HI3 A;  2ZHF H;  1GBM A;  1LQE A;  2QXG A;  2TGT A;  1CVW H;  1P10 A;  4DY7 B;  2GDD A;  4Y8Y A;  5L2Y H;  1EOJ A;  2WV9 A;  3KL6 A;  4AFS A;  2BLO A;  5JBT A;  1MCT A;  1C5P A;  3VG8 A;  1HCG A;  4U30 A;  1H8I H;  1PQ7 A;  2OK5 A;  4AC9 A;  3BEU A;  4X6P A;  4Y76 A;  1LVO A;  3F9E A;  1THP B;  3OTJ E;  4WMD A;  1RRK A;  4XOJ A;  3KQE A;  2ZEC A;  4NIY A;  1GBH A;  1F0T A;  2A4R A;  3T25 A;  1GVL A;  2CXV A;  3AAU A;  2W6J D;  2J98 B;  2J94 A;  4JMY A;  4TYD A;  4CRG A;  4ABJ A;  1QBV H;  4DW2 U;  1W0J D;  3SU0 A;  1L1J A;  2ANK H;  2K1Q A;  1Z6E A;  5CE1 A;  1C1N A;  3M7Q A;  4X6N A;  4ZRO A;  1RD3 B;  2ASU B;  4DG4 A;  4YOJ A;  4OM9 A;  5F8X A;  1SGD E;  1AUJ A;  1PPE E;  2GZ9 A;  4A1T A;  3RUO A;  1O5A B;  4P00 A;  1EZX C;  1ELV A;  3LC3 A;  2B8O H;  2KCO A;  3UR6 A;  1AMH A;  3GYM A;  5DN6 D;  1P2J A;  5F6M A;  1O3N A;  4FUE A;  4KGA A;  1Z8J B;  1AKS A;  1IQF A;  2HAL A;  4A6L A;  2SGE E;  2FTL E;  4X0W U;  1O35 A;  3NPS A;  4JK5 A;  2BQW B;  1TON A;  1DY8 A;  4YLQ H;  4O9V A;  2ZGB H;  1AE5 A;  3LU9 B;  3GY4 A;  2Q1J A;  2UUJ B;  3M3S A;  4AFZ A;  1T4V H;  2H9T H;  1UHB B;  2ZCH P;  1P2Q A;  2Y5H A;  3A7V A;  2OQU A;  4RT0 A;  4O3U A;  5SGA E;  1FN8 A;  1O31 A;  2Q6F A;  2VIN A;  1EAT A;  2A32 A;  4XBB A;  3RDZ A;  3PRD A;  1AFE H;  2ZQ2 A;  4YT6 H;  5EOD A;  6GCH F;  4OGY A;  1THS H;  3EDX B;  3L3T A;  2GZ8 A;  3E91 A;  2XBV A;  2ZGX H;  1GJ4 H;  1NFW A;  1ELB A;  2FXR A;  1XUK A;  1TE0 A;  1V2W T;  5DP8 A;  1FY8 E;  2C8Y B;  1NRN H;  1O30 A;  4KTU A;  5GCH F;  2TPI Z;  1GBE A;  2ZF0 H;  1QL8 A;  1VIT F;  3B9F H;  3OY5 U;  1ELG A;  3BTD E;  3F68 H;  1SSX A;  1H9I E;  5T6G A;  1YLD A;  2G8T A;  5DJ7 A;  1DIT H;  1TAB E;  3TNT A;  1OX1 A;  1GMC F;  1P3C A;  3SUE A;  1OWD A;  4Z0K A;  3UAI C;  4JZD H;  1LDT T;  2C90 B;  4Y8Z A;  2BTC E;  4HFP B;  3GY6 A;  1UTM A;  2BLQ A;  1ZPB A;  3H09 A;  5TJX A;  2C3S A;  1A7S A;  4ISL A;  1GBI A;  3A80 A;  3RU4 T;  1QY6 A;  1O0D H;  1LHC H;  3D65 E;  3A7X A;  1P01 A;  1EP6 A;  1W7X H;  4NIV A;  3OE7 D;  3TGI E;  1CHO F;  1MKX K;  1W10 U;  1TB6 H;  2A5A A;  4MNV A;  3NUM A;  3RXO A;  2W6I D;  4AGJ A;  5GXP A;  1P02 A;  4B73 A;  3I29 A;  1HYL A;  1TNG A;  1K28 D;  1HIA B;  2PKS C;  2QF0 A;  4MTB A;  1P2O A;  3SU4 A;  1BCU H;  1CT4 E;  2EQN A;  1DOJ A;  4ABI A;  5DP7 A;  4NG9 H;  1GGD C;  4CR5 A;  5L6N H;  3QZQ A;  3MYW A;  1IQH A;  1HAZ B;  1QZ8 A;  3S7H B;  3TK6 A;  1FY4 A;  2AEI H;  3SV8 A;  1W12 U;  3KQB A;  3T62 A;  1BBR H;  1AVG H;  1P09 A;  3AVZ A;  1J17 T;  3ODD A;  2ZGC A;  3PTN A;  4ZH8 A;  2A4O A;  3SZN A;  1LHG H;  1FLE E;  2UWO A;  1XUJ A;  1YBW A;  3D49 H;  2XTT B;  4X6M A;  3M3T A;  2AIQ A;  3IWM A;  4LOY H;  1DDJ A;  1C2H A;  2GCH G;  2ZKS A;  3OFN D;  3T28 A;  2P16 A;  4NWL A;  1K1P A;  1Y3U A;  2FLR H;  3MOC A;  1OWJ A;  1WAY B;  5FXL A;  1BJV A;  3SQE E;  4AOR A;  3UPE A;  4YM9 A;  2Y82 A;  1FIW A;  1BRA A;  1CBW B;  3RXC A;  4RKO B;  3PO1 B;  4WJG 2;  3UNR A;  1G3B A;  3BTW E;  2BY9 X;  1K0H A;  1LVM A;  4Y6D A;  1QFK H;  1GHA G;  1DIC A;  4WH8 A;  1O3J A;  1C1T A;  2G55 A;  1FZZ A;  1W14 U;  2B0F A;  1GJC B;  4BAH B;  4E7N A;  1B0F A;  4XE4 A;  1UTJ A;  2ZQ1 A;  1W8B H;  5EJ1 A;  1OWI A;  2Z3D A;  1G3C A;  1EAW A;  5JBA S;  1AUT C;  4BAO B;  3UQO A;  2PSY A;  4ABH A;  5JPM H;  4CBN A;  2KZ4 A;  4UFF H;  1S83 A;  5EJZ A;  4D76 A;  1C9P A;  3ZVD A;  2XRC A;  3V12 A;  2H9H A;  1IQN A;  4IBL H;  2VIQ A;  1PYT C;  2XWA A;  2UUY A;  3RXB A;  3S0N A;  3U8O H;  3TK5 A;  1HJA B;  4J2Y B;  1P57 B;  1PQA A;  4HG6 A;  1C2I A;  2ZCK P;  3IIT A;  4B2A A;  1C1W H;  2ZHQ H;  1NFU A;  1FNI A;  1Z71 A;  1S6L A;  1C1S A;  3PV5 A;  3DCL A;  1GHY H;  1TBQ H;  1SGC A;  1V6D A;  3MI4 A;  3BG4 B;  3M3V A;  1WTH D;  3W1E A;  1XKA C;  2XCN A;  3TGJ E;  2FOC A;  1TPP A;  1EUF A;  1C5W B;  1KXF A;  1U6Q A;  4EST E;  1HAY B;  1F0U A;  5A8Z A;  1QB1 A;  1NRO H;  2BDH A;  1F7Z A;  1ZML A;  1MQ5 A;  7LPR A;  2ODP A;  3RXL A;  5DK1 A;  4LZ4 B;  4X1Q U;  1MCV A;  1O5G H;  2YOL A;  3DUX H;  4LZ1 H;  2IOT A;  3R3G B;  4UFG H;  4AZ2 B;  1TGS Z;  3S9A A;  2DE8 A;  3Q3X A;  2ZU1 A;  4ACB A;  5FL7 D;  1IQE A;  1L2E A;  2Y6T A;  4BTI B;  2RCE A;  1YPH C;  4Q4L A;  1AQ7 A;  1QRW A;  1Y3Y A;  1AB9 B;  3C27 B;  3P8F A;  3M5N A;  2J95 A;  4TPI Z;  1BML A;  1KSN A;  3KN2 A;  1INC A;  3A89 A;  1ESB A;  2YMS B;  1SOT A;  4FVB A;  2QV1 A;  2ZFR H;  3GY5 A;  2BD4 A;  1KYN A;  3RXP A;  3SJ8 A;  3SU2 A;  2PFE A;  5JBC S;  1UJ1 A;  5CHA B;  2G5V A;  1HV7 A;  5HMA A;  2RA0 A;  3BV9 B;  4WXV A;  5LH8 A;  1VCP A;  5F8Z A;  4CR9 A;  4WVP E;  3RXD A;  2AER H;  2OC7 A;  2ZPR A;  4CHA C;  1D3T B;  4I8L A;  1C2E A;  1NFY A;  1O2Y A;  2ZDA H;  3UNQ A;  3RMN H;  3O8D A;  3JZ2 B;  3SO3 A;  1HAP H;  3NZI A;  4R8T B;  3ZVF A;  4JZF H;  2FOB A;  1C5X B;  1QBN A;  3SNC A;  1GVZ A;  2FES H;  3U9A H;  1GG6 B;  5CHB A;  2PR3 A;  1RTK A;  3LGY A;  4I33 A;  1XMN B;  2V3O H;  2F9B H;  2WUC A;  3ENS B;  4FUG A;  1GJD B;  4ISO A;  1ZYO A;  3LC5 A;  1MQ6 A;  4AYV B;  1NC6 A;  1HLT H;  2ZI2 H;  1KLT A;  1N6X A;  5HM2 A;  5DP6 A;  5HM9 A;  5LGO A;  1ID5 H;  1IHT H;  1C1M A;  2Z3C A;  2ZC9 H;  3AAV A;  1O3F A;  3HGP A;  1ZSK A;  4OS7 A;  2Q6G A;  2GMT B;  1QA7 A;  1ZHR A;  2A7H A;  3SU5 A;  3TU7 H;  3A84 A;  2O8M A;  3QLP H;  1EPT B;  1UK4 A;  2BDG A;  4B75 A;  1KDQ A;  1M9U A;  5FX6 A;  3KQ5 A;  2EI8 A;  1K22 H;  3P8O A;  5L30 H;  1RXP A;  3Q3Y A;  3TIU A;  4UDW H;  3SNB A;  3MU0 A;  3PLB A;  2VIP A;  4ACA A;  2ALP A;  2JET C;  1V2R T;  3BTQ E;  1GBF A;  3E16 B;  4D9R A;  5K0H A;  2TGP Z;  2VBC A;  1UHB A;  2UUF B;  5DO4 H;  3LH1 A;  1RIW C;  2OTV A;  3VGC B;  2CF9 H;  5GJ4 B;  2AHM E;  1BMA A;  1MTV A;  1S6F A;  1UW7 A;  1C2L A;  1SGT A;  2ZPQ A;  1LCY A;  1FPC H;  3BTM E;  1C5N H;  3BIV H;  4K3J A;  3F2F A;  2WPI S;  3A8B A;  2J34 A;  1JRT A;  2BXU H;  2PTN A;  1ETR H;  4Q7Y A;  3T5F H;  2BQ6 B;  1EP5 A;  1A46 H;  1MZA A;  2VIW A;  1TNJ A;  2ODQ A;  2FOF A;  4X2W A;  2FIR H;  4GUX A;  1ZSL A;  5C94 A;  3P70 B;  1A3B H;  3GCH C;  2DE9 A;  1O2L A;  5GWZ A;  3U98 H;  2LPR A;  1TNH A;  4F48 B;  8LPR A;  2TBS A;  3F2G A;  2QXJ A;  2YMS D;  3DA9 B;  4CH2 B;  3MH6 A;  1DWC H;  4ISN A;  1P2I A;  5A2M H;  1TYN A;  1WQS A;  4B74 A;  4K1E A;  4X8T H;  2BDB A;  2WPL S;  5EXL A;  3WWF A;  3I78 A;  3UY9 A;  1RTF B;  5E8E H;  1CSO E;  1D9I A;  5F03 A;  3U8T H;  4B2B A;  1UO6 A;  3MFJ A;  2YNA A;  2QGR A;  1P03 A;  4A1V A;  3MU1 A;  1NU9 A;  1UVP A;  2WYG A;  4X1P U;  9LPR A;  5ABW A;  2ZTZ A;  1O3C A;  1SGR E;  3ATI A;  1CGH A;  5JB8 S;  1IAU A;  8KME 2;  1ANC A;  1VGC B;  3M7T A;  3M5L A;  4JCN A;  4MNY A;  6GCH G;  1TRY A;  1T8N A;  1V2T T;  3GCN A;  1DX5 M;  3NXP A;  4KEL A;  1T32 A;  1O2X A;  3SUG A;  1FDP A;  3MTY A;  2EI7 A;  3SUF A;  1UTN A;  2FOE A;  1V2S T;  2OC8 A;  2XWB I;  3GIS B;  2XBX A;  4Y79 A;  1Q31 A;  8GCH F;  1Q2W A;  2OQ5 A;  5JB9 S;  3GY7 A;  1A4W H;  1O3D A;  2OCV B;  3ATK A;  1XXF A;  3QTO H;  4OS6 A;  1E79 D;  1SFQ B;  2K8I A;  1Z1J A;  3E0P B;  1S0Q A;  1W0Z U;  1GHW H;  1BRC E;  1D6R A;  1JIR A;  3EA8 A;  1GPZ A;  1O34 A;  2JDI D;  1G32 B;  3MNS A;  4K1S A;  1GMC G;  4Y8X A;  2CF8 H;  1ETT H;  1J8A A;  2PKA B;  4F49 A;  2F43 B;  1BIT A;  1P04 A;  3ZIA D;  1SQO A;  3P8G A;  2ZFS A;  3RXT A;  2F91 A;  1J9C H;  1BTP A;  2Z6B D;  1PJP A;  1P05 A;  1KY9 A;  4FUJ A;  5FHT A;  1GI9 B;  2CHA C;  1OWH A;  1TGB A;  1GJ7 B;  3GY2 A;  1LPK B;  2GDE H;  1NS3 A;  1QGF A;  2HNT C;  2VH6 A;  1CHO G;  5ETX A;  1OPH B;  1TRM A;  2KFW A;  5I46 H;  1J14 A;  2D8W A;  1BTU A;  2Y5G A;  1ZRK A;  4INH A;  2FI3 E;  4PRO A;  2IJO B;  2AS9 A;  2B5T B;  5C1X A;  3S9B A;  5AF9 H;  1W7G H;  4IS5 A;  3LGV A;  2O8W A;  5EQS A;  1QQ4 A;  1ANB A;  1SHH B;  2RG3 A;  4XFQ A;  1MTN C;  1A3E H;  1O5B B;  2QE7 D;  4MG3 A;  2P3T B;  3W94 A;  1SGP E;  2J9N A;  2OC1 A;  4B6E A;  4NGA H;  1N6Y A;  2ANW A;  4SGA E;  4AFQ A;  2H5D A;  1KXB A;  1BMF D;  3PMA B;  5CMX H;  1O2W A;  1TRN A;  2R2W U;  2HRV A;  1JMO H;  2ZDK A;  4YLU A;  2V0B A;  2ZP0 H;  3HGN A;  1UVS H;  1YLN A;  3SJO A;  1MTU A;  1NY2 2;  2BY6 X;  2UUK B;  3LPR A;  3UR9 A;  5DP9 A;  4K60 A;  3GOV B;  4VGC B;  1GHB F;  3P92 A;  4FUB A;  3KYF A;  2XND D;  1GVK B;  2BDC A;  4DVA U;  2BY8 X;  1A5I A;  1YM0 A;  3NKK A;  3MH4 A;  4DT4 A;  1ETS H;  2WIN I;  3RM2 H;  2A7C A;  2XC0 A;  4ZKO U;  2HVX A;  3MH7 A;  1OYQ A;  1GCT C;  2V3H H;  2QXH A;  1KIG H;  2JJ2 D;  3PRO A;  1L0Z A;  1LPG B;  1QJ7 B;  1YPM H;  1YCP K;  3A85 A;  3ATL A;  3WWB A;  5HIY A;  1O3L A;  1YF4 A;  1A5H A;  1ZRB A;  4Q63 A;  1C1O A;  4FUI A;  1Z7K A;  1XXD A;  5T3H A;  4E05 H;  1V2L T;  5G4B A;  1PPH E;  1RGQ A;  1V2U T;  2PUX B;  5A0B A;  3KHV A;  1O2P A;  5A8Y A;  2GCT C;  3K6Z A;  3ZZD A;  4ZAE A;  3PMJ A;  1O3E A;  2TIO A;  3ZV9 A;  2NU2 E;  4IMZ A;  1GMD F;  1EJA A;  2BX4 A;  1YCP M;  1V2V T;  3ZZ6 A;  3ZVE A;  1ZOM A;  1WXR A;  2QY0 B;  1AFQ C;  1UCY K;  4X1S U;  2ANY A;  2ZDM A;  1QR3 E;  3W95 A;  1NM6 A;  2ZTX A;  1WSS H;  1E1Q D;  1MUE B;  3CP7 A;  1GCD A;  1TNL A;  1GDQ A;  2BD9 A;  2PGQ B;  2PTC E;  4BTU B;  1QL7 A;  4NIX A;  1DVA H;  2XC4 A;  1K9O E;  2Z9K A;  1E38 B;  3FFG A;  4KP0 A;  1F2S E;  4I31 A;  2W26 A;  1GI7 B;  1IQG A;  3O8R A;  1PQ8 A;  1RFN A;  1TFX A;  1BUI A;  1F5R A;  4H4F A;  1C5Y B;  1YPG H;  3M5O A;  2PUQ H;  1ARC A;  2Z3E A;  1G36 A;  2FP7 B;  1CO7 E;  3SV9 A;  1Z8G A;  4UFE H;  5FPS A;  3R0F A;  3SOS A;  1ZJK A;  4XD7 D;  1SLU B;  2FTM A;  3BTE E;  3MU4 A;  7KME H;  2A1D B;  2F83 A;  3LJJ A;  7GCH F;  4ZHL U;  1SFI A;  1Y5A T;  5I25 A;  2W7U A;  3GCT G;  4JZI A;  4X2Y A;  1HAX B;  1QB9 A;  3IG6 B;  4AG1 A;  2I6Q A;  3RU4 D;  1YGC H;  1C2M A;  4NA7 A;  4Y7A A;  5A0A E;  1DS2 E;  1GJ6 A;  1YC0 A;  1SGQ E;  1ZLR A;  1Y5U T;  1YPL H;  3OEH D;  1JXP A;  1C1P A;  1FY5 A;  2BX3 A;  4KTC A;  3Q76 A;  3PV2 A;  3K2U A;  1BMN H;  2BM2 A;  3I77 A;  2ZHW H;  1CA0 B;  2VU8 E;  1C5U A;  1RTL A;  3F9G A;  5FCK A;  2BD5 A;  1EZS C;  2OD3 B;  4CRD A;  1EB1 H;  3CEN A;  1E34 B;  2G52 A;  4D7G A;  1GBJ A;  5DKM A;  5KED A;  1YP9 A;  1C1V H;  4MVN A;  4AOQ A;  3B8J A;  1Y3V A;  3QN7 A;  1GI1 A;  2W3I A;  3OAA D;  1OP2 A;  4M9F A;  1GBB A;  2FI5 E;  3HK6 B;  4Q7Z A;  4RT1 A;  2PW8 H;  1ELE E;  3GY8 A;  1OP8 A;  1SL3 A;  1BHX F;  1FUJ A;  1SB1 H;  2BD8 A;  4GPG A;  2O8L A;  4X2V A;  2BYA X;  2TGA A;  3STI A;  1MKX H;  1PFX C;  1W0Y H;  1EQ9 A;  2ILN A;  3PLK A;  1AVW A;  3H5C B;  5DPA A;  1TBZ H;  1FY3 A;  1NRR H;  2G00 A;  5FBE A;  2SGQ E;  3MNB A;  3P6Z B;  2Z9G A;  2SGP E;  2VGC C;  1UTO A;  4GVU A;  2FOA A;  3KGP A;  1H4W A;  5KEC A;  1K1I A;  2AMQ A;  1ZMN A;  1T8M A;  1AN1 E;  2OC0 A;  3RXI A;  1GDU A;  1O3I A;  2FYQ A;  4OS4 A;  4TY7 A;  3M35 A;  2HVY B;  3QWC H;  3QX5 H;  4CRF A;  3CS0 A;  1EZU C;  4XRN A;  4Q80 A;  2XW9 A;  4TY6 A;  2FS9 A;  1GI3 A;  4DUR A;  4I8J A;  1XVM A;  1H8E D;  1DLK B;  2AIP A;  4ISI H;  3VB7 A;  1NU7 B;  2CJI A;  1O5C B;  3F1S B;  1FY1 A;  2RDE A;  2TGD A;  1T31 A;  2CV3 A;  3URD A;  2ZTY A;  4NZQ A;  3OY6 U;  1EXF A;  2CGA A;  5FPY A;  1J15 A;  1ZTL A;  1HBT H;  5AFY H;  4FET A;  5C5O A;  3KQD A;  2KCA A;  3ZVG A;  4YT7 H;  1BRB E;  1PPG E;  3RXV A;  3RXJ A;  2V3M A;  2A45 B;  3E90 B;  1SGF G;  1ZSJ A;  1HNE E;  1WOF A;  3LH3 A;  4UFD H;  1O3H A;  5E0J A;  3U8R H;  3QK1 A;  4DIH H;  1WDI A;  2ZZU H;  3QGJ A;  2NU4 E;  2P59 A;  1NO9 H;  4I8G A;  1OWK A;  3LOX A;  1QBO A;  3LON A;  4RI0 A;  1EFR D;  1O2V A;  3V7T A;  4IW4 E;  1QB6 A;  2O8U A;  2THF B;  4ZCN A;  1OOK B;  3AW1 A;  1GMH G;  4XDE A;  3SND A;  1FMG A;  3UUZ A;  2OIN A;  3SBK A;  1HAV A;  1O3M A;  3P95 A;  1W11 U;  2BD3 A;  1DSU A;  1F5L A;  3OSY A;  5A8X A;  2JIZ D;  1AWF H;  1D3Q B;  3MMG A;  1IQK A;  1NT1 A;  3F3B A;  3M7U A;  1HJ8 A;  3TVJ B;  3STJ A;  1TX6 A;  3HKI B;  2J5U A;  3RXH A;  1Y3X A;  2VVU A;  3MO6 A;  3AK5 A;  6CHA C;  1BIO A;  1ELT A;  1ZGV A;  3EYD A;  3L6P A;  1GI5 A;  1RS0 A;  3M61 U;  1GI8 B;  3UQV A;  2EA3 A;  3A82 A;  4WME A;  4YO9 A;  2BZ6 H;  4U32 A;  4NA8 A;  3GS9 A;  1N8O C;  1K1L A;  6LPR A;  4Y0Y E;  2ZG0 H;  1P0S H;  4GHQ A;  3FO8 D;  2EI6 A;  1ELD E;  2D2D A;  4OGX A;  2P94 A;  2QF4 A;  3ZZ9 A;  2GX4 A;  2SNW A;  5C1U A;  3SZE A;  3HPT B;  4Z1M D;  5B6O A;  3V3M A;  3KNX A;  2KAI A;  1UTP A;  1NPM A;  1K21 H;  1J16 A;  2P8O C;  1G3E A;  1BTZ A;  1K1M A;  4NCY A;  1P8V C;  1PPC E;  1A2C H;  1SGN E;  1ZHM A;  1QCP A;  3OU0 A;  4BNR A;  2HGT H;  2SGF E;  1ELC A;  2GT7 A;  8GCH G;  3A83 A;  1MU8 B;  1GBA A;  1S82 A;  4INK A;  1ANE A;  1V2K T;  1BTY A;  2LNC A;  2VIO A;  1AI8 H;  3ZZA A;  4GCH F;  1LPZ B;  4WXI A;  2H5C A;  3FP8 E;  2BQ7 B;  3SV7 A;  3TJO A;  4IN2 A;  1FAK H;  3SGB E;  4JYT A;  1C5Z B;  1FXY A;  1SVP A;  3T29 A;  1CT2 E;  2ZFQ H;  3ZZ5 A;  3BEF B;  1ZMJ A;  4I32 A;  1TPA E;  1VR1 H;  2BVR H;  4ZUH A;  1L4D A;  2PP6 A;  4ZHA A;  1DUA A;  5JBB S;  2WZQ A;  1V2N T;  2J98 A;  3OX7 U;  3RXK A;  3T27 A;  3JZ1 B;  1O2N A;  2BDA A;  5T1V A;  1DLE A;  1LVY A;  2VWL A;  1S84 A;  3UTU H;  1MBM A;  3LIW A;  2SGD E;  1C2G A;  1SC8 U;  2J97 A;  2A4G A;  1QJ6 B;  1BMM H;  4A5T S;  5DP4 A;  5CDF E;  3EA9 A;  1AKS B;  1GWA A;  2WPM S;  4RSP A;  1NRQ H;  3ODF A;  1OHH D;  1GJ9 B;  1SGF A;  1HFD A;  3SV6 A;  1MH0 A;  2Y5F A;  4BAQ B;  1HGT H;  5EG4 A;  1L1G A;  1F5K U;  1SI5 H;  1SQT A;  1FON A;  4ZHM U;  1AY6 H;  2W5E A;  4A7I B;  1LHD H;  4LXB H;  2J4I A;  4GAW A;  3VFE A;  2F9O A;  4WMF A;  4WWY A;  1UCY E;  5EST E;  1BHX B;  1S81 A;  4UEH H;  5J4S A;  1VJ9 U;  5FCR A;  3URC A;  1HRT H;  4BAM B;  1DWB H;  1JIM A;  1KLJ H;  2IPQ X;  3OEE D;  1NTP A;  4K8B A;  2A5K A;  3E6P H;  2BOH B;  1SGY E;  4NZL A;  1TLD A;  3BIU H;  1TMT H;  1XUH A;  1ESA A;  1PPB H;  5FPT A;  1UMA H;  3TH2 H;  1BJU A;  3RXE A;  1S0R A;  2GCH F;  2BMG B;  3SI3 H;  1MAX A;  1BDA A;  3PRB A;  3TGK E;  4HTC H;  2ZA5 A;  4BXW A;  4R0I A;  1ABJ H;  1CE5 A;  4I86 A;  4MPW A;  4FUH A;  3Q77 A;  1AND A;  1TPO A;  2EY4 C;  3MQK C;  4MNW A;  3PB1 E;  3A8C A;  3TH3 H;  4X6O A;  2FX4 A;  5PTP A;  2BY7 X;  2A7J A;  4E7R G;  1EB2 A;  4DII H;  2QIQ A;  3URE A;  1KXC A;  4K1T A;  1UVU H;  3E3T A;  2WPH S;  1RJX B;  3FN8 A;  1P2K A;  2A2Q H;  3MNC A;  5AVD A;  1C4V 2;  3SU1 A;  3SU3 A;  1MAY A;  2Z9L A;  1C9T A;  2PKS B;  5F53 A;  3P8N A;  1TBR H;  4OS2 A;  5DSF A;  1DAN H;  2OXS A;  3SI4 H;  1CA8 B;  1GMD G;  1KLI H;  1A0L A;  3GDS A;  1O3O A;  1GBK A;  2KM0 A;  4ZKR U;  4UD9 H;  1GGD B;  1C5L H;  1Y3W A;  4YES B;  3SN8 A;  3EAJ A;  3OTP A;  2H1U A;  1AIX H;  4J1Y A;  1NES E;  1A1R A;  4YXW D;  1X7A C;  1ZZZ A;  1T7C A;  3PYH A;  1XKB C;  4Y10 E;  1PPF E;  1S85 A;  2BLW A;  3K65 B;  3KQC A;  3A7W A;  3NK8 A;  2CN0 H;  1F0R A;  5GIB A;  2R0K A;  1EZQ A;  1VCQ A;  1MAB B;  2ZDN A;  1G3D A;  8EST E;  1HIA A;  3RXG A;  3UIR A;  2GVF A;  4NFF A;  3VXF H;  4SGB E;  1G37 A;  2WUB A;  4TWY A;  1KTT B;  1V2M T;  2GZ7 A;  2UWL A;  3HAT H;  3N7E A;  3C1K A;  1QRZ A;  1FN6 A;  1TNK A;  3F9H A;  4NSY A;  1UTL M;  3VB4 A;  3ZVC A;  1ZTJ A;  5C17 A;  1HAG E;  2BVS H;  3EGK H;  1MD8 A;  3D23 A;  2Q6D A;  3M37 A;  2C8Z B;  3O8C A;  4ZMA H;  1AHT H;  1MKW K;  1SLV B;  2G81 E;  2LEL A;  4Q7X A;  1AGJ A;  2FMJ A;  5GCH G;  2Z7F E;  4O97 A;  2EST E;  1G2L A;  2WHX A;  1VIT G;  1QJ1 B;  2VWO A;  1HAO H;  1A0J A;  2GTB A;  2ZIQ H;  1C2F A;  1Y5B T;  2F9V A;  3VB3 A;  2ZU4 A;  2EC9 H;  3BN9 A;  3TNS A;  1MD7 A;  3RXF A;  1DST A;  4K8Y A;  1O3P B;  3QGN B;  5HXF A;  1UTK A;  9EST A;  1KXE A;  4Y0Z E;  3SHC H;  1C5R A;  3A86 A;  2VNT A;  4MPV A;  3O8B A;  2R0L A;  5TCC A;  1O33 A;  3V13 A;  2KX4 A;  1CBW C;  2SGA A;  4D8N A;  1NFX A;  2FS8 A;  1VCW A;  1O36 A;  3PO1 C;  7EST E;  1QTF A;  2QN5 T;  3N7D A;  4QT8 C;  3U1J B;  2AFQ B;  4CRE A;  3QO6 A;  1V3X A;  2ZFT A;  3BTH E;  1W2K H;  4LK4 A;  1CQQ A;  3DSO A;  3F2H A;  4B71 A;  1TGT A;  2FDA A;  2FOG A;  1XUG A;  2GT8 A;  5C3N A;  4XBC A;  2AYW A;  2H6M A;  1DFP A;  1UTQ A;  1XUI A;  1UVT H;  4X8V H;  1PQ5 A;  5H4I B;  1NBM D;  2BXT H;  5C0T A;  4X8U H;  2QF3 A;  2NWN A;  1F0S A;  3PWC A;  1BTX A;  1AZZ A;  4ABA A;  1H8H D;  2EEK A;  2R3U A;  1Z1I A;  5EQQ A;  1D3P B;  1KXD A;  1O38 A;  2ULL A;  4JZE H;  1GL1 A;  2PSX A;  2JKH A;  2VJ1 A;  3ATW A;  4TWW A;  3DD2 H;  2GV7 A;  1GJB B;  1QNJ A;  2ZNK H;  1O2G H;  4UON A;  2VH0 A;  4E06 H;  1O2K A;  4XBD A;  1SKY E;  4TSF D;  2W3K A;  1AVX A;  1HPG A;  1HJA C;  4NIW A;  3ZZB A;  4MQA A;  4GLY A;  1V2J T;  1WBG B;  2XYA A;  1TAL A;  3U1I B;  4KKD A;  1KTS B;  2NU3 E;  3RLY H;  1HAI H;  3BG4 C;  1SLX B;  2B7D H;  1O2T A;  1SQA A;  3RU4 E;  1O3B A;  3H7O A;  1C1R A;  2XC5 A;  1FI8 A;  1GHV H;  1T4U H;  2XBW A;  3SJK A;  3OYP A;  2O8T A;  2Y7X A;  2J2U A;  4K69 A;  1OKX A;  1GI2 A;  2M2A A;  2I6S A;  1O2I A;  3FP6 E;  5LPR A;  1FQ3 A;  2WPD D;  3LKW A;  5K7R A;  3RXS A;  3UFA A;  2C93 B;  1O37 A;  4UE7 H;  2IN2 A;  2HNT F;  1DPO A;  2R3Y A;  1W0K D;  1SG8 B;  3LGU A;  1YPH E;  1BOQ A;  2NU1 E;  4JZ1 A;  1C2J A;  4FU8 A;  1SPJ A;  2PLX A;  2UWP A;  3FVF B;  4Y7B A;  5KGO A;  4BOH A;  4Y71 A;  4Z6A H;  4NWK A;  4DCD A;  1NZQ H;  3BEI B;  4H6S B;  2BY5 X;  4A1X A;  5ESB A;  2BDI A;  4CHA B;  2OBO A;  3N99 A;  1AB9 C;  1ZGI A;  1QA0 A;  3SGA E;  3U69 H;  4BAN B;  2GGV B;  3U28 C;  3SHA H;  2HLC A;  3Q00 A;  3RXU A;  1BB0 B;  3L33 A;  3AAS A;  1ZPZ A;  1VIT H;  1IQL A;  2YMS C;  1K1O A;  3RXQ A;  4CRA A;  3DFL A;  4X1N U;  1YPK H;  3SYJ A;  2FOM B;  1CGI E;  3GDU A;  5HKK D;  2PV9 B;  3VEQ B;  1YCP H;  2VVV A;  3MWI U;  3WY8 A;  5CHA C;  1EX3 A;  1GBD A;  1XVO A;  1JRS A;  1JBU H;  1UK2 A;  4H42 U;  2WV4 A;  3MO3 A;  1KXA A;  3RMO H;  1QL9 A;  2BDY A;  3BSQ A;  4K5Z A;  1GI4 A;  1TOC B;  1H9L B;  1TQ7 B;  5EGM A;  2OBQ A;  1EKB B;  2KR7 A;  1YY3 A;  4I8H A;  3MU5 A;  4YZU A;  1GG6 C;  1PYT D;  1UCY H;  4O03 A;  3KCG H;  5EPY A;  3B23 B;  1C2D A;  1ZR0 A;  3PMB B;  2XBY A;  3FZZ A;  1TOM H;  4JYV H;  2IPH A;  1KDQ B;  2D26 C;  1TGC A;  1DWE H;  1MBQ A;  1WQV H;  3CS7 A;  1O3A A;  5F8T A;  5EJL A;  1XUF A;  3D62 A;  2OP9 A;  2JET B;  3S7K B;  5A0C A;  4AG2 A;  1NRP H;  2HLD D;  4CRC A;  1RIW B;  2QC2 A;  2ZCL P;  2HOB A;  1Q3X A;  1FPH H;  2GMT C;  1HDT H;  5IK2 D;  2VB0 A;  3EA7 A;  1DXW A;  1C4U 2;  1P11 E;  3EE7 A;  1EPT A;  1C2K A;  1ARB A;  2FWW A;  4ZKS U;  2NU0 E;  3TPI Z;  1EPT C;  1NRS H;  3A81 A;  2VIV A;  1AWH B;  3GCO A;  3BTK E;  3E0N B;  4GCH G;  1YPE H;  1ZTK A;  1H8D H;  2Y7Z A;  4TPY A;  4OS1 A;  1NN6 A;  4JK6 A;  2HWL B;  2DUC A;  3EQ0 H;  1GL0 E;  4CRB A;  1T8L A;  3GCH B;  3UOP A;  3VGC C;  2B9L A;  4DJZ B;  1EAX A;  2SFA A;  3SUD A;  3M5M A;  1QQU A;  2KCP A;  3SOR A;  3UWJ H;  5E2P A;  5HGG A;  2PWX A;  1DM4 B;  3VB5 A;  1KMH B;  3MNX A;  2XCF A;  2G4T A;  3MO9 A;  5EW2 H;  3F9F A;  4ASU D;  3TJN A;  1V2P T;  1OYT H;  2A4Q A;  3QZR A;  3PTB A;  5C20 A;  2AMD A;  4WY3 A;  5AHG H;  1EJM A;  4IN1 A;  1TA2 A;  1CT0 E;  1DY9 A;  1BQY A;  5EPN A;  1IQJ A;  2PHB A;  1BT7 A;  1D4P B;  2CMY A;  1P12 E;  2F9P A;  1BTH H;  2BOK A;  1G9I E;  1BBR K;  2L6O A;  2SNV A;  1OSS A;  3PM3 A;  4IC5 A;  1QHR B;  2J38 A;  2ZU5 A;  4TT3 D;  3A88 A;  5EQR A;  3BTT E;  1O2Z A;  5E2O A;  2ZHE H;  3RXA A;  5IYT A;  4U2W A;  5C67 A;  3RC5 A;  1OP0 A;  4FUD A;  5DP3 A;  2BHG A;  4AFU A;  2VID A;  3DFJ A;  3BG8 A;  1GBT A;  1SMF E;  4ZXY H;  1P2N A;  4ASH A;  3K9X B;  3NCL A;  2A5I A;  3PV4 A;  1DXP A;  1LHE H;  1A61 H;  2HPQ H;  1Z8R A;  2STB E;  1GHZ A;  3K6Y A;  1S5S A;  1SGI B;  1GI0 A;  3ITI A;  3RML H;  1C5M D;  2GKV E;  1O3G A;  3VPK A;  2ODY B;  5EOK A;  4YTA A;  1VGC C;  1QRX A;  3RXR A;  3G01 A;  4AB8 A;  1MZD A;  3UOU A;  3ZZ7 A;  1EAU A;  2Z9I A;  1WV7 H;  3LDX H;  1L1N A;  2JH0 D;  3ZV8 A;  1N1L A;  5BRR E;  2CHA B;  3SGQ E;  4AX9 H;  5HYO A;  3DSP A;  2QYI A;  1TX7 A;  2BD2 A;  4M7G A;  2F3C E;  1UK3 A;  2O9Q A;  1HJ9 A;  3EE0 B;  1AO5 A;  1E35 B;  1YLC A;  3FZD A;  4GSO A;  4IGD A;  5FBI A;  4AYY B;  1V2O T;  3UWI A;  2ALV A;  3ZYE A;  3RLW H;  2Z94 A;  2PKA A;  1VJA U;  1E1R D;  3P17 H;  1TQ0 B;  3FP7 E;  5LPE A;  2WSS D;  2HNT E;  1EAS A;  1MTN B;  2VWN A;  1VKY A;  5EIY A;  3SV2 H;  2ZU2 A;  2QA9 E;  1DWD H;  1O3K A;  3N7O A;  1IHS H;  2H2Z A;  2GD4 B;  1BZX E;  1W3C A;  3VXE H;  1SOZ A;  3FOA A;  1WCZ A;  1CHG A;  1TX8 A;  2WV5 A;  2V6N A;  1Z8I B;  4MPX A;  4YOG A;  4A92 A;  2ZDL A;  1G30 B;  1HUT H;  1HXE H;  1P9S A;  1WTG H;  1COW D;  2C8W B;  4F55 A;  5B6L A;  3KID U;  2AGE X;  1H9H E;  3SJI A;  3TLO A;  3TJU A;  1FX0 B;  5FAH A;  2OLG A;  2ZDV H;  3BTF E;  4KTS A;  1MTW A;  1OWE A;  1FJS A;  1ZPC A;  1YPJ H;  2Y81 A;  3GDV A;  2XXL A;  2P95 A;  2HPP H;  1WUN H;  2ANM H;  5C5N A;  1SHY A;  2PGB B;  3FKS D;  1QIX B;  1F92 A;  2JJ1 D;  4FXG H;  1GHX H;  2STA E;  2FM2 A;  1ZHP A;  2GV6 A;  1ACB E;  1D3D B;  3SNE A;  1TMB H;  1GCT B;  4B6F A;  2ZO3 H;  2BB4 A;  2FOH A;  3TJV A;  3TK9 A;  2GJG A;  4P02 A;  4Q2K A;  1HAH H;  4DOQ A;  1E0F D;  3F0P A;  3HK3 B;  1H1B A;  4NA9 H;  4ABD A;  3GCT F;  1FIZ A;  2AMP A;  4VGC C;  1HB0 B;  2BD7 A;  3A7T A;  2P93 A;  4FVD A;  2V35 A;  1GBL A;  3SQH E;  2WPJ S;  2LP6 A;  1SR5 C;  1YYY 1;  3CNR A;  4IC6 A;  1O5D H;  1WYK A;  4BAK B;  1O39 A;  2GCT B;  1XX9 A;  5E0H A;  1K1N A;  2FO9 A;  4X2X A;  1SLW B;  2R9P A;  5T6F A;  3E1X B;  2AGG X;  4BTT B;  1AFQ B;  3Q3K A;  1AE8 H;  2QCY A;  1B5G H;  3MU8 A;  1FAX A;  2BVX H;  1ORF A;  2FI4 E;  2KCY A;  3ZVB A;  3QTV H;  1K1J A;  2C8X B;  4FU9 A;  4D7F A;  5GDS H;  3LJO A;  1ABI H;  5DG6 A;  1O2Q A;  1A5G H;  3FAN A;  4FOU C;  1MMJ N;  1S6H A;  4ZXX H;  1EOL A;  2AGI X;  1GJ8 B;  1O2S A;  1DT2 A;  1C1U H;  3GYL B;  1C4Y 2;  3QDZ B;  2J92 A;  1TGN A;  1LKA A;  1V2Q T;  2VVC A;  1B7X B;  2RA3 A;  2TRM A;  3QUM P;  2A0Q B;  3PWB A;  2JH5 D;  3F0O A;  1OXG A;  4NFE A;  2ZWL H;  2G5N A;  3A87 A;  3A7Z A;  3UB0 A;  1P06 A;  4MDS A;  1GJ5 H;  2XOK D;  3F6U H;  3NRL A;  1JWT A;  1BTW A;  1CGJ E;  1O2H A;  2G51 A;  1O2J A;  4GHT A;  5LPF A;  3RM0 H;  2AH4 X;  2XNI A;  1IQM A;  2M5T A;  4X8S H;  4B2C A;  3RMM H;  3TIT A;  1SQR A;  4I8K A;  1GHB G;  4Y11 E;  3SNA A;  3ZZ8 A;  4CBO A;  1O2R A;  2QXI A;  1AZ8 A;  2BZA A;  2F9U A;  2F9N A;  3NWU A;  2RFK C;  1AD8 H;  1P2M A;  2ZFF H;  2WPK S;  1YKT A;  5JDU B;  3BF6 H;  2Z9J A;  1LVB A;  5A09 A;  1DE7 H;  3ZZ3 A;  1TWX B;  5C0U A;  3ZZC A;  4B1T A;  2D1J A;  4OS5 A;  1EJN A;  3LGI A;  5GND A;  5C2Z A;  1GHA F;  1AU8 A;  1K2I 1;  1Z6J H;  3LT3 A;  3ELA H; 
#chains in the Genus database with same CATH homology
 2KX4 A;  1K0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...