2R9PA

Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(bpti)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
publication title Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r9pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r9pA02
1DSUA 5CHAB 3ZZ8A 1Y59T 3M3VA 1IQGA 1LQDB 4WMFA 1XUIA 3GCOA 3V7TA 1KSNA 2OQ5A 1FY3A 1O2LA 1KXBA 3UR6A 3EA8A 4D76A 1O35A 1C4U2 3UPEA 2AGEX 4NA9H 2XBWA 5A8XA 1O2KA 2O8TA 4X1SU 2ZDMA 4RSPA 3ZZ7A 3RC4A 5IYTA 4OGXA 3RXFA 1BJUA 6CHAC 1MAYA 1SLWB 3TK9A 3RC5A 1ESTA 2W3IA 1EAWA 4H42U 2ZPSA 1VCPA 1Q2WA 1TMBH 1OP0A 1KDQA 1NFXA 2XRCA 4BANB 1XMNB 1CGHA 1HJAB 1OP2A 1J14A 1Y3YA 4OS4A 2FIRH 3T2NA 1O33A 1ABIH 2XXLA 5LH8A 4JZFH 1EASA 1UCYE 1GI1A 1DY9A 4ZXXH 1O39A 1QL7A 1CT4E 3RXJA 3NCLA 3S7HB 3LJJA 5AF9H 2ZECA 3CS7A 3I78A 4X1RU 4X8TH 1DWBH 3PO1B 4Q7XA 4KTCA 3T62A 1HYLA 3PYHA 1ZTLA 2QXHA 3RMOH 1TPOA 1LO6A 1CA0B 2VVUA 1A0HB 1BITA 3MU8A 1C1PA 1T8OA 1GMCG 2GT7A 1O34A 2ANKH 3EYDA 3GCHC 1LHGH 4FVDA 3DFLA 3PWBA 1DT2A 1P02A 2A5IA 1DITH 5DP4A 2A45B 1S6FA 3TGJE 3HKIB 2ZGBH 3GISB 7ESTE 5JPMH 1G3BA 1PPGE 1G36A 1EZUC 4GCHF 4RKJB 2SGDE 1AE5A 1C2FA 4E7RG 2F9OA 3S0NA 1UTLM 4ZH8A 4R0IA 1T8LA 1VCQA 3NXPA 1NTPA 1ELGA 3Q3XA 1NESE 1GHAF 1ZSKA 2VU8E 4AZ2B 1BUIA 2VGCB 2ZTYA 1SVPA 4ABAA 4KGAA 3UR9A 1IOEA 5HM9A 2FM2A 5DP3A 3VXFH 5A0CA 4J1YA 1ZGIA 1G30B 3U8TH 1GI2A 1O2WA 3DFJA 1YGCH 1Q31A 1ZPZA 1O3KA 2FYQA 1CGIE 1HDTH 1EKBB 4K60A 4NCYA 2ANWA 1A4WH 1ZYOA 3ATMA 3RXVA 1GDQA 2Z3EA 4FU9A 1GHBG 3ITIA 7GCHG 1TRNA 3P8NA 1ABJH 1CGJE 2Y82A 2PLXA 4HTCH 3OU0A 4NWKA 1EB2A 1O3JA 3OY5U 1AWFH 4JZ1A 1Y5AT 2YNBA 2BD3A 2XW9A 1H8IH 4GPGA 4DOQA 1W13U 2NU3E 1RTLA 4X8VH 3A8AA 1ID5H 1SBWA 1Z1JA 4U2WA 1K1JA 1HV7A 2SNWA 2SNVA 1JIMA 3URDA 2PSYA 4ZKRU 2Q6GA 4A92A 5A09A 1UTJA 4J2YB 4ASHA 5E0GA 4JK6A 1O2MA 1JBUH 4Y8XA 4K5ZA 1P01A 3RMNH 1FY1A 1UVPA 1FXYA 1KXDA 4ISNA 4JZDH 5T6GA 4CR5A 2ZDKA 1GCDA 1F0RA 7LPRA 1EX3A 3PMBB 4YT7H 1JRSA 2ZGXH 5C3NA 1C1SA 3BEFB 4NSVA 3RM2H 1Y3XA 5C1YA 1OXGA 3FFGA 2H9EH 2XBXA 3SQEE 3SBKA 2FMJA 6ESTA 4CR9A 1C1NA 4BAMB 1VR1H 4AG1A 1DUEA 1BRCE 2HRVA 1OPHB 4OS2A 1UHBB 3MNBA 1BDAA 2W7SA 5EQQA 3BTHE 4UD9H 3RXUA 3GY3A 3SNEA 4CBOA 2BY8X 2FI4E 1AD8H 1CBWB 1O31A 3H5CB 2XWAA 4TPYA 1GMDF 1S81A 1GG6B 2XC0A 3URCA 5DG6A 2A0QB 5LGOA 3BG8A 5DPAA 2EA3A 2ZZUH 3L6PA 3SNAA 1C2GA 1L4ZA 3S7KB 1BTUA 2HNTC 1IQJA 1IHTH 1UVSH 1CU1A 2ODYB 3K9XB 1XKBC 1TB6H 4BTIB 1AUJA 4NIXA 1T31A 3TGKE 1ANEA 1O37A 3PM3A 1ZHMA 1C1RA 5DP6A 4YM9A 2HPQH 4Q80A 1F92A 4ISIH 4O3UA 2ZA5A 1P12E 3FZZA 3BN9A 3TJNA 3LGWA 4AORA 1C2IA 5EG4A 3GICB 2ANYA 5TJXA 4CRGA 1SGFG 2G5NA 1VZQH 4A1VA 1A0JA 5JBAS 1PYTD 1BTYA 1JMOH 3QK1A 4MNYA 1WCZA 2J9NA 2Z94A 3M37A 3PMHB 2JETC 2NWNA 1ZGVA 3R0FA 3ZVCA 2J95A 2XC5A 4K1SA 3E1XB 1THPB 4K69A 1C5LH 1W2KH 3NK8A 3MU0A 2A7JA 1TOMH 5EW1H 2CHAC 1GHVH 1Y3UA 1QA0A 3IITA 3F6UH 1WBGB 3AAUA 5DO4H 2FOBA 4IGDA 2Y7ZA 2VH6A 1FY5A 4TWWA 1QJ7B 2FWWA 1GBEA 1TFXA 3TJUA 1TGBA 2P59A 2RCEA 3RXPA 1XUHA 1TWXB 5I25A 2ZC9H 5FXLA 2FP7B 3A8DA 5AVDA 4MDSA 2TGDA 3TK5A 2R3YA 1AZZA 2OC1A 1G2MA 4UE7H 1O2VA 4VGCB 2GMTC 1Y3VA 2QGRA 3E0NB 3T29A 1FJSA 2GCHF 1KXFA 1XKAC 3RU4T 2J94A 2QXGA 5GJ4B 1UCYH 1EAXA 2ZGJA 3F9HA 3B9FH 5BPEA 5DGJA 2P95A 3LGVA 1QB1A 2H9TH 2BXTH 2V6NA 3SOSA 3UREA 3UY9A 4WMDA 3KQCA 3RXMA 1J16A 1MMJN 2F9BH 2ZFPH 4LXBH 1C2DA 4YO9A 1EJNA 4K1EA 3ATWA 1LDTT 3HGNA 3TJVA 4UONA 2FODA 1C2KA 1P04A 3W95A 3MU4A 4AB9A 1P09A 3EDXB 4BAKB 4MNWA 2BY9X 4CRDA 1P2MA 1C2MA 3D62A 2ZCKP 1NRQH 1GHXH 3HATH 1O3BA 1QBNA 1YCPH 2ZHWH 5HM2A 1LKAA 1BTPA 1WU1A 4OS7A 5EQRA 2QA9E 4Y10E 2GZ7A 4GCHG 4X2WA 2BDHA 1C1TA 5JBCS 1VJAU 3AASA 1BZXE 4ISOA 1FLEE 2PKAB 5JB8S 1MTSA 1TA6A 2IN2A 1KXCA 3HKJB 3HPTB 1XUFA 2A4RA 1C5PA 1FPHH 1GHAG 4MPWA 1QR3E 1H4WA 4JK5A 3GDUA 2Z9KA 2WINI 2G00A 1EP5A 1GI0A 1ETRH 2OXSA 5EXNA 2D26C 1YLDA 1YC0A 2UWOA 1A0LA 1ESAA 1S0RA 2FS8A 1TYNA 3ATKA 1LPGB 1Z7KA 2A4OA 1DX5M 4GAWA 1A3BH 4Z6AH 4LOYH 2O8MA 1C2EA 1WAYB 1O30A 2BD4A 2O8LA 1GI3A 4HZHA 2FTMA 3I29A 1UK4A 1Y5UT 1UTKA 2PHBA 3TU7H 1V3XA 2BYAX 1RRKA 3M3TA 1F5RA 1FN6A 1SOTA 1UTQA 3PV4A 1F7ZA 2PKSC 3P17H 1ANCA 1JIRA 1KDQB 1AU8A 3A7WA 5E2OA 5BRRE 2HLCA 3P8OA 1EZSC 1SSXA 3SUEA 3NPSA 4X1QU 3GY5A 5F6MA 2ODQA 3S9AA 1YPJH 2ZGHA 2QV1A 3RU4E 2B9LA 3ODDA 2BQ7B 4WF8A 1BBRK 3SW2B 1DSTA 3A7YA 3BG4B 2OQUA 2XTTB 2ZU3A 1RIWB 1O2IA 1LVBA 2VWMA 4TPIZ 1FPCH 2ZG0H 2B0FA 2HVXA 1EATA 1EZQA 1P05A 2QAAA 2Z9LA 1E0FD 1Q3XA 4TY7A 1C1OA 1TBRH 2ZU5A 4IN2A 1DVAH 2GV7A 3ZV9A 1MQ6A 4MPVA 2BD9A 2YNAA 1QNJA 2BX4A 1O5CB 2OINA 4LZ1H 2LPRA 3SHCH 1BT7A 1MQ5A 4JYUH 1HNEE 1HAVA 2G5VA 1YLCA 3RLWH 1F0SA 1HAIH 3QO6A 1DXPA 3ZVGA 2BX3A 5ESTE 3TITA 2C8ZB 4XBCA 4I8LA 1A5IA 2FZZA 1GMDG 1P03A 1V2RT 4FUIA 4GHTA 1EZXC 1ZMLA 1ELEE 3UOUA 5LPFA 3GYLB 2A5AA 1YPGH 4ZKOU 3NUMA 1GBCA 2ZFQH 4X6MA 1V2TT 3F9GA 1NY22 3ZZ6A 1WOFA 2PTCE 4K3JA 3M7QA 5L2ZH 3LC5A 2SGQE 4AFZA 2VIVA 3SORA 2YOLA 1TPSA 1KTTB 3U69H 4CHAB 1YKTA 1AFEH 2HGTH 2QF0A 2GZ8A 1Z8RA 1O2UA 1O2SA 1FN8A 1LHDH 2UWLA 3A8CA 3MNCA 1A5GH 1O3OA 4ZHLU 4MG3A 1C5ZB 2EI6A 3ESTA 3MTYA 4ABHA 3SUDA 1SQAA 2EC9H 1G3EA 2OLGA 3SGBE 5FBEA 1SMFE 2BDCA 1LQEA 3JZ1B 5DP8A 1O2JA 3NWUA 1NFWA 2GGVB 2PV9B 4FUBA 2C4FH 3BEUA 1C5VA 4DY7B 2AIPA 2H5DA 2ZCLP 3TGIE 3MYWA 1DXWA 3U1JB 3LH3A 2QN5T 3VGCC 4KELA 5DP7A 3MFJA 4NZLA 3ZYDA 2BHGA 1EXFA 2Y5HA 1C1QA 1HUTH 2BTCE 1AKSA 1NRNH 4MVNA 1GBBA 1ZSLA 2FOCA 2ZHFH 1XM1A 1O5FH 2ZPQA 3BTEE 3EA9A 1E34B 1ELBA 2BD7A 3RXIA 4DIHH 3Q3YA 1TNGA 2GCTC 3BTFE 1AMHA 1YPHC 5C1XA 3NZIA 1DLEA 4BAHB 1P57B 2SGPE 1PPEE 1AI8H 5FPSA 1YPMH 1OKXA 1ETSH 4XBDA 4A6LA 3AAVA 4E7NA 1EAUA 2BQWB 1BTWA 4TY6A 4I33A 3EQ0H 2BLQA 1FMGA 2J92A 4Y76A 4LZ4B 4XFQA 2SGFE 1OWIA 1LMWB 1WV7H 2GCHG 2TGAA 3HK6B 2RG3A 2KAIA 1O5BB 2GX4A 1AVGH 2BM2A 1TA2A 2UUKB 1GI8B 3WY8A 3M5NA 3OYPA 1GHWH 3A80A 3ZVBA 1CHGA 3MO3A 2PFEA 6CHAB 1AB9C 3P92A 4JCNA 1QJ6B 2W3KA 1F2SE 3GY7A 4THNH 1YCPM 4X6PA 1CT0E 4IMQA 1V2ST 3U98H 1WTHD 2ZFRH 3BTME 4UFEH 1GJ4H 5EODA 1L2EA 2GV6A 2PGQB 1FONA 2D1JA 1LCYA 1SHYA 4ZAEA 5FX6A 1A46H 1H9HE 1DWCH 4UFDH 1C5UA 2BY6X 1EJMA 2O8UA 1LHCH 4ZHMU 2JH0D 4WJG2 1DWEH 1LKBA 2STBE 4ZKNU 1GI5A 3U9AH 1LHEH 3SHAH 1KTSB 1KYNA 5ETXA 2F9VA 4D9RA 2JKHA 2FLRH 1G2LA 1V2LT 2HNTF 4Y71A 4I31A 1GBKA 5GWZA 3GCHB 2H9HA 1O3EA 1FAXA 5C2ZA 1SLUB 3SV2H 1C5OH 2CF9H 2TBSA 2XCFA 5FCKA 5L2YH 2DUCA 2AGIX 1C5NH 2UWPA 2PR3A 1XXFA 1AVXA 5A2MH 1AVWA 1ZHPA 3Q00A 3PWCA 2BY7X 1MCTA 1XUGA 1HAYB 1O5AB 3BTKE 5HYOA 1DANH 5JB9S 2J4IA 2WPLS 5FPTA 1O5DH 3KEEA 3A84A 1KLTA 3SNBA 1PQ5A 5EXMA 3STJA 1K9OE 3SNCA 4UFGH 4BAOB 1TGNA 1FY4A 2FX6A 4JMYA 1INCA 3QDZB 1QGFA 1GI4A 1NFYA 8LPRA 1BHXF 1J8AA 4Y7AA 1E36B 5C1UA 1GI7B 1Z6EA 3F9EA 5AFZH 1K1PA 2W7UA 1EP6A 2WPIS 1F0UA 2GZ9A 1OWEA 2WPHS 3PLBA 3UWJH 1FZZA 3KN2A 2RA3A 1NT1A 1ACBE 1H9IE 1SGCA 4O97A 1G3DA 3Q76A 2P94A 2WV4A 3SZNA 3V12A 2G4UA 2Z6BD 1BMMH 1P2JA 1D3DB 1W14U 2P93A 4NFEA 1TRMA 3O8DA 1QB6A 3F68H 4ESTE 4HFPB 1W7XH 3U1IB 2M5TA 2FI3E 2A7CA 3RXCA 1GL0E 2BVRH 1Z8IB 3SO3A 2BLWA 4Y7BA 1BIOA 5FBIA 1PPHE 3SU3A 2ZDNA 4F4OC 1O3DA 4M7GA 1ELDE 1O2PA 1DDJA 2IPHA 4CRCA 1TGSZ 2XNIA 1ELTA 4YLQH 2VIPA 3MWIU 3UTUH 2ZI2H 1SGRE 3UFAA 1P3EA 5E0JA 5DP9A 2Z7FE 3E16B 2JH6D 1EPTC 1ESBA 2CN0H 4FVBA 4FUGA 2QYIA 3MO6A 1MTNC 1TE0A 1L1JA 1P9SA 2A5KA 1T4UH 1SC8U 1QBVH 1HAZB 1V2VT 1V2KT 1K2I1 2OCVB 2SGEE 3TIUA 4DW2U 1HBTH 1BJVA 1CQQA 1YPEH 5DKMA 4SGAE 4MPXA 1ETTH 1MKXK 1O5GH 2H6MA 1W3CA 2Y7XA 4WXVA 3GY2A 5J4SA 3BEIB 3QTOH 1MBMA 2BOHB 4E05H 1LHFH 3C1KA 3MNXA 1FI8A 1ORFA 1THSH 5C20A 1W11U 4WY3A 2VVCA 2AFQB 2W5EA 1O2GH 2GT8A 4Y8YA 1PPZA 1GBFA 5E2PA 1WQSA 3MH5A 3QGJA 1AFQC 3MNSA 2V0BA 4BOHA 1HJ9A 2AMPA 4NIYA 2Y80A 3O8BA 4U32A 3PTBA 1P9UA 3S9BA 3EA7A 4LK4A 2FOFA 1G3CA 3FANA 4X6NA 1EJAA 3MU5A 1L1NA 2FX4A 3P8FA 1BRBE 1HAOH 2ZWLH 1TABE 1HIAA 4AGJA 1RXPA 2EI7A 3RXQA 5T6DA 1AIXH 5JDUB 1Y5BT 3OSYA 4X0WU 1W12U 1ZTKA 3RU4D 1TAWA 4X1PU 3ZVEA 1P11E 3HK3B 3UNRA 3A7TA 4WH8A 1SGPE 2FOMB 4INLA 2AIQA 1C1UH 2V3HH 1GJ6A 2GD4B 3DUXH 4UDWH 1BB0B 1H1BA 3U8OH 1GCTC 5K0HA 1AE8H 1TPPA 4O9VA 1JWTA 3QZQA 1S6HA 1UMAH 2JETB 2PW8H 2F83A 1ARCA 1SLVB 1BHXB 3AW1A 4NSYA 2ZQ1A 1KIGH 4D8NA 2CHAB 1D3PB 1QRZA 4E06H 4OS5A 3GY8A 3K6ZA 1HGTH 4DGJA 1GWAA 2NU0E 2ZNKH 3KNXA 1EOLA 4OS6A 3RXHA 1TQ0B 4NGAH 1PYTC 3TNSA 1D3TB 3D49H 3SUGA 3MHWU 1SL3A 1QURH 3LH1A 4AYYB 1SB1H 1GJAB 2GKVE 1ZRKA 2V35A 1P10A 1TGTA 2G81E 2GMTB 3RDZA 1H9LB 3UNQA 4GVUA 3GDSA 1FY8E 2H5CA 2ZP0H 3F1SB 4ZUHA 3H7TA 4TWYA 4IC6A 1ZMNA 4IC5A 1BQYA 1UVOA 4YZUA 1C4V2 1OYQA 3ODFA 3RXEA 2GDDA 1HFDA 1OOKB 4INKA 5H4IB 2THFB 1SGYE 4JZIA 1V2PT 4FU7A 1K28D 1NROH 2BDYA 2PUQH 3LGIA 3AVZA 1JOUB 3E3TA 5AHGH 1EOJA 1O3PB 2ZHQH 4XDEA 2BB4A 1C1WH 1O3HA 4FU8A 2OC8A 4K2YA 3MO9A 1HAHH 1C9TA 5K7RA 3C27B 1NS3A 5J4QA 5EQSA 1EUFA 2BQ6B 2FDAA 3SV8A 3O8CA 2QCYA 1LVYA 1AY6H 2AH4X 2RA0A 1AN1E 1L0ZA 3ZZ9A 1SFQB 1MZAA 4YESB 1P3CA 2SGAA 1OWHA 2A1DB 1XXDA 2NU1E 2QC2A 1MKWK 5GCHG 1GMHF 3PLPA 1SQTA 2WYGA 3A7ZA 4DCDA 2OBOA 1ZMJA 4I8HA 5FHTA 1W0YH 3VB6A 3SQHE 4X2XA 1O3LA 4GHQA 3A87A 3SU0A 3UUZA 1EPTA 4AFSA 1RS0A 3TJOA 1TNHA 2ZGCA 3SNDA 2BDGA 1QJ1B 4QT8C 1PJPA 1TBQH 3ZZDA 3T26A 3EAJA 2ZEBA 4TYDA 3QGNB 3VB3A 1DE7H 2ASUB 2VWNA 1O3MA 1RGQA 8GCHF 1GBJA 1OX1A 3CENA 3UNSA 3FP8E 4O3TA 4A1TA 1UHBA 3E8LA 2ZTZA 1GVLA 3RUOA 1B5GH 4HGCA 4FUEA 1G9IE 2UUFB 2Z3DA 1W0ZU 4ZROA 3SJ8A 1O3FA 1C4Y2 4DURA 2FTLE 1TGCA 1TMTH 1GGDC 2OTVA 4B73A 1HJ8A 3MU1A 2ZDAH 5C67A 3PMJA 1VGCC 4I8JA 1NU9A 3KGPA 4B71A 4Y8ZA 2AYWA 2PKSB 3LONA 1P2QA 1Z8GA 4WXIA 1SGNE 3BTGE 9ESTA 4AG2A 2ZDLA 4B74A 2AEIH 2ZFSA 1TPAE 2A2QH 4IBLH 3LGYA 2A32A 2C90B 1MD7A 1NFUA 1K1IA 1OS8A 1C2JA 3KQBA 2ULLA 1K1OA 2OUAA 3QN7A 2XWBI 1SG8B 2OC7A 4CH8B 3M35A 2ANMH 3V13A 3GCNA 4YTAA 4GLYA 1OWDA 1GBAA 2OBQA 1WYKA 1GVKB 1CVWH 2F3CE 1QQUA 2WPMS 3SUFA 5LPEA 1UTPA 3SGQE 1PPCE 3RXBA 1BRAA 4KTUA 1QRXA 4RN6A 4FUFA 1IQFA 2A7HA 1UK2A 1V2OT 1VJ9U 1FV9A 3S9CA 2ZQ2A 2AS9A 3LT3A 1WSSH 1BMAA 4Q2KA 3QX5H 1TOCB 4AX9H 4BNRA 1N8OC 4NIWA 3SI4H 3SJIA 4BXWA 1GBDA 3FP6E 4AFUA 3K2UA 1NM6A 3IWMA 4YT6H 1BTZA 3VXEH 1MD8A 2ZDVH 1BMLA 1JRTA 4NFFA 4CRAA 4ISHH 3ATLA 4ABIA 3LOXA 3FVFB 1SGEE 1E38B 2BLOA 1SLXB 3M61U 1FIWA 2J34A 1VITF 1XVOA 4FUHA 3RM0H 3DD2H 1C2HA 2J2UA 1RFNA 1TRYA 1ZRBA 1IAUA 4KTSA 4KKDA 3RXDA 5LPRA 1O36A 4A7IB 1CE5A 3A81A 1RJXB 2ZCHP 3PB1E 1TX7A 2WUCA 4NA8A 1MCVA 5EU8A 3TNTA 2H1UA 3GY4A 4IMZA 5EPNA 1HAXB 1DLKB 1HAGE 2G55A 2P8OC 4Y0YE 2WPKS 1K21H 1W10U 5FAHA 1O2OA 1C5QA 1BBRH 3BTWE 2XCNA 2A4QA 3B8JA 2FO9A 3VGCB 1BRUP 4XE4A 3ZVDA 4X1NU 3VB5A 2VIOA 2BMGB 3MI4A 5GXPA 3KCGH 1T7CA 3DHKH 1Y3WA 1LTOA 2G51A 3ENSB 3SU2A 2O8WA 3SU1A 4DJZB 1ZJDA 3LGUA 1QFKH 2VIWA 5HMAA 4MTBA 4CRFA 1TONA 2B5TB 2FOHA 4ZKSU 4Z0KA 1SI5H 1T8NA 4F49A 2HALA 5TCAA 1C5TA 1O3IA 2GCTB 1AZ8A 3T25A 1A2CH 1PPFE 2Q6FA 1QA7A 1V2WT 4MPUA 1UVUH 3LU9B 1M9UA 5TCCA 2LNCA 1ELVA 2FEQH 4KP0A 4WWYA 3GOVB 4Q7YA 3SJ9A 1UK3A 3KQDA 3STIA 3CS0A 1X7AC 2VH0A 5L6NH 3LKWA 1ELFA 2FOAA 1IQLA 5CHAC 1O2YA 1CHOG 1IQKA 1VCWA 3QLPH 2GTBA 1SGDE 2B7DH 1ZJKA 4WVPE 1FNIA 4Q7ZA 1EB1H 3UQVA 4YOIA 2OP9A 1AB9B 2BDAA 2ODPA 2FI5E 1TIOA 2XYAA 3LGTA 8ESTE 5CMXH 4MLFB 1GDUA 3VFEA 4X8SH 1MBQA 3MH7A 1N6YA 1T8MA 4NWLA 2BDBA 1AQ7A 1UTMA 1OYTH 1YPLH 3G01A 3UIRA 1HJAC 1QCPA 1MTUA 1ZPBA 4AYVB 5T6FA 1HB0B 2ALPA 1FUJA 4ABGA 1HIAB 2ZTXA 2VIDA 2ZU1A 4XBBA 4XOJA 1LVMA 1V2NT 1V6DA 2BD8A 3SI3H 5FPYA 2CGAA 4B2BA 3MOCA 1O2QA 1P0SH 3TLOA 4OS1A 2EI8A 3PO1C 1GMHG 1GBHA 1IHSH 2DE9A 3BTTE 3GCTF 3VB7A 1CA0C 1NPMA 1T32A 2VNTA 2FPZA 1IQIA 4UEHH 1HLTH 1V2MT 3E90B 3IG6B 3UWIA 1L4DA 3NKKA 5GCHF 4PROA 2CJIA 4B2AA 1O3CA 2Q1JA 4GUXA 3Q77A 2PSXA 1SOZA 4YOJA 2VVVA 3LPRA 1O2HA 2D2DA 1N6XA 1SGQE 1YM0A 5GPIB 8GCHG 1J17T 2C93B 1J9CH 2ZF0H 1A3EH 1O2TA 2WUBA 1IQEA 1UJ1A 5EPYA 1AWHB 5HXFA 3PLKA 4ABEA 1TNIA 2FS9A 3BSQA 3A85A 1C1VH 1XUKA 2VGCC 3DT0H 1RD3B 1EAIA 1WQVH 1GL1A 3SV7A 2J38A 2VJ1A 3BTDE 4BTTB 1DPOA 1TX8A 2BOKA 2P3UB 3TH4H 2CXVA 1O3AA 5B6OA 4AOQA 3K6YA 1IQNA 5A0BA 4B1TA 1PQ8A 2WV5A 1MU6B 4B76A 3V3MA 4JYVH 3T5FH 5A0AE 4MNXA 2NU4E 4X2YA 2BXUH 1NU7B 1B0FA 3AW0A 3ZZ5A 1T4VH 3O8RA 2QXJA 3BF6H 2R0LA 1YF4A 3RXRA 1NC6A 2HWLB 2Y5GA 1YPHE 1S82A 3R3GB 1QHRB 1FDPA 3SV6A 1DUAA 2IOTA 1N1LA 5ESBA 1MTWA 3M7TA 4WH6A 4K1TA 1A7SA 1ZHRA 1O2XA 1IQMA 2ALVA 3V0XA 4FUJA 4U30A 4ISLA 2VB0A 2FESH 1BMNH 1SPJA 3SU4A 5I46H 3D23A 1XVMA 1GBLA 2Y81A 1E37B 5GIBA 3JZ2B 2A2XH 2ZO3H 1TNKA 3ELAH 1TNLA 1EPTB 4IN1A 5CE1A 4X8UH 3SJOA 3ZZAA 3QZRA 4MQAA 4ABDA 4ABFA 1P2NA 1MTNB 2RDLA 2ZPRA 3KL6A 5JYIA 3M36A 3PTNA 3DA9B 3BIUH 4DG4A 3HGPA 1A5HA 1O3GA 4K8BA 3H7OA 1DFPA 1VITG 1O2NA 5GDSH 3B23B 3VEQB 1B0EA 3ATIA 3I77A 1CBWC 5E0HA 1S84A 2R9PA 1GG6C 3MH6A 3RXSA 3UQOA 1ZR0A 1DWDH 3OY6U 1UCYK 3VB4A 5FCRA 1O2RA 3T27A 2GP9B 1ARBA 2F9NA 5ABWA 2R3UA 3P95A 3RMMH 4B2CA 2BVXH 3TH3H 1P2IA 3BTQE 4AB8A 1AFQB 1FQ3A 1Z6JH 1GHYH 6GCHF 2XBVA 3QUMP 2FYRA 2IJOB 2QY0B 1SR5C 1FAKH 1QQ4A 2OD3B 3P6ZB 1HCGA 5C5NA 2Y6TA 3EGKH 3P70B 2O9QA 1GJDB 5DJ7A 1GI9B 1W8BH 3S69A 1ELCA 2HOBA 4O03A 3ZZ3A 4AN7A 2Z9JA 5IDKA 1W7GH 4A5TS 3LDXH 1O3NA 2GVFA 2ZU2A 1ZSJA 4Y11E 1QRWA 4FUCA 2JH5D 1GCTB 3PMAB 4INHA 1SQOA 2AMDA 3E91A 1BBRE 1PPBH 1UO6A 1YCPK 2VWOA 2DE8A 2V3OH 3ZZ4A 4I7YH 1L1GA 1AHTH 1ANBA 5EOKA 5JBBS 1HAVB 2PUXB 1TMUH 1MH0A 3PROA 1LVOA 4A1XA 2FOEA 4D7GA 4DIIH 1D9IA 8KME2 1DOJA 1C2LA 2C8WB 4BXSA 1UVTH 1O0DH 1C5MD 1GJCB 1LPZB 5DP5A 2G8TA 3EE0B 5HGGA 1K1NA 1AGJA 2FLBH 1NRSH 1MKXH 3L3TA 3E0PB 4Y79A 1CHOF 4VGCC 3M3SA 1ZPCA 1MTVA 1XUJA 3A8BA 4X6OA 5SGAE 2K1QA 3CP7A 1SGTA 1QB9A 1OWKA 1SGFA 2EEKA 3UOPA 3OTJE 2ILNA 4H6TA 2UUYA 2H2ZA 5T3HA 2ZHDA 3TH2H 2BZ6H 5EW2H 1HAPH 3SN8A 2ZFFH 1AUTC 4DVAU 4U01A 1KLJH 1U6QA 2PGBB 1QIXB 1S85A 2CMYA 5A8ZA 1MUEB 1TLDA 4YLUA 7KMEH 2TRMA 2R2MB 3MMGA 3M5MA 2BZAA 2G4TA 1KY9A 3QTVH 1A61H 3A82A 4BTUB 3GCTG 3SU5A 1MU8B 1BTXA 1MZDA 1ZOMA 2P3FH 2Z9GA 1OWJA 2OC0A 3P8GA 1GDNA 1CT2E 4FUDA 1V2JT 4Y6DA 2Q6DA 1AKSB 2G52A 4B75A 2ESTE 3ZVAA 2PWXA 1BOQA 5A8YA 1HXEH 3M7UA 2XBYA 2Z9IA 4NZQA 5F03A 2GDEH 1S83A 1FIZA 2HNTE 3A88A 4X2VA 5FX5A 4D9QA 1GMCF 4XSKU 3OX7U 4AGKA 3KIDU 1PFXC 2F91A 1HPGA 3KHVA 1Z8JB 3ZZBA 1NO9H 3RP2A 3GY6A 2TGPZ 1TBZH 1P2KA 4AFQA 1F0TA 1NRPH 3RXTA 3E6PH 3GDVA 4CRBA 2KAIB 1V2QT 3TVJB 3RLYH 5E8EH 3LIWA 1CA8B 2W26A 5F8XA 1GJBB 1HXFH 2QF3A 2BD2A 2TPIZ 2A31A 1Z1IA 3BIVH 3M5LA 1NRRH 1DICA 1JXPA 4R8TB 3RC6A 2Z3CA 3KQEA 4FXGH 3MH4A 1GGDB 2UUJB 3SU6A 4DT7B 5PTPA 2R2WU 1H8DH 1WTGH 1B7XB 1VGCB 3GYMA 1GVZA 3SGAE 2ZKSA 1QY6A 6LPRA 1O38A 2SFAA 1C5YB 1WUNH 4IW4E 4WMEA 1SHHB 1O32A 2F9PA 1YPKH 1IQHA 1LPKB 1GHBF 3T28A 3RXLA 7GCHF 1C1MA 2AERH 1GJ9B 1SGIB 1D6RA 4NA7A 3LC3A 1YYY1 3KF2A 1PQAA 1TX6A 1A1RA 2B8OH 3M5OA 2ZFTA 4CBNA 1YP9A 1BCUH 1GJ8B 1C5RA 1G37A 1TALA 1QL8A 3BG4C 1O2ZA 1QBOA 1ZZZA 9LPRA 1ELAA 3ZVFA 1GBTA 2AGGX 1RIWC 2C8YB 3F9FA 1MKWH 4JZEH 1OP8A 1DY8A 1GJ7B 4ZHAA 1GPZA 1ZLRA 1AO5A 2NU2E 3FZDA 4GSOA 5DK1A 3SJKA 2TIOA 4I32A 3ZV8A 3U8RH 1F5LA 4ABBA 2I6SA 5L30H 1EQ9A 1OSSA 4CH2B 2HPPH 4I8GA 1N8OB 1THRH 1P06A 3A83A 1E35B 2AMQA 3A89A 3QWCH 2FXRA 2BDIA 3A7VA 2ZIQH 1C5SA 1ANDA 2TGTA 1CSOE 3FAOA 5EGMA 3D65E 1GJ5H 4YOGA 2ZHEH 3Q3KA 1BTHH 1VITH 1NN6A 1D4PB 5EXLA 1QTFA 3LJOA 2BLVA 2P16A 2XC4A 1Y8TA 1GBIA 2WPJS 3RXAA 2D8WA 5C5OA 1D6WA 6GCHG 4K8YA 4BAQB 4Y0ZE 3A7XA 4IS5A 1S0QA 4NIVA 1RTKA 4ZMAH 2FOGA 1DS2E 1CO7E 4MNVA 1MAXA 2VINA 4CHAC 5F8TA 2BD5A 1UTNA 1GBMA 2BY5X 2I6QA 1KXEA 1PQ7A 1SFIA 3RXKA 1P8VC 1D3QB 2QIQA 2VIQA 3RXOA 1UTOA 1P2OA 1KLIH 2C3SA 2Y5FA 2PTNA 4RKOB 2P8OB 2CF8H 1TQ7B 1Z71A 1J15A 4H6SB 1KXAA 3W94A 1F5KU 1BA8B 3L33A 1NZQH 1GI6A 5G4BA 2STAE 4H4FA 4SGBE 3RMLH 1GHZA 2BVSH 1K22H 1TNJA 1ZTJA 4NG9H 1YBWA 2QXIA 2C8XB 3VPKA 4UFFH 3K65B 2VWLA 3TPIZ 3TK6A 2P3TB 3SV9A 3ZYEA 4ABJA 2A4GA 2R0KA 4I8KA 5JBTA 1XX9A 2WYJA 4ZXYH 1G32B 2CV3A 1C5XB 2PKAA 1QL9A 2ZU4A 3BV9B 1O5EH 1RTFB 1S5SA 1K1MA 1C9PA 5AFYH 1HRTH 3ZZCA 1C5WB 3A86A 1DM4B 3RXGA 5F8ZA 3N7OA 1V2UT 4JYTA 2F9UA 4HI3A 3FP7E 4D7FA 1K1LA 4CREA 4OGYA
chains in the Genus database with same CATH superfamily
2V3MA 1DSUA 4ACBA 5CHAB 3ZZ8A 1Y59T 3M3VA 1IQGA 1LQDB 4WMFA 1XUIA 3GCOA 3V7TA 1KSNA 2OQ5A 1FY3A 1O2LA 1KXBA 3UR6A 3EA8A 4D76A 1O35A 1C4U2 3UPEA 2AGEX 4NA9H 2XBWA 5A8XA 1O2KA 2O8TA 4X1SU 2ZDMA 4RSPA 3ZZ7A 3RC4A 5IYTA 4OGXA 3RXFA 1BJUA 6CHAC 1MAYA 1SLWB 4ZCNA 3TK9A 3RC5A 1ESTA 2W3IA 1EAWA 4H42U 2ZPSA 1VCPA 1Q2WA 1TMBH 1OP0A 1KDQA 1NFXA 2XRCA 4BANB 1XMNB 1CGHA 1HJAB 1OP2A 1J14A 1Y3YA 4OS4A 2FIRH 3T2NA 1O33A 1ABIH 2XXLA 2J97A 5LH8A 4JZFH 1EASA 1UCYE 1GI1A 1DY9A 4ZXXH 1O39A 1QL7A 1CT4E 3RXJA 3NCLA 3S7HB 3LJJA 5AF9H 2ZECA 3CS7A 3I78A 3EE7A 4X1RU 4X8TH 1DWBH 3PO1B 4Q7XA 4KTCA 3T62A 1HYLA 3PYHA 1ZTLA 1NBME 2QXHA 3RMOH 1TPOA 1LO6A 1CA0B 2VVUA 4P02A 1A0HB 1BITA 3MU8A 1C1PA 1T8OA 1GMCG 2GT7A 1O34A 2KFWA 2ANKH 3EYDA 3GCHC 1LHGH 2YMSD 4FVDA 3DFLA 3PWBA 1DT2A 3N99A 1P02A 2A5IA 5C0TA 1DITH 5DP4A 2A45B 3U28C 1S6FA 3TGJE 3HKIB 2ZGBH 3GISB 7ESTE 5JPMH 1G3BA 1PPGE 1G36A 1EZUC 4GCHF 4RKJB 2SGDE 1AE5A 1C2FA 4E7RG 2F9OA 3S0NA 1UTLM 4ZH8A 4R0IA 1T8LA 1VCQA 3NXPA 1NTPA 1ELGA 3Q3XA 1NESE 5T1VA 1GHAF 1ZSKA 2VU8E 4AZ2B 1BUIA 2VBCA 2VGCB 1SVPA 2ZTYA 4ABAA 3DSPA 4KGAA 3UR9A 1IOEA 5HM9A 2FM2A 5DP3A 3VXFH 5A0CA 4J1YA 1ZGIA 1G30B 3U8TH 1GI2A 1O2WA 3DFJA 4XRNA 1YGCH 1Q31A 1ZPZA 3NRLA 1O3KA 2FYQA 1CGIE 1HDTH 1EKBB 4K60A 4NCYA 2ANWA 1A4WH 1ZYOA 3ATMA 3RXVA 1GDQA 2Z3EA 4FU9A 1GHBG 3ITIA 7GCHG 1TRNA 3P8NA 5IK2D 1ABJH 1CGJE 2Y82A 2PLXA 4HTCH 3OU0A 4NWKA 1EB2A 1O3JA 3OY5U 1AWFH 4JZ1A 1Y5AT 2YNBA 2BD3A 2XW9A 1H8IH 4GPGA 4DOQA 1W13U 2NU3E 1RTLA 4X8VH 3A8AA 1ID5H 1SBWA 1Z1JA 4U2WA 1K1JA 1HV7A 2SNWA 2SNVA 1JIMA 3URDA 2PSYA 4ZKRU 2Q6GA 4A92A 5A09A 1UTJA 4J2YB 4ASHA 5E0GA 4JK6A 1O2MA 1JBUH 4Y8XA 4K5ZA 1P01A 3RMNH 1FY1A 1UVPA 3OTPA 1FXYA 1KXDA 4ISNA 4JZDH 5T6GA 4CR5A 2ZDKA 1GCDA 1F0RA 7LPRA 1EX3A 3PMBB 4YT7H 1JRSA 2ZGXH 5C3NA 1C1SA 3BEFB 4NSVA 3RM2H 1Y3XA 5C1YA 1OXGA 3FFGA 2H9EH 2XBXA 3SQEE 3SBKA 2FMJA 6ESTA 4CR9A 1C1NA 4BAMB 1VR1H 4AG1A 1DUEA 1BRCE 2HRVA 1OPHB 4OS2A 1UHBB 3MNBA 1BDAA 2W7SA 5EQQA 3BTHE 4UD9H 3RXUA 2J98B 3GY3A 3SNEA 4CBOA 2BY8X 2FI4E 1AD8H 1CBWB 1O31A 3H5CB 2XWAA 4TPYA 1GMDF 5DN6D 1S81A 5KECA 1GG6B 2XC0A 3URCA 5DG6A 2A0QB 5LGOA 3BG8A 5DPAA 2EA3A 2ZZUH 3L6PA 3SNAA 1C2GA 1L4ZA 3S7KB 1BTUA 2HNTC 1IQJA 1IHTH 1UVSH 1CU1A 2ODYB 3K9XB 1XKBC 1TB6H 4BTIB 1AUJA 4NIXA 2WHXA 1T31A 3TGKE 1ANEA 1O37A 3PM3A 1ZHMA 1C1RA 5DP6A 4YM9A 2HPQH 4Q80A 1WXRA 1F92A 4ISIH 4O3UA 2ZA5A 1P12E 1KMHB 3FZZA 3BN9A 3TJNA 5B6LA 3LGWA 4AORA 1C2IA 5EG4A 3GICB 2ANYA 5TJXA 3KQ5A 4CRGA 1SGFG 2G5NA 1VZQH 4A1VA 1A0JA 5JBAS 1PYTD 1BTYA 1JMOH 3QK1A 4MNYA 1WCZA 2J9NA 2Z94A 3M37A 3PMHB 2JETC 2NWNA 2W6ID 1ZGVA 4Z1MD 3R0FA 3ZVCA 2J95A 2XC5A 3N7EA 4K1SA 3E1XB 3AK5A 1THPB 4K69A 1C5LH 1W2KH 3NK8A 3MU0A 2A7JA 1TOMH 5EW1H 2CHAC 1GHVH 1Y3UA 1QA0A 3IITA 3F6UH 1WBGB 3AAUA 5DO4H 2FOBA 4IGDA 2Y7ZA 2VH6A 1FY5A 4TWWA 1QJ7B 2FWWA 1GBEA 1TFXA 3DCLA 3TJUA 1TGBA 2P59A 2RCEA 3RXPA 1XUHA 1TWXB 5I25A 2ZC9H 5FXLA 2FP7B 3A8DA 5AVDA 4MDSA 2TGDA 3TK5A 2R3YA 1AZZA 2OC1A 1G2MA 4UE7H 1O2VA 4VGCB 2GMTC 1Y3VA 2QGRA 3E0NB 3T29A 1FJSA 1S6LA 2GCHF 1KXFA 1XKAC 4TSFD 2J94A 2QXGA 5GJ4B 3RU4T 1UCYH 1EAXA 2ZGJA 3F9HA 3B9FH 5BPEA 5DGJA 2P95A 3LGVA 1QB1A 2H9TH 2BXTH 2V6NA 3SOSA 3UREA 3UY9A 4WMDA 4TT3D 3KQCA 3RXMA 1J16A 1MMJN 2F9BH 2ZFPH 1QZ8A 4LXBH 1C2DA 4YO9A 2IPQX 1EJNA 4K1EA 3ATWA 1LDTT 3HGNA 3TJVA 4UONA 2FODA 1C2KA 1P04A 3W95A 3MU4A 4AB9A 1P09A 3EDXB 4BAKB 4MNWA 2BY9X 4CRDA 1P2MA 1C2MA 3D62A 2ZCKP 1NRQH 1GHXH 3HATH 1O3BA 1QBNA 1YCPH 2ZHWH 5HM2A 1LKAA 2EQNA 1BTPA 1WU1A 4OS7A 5EQRA 2QA9E 4Y10E 2GZ7A 4GCHG 4X2WA 2BDHA 1C1TA 5JBCS 1VJAU 3AASA 1BZXE 4ISOA 1FLEE 2PKAB 2GJGA 5JB8S 1MTSA 1TA6A 2IN2A 1KXCA 3HKJB 3HPTB 1XUFA 2A4RA 1C5PA 1FPHH 1GHAG 4MPWA 1QR3E 1H4WA 4JK5A 3GDUA 2Z9KA 4ASUD 2WINI 2G00A 1EP5A 1GI0A 1ETRH 2OXSA 5EXNA 2D26C 1YLDA 1YC0A 2UWOA 1A0LA 1ESAA 1S0RA 2FS8A 1TYNA 3ATKA 1LPGB 1Z7KA 2A4OA 1DX5M 4GAWA 1A3BH 4Z6AH 4LOYH 3UAIC 2O8MA 1C2EA 1WAYB 1O30A 2BD4A 2O8LA 1GI3A 4HZHA 2FTMA 3I29A 1UK4A 1Y5UT 1UTKA 2PHBA 3TU7H 1V3XA 2BYAX 1RRKA 3M3TA 1F5RA 1FN6A 1SOTA 1UW7A 1UTQA 3PV4A 1F7ZA 2PKSC 3P17H 2RFKC 1ANCA 1JIRA 1KDQB 1AU8A 3A7WA 5E2OA 5BRRE 2HLCA 3P8OA 1EZSC 1SSXA 3SUEA 3NPSA 4X1QU 3GY5A 5F6MA 2ODQA 3S9AA 1YPJH 2ZGHA 2QV1A 3RU4E 2B9LA 3ODDA 2BQ7B 4B6EA 4WF8A 1BBRK 3SW2B 1DSTA 3A7YA 3BG4B 2OQUA 2XTTB 2ZU3A 1NBMD 1O2IA 1LVBA 1RIWB 2VWMA 4TPIZ 1FPCH 2ZG0H 2LELA 2B0FA 2HVXA 1EATA 1EZQA 1P05A 2QAAA 2Z9LA 1E0FD 1Q3XA 4TY7A 1C1OA 1TBRH 2ZU5A 3OAAD 4IN2A 1DVAH 2GV7A 3ZV9A 1MQ6A 4MPVA 2BD9A 2YNAA 1QNJA 2BX4A 1O5CB 2OINA 4LZ1H 2LPRA 4OM9A 5HIYA 3SHCH 1BT7A 1MQ5A 1COWD 4JYUH 1HNEE 4Q4LA 1HAVA 2G5VA 1YLCA 3RLWH 1F0SA 1HAIH 3QO6A 1DXPA 3ZVGA 2BX3A 5ESTE 3TITA 2C8ZB 4XBCA 4I8LA 5KGOA 1A5IA 2FZZA 1GMDG 1P03A 1V2RT 4FUIA 4GHTA 1EZXC 1ZMLA 1ELEE 2HLDD 2XOKD 3UOUA 5LPFA 3GYLB 2A5AA 1YPGH 4ZKOU 3NUMA 1GBCA 2ZFQH 4X6MA 1V2TT 3F9GA 1NY22 3ZZ6A 1WOFA 2PTCE 4K3JA 3M7QA 5L2ZH 2JJ1D 3LC5A 2SGQE 4AFZA 2VIVA 3SORA 2YOLA 1TPSA 1KTTB 3U69H 4CHAB 1YKTA 1AFEH 2HGTH 2QF0A 2GZ8A 1Z8RA 3N7DA 1O2UA 1O2SA 1FN8A 1LHDH 2UWLA 3A8CA 3MNCA 1A5GH 1O3OA 4ZHLU 4MG3A 1C5ZB 2EI6A 3ESTA 3MTYA 4ABHA 3SUDA 1SQAA 2EC9H 1G3EA 2OLGA 3SGBE 5FBEA 1SMFE 2BDCA 3F2FA 1LQEA 3JZ1B 5DP8A 1O2JA 3NWUA 1NFWA 2GGVB 2KM0A 2PV9B 4FUBA 2C4FH 3BEUA 1C5VA 4DY7B 2AIPA 2H5DA 1VKYA 2ZCLP 3TGIE 3MYWA 1DXWA 3U1JB 3LH3A 2QN5T 3VGCC 4KELA 3PV2A 5DP7A 3MFJA 4NZLA 3ZYDA 2BHGA 1EXFA 2Y5HA 1C1QA 1HUTH 2BTCE 2KCPA 1AKSA 1NRNH 4MVNA 1GBBA 1ZSLA 2FOCA 2ZHFH 1XM1A 1O5FH 2ZPQA 3BTEE 3EA9A 1E34B 1ELBA 2BD7A 3RXIA 4DIHH 3Q3YA 1TNGA 2GCTC 3BTFE 1AMHA 1YPHC 5C1XA 3NZIA 1DLEA 4BAHB 1P57B 2SGPE 1PPEE 1AI8H 5FPSA 1YPMH 1OKXA 1ETSH 4XBDA 4A6LA 3AAVA 4E7NA 1EAUA 2BQWB 1BTWA 2KR7A 4TY6A 4I33A 3EQ0H 2BLQA 3F2HA 1FMGA 2J92A 4Y76A 4LZ4B 4XFQA 2SGFE 1OWIA 1LMWB 1WV7H 2GCHG 2KCAA 2TGAA 3HK6B 2RG3A 2KAIA 1O5BB 2GX4A 1AVGH 3WWBA 2BM2A 1TA2A 2UUKB 1GI8B 3SYJA 3WY8A 3M5NA 3OYPA 1GHWH 3A80A 1SQRA 4FOUC 3ZVBA 1CHGA 3MO3A 2J5UA 2PFEA 6CHAB 1AB9C 3P92A 4JCNA 1QJ6B 2W3KA 1F2SE 3GY7A 1FX0B 4THNH 1YCPM 4X6PA 1CT0E 4IMQA 1V2ST 3U98H 1WTHD 2ZFRH 3BTME 4UFEH 1GJ4H 5EODA 2F4LA 1L2EA 2GV6A 2PGQB 1FONA 2D1JA 1LCYA 1SHYA 4ZAEA 5FX6A 1A46H 1H9HE 1DWCH 4UFDH 1C5UA 2BY6X 1EJMA 2O8UA 1LHCH 4ZHMU 2JH0D 4WJG2 1DWEH 1LKBA 2STBE 4ZKNU 1GI5A 3U9AH 1LHEH 1YWUA 1KTSB 3SHAH 1KYNA 5ETXA 2F9VA 4D9RA 2JKHA 2FLRH 1G2LA 1V2LT 2HNTF 4Y71A 4I31A 1GBKA 5GWZA 3GCHB 2OK5A 2H9HA 1O3EA 1FAXA 5C2ZA 1SLUB 3SV2H 1C5OH 2CF9H 2TBSA 2XCFA 5FCKA 5L2YH 2DUCA 2AGIX 1C5NH 2UWPA 2PR3A 1XXFA 1AVXA 5A2MH 1AVWA 1ZHPA 3Q00A 3PWCA 2BY7X 1MCTA 4P00A 1XUGA 1HAYB 1O5AB 3BTKE 5HYOA 1DANH 5JB9S 2J4IA 2WPLS 5FPTA 3FN8A 4DT4A 1O5DH 3KEEA 3A84A 1KLTA 3SNBA 1PQ5A 5EXMA 3STJA 2YMSC 1MABB 1K9OE 3SNCA 4Q63A 4UFGH 4BAOB 1TGNA 1FY4A 2FX6A 3KYGA 4JMYA 1INCA 3QDZB 1QGFA 1GI4A 1NFYA 8LPRA 1BHXF 1J8AA 4Y7AA 1E36B 5C1UA 1GI7B 1Z6EA 3F9EA 5AFZH 1K1PA 2W7UA 1EP6A 2WPIS 1F0UA 2GZ9A 1OWEA 2WPHS 3PLBA 3UWJH 1FZZA 2WSSD 3KN2A 2RA3A 1NT1A 1ACBE 1H9IE 1WDIA 1SGCA 4O97A 1G3DA 3Q76A 2P94A 2WV4A 3SZNA 3V12A 2G4UA 2Z6BD 1BMMH 1P2JA 1D3DB 1W14U 2P93A 4NFEA 1TRMA 3O8DA 1QB6A 3F68H 3OEED 4ESTE 3PRBA 4HFPB 1W7XH 2KCOA 3U1IB 2M5TA 2FI3E 2A7CA 3RXCA 1GL0E 2BVRH 1Z8IB 3SO3A 2BLWA 4Y7BA 1BIOA 5FBIA 1PPHE 3SU3A 2ZDNA 4F4OC 1O3DA 4M7GA 1ELDE 1O2PA 1DDJA 2IPHA 4CRCA 1TGSZ 2XNIA 1ELTA 4YLQH 2VIPA 3MWIU 3UTUH 2ZI2H 1SGRE 3UFAA 1P3EA 5E0JA 5DP9A 2Z7FE 3E16B 2JH6D 1EPTC 1ESBA 2CN0H 4FVBA 4FUGA 2QYIA 3MO6A 5CHBA 1MTNC 1TE0A 1L1JA 1P9SA 2A5KA 1T4UH 1SC8U 1QBVH 1HAZB 1V2VT 1V2KT 1K2I1 2OCVB 2SGEE 3TIUA 4DW2U 1HBTH 1BJVA 1CQQA 1YPEH 5DKMA 4SGAE 4MPXA 1ETTH 1MKXK 1O5GH 2H6MA 1W3CA 2Y7XA 4WXVA 3GY2A 5J4SA 3BEIB 3QTOH 1MBMA 2BOHB 4E05H 1LHFH 3C1KA 3MNXA 1FI8A 1ORFA 1THSH 5C20A 1W11U 4WY3A 2VVCA 2AFQB 2W5EA 1O2GH 2GT8A 4Y8YA 1PPZA 1GBFA 5E2PA 1WQSA 3MH5A 3QGJA 1AFQC 3MNSA 2V0BA 4BOHA 1HJ9A 2AMPA 4NIYA 3H09A 2Y80A 3O8BA 4U32A 3PTBA 1P9UA 3S9BA 3EA7A 4LK4A 2FOFA 1G3CA 3FANA 4X6NA 1EJAA 3MU5A 5HKKD 1L1NA 2FX4A 3P8FA 1BRBE 1HAOH 2ZWLH 1TABE 1HIAA 4AGJA 1RXPA 2EI7A 3RXQA 5T6DA 1AIXH 5JDUB 1Y5BT 3OSYA 4X0WU 1W12U 1ZTKA 3RU4D 1TAWA 4X1PU 3ZVEA 1P11E 3HK3B 3UNRA 2EY4C 3A7TA 4WH8A 1SGPE 2FOMB 4INLA 2AIQA 1C1UH 2V3HH 1GJ6A 2GD4B 3DUXH 3FOAA 1BB0B 1H1BA 4UDWH 1GCTC 3U8OH 5K0HA 1AE8H 1TPPA 4O9VA 1JWTA 3QZQA 1S6HA 1UMAH 2JETB 2PW8H 2F83A 1SKYE 1ARCA 1SLVB 1BHXB 3AW1A 4NSYA 2ZQ1A 1KIGH 4D8NA 2CHAB 1D3PB 1QRZA 4E06H 4OS5A 3GY8A 3K6ZA 1HGTH 4DGJA 1GWAA 2NU0E 2ZNKH 3KNXA 1EOLA 4OS6A 3RXHA 1TQ0B 4NGAH 1PYTC 3TNSA 1D3TB 3D49H 3SUGA 3MHWU 4HG6A 1SL3A 1QURH 3LH1A 4AYYB 1SB1H 1GJAB 2GKVE 1ZRKA 2V35A 1P10A 1TGTA 2G81E 2GMTB 3RDZA 1H9LB 3UNQA 4GVUA 3GDSA 1FY8E 2H5CA 2ZP0H 3F1SB 4ZUHA 3H7TA 4TWYA 4IC6A 1ZMNA 4IC5A 1BQYA 1UVOA 1EFRD 4YZUA 1C4V2 1OYQA 3ODFA 3RXEA 2GDDA 1HFDA 5C17A 1OOKB 4INKA 5H4IB 2THFB 1SGYE 4JZIA 1V2PT 4FU7A 1K28D 1NROH 1E1RD 2BDYA 2PUQH 3LGIA 3AVZA 1JOUB 3E3TA 5AHGH 1EOJA 1O3PB 2ZHQH 4XDEA 2BB4A 1C1WH 1O3HA 4FU8A 2OC8A 4K2YA 4I86A 3MO9A 1HAHH 4FETA 1C9TA 5K7RA 3C27B 1NS3A 5J4QA 5EQSA 1EUFA 2BQ6B 2FDAA 3SV8A 3O8CA 2QCYA 1LVYA 1AY6H 2AH4X 2RA0A 1AN1E 1L0ZA 3ZZ9A 1SFQB 1MZAA 4YESB 1P3CA 2SGAA 1OWHA 2A1DB 1XXDA 2NU1E 2QC2A 1MKWK 5GCHG 1GMHF 3PLPA 1SQTA 2WYGA 3A7ZA 4DCDA 2OBOA 1ZMJA 4I8HA 5FHTA 1W0YH 3VB6A 3SQHE 4X2XA 1O3LA 4GHQA 3A87A 2KCYA 3SU0A 3UUZA 1EPTA 4AFSA 1RS0A 3TJOA 1TNHA 2ZGCA 3SNDA 2BDGA 1QJ1B 4QT8C 1PJPA 1TBQH 3ZZDA 3T26A 3EAJA 2ZEBA 4TYDA 3QGNB 3VB3A 1DE7H 2ASUB 2VWNA 1O3MA 1RGQA 8GCHF 1GBJA 1OX1A 3CENA 3UNSA 3FP8E 4O3TA 4A1TA 1UHBA 3E8LA 2ZTZA 1GVLA 3RUOA 1B5GH 4HGCA 4FUEA 1G9IE 2UUFB 2Z3DA 2J98A 1W0ZU 4ZROA 3SJ8A 1O3FA 1C4Y2 4DURA 2FTLE 1TGCA 1TMTH 1GGDC 2OTVA 4B73A 1HJ8A 3MU1A 2ZDAH 2KX4A 5C67A 3PMJA 4YXWD 1VGCC 4I8JA 1NU9A 3KGPA 4B71A 4Y8ZA 2AYWA 2PKSB 3LONA 1P2QA 1Z8GA 4WXIA 1SGNE 3BTGE 9ESTA 4AG2A 2ZDLA 4B74A 2AEIH 2ZFSA 1TPAE 2A2QH 4IBLH 3LGYA 2A32A 2IJD1 2C90B 1MD7A 1NFUA 1K1IA 1OS8A 1C2JA 2JIZD 3KQBA 2ULLA 1K1OA 2OUAA 3QN7A 2XWBI 1SG8B 2OC7A 4CH8B 1E79D 3M35A 2ANMH 3V13A 3GCNA 4YTAA 4GLYA 1OWDA 1GBAA 2OBQA 1WYKA 1GVKB 1CVWH 2F3CE 1QQUA 2WPMS 3SUFA 5EJZA 5LPEA 1UTPA 3SGQE 1PPCE 3RXBA 1BRAA 4KTUA 1QRXA 4RN6A 4FUFA 1IQFA 2A7HA 1UK2A 1V2OT 1VJ9U 1FV9A 3S9CA 2ZQ2A 2W6JD 2AS9A 3LT3A 1WSSH 1BMAA 2QE7D 4M9FA 4Q2KA 2JDID 3QX5H 1TOCB 4AX9H 5FL7D 4BNRA 1N8OC 4NIWA 3F3BA 3SI4H 3SJIA 4BXWA 1GBDA 3FP6E 4AFUA 3OEHD 3K2UA 1NM6A 3IWMA 4YT6H 1BTZA 3VXEH 1MD8A 2ZDVH 1BMLA 1JRTA 4NFFA 4CRAA 4ISHH 3ATLA 4ABIA 3LOXA 3FVFB 1SGEE 1E38B 2BLOA 4AC9A 1SLXB 3M61U 1FIWA 2J34A 1VITF 1XVOA 4FUHA 3RM0H 3DD2H 2WV9A 1C2HA 2J2UA 1RFNA 1TRYA 1ZRBA 1IAUA 4KTSA 4KKDA 3RXDA 5LPRA 1O36A 4A7IB 1CE5A 3A81A 1RJXB 2ZCHP 3PB1E 1TX7A 2WUCA 4NA8A 1MCVA 5EU8A 3TNTA 2H1UA 3GY4A 4IMZA 5EPNA 1HAXB 1DLKB 1HAGE 2G55A 2P8OC 4Y0YE 2WPKS 1K21H 1W10U 5FAHA 1O2OA 1C5QA 1BBRH 3BTWE 2XCNA 2A4QA 3B8JA 2FO9A 3VGCB 1BRUP 4XE4A 3ZVDA 4X1NU 3VB5A 2VIOA 2BMGB 3MI4A 5GXPA 3KCGH 1T7CA 3DHKH 1Y3WA 1LTOA 2HVYB 2G51A 3ENSB 3SU2A 2O8WA 3SU1A 4DJZB 1ZJDA 3LGUA 1QFKH 2VIWA 5HMAA 4MTBA 4CRFA 1TONA 3OFND 2B5TB 1H8HD 2FOHA 4ZKSU 4Z0KA 1SI5H 1T8NA 4F49A 2HALA 5TCAA 1C5TA 1O3IA 2GCTB 1AZ8A 5F53A 3T25A 1A2CH 1PPFE 2Q6FA 1QA7A 1V2WT 4MPUA 1UVUH 2KZ4A 3LU9B 1M9UA 5TCCA 2LNCA 1ELVA 2FEQH 4KP0A 4WWYA 3GOVB 4Q7YA 3SJ9A 1UK3A 3KQDA 3STIA 3CS0A 1X7AC 2VH0A 5L6NH 3LKWA 1ELFA 2FOAA 1IQLA 5CHAC 1O2YA 1CHOG 1IQKA 1VCWA 3QLPH 2GTBA 1SGDE 2B7DH 1ZJKA 4WVPE 1FNIA 4Q7ZA 1EB1H 3UQVA 4YOIA 2OP9A 1AB9B 2BDAA 2ODPA 2FI5E 1TIOA 2XYAA 3LGTA 8ESTE 5CMXH 4MLFB 1GDUA 3VFEA 4X8SH 2XNDD 1MBQA 3MH7A 1N6YA 1T8MA 4NWLA 2BDBA 1AQ7A 1UTMA 1OYTH 1YPLH 3G01A 3UIRA 1HJAC 1QCPA 1MTUA 1ZPBA 4AYVB 5T6FA 1HB0B 2ALPA 1FUJA 4XD7D 4ABGA 1HIAB 2ZTXA 2VIDA 2ZU1A 4XBBA 4XOJA 1LVMA 1V2NT 1V6DA 2BD8A 3SI3H 5FPYA 2CGAA 4B2BA 3MOCA 1O2QA 1P0SH 3TLOA 4OS1A 2EI8A 3PO1C 1GMHG 1GBHA 1IHSH 2DE9A 3BTTE 3GCTF 3VB7A 1CA0C 1NPMA 1T32A 2VNTA 2FPZA 1IQIA 4UEHH 1HLTH 4F55A 1V2MT 3E90B 3IG6B 3UWIA 1L4DA 3NKKA 5GCHF 4PROA 2CJIA 4B2AA 1O3CA 2Q1JA 4GUXA 3Q77A 2PSXA 1SOZA 4YOJA 2VVVA 3LPRA 1O2HA 2D2DA 1N6XA 1SGQE 1YM0A 5GPIB 8GCHG 1J17T 2C93B 3FO8D 1J9CH 2ZF0H 1A3EH 1O2TA 2WUBA 1IQEA 1UJ1A 5EPYA 1AWHB 5CDFE 5HXFA 3PLKA 3W1EA 4B6FA 4ABEA 1TNIA 2FS9A 2JJ2D 3BSQA 3A85A 1K0HA 1C1VH 1XUKA 2VGCC 2YMSB 3DT0H 1RD3B 1EAIA 1WQVH 1GL1A 3SV7A 2J38A 2VJ1A 3BTDE 4BTTB 1DPOA 1TX8A 2BOKA 2P3UB 3TH4H 2CXVA 1O3AA 5B6OA 4RT1A 4AOQA 3K6YA 1IQNA 5A0BA 4B1TA 1PQ8A 2WV5A 1MU6B 4B76A 3V3MA 4JYVH 3T5FH 5A0AE 4MNXA 2NU4E 4X2YA 2BXUH 1NU7B 1B0FA 3AW0A 3ZZ5A 1T4VH 3O8RA 2QXJA 3BF6H 2R0LA 1YF4A 3RXRA 1NC6A 2HWLB 2Y5GA 1YPHE 1S82A 3R3GB 1QHRB 1FDPA 3SV6A 5C0UA 1DUAA 2PP6A 5EJ1A 2IOTA 1N1LA 3ZIAD 5ESBA 1MTWA 3F2GA 3M7TA 4WH6A 4K1TA 1A7SA 1ZHRA 1O2XA 1IQMA 2ALVA 3V0XA 4FUJA 4U30A 4ISLA 2VB0A 2FESH 1BMNH 1SPJA 3SU4A 5I46H 3D23A 1XVMA 1GBLA 2Y81A 1E37B 5GIBA 3JZ2B 3DSOA 2A2XH 2ZO3H 1TNKA 3ELAH 2WPDD 1TNLA 1EPTB 4IN1A 5CE1A 4X8UH 3SJOA 3ZZAA 3QZRA 4MQAA 4ABDA 4ABFA 1P2NA 2L6OA 1MTNB 2RDLA 2ZPRA 3KL6A 5JYIA 3M36A 3PTNA 3DA9B 3BIUH 4DG4A 3HGPA 1A5HA 1O3GA 4K8BA 3H7OA 1DFPA 1VITG 1O2NA 5GDSH 3B23B 3VEQB 1B0EA 3ATIA 3I77A 1CBWC 5E0HA 1S84A 2R9PA 1GG6C 3MH6A 3RXSA 3UQOA 1ZR0A 1DWDH 3OY6U 1UCYK 3VB4A 5FCRA 1O2RA 3T27A 2GP9B 1ARBA 2F9NA 5ABWA 2R3UA 3P95A 3RMMH 4B2CA 2BVXH 3TH3H 1P2IA 3BTQE 4AB8A 1AFQB 1FQ3A 1Z6JH 1GHYH 6GCHF 2RDEA 2XBVA 3QUMP 2F43B 2FYRA 2IJOB 2QY0B 1SR5C 1FAKH 1QQ4A 2OD3B 3P6ZB 1HCGA 5C5NA 2Y6TA 3EGKH 3P70B 2O9QA 1GJDB 5DJ7A 1GI9B 1W8BH 3S69A 1ELCA 2HOBA 4O03A 2CK3D 3ZZ3A 4AN7A 3VG8A 2Z9JA 4RI0A 5IDKA 3FKSD 1W7GH 4A5TS 3LDXH 1E1QD 1O3NA 2GVFA 2ZU2A 1ZSJA 3F0OA 4Y11E 1QRWA 4FUCA 2JH5D 1GCTB 3PMAB 4INHA 1SQOA 2AMDA 3E91A 1BBRE 1PPBH 1UO6A 1YCPK 2VWOA 5HIZA 2DE8A 2V3OH 3ZZ4A 4I7YH 1L1GA 3DSGA 1AHTH 1ANBA 5EOKA 5JBBS 1HAVB 2PUXB 4RT0A 5GNDA 1TMUH 1MH0A 3PROA 1LVOA 4A1XA 2FOEA 4D7GA 4DIIH 3PV5A 1D9IA 8KME2 1DOJA 1C2LA 2C8WB 4BXSA 1UVTH 1O0DH 4ACAA 1C5MD 1GJCB 1LPZB 5DP5A 2G8TA 3EE0B 5HGGA 1K1NA 1AGJA 2FLBH 1NRSH 1MKXH 3L3TA 3E0PB 4Y79A 1CHOF 4VGCC 3M3SA 1ZPCA 1MTVA 1XUJA 2K0QA 3A8BA 4X6OA 5SGAE 2K1QA 2K8IA 3CP7A 1SGTA 1QB9A 1OWKA 1SGFA 2EEKA 3UOPA 3OTJE 2ILNA 4H6TA 2UUYA 2H2ZA 5T3HA 2ZHDA 3TH2H 2BZ6H 5EW2H 1HAPH 3SN8A 2ZFFH 1AUTC 4DVAU 4U01A 1KLJH 1U6QA 2PGBB 1QIXB 1S85A 2CMYA 3OE7D 5A8ZA 1MUEB 1TLDA 4YLUA 7KMEH 2TRMA 2R2MB 3MMGA 3M5MA 2BZAA 2G4TA 1KY9A 3QTVH 1A61H 3A82A 4BTUB 3GCTG 3SU5A 1MU8B 1BTXA 1MZDA 1ZOMA 2P3FH 2Z9GA 1OWJA 2OC0A 3P8GA 2AHME 1GDNA 1CT2E 4FUDA 1V2JT 4Y6DA 2Q6DA 1AKSB 2G52A 3GS9A 2ESTE 3ZVAA 4B75A 2PWXA 1BOQA 2WZQA 5A8YA 1HXEH 1YLNA 3M7UA 2XBYA 2Z9IA 4NZQA 5F03A 2GDEH 1S83A 1FIZA 2HNTE 3A88A 4X2VA 5FX5A 4D9QA 1GMCF 4XSKU 3OX7U 4AGKA 3KIDU 1PFXC 3WW7A 1H8ED 2QF4A 2F91A 1HPGA 3KHVA 1Z8JB 3ZZBA 1NO9H 3CNRA 3RP2A 3GY6A 2TGPZ 1TBZH 1P2KA 4AFQA 1F0TA 1NRPH 3RXTA 3E6PH 2QF5A 3GDVA 4CRBA 2KAIB 1V2QT 3TVJB 3KYFA 3RLYH 5E8EH 3LIWA 1CA8B 2W26A 5F8XA 1GJBB 1HXFH 2QF3A 2BD2A 2TPIZ 2A31A 1Z1IA 3BIVH 3M5LA 1NRRH 1DICA 1JXPA 4R8TB 3RC6A 2Z3CA 3KQEA 4FXGH 3MH4A 1GGDB 2UUJB 3SU6A 4DT7B 5PTPA 2R2WU 1H8DH 1WTGH 3WWFA 1B7XB 1VGCB 3GYMA 1GVZA 1BMFD 3SGAE 2ZKSA 1QY6A 6LPRA 1O38A 2SFAA 1C5YB 1WUNH 5KEDA 4IW4E 1OHHD 4WMEA 1SHHB 3MQKC 1O32A 2F9PA 1YPKH 1IQHA 1LPKB 1GHBF 3T28A 3RXLA 5EIYA 7GCHF 1C1MA 2AERH 1GJ9B 1SGIB 1D6RA 3SZEA 4NA7A 3LC3A 1YYY1 3KF2A 1PQAA 1TX6A 1A1RA 2B8OH 4F48B 3M5OA 2ZFTA 4CBNA 1YP9A 1BCUH 1GJ8B 1C5RA 1G37A 1TALA 1QL8A 3BG4C 1O2ZA 1QBOA 1ZZZA 9LPRA 1ELAA 3ZVFA 1GBTA 2AGGX 2C8YB 1RIWC 3F9FA 1MKWH 2LP6A 4JZEH 1OP8A 1DY8A 1GJ7B 4ZHAA 1GPZA 1ZLRA 1AO5A 2NU2E 3FZDA 4GSOA 5DK1A 3PRDA 3SJKA 2TIOA 4I32A 3ZV8A 3U8RH 1F5LA 4ABBA 2I6SA 5L30H 1EQ9A 1W0JD 1OSSA 4CH2B 2HPPH 4I8GA 1N8OB 1THRH 1P06A 3A83A 5C94A 1E35B 2AMQA 3A89A 3QWCH 2FXRA 2BDIA 3A7VA 2ZIQH 1C5SA 1ANDA 2TGTA 1CSOE 2L74A 3FAOA 5EGMA 5DSFA 3D65E 2V7QD 1GJ5H 4YOGA 2ZHEH 3Q3KA 1BTHH 1W0KD 1VITH 1NN6A 1D4PB 5EXLA 1QTFA 3LJOA 2BLVA 2P16A 2XC4A 1Y8TA 1GBIA 2WPJS 3RXAA 2D8WA 5C5OA 1D6WA 6GCHG 4K8YA 4BAQB 4Y0ZE 3A7XA 4IS5A 1S0QA 4NIVA 1RTKA 4ZMAH 2FOGA 1DS2E 1CO7E 4MNVA 1MAXA 2VINA 4CHAC 5F8TA 2BD5A 1UTNA 1GBMA 2BY5X 2I6QA 1KXEA 1YY3A 1PQ7A 1SFIA 3RXKA 2M2AA 1P8VC 1D3QB 2QIQA 2VIQA 3RXOA 1UTOA 1P2OA 3UB0A 1KLIH 2C3SA 2Y5FA 2PTNA 4RKOB 2CF8H 2P8OB 1TQ7B 1Z71A 1J15A 4H6SB 1KXAA 3W94A 1F5KU 1BA8B 3L33A 1NZQH 1GI6A 5G4BA 2STAE 4H4FA 4SGBE 3RMLH 1GHZA 2BVSH 1K22H 1TNJA 1ZTJA 4NG9H 1YBWA 5EJLA 2QXIA 2C8XB 3VPKA 4UFFH 3K65B 2VWLA 3TPIZ 3TK6A 2P3TB 3SV9A 3ZYEA 4ABJA 2A4GA 2R0KA 4I8KA 5JBTA 1XX9A 2WYJA 4ZXYH 1G32B 2CV3A 1C5XB 2PKAA 3F0PA 1QL9A 2ZU4A 3BV9B 1O5EH 1RTFB 1S5SA 1K1MA 1C9PA 5AFYH 1HRTH 3ZZCA 1C5WB 3A86A 1DM4B 3RXGA 5F8ZA 3N7OA 1V2UT 4JYTA 2F9UA 4HI3A 3FP7E 4D7FA 1K1LA 4CREA 4OGYA
chains in the Genus database with same CATH topology
1DSUA 5CHAB 3ZZ8A 1Y59T 3M3VA 1IQGA 1LQDB 4WMFA 1XUIA 3GCOA 3V7TA 1KSNA 2OQ5A 1FY3A 1O2LA 1KXBA 3UR6A 3EA8A 4D76A 1O35A 1C4U2 3UPEA 2AGEX 4NA9H 2XBWA 5A8XA 1O2KA 2O8TA 4X1SU 2ZDMA 4RSPA 3ZZ7A 3RC4A 5IYTA 4OGXA 3RXFA 1BJUA 6CHAC 1MAYA 1SLWB 3TK9A 3RC5A 1ESTA 2W3IA 1EAWA 4H42U 2ZPSA 1VCPA 1Q2WA 1TMBH 1OP0A 1KDQA 1NFXA 2XRCA 4BANB 1XMNB 1CGHA 1HJAB 1OP2A 1J14A 1Y3YA 4OS4A 2FIRH 3T2NA 1O33A 1ABIH 2XXLA 5LH8A 4JZFH 1EASA 1UCYE 1GI1A 1DY9A 4ZXXH 1O39A 1QL7A 1CT4E 3RXJA 3NCLA 3S7HB 3LJJA 5AF9H 2ZECA 3CS7A 3I78A 4X1RU 4X8TH 1DWBH 3PO1B 4Q7XA 4KTCA 3T62A 1HYLA 3PYHA 1ZTLA 2QXHA 3RMOH 1TPOA 1LO6A 1CA0B 2VVUA 1A0HB 1BITA 3MU8A 1C1PA 1T8OA 1GMCG 2GT7A 1O34A 2ANKH 3EYDA 3GCHC 1LHGH 4FVDA 3DFLA 3PWBA 1DT2A 1P02A 2A5IA 1DITH 5DP4A 2A45B 1S6FA 3TGJE 3HKIB 2ZGBH 3GISB 7ESTE 5JPMH 1G3BA 1PPGE 1G36A 1EZUC 4GCHF 4RKJB 2SGDE 1AE5A 1C2FA 4E7RG 2F9OA 3S0NA 1UTLM 4ZH8A 4R0IA 1T8LA 1VCQA 3NXPA 1NTPA 1ELGA 3Q3XA 1NESE 1GHAF 1ZSKA 2VU8E 4AZ2B 1BUIA 2VGCB 2ZTYA 1SVPA 4ABAA 4KGAA 3UR9A 1IOEA 5HM9A 2FM2A 5DP3A 3VXFH 5A0CA 4J1YA 1ZGIA 1G30B 3U8TH 1GI2A 1O2WA 3DFJA 1YGCH 1Q31A 1ZPZA 1O3KA 2FYQA 1CGIE 1HDTH 1EKBB 4K60A 4NCYA 2ANWA 1A4WH 1ZYOA 3ATMA 3RXVA 1GDQA 2Z3EA 4FU9A 1GHBG 3ITIA 7GCHG 1TRNA 3P8NA 1ABJH 1CGJE 2Y82A 2PLXA 4HTCH 3OU0A 4NWKA 1EB2A 1O3JA 3OY5U 1AWFH 4JZ1A 1Y5AT 2YNBA 2BD3A 2XW9A 1H8IH 4GPGA 4DOQA 1W13U 2NU3E 1RTLA 4X8VH 3A8AA 1ID5H 1SBWA 1Z1JA 4U2WA 1K1JA 1HV7A 2SNWA 2SNVA 1JIMA 3URDA 2PSYA 4ZKRU 2Q6GA 4A92A 5A09A 1UTJA 4J2YB 4ASHA 5E0GA 4JK6A 1O2MA 1JBUH 4Y8XA 4K5ZA 1P01A 3RMNH 1FY1A 1UVPA 1FXYA 1KXDA 4ISNA 4JZDH 5T6GA 4CR5A 2ZDKA 1GCDA 1F0RA 7LPRA 1EX3A 3PMBB 4YT7H 1JRSA 2ZGXH 5C3NA 1C1SA 3BEFB 4NSVA 3RM2H 1Y3XA 5C1YA 1OXGA 3FFGA 2H9EH 2XBXA 3SQEE 3SBKA 2FMJA 6ESTA 4CR9A 1C1NA 4BAMB 1VR1H 4AG1A 1DUEA 1BRCE 2HRVA 1OPHB 4OS2A 1UHBB 3MNBA 1BDAA 2W7SA 5EQQA 3BTHE 4UD9H 3RXUA 3GY3A 3SNEA 4CBOA 2BY8X 2FI4E 1AD8H 1CBWB 1O31A 3H5CB 2XWAA 4TPYA 1GMDF 1S81A 1GG6B 2XC0A 3URCA 5DG6A 2A0QB 5LGOA 3BG8A 5DPAA 2EA3A 2ZZUH 3L6PA 3SNAA 1C2GA 1L4ZA 3S7KB 1BTUA 2HNTC 1IQJA 1IHTH 1UVSH 1CU1A 2ODYB 3K9XB 1XKBC 1TB6H 4BTIB 1AUJA 4NIXA 1T31A 3TGKE 1ANEA 1O37A 3PM3A 1ZHMA 1C1RA 5DP6A 4YM9A 2HPQH 4Q80A 1F92A 4ISIH 4O3UA 2ZA5A 1P12E 3FZZA 3BN9A 3TJNA 3LGWA 4AORA 1C2IA 5EG4A 3GICB 2ANYA 5TJXA 4CRGA 1SGFG 2G5NA 1VZQH 4A1VA 1A0JA 5JBAS 1PYTD 1BTYA 1JMOH 3QK1A 4MNYA 1WCZA 2J9NA 2Z94A 3M37A 3PMHB 2JETC 2NWNA 1ZGVA 3R0FA 3ZVCA 2J95A 2XC5A 4K1SA 3E1XB 1THPB 4K69A 1C5LH 1W2KH 3NK8A 3MU0A 2A7JA 1TOMH 5EW1H 2CHAC 1GHVH 1Y3UA 1QA0A 3IITA 3F6UH 1WBGB 3AAUA 5DO4H 2FOBA 4IGDA 2Y7ZA 2VH6A 1FY5A 4TWWA 1QJ7B 2FWWA 1GBEA 1TFXA 3TJUA 1TGBA 2P59A 2RCEA 3RXPA 1XUHA 1TWXB 5I25A 2ZC9H 5FXLA 2FP7B 3A8DA 5AVDA 4MDSA 2TGDA 3TK5A 2R3YA 1AZZA 2OC1A 1G2MA 4UE7H 1O2VA 4VGCB 2GMTC 1Y3VA 2QGRA 3E0NB 3T29A 1FJSA 2GCHF 1KXFA 1XKAC 3RU4T 2J94A 2QXGA 5GJ4B 1UCYH 1EAXA 2ZGJA 3F9HA 3B9FH 5BPEA 5DGJA 2P95A 3LGVA 1QB1A 2H9TH 2BXTH 2V6NA 3SOSA 3UREA 3UY9A 4WMDA 3KQCA 3RXMA 1J16A 1MMJN 2F9BH 2ZFPH 4LXBH 1C2DA 4YO9A 1EJNA 4K1EA 3ATWA 1LDTT 3HGNA 3TJVA 4UONA 2FODA 1C2KA 1P04A 3W95A 3MU4A 4AB9A 1P09A 3EDXB 4BAKB 4MNWA 2BY9X 4CRDA 1P2MA 1C2MA 3D62A 2ZCKP 1NRQH 1GHXH 3HATH 1O3BA 1QBNA 1YCPH 2ZHWH 5HM2A 1LKAA 1BTPA 1WU1A 4OS7A 5EQRA 2QA9E 4Y10E 2GZ7A 4GCHG 4X2WA 2BDHA 1C1TA 5JBCS 1VJAU 3AASA 1BZXE 4ISOA 1FLEE 2PKAB 5JB8S 1MTSA 1TA6A 2IN2A 1KXCA 3HKJB 3HPTB 1XUFA 2A4RA 1C5PA 1FPHH 1GHAG 4MPWA 1QR3E 1H4WA 4JK5A 3GDUA 2Z9KA 2WINI 2G00A 1EP5A 1GI0A 1ETRH 2OXSA 5EXNA 2D26C 1YLDA 1YC0A 2UWOA 1A0LA 1ESAA 1S0RA 2FS8A 1TYNA 3ATKA 1LPGB 1Z7KA 2A4OA 1DX5M 4GAWA 1A3BH 4Z6AH 4LOYH 2O8MA 1C2EA 1WAYB 1O30A 2BD4A 2O8LA 1GI3A 4HZHA 2FTMA 3I29A 1UK4A 1Y5UT 1UTKA 2PHBA 3TU7H 1V3XA 2BYAX 1RRKA 3M3TA 1F5RA 1FN6A 1SOTA 1UTQA 3PV4A 1F7ZA 2PKSC 3P17H 1ANCA 1JIRA 1KDQB 1AU8A 3A7WA 5E2OA 5BRRE 2HLCA 3P8OA 1EZSC 1SSXA 3SUEA 3NPSA 4X1QU 3GY5A 5F6MA 2ODQA 3S9AA 1YPJH 2ZGHA 2QV1A 3RU4E 2B9LA 3ODDA 2BQ7B 4WF8A 1BBRK 3SW2B 1DSTA 3A7YA 3BG4B 2OQUA 2XTTB 2ZU3A 1RIWB 1O2IA 1LVBA 2VWMA 4TPIZ 1FPCH 2ZG0H 2B0FA 2HVXA 1EATA 1EZQA 1P05A 2QAAA 2Z9LA 1E0FD 1Q3XA 4TY7A 1C1OA 1TBRH 2ZU5A 4IN2A 1DVAH 2GV7A 3ZV9A 1MQ6A 4MPVA 2BD9A 2YNAA 1QNJA 2BX4A 1O5CB 2OINA 4LZ1H 2LPRA 3SHCH 1BT7A 1MQ5A 4JYUH 1HNEE 1HAVA 2G5VA 1YLCA 3RLWH 1F0SA 1HAIH 3QO6A 1DXPA 3ZVGA 2BX3A 5ESTE 3TITA 2C8ZB 4XBCA 4I8LA 1A5IA 2FZZA 1GMDG 1P03A 1V2RT 4FUIA 4GHTA 1EZXC 1ZMLA 1ELEE 3UOUA 5LPFA 3GYLB 2A5AA 1YPGH 4ZKOU 3NUMA 1GBCA 2ZFQH 4X6MA 1V2TT 3F9GA 1NY22 3ZZ6A 1WOFA 2PTCE 4K3JA 3M7QA 5L2ZH 3LC5A 2SGQE 4AFZA 2VIVA 3SORA 2YOLA 1TPSA 1KTTB 3U69H 4CHAB 1YKTA 1AFEH 2HGTH 2QF0A 2GZ8A 1Z8RA 1O2UA 1O2SA 1FN8A 1LHDH 2UWLA 3A8CA 3MNCA 1A5GH 1O3OA 4ZHLU 4MG3A 1C5ZB 2EI6A 3ESTA 3MTYA 4ABHA 3SUDA 1SQAA 2EC9H 1G3EA 2OLGA 3SGBE 5FBEA 1SMFE 2BDCA 1LQEA 3JZ1B 5DP8A 1O2JA 3NWUA 1NFWA 2GGVB 2PV9B 4FUBA 2C4FH 3BEUA 1C5VA 4DY7B 2AIPA 2H5DA 2ZCLP 3TGIE 3MYWA 1DXWA 3U1JB 3LH3A 2QN5T 3VGCC 4KELA 5DP7A 3MFJA 4NZLA 3ZYDA 2BHGA 1EXFA 2Y5HA 1C1QA 1HUTH 2BTCE 1AKSA 1NRNH 4MVNA 1GBBA 1ZSLA 2FOCA 2ZHFH 1XM1A 1O5FH 2ZPQA 3BTEE 3EA9A 1E34B 1ELBA 2BD7A 3RXIA 4DIHH 3Q3YA 1TNGA 2GCTC 3BTFE 1AMHA 1YPHC 5C1XA 3NZIA 1DLEA 4BAHB 1P57B 2SGPE 1PPEE 1AI8H 5FPSA 1YPMH 1OKXA 1ETSH 4XBDA 4A6LA 3AAVA 4E7NA 1EAUA 2BQWB 1BTWA 4TY6A 4I33A 3EQ0H 2BLQA 1FMGA 2J92A 4Y76A 4LZ4B 4XFQA 2SGFE 1OWIA 1LMWB 1WV7H 2GCHG 2TGAA 3HK6B 2RG3A 2KAIA 1O5BB 2GX4A 1AVGH 2BM2A 1TA2A 2UUKB 1GI8B 3WY8A 3M5NA 3OYPA 1GHWH 3A80A 3ZVBA 1CHGA 3MO3A 2PFEA 6CHAB 1AB9C 3P92A 4JCNA 1QJ6B 2W3KA 1F2SE 3GY7A 4THNH 1YCPM 4X6PA 1CT0E 4IMQA 1V2ST 3U98H 1WTHD 2ZFRH 3BTME 4UFEH 1GJ4H 5EODA 1L2EA 2GV6A 2PGQB 1FONA 2D1JA 1LCYA 1SHYA 4ZAEA 5FX6A 1A46H 1H9HE 1DWCH 4UFDH 1C5UA 2BY6X 1EJMA 2O8UA 1LHCH 4ZHMU 2JH0D 4WJG2 1DWEH 1LKBA 2STBE 4ZKNU 1GI5A 3U9AH 1LHEH 3SHAH 1KTSB 1KYNA 5ETXA 2F9VA 4D9RA 2JKHA 2FLRH 1G2LA 1V2LT 2HNTF 4Y71A 4I31A 1GBKA 5GWZA 3GCHB 2H9HA 1O3EA 1FAXA 5C2ZA 1SLUB 3SV2H 1C5OH 2CF9H 2TBSA 2XCFA 5FCKA 5L2YH 2DUCA 2AGIX 1C5NH 2UWPA 2PR3A 1XXFA 1AVXA 5A2MH 1AVWA 1ZHPA 3Q00A 3PWCA 2BY7X 1MCTA 1XUGA 1HAYB 1O5AB 3BTKE 5HYOA 1DANH 5JB9S 2J4IA 2WPLS 5FPTA 1O5DH 3KEEA 3A84A 1KLTA 3SNBA 1PQ5A 5EXMA 3STJA 1K9OE 3SNCA 4UFGH 4BAOB 1TGNA 1FY4A 2FX6A 4JMYA 1INCA 3QDZB 1QGFA 1GI4A 1NFYA 8LPRA 1BHXF 1J8AA 4Y7AA 1E36B 5C1UA 1GI7B 1Z6EA 3F9EA 5AFZH 1K1PA 2W7UA 1EP6A 2WPIS 1F0UA 2GZ9A 1OWEA 2WPHS 3PLBA 3UWJH 1FZZA 3KN2A 2RA3A 1NT1A 1ACBE 1H9IE 1SGCA 4O97A 1G3DA 3Q76A 2P94A 2WV4A 3SZNA 3V12A 2G4UA 2Z6BD 1BMMH 1P2JA 1D3DB 1W14U 2P93A 4NFEA 1TRMA 3O8DA 1QB6A 3F68H 4ESTE 4HFPB 1W7XH 3U1IB 2M5TA 2FI3E 2A7CA 3RXCA 1GL0E 2BVRH 1Z8IB 3SO3A 2BLWA 4Y7BA 1BIOA 5FBIA 1PPHE 3SU3A 2ZDNA 4F4OC 1O3DA 4M7GA 1ELDE 1O2PA 1DDJA 2IPHA 4CRCA 1TGSZ 2XNIA 1ELTA 4YLQH 2VIPA 3MWIU 3UTUH 2ZI2H 1SGRE 3UFAA 1P3EA 5E0JA 5DP9A 2Z7FE 3E16B 2JH6D 1EPTC 1ESBA 2CN0H 4FVBA 4FUGA 2QYIA 3MO6A 1MTNC 1TE0A 1L1JA 1P9SA 2A5KA 1T4UH 1SC8U 1QBVH 1HAZB 1V2VT 1V2KT 1K2I1 2OCVB 2SGEE 3TIUA 4DW2U 1HBTH 1BJVA 1CQQA 1YPEH 5DKMA 4SGAE 4MPXA 1ETTH 1MKXK 1O5GH 2H6MA 1W3CA 2Y7XA 4WXVA 3GY2A 5J4SA 3BEIB 3QTOH 1MBMA 2BOHB 4E05H 1LHFH 3C1KA 3MNXA 1FI8A 1ORFA 1THSH 5C20A 1W11U 4WY3A 2VVCA 2AFQB 2W5EA 1O2GH 2GT8A 4Y8YA 1PPZA 1GBFA 5E2PA 1WQSA 3MH5A 3QGJA 1AFQC 3MNSA 2V0BA 4BOHA 1HJ9A 2AMPA 4NIYA 2Y80A 3O8BA 4U32A 3PTBA 1P9UA 3S9BA 3EA7A 4LK4A 2FOFA 1G3CA 3FANA 4X6NA 1EJAA 3MU5A 1L1NA 2FX4A 3P8FA 1BRBE 1HAOH 2ZWLH 1TABE 1HIAA 4AGJA 1RXPA 2EI7A 3RXQA 5T6DA 1AIXH 5JDUB 1Y5BT 3OSYA 4X0WU 1W12U 1ZTKA 3RU4D 1TAWA 4X1PU 3ZVEA 1P11E 3HK3B 3UNRA 3A7TA 4WH8A 1SGPE 2FOMB 4INLA 2AIQA 1C1UH 2V3HH 1GJ6A 2GD4B 3DUXH 4UDWH 1BB0B 1H1BA 3U8OH 1GCTC 5K0HA 1AE8H 1TPPA 4O9VA 1JWTA 3QZQA 1S6HA 1UMAH 2JETB 2PW8H 2F83A 1ARCA 1SLVB 1BHXB 3AW1A 4NSYA 2ZQ1A 1KIGH 4D8NA 2CHAB 1D3PB 1QRZA 4E06H 4OS5A 3GY8A 3K6ZA 1HGTH 4DGJA 1GWAA 2NU0E 2ZNKH 3KNXA 1EOLA 4OS6A 3RXHA 1TQ0B