2R9PA

Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor(bpti)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin-3
publication title Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r9pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r9pA02
1SBWA 1CT4E 3ZZAA 3PTBA 1IQHA 2ZCLP 1SGFG 1ZR0A 3U1IB 1JWTA 1ZHRA 3A86A 1ELAA 1ETSH 1O2KA 1P0SH 3H5CB 1MTWA 2CHAB 4ISHH 1GHAF 4GHQA 1TMBH 3SI4H 2ZQ1A 2OC0A 1MKWH 2XCFA 4X0WU 1SFIA 2ODQA 1P3EA 1THPB 3QWCH 1ZZZA 5JBAS 4AFZA 4THNH 4DVAU 3OTJE 5DP8A 1C5MD 1UCYH 5DP5A 2ZFFH 1FUJA 1EZQA 2WV4A 1DLEA 1GWAA 1C5WB 1SGIB 1GJBB 4DURA 1XM1A 2BMGB 2Z3EA 4GAWA 4Q7YA 2AMQA 3UPEA 1SGNE 1SQAA 2OP9A 2RDLA 3QGNB 3UOUA 3BSQA 3GY4A 1RD3B 4VGCC 3AW0A 1TRNA 2VVUA 5LH8A 2RA3A 1HAOH 3ESTA 1ZMNA 4O3TA 1O2TA 1YCPK 2GCTB 1SHYA 2P95A 4FUEA 7LPRA 3SQEE 2GT7A 3RU4T 2R9PA 1A5IA 3ZZ7A 3QTVH 1J17T 1V2KT 1GMHF 2A31A 5EQSA 1O2RA 3MNCA 5FX6A 3SJOA 1P3CA 4Q2KA 2HNTC 2SGQE 3I77A 4H42U 2JKHA 1FPHH 1UVUH 4TYDA 1ZHPA 3FFGA 2W3IA 5AVDA 1DITH 1FXYA 3BEUA 5J4QA 1VGCC 2G8TA 1SGYE 2SGPE 1F2SE 1ESAA 2GMTB 3CP7A 3OU0A 2G00A 2VWNA 2G5VA 2HLCA 1FN6A 2XCNA 3BN9A 4JYTA 3UFAA 1V2RT 1E34B 1O2LA 3P8NA 4MPUA 3M7TA 2ZHDA 3MTYA 4MG3A 4HZHA 4IN1A 4B2BA 2YNBA 4YO9A 3SU0A 3HPTB 5CHAC 2GT8A 7ESTE 1O2WA 1P2NA 1GJ7B 3AVZA 3SJIA 2ZC9H 1AKSA 2ZFQH 2F9PA 3TJNA 1HDTH 1CT2E 2GDDA 1FNIA 3GOVB 3V3MA 3NUMA 1HIAB 2FODA 1P11E 1LKAA 1AU8A 2A2QH 2GGVB 1Z8IB 4Z6AH 3ZVCA 2I6SA 2CF9H 2CF8H 2W7UA 3S9CA 3RXLA 3EA7A 5EGMA 1C5UA 1GBMA 1BRBE 2B9LA 1P05A 4CR5A 3M36A 1OWIA 1QBOA 2Z9IA 3M5MA 1B5GH 1HLTH 5GXPA 1A5HA 1G36A 5I25A 4NFFA 1J14A 2C4FH 1EJAA 1F5KU 2FI5E 3TGKE 1YPJH 1ELDE 5A0CA 2BTCE 3EYDA 3DFLA 2ALPA 1G3CA 2EEKA 1GI7B 1QRXA 4XFQA 3QZQA 5JB8S 1WQSA 4FUHA 1AFQC 4AYVB 4O9VA 2FI4E 4D9RA 1GCTC 2XRCA 1YC0A 2NWNA 2ZTYA 1T7CA 1UTQA 1YP9A 1LHDH 3MU1A 1FV9A 3B23B 1C1MA 1UVPA 2QCYA 1F0TA 2BY8X 5LPEA 1QBVH 1TX6A 1TX8A 1ZJKA 2VGCB 3FP7E 5LPFA 1T8OA 1GJ6A 3Q00A 7KMEH 2AERH 3OY5U 1P8VC 1BTXA 3L6PA 4E05H 1GHBG 2FIRH 1GJ8B 4YLQH 3A7WA 3C1KA 1QL9A 2Y80A 4I8GA 2RG3A 2P16A 4Y7AA 1P06A 5LGOA 1O39A 4JZEH 2ZECA 1T32A 2CJIA 2A5IA 3T29A 1F0RA 1NFUA 2ZFSA 1Y3VA 3GY7A 3LONA 1Q2WA 1KDQB 3F9GA 4FU8A 1HAVA 2J94A 4B73A 1C2EA 2JETB 3DA9B 1XX9A 1IQKA 2WPJS 1S6FA 1BTUA 1UTKA 4INLA 1YBWA 1AWHB 1O3MA 3TITA 2BXUH 4H4FA 2O8MA 5FPYA 5C1UA 1AQ7A 2F83A 1GBDA 1AMHA 4JZIA 2UUKB 4DW2U 1H9LB 2PKSC 1SVPA 4R0IA 1GJAB 2WV5A 2QA9E 1JIRA 2OC7A 4X2WA 1F92A 1LDTT 3MHWU 4Y79A 4ABGA 1NN6A 1EUFA 3TLOA 1WSSH 2O8LA 1W0YH 1C1VH 1C2JA 2VIQA 4IC5A 1GBKA 3VGCB 1FJSA 1MU8B 3P8FA 1SLUB 2BDYA 2Z94A 1A0HB 1ELVA 1SPJA 3URDA 3OSYA 1SGDE 1ANEA 5FBIA 2C93B 1GBFA 2HGTH 1SGCA 2ZP0H 1SGTA 2C8ZB 3GY5A 5HM2A 3FP8E 1ZPCA 2PLXA 1HJ8A 3ODFA 1C5LH 1GI8B 2VIWA 3EDXB 4CRBA 5A8XA 1V6DA 1EOJA 2QY0B 3TH4H 4K2YA 1P2QA 3HGPA 3BIVH 1GBLA 2F9BH 3VB3A 3ZZ6A 4MNWA 4E7NA 1QNJA 1TBRH 2SGAA 4MPWA 2H9TH 1FPCH 3PMAB 4INKA 5PTPA 2H5CA 1NU9A 1TE0A 3ZZ3A 2ZPQA 1KLTA 5EG4A 1LMWB 1GBIA 1C5VA 2KAIA 4ASHA 5GDSH 3ZZ4A 1FMGA 4NCYA 3IITA 1P2JA 2BY5X 1ELTA 4BTTB 2FOEA 3BEIB 2SGEE 2FPZA 1NRRH 1QL7A 1O3DA 4ZKSU 1LVOA 1C1UH 1LPZB 2Z3CA 1EZUC 3U8RH 1MKXH 1VCQA 1IHTH 1IQIA 1W2KH 2FWWA 2ZGXH 1E36B 4I8JA 1SHHB 1SLWB 4A6LA 3A88A 1SQTA 5F8XA 1O5CB 2BD4A 1SC8U 3T25A 1DXPA 3HGNA 2V0BA 4YT7H 3LDXH 1XUJA 1MMJN 3T5FH 1UTJA 1CSOE 1K28D 1BBRK 3KN2A 1PQ8A 3DD2H 4WVPE 1SI5H 4Y8XA 3RC6A 3VXEH 4CRGA 2A4OA 5ABWA 3SV9A 1PPHE 1A1RA 2Z7FE 2GDEH 1QCPA 2XBWA 3T26A 3LGUA 1Y3WA 1UK4A 4BXSA 1ZPBA 4AZ2B 1EAXA 2OC1A 3BTEE 2Q6FA 4GLYA 2G4TA 2W5EA 5FCKA 2YNAA 1P03A 2LPRA 3S9BA 3SNCA 5DO4H 1MTSA 3U8OH 2BD8A 1GGDC 3SO3A 3MH6A 1D3QB 1BTHH 1TOMH 1O3EA 3MH5A 4IMQA 4IBLH 3M37A 1C1RA 4CH2B 3HATH 2EI7A 4UONA 5LPRA 1AO5A 1SR5C 1Z71A 3O8DA 3RXFA 1KXBA 5IYTA 3EE0B 1Y5AT 1MCTA 1W0ZU 5BPEA 3RXCA 3FVFB 3M7QA 1YCPH 3U69H 3GCHC 4NG9H 2PWXA 1Y5UT 3LC3A 1SSXA 1C1TA 1MD7A 4DT7B 1YPGH 1O2NA 1IQLA 2ZDMA 2V3OH 1V2LT 4PROA 1IQNA 3Q3YA 1P2IA 4GHTA 4JYUH 4WJG2 3S9AA 1EZXC 4B75A 4JZ1A 1D3PB 4WH8A 1QJ7B 1MU6B 3RXRA 4GSOA 1PYTC 3O8BA 2R0KA 2H5DA 4IGDA 1PYTD 2BY9X 1O3OA 2FXRA 3K6ZA 2Y5GA 4E06H 3S69A 5ESTE 3SQHE 1C5NH 4MVNA 3PB1E 3STJA 3MO3A 3QGJA 3LH3A 1AWFH 1UJ1A 1CO7E 4AB8A 2NU0E 4ESTE 5SGAE 4BOHA 3CS7A 5EODA 1YPHE 1HAGE 1Y3XA 5L2YH 3A7YA 5L2ZH 2ZF0H 2XNIA 2ZU3A 2D1JA 2GVFA 1BHXB 1ELEE 1TGBA 3RU4E 1O2QA 1CA8B 1W14U 4K60A 4OS1A 3TH2H 1VITH 4AG1A 4YT6H 2JH5D 2A2XH 1YPEH 4ABFA 1UTMA 3Q3XA 1PPBH 3QZRA 1EASA 2W26A 2G51A 2TGDA 2C90B 1IQEA 3UWIA 1WCZA 2V6NA 1XUKA 1QBNA 4YOGA 3A83A 1BB0B 1V2VT 4I8LA 3M5NA 2BVXH 1NM6A 2QC2A 3M3VA 3MU0A 1P57B 3P8OA 4X1NU 1SLVB 3ELAH 3ZVBA 2WPLS 1FI8A 3NPSA 4AORA 1CHGA 1Q3XA 1K1MA 1KXAA 4X1RU 2ZPRA 1NRQH 1MAYA 1TYNA 1XKAC 1DS2E 4OS5A 3KF2A 1V2NT 1D9IA 3ZZ9A 1V2ST 5B6OA 1C2HA 1V2PT 3C27B 1UMAH 1ZPZA 1CGJE 2GZ8A 1GBBA 1FDPA 5HM9A 2BLQA 4FU7A 4BAKB 3O8RA 4WH6A 3BTME 2C3SA 4J2YB 1GJ5H 4U2WA 2FOMB 3TK9A 1OWJA 3PM3A 1IQMA 2D8WA 1TPPA 1OWKA 6CHAC 3F6UH 1AVXA 2ZI2H 2J95A 4FUJA 3ATIA 4ZHAA 3A82A 1P2KA 1AB9C 2ANYA 3NWUA 5ETXA 4XSKU 3RMLH 5DK1A 5E0GA 5F03A 1ZHMA 3RXMA 3SV6A 1BOQA 2EA3A 3G01A 1QY6A 1K2I1 3SJ8A 3ZV8A 1K1IA 2FO9A 3RMMH 1Z6JH 1RIWB 1RGQA 4NFEA 1ESBA 1KXCA 4X1PU 1YPLH 1O32A 1W7GH 1ELFA 2IOTA 5HYOA 1TGTA 4Y8ZA 1DPOA 1O3IA 1TPSA 2FDAA 2HRVA 4NA8A 1FAXA 4OS2A 5DJ7A 1DDJA 1G9IE 2BZAA 3TNTA 1E35B 2AIPA 1YF4A 3KHVA 3EA9A 4INHA 1TNKA 4DIHH 1SGPE 2VIOA 4BXWA 2PGBB 2AEIH 1GHWH 3A7XA 4HTCH 5TCAA 5FX5A 1IQFA 3SNBA 1TAWA 3W95A 2CV3A 3SU3A 1MUEB 3RC4A 4UFFH 2WYGA 1HJ9A 2O8UA 1BMNH 1KXFA 4A7IB 1NRPH 3I78A 3ATKA 2D26C 5AFZH 1O2UA 3M61U 3GISB 5DPAA 1MZAA 3T62A 5A2MH 4Y71A 1Z8JB 2HVXA 2F9UA 5EPNA 4X8TH 1C9TA 3F68H 2ASUB 2BQWB 2FX4A 1O3FA 2ZDNA 2H6MA 3S7KB 2HOBA 1GBHA 1C2IA 1THSH 1Z8RA 4YM9A 1TONA 1DE7H 1GG6C 1QHRB 5I46H 3VXFH 2BD2A 1YKTA 2J34A 5EQRA 4ISNA 3SJKA 1RRKA 1B7XB 1GBJA 5FBEA 1AVGH 1HJAC 3GY8A 1Y8TA 3RXTA 2ZFTA 1KYNA 1JOUB 2NU4E 2A32A 2Z6BD 5GCHG 2OTVA 1JMOH 2VH0A 1ZTJA 5F8TA 3GY3A 4AG2A 2P3FH 1GI9B 1W11U 3GY6A 3NK8A 1T4VH 2KAIB 1C5TA 2ZCKP 2GD4B 1LHGH 1BJUA 1FY1A 5DP3A 4O3UA 1DSTA 3E91A 1O2PA 2Z3DA 5DGJA 1PPZA 2Y5HA 1HAYB 4CHAB 4I8HA 3MWIU 2ZGHA 4UE7H 4ABJA 1NFWA 1O37A 3M35A 1DICA 4NZQA 4MPXA 1TX7A 4JZFH 1TQ7B 2I6QA 1Y3YA 1BITA 1PPCE 3KQBA 1SGRE 2IPHA 2XC0A 3P70B 3PO1C 4I32A 4WXIA 3RLWH 2AMDA 1O2VA 5JPMH 3PMBB 1ANDA 1J16A 4DIIH 1IQGA 1BBRH 1BA8B 5K7RA 1W12U 2P94A 1O2HA 3EGKH 3RDZA 3WY8A 2H9HA 1DWDH 3D62A 3T28A 2XC5A 1O30A 3ZVEA 3P17H 4D8NA 2FLRH 2H2ZA 4UD9H 4XE4A 4Y7BA 2SGDE 3UWJH 1RS0A 3LGYA 1SGEE 4ZH8A 1C4U2 2WPIS 4ABAA 1HYLA 1UVTH 2BLWA 4TY7A 3A85A 1CU1A 1THRH 1A3EH 1QR3E 2FOFA 2PGQB 1H8IH 5AHGH 2BX4A 1AUJA 1BMLA 1XXDA 4I7YH 5G4BA 3LJJA 2VIPA 3NZIA 1IHSH 3UR6A 1NO9H 1O35A 1C5YB 4FXGH 4AX9H 3SW2B 3E3TA 5DP9A 2XC4A 4U01A 3TPIZ 1N8OB 3HK3B 1GL1A 1EOLA 3SHCH 1S83A 4IN2A 4Q80A 1INCA 1C9PA 1KXEA 2H9EH 1LPKB 3P92A 4CRDA 2EI8A 4FUCA 1LHCH 1BTPA 1EP5A 5T6DA 5A0AE 1EPTB 5HGGA 2R3UA 2BY6X 1AZZA 1FY4A 3RXUA 3OX7U 4WMEA 1V2MT 2BY7X 3PWBA 1MH0A 1S81A 1TIOA 1FZZA 4AFQA 1ZJDA 8KME2 1OX1A 1U6QA 2XTTB 1F5LA 5GCHF 4B74A 1NROH 3A89A 3GCTG 4UFDH 3RXHA 1W13U 1HCGA 4H6SB 3URCA 4B2CA 4D7FA 2B5TB 1PQAA 2ZFRH 1G2LA 1EZSC 2Y5FA 2PHBA 3W94A 5EW2H 1QIXB 2B8OH 2HPQH 2F91A 1O5DH 3KIDU 4YLUA 1C1SA 2C8WB 2BDIA 4F49A 2BD7A 2WPKS 2OBQA 3TGIE 1TPOA 1WOFA 3A87A 5ESBA 3RXSA 2HNTE 4CBOA 1A2CH 2P8OB 4K1SA 1HXEH 4Y11E 1E38B 1OYTH 4KTCA 1ANCA 1DY8A 1NFYA 4DG4A 2VU8E 3FANA 3GDUA 4NGAH 2ZDKA 4LXBH 1AY6H 1IAUA 1O3BA 1QL8A 5A8YA 3PV4A 3M7UA 4FUFA 2CHAC 2PW8H 1DUAA 1LPGB 3M5OA 3SV7A 2FS8A 1YLDA 1JRSA 2G4UA 1ZOMA 2CGAA 1TA6A 3A7TA 2FMJA 2OLGA 1O2MA 1OS8A 2A5AA 3RXPA 1SMFE 3BTQE 3GYMA 3R3GB 3RXEA 2J38A 2XWBI 3GY2A 3UNSA 2AMPA 4YESB 3QO6A 4X6OA 2UWOA 4BAMB 2VIDA 2A1DB 4JMYA 1T4UH 4AFUA 3MU4A 1TQ0B 2A7JA 4LZ1H 1XVMA 1O2OA 1ZGVA 5EU8A 1NS3A 1O5GH 1NU7B 2ZU2A 4GPGA 3TNSA 3F1SB 3H7OA 4TWWA 1A3BH 1K1LA 3SNDA 3FZDA 2SFAA 2C8XB 3LGTA 1EB2A 1VZQH 2GCTC 1S0QA 2NU3E 1N6YA 1YCPM 2BLOA 1QQUA 4JK5A 5H4IB 5E0HA 1EXFA 1MKWK 2UUYA 3K65B 4KKDA 1UTNA 2EI6A 4WMFA 3P95A 3BG4B 2OCVB 2ZFPH 3U98H 3ZZ8A 1RTKA 1Z1IA 3KQDA 2OUAA 1WV7H 1NY22 1UCYK 1ELCA 2PSXA 5C1YA 1D3DB 1ESTA 2W3KA 1TBQH 3GCTF 2ZIQH 3VB6A 2W7SA 2ZPSA 4FVDA 1VJAU 2GMTC 2RCEA 3UQVA 2ZDLA 3PWCA 1HXFH 1MTVA 3E16B 2TPIZ 3SU6A 2TGPZ 4ABEA 5GPIB 1ZGIA 2ZU4A 1UVSH 2ODYB 1UVOA 4U30A 1QRWA 3RXQA 3V13A 1O5BB 1TLDA 1BCUH 4DJZB 1QFKH 3ITIA 2CMYA 4TY6A 3A8CA 4X2YA 2AFQB 1T31A 2BDAA 3MNSA 4X1SU 3M5LA 2PUXB 1FONA 1GJCB 1CBWB 4WMDA 3A81A 1F0UA 5C20A 1GI4A 1Y3UA 5F6MA 1PJPA 3FP6E 1W3CA 1ORFA 1RTFB 4A1TA 2AGIX 3QX5H 1C2GA 2Y81A 1CA0B 2RA0A 1E37B 2ZGJA 3MO6A 1BT7A 4Y6DA 1O3AA 1JBUH 1P04A 4LOYH 1GI0A 1B0EA 1F5RA 3PLBA 4GCHG 4B1TA 4X8SH 2ZHWH 3AAVA 4LZ4B 4BNRA 1K22H 5GJ4B 4D76A 1TB6H 3EA8A 3NCLA 4NIWA 4CBNA 4MLFB 1K1JA 2K1QA 2OXSA 4ABIA 2FTLE 2XWAA 3A80A 1EAIA 2VWOA 3F9EA 2BDGA 5C5OA 2ILNA 2FM2A 3RMNH 1RJXB 2ULLA 4TWYA 1GCDA 1CGHA 1O5EH 1P2MA 2G52A 3RXJA 3SV2H 4B76A 5DG6A 1OKXA 1PPFE 4XBDA 1O5FH 1MTNB 5JDUB 3ZVFA 3UY9A 2QIQA 2TGTA 3L33A 4BANB 3JZ1B 4ABHA 1KTTB 4D7GA 1TFXA 1SOTA 1O0DH 3FAOA 1BQYA 1HIAA 2J4IA 1H4WA 2C8YB 2SNWA 2ZCHP 3ATLA 2R0LA 2VGCC 1O3NA 1JIMA 2TIOA 3M3TA 3UNQA 3SJ9A 3BTGE 1K1NA 2O9QA 5HXFA 1BHXF 1C2DA 1TWXB 4ISOA 3ZZDA 2F3CE 2BQ6B 3QK1A 1ABJH 1TALA 4K8YA 2QXJA 5T3HA 1SL3A 1EJNA 1VITG 1O2YA 1BTYA 4Y10E 4FU9A 2BHGA 3TJOA 4YTAA 1ZMJA 1P12E 1MQ6A 1GI6A 2BVSH 2JETC 2A4QA 1TA2A 3ZYDA 1BTZA 4ABBA 4ZHLU 4VGCB 2CN0H 1SGFA 3AAUA 2XYAA 2A7CA 5FPSA 3SU1A 1NT1A 2FESH 4A1XA 1ABIH 3RMOH 4HGCA 2ZDVH 1SG8B 2VVVA 3RXAA 3RXIA 1G3DA 1T8LA 2XW9A 1GMDG 2VJ1A 1AKSB 3E8LA 2Q6GA 1FN8A 5GIBA 5EOKA 2BDHA 4WY3A 3B8JA 4DGJA 3VGCC 1QURH 1TRMA 5CE1A 4MQAA 1GJ4H 2B7DH 4K1EA 3KEEA 1G32B 2DUCA 1GBAA 1O3LA 1J9CH 1Y59T 2ZEBA 2V35A 2WPHS 3QLPH 1BJVA 3A8BA 3PMJA 1W8BH 3T2NA 1VGCB 1CT0E 2OD3B 3ZVGA 4LK4A 4MDSA 2IN2A 1KDQA 1NPMA 2FOCA 2R3YA 4GCHF 8ESTE 2JH0D 1ZTLA 9ESTA 4X2XA 3MFJA 4M7GA 1GI2A 3SGAE 1CQQA 3PROA 2ZTXA 1ANBA 6LPRA 1EB1H 1GL0E 4K3JA 1H1BA 3GDVA 1V2UT 3GCNA 5CHAB 3D23A 1OP8A 1VR1H 1QB6A 3RXOA 1AUTC 3MI4A 1HV7A 3Q76A 3E90B 1FAKH 1RFNA 7GCHF 4KGAA 3EAJA 4JYVH 3SBKA 5EQQA 1J8AA 5FXLA 3S0NA 1XVOA 3A8DA 2ZGBH 1C5OH 1Z1JA 3BTDE 4CREA 3KQEA 4DY7B 1HAPH 4FUBA 4ZHMU 1AHTH 1DM4B 5C3NA 2ZA5A 4MNXA 1T8NA 2VIVA 3V7TA 2BVRH 4I8KA 2FYQA 1G30B 1GI1A 3ATWA 1BBRE 4DOQA 5J4SA 1VITF 3PTNA 3BIUH 4CH8B 4YOJA 4X1QU 2GKVE 1HAVB 1AFQB 1HPGA 3KNXA 5DP4A 3ZVDA 1GCTB 5FPTA 2PKAA 4A5TS 4X2VA 2BOKA 1TGNA 1IQJA 1FY5A 1P02A 4ZMAH 1XUFA 2ZZUH 1LTOA 3DFJA 4BAQB 2Z9LA 1DY9A 1E0FD 1Z8GA 5C5NA 3UQOA 5CMXH 5E2PA 1C1WH 4ISLA 3SUGA 4Y0ZE 4KTSA 1GMDF 1TPAE 1C2LA 4ZKRU 3R0FA 1EKBB 2J2UA 2P3UB 4YOIA 1UHBA 1ZYOA 1FIZA 1OP0A 1SQOA 2O8WA 1LVMA 1WBGB 2PTNA 2QXIA 2WPMS 4ISIH 3KQCA 3V0XA 1GDQA 2ZDAH 2ANMH 3MOCA 2ZNKH 2Q1JA 1AGJA 1ZRBA 3ZYEA 5JYIA 1C2KA 2VWLA 1HAIH 1BIOA 1H9HE 1LQEA 1ZMLA 1TNIA 2YOLA 4UEHH 1W10U 2UUJB 1ID5H 1F7ZA 1CVWH 1C1OA 4BAOB 1O33A 3MH7A 1NZQH 1Z6EA 3HKJB 2ZU5A 3ODDA 3LC5A 3SNAA 2VVCA 1EQ9A 2PKSB 1L4ZA 2A4GA 1C2FA 1OWEA 1TNGA 4NSYA 4XBCA 1GHVH 3QTOH 5JBBS 1BRCE 1MTUA 1N1LA 5AF9H 2JH6D 1TNLA 3BEFB 4RSPA 1SGQE 4K5ZA 2Y82A 2H1UA 2OQ5A 1TNHA 2GZ7A 5JB9S 2STBE 5TJXA 1MBQA 1C5ZB 2ANKH 3A84A 3U8TH 1WQVH 2VINA 4RKOB 4ZUHA 2ZTZA 3IWMA 1WTHD 3UREA 1C5QA 5C2ZA 1A46H 3TH3H 3RXGA 3UIRA 3K6YA 1P09A 4NIYA 3RXBA 4MNVA 2R2MB 3BV9B 3P6ZB 1PFXC 1TMUH 1O3JA 3VB7A 5DP6A 3ENSB 1D6RA 3LGVA 1DSUA 1M9UA 1DXWA 3BTWE 1XUIA 1YGCH 1S5SA 1QA0A 2OINA 1AVWA 1TMTH 5A0BA 5EPYA 5DP7A 1AIXH 1BRAA 1L1NA 2Y7XA 2BYAX 1F0SA 1MCVA 1O3KA 2Y7ZA 4OS6A 2EC9H 1L0ZA 1OYQA 3PMHB 1QA7A 3SN8A 4FVBA 1O2IA 1UTLM 3ZZBA 1O2XA 1HAHH 3SI3H 1GVZA 2GCHG 3LPRA 1TABE 1O2ZA 1GI3A 3PLKA 4YZUA 3SU5A 5IDKA 1PQ7A 1S0RA 1OSSA 3QUMP 1RTLA 1KLIH 3RXVA 2AIQA 4IS5A 1K9OE 5BRRE 3NXPA 1HBTH 4K1TA 1L2EA 3QN7A 1P9UA 4AGJA 2A7HA 3TIUA 4O97A 1K1OA 1MAXA 4A1VA 3DHKH 1HNEE 1KIGH 1JRTA 2UWPA 1S85A 4JCNA 3KL6A 3Q3KA 8GCHG 2XBVA 5FHTA 1IOEA 1GBEA 2CXVA 2QF3A 4ZAEA 4AGKA 1VCPA 3MYWA 3PYHA 1ZSKA 5GWZA 5L6NH 1GBCA 1VJ9U 2ZU1A 1UK2A 2TBSA 4K69A 1NFXA 1WYKA 1C1QA 3VB4A 2QF0A 4AFSA 2P59A 1SOZA 1MQ5A 3EQ0H 1HGTH 1EJMA 1LVBA 3E1XB 4O03A 3TK6A 3MU8A 2WYJA 1QB9A 1TGSZ 1KXDA 2Z9JA 1ARCA 1O31A 1LQDB 1DT2A 4ZKOU 1DWCH 4BTIB 5T6FA 2GTBA 4UDWH 4NSVA 1T8MA 2FZZA 1L1GA 1EAWA 2FLBH 2G81E 4AN7A 3SHAH 1KTSB 1EATA 3TK5A 3GYLB 3ZVAA 1HB0B 1QQ4A 3BF6H 3ATMA 4J1YA 1ZRKA 1XXFA 1FIWA 1GGDB 5C67A 1H8DH 2FS9A 2Z9GA 4DCDA 1RIWC 1X7AC 3A7ZA 5EXMA 1QTFA 3LJOA 2QXHA 4OS7A 4QT8C 4JK6A 2WUCA 1P2OA 1AZ8A 1CE5A 3P8GA 1ZSJA 3GCHB 3SOSA 1V2JT 3GDSA 3UUZA 3LU9B 2G55A 1FQ3A 1OXGA 4ZROA 4RKJB 2J9NA 1BZXE 1O38A 1LKBA 2IJOB 4OGXA 1L4DA 4Z0KA 1OP2A 3MNXA 1XMNB 1A5GH 3STIA 3D65E 1BRUP 1GDUA 1C4V2 1KLJH 1ZLRA 2FYRA 1DX5M 2OBOA 1O2SA 2OQUA 2GCHF 2LNCA 3RXDA 2ZQ2A 3E0NB 3K2UA 3TJVA 2FOGA 1O3GA 2OC8A 4X6PA 4XOJA 2ANWA 2HWLB 2PR3A 1PQ5A 3BG8A 1A0JA 3OY6U 4ZKNU 2AH4X 1KY9A 1NRNH 4B2AA 4NWLA 1V2WT 1C4Y2 4X8UH 2HPPH 1P01A 2FOBA 5E8EH 1N6XA 2FX6A 6GCHG 1OWDA 3SORA 8GCHF 3KCGH 5DKMA 1L1JA 1O2JA 5E0JA 1CHOG 6ESTA 4TPIZ 2TGAA 4ZXXH 2NU1E 2PSYA 4K8BA 2PFEA 2UWLA 2ZGCA 1KSNA 2DE9A 3DT0H 9LPRA 1ZTKA 5FCRA 3SU4A 2SGFE 3DUXH 3AASA 4Q7ZA 2PV9B 2F9VA 3VB5A 4AB9A 1C2MA 2F9NA 2HALA 3ZZ5A 4CHAC 1XUHA 4BTUB 1LHFH 1QGFA 3SUDA 1JXPA 3FZZA 2PUQH 1NC6A 4X6MA 4OGYA 1BTWA 5HMAA 1A0LA 4KP0A 2P3TB 1AD8H 3LIWA 2ZHFH 1GI5A 1EAUA 3LOXA 1ELBA 4NA9H 4CRAA 5K0HA 2GP9B 1HAZB 3CS0A 2NU2E 2BLVA 1XUGA 1QRZA 3SUEA 1RXPA 4Q7XA 4OS4A 1YPKH 2BD9A 3I29A 2PKAB 8LPRA 1TGCA 1C1NA 5JBTA 4Y0YE 1SB1H 2V3HH 1CGIE 4FUGA 2VNTA 4GVUA 3AW1A 1AI8H 3GCOA 1WU1A 2BXTH 1EP6A 3B9FH 1O2GH 4X8VH 6CHAB 4NA7A 1A4WH 4I31A 4CRCA 1B0FA 2P93A 1K21H 1YPHC 1AB9B 1WUNH 1GVKB 1GHBF 3H7TA 3MO9A 5EW1H 1V2TT 1UHBB 2THFB 4D9QA 3SNEA 1DANH 2QV1A 5AFYH 3SZNA 1J15A 1OOKB 3RU4D 1GHXH 4U32A 2Q6DA 1N8OC 2GV6A 2WUBA 3T27A 2R2WU 3A8AA 1ELGA 1ZSLA 4X6NA 3SGQE 4MNYA 1LVYA 1W7XH 1MZDA 1P9SA 1UTOA 2SNVA 1DLKB 1GBTA 1EPTC 7GCHG 1Z7KA 4ABDA 6GCHF 1UO6A 2XXLA 2O8TA 4XDEA 1G2MA 3RC5A 1GPZA 3VFEA 1CHOF 1V2QT 2FP7B 4KTUA 3SU2A 3TVJB 3LH1A 1G37A 1HRTH 5F8ZA 1GDNA 1XKBC 1QJ1B 1LHEH 1D4PB 3VEQB 1GMCG 1A61H 5A09A 5JBCS 1C5RA 1DWBH 2A5KA 3E0PB 1DWEH 1O36A 1FY8E 5A8ZA 1D6WA 5C1XA 3SV8A 3KGPA 3U9AH 4CRFA 1MBMA 3NKKA 5EXNA 3U1JB 1V3XA 4UFEH 2ZO3H 3JZ2B 2VH6A 2TRMA 1NTPA 3LT3A 3MH4A 2P8OC 2WINI 1A7SA 1YYY1 1DOJA 1SLXB 1K1PA 1GG6B 4FUIA 4NWKA 2HNTF 3IG6B 3ZV9A 3RM0H 1ETRH 1ETTH 1HJAB 4GUXA 3UNRA 2QAAA 1BMAA 1EPTA 1BDAA 4NIVA 1YM0A 2GX4A 1GHZA 4KELA 3F9HA 3LKWA 3ZZCA 4WXVA 5E2OA 3HK6B 3F9FA 1HFDA 1O3HA 4IC6A 4RN6A 4SGAE 2ODPA 4R8TB 1G3BA 2BD5A 3K9XB 4AOQA 1ARBA 1S82A 2FOHA 3MMGA 1FLEE 3CENA 2FI3E 1DFPA 1AE5A 3M3SA 3QDZB 2QYIA 3RP2A 2BQ7B 1V2OT 3TJUA 3RUOA 1LCYA 2GZ9A 1O34A 3UTUH 3PLPA 2XBXA 1NESE 1UTPA 4Y76A 1HAXB 1Q31A 1YPMH 3UR9A 1H9IE 1OPHB 1AE8H 1VCWA 3RM2H 2PTCE 5TCCA 3PO1B 1PPGE 2A0QB 2BB4A 4UFGH 4XBBA 3D49H 2AS9A 2ZG0H 2QGRA 1GJ9B 2FOAA 1NRSH 3N7OA 4FUDA 1GHAG 1TOCB 1OWHA 1O5AB 3VPKA 1GVLA 3HKIB 1QJ6B 4WWYA 5L30H 2BDCA 2ESTE 3S7HB 2BM2A 2BDBA 1UCYE 3SGBE 2A45B 4JZDH 1WTGH 4SGBE 1DVAH 4TPYA 3BG4C 3GICB 2G5NA 4I33A 3BTTE 1C5PA 1BMMH 3RLYH 1C1PA 1S84A 4Y8YA 1GJDB 1SFQB 3UOPA 2FEQH 2BZ6H 1GHYH 4A92A 2BD3A 2F9OA 3OYPA 1GMCF 2B0FA 4WF8A 4B71A 1TRYA 3O8CA 4E7RG 1AFEH 1O3PB 4MTBA 3BTHE 2ALVA 1YLCA 3LGIA 2A4RA 1C5XB 1O3CA 2GV7A 3A7VA 2J92A 1UK3A 2Y6TA 3Q77A 2QXGA 2AGEX 2XBYA 1GMHG 5EXLA 2BX3A 1CBWC 1D3TB 2VWMA 2AGGX 3TU7H 1BUIA 4ZXYH 1G3EA 3BTKE 2STAE 1QB1A 1LO6A 4IMZA 1MD8A 3MU5A 1CA0C 3TGJE 2VB0A 2D2DA 2UUFB 4F4OC 2ZHQH 2ZKSA 2M5TA 3L3TA 1EX3A 2BOHB 2ZWLH 4BAHB 4IW4E 1TNJA 1P10A 1Y5BT 1TBZH 2ZHEH 3SUFA 2FTMA 2AYWA 4MPVA 4NZLA 2DE8A 3MNBA 3RXKA 2Z9KA 1PPEE 2QN5T 1FY3A 3BTFE 5T6GA 3LGWA 4NIXA 1S6HA 1MKXK 1HUTH 4HI3A 1C5SA 1ACBE 4AYYB 4CR9A 3V12A 4H6TA 4HFPB 1WAYB 3E6PH 5FAHA 1DUEA 1AN1E 1MTNC
chains in the Genus database with same CATH superfamily
1SBWA 1CT4E 3ZZAA 3PTBA 1IQHA 2ZCLP 1SGFG 1ZR0A 3U1IB 1JWTA 1ZHRA 3A86A 1ELAA 1ETSH 1O2KA 1P0SH 3H5CB 1MTWA 2CHAB 4ISHH 1GHAF 4GHQA 1TMBH 3SI4H 2ZQ1A 2OC0A 3DSOA 1MKWH 4RT1A 2XCFA 4X0WU 1SFIA 2ODQA 1P3EA 3H09A 1THPB 3QWCH 2V3MA 1ZZZA 5JBAS 4AFZA 4THNH 4DVAU 3OTJE 5DP8A 2XOKD 1C5MD 1UCYH 5DP5A 2ZFFH 1FUJA 1EZQA 2WV4A 1DLEA 1GWAA 1C5WB 1SGIB 1GJBB 5KECA 4DURA 1XM1A 2RDEA 2BMGB 2Z3EA 4GAWA 4Q7YA 2AMQA 3UPEA 1SGNE 1SQAA 2OP9A 2RDLA 3QGNB 3UOUA 3BSQA 3GY4A 1RD3B 4VGCC 3AW0A 1TRNA 2VVUA 5LH8A 2F4LA 2RA3A 1HAOH 3ESTA 1ZMNA 4O3TA 1O2TA 1YCPK 2GCTB 1SHYA 2P95A 4FUEA 7LPRA 3SQEE 2GT7A 3RU4T 2R9PA 2L74A 1A5IA 3ZZ7A 3QTVH 1J17T 1V2KT 1GMHF 2A31A 5EQSA 5KEDA 1O2RA 3MNCA 5FX6A 3SJOA 1P3CA 4Q2KA 2HNTC 2SGQE 3I77A 4H42U 2JKHA 1FPHH 1UVUH 4TYDA 1ZHPA 3FFGA 2W3IA 5AVDA 1DITH 4ASUD 1FXYA 3BEUA 5J4QA 1VGCC 2G8TA 1SGYE 2SGPE 1F2SE 1ESAA 2GMTB 3CP7A 3OU0A 2G00A 2VWNA 2G5VA 2HLCA 1FN6A 2XCNA 3BN9A 4JYTA 3UFAA 1V2RT 1E34B 1O2LA 3P8NA 4MPUA 3M7TA 2ZHDA 3MTYA 4MG3A 4HZHA 4IN1A 4B2BA 2YNBA 4YO9A 3SU0A 3HPTB 5CHAC 2GT8A 7ESTE 1O2WA 1P2NA 2K8IA 1GJ7B 3AVZA 3SJIA 2ZC9H 1AKSA 2ZFQH 2WSSD 2F9PA 2HVYB 3TJNA 4F48B 1HDTH 1CT2E 2GDDA 1FNIA 3GOVB 3V3MA 3NUMA 1HIAB 2FODA 1P11E 1LKAA 1AU8A 2GGVB 2A2QH 1Z8IB 4Z6AH 3ZVCA 2I6SA 2CF9H 2CF8H 2W7UA 3S9CA 3RXLA 3EA7A 5EGMA 1C5UA 1GBMA 1BRBE 2B9LA 1P05A 4CR5A 3M36A 1OWIA 1QBOA 2Z9IA 3M5MA 1B5GH 1HLTH 5GXPA 1A5HA 1G36A 5I25A 4NFFA 1J14A 2C4FH 1EJAA 1F5KU 2FI5E 3TGKE 1YPJH 1ELDE 3MQKC 5A0CA 2BTCE 3EYDA 3DFLA 2ALPA 3DSGA 1G3CA 2KCPA 2EEKA 1GI7B 1QRXA 4XFQA 3QZQA 5JB8S 1WQSA 5CHBA 4FUHA 1AFQC 4AYVB 4O9VA 2FI4E 4D9RA 3FOAA 1GCTC 2XRCA 1YC0A 2NWNA 2ZTYA 1T7CA 1UTQA 1E79D 1YP9A 1LHDH 3MU1A 1FV9A 3B23B 1C1MA 1UVPA 2QCYA 1F0TA 2BY8X 5LPEA 1QBVH 2YMSB 1TX6A 1TX8A 1ZJKA 2VGCB 3FP7E 5LPFA 1T8OA 1GJ6A 3Q00A 7KMEH 2AERH 3OY5U 1P8VC 1BTXA 3L6PA 4E05H 1GHBG 2FIRH 1GJ8B 4YLQH 3A7WA 3C1KA 1QL9A 2Y80A 4I8GA 2RG3A 2P16A 4Y7AA 1P06A 4Z1MD 5LGOA 1O39A 4JZEH 2ZECA 1T32A 2CJIA 2A5IA 3T29A 1F0RA 2PP6A 1NFUA 2ZFSA 1Y3VA 3GY7A 3LONA 1Q2WA 1KDQB 3F9GA 4FU8A 1HAVA 2J94A 4B73A 1C2EA 2JETB 3DA9B 1XX9A 1IQKA 2WPJS 1S6FA 1BTUA 1UTKA 4INLA 1YBWA 1AWHB 1O3MA 3TITA 2BXUH 4H4FA 2O8MA 5FPYA 5C1UA 1AQ7A 2F83A 1GBDA 4FOUC 1AMHA 2KR7A 2UUKB 4JZIA 4DW2U 1H9LB 2PKSC 1SVPA 4R0IA 1GJAB 1EFRD 2WV5A 2QA9E 1JIRA 2OC7A 4X2WA 1F92A 1LDTT 3MHWU 4Y79A 4ABGA 1NN6A 1EUFA 3TLOA 1WSSH 2O8LA 1W0YH 1C1VH 1C2JA 2VIQA 4IC5A 1GBKA 3VGCB 1FJSA 1MU8B 3P8FA 1SLUB 2BDYA 2Z94A 1A0HB 1ELVA 1SPJA 3URDA 3OSYA 1SGDE 1ANEA 5FBIA 2C93B 5C0TA 1GBFA 2HGTH 1SGCA 2ZP0H 1SGTA 2C8ZB 3GY5A 5HM2A 1COWD 1ZPCA 3FP8E 2PLXA 1HJ8A 3ODFA 1C5LH 1GI8B 2VIWA 3EDXB 4CRBA 5A8XA 1V6DA 1EOJA 2QY0B 3OEED 3TH4H 4K2YA 1P2QA 3HGPA 3BIVH 1YY3A 1GBLA 2F9BH 3VB3A 3ZZ6A 4MNWA 5HIZA 4E7NA 1QNJA 1TBRH 2SGAA 4MPWA 2H9TH 1FPCH 2J5UA 2JJ1D 3PMAB 4INKA 5PTPA 2H5CA 1NU9A 1TE0A 3ZZ3A 2ZPQA 1KLTA 5EG4A 1LMWB 1GBIA 1C5VA 2KAIA 4ASHA 5GDSH 3ZZ4A 1FMGA 4NCYA 3IITA 1P2JA 2BY5X 1ELTA 4BTTB 2FOEA 3BEIB 2SGEE 1S6LA 3N7EA 2FPZA 1NRRH 1QL7A 1O3DA 4ZKSU 1LVOA 1C1UH 1LPZB 2Z3CA 1EZUC 3U8RH 1MKXH 1VCQA 1IHTH 1IQIA 3DCLA 1W2KH 2FWWA 2ZGXH 1E36B 4I8JA 1SHHB 1SLWB 4A6LA 3A88A 1SQTA 5F8XA 1O5CB 2BD4A 1SC8U 3T25A 1DXPA 3HGNA 2V0BA 4YT7H 3LDXH 3N7DA 1XUJA 1MMJN 3T5FH 1UTJA 1CSOE 1K28D 1BBRK 3KN2A 1PQ8A 4RT0A 4WVPE 1SI5H 3F0OA 4Y8XA 3RC6A 3VXEH 2A4OA 4CRGA 5ABWA 3SV9A 1PPHE 1A1RA 2Z7FE 2GDEH 1QCPA 2XBWA 3T26A 3LGUA 5DSFA 1Y3WA 1UK4A 4BXSA 1ZPBA 4AZ2B 4TT3D 1EAXA 2OC1A 3BTEE 2Q6FA 4GLYA 2G4TA 2W5EA 5FCKA 2YNAA 1P03A 2LPRA 3S9BA 3KYGA 3SNCA 5DO4H 1MTSA 3U8OH 2BD8A 1GGDC 3SO3A 3MH6A 1D3QB 1BTHH 1TOMH 3KYFA 1O3EA 3MH5A 4IMQA 4IBLH 3M37A 1C1RA 4CH2B 3HATH 2EI7A 4UONA 5LPRA 1AO5A 1SR5C 1Z71A 3O8DA 3RXFA 1KXBA 5IYTA 3EE0B 1Y5AT 1MCTA 1W0ZU 4XD7D 5BPEA 3RXCA 3FVFB 3M7QA 1YCPH 3U69H 3GCHC 4NG9H 2PWXA 1Y5UT 3LC3A 1SSXA 1C1TA 1MD7A 4DT7B 1YPGH 1O2NA 1IQLA 2ZDMA 2V3OH 1V2LT 4PROA 1IQNA 3Q3YA 1P2IA 4GHTA 4JYUH 4WJG2 3S9AA 1EZXC 4B75A 4JZ1A 1D3PB 4WH8A 1QJ7B 1MU6B 3RXRA 4GSOA 1PYTC 2JJ2D 3O8BA 2R0KA 2H5DA 4IGDA 1PYTD 2BY9X 1O3OA 2FXRA 1E1RD 3K6ZA 2Y5GA 4E06H 3S69A 5ESTE 3SQHE 1C5NH 4MVNA 3PB1E 3STJA 3MO3A 3QGJA 3LH3A 1AWFH 2L6OA 3WW7A 4P00A 1UJ1A 1CO7E 4AB8A 2NU0E 4ESTE 5SGAE 4BOHA 3CS7A 5GNDA 5EODA 1YPHE 1HAGE 1Y3XA 5L2YH 3A7YA 4ACBA 5L2ZH 2ZF0H 2XNIA 2ZU3A 2D1JA 2GVFA 1BHXB 1ELEE 1TGBA 3RU4E 1O2QA 1CA8B 1W14U 4K60A 4OS1A 3TH2H 1VITH 3ZIAD 4YT6H 4AG1A 2JH5D 4YXWD 2A2XH 1YPEH 4ABFA 1UTMA 3Q3XA 1PPBH 3QZRA 1EASA 2W26A 2G51A 2TGDA 2C90B 1IQEA 3UWIA 1WCZA 2V6NA 1XUKA 1QBNA 4YOGA 3A83A 1BB0B 1V2VT 4I8LA 3M5NA 2BVXH 1NM6A 2QC2A 3M3VA 3MU0A 1P57B 3P8OA 4X1NU 2JDID 1SLVB 3ELAH 3ZVBA 2WPLS 1FI8A 3NPSA 4AORA 1CHGA 1Q3XA 1K1MA 1KXAA 4X1RU 2ZPRA 1NRQH 1MAYA 1TYNA 1XKAC 1BMFD 1DS2E 4OS5A 3KF2A 1V2NT 1D9IA 3ZZ9A 1V2ST 5B6OA 1C2HA 1V2PT 3C27B 1UMAH 1H8ED 1ZPZA 1CGJE 2RFKC 2GZ8A 1GBBA 1FDPA 5HM9A 2BLQA 4FU7A 4BAKB 3O8RA 4WH6A 3BTME 2C3SA 4J2YB 1GJ5H 4U2WA 2FOMB 3TK9A 1OWJA 3PM3A 1IQMA 2D8WA 1TPPA 1OWKA 6CHAC 3F6UH 1AVXA 2ZI2H 2J95A 4FUJA 3ATIA 4ZHAA 3A82A 1P2KA 1AB9C 2ANYA 3NWUA 5ETXA 4XSKU 3RMLH 5DK1A 5E0GA 5F03A 1ZHMA 3RXMA 3SV6A 2QF5A 1BOQA 2EA3A 3G01A 1QY6A 1K2I1 3SJ8A 3ZV8A 1K1IA 2FO9A 3RMMH 4OM9A 1Z6JH 1RIWB 1RGQA 4NFEA 1ESBA 4AC9A 1KXCA 4X1PU 1YPLH 1O32A 1W7GH 1ELFA 2IOTA 5HYOA 1TGTA 4Y8ZA 1DPOA 1O3IA 1TPSA 2FDAA 2HRVA 4NA8A 1FAXA 4OS2A 5DJ7A 1DDJA 1G9IE 2BZAA 3TNTA 1E35B 2AIPA 1YF4A 3KHVA 3EA9A 4INHA 1TNKA 4DIHH 1SGPE 2VIOA 4BXWA 3VG8A 2PGBB 2AEIH 1GHWH 3A7XA 4HTCH 5TCAA 3PRDA 1IQFA 5FX5A 3SNBA 1TAWA 3W95A 2LELA 2CV3A 3SU3A 1MUEB 3RC4A 2W6JD 4UFFH 2WYGA 1HJ9A 2O8UA 1BMNH 1KXFA 4A7IB 1NRPH 3I78A 3ATKA 2D26C 5AFZH 1O2UA 2WZQA 3GISB 3M61U 5DPAA 5KGOA 1MZAA 3T62A 5A2MH 4Y71A 1Z8JB 2HVXA 2F9UA 5EPNA 4X8TH 1C9TA 3F68H 2ASUB 2BQWB 2FX4A 1O3FA 2ZDNA 2H6MA 3S7KB 2HOBA 1GBHA 1C2IA 1THSH 1Z8RA 4YM9A 1TONA 1DE7H 1GG6C 1QHRB 5I46H 3VXFH 2BD2A 1YKTA 2J34A 5EQRA 4ISNA 3SJKA 1RRKA 1B7XB 1GBJA 5FBEA 1AVGH 1HJAC 3GY8A 1Y8TA 3RXTA 2ZFTA 1KYNA 5IK2D 1JOUB 2NU4E 4Q63A 2A32A 2Z6BD 5GCHG 2OTVA 1JMOH 2VH0A 1ZTJA 5F8TA 3GY3A 4AG2A 2P3FH 1GI9B 1W11U 3GY6A 3NK8A 1T4VH 2KAIB 1C5TA 2ZCKP 2GD4B 1LHGH 1BJUA 1FY1A 5DP3A 4O3UA 1DSTA 3E91A 1O2PA 2Z3DA 5DGJA 1PPZA 1WXRA 2Y5HA 1HAYB 4CHAB 4I8HA 3MWIU 2ZGHA 4UE7H 4ABJA 1NFWA 1O37A 3M35A 1DICA 4NZQA 4MPXA 1TX7A 4JZFH 1TQ7B 2I6QA 1Y3YA 1BITA 1PPCE 3KQBA 1SGRE 2IPHA 2XC0A 3P70B 3PO1C 4I32A 4WXIA 3RLWH 2AMDA 1O2VA 5JPMH 3PMBB 1ANDA 1J16A 4DIIH 1IQGA 1BBRH 1BA8B 5K7RA 1W12U 2P94A 1O2HA 2JIZD 3EGKH 3RDZA 3WY8A 2H9HA 1DWDH 3D62A 3T28A 2XC5A 3DD2H 1O30A 3ZVEA 3P17H 4D8NA 2FLRH 2H2ZA 4UD9H 4XE4A 4Y7BA 2SGDE 3UWJH 1RS0A 3LGYA 1SGEE 4ZH8A 1C4U2 2WPIS 4ABAA 1HYLA 1UVTH 2BLWA 4TY7A 3A85A 3OFND 1CU1A 1THRH 1A3EH 1QR3E 2FOFA 2PGQB 1H8IH 5AHGH 2BX4A 1AUJA 1BMLA 1XXDA 4I7YH 5G4BA 3LJJA 2VIPA 3NZIA 1IHSH 3UR6A 1NO9H 1O35A 2K0QA 1C5YB 4FXGH 4AX9H 3SW2B 3E3TA 5DP9A 2XC4A 4U01A 3TPIZ 1N8OB 3HK3B 1GL1A 1EOLA 3SHCH 1S83A 4IN2A 4Q80A 1INCA 1C9PA 1KXEA 2H9EH 1LPKB 3P92A 4CRDA 2EI8A 4FUCA 1LHCH 1BTPA 1EP5A 5T6DA 5A0AE 1EPTB 3OTPA 5HGGA 2R3UA 2BY6X 1AZZA 1FY4A 3RXUA 3OX7U 4WMEA 1V2MT 2BY7X 3PWBA 1MH0A 1S81A 1TIOA 1FZZA 4AFQA 1ZJDA 8KME2 1OX1A 1U6QA 2XTTB 1F5LA 5GCHF 4B74A 1NROH 3A89A 3GCTG 4UFDH 3RXHA 1W13U 1HCGA 4H6SB 3URCA 4B2CA 4D7FA 2B5TB 1PQAA 2ZFRH 1G2LA 1EZSC 2Y5FA 2PHBA 3W94A 5EW2H 1QIXB 2B8OH 2HPQH 2F91A 1O5DH 3KIDU 4YLUA 1C1SA 2C8WB 2BDIA 4F49A 2BD7A 2WPKS 2CK3D 2OBQA 3TGIE 1TPOA 1WOFA 3A87A 5ESBA 3RXSA 2HNTE 2KCYA 1A2CH 4CBOA 5DN6D 2P8OB 4K1SA 1HXEH 2HLDD 4Y11E 1E38B 1OYTH 4KTCA 1ANCA 1DY8A 1NFYA 4DG4A 2VU8E 3FANA 3GDUA 5C0UA 4NGAH 2ZDKA 4LXBH 1AY6H 1IAUA 1O3BA 1QL8A 5A8YA 3PV4A 3M7UA 4FUFA 2CHAC 2PW8H 1DUAA 1LPGB 3M5OA 3SV7A 2FS8A 1YLDA 1JRSA 2G4UA 1ZOMA 2CGAA 1TA6A 3A7TA 2FMJA 2OLGA 1O2MA 1OS8A 2A5AA 3RXPA 2XNDD 1SMFE 3BTQE 3GYMA 3R3GB 3RXEA 2J38A 2XWBI 3GY2A 3UNSA 2AMPA 4YESB 3QO6A 4X6OA 2UWOA 4BAMB 2VIDA 2A1DB 4JMYA 1T4UH 4AFUA 3MU4A 1TQ0B 2A7JA 4LZ1H 1XVMA 1O2OA 1ZGVA 5EU8A 5FL7D 1NS3A 1O5GH 1NU7B 2ZU2A 4GPGA 3TNSA 3F1SB 3H7OA 4TWWA 1A3BH 1K1LA 4F55A 3SNDA 3FZDA 2IJD1 2SFAA 4B6FA 2C8XB 3LGTA 1EB2A 1VZQH 2GCTC 1S0QA 2NU3E 1N6YA 1YCPM 2BLOA 1QQUA 2QF4A 4JK5A 5H4IB 1QZ8A 2KCAA 5E0HA 1EXFA 1MKWK 2UUYA 3K65B 4KKDA 1UTNA 2EI6A 4WMFA 3P95A 3BG4B 2OCVB 2ZFPH 3U98H 3W1EA 3ZZ8A 1RTKA 1Z1IA 3KQDA 2OUAA 1WV7H 1NY22 1UCYK 5EJZA 1ELCA 2PSXA 3FKSD 5C1YA 1D3DB 1ESTA 2W3KA 1TBQH 3GCTF 2ZIQH 3VB6A 2W7SA 2ZPSA 4FVDA 1VJAU 2GMTC 2RCEA 3UQVA 2ZDLA 3PWCA 1HXFH 1MTVA 3E16B 2TPIZ 3SU6A 2TGPZ 4ABEA 5GPIB 2V7QD 1ZGIA 2ZU4A 1UVSH 2ODYB 1UVOA 4U30A 1QRWA 3RXQA 3V13A 1O5BB 1TLDA 1BCUH 4DJZB 1QFKH 3ITIA 2CMYA 4TY6A 3A8CA 4X2YA 2AFQB 1T31A 2BDAA 3MNSA 4X1SU 3M5LA 2PUXB 1FONA 1GJCB 1CBWB 4WMDA 1E1QD 2KM0A 3A81A 1F0UA 5C20A 1GI4A 1Y3UA 5F6MA 1PJPA 3FP6E 3GS9A 1W3CA 3UB0A 1ORFA 1RTFB 4A1TA 2AGIX 3QX5H 1C2GA 2Y81A 1CA0B 2RA0A 1E37B 2ZGJA 3MO6A 1BT7A 4Y6DA 1O3AA 1JBUH 1P04A 1K0HA 4LOYH 1GI0A 1B0EA 1F5RA 3PLBA 4GCHG 4B1TA 2KX4A 4X8SH 2ZHWH 3AAVA 4LZ4B 4BNRA 5C94A 1K22H 5GJ4B 4D76A 1TB6H 3EA8A 3NCLA 4NIWA 4CBNA 4MLFB 1K1JA 2K1QA 2OXSA 4ABIA 2FTLE 2XWAA 3A80A 1EAIA 2VWOA 3F9EA 2BDGA 5C5OA 2ILNA 2FM2A 3RMNH 1RJXB 2ULLA 3KQ5A 4TWYA 1GCDA 1CGHA 1O5EH 1P2MA 2G52A 3RXJA 3SV2H 4B76A 5DG6A 1OKXA 1PPFE 4XBDA 1O5FH 1MTNB 5JDUB 3ZVFA 3UY9A 2QIQA 2TGTA 3L33A 4BANB 3JZ1B 4ABHA 1KTTB 4D7GA 1TFXA 1SOTA 1O0DH 3FAOA 1BQYA 3OE7D 1HIAA 2J4IA 1H4WA 2C8YB 2SNWA 2ZCHP 3ATLA 2YMSC 2R0LA 2VGCC 1O3NA 1JIMA 2TIOA 3M3TA 3NRLA 2YMSD 3SJ9A 3UNQA 3BTGE 1K1NA 2F43B 5T1VA 2O9QA 5HXFA 1BHXF 1C2DA 1TWXB 4HG6A 4ISOA 3ZZDA 2F3CE 2BQ6B 3PV2A 3QK1A 1ABJH 1TALA 4K8YA 2QXJA 5T3HA 1SL3A 1EJNA 1VITG 1O2YA 1BTYA 4Y10E 4FU9A 2BHGA 3TJOA 4YTAA 1ZMJA 1KMHB 1P12E 1MQ6A 1GI6A 2BVSH 2JETC 2A4QA 1TA2A 3ZYDA 2WHXA 1BTZA 4ABBA 4ZHLU 4VGCB 2CN0H 3U28C 1SGFA 3AAUA 2XYAA 2A7CA 5FPSA 3WWBA 3SU1A 1NT1A 1NBMD 2FESH 4A1XA 1ABIH 3RMOH 4HGCA 2ZDVH 1SG8B 2VVVA 3RXAA 3RXIA 1G3DA 1T8LA 2XW9A 1GMDG 2VJ1A 1AKSB 3E8LA 2Q6GA 1FN8A 4RI0A 5GIBA 5EOKA 2BDHA 4WY3A 3B8JA 4DGJA 3VGCC 1QURH 3DSPA 1TRMA 5CE1A 4MQAA 1GJ4H 2B7DH 3WWFA 4I86A 4K1EA 3KEEA 1G32B 2DUCA 1GBAA 1O3LA 1J9CH 5EJ1A 1Y59T 2ZEBA 2V35A 2WPHS 3QLPH 1BJVA 3A8BA 3PMJA 1W8BH 3T2NA 1VGCB 1CT0E 1FX0B 2OD3B 3AK5A 3ZVGA 4LK4A 4MDSA 2IN2A 1KDQA 1NPMA 2FOCA 2R3YA 4GCHF 8ESTE 2JH0D 1ZTLA 9ESTA 4X2XA 3MFJA 2QE7D 4M7GA 1GI2A 3SGAE 4P02A 1CQQA 3PROA 4M9FA 2ZTXA 1ANBA 6LPRA 1EB1H 1GL0E 4K3JA 1H1BA 3GDVA 1V2UT 3GCNA 5CHAB 3D23A 1OP8A 1VR1H 1QB6A 3RXOA 1AUTC 3MI4A 1HV7A 3Q76A 3E90B 1FAKH 1RFNA 7GCHF 4KGAA 3EAJA 4JYVH 3SBKA 5EQQA 1J8AA 5FXLA 3S0NA 1XVOA 3A8DA 2ZGBH 1C5OH 1Z1JA 3BTDE 4CREA 3KQEA 4DY7B 1HAPH 4FUBA 4ZHMU 1AHTH 1DM4B 5C3NA 5HKKD 2WV9A 2ZA5A 4MNXA 1T8NA 2VIVA 3V7TA 2BVRH 4I8KA 2FYQA 1G30B 1GI1A 3ATWA 1BBRE 4DOQA 3FN8A 5J4SA 1VITF 3PTNA 3BIUH 4CH8B 4YOJA 4X1QU 2GKVE 1HAVB 1AFQB 1HPGA 3KNXA 5DP4A 3ZVDA 1GCTB 5FPTA 2PKAA 4A5TS 4X2VA 2BOKA 1TGNA 1IQJA 5EJLA 1FY5A 1P02A 4ZMAH 1XUFA 2ZZUH 1LTOA 3DFJA 4BAQB 2Z9LA 1DY9A 1E0FD 1Z8GA 5C5NA 3UQOA 5CMXH 5E2PA 1C1WH 4ISLA 3SUGA 4Y0ZE 4B6EA 4KTSA 1GMDF 1TPAE 1C2LA 4ZKRU 3R0FA 1EKBB 2J2UA 2P3UB 4YOIA 1UHBA 1ZYOA 1FIZA 1OP0A 1SQOA 2O8WA 1LVMA 1WBGB 2PTNA 2QXIA 2WPMS 4ISIH 3KQCA 3V0XA 1GDQA 2ZDAH 2ANMH 3MOCA 2ZNKH 2Q1JA 1AGJA 1ZRBA 3ZYEA 5JYIA 1C2KA 2VWLA 1HAIH 1BIOA 1H9HE 1LQEA 1ZMLA 1TNIA 2YOLA 4UEHH 1W10U 2UUJB 1ID5H 1F7ZA 1CVWH 2J98A 1C1OA 4BAOB 1O33A 3MH7A 1NZQH 1Z6EA 3HKJB 2ZU5A 3ODDA 3LC5A 3SNAA 2VVCA 1EQ9A 2PKSB 1L4ZA 2A4GA 1C2FA 1OWEA 1TNGA 4NSYA 4XBCA 1GHVH 3QTOH 5HIYA 5JBBS 1BRCE 1MTUA 1N1LA 5AF9H 2JH6D 1TNLA 2KZ4A 3BEFB 4RSPA 1SGQE 4K5ZA 1W0KD 2Y82A 2H1UA 2OQ5A 1TNHA 2GZ7A 3F3BA 5JB9S 2STBE 5TJXA 1MBQA 1C5ZB 2ANKH 3A84A 3U8TH 1WQVH 2VINA 4RKOB 4ZUHA 2ZTZA 3IWMA 1WTHD 3UREA 1C5QA 5C2ZA 1A46H 3TH3H 3RXGA 1YLNA 3UIRA 3K6YA 1P09A 4NIYA 3RXBA 4MNVA 2R2MB 3BV9B 3P6ZB 1PFXC 1TMUH 1O3JA 3F0PA 5DP6A 3VB7A 3ENSB 1D6RA 3LGVA 1DSUA 1M9UA 1DXWA 3BTWE 1XUIA 1YGCH 1S5SA 1QA0A 2OINA 1AVWA 1TMTH 5A0BA 5EPYA 5DP7A 1AIXH 1BRAA 1L1NA 2Y7XA 2BYAX 1F0SA 1MCVA 1O3KA 2Y7ZA 4OS6A 2EC9H 1L0ZA 3OEHD 1OYQA 3PMHB 1QA7A 3SN8A 4FVBA 1O2IA 1UTLM 3ZZBA 1O2XA 1HAHH 3SI3H 1GVZA 2GCHG 3LPRA 1TABE 1O2ZA 1GI3A 3PLKA 4YZUA 3SU5A 5IDKA 1PQ7A 1S0RA 1OSSA 3QUMP 1RTLA 1KLIH 3RXVA 2AIQA 2GJGA 4IS5A 1K9OE 5BRRE 3NXPA 1HBTH 4K1TA 1L2EA 3QN7A 1P9UA 4AGJA 2A7HA 3TIUA 4O97A 1K1OA 1MAXA 3SZEA 3PV5A 4A1VA 3DHKH 1HNEE 1KIGH 1JRTA 2UWPA 1S85A 2OK5A 4JCNA 3KL6A 3Q3KA 8GCHG 2XBVA 5FHTA 2EY4C 1IOEA 1GBEA 2CXVA 2QF3A 4ZAEA 4AGKA 1VCPA 3MYWA 3PYHA 1ZSKA 1YWUA 5GWZA 1GBCA 1VJ9U 5L6NH 2ZU1A 1UK2A 2TBSA 4K69A 1NFXA 1WYKA 1C1QA 5F53A 2QF0A 3VB4A 4AFSA 2P59A 1SOZA 1MQ5A 3EQ0H 1HGTH 1EJMA 1LVBA 3E1XB 4O03A 3TK6A 3MU8A 2WYJA 1QB9A 1TGSZ 1KXDA 2Z9JA 1ARCA 1O31A 1LQDB 1DT2A 4ZKOU 1DWCH 4BTIB 1VKYA 5T6FA 2GTBA 4UDWH 4NSVA 1T8MA 2FZZA 1L1GA 1EAWA 2FLBH 2G81E 4AN7A 3SHAH 1KTSB 1EATA 3TK5A 3GYLB 3ZVAA 1HB0B 1QQ4A 3BF6H 3ATMA 4J1YA 1ZRKA 1XXFA 1FIWA 1GGDB 5C67A 1H8DH 2FS9A 2Z9GA 4DCDA 1RIWC 1X7AC 1SKYE 1WDIA 3A7ZA 5EXMA 1QTFA 3LJOA 2QXHA 4OS7A 4QT8C 4JK6A 2WUCA 1P2OA 1AZ8A 1CE5A 3P8GA 1ZSJA 3GCHB 3SOSA 1V2JT 3GDSA 3UUZA 3LU9B 2G55A 1FQ3A 1OXGA 4ZROA 4RKJB 2VBCA 2J9NA 1BZXE 1O38A 1LKBA 2IJOB 4OGXA 1L4DA 4Z0KA 1OP2A 3MNXA 1XMNB 1A5GH 3STIA 3D65E 1BRUP 1GDUA 1C4V2 1KLJH 1ZLRA 2FYRA 5B6LA 1DX5M 2OBOA 1O2SA 2OQUA 2WPDD 2GCHF 2LNCA 3RXDA 2ZQ2A 3E0NB 3K2UA 3TJVA 2FOGA 1O3GA 2OC8A 4X6PA 4XOJA 2ANWA 3F2HA 2HWLB 2PR3A 1PQ5A 3BG8A 1A0JA 3OY6U 4ZKNU 2AH4X 1KY9A 1NRNH 4B2AA 4NWLA 1V2WT 5CDFE 1C4Y2 4X8UH 2HPPH 1P01A 2FOBA 5E8EH 1N6XA 2FX6A 6GCHG 1OWDA 2W6ID 3SORA 8GCHF 3KCGH 5DKMA 1L1JA 1O2JA 5E0JA 1CHOG 6ESTA 4TPIZ 2TGAA 4ZXXH 1SQRA 2NU1E 2PSYA 4K8BA 2PFEA 2UWLA 2ZGCA 1KSNA 2DE9A 3DT0H 9LPRA 1ZTKA 5FCRA 3SU4A 2SGFE 3DUXH 3AASA 4Q7ZA 2PV9B 2F9VA 3VB5A 4AB9A 1C2MA 3OAAD 2F9NA 2HALA 3ZZ5A 4CHAC 1XUHA 4BTUB 1LHFH 1QGFA 1H8HD 3SUDA 1JXPA 3FZZA 2PUQH 1NC6A 4X6MA 4OGYA 1BTWA 5HMAA 1A0LA 4KP0A 2P3TB 1AD8H 3LIWA 2ZHFH 1GI5A 1EAUA 3LOXA 1ELBA 4NA9H 4CRAA 5K0HA 2GP9B 1HAZB 3CS0A 2NU2E 2BLVA 1XUGA 1QRZA 3SUEA 1RXPA 4Q7XA 4OS4A 1YPKH 2BD9A 3I29A 2PKAB 8LPRA 1TGCA 1C1NA 5JBTA 4Y0YE 1SB1H 2AHME 2V3HH 1CGIE 4FUGA 2VNTA 4GVUA 3AW1A 1AI8H 3GCOA 1WU1A 2BXTH 3F2GA 1EP6A 3B9FH 1O2GH 4X8VH 4DT4A 6CHAB 4NA7A 1A4WH 4I31A 4CRCA 1B0FA 2P93A 1K21H 1YPHC 1AB9B 1WUNH 1GVKB 1GHBF 3H7TA 3MO9A 5EW1H 1V2TT 1UHBB 2THFB 4D9QA 3SNEA 1DANH 2QV1A 4XRNA 5AFYH 3SZNA 1J15A 4TSFD 1OOKB 3RU4D 3PRBA 1GHXH 4U32A 2Q6DA 1N8OC 2GV6A 2WUBA 3T27A 2R2WU 3A8AA 3N99A 1ELGA 1ZSLA 4X6NA 3SGQE 4MNYA 1LVYA 1W7XH 2J98B 1MZDA 1P9SA 3UAIC 1UTOA 2SNVA 1DLKB 1GBTA 1EPTC 7GCHG 1Z7KA 4ABDA 6GCHF 1UO6A 2XXLA 2O8TA 2M2AA 4XDEA 1G2MA 3RC5A 1GPZA 3VFEA 1CHOF 1V2QT 2FP7B 4KTUA 3SU2A 3TVJB 3LH1A 1G37A 1HRTH 5F8ZA 1GDNA 3SYJA 1XKBC 2J97A 1QJ1B 1LHEH 1D4PB 3VEQB 1GMCG 1A61H 5A09A 5JBCS 1C5RA 1DWBH 2A5KA 3E0PB 1DWEH 1O36A 1FY8E 5A8ZA 1D6WA 3F2FA 5C1XA 3SV8A 3KGPA 3U9AH 4CRFA 1MBMA 3NKKA 5EXNA 3U1JB 1V3XA 4UFEH 2ZO3H 3JZ2B 2VH6A 2TRMA 1NTPA 3LT3A 4ACAA 3MH4A 2P8OC 2WINI 1A7SA 1YYY1 3CNRA 1DOJA 1SLXB 1K1PA 1GG6B 4FUIA 4NWKA 2HNTF 3IG6B 3ZV9A 3RM0H 1ETRH 1ETTH 1HJAB 4GUXA 3UNRA 2QAAA 1BMAA 1EPTA 1BDAA 4NIVA 1YM0A 2GX4A 1GHZA 4KELA 3F9HA 3LKWA 3ZZCA 4WXVA 5E2OA 3HK6B 3F9FA 1HFDA 1O3HA 4IC6A 4RN6A 4SGAE 2ODPA 4R8TB 1G3BA 2BD5A 3K9XB 4AOQA 1ARBA 1S82A 2FOHA 3MMGA 1FLEE 3CENA 2FI3E 1DFPA 1AE5A 3M3SA 3QDZB 2QYIA 3RP2A 2BQ7B 2LP6A 1V2OT 3TJUA 3RUOA 1LCYA 2GZ9A 1O34A 3UTUH 3PLPA 2XBXA 1NESE 1UTPA 4Y76A 1HAXB 1Q31A 1YPMH 3UR9A 1H9IE 1OPHB 1AE8H 1VCWA 3RM2H 1UW7A 2PTCE 5EIYA 5TCCA 3PO1B 1PPGE 2A0QB 2BB4A 4UFGH 4XBBA 3D49H 2AS9A 2ZG0H 2QGRA 1GJ9B 2FOAA 1NRSH 3N7OA 2EQNA 4FUDA 1GHAG 1TOCB 1OWHA 1O5AB 3VPKA 1GVLA 3HKIB 1QJ6B 4WWYA 5L30H 2BDCA 2ESTE 3S7HB 2BM2A 2BDBA 1UCYE 3SGBE 2A45B 4JZDH 1WTGH 4SGBE 1DVAH 4TPYA 3BG4C 3GICB 2G5NA 4I33A 3BTTE 1C5PA 1BMMH 3RLYH 1C1PA 1S84A 4Y8YA 1GJDB 1SFQB 3UOPA 2FEQH 2BZ6H 1GHYH 4A92A 2BD3A 2F9OA 3OYPA 1GMCF 2B0FA 4WF8A 4B71A 1TRYA 3O8CA 4E7RG 1AFEH 5C17A 4FETA 1O3PB 4MTBA 3BTHE 2ALVA 1YLCA 3LGIA 2A4RA 1C5XB 1O3CA 2GV7A 3A7VA 1MABB 2J92A 1UK3A 2Y6TA 3Q77A 2QXGA 2AGEX 2XBYA 1GMHG 5EXLA 2BX3A 1CBWC 1D3TB 2VWMA 2AGGX 3TU7H 1BUIA 4ZXYH 1G3EA 3BTKE 2STAE 1QB1A 1LO6A 4IMZA 1MD8A 2KFWA 3MU5A 1CA0C 3TGJE 2VB0A 2D2DA 1NBME 2IPQX 2UUFB 4F4OC 2ZHQH 2ZKSA 3FO8D 3EE7A 2M5TA 3L3TA 1EX3A 2BOHB 2ZWLH 4BAHB 4IW4E 1TNJA 1P10A 1Y5BT 1TBZH 2ZHEH 3SUFA 2FTMA 2AYWA 4MPVA 4NZLA 2DE8A 3MNBA 3RXKA 4ZCNA 2Z9KA 1PPEE 2QN5T 1FY3A 2KCOA 3BTFE 5T6GA 3LGWA 4NIXA 1S6HA 1MKXK 1HUTH 4HI3A 1C5SA 4Q4LA 1ACBE 4AYYB 1W0JD 4CR9A 3V12A 4H6TA 4HFPB 1WAYB 3E6PH 5FAHA 1DUEA 1AN1E 1MTNC 1OHHD
chains in the Genus database with same CATH topology
1SBWA 1CT4E 3ZZAA 3PTBA 1IQHA 2ZCLP 1SGFG 1ZR0A 3U1IB 1JWTA 1ZHRA 3A86A 1ELAA 1ETSH 1O2KA 1P0SH 3H5CB 1MTWA 2CHAB 4ISHH 1GHAF 4GHQA 1TMBH 3SI4H 2ZQ1A 2OC0A 1MKWH 2XCFA 4X0WU 1SFIA 2ODQA 1P3EA 1THPB 3QWCH 1ZZZA 5JBAS 4AFZA 4THNH 4DVAU 3OTJE 5DP8A 1C5MD 1UCYH 5DP5A 2ZFFH 1FUJA 1EZQA 2WV4A 1DLEA 1GWAA 1C5WB 1SGIB 1GJBB 4DURA 1XM1A 2BMGB 2Z3EA 4GAWA 4Q7YA 2AMQA 3UPEA 1SGNE 1SQAA 2OP9A 2RDLA 3QGNB 3UOUA 3BSQA 3GY4A 1RD3B 4VGCC 3AW0A 1TRNA 2VVUA 5LH8A 2RA3A 1HAOH 3ESTA 1ZMNA 4O3TA 1O2TA 1YCPK 2GCTB 1SHYA 2P95A 4FUEA 7LPRA 3SQEE 2GT7A 3RU4T 2R9PA 1A5IA 3ZZ7A 3QTVH 1J17T 1V2KT 1GMHF 2A31A 5EQSA 1O2RA 3MNCA 5FX6A 3SJOA 1P3CA 4Q2KA 2HNTC 2SGQE 3I77A 4H42U 2JKHA 1FPHH 1UVUH 4TYDA 1ZHPA 3FFGA 2W3IA 5AVDA 1DITH 1FXYA 3BEUA 5J4QA 1VGCC 2G8TA 1SGYE 2SGPE 1F2SE 1ESAA 2GMTB 3CP7A 3OU0A 2G00A 2VWNA 2G5VA 2HLCA 1FN6A 2XCNA 3BN9A 4JYTA 3UFAA 1V2RT 1E34B 1O2LA 3P8NA 4MPUA 3M7TA 2ZHDA 3MTYA 4MG3A 4HZHA 4IN1A 4B2BA 2YNBA 4YO9A 3SU0A 3HPTB 5CHAC 2GT8A 7ESTE 1O2WA 1P2NA 1GJ7B 3AVZA 3SJIA 2ZC9H 1AKSA 2ZFQH 2F9PA 3TJNA 1HDTH 1CT2E 2GDDA 1FNIA 3GOVB 3V3MA 3NUMA 1HIAB 2FODA 1P11E 1LKAA 1AU8A 2A2QH 2GGVB 1Z8IB 4Z6AH 3ZVCA 2I6SA 2CF9H 2CF8H 2W7UA 3S9CA 3RXLA 3EA7A 5EGMA 1C5UA 1GBMA 1BRBE 2B9LA 1P05A 4CR5A 3M36A 1OWIA 1QBOA 2Z9IA 3M5MA 1B5GH 1HLTH 5GXPA 1A5HA 1G36A 5I25A 4NFFA 1J14A 2C4FH 1EJAA 1F5KU 2FI5E 3TGKE 1YPJH 1ELDE 5A0CA 2BTCE 3EYDA 3DFLA 2ALPA 1G3CA 2EEKA 1GI7B 1QRXA 4XFQA 3QZQA 5JB8S 1WQSA 4FUHA 1AFQC 4AYVB 4O9VA 2FI4E 4D9RA 1GCTC 2XRCA 1YC0A 2NWNA 2ZTYA 1T7CA 1UTQA 1YP9A 1LHDH 3MU1A 1FV9A 3B23B 1C1MA 1UVPA 2QCYA 1F0TA 2BY8X 5LPEA 1QBVH 1TX6A 1TX8A 1ZJKA 2VGCB 3FP7E 5LPFA 1T8OA 1GJ6A 3Q00A 7KMEH 2AERH 3OY5U 1P8VC 1BTXA 3L6PA 4E05H 1GHBG 2FIRH 1GJ8B 4YLQH 3A7WA 3C1KA 1QL9A 2Y80A 4I8GA 2RG3A 2P16A 4Y7AA 1P06A 5LGOA 1O39A 4JZEH 2ZECA 1T32A 2CJIA 2A5IA 3T29A 1F0RA 1NFUA 2ZFSA 1Y3VA 3GY7A 3LONA 1Q2WA 1KDQB 3F9GA 4FU8A 1HAVA 2J94A 4B73A 1C2EA 2JETB 3DA9B 1XX9A 1IQKA 2WPJS 1S6FA 1BTUA 1UTKA 4INLA 1YBWA 1AWHB 1O3MA 3TITA 2BXUH 4H4FA 2O8MA 5FPYA 5C1UA 1AQ7A 2F83A 1GBDA 1AMHA 4JZIA 2UUKB 4DW2U 1H9LB 2PKSC 1SVPA 4R0IA 1GJAB 2WV5A 2QA9E 1JIRA 2OC7A 4X2WA 1F92A 1LDTT 3MHWU 4Y79A 4ABGA 1NN6A 1EUFA 3TLOA 1WSSH 2O8LA 1W0YH 1C1VH 1C2JA 2VIQA 4IC5A 1GBKA 3VGCB 1FJSA 1MU8B 3P8FA 1SLUB 2BDYA 2Z94A 1A0HB 1ELVA 1SPJA 3URDA 3OSYA 1SGDE 1ANEA 5FBIA 2C93B 1GBFA 2HGTH 1SGCA 2ZP0H 1SGTA 2C8ZB 3GY5A 5HM2A 3FP8E 1ZPCA 2PLXA 1HJ8A 3ODFA 1C5LH 1GI8B 2VIWA 3EDXB 4CRBA 5A8XA 1V6DA 1EOJA 2QY0B 3TH4H 4K2YA 1P2QA 3HGPA 3BIVH 1GBLA 2F9BH 3VB3A 3ZZ6A 4MNWA 4E7NA 1QNJA 1TBRH 2SGAA 4MPWA 2H9TH 1FPCH 3PMAB 4INKA 5PTPA 2H5CA 1NU9A 1TE0A 3ZZ3A 2ZPQA 1KLTA 5EG4A 1LMWB 1GBIA 1C5VA 2KAIA 4ASHA 5GDSH 3ZZ4A 1FMGA 4NCYA 3IITA 1P2JA 2BY5X 1ELTA 4BTTB 2FOEA 3BEIB 2SGEE 2FPZA 1NRRH 1QL7A 1O3DA 4ZKSU 1LVOA 1C1UH 1LPZB 2Z3CA 1EZUC 3U8RH 1MKXH 1VCQA 1IHTH 1IQIA 1W2KH 2FWWA 2ZGXH 1E36B 4I8JA 1SHHB 1SLWB 4A6LA 3A88A 1SQTA 5F8XA 1O5CB 2BD4A 1SC8U 3T25A 1DXPA 3HGNA 2V0BA 4YT7H 3LDXH 1XUJA 1MMJN 3T5FH 1UTJA 1CSOE 1K28D 1BBRK 3KN2A 1PQ8A 3DD2H 4WVPE 1SI5H 4Y8XA 3RC6A 3VXEH 4CRGA 2A4OA 5ABWA 3SV9A 1PPHE 1A1RA 2Z7FE 2GDEH 1QCPA 2XBWA 3T26A 3LGUA 1Y3WA 1UK4A 4BXSA 1ZPBA 4AZ2B 1EAXA 2OC1A 3BTEE 2Q6FA 4GLYA 2G4TA 2W5EA 5FCKA 2YNAA 1P03A 2LPRA 3S9BA 3SNCA 5DO4H 1MTSA 3U8OH 2BD8A 1GGDC 3SO3A 3MH6A 1D3QB 1BTHH 1TOMH 1O3EA 3MH5A 4IMQA 4IBLH 3M37A 1C1RA 4CH2B 3HATH 2EI7A 4UONA 5LPRA 1AO5A 1SR5C 1Z71A 3O8DA 3RXFA 1KXBA 5IYTA 3EE0B 1Y5AT 1MCTA 1W0ZU 5BPEA 3RXCA 3FVFB 3M7QA 1YCPH 3U69H 3GCHC 4NG9H 2PWXA 1Y5UT 3LC3A 1SSXA 1C1TA 1MD7A 4DT7B 1YPGH 1O2NA 1IQLA 2ZDMA 2V3OH 1V2LT 4PROA 1IQNA 3Q3YA 1P2IA 4GHTA 4JYUH 4WJG2 3S9AA 1EZXC 4B75A 4JZ1A 1D3PB 4WH8A 1QJ7B 1MU6B 3RXRA 4GSOA 1PYTC 3O8BA 2R0KA 2H5DA 4IGDA 1PYTD 2BY9X 1O3OA 2FXRA 3K6ZA 2Y5GA 4E06H 3S69A 5ESTE 3SQHE 1C5NH 4MVNA 3PB1E 3STJA 3MO3A 3QGJA 3LH3A 1AWFH 1UJ1A 1CO7E 4AB8A 2NU0E 4ESTE 5SGAE 4BOHA 3CS7A 5EODA 1YPHE 1HAGE 1Y3XA 5L2YH 3A7YA 5L2ZH 2ZF0H 2XNIA 2ZU3A 2D1JA 2GVFA 1BHXB 1ELEE 1TGBA 3RU4E 1O2QA 1CA8B 1W14U 4K60A 4OS1A 3TH2H 1VITH 4AG1A 4YT6H 2JH5D 2A2XH 1YPEH 4ABFA 1UTMA 3Q3XA 1PPBH 3QZRA 1EASA 2W26A 2G51A 2TGDA 2C90B 1IQEA 3UWIA 1WCZA 2V6NA 1XUKA 1QBNA 4YOGA 3A83A 1BB0B 1V2VT 4I8LA 3M5NA 2BVXH 1NM6A 2QC2A 3M3VA 3MU0A 1P57B 3P8OA 4X1NU 1SLVB 3ELAH 3ZVBA 2WPLS 1FI8A 3NPSA 4AORA 1CHGA 1Q3XA 1K1MA 1KXAA 4X1RU 2ZPRA 1NRQH 1MAYA 1TYNA 1XKAC 1DS2E 4OS5A 3KF2A 1V2NT 1D9IA 3ZZ9A 1V2ST 5B6OA 1C2HA 1V2PT 3C27B 1UMAH 1ZPZA 1CGJE 2GZ8A 1GBBA 1FDPA 5HM9A 2BLQA 4FU7A 4BAKB 3O8RA 4WH6A 3BTME 2C3SA 4J2YB 1GJ5H 4U2WA 2FOMB 3TK9A 1OWJA 3PM3A 1IQMA 2D8WA 1TPPA 1OWKA 6CHAC 3F6UH 1AVXA 2ZI2H 2J95A 4FUJA 3ATIA 4ZHAA 3A82A 1P2KA 1AB9C 2ANYA 3NWUA 5ETXA 4XSKU 3RMLH 5DK1A 5E0GA 5F03A 1ZHMA 3RXMA 3SV6A 1BOQA 2EA3A 3G01A 1QY6A 1K2I1 3SJ8A 3ZV8A 1K1IA 2FO9A 3RMMH 1Z6JH 1RIWB 1RGQA 4NFEA 1ESBA 1KXCA 4X1PU 1YPLH 1O32A 1W7GH 1ELFA 2IOTA 5HYOA 1TGTA 4Y8ZA 1DPOA 1O3IA 1TPSA 2FDAA 2HRVA 4NA8A 1FAXA 4OS2A 5DJ7A 1DDJA 1G9IE 2BZAA 3TNTA 1E35B 2AIPA 1YF4A 3KHVA 3EA9A 4INHA 1TNKA 4DIHH 1SGPE 2VIOA 4BXWA 2PGBB 2AEIH 1GHWH 3A7XA 4HTCH 5TCAA 5FX5A 1IQFA 3SNBA 1TAWA 3W95A 2CV3A 3SU3A 1MUEB 3RC4A 4UFFH 2WYGA 1HJ9A 2O8UA 1BMNH 1KXFA 4A7IB 1NRPH 3I78A 3ATKA 2D26C 5AFZH 1O2UA 3M61U 3GISB 5DPAA 1MZAA 3T62A 5A2MH 4Y71A 1Z8JB 2HVXA 2F9UA 5EPNA 4X8TH 1C9TA 3F68H 2ASUB 2BQWB 2FX4A 1O3FA 2ZDNA 2H6MA 3S7KB 2HOBA 1GBHA 1C2IA 1THSH 1Z8RA 4YM9A 1TONA 1DE7H 1GG6C 1QHRB 5I46H 3VXFH 2BD2A 1YKTA 2J34A 5EQRA 4ISNA 3SJKA 1RRKA 1B7XB 1GBJA 5FBEA 1AVGH 1HJAC 3GY8A 1Y8TA 3RXTA 2ZFTA 1KYNA 1JOUB 2NU4E 2A32A 2Z6BD 5GCHG 2OTVA 1JMOH 2VH0A 1ZTJA 5F8TA 3GY3A 4AG2A 2P3FH 1GI9B 1W11U 3GY6A 3NK8A 1T4VH 2KAIB 1C5TA 2ZCKP 2GD4B 1LHGH 1BJUA 1FY1A 5DP3A 4O3UA 1DSTA 3E91A 1O2PA 2Z3DA 5DGJA 1PPZA 2Y5HA 1HAYB 4CHAB 4I8HA 3MWIU 2ZGHA 4UE7H 4ABJA 1NFWA 1O37A 3M35A 1DICA 4NZQA 4MPXA 1TX7A 4JZFH 1TQ7B 2I6QA 1Y3YA 1BITA 1PPCE 3KQBA 1SGRE 2IPHA 2XC0A 3P70B 3PO1C 4I32A 4WXIA 3RLWH 2AMDA 1O2VA 5JPMH 3PMBB 1ANDA 1J16A 4DIIH 1IQGA 1BBRH 1BA8B 5K7RA 1W12U 2P94A 1O2HA 3EGKH 3RDZA 3WY8A 2H9HA 1DWDH 3D62A 3T28A 2XC5A 1O30A 3ZVEA 3P17H 4D8NA 2FLRH 2H2ZA 4UD9H 4XE4A 4Y7BA 2SGDE 3UWJH 1RS0A 3LGYA 1SGEE 4ZH8A 1C4U2 2WPIS 4ABAA 1HYLA 1UVTH 2BLWA 4TY7A 3A85A 1CU1A 1THRH 1A3EH 1QR3E 2FOFA 2PGQB 1H8IH 5AHGH 2BX4A 1AUJA 1BMLA 1XXDA 4I7YH 5G4BA 3LJJA 2VIPA 3NZIA 1IHSH 3UR6A 1NO9H 1O35A 1C5YB 4FXGH 4AX9H 3SW2B 3E3TA 5DP9A 2XC4A 4U01A 3TPIZ 1N8OB 3HK3B 1GL1A 1EOLA 3SHCH 1S83A 4IN2A 4Q80A 1INCA 1C9PA 1KXEA 2H9EH 1LPKB 3P92A 4CRDA 2EI8A 4FUCA 1LHCH 1BTPA 1EP5A 5T6DA 5A0AE 1EPTB 5HGGA 2R3UA 2BY6X 1AZZA 1FY4A 3RXUA 3OX7U 4WMEA 1V2MT 2BY7X 3PWBA 1MH0A 1S81A 1TIOA 1FZZA 4AFQA 1ZJDA 8KME2 1OX1A 1U6QA 2XTTB 1F5LA 5GCHF 4B74A 1NROH 3A89A 3GCTG 4UFDH 3RXHA 1W13U 1HCGA 4H6SB 3URCA 4B2CA 4D7FA 2B5TB 1PQAA 2ZFRH 1G2LA 1EZSC 2Y5FA 2PHBA 3W94A 5EW2H 1QIXB 2B8OH 2HPQH 2F91A 1O5DH 3KIDU 4YLUA 1C1SA 2C8WB 2BDIA 4F49A 2BD7A 2WPKS 2OBQA 3TGIE 1TPOA 1WOFA 3A87A 5ESBA 3RXSA 2HNTE 4CBOA 1A2CH 2P8OB 4K1SA 1HXEH 4Y11E 1E38B 1OYTH 4KTCA 1ANCA 1DY8A 1NFYA 4DG4A 2VU8E 3FANA 3GDUA 4NGAH 2ZDKA 4LXBH 1AY6H 1IAUA 1O3BA 1QL8A 5A8YA 3PV4A 3M7UA 4FUFA 2CHAC 2PW8H 1DUAA 1LPGB 3M5OA 3SV7A 2FS8A 1YLDA 1JRSA 2G4UA 1ZOMA 2CGAA 1TA6A 3A7TA 2FMJA 2OLGA 1O2MA 1OS8A 2A5AA 3RXPA 1SMFE 3BTQE 3GYMA 3R3GB 3RXEA 2J38A 2XWBI 3GY2A 3UNSA 2AMPA 4YESB 3QO6A 4X6OA 2UWOA 4BAMB 2VIDA 2A1DB 4JMYA 1T4UH 4AFUA 3MU4A 1TQ0B 2A7JA 4LZ1H 1XVMA 1O2OA 1ZGVA 5EU8A 1NS3A 1O5GH 1NU7B 2ZU2A 4GPGA 3TNSA 3F1SB 3H7OA 4TWWA 1A3BH 1K1LA 3SNDA 3FZDA 2SFAA 2C8XB 3LGTA 1EB2A 1VZQH 2GCTC 1S0QA 2NU3E 1N6YA 1YCPM 2BLOA 1QQUA 4JK5A 5H4IB 5E0HA 1EXFA 1MKWK 2UUYA 3K65B 4KKDA 1UTNA 2EI6A 4WMFA 3P95A 3BG4B 2OCVB 2ZFPH 3U98H 3ZZ8A 1RTKA 1Z1IA 3KQDA 2OUAA 1WV7H 1NY22 1UCYK 1ELCA 2PSXA 5C1YA 1D3DB 1ESTA 2W3KA 1TBQH 3GCTF 2ZIQH 3VB6A 2W7SA 2ZPSA 4FVDA