1QIXB

Porcine pancreatic elastase complexed with human beta-casomorphin-7
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase
molecule keywords BETA-CASOMORPHIN-7
publication title Structure of a Specific Acyl-Enzyme Complex Formed between Beta-Casomorphin-7 and Porcine Pancreatic Elastase
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qixB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qixB01
4X1SU 2J2UA 1O2GH 3MMGA 3W95A 2WYGA 1EX3A 2D8WA 1LVBA 1EB1H 3O8BA 2XWBI 2FO9A 2PTCE 1C5SA 1SOTA 4M7GA 1NT1A 1O5CB 2STAE 1FNIA 3A89A 3PTBA 1LHEH 5GCHF 1GJAB 1KXCA 3LIWA 4CR9A 1AE8H 1UVPA 1C2KA 3RC6A 1A5GH 1DY9A 2H2ZA 2A5IA 4GPGA 1UJ1A 4ZAEA 4PROA 1LQEA 1ZRKA 1P2MA 3QDZB 4YT7H 1A46H 2BZ6H 2VU8E 5BRRE 3PB1E 1GJ7B 1SQTA 1O3EA 4YLQH 2VNTA 2XBXA 2R2MB 1VR1H 2HNTF 3F9EA 3QTOH 3MHWU 2BY7X 2CV3A 4UDWH 1QGFA 1SVPA 3FP6E 5DP8A 1AUTC 3VEQB 2BY9X 4F49A 4K2YA 4X6OA 1SLWB 2NU4E 1TRNA 3D49H 3A7TA 3MNXA 4Y0ZE 1ZTJA 1QBOA 1C1MA 2TRMA 1AKSA 2ZGJA 1C1TA 3NWUA 1S82A 1O2SA 3T29A 7GCHF 1O3KA 4YM9A 4ABGA 2HLCA 1YF4A 4XE4A 4X6PA 1BQYA 4X2WA 1O5BB 1AZZA 1EJNA 3ESTA 3LGTA 3RXVA 3QGNB 1HLTH 2A4OA 4TYDA 1SGIB 1QRZA 3LPRA 3ODFA 3UUZA 1TGTA 1EQ9A 2GDEH 4ZKOU 1UK3A 3SU2A 1K1MA 3BTQE 2VIWA 2O8MA 1BBRK 4ABDA 1GBKA 1SHYA 3ZZ6A 1PPGE 4A5TS 2ZG0H 1HAXB 3SNEA 1ZSKA 1QHRB 3ZZ8A 4D7GA 1DDJA 2PGBB 1F0TA 1VITH 1QB1A 1C2HA 1KDQA 1C4Y2 5JBAS 2G4TA 1S85A 4MNVA 2NU3E 2QA9E 3RMMH 1GL1A 4K8YA 3GYLB 4ABEA 1D3QB 1GGDC 1PYTC 1GBMA 3RXIA 2XCFA 3P95A 2FESH 4ZROA 1GGDB 3KQDA 3BTFE 1DWBH 1G3BA 1O2XA 1HAPH 1C1SA 1WBGB 1ZPBA 1O38A 1RRKA 2BD3A 5CMXH 5JBTA 3PV4A 1O2JA 1TRMA 2J34A 1ETRH 6GCHF 2A5AA 3M3TA 1F0SA 3RXJA 5EQQA 2ZO3H 3SHCH 3SNBA 3L3TA 3WY8A 2RA0A 4SGAE 1N6YA 2SGQE 1A1RA 1TX6A 3TITA 5A2MH 4I33A 4B2CA 1ZOMA 4XBCA 1GMDG 4BOHA 1BBRE 4A1VA 4SGBE 1BMNH 3R3GB 1HBTH 2D2DA 1KY9A 2LPRA 2QN5T 1XVMA 4WJG2 3ZZ4A 2WPIS 2QXGA 5C67A 1LPKB 1BTYA 4X2VA 2TBSA 1QB6A 3TGJE 5LPRA 1ELDE 2ZU1A 1PPZA 4YT6H 1E34B 4B74A 2GT7A 2F9VA 5C1UA 5L6NH 1FIWA 1O2OA 3GCHC 3KQBA 3RXMA 3BG4B 1G2LA 5PTPA 5DP5A 3GCHB 1P06A 3B23B 2C90B 3GY8A 3QTVH 2ZU3A 3SJKA 1PJPA 2H9HA 2VIOA 1CGHA 1TPSA 1M9UA 4H4FA 1N8OC 2THFB 1ZGVA 5GPIB 4MPXA 1ELBA 1Z8JB 4FVDA 1N8OB 2G55A 1NS3A 1YBWA 3KHVA 4HFPB 3VFEA 1VGCC 4B1TA 4I31A 1O3DA 1IQMA 1P2JA 1TBRH 1ETTH 1AD8H 1QBNA 1VGCB 2RCEA 4BAOB 2JKHA 4WWYA 2BVRH 3K6ZA 4X8SH 1ZMLA 2BD9A 4B2AA 4A1XA 3ELAH 4DURA 2EEKA 3GY2A 4E7RG 2FI5E 1CO7E 3H7OA 4BXSA 1GMHG 2Z9GA 4JZIA 1PPEE 4IMQA 1O3OA 3SJ9A 3SNCA 1T32A 1AIXH 3U98H 2VVVA 3I29A 4X8UH 1DLEA 1QRXA 4DW2U 2FIRH 1PQ8A 1MKWK 3BTTE 1JIRA 2G8TA 2WV4A 1YCPH 1A5HA 1XXFA 2SGFE 1DY8A 1AMHA 5A0AE 3A7YA 3P70B 5C1YA 1BB0B 5JYIA 2VH6A 4FUEA 1FAKH 3LDXH 1SQAA 1IQKA 1A0HB 4BTUB 2BLWA 2XXLA 8LPRA 1W11U 3RXDA 1L1JA 4Y7BA 1K1OA 2GDDA 3M3VA 1EB2A 1ZHMA 1MTNC 2EA3A 1FN6A 2WPKS 1ABIH 5E2OA 3UR9A 3SJ8A 2J38A 1O3PB 2JH5D 4TPIZ 2ODQA 2RG3A 3BTHE 3A7VA 1NTPA 2NU1E 3S9BA 4DJZB 1FY4A 2VIPA 1F5KU 1GJCB 3RM2H 3L6PA 4NIXA 3RXTA 3IITA 1C2DA 4NA9H 2AYWA 4ZXXH 3UWIA 1H4WA 2BM2A 1TGCA 1LO6A 1K1NA 4IGDA 1AHTH 1V2LT 3SV8A 5EW2H 2C8XB 1JXPA 2VVCA 4Q7YA 4WVPE 2Y82A 1HAHH 3A8DA 2K1QA 3RUOA 3OY6U 1NY22 4O3TA 1O2UA 1BJUA 1P8VC 4MPUA 4INHA 1AQ7A 2Z3CA 1VITF 1HAZB 2ANKH 2FX6A 3TH3H 1XUHA 2LNCA 4BNRA 3BEFB 3Q3KA 2VWNA 2V3OH 3R0FA 5F8XA 2BYAX 2H1UA 1DANH 4IC5A 4LOYH 5FCRA 2FM2A 1TALA 3SN8A 4NSVA 2D1JA 2BDBA 1FAXA 1ANDA 2TGDA 1WTGH 4BAKB 5A8YA 1Z6EA 3NUMA 3HKIB 4KELA 1FXYA 1FZZA 4WMFA 4BANB 1E38B 3SGBE 1MD7A 4BAQB 2BX3A 1QRWA 3L33A 3PMAB 1QA0A 2W3IA 2BX4A 1PPBH 5C2ZA 2R3YA 3UREA 1FIZA 3SU6A 3RMOH 1O32A 4R0IA 1AB9B 2SFAA 3HATH 1WAYB 2AGGX 1L4DA 1SSXA 3ZVAA 1OWKA 4K69A 4B75A 4X1RU 3TNTA 1GI1A 1FV9A 1V3XA 3KEEA 5E0GA 2WV5A 1QY6A 1EOJA 3NCLA 1G2MA 1TOCB 4KKDA 1F7ZA 1MBMA 3I77A 3MNSA 2WPLS 1JWTA 3ZVEA 1JRTA 4U01A 1W12U 1BBRH 3A87A 3CS7A 3TH2H 3U8TH 2CN0H 5F03A 4DGJA 1IQIA 1H9LB 4OS5A 1P11E 1NFYA 1Y5UT 1A7SA 3A7XA 2XC0A 1RFNA 1ZRBA 1JOUB 1LCYA 4X8VH 1DFPA 3ZZDA 1CVWH 1T8NA 3E8LA 1VZQH 3M37A 1HXFH 1SMFE 4LK4A 2P16A 2UWPA 3S9CA 2OXSA 1C5WB 1LDTT 1RTFB 1KIGH 1NESE 3QLPH 1BA8B 2Y5HA 3LH1A 3RC4A 1P05A 1TAWA 3E6PH 1SPJA 4GUXA 3M3SA 1NZQH 4O9VA 1HAVA 2XBWA 3A85A 3SU0A 1O39A 3V3MA 2Y7XA 3ZV8A 4CR5A 1JIMA 1C9TA 1EAIA 3SJIA 2A1DB 2Z3DA 2HNTC 4NWKA 1QCPA 3F9GA 5F6MA 4NZQA 1BRCE 1GJ9B 1GL0E 3A81A 4U30A 2P94A 2ZDNA 3JZ1B 1EATA 3FZZA 3LU9B 1SGCA 2A31A 1T31A 2CHAC 1G3DA 4OS7A 5L30H 4THNH 1GHXH 5JDUB 1D3PB 2A7HA 2TGAA 2CHAB 1YC0A 4E05H 2BDYA 1XKBC 2BQWB 4YTAA 1C2FA 5BPEA 1C2LA 1CSOE 1BOQA 3NKKA 2PHBA 1A3EH 3UNSA 3DUXH 2W7SA 1DSUA 2ALVA 2NU2E 3BTME 1H8DH 1G36A 1GJ8B 3LGIA 5E2PA 4TWWA 1PQ5A 2ZTYA 2QY0B 3MI4A 3F9HA 3OSYA 4TY6A 2G00A 2TGTA 5AFZH 4DVAU 1OPHB 3EA7A 2ZGHA 1QFKH 3RU4D 1T8MA 2BOHB 1MMJN 2BVXH 4CBNA 1GHBF 3M5MA 2WUBA 2ZIQH 1TNIA 2YNAA 3DFLA 4AX9H 1HYLA 1YPGH 2QC2A 3KQEA 4UONA 3UPEA 3VGCC 1Q3XA 3P17H 3ENSB 4JZ1A 4CRDA 4D76A 1P57B 3SUEA 1W14U 4AB9A 3VGCB 1GI8B 1P3CA 3QZRA 1K2I1 1LPZB 3MO3A 1P3EA 3N7OA 3HGNA 2ODPA 3HK6B 1TNLA 3M7TA 3SO3A 3MH6A 1EASA 4UFEH 1ZHRA 3URCA 1G9IE 2STBE 1BIOA 1IHSH 3EQ0H 1GBTA 1WQVH 5EQSA 3VPKA 1O5GH 2ZGCA 5FX5A 4ESTE 2XC5A 5DG6A 3MU5A 1BCUH 4WMDA 1B0EA 1THRH 3RXHA 3V0XA 1FY8E 5FPSA 4D7FA 3BIUH 4MDSA 1MKWH 1TONA 4NA8A 5DPAA 5A8XA 4IS5A 1E35B 2QCYA 2YNBA 5GXPA 4K1SA 2A4RA 4KGAA 4FUCA 1O2NA 4Y8XA 4WMEA 2A2QH 3PTNA 3EDXB 1YPJH 1OSSA 3DT0H 3PLPA 1ZJKA 4DOQA 4KTCA 4ZMAH 4JMYA 1C5NH 1INCA 1YM0A 1J15A 4AYYB 3TIUA 1KYNA 2AGEX 3HGPA 1XX9A 2QXJA 2VB0A 4U32A 1ANCA 1ARCA 8GCHF 3SGQE 3MO9A 1C5MD 1CHOG 1SQOA 2OD3B 3ATKA 1A0JA 4TWYA 4DT7B 1UTPA 2DE9A 1P2NA 4UFFH 3H7TA 1QBVH 5EQRA 3TLOA 2P93A 2VIDA 4JZEH 2FP7B 4GCHG 1SFIA 4ABAA 2FI3E 2ZFQH 3EGKH 1F5LA 1EOLA 2C93B 5E8EH 1SGPE 1W13U 4FUIA 3PMJA 3VB5A 4I8JA 3A86A 1SFQB 1TPOA 4FU9A 1MTSA 1NU9A 3RXAA 4CRCA 3Q3YA 1W10U 2ZFRH 2OC1A 3BIVH 4A1TA 4BXWA 2UUFB 2UWOA 2ANWA 1TFXA 3MU8A 1OYQA 2ESTE 3RXUA 3U1IB 4AB8A 1P04A 1V2JT 1THPB 3LJOA 3GYMA 2O8UA 2EI6A 3GISB 1LMWB 3SW2B 1W3CA 3B8JA 5FCKA 2GP9B 2FZZA 2ZKSA 4NSYA 3RXEA 3SV6A 1KLJH 1VJ9U 1T8OA 3E16B 2ANYA 3M36A 1C1OA 3UFAA 2JH0D 1AFEH 1EAWA 2A0QB 2F3CE 3P8GA 4DIIH 2GGVB 5F8ZA 3PYHA 2OC8A 1HB0B 2ZPQA 1K22H 3O8RA 1THSH 4X2XA 1UTKA 4OS2A 1H9HE 1MCVA 1F92A 1ZTKA 2FTMA 3FAOA 1S0QA 2GVFA 4XSKU 1HAOH 4KTUA 4GLYA 3VB4A 1KXEA 1MKXK 1XVOA 1GBHA 3TPIZ 1V2TT 1BHXF 1TBZH 3SUDA 3MNCA 2OBQA 2G4UA 3QO6A 1UTLM 1DM4B 1G3EA 1XMNB 5FPTA 2FPZA 3KNXA 3S9AA 4ABBA 1BRUP 1GBJA 5C5OA 1O5EH 1S81A 1BTHH 1GHAF 1GCTB 2CJIA 2ZDMA 3LGVA 1QQUA 4Y10E 1C5OH 2ZDKA 4NGAH 1LTOA 4GVUA 1WUNH 2OC0A 3KN2A 5JB9S 3TK9A 3FP8E 4QT8C 2R3UA 1NN6A 5A0CA 4FUGA 2ZCKP 1GG6B 2ZPSA 9ESTA 3GY3A 4YOJA 3D65E 7LPRA 4XDEA 3FP7E 5FXLA 5AHGH 2ZCHP 4AFZA 2CMYA 2BDAA 1HV7A 1J8AA 1ID5H 1IQEA 4JZDH 5AF9H 4ZXYH 1N1LA 2ZDAH 2B5TB 1NRSH 1ESTA 2YOLA 4CREA 1J16A 3MH4A 2B9LA 3FANA 1TNJA 2A7CA 1K28D 1E36B 1V2PT 1E0FD 3M61U 4XOJA 3BTDE 2Y7ZA 3Q3XA 4Y11E 3P8NA 2VH0A 1O3CA 5EODA 2IN2A 2HPPH 2XC4A 2J95A 5TCCA 1OP8A 1W0YH 1T7CA 2VJ1A 2Z9KA 2OTVA 1DUAA 1H8IH 2W5EA 3S0NA 1FY1A 2ZU5A 2O8TA 4BTIB 2XCNA 1FQ3A 5I25A 5JBCS 2B8OH 4AYVB 1MTUA 1GI7B 4JK5A 1QTFA 2Y80A 5EXMA 3SV9A 3RXQA 3BG4C 1WTHD 1SGFA 3U9AH 1HCGA 1YP9A 3LKWA 1O0DH 1NFUA 1O2TA 3TVJB 2BXTH 1ARBA 4ABFA 2Q6GA 2OCVB 3GY7A 1O31A 2Z9IA 5HM2A 4K8BA 1ZTLA 3LONA 1P09A 1N6XA 1FY3A 3EYDA 1AE5A 1QL7A 1LVMA 2C8YB 1HJAC 3ODDA 1AU8A 1OWHA 1TWXB 3GDUA 5DK1A 1CQQA 1GHWH 2Q6DA 5T6GA 1S0RA 1P2KA 1A4WH 1UTJA 4NCYA 1HJAB 2ZF0H 1O2HA 4RN6A 4ABHA 3RU4T 5HYOA 1RJXB 1UTQA 4Y6DA 1O3BA 2WPJS 1BTUA 1HAVB 4ZKSU 2Q1JA 2TGPZ 3A84A 1XXDA 1CA0C 4ZUHA 2QGRA 4Y71A 2AIQA 3RXOA 1JMOH 2BB4A 2HPQH 2IOTA 1CA8B 1HAIH 1PFXC 2ZHWH 1CA0B 1Z1JA 1J9CH 3UOUA 3ATWA 2ZHDA 1NRNH 4Q7XA 3RMNH 1BZXE 1MQ6A 3SUFA 2G52A 4H42U 2GX4A 3RC5A 6ESTA 4JK6A 2P3TB 2VWLA 2PR3A 1UVSH 1RTKA 4ISNA 2QV1A 3TH4H 1IQHA 1Q2WA 1SG8B 4BAMB 1MQ5A 3DA9B 1GI0A 2A32A 3BN9A 2J92A 2GKVE 2BDGA 1ANEA 1SR5C 2BTCE 2FI4E 2FOAA 1P01A 3QN7A 1UCYK 3E91A 1IOEA 1UHBB 3RXGA 1DVAH 3LGYA 1AN1E 1ZSJA 3SNDA 2Z7FE 3AAUA 3P6ZB 4GHQA 1G37A 2O9QA 5FAHA 1Z8GA 2KAIB 4HGCA 1TMTH 1GVKB 4DG4A 1T4VH 1OWJA 1CGJE 2Z9LA 1GHBG 3ZVCA 2FODA 3RP2A 1DWEH 1Y3WA 1MTVA 1SL3A 1ELTA 1P02A 1UK2A 1QURH 1YCPM 1MCTA 1J17T 3C27B 3M7QA 1TE0A 1BUIA 4I8LA 3NK8A 3SOSA 2Z3EA 5C1XA 2PSXA 2Y5GA 3S69A 3MU1A 1GI5A 1TGSZ 3LOXA 1DPOA 4JYVH 1GWAA 3QZQA 1C1VH 1NRQH 2PKSB 1UTOA 3T27A 3V7TA 2GV7A 1GDUA 3UQVA 2I6SA 4AGKA 3EA9A 1DSTA 1B0FA 1DUEA 3KGPA 4X6NA 4X1NU 1OOKB 1AFQC 5EGMA 1LQDB 1DWCH 1K21H 2WPMS 9LPRA 1VCPA 3SBKA 1TGBA 1IQNA 1AFQB 1AUJA 5GJ4B 4Y8ZA 3U8OH 1UCYE 1QA7A 3UTUH 1GJ6A 1LKAA 1IQJA 2FOHA 1YPKH 1AI8H 2J94A 1O3LA 2XRCA 3V12A 4X6MA 1ZHPA 2ZFSA 4XBDA 1AB9C 2AFQB 2A4GA 3ZZBA 2OQ5A 1JRSA 4Y79A 1IQGA 3GDSA 1O5FH 1NFXA 1HPGA 2ZTZA 1P2QA 1EZUC 3BEUA 5TJXA 4YESB 1V2UT 1L1NA 1SGEE 1BMMH 1UK4A 2PWXA 3ATIA 3P8FA 4ZKRU 1TA2A 1UVTH 1W0ZU 2A45B 1C1RA 1AVXA 2ZI2H 4OGXA 8GCHG 4JZFH 4WH8A 4D9QA 1Y3UA 1EP6A 1TBQH 1MKXH 3OTJE 1K1LA 3CP7A 3DD2H 2ILNA 1VJAU 2P8OC 3TK6A 4Y0YE 1SGDE 2ZNKH 2CF8H 2ZTXA 1PQAA 1IHTH 1O3JA 4BAHB 2P8OB 1OWDA 1YKTA 2Z6BD 3LGWA 4GSOA 2HVXA 3K9XB 1PPCE 5GCHG 3ATMA 3C1KA 3SU4A 1QQ4A 1C2JA 1LKBA 1WOFA 1W2KH 3A7ZA 1D4PB 4K5ZA 1F0UA 5J4QA 5GDSH 1ELEE 5T6FA 3LC5A 5JPMH 1YPMH 3SU5A 2GV6A 2FOCA 1BRAA 1P9SA 1DXPA 2WUCA 1OX1A 1QL9A 1WQSA 2BXUH 1GJ5H 4KTSA 1GBIA 1P10A 3VB3A 4AZ2B 2CF9H 5CE1A 4LZ1H 1O3GA 1O2KA 1VCQA 2BHGA 1D3TB 1WCZA 4UFGH 5ESTE 5LPEA 2GZ7A 3TJVA 1GI4A 1TA6A 1O2YA 1YLCA 3PMBB 1CGIE 4WF8A 1ZMJA 4AFUA 1C5VA 3ZZ7A 2M5TA 2SGDE 1AVGH 3ATLA 3RXLA 1V2KT 1OXGA 4NIYA 2AS9A 1KXFA 2PKAB 2QF3A 2VIVA 4FUBA 7GCHG 1ELCA 1L2EA 4K60A 3EA8A 3MNBA 1WSSH 4I7YH 2ASUB 3RLWH 2OLGA 2Z94A 1TOMH 1OKXA 1SGRE 3TK5A 2XNIA 1OP2A 2OBOA 2Y81A 5J4SA 2HOBA 1UHBA 3MYWA 1W8BH 3BV9B 4INLA 3NPSA 4IC6A 1O3AA 1GJBB 1IAUA 2RA3A 2KAIA 1NFWA 4FVBA 1BHXB 1S6HA 4O03A 2ZEBA 2FOMB 1Y5BT 3IWMA 4CHAC 1GHZA 1HAYB 1GJDB 2H9EH 1BTWA 5K7RA 3TJOA 4CHAB 1ANBA 3KCGH 1L0ZA 2EI7A 3GY5A 2H6MA 3MTYA 1Z1IA 5JB8S 3GCOA 3P92A 1HAGE 4MPVA 4I8GA 4AN7A 3QK1A 3BSQA 1MAYA 4ZHMU 1HDTH 2NU0E 3BTEE 3M5LA 1O3NA 1RS0A 4A7IB 2VIQA 4O97A 1O2IA 4CH2B 1HNEE 1TNHA 3K65B 3JZ2B 3D62A 2GTBA 3MU4A 6GCHG 1KTSB 4I8KA 3GOVB 2BD7A 2PSYA 4TPYA 4IMZA 1YPHC 2QYIA 1TGNA 1XUJA 3BG8A 3VB6A 2FS9A 1ZGIA 2PGQB 1P03A 1EPTA 5F8TA 3K2UA 4A92A 1DS2E 5DP7A 3SHAH 1KXAA 4CRGA 1FI8A 2H5DA 4XFQA 1ZR0A 1AO5A 1SGFG 4AG1A 3ZVBA 5FHTA 2HRVA 3S7HB 5T3HA 3OX7U 1C4V2 1UCYH 1ESBA 4MNWA 1K1JA 1EZXC 3M7UA 3AW1A 3SZNA 1DX5M 1NROH 3RXSA 1C5LH 7KMEH 1OYTH 2SNVA 3HKJB 3MOCA 3SORA 5DP9A 5EOKA 2AMDA 2FWWA 1SHHB 6CHAC 3ZYDA 2BOKA 1HGTH 2ODYB 1SB1H 1ELVA 2JETC 4IN2A 1NM6A 6CHAB 4YZUA 2ZP0H 1D3DB 2ZWLH 5AVDA 2GD4B 5H4IB 1RD3B 2JETB 1XM1A 2V3HH 4NIWA 3B9FH 1A0LA 2PLXA 1NU7B 1TMBH 2BD2A 2F83A 2BLOA 1O3HA 1LHDH 4E7NA 1OWIA 1GDQA 1WU1A 2C8ZB 6LPRA 1MZDA 3AAVA 1JBUH 3DHKH 1ORFA 4F4OC 3E1XB 1V2RT 1EZQA 1W7XH 3SU3A 1ZJDA 4LXBH 3CENA 1RGQA 5DP3A 1SBWA 3W94A 3TGKE 1LPGB 3PMHB 3PLKA 1U6QA 1TYNA 4OS1A 1NRRH 1AGJA 2ZQ2A 3A82A 3TGIE 4ASHA 1V2VT 2PUQH 1X7AC 5GIBA 2F9OA 3RLYH 3PM3A 1A2CH 2PKAA 2SGPE 2ZHFH 2H9TH 4JYUH 5C20A 1D6WA 3LGUA 5A09A 1GMCF 1C1NA 5K0HA 4YOIA 2GZ8A 1AY6H 1TQ0B 1Y3VA 1D9IA 2PW8H 4BTTB 2G51A 2OP9A 1GI3A 1SGNE 1W7GH 3UR6A 2XW9A 1LVYA 2TPIZ 1BT7A 3SNAA 4WXIA 1EAUA 1GCTC 3F9FA 4Q2KA 1NO9H 3FZDA 4MLFB 2R0KA 5DP6A 2VINA 1VCWA 1YYY1 1ZMNA 3TJUA 1UVUH 2A7JA 1UTNA 1D6RA 1ZSLA 3UIRA 4UD9H 1GG6C 2O8WA 4UFDH 1Q31A 3G01A 4H6SB 4ZHLU 4AG2A 1VITG 2UUYA 1GHYH 3ZVFA 2EC9H 1TNKA 2TIOA 1LHGH 1OWEA 2C8WB 5EU8A 1FJSA 1EUFA 2FYRA 1AVWA 2ZQ1A 4WXVA 1SI5H 1ETSH 1GBCA 2ALPA 1BITA 3ZVDA 1O3IA 3U69H 3VB7A 5EXNA 1ABJH 2ZPRA 1Z8IB 4ISLA 1KLTA 3M5NA 1TNGA 4X1PU 2D26C 2GCHF 2A4QA 2FOGA 1B7XB 1L4ZA 1CE5A 1NRPH 1TABE 4MG3A 3SV7A 1DOJA 1S84A 4FUDA 3O8CA 2XTTB 2G81E 2F9UA 4XBBA 1DICA 1FONA 1HRTH 1Z6JH 2G5NA 2ZDVH 1WV7H 5C5NA 2P3UB 1DXWA 2UUKB 2GMTC 2BZAA 4AFSA 1S6FA 2AMPA 4GHTA 1QJ1B 4ZH8A 4RSPA 2VWMA 2GMTB 4X1QU 1FPCH 3A88A 1C2GA 1EKBB 3U8RH 2UWLA 1HXEH 5A0BA 1GBLA 1P12E 2ZHEH 1CU1A 4AORA 2QXIA 3SQEE 1PPFE 5EW1H 3MU0A 3T26A 5LH8A 3RM0H 1BRBE 1HJ9A 3AW0A 2BD8A 1GI9B 3RXFA 1O2ZA 3KF2A 4HZHA 5JBBS 1F5RA 1KXBA 1V2WT 5LGOA 1QR3E 2WPHS 1EJAA 5DGJA 1C4U2 8KME2 2UUJB 1GI6A 2J4IA 2HALA 1V2ST 3GY4A 2F9PA 3V13A 1EJMA 1DWDH 3E0PB 4MPWA 2Y6TA 3QX5H 1ZPCA 1AZ8A 3P8OA 4NIVA 3RXPA 1GVLA 1QIXB 1NPMA 1O3MA 2IJOB 1KTTB 2QXHA 1GBDA 4K3JA 2HNTE 3SUGA 4B71A 2ZA5A 3GCTF 3LH3A 3ZV9A 1FPHH 3MO6A 3SV2H 2OUAA 2R0LA 1CHOF 2XYAA 1AWHB 1IQLA 1SLXB 2ZDLA 1MU8B 2B0FA 2H5CA 1O2MA 2GT8A 2FEQH 3E0NB 1XUIA 1ZZZA 4ZKNU 3O8DA 1FUJA 2AEIH 4CH8B 2W26A 4K1TA 4ISIH 4GCHF 3SU1A 1DLKB 2CXVA 1GHVH 1FDPA 5FBIA 4FU7A 3OYPA 3A8CA 1OS8A 1TPAE 2ZU4A 2BLQA 2PFEA 2Q6FA 3STIA 2PV9B 4WH6A 2VGCC 2O8LA 3ZZAA 3RMLH 3ZZ5A 2DUCA 1TRYA 1V2QT 2EI8A 1FLEE 2VVUA 1Y59T 3UY9A 2VGCB 3GY6A 1ELAA 3UNRA 2QIQA 3OU0A 4Y8YA 4AFQA 1UVOA 1UTMA 2AGIX 4YLUA 2FXRA 1C2EA 1CT2E 5DP4A 1A5IA 1GI2A 1V2NT 2SGAA 4YOGA 1TIOA 4WY3A 1TQ7B 3F1SB 2ZFTA 3AVZA 2HGTH 1C9PA 2SNWA 3T62A 3UNQA 4A6LA 5HMAA 2J9NA 1ZYOA 3ZZCA 3EAJA 1ELFA 5ESBA 2AERH 1O2RA 1HIAB 3Q77A 2WINI 1V2MT 1BTXA 4B76A 1TX8A 1KLIH 1H1BA 3HK3B 1FY5A 1GJ4H 2P59A 5IYTA 2PKSC 4DCDA 5DO4H 2QAAA 1MU6B 5G4BA 2R9PA 4ZHAA 4ABJA 1MTNB 1XKAC 2FOEA 3E3TA 4X0WU 2BD4A 1KSNA 3SGAE 1C5QA 3T2NA 1MAXA 2ZFPH 1GBFA 1YPHE 4I32A 1O5DH 2PTNA 1GCDA 4CRBA 4R8TB 1SC8U 2ZFFH 3ZZ3A 2R2WU 1O5AB 2JH6D 3VXFH 4CRFA 4ABIA 5A8ZA 1EPTC 3MH7A 1SLUB 2ANMH 5AFYH 4MTBA 3PWBA 1EPTB 2BQ6B 1Z7KA 3LJJA 4MQAA 5HXFA 4Q80A 3BTKE 5EG4A 1C1PA 2FLRH 1MD8A 1G32B 1YPLH 1P2OA 4OGYA 1C5XB 1L1GA 2A2XH 1C1QA 2ZGXH 1V2OT 4AOQA 4K1EA 3H5CB 2BMGB 3KL6A 4DY7B 1K1IA 3GCNA 2FS8A 4E06H 1C5YB 2FOFA 3CS0A 4Y7AA 4B73A 3BTGE 4MVNA 1HFDA 1O37A 4FUFA 1GBAA 1C1UH 5TCAA 1C5PA 5HM9A 4O3UA 1P9UA 2HWLB 4UEHH 4TY7A 1XUGA 1O2LA 4RKJB 3TNSA 1GBEA 2BVSH 5HGGA 1C2MA 4H6TA 2XBVA 1AWFH 3AASA 1GMDF 3S7KB 1BTPA 1K9OE 1LVOA 3SI3H 1C5ZB 2F9BH 4OS4A 1IQFA 1BMAA 2P95A 2GCTC 1GVZA 2NWNA 3PLBA 4IN1A 1ZLRA 2SGEE 1K1PA 1HJ8A 1O2QA 1O34A 4X2YA 1T8LA 3U1JB 4IBLH 1FMGA 2GCTB 4INKA 4U2WA 1PPHE 3SI4H 4FUJA 3A80A 1Y3XA 1LHCH 2BDIA 1O33A 1SGYE 4MNXA 5ETXA 4CRAA 1RTLA 1ACBE 2FLBH 1TLDA 3T25A 2FDAA 4ISHH 3MFJA 2AIPA 4Y76A 3EE0B 4FU8A 2ZGBH 3A83A 3OY5U 1QL8A 3T28A 1C5TA 2VWOA 8ESTE 4JCNA 2BD5A 1BDAA 3DFJA 3A8BA 1PYTD 2Y5FA 2BLVA 1J14A 1SLVB 1DT2A 5FX6A 1TB6H 1HUTH 4DIHH 1KXDA 5EPNA 5C3NA 5I46H 5EXLA 3PWCA 4B2BA 4ISOA 1RXPA 3UWJH 3LC3A 3RDZA 3NXPA 1YPEH 1O2VA 4D8NA 4IW4E 1QJ7B 5DJ7A 2W7UA 1F2SE 3QWCH 2XWAA 3K6YA 1G3CA 1GPZA 2F91A 3ITIA 2WYJA 4FUHA 1BJVA 4Z0KA 4NFFA 1DITH 4RKOB 1GMCG 1GDNA 1Y8TA 3GICB 1O2PA 1Z71A 3SJOA 3SQHE 2AMQA 1GMHF 2OINA 4VGCC 3RXRA 3LT3A 1S5SA 5FPYA 3STJA 4KP0A 2XBYA 2FTLE 1C5UA 2GZ9A 4X8TH 4LZ4B 4VGCB 4Q7ZA 3TU7H 5LPFA 1CT4E 1AKSB 3PROA 4OS6A 3FVFB 2BY8X 1QB9A 1O30A 2A5KA 1A3BH 1ZPZA 1F0RA 1FN8A 1SOZA 1GBBA 4GAWA 3NZIA 1EZSC 1GHAG 1O3FA 1QJ6B 1S83A 4I8HA 2PUXB 4HTCH 5DKMA 1H9IE 1HIAA 2F9NA 2BY5X 1C1WH 5CHAC 1TX7A 3MH5A 1O36A 2BDCA 5IDKA 4CBOA 5L2ZH 2FX4A 1Y5AT 5CHAB 1O35A 3UQOA 3E90B 2V0BA 1MTWA 2W3KA 2DE8A 4J2YB 1CBWC 1BTZA 3TJNA 1LHFH 2BDHA 1QNJA 1MH0A 2ZECA 2BQ7B 5SGAE 1PQ7A 1B5GH 1EXFA 2FOBA 3D23A 5ABWA 1BMLA 1CBWB 2FYQA 1KDQB 1T4UH 3HPTB 3UOPA 3A8AA 1EAXA 2GCHG 4NFEA 3A7WA 3VXEH 3RXCA 4JYTA 4AGJA 2V35A 4Z6AH 5GWZA 2G5VA 3ZYEA 3Q76A 5L2YH 3Q00A 1CT0E 3RXKA 1CHGA 3FFGA 3T5FH 2CGAA 2AH4X 2OC7A 3F68H 1RIWC 1EP5A 2BY6X 4UE7H 4NZLA 2ZCLP 1MUEB 3QUMP 1SGQE 4HI3A 2OQUA 3M5OA 1RIWB 1XUFA 1YLDA 2C4FH 2RDLA 7ESTE 1O2WA 1A61H 4J1YA 2Z9JA 1XUKA 5T6DA 1Y3YA 1TMUH 1YCPK 1ESAA 2C3SA 1UMAH 3BF6H 3RU4E 4NA7A 2ZZUH 3BEIB 1MZAA 3KQCA 3BTWE 2V6NA 4MNYA 1C2IA 1P0SH 2QF0A 2B7DH 5FBEA 1UO6A 3I78A 1P2IA 2P3FH 3ZVGA 3M35A 3KIDU 3ZZ9A 3RXBA 2ZC9H 1NC6A 2ULLA 3QGJA 1C5RA 4YO9A 1E37B 4NWLA 1ELGA 3MWIU 5B6OA 1MBQA 5E0JA 1TPPA 3IG6B 5E0HA 1SGTA 1G30B 2IPHA 4NG9H 3F6UH 2ZU2A 3GDVA 3GCTG 1YGCH 2FMJA 1OP0A 3PO1C 3URDA 2I6QA 1V6DA 2ZHQH 1Z8RA 4FXGH 5EPYA 4D9RA 3PO1B 1DE7H 1WYKA
chains in the Genus database with same CATH superfamily
4X1SU 2J2UA 1O2GH 3MMGA 3W95A 2WYGA 3F0PA 1EX3A 2D8WA 1LVBA 1EB1H 3O8BA 2XWBI 2FO9A 2PTCE 1C5SA 1SOTA 4M7GA 1NT1A 1O5CB 2STAE 1FNIA 3A89A 2HVYB 3PTBA 1LHEH 5GCHF 1GJAB 4P00A 1KXCA 3LIWA 4CR9A 1AE8H 1UVPA 1C2KA 3RC6A 1A5GH 1DY9A 2H2ZA 2A5IA 4GPGA 2PP6A 1UJ1A 4ZAEA 4PROA 1LQEA 1ZRKA 1P2MA 3QDZB 4YT7H 1A46H 2BZ6H 2VU8E 5BRRE 3PB1E 1GJ7B 1SQTA 1O3EA 4YLQH 2VNTA 2XBXA 2R2MB 1VR1H 2HNTF 3F9EA 3QTOH 3MHWU 2BY7X 2CV3A 4UDWH 1QGFA 1SVPA 3FP6E 5DP8A 1AUTC 3VEQB 2BY9X 3FN8A 4F49A 4K2YA 4X6OA 1SLWB 2NU4E 1TRNA 3D49H 3A7TA 3MNXA 3FO8D 4Y0ZE 1ZTJA 1QBOA 1C1MA 2TRMA 1AKSA 2ZGJA 1C1TA 3NWUA 1S82A 1O2SA 3T29A 7GCHF 1O3KA 4YM9A 4ABGA 2HLCA 1YF4A 3F2GA 4XE4A 4X6PA 1BQYA 4X2WA 1O5BB 1AZZA 1EJNA 3ESTA 3LGTA 3RXVA 3QGNB 1HLTH 2A4OA 4TYDA 1SGIB 1QRZA 4ZCNA 3LPRA 3ODFA 3UUZA 5EIYA 1TGTA 1EQ9A 2GDEH 4ZKOU 1UK3A 3F3BA 3SU2A 1K1MA 3BTQE 2VIWA 4B6EA 2O8MA 1BBRK 4ABDA 1GBKA 2HLDD 1SHYA 3ZZ6A 1PPGE 4A5TS 2ZG0H 1HAXB 3SNEA 1ZSKA 1QHRB 3ZZ8A 4D7GA 1DDJA 2PGBB 1F0TA 1VITH 1QB1A 1C2HA 4XRNA 1KDQA 1C4Y2 5JBAS 2G4TA 1S85A 4MNVA 4TT3D 2NU3E 2QA9E 3RMMH 1GL1A 4K8YA 3GYLB 4ABEA 1D3QB 1GGDC 1PYTC 1GBMA 3RXIA 2XCFA 3P95A 2FESH 4ZROA 1GGDB 3KQDA 3BTFE 1DWBH 1G3BA 1O2XA 1HAPH 1C1SA 1WBGB 1ZPBA 1O38A 1RRKA 2EQNA 2BD3A 5CMXH 5JBTA 3PV4A 1O2JA 1TRMA 2J34A 1ETRH 6GCHF 2A5AA 3M3TA 1F0SA 5GNDA 3RXJA 5EQQA 2ZO3H 3SHCH 3SNBA 3L3TA 3WY8A 2RA0A 5DSFA 5HIZA 4SGAE 1N6YA 2SGQE 1A1RA 1TX6A 3TITA 5A2MH 4I33A 4B2CA 1ZOMA 4XBCA 1GMDG 4BOHA 1BBRE 3KYFA 4A1VA 4SGBE 1BMNH 3R3GB 1HBTH 2D2DA 1KY9A 2KCOA 2LPRA 2QN5T 1XVMA 4WJG2 3ZZ4A 2WPIS 2QXGA 5C67A 1LPKB 1BTYA 4X2VA 2TBSA 1QB6A 3TGJE 5LPRA 1ELDE 2ZU1A 1PPZA 3N7EA 4YT6H 1E34B 4B74A 3F2HA 2GT7A 2F9VA 5C1UA 1WDIA 5L6NH 1FIWA 1O2OA 3GCHC 3KQBA 3RXMA 3BG4B 1G2LA 5PTPA 5DP5A 3GCHB 1P06A 2J98B 3B23B 2C90B 3GY8A 3QTVH 2ZU3A 3SJKA 1PJPA 2H9HA 2VIOA 1CGHA 1TPSA 1M9UA 4H4FA 1N8OC 2THFB 1ZGVA 5GPIB 4MPXA 1ELBA 1Z8JB 4FVDA 1N8OB 2G55A 4P02A 1NS3A 1YBWA 3KHVA 4HFPB 3VFEA 1VGCC 4B1TA 4I31A 1YY3A 1MABB 1O3DA 1IQMA 1P2JA 1TBRH 1ETTH 1AD8H 1QBNA 1VGCB 2RCEA 4BAOB 2JKHA 4WWYA 2BVRH 3K6ZA 4X8SH 1ZMLA 2BD9A 4B2AA 4A1XA 3ELAH 4DURA 2EEKA 3GY2A 4E7RG 2FI5E 1CO7E 3H7OA 4BXSA 1GMHG 2Z9GA 4JZIA 1PPEE 4IMQA 1O3OA 3SJ9A 3SNCA 1T32A 1AIXH 3U98H 2VVVA 3I29A 4X8UH 1DLEA 1QRXA 4DW2U 3F0OA 2FIRH 1PQ8A 1MKWK 3BTTE 1JIRA 2G8TA 2WV4A 1YCPH 1A5HA 1XXFA 2SGFE 1DY8A 1AMHA 5A0AE 3A7YA 3P70B 5C1YA 1BB0B 5JYIA 2VH6A 4FUEA 1FAKH 3LDXH 1SQAA 1IQKA 1A0HB 4BTUB 2BLWA 2XXLA 8LPRA 1W11U 3RXDA 2VBCA 1L1JA 4Y7BA 1K1OA 2GDDA 3M3VA 1EB2A 1ZHMA 1MTNC 2EA3A 1FN6A 2WPKS 1ABIH 5E2OA 3UR9A 3SJ8A 2J38A 1O3PB 2JH5D 4TPIZ 2ODQA 2RG3A 3BTHE 3A7VA 1NTPA 2NU1E 3S9BA 4DJZB 1FY4A 2VIPA 1F5KU 1GJCB 3RM2H 3L6PA 4NIXA 3RXTA 3IITA 5KECA 1C2DA 4NA9H 2AYWA 4ZXXH 3UWIA 1H4WA 2BM2A 1TGCA 1LO6A 1K1NA 4IGDA 1AHTH 1V2LT 3SV8A 5F53A 5EW2H 2C8XB 1JXPA 2VVCA 4Q7YA 4WVPE 2Y82A 1HAHH 3A8DA 2K1QA 3RUOA 3OY6U 1NY22 4O3TA 1O2UA 1BJUA 1P8VC 4MPUA 4INHA 1AQ7A 2Z3CA 1VITF 1HAZB 2ANKH 2FX6A 3TH3H 1XUHA 2LNCA 4BNRA 2KM0A 3BEFB 3Q3KA 2VWNA 2V3OH 3R0FA 5F8XA 2BYAX 2H1UA 1DANH 4IC5A 4LOYH 1KMHB 5FCRA 2FM2A 1TALA 3SN8A 4NSVA 2D1JA 2BDBA 1FAXA 1ANDA 2TGDA 1WTGH 4BAKB 5A8YA 1Z6EA 3NUMA 3HKIB 4KELA 1FXYA 1FZZA 4WMFA 4BANB 1E38B 3SGBE 1MD7A 4BAQB 2BX3A 1QRWA 3L33A 3PMAB 1QA0A 2W3IA 2BX4A 1PPBH 5C2ZA 2R3YA 3UREA 1FIZA 3SU6A 3RMOH 1O32A 4R0IA 1AB9B 2SFAA 3HATH 1WAYB 2AGGX 5KGOA 1L4DA 1SSXA 3WWFA 1OWKA 3ZVAA 4K69A 4B75A 4X1RU 2V3MA 3TNTA 1GI1A 1FV9A 4Z1MD 1V3XA 3KEEA 2K8IA 2WV5A 5E0GA 1QY6A 3FKSD 1EOJA 3NCLA 1G2MA 1TOCB 4KKDA 1F7ZA 1MBMA 3I77A 3MNSA 2WPLS 1JWTA 3ZVEA 1JRTA 4U01A 1W12U 1BBRH 3A87A 3CS7A 3TH2H 3U8TH 2CN0H 5F03A 2J98A 4DGJA 1IQIA 1H9LB 4OS5A 1P11E 1NFYA 1Y5UT 1A7SA 3A7XA 2XC0A 1RFNA 1ZRBA 1JOUB 1LCYA 4X8VH 1DFPA 3ZZDA 1CVWH 1T8NA 3E8LA 1VZQH 3M37A 1HXFH 1SMFE 4LK4A 2P16A 2UWPA 3S9CA 2OXSA 1C5WB 1LDTT 1RTFB 1KIGH 1NESE 3QLPH 1BA8B 2Y5HA 4ACBA 3LH1A 3RC4A 1P05A 1TAWA 3E6PH 1SPJA 4GUXA 3M3SA 1NZQH 4O9VA 1HAVA 2XBWA 3A85A 3SU0A 1O39A 3V3MA 2Y7XA 3ZV8A 4CR5A 1JIMA 1C9TA 1EAIA 3SJIA 2A1DB 2Z3DA 2HNTC 4NWKA 1QCPA 3F9GA 5F6MA 4NZQA 1BRCE 1GJ9B 1GL0E 3A81A 4U30A 2P94A 2ZDNA 3JZ1B 1EATA 3FZZA 3LU9B 1SGCA 2A31A 1T31A 2CHAC 1G3DA 4OS7A 5L30H 4THNH 1GHXH 5JDUB 1D3PB 2A7HA 2TGAA 2CHAB 1YC0A 4E05H 2BDYA 1XKBC 2BQWB 4YTAA 1C2FA 5BPEA 1C2LA 1CSOE 1BOQA 3NKKA 3N7DA 2PHBA 1A3EH 3UNSA 3DUXH 2W7SA 1DSUA 2ALVA 2NU2E 3BTME 1H8DH 1G36A 1GJ8B 3LGIA 5E2PA 4TWWA 1PQ5A 2ZTYA 2QY0B 3MI4A 3F9HA 5DN6D 3OSYA 4TY6A 2G00A 2TGTA 5AFZH 4DVAU 1OPHB 3EA7A 2ZGHA 1QFKH 3RU4D 1T8MA 2BOHB 1MMJN 2BVXH 4CBNA 1GHBF 3M5MA 2WUBA 2ZIQH 1TNIA 2YNAA 3DFLA 4AX9H 1HYLA 1YPGH 2QC2A 3KQEA 4UONA 3UPEA 5C0UA 3VGCC 1Q3XA 3P17H 3ENSB 4JZ1A 4CRDA 3OEHD 1P57B 3SUEA 4D76A 1W14U 4AB9A 3VGCB 1GI8B 1P3CA 3QZRA 1K2I1 1LPZB 3MO3A 1P3EA 3N7OA 3HGNA 2ODPA 3HK6B 1TNLA 3M7TA 3SO3A 3MH6A 1EASA 4UFEH 1ZHRA 3URCA 1G9IE 2STBE 1BIOA 1IHSH 1YLNA 3EQ0H 1GBTA 1WQVH 5EQSA 2WV9A 3VPKA 1O5GH 2ZGCA 5FX5A 4ESTE 2XC5A 5DG6A 3MU5A 1BCUH 4WMDA 1B0EA 1THRH 1WXRA 3RXHA 3V0XA 1FY8E 5FPSA 4D7FA 3BIUH 4MDSA 1MKWH 1TONA 4NA8A 5DPAA 5A8XA 4IS5A 1E35B 2IPQX 2QCYA 2YNBA 5GXPA 4K1SA 2A4RA 4KGAA 4FUCA 1O2NA 4Y8XA 2XNDD 4WMEA 2A2QH 3PTNA 2KX4A 3EDXB 3SYJA 1YPJH 1OSSA 3DT0H 3PLPA 1ZJKA 4DOQA 4KTCA 4ZMAH 4JMYA 1C5NH 1INCA 1YM0A 1J15A 4AYYB 3TIUA 1KYNA 2AGEX 3HGPA 1XX9A 2QXJA 2VB0A 4U32A 1ANCA 1ARCA 8GCHF 3SGQE 3MO9A 1C5MD 1CHOG 1SQOA 2OD3B 2XOKD 3ATKA 1A0JA 4TWYA 4DT7B 1UTPA 2DE9A 1P2NA 4UFFH 2OK5A 3H7TA 1QBVH 5EQRA 3TLOA 2P93A 2VIDA 4JZEH 2FP7B 3DCLA 4GCHG 1SFIA 4ABAA 2FI3E 2ZFQH 3EGKH 1F5LA 1EOLA 2C93B 5E8EH 3WW7A 1SGPE 1W13U 4FUIA 3PMJA 3VB5A 4I8JA 3A86A 1SFQB 1TPOA 4FU9A 1MTSA 1NU9A 3RXAA 4CRCA 3Q3YA 1W10U 2ZFRH 2OC1A 3BIVH 4A1TA 4BXWA 3MQKC 2UUFB 2UWOA 2ANWA 1TFXA 3MU8A 1OYQA 2ESTE 3RXUA 3U1IB 4AB8A 1P04A 1V2JT 1THPB 3LJOA 3GYMA 2O8UA 2EI6A 3GISB 1LMWB 3SW2B 1W3CA 3B8JA 5FCKA 2GP9B 2FZZA 2ZKSA 4NSYA 3RXEA 3SV6A 1KLJH 1VJ9U 1T8OA 3KYGA 3E16B 2ANYA 3M36A 1C1OA 3UFAA 2JH0D 1AFEH 1EAWA 2A0QB 2F3CE 3P8GA 4DIIH 2GGVB 5F8ZA 3PYHA 2OC8A 1HB0B 2ZPQA 1K22H 3O8RA 1THSH 4X2XA 1UTKA 4OS2A 2JJ1D 1H9HE 1MCVA 1F92A 1ZTKA 2FTMA 2LP6A 3FAOA 1S0QA 2GVFA 4XSKU 3PV2A 1UW7A 1HAOH 4KTUA 4GLYA 3VB4A 1KXEA 1MKXK 1XVOA 1GBHA 3TPIZ 1V2TT 1BHXF 1TBZH 3SUDA 3MNCA 2OBQA 2G4UA 3QO6A 1UTLM 1DM4B 1G3EA 1XMNB 5FPTA 2FPZA 3KNXA 3S9AA 4ABBA 1BRUP 1GBJA 5C5OA 1O5EH 1S81A 1BTHH 1GHAF 1GCTB 2CJIA 2ZDMA 3LGVA 1QQUA 4Y10E 1C5OH 2ZDKA 4NGAH 1LTOA 4GVUA 2QE7D 1WUNH 2OC0A 4DT4A 3KN2A 5JB9S 3TK9A 3FP8E 4QT8C 2R3UA 1NN6A 5A0CA 4FUGA 2ZCKP 1GG6B 2ZPSA 9ESTA 2W6JD 3GY3A 3D65E 4YOJA 4XDEA 3FP7E 7LPRA 3VG8A 5FXLA 5AHGH 2ZCHP 4AFZA 2CMYA 2BDAA 1HV7A 1J8AA 1ID5H 1IQEA 4JZDH 5AF9H 4ZXYH 1N1LA 2ZDAH 2B5TB 1NRSH 1ESTA 2YOLA 4CREA 1J16A 3MH4A 2B9LA 3FANA 1TNJA 2A7CA 1K28D 1E36B 1V2PT 1E0FD 1H8ED 3M61U 4XOJA 3BTDE 2Y7ZA 3Q3XA 4Y11E 3P8NA 2VH0A 1O3CA 2LELA 5EODA 2IN2A 2HPPH 2XC4A 2J95A 5TCCA 1OP8A 1W0YH 1T7CA 2VJ1A 2Z9KA 2OTVA 1DUAA 1H8IH 2WHXA 2W5EA 2K0QA 3S0NA 1FY1A 2ZU5A 2O8TA 2W6ID 4BTIB 2XCNA 1FQ3A 5I25A 5JBCS 2B8OH 4AYVB 1MTUA 1GI7B 4JK5A 1QTFA 2Y80A 5EXMA 3SV9A 3RXQA 3BG4C 1WTHD 4RT1A 1SGFA 3U9AH 1HCGA 1YP9A 3LKWA 1O0DH 1NFUA 1O2TA 3TVJB 2BXTH 1ARBA 2L74A 4ABFA 2Q6GA 2OCVB 3GY7A 1O31A 2Z9IA 5HM2A 4K8BA 1ZTLA 3LONA 1P09A 1N6XA 1FY3A 3EYDA 1AE5A 1QL7A 1LVMA 2C8YB 3DSPA 2WPDD 1HJAC 3ODDA 1AU8A 1OWHA 1TWXB 3GDUA 5DK1A 1CQQA 1GHWH 2Q6DA 5T6GA 1S0RA 1P2KA 1A4WH 1UTJA 4NCYA 1HJAB 2ZF0H 1O2HA 4RN6A 4ABHA 3RU4T 5HYOA 1RJXB 1UTQA 4Y6DA 1O3BA 2WPJS 1BTUA 1HAVB 4ZKSU 2Q1JA 2F4LA 2TGPZ 3A84A 1XXDA 1CA0C 4ZUHA 2QGRA 4Y71A 2AIQA 2KR7A 3RXOA 1JMOH 2BB4A 2HPQH 2IOTA 1CA8B 1HAIH 1PFXC 2ZHWH 1CA0B 1Z1JA 1J9CH 3UOUA 3ATWA 2ZHDA 1NRNH 4Q7XA 3RMNH 1BZXE 1MQ6A 3SUFA 2G52A 4H42U 2GX4A 3RC5A 6ESTA 4JK6A 2P3TB 2VWLA 2PR3A 1UVSH 1RTKA 4ISNA 2QV1A 3TH4H 1IQHA 1Q2WA 1SG8B 4BAMB 1MQ5A 3DA9B 1GI0A 2JJ2D 4F48B 2A32A 3BN9A 2J92A 2GKVE 4F55A 2BDGA 1ANEA 1SR5C 2BTCE 2FI4E 2FOAA 1P01A 3QN7A 1UCYK 3E91A 1IOEA 1UHBB 3RXGA 1DVAH 3LGYA 1AN1E 1ZSJA 3SNDA 2Z7FE 3AAUA 1W0KD 3P6ZB 4GHQA 1G37A 2O9QA 5FAHA 1Z8GA 2KAIB 4HGCA 1TMTH 1GVKB 4DG4A 2J97A 3CNRA 1T4VH 1OWJA 1CGJE 2Z9LA 3H09A 1GHBG 3PRDA 3ZVCA 2IJD1 2FODA 3RP2A 1DWEH 1Y3WA 1MTVA 1SL3A 1ELTA 1P02A 1UK2A 3FOAA 1QURH 1YCPM 1MCTA 1J17T 3C27B 3M7QA 1TE0A 1BUIA 2KCYA 4I8LA 3NK8A 3SOSA 2Z3EA 5C1XA 2PSXA 2Y5GA 3S69A 3MU1A 1GI5A 1TGSZ 3LOXA 1DPOA 4JYVH 3U28C 1GWAA 3QZQA 1C1VH 1NRQH 2PKSB 3OAAD 1UTOA 3T27A 3V7TA 2GV7A 1GDUA 3UQVA 2I6SA 4AGKA 3EA9A 1DSTA 1B0FA 1DUEA 3KGPA 4X6NA 4X1NU 1OOKB 1AFQC 5EGMA 1LQDB 1DWCH 1K21H 2WPMS 9LPRA 1VCPA 3SBKA 1TGBA 1IQNA 1AFQB 1AUJA 4M9FA 1NBME 5GJ4B 4Y8ZA 3U8OH 1UCYE 1QA7A 3UTUH 1GJ6A 2M2AA 1LKAA 1IQJA 2FOHA 1YPKH 1AI8H 2J94A 1O3LA 5T1VA 2XRCA 3V12A 4X6MA 1ZHPA 2ZFSA 4XBDA 1AB9C 2AFQB 2A4GA 3ZZBA 2OQ5A 1JRSA 4Y79A 1IQGA 3GDSA 4B6FA 1O5FH 1NFXA 1HPGA 2ZTZA 3N99A 1P2QA 1EZUC 3BEUA 5TJXA 4YESB 1V2UT 1L1NA 1SGEE 1BMMH 1UK4A 2PWXA 3ATIA 3P8FA 4ZKRU 1TA2A 1UVTH 1W0ZU 2A45B 1C1RA 1AVXA 2ZI2H 4OGXA 8GCHG 4JZFH 4WH8A 4D9QA 1Y3UA 1EP6A 1TBQH 1MKXH 2KZ4A 3OTJE 1K1LA 3CP7A 3DD2H 2ILNA 1VJAU 2J5UA 2P8OC 3TK6A 4Y0YE 1SGDE 2ZNKH 2CF8H 2ZTXA 1PQAA 1BMFD 1IHTH 1O3JA 4BAHB 2P8OB 1OWDA 1YKTA 2Z6BD 3LGWA 4GSOA 2HVXA 3K9XB 3UB0A 1PPCE 5GCHG 5FL7D 3ATMA 3C1KA 3SU4A 1QQ4A 1C2JA 1LKBA 1WOFA 1W2KH 3A7ZA 1D4PB 2RDEA 4K5ZA 1F0UA 5J4QA 5GDSH 1ELEE 5T6FA 3LC5A 5JPMH 1YPMH 3SU5A 2GV6A 2FOCA 1BRAA 1P9SA 1DXPA 2WUCA 1OX1A 1QL9A 1WQSA 2BXUH 1GJ5H 4KTSA 1GBIA 1P10A 3VB3A 4AZ2B 2CF9H 5CE1A 4LZ1H 1O3GA 1O2KA 1VCQA 2BHGA 1D3TB 1WCZA 4UFGH 5ESTE 5LPEA 2GZ7A 3TJVA 1GI4A 1TA6A 1O2YA 1YLCA 3PMBB 1CGIE 4WF8A 1ZMJA 4AFUA 1C5VA 3ZZ7A 2M5TA 2SGDE 1AVGH 3ATLA 3RXLA 1V2KT 1OXGA 4NIYA 2AS9A 1KXFA 2PKAB 2QF3A 2VIVA 4FUBA 7GCHG 1ELCA 1L2EA 4K60A 3EA8A 3MNBA 1WSSH 4I7YH 2ASUB 3RLWH 2OLGA 2WZQA 1TOMH 2Z94A 1OKXA 1SGRE 3TK5A 2XNIA 1OP2A 2OBOA 2Y81A 5J4SA 2HOBA 1UHBA 3MYWA 1W8BH 3BV9B 4INLA 3NPSA 2YMSD 4IC6A 2V7QD 2EY4C 1O3AA 1GJBB 1IAUA 1E79D 2RA3A 2KAIA 1NFWA 4FVBA 1BHXB 1S6HA 4O03A 3W1EA 2ZEBA 2FOMB 1Y5BT 3IWMA 2KCAA 4CHAC 1GHZA 1E1QD 5C17A 1HAYB 1GJDB 2H9EH 1BTWA 5K7RA 3TJOA 4CHAB 1ANBA 3KCGH 1L0ZA 2EI7A 3GY5A 2H6MA 3MTYA 1Z1IA 5JB8S 3GCOA 3P92A 1HAGE 3GS9A 4MPVA 4I8GA 4AN7A 3QK1A 3BSQA 1MAYA 4ZHMU 1HDTH 2NU0E 4OM9A 3BTEE 3M5LA 1O3NA 1RS0A 2KCPA 4A7IB 1S6LA 2VIQA 4O97A 1O2IA 4I86A 1HNEE 4CH2B 1TNHA 3K65B 5KEDA 1W0JD 3JZ2B 3D62A 2GTBA 3MU4A 6GCHG 1KTSB 4I8KA 3GOVB 2BD7A 2PSYA 4TPYA 4IMZA 4FOUC 1YPHC 2QYIA 1TGNA 1XUJA 3BG8A 3VB6A 2FS9A 1ZGIA 2PGQB 1P03A 1EPTA 5F8TA 3K2UA 4A92A 1DS2E 5DP7A 3SHAH 1KXAA 4CRGA 1FI8A 2H5DA 4XFQA 1ZR0A 1AO5A 1SGFG 4AG1A 3ZVBA 3OE7D 5FHTA 2HRVA 3S7HB 5T3HA 3OX7U 1C4V2 1UCYH 1ESBA 4MNWA 1K1JA 1EZXC 5C94A 3M7UA 2F43B 3AW1A 3SZNA 1DX5M 1NROH 3KQ5A 3RXSA 1C5LH 7KMEH 1OYTH 2SNVA 3HKJB 3MOCA 3SORA 5DP9A 5EOKA 2AMDA 2FWWA 1SHHB 6CHAC 3ZYDA 2BOKA 4RI0A 1HGTH 2ODYB 1SB1H 1ELVA 2JETC 4IN2A 1NM6A 6CHAB 4YZUA 2ZP0H 1D3DB 2ZWLH 5AVDA 2GD4B 5H4IB 2KFWA 1RD3B 2JETB 1XM1A 2V3HH 4NIWA 3B9FH 1A0LA 2PLXA 1NU7B 1TMBH 2BD2A 3WWBA 2F83A 2BLOA 1O3HA 2JIZD 1LHDH 4E7NA 1OWIA 1GDQA 1WU1A 2C8ZB 6LPRA 1MZDA 3AAVA 1JBUH 3DHKH 1ORFA 4F4OC 3E1XB 1V2RT 1EZQA 1W7XH 3SU3A 1ZJDA 4LXBH 3CENA 1RGQA 5DP3A 1SBWA 3W94A 3TGKE 1LPGB 3PMHB 3PLKA 1U6QA 1TYNA 4OS1A 1NRRH 1AGJA 2ZQ2A 3A82A 3TGIE 4ASHA 1V2VT 2PUQH 1X7AC 5GIBA 2F9OA 3RLYH 3PM3A 1A2CH 2PKAA 2SGPE 2ZHFH 2H9TH 2QF4A 4JYUH 5C20A 1D6WA 3LGUA 5A09A 3ZIAD 1GMCF 1C1NA 5K0HA 2AHME 4RT0A 4YOIA 2GZ8A 1AY6H 1TQ0B 1Y3VA 1D9IA 2PW8H 4BTTB 2G51A 2OP9A 1GI3A 1SGNE 1W7GH 3UR6A 2XW9A 1LVYA 2TPIZ 1BT7A 3SNAA 5C0TA 4WXIA 1EAUA 1GCTC 3F9FA 4Q2KA 1NO9H 3FZDA 4MLFB 2R0KA 5DP6A 2VINA 1VCWA 1YYY1 1ZMNA 3TJUA 1UVUH 2A7JA 1UTNA 1D6RA 1ZSLA 3UIRA 4UD9H 1GG6C 2O8WA 4UFDH 1Q31A 3F2FA 3G01A 4H6SB 4ZHLU 4AG2A 1VITG 2UUYA 1GHYH 3ZVFA 2EC9H 1TNKA 2TIOA 1LHGH 1OWEA 2C8WB 5EU8A 1FJSA 1EUFA 2FYRA 1AVWA 2ZQ1A 4WXVA 1SI5H 1ETSH 1GBCA 2ALPA 2JDID 1BITA 3ZVDA 1O3IA 3U69H 3VB7A 5EXNA 1ABJH 2ZPRA 1Z8IB 5B6LA 4ISLA 1KLTA 3M5NA 1TNGA 5CDFE 4X1PU 2D26C 2GCHF 2A4QA 2FOGA 1B7XB 1L4ZA 1CE5A 1NRPH 1TABE 4MG3A 3SV7A 1DOJA 1S84A 4FUDA 3O8CA 2XTTB 2G81E 2F9UA 4XBBA 1DICA 1FONA 1HRTH 1FX0B 1Z6JH 2G5NA 2ZDVH 5HIYA 1WV7H 5C5NA 2P3UB 1DXWA 2UUKB 2GMTC 2BZAA 3DSOA 4AFSA 1S6FA 2AMPA 4GHTA 1QJ1B 4ZH8A 4RSPA 2VWMA 2GMTB 4X1QU 2RFKC 1FPCH 3A88A 1C2GA 1EKBB 3U8RH 2UWLA 1HXEH 5A0BA 1GBLA 1P12E 2ZHEH 5CHBA 1CU1A 4AORA 2QXIA 3SQEE 1PPFE 5EJLA 5EW1H 3MU0A 3T26A 5LH8A 3RM0H 1BRBE 1HJ9A 3AW0A 2BD8A 1GI9B 1YWUA 3RXFA 1O2ZA 3KF2A 4HZHA 5JBBS 1F5RA 2YMSC 1KXBA 1V2WT 5LGOA 1QR3E 2WPHS 1EJAA 5DGJA 1C4U2 8KME2 3AK5A 2YMSB 2UUJB 1GI6A 2J4IA 2HALA 1SKYE 1V2ST 4TSFD 3GY4A 2F9PA 3V13A 1EJMA 5EJZA 4Q63A 1DWDH 3E0PB 4MPWA 2Y6TA 3QX5H 1ZPCA 1AZ8A 3P8OA 4NIVA 3RXPA 1EFRD 1GVLA 1QIXB 1NPMA 1O3MA 2IJOB 1KTTB 2QXHA 1GBDA 4K3JA 2HNTE 3SUGA 4B71A 2ZA5A 3GCTF 3LH3A 3ZV9A 5IK2D 1FPHH 3MO6A 3SV2H 2OUAA 2R0LA 3DSGA 1CHOF 2XYAA 1AWHB 1IQLA 1SLXB 2ZDLA 1MU8B 2B0FA 2H5CA 1O2MA 1QZ8A 2GT8A 2FEQH 3E0NB 1XUIA 1ZZZA 4ZKNU 3O8DA 1FUJA 2AEIH 4CH8B 2QF5A 2W26A 4K1TA 4ISIH 4GCHF 3SU1A 1DLKB 2CXVA 1GHVH 1FDPA 5FBIA 4FU7A 3OYPA 3A8CA 1OS8A 1TPAE 2ZU4A 3NRLA 2BLQA 2PFEA 2Q6FA 3STIA 2PV9B 4WH6A 2VGCC 2O8LA 3ZZAA 3RMLH 3ZZ5A 2DUCA 1OHHD 1TRYA 1V2QT 2EI8A 1FLEE 2VVUA 1Y59T 3UY9A 2VGCB 3OTPA 3GY6A 1NBMD 1ELAA 3UNRA 2QIQA 3OU0A 4Y8YA 4AFQA 1UVOA 1UTMA 2AGIX 4YLUA 2FXRA 1C2EA 1CT2E 2WSSD 5DP4A 1A5IA 1GI2A 4Q4LA 1V2NT 2SGAA 4YOGA 1TIOA 4WY3A 1TQ7B 3F1SB 2ZFTA 3AVZA 2HGTH 1C9PA 2SNWA 3OEED 3T62A 3UNQA 4A6LA 5HMAA 2J9NA 3PRBA 1ZYOA 3ZZCA 3EAJA 1ELFA 5ESBA 2AERH 1O2RA 1HIAB 3Q77A 2WINI 1V2MT 1BTXA 4B76A 1TX8A 1KLIH 1H1BA 3HK3B 1FY5A 1GJ4H 2P59A 5IYTA 2PKSC 4DCDA 5DO4H 2QAAA 1MU6B 5G4BA 2R9PA 4FETA 4ZHAA 4ABJA 1MTNB 1XKAC 2FOEA 3E3TA 4X0WU 2BD4A 1KSNA 3SGAE 1C5QA 3T2NA 1MAXA 2ZFPH 1GBFA 1YPHE 4I32A 1O5DH 2PTNA 1GCDA 4CRBA 4R8TB 1SC8U 2ZFFH 3ZZ3A 2R2WU 1O5AB 2JH6D 3VXFH 4CRFA 4ABIA 5A8ZA 1EPTC 3MH7A 1SLUB 2ANMH 5AFYH 4MTBA 3PWBA 1EPTB 2BQ6B 1Z7KA 3LJJA 4MQAA 5HXFA 4Q80A 3BTKE 5EG4A 1C1PA 2FLRH 1MD8A 1G32B 1YPLH 1P2OA 4OGYA 1H8HD 4YXWD 1C5XB 1L1GA 2A2XH 1C1QA 2ZGXH 3UAIC 1V2OT 4AOQA 4K1EA 3H5CB 2BMGB 3KL6A 4DY7B 1K1IA 3GCNA 2FS8A 3PV5A 4E06H 1C5YB 2FOFA 3CS0A 4Y7AA 4ACAA 4B73A 3BTGE 4MVNA 1HFDA 1O37A 4FUFA 1GBAA 1C1UH 5TCAA 1C5PA 5HM9A 1VKYA 4O3UA 1P9UA 2HWLB 4UEHH 4XD7D 4TY7A 1XUGA 1O2LA 4RKJB 3TNSA 1GBEA 2BVSH 5HGGA 1C2MA 4H6TA 2XBVA 1AWFH 4ASUD 3AASA 1GMDF 3S7KB 1BTPA 1K9OE 1LVOA 3SI3H 1C5ZB 2F9BH 4OS4A 1IQFA 1BMAA 2GCTC 2NWNA 1GVZA 2P95A 3PLBA 4IN1A 1ZLRA 2SGEE 1K1PA 1HJ8A 1O2QA 1O34A 2L6OA 4X2YA 1T8LA 3U1JB 4IBLH 1FMGA 2GCTB 4INKA 4U2WA 1PPHE 3SI4H 4FUJA 3A80A 1K0HA 1Y3XA 1LHCH 2BDIA 1O33A 1SGYE 4MNXA 5ETXA 4CRAA 1RTLA 1ACBE 2FLBH 1TLDA 3T25A 2FDAA 4ISHH 3MFJA 2AIPA 1COWD 4Y76A 3EE0B 4FU8A 2ZGBH 3A83A 3OY5U 1QL8A 3T28A 1C5TA 2VWOA 8ESTE 4JCNA 2BD5A 1BDAA 3DFJA 3A8BA 1PYTD 2Y5FA 2BLVA 1J14A 1SLVB 1DT2A 5FX6A 1TB6H 1HUTH 4DIHH 1KXDA 5EPNA 5C3NA 5I46H 2GJGA 5EXLA 3PWCA 4B2BA 4ISOA 1RXPA 3UWJH 3LC3A 3RDZA 3NXPA 1YPEH 1O2VA 4D8NA 4IW4E 1QJ7B 5DJ7A 2W7UA 1F2SE 3QWCH 3SZEA 2XWAA 3K6YA 1G3CA 1GPZA 2F91A 3ITIA 2WYJA 4FUHA 1BJVA 4Z0KA 4NFFA 1DITH 4RKOB 1GMCG 1GDNA 1Y8TA 3GICB 1O2PA 1Z71A 3SJOA 3SQHE 2AMQA 1GMHF 2OINA 4VGCC 3RXRA 3LT3A 1S5SA 5FPYA 3STJA 4KP0A 2XBYA 2FTLE 1C5UA 2GZ9A 4X8TH 4LZ4B 4VGCB 4Q7ZA 3TU7H 5LPFA 1CT4E 1AKSB 3PROA 4OS6A 3FVFB 2BY8X 4HG6A 1QB9A 1O30A 2A5KA 1A3BH 1ZPZA 1F0RA 1FN8A 1SOZA 1GBBA 4GAWA 3NZIA 3OFND 1EZSC 1GHAG 1O3FA 1QJ6B 1S83A 4I8HA 4AC9A 2PUXB 4HTCH 1E1RD 5DKMA 1H9IE 1HIAA 2F9NA 2BY5X 1C1WH 5CHAC 1TX7A 3MH5A 1O36A 2BDCA 5IDKA 4CBOA 5L2ZH 2FX4A 1Y5AT 5CHAB 1O35A 3UQOA 3E90B 2V0BA 1MTWA 2W3KA 2DE8A 4J2YB 1CBWC 1BTZA 3TJNA 1LHFH 2BDHA 1QNJA 1MH0A 2ZECA 2BQ7B 5SGAE 1PQ7A 1B5GH 1EXFA 2FOBA 3D23A 5ABWA 1BMLA 1CBWB 2FYQA 1KDQB 1T4UH 3HPTB 3UOPA 3A8AA 1EAXA 2GCHG 4NFEA 3A7WA 3VXEH 5EJ1A 3RXCA 4JYTA 4AGJA 2V35A 4Z6AH 5GWZA 2G5VA 3EE7A 3ZYEA 3Q76A 5L2YH 3Q00A 1CT0E 3RXKA 1CHGA 3FFGA 3T5FH 2CGAA 2AH4X 2OC7A 3F68H 1RIWC 1EP5A 2BY6X 4UE7H 4NZLA 2ZCLP 1MUEB 3QUMP 1SGQE 4HI3A 2OQUA 3M5OA 5HKKD 1RIWB 1XUFA 1YLDA 1SQRA 2C4FH 2RDLA 7ESTE 1O2WA 1A61H 4J1YA 2Z9JA 1XUKA 5T6DA 1Y3YA 1TMUH 1YCPK 1ESAA 2C3SA 1UMAH 3BF6H 3RU4E 4NA7A 2ZZUH 3BEIB 1MZAA 3KQCA 3BTWE 2V6NA 4MNYA 1C2IA 1P0SH 2QF0A 2B7DH 5FBEA 1UO6A 3I78A 1P2IA 2CK3D 2P3FH 3ZVGA 3M35A 3KIDU 3ZZ9A 3RXBA 2ZC9H 1NC6A 2ULLA 3QGJA 1C5RA 4YO9A 1E37B 4NWLA 1ELGA 3MWIU 5B6OA 1MBQA 5E0JA 1TPPA 3IG6B 5E0HA 1SGTA 1G30B 2IPHA 4NG9H 3F6UH 2ZU2A 3GDVA 3GCTG 1YGCH 2FMJA 1OP0A 3PO1C 3URDA 2I6QA 1V6DA 2ZHQH 1Z8RA 4FXGH 5EPYA 4D9RA 3PO1B 1DE7H 1WYKA
chains in the Genus database with same CATH topology
4X1SU 2J2UA 1O2GH 3MMGA 3W95A 2WYGA 1EX3A 2D8WA 1LVBA 1EB1H 3O8BA 2XWBI 2FO9A 2PTCE 1C5SA 1SOTA 4M7GA 1NT1A 1O5CB 2STAE 1FNIA 3A89A 3PTBA 1LHEH 5GCHF 1GJAB 1KXCA 3LIWA 4CR9A 1AE8H 1UVPA 1C2KA 3RC6A 1A5GH 1DY9A 2H2ZA 2A5IA 4GPGA 1UJ1A 4ZAEA 4PROA 1LQEA 1ZRKA 1P2MA 3QDZB 4YT7H 1A46H 2BZ6H 2VU8E 5BRRE 3PB1E 1GJ7B 1SQTA 1O3EA 4YLQH 2VNTA 2XBXA 2R2MB 1VR1H 2HNTF 3F9EA 3QTOH 3MHWU 2BY7X 2CV3A 4UDWH 1QGFA 1SVPA 3FP6E 5DP8A 1AUTC 3VEQB 2BY9X 4F49A 4K2YA 4X6OA 1SLWB 2NU4E 1TRNA 3D49H 3A7TA 3MNXA 4Y0ZE 1ZTJA 1QBOA 1C1MA 2TRMA 1AKSA 2ZGJA 1C1TA 3NWUA 1S82A 1O2SA 3T29A 7GCHF 1O3KA 4YM9A 4ABGA 2HLCA 1YF4A 4XE4A 4X6PA 1BQYA 4X2WA 1O5BB 1AZZA 1EJNA 3ESTA 3LGTA 3RXVA 3QGNB 1HLTH 2A4OA 4TYDA 1SGIB 1QRZA 3LPRA 3ODFA 3UUZA 1TGTA 1EQ9A 2GDEH 4ZKOU 1UK3A 3SU2A 1K1MA 3BTQE 2VIWA 2O8MA 1BBRK 4ABDA 1GBKA 1SHYA 3ZZ6A 1PPGE 4A5TS 2ZG0H 1HAXB 3SNEA 1ZSKA 1QHRB 3ZZ8A 4D7GA 1DDJA 2PGBB 1F0TA 1VITH 1QB1A 1C2HA 1KDQA 1C4Y2 5JBAS 2G4TA 1S85A 4MNVA 2NU3E 2QA9E 3RMMH 1GL1A 4K8YA 3GYLB 4ABEA 1D3QB 1GGDC 1PYTC 1GBMA 3RXIA 2XCFA 3P95A 2FESH 4ZROA 1GGDB 3KQDA 3BTFE 1DWBH 1G3BA 1O2XA 1HAPH 1C1SA 1WBGB 1ZPBA 1O38A 1RRKA 2BD3A 5CMXH 5JBTA 3PV4A 1O2JA 1TRMA 2J34A 1ETRH 6GCHF 2A5AA 3M3TA 1F0SA 3RXJA 5EQQA 2ZO3H 3SHCH 3SNBA 3L3TA 3WY8A 2RA0A 4SGAE 1N6YA 2SGQE 1A1RA 1TX6A 3TITA 5A2MH 4I33A 4B2CA 1ZOMA 4XBCA 1GMDG 4BOHA 1BBRE 4A1VA 4SGBE 1BMNH 3R3GB 1HBTH 2D2DA 1KY9A 2LPRA 2QN5T 1XVMA 4WJG2 3ZZ4A 2WPIS 2QXGA 5C67A 1LPKB 1BTYA 4X2VA 2TBSA 1QB6A 3TGJE 5LPRA 1ELDE 2ZU1A 1PPZA 4YT6H 1E34B 4B74A 2GT7A 2F9VA 5C1UA 5L6NH 1FIWA 1O2OA 3GCHC 3KQBA 3RXMA 3BG4B 1G2LA 5PTPA 5DP5A 3GCHB 1P06A 3B23B 2C90B 3GY8A 3QTVH 2ZU3A 3SJKA 1PJPA 2H9HA 2VIOA 1CGHA 1TPSA 1M9UA 4H4FA 1N8OC 2THFB 1ZGVA 5GPIB 4MPXA 1ELBA 1Z8JB 4FVDA 1N8OB 2G55A 1NS3A 1YBWA 3KHVA 4HFPB 3VFEA 1VGCC 4B1TA 4I31A 1O3DA 1IQMA 1P2JA 1TBRH 1ETTH 1AD8H 1QBNA 1VGCB 2RCEA 4BAOB 2JKHA 4WWYA 2BVRH 3K6ZA 4X8SH 1ZMLA 2BD9A 4B2AA 4A1XA 3ELAH 4DURA 2EEKA 3GY2A 4E7RG 2FI5E 1CO7E 3H7OA 4BXSA 1GMHG 2Z9GA 4JZIA 1PPEE 4IMQA 1O3OA 3SJ9A 3SNCA 1T32A 1AIXH 3U98H 2VVVA 3I29A 4X8UH 1DLEA 1QRXA 4DW2U 2FIRH 1PQ8A 1MKWK 3BTTE 1JIRA 2G8TA 2WV4A 1YCPH 1A5HA 1XXFA 2SGFE 1DY8A 1AMHA 5A0AE 3A7YA 3P70B 5C1YA 1BB0B 5JYIA 2VH6A 4FUEA 1FAKH 3LDXH 1SQAA 1IQKA 1A0HB 4BTUB 2BLWA 2XXLA 8LPRA 1W11U 3RXDA 1L1JA 4Y7BA 1K1OA 2GDDA 3M3VA 1EB2A 1ZHMA 1MTNC 2EA3A 1FN6A 2WPKS 1ABIH 5E2OA 3UR9A 3SJ8A 2J38A 1O3PB 2JH5D 4TPIZ 2ODQA 2RG3A 3BTHE 3A7VA 1NTPA 2NU1E 3S9BA 4DJZB 1FY4A 2VIPA 1F5KU 1GJCB 3RM2H 3L6PA 4NIXA 3RXTA 3IITA 1C2DA 4NA9H 2AYWA 4ZXXH 3UWIA 1H4WA 2BM2A 1TGCA 1LO6A 1K1NA 4IGDA 1AHTH 1V2LT 3SV8A 5EW2H 2C8XB 1JXPA 2VVCA 4Q7YA 4WVPE 2Y82A 1HAHH 3A8DA 2K1QA 3RUOA 3OY6U 1NY22 4O3TA 1O2UA 1BJUA 1P8VC 4MPUA 4INHA 1AQ7A 2Z3CA 1VITF 1HAZB 2ANKH 2FX6A 3TH3H 1XUHA 2LNCA 4BNRA 3BEFB 3Q3KA 2VWNA 2V3OH 3R0FA 5F8XA 2BYAX 2H1UA 1DANH 4IC5A 4LOYH 5FCRA 2FM2A 1TALA 3SN8A 4NSVA 2D1JA 2BDBA 1FAXA 1ANDA 2TGDA 1WTGH 4BAKB 5A8YA 1Z6EA 3NUMA 3HKIB 4KELA 1FXYA 1FZZA 4WMFA 4BANB 1E38B 3SGBE 1MD7A 4BAQB 2BX3A 1QRWA 3L33A 3PMAB 1QA0A 2W3IA 2BX4A 1PPBH 5C2ZA 2R3YA 3UREA 1FIZA 3SU6A 3RMOH 1O32A 4R0IA 1AB9B 2SFAA 3HATH 1WAYB 2AGGX 1L4DA 1SSXA 3ZVAA 1OWKA 4K69A 4B75A 4X1RU 3TNTA 1GI1A 1FV9A 1V3XA 3KEEA 5E0GA 2WV5A 1QY6A 1EOJA 3NCLA 1G2MA 1TOCB 4KKDA 1F7ZA 1MBMA 3I77A 3MNSA 2WPLS 1JWTA 3ZVEA 1JRTA 4U01A 1W12U 1BBRH 3A87A 3CS7A 3TH2H 3U8TH 2CN0H 5F03A 4DGJA 1IQIA 1H9LB 4OS5A 1P11E 1NFYA 1Y5UT 1A7SA 3A7XA 2XC0A 1RFNA 1ZRBA 1JOUB 1LCYA 4X8VH 1DFPA 3ZZDA 1CVWH 1T8NA 3E8LA 1VZQH 3M37A 1HXFH 1SMFE 4LK4A 2P16A 2UWPA 3S9CA 2OXSA 1C5WB 1LDTT 1RTFB 1KIGH 1NESE 3QLPH 1BA8B 2Y5HA 3LH1A 3RC4A 1P05A 1TAWA 3E6PH 1SPJA 4GUXA 3M3SA 1NZQH 4O9VA 1HAVA 2XBWA 3A85A 3SU0A 1O39A 3V3MA 2Y7XA 3ZV8A 4CR5A 1JIMA 1C9TA 1EAIA 3SJIA 2A1DB 2Z3DA 2HNTC 4NWKA 1QCPA 3F9GA 5F6MA 4NZQA 1BRCE 1GJ9B 1GL0E 3A81A 4U30A 2P94A 2ZDNA 3JZ1B 1EATA 3FZZA 3LU9B 1SGCA 2A31A 1T31A 2CHAC 1G3DA 4OS7A 5L30H 4THNH 1GHXH 5JDUB 1D3PB 2A7HA 2TGAA 2CHAB 1YC0A 4E05H 2BDYA 1XKBC 2BQWB 4YTAA 1C2FA 5BPEA 1C2LA 1CSOE 1BOQA 3NKKA 2PHBA 1A3EH 3UNSA 3DUXH 2W7SA 1DSUA 2ALVA 2NU2E 3BTME 1H8DH 1G36A 1GJ8B 3LGIA 5E2PA 4TWWA 1PQ5A 2ZTYA 2QY0B 3MI4A 3F9HA 3OSYA 4TY6A 2G00A 2TGTA 5AFZH 4DVAU 1OPHB 3EA7A 2ZGHA 1QFKH 3RU4D 1T8MA 2BOHB 1MMJN 2BVXH 4CBNA 1GHBF 3M5MA 2WUBA 2ZIQH 1TNIA 2YNAA 3DFLA 4AX9H 1HYLA 1YPGH 2QC2A 3KQEA 4UONA 3UPEA 3VGCC 1Q3XA 3P17H 3ENSB 4JZ1A 4CRDA 4D76A 1P57B 3SUEA 1W14U 4AB9A 3VGCB 1GI8B 1P3CA 3QZRA 1K2I1 1LPZB 3MO3A 1P3EA 3N7OA 3HGNA 2ODPA 3HK6B 1TNLA 3M7TA 3SO3A 3MH6A 1EASA 4UFEH 1ZHRA 3URCA 1G9IE 2STBE 1BIOA 1IHSH 3EQ0H 1GBTA 1WQVH 5EQSA 3VPKA 1O5GH 2ZGCA 5FX5A 4ESTE 2XC5A 5DG6A 3MU5A 1BCUH 4WMDA 1B0EA 1THRH 3RXHA 3V0XA 1FY8E 5FPSA 4D7FA 3BIUH 4MDSA 1MKWH 1TONA 4NA8A 5DPAA 5A8XA 4IS5A 1E35B 2QCYA 2YNBA 5GXPA 4K1SA 2A4RA 4KGAA 4FUCA 1O2NA 4Y8XA 4WMEA 2A2QH 3PTNA 3EDXB 1YPJH 1OSSA 3DT0H 3PLPA 1ZJKA 4DOQA 4KTCA 4ZMAH 4JMYA 1C5NH 1INCA 1YM0A 1J15A 4AYYB 3TIUA 1KYNA 2AGEX 3HGPA 1XX9A 2QXJA 2VB0A 4U32A 1ANCA 1ARCA 8GCHF 3SGQE 3MO9A 1C5MD 1CHOG 1SQOA 2OD3B 3ATKA 1A0JA 4TWYA 4DT7B 1UTPA 2DE9A 1P2NA 4UFFH 3H7TA 1QBVH 5EQRA 3TLOA 2P93A 2VIDA 4JZEH 2FP7B 4GCHG 1SFIA 4ABAA 2FI3E 2ZFQH 3EGKH 1F5LA 1EOLA 2C93B 5E8EH 1SGPE 1W13U 4FUIA 3PMJA 3VB5A 4I8JA 3A86A 1SFQB 1TPOA 4FU9A 1MTSA 1NU9A 3RXAA 4CRCA 3Q3YA 1W10U 2ZFRH 2OC1A 3BIVH 4A1TA 4BXWA 2UUFB 2UWOA 2ANWA 1TFXA 3MU8A 1OYQA 2ESTE 3RXUA 3U1IB 4AB8A 1P04A 1V2JT 1THPB 3LJOA 3GYMA 2O8UA 2EI6A 3GISB 1LMWB 3SW2B 1W3CA 3B8JA 5FCKA 2GP9B 2FZZA 2ZKSA 4NSYA 3RXEA 3SV6A 1KLJH 1VJ9U 1T8OA 3E16B 2ANYA 3M36A 1C1OA 3UFAA 2JH0D 1AFEH 1EAWA 2A0QB 2F3CE 3P8GA 4DIIH 2GGVB 5F8ZA 3PYHA 2OC8A 1HB0B 2ZPQA 1K22H 3O8RA 1THSH 4X2XA 1UTKA 4OS2A 1H9HE 1MCVA 1F92A 1ZTKA 2FTMA 3FAOA 1S0QA 2GVFA 4XSKU 1HAOH 4KTUA 4GLYA 3VB4A 1KXEA 1MKXK 1XVOA 1GBHA 3TPIZ 1V2TT 1BHXF 1TBZH 3SUDA 3MNCA 2OBQA 2G4UA 3QO6A 1UTLM 1DM4B 1G3EA 1XMNB 5FPTA 2FPZA 3KNXA 3S9AA 4ABBA 1BRUP 1GBJA 5C5OA 1O5EH 1S81A 1BTHH 1GHAF 1GCTB 2CJIA 2ZDMA 3LGVA 1QQUA 4Y10E 1C5OH 2ZDKA 4NGAH 1LTOA 4GVUA 1WUNH 2OC0A 3KN2A 5JB9S 3TK9A 3FP8E 4QT8C 2R3UA 1NN6A 5A0CA 4FUGA 2ZCKP 1GG6B 2ZPSA 9ESTA 3GY3A 4YOJA 3D65E 7LPRA 4XDEA 3FP7E 5FXLA 5AHGH 2ZCHP 4AFZA 2CMYA 2BDAA 1HV7A 1J8AA 1ID5H 1IQEA 4JZDH 5AF9H 4ZXYH 1N1LA 2ZDAH 2B5TB 1NRSH 1ESTA 2YOLA 4CREA 1J16A 3MH4A 2B9LA 3FANA 1TNJA 2A7CA 1K28D 1E36B 1V2PT 1E0FD 3M61U 4XOJA 3BTDE 2Y7ZA 3Q3XA 4Y11E 3P8NA 2VH0A 1O3CA 5EODA 2IN2A 2HPPH 2XC4A 2J95A 5TCCA 1OP8A 1W0YH 1T7CA 2VJ1A 2Z9KA 2OTVA 1DUAA 1H8IH 2W5EA 3S0NA 1FY1A 2ZU5A 2O8TA 4BTIB 2XCNA 1FQ3A 5I25A 5JBCS 2B8OH 4AYVB 1MTUA 1GI7B 4JK5A 1QTFA 2Y80A 5EXMA 3SV9A 3RXQA 3BG4C 1WTHD 1SGFA 3U9AH 1HCGA 1YP9A 3LKWA 1O0DH 1NFUA 1O2TA 3TVJB 2BXTH 1ARBA 4ABFA 2Q6GA 2OCVB 3GY7A 1O31A 2Z9IA 5HM2A 4K8BA 1ZTLA 3LONA 1P09A 1N6XA 1FY3A 3EYDA 1AE5A 1QL7A 1LVMA 2C8YB 1HJAC 3ODDA 1AU8A 1OWHA 1TWXB 3GDUA 5DK1A 1CQQA 1GHWH 2Q6DA 5T6GA 1S0RA 1P2KA 1A4WH 1UTJA 4NCYA 1HJAB 2ZF0H 1O2HA 4RN6A 4ABHA 3RU4T 5HYOA 1RJXB 1UTQA 4Y6DA 1O3BA 2WPJS 1BTUA 1HAVB 4ZKSU 2Q1JA 2TGPZ 3A84A 1XXDA 1CA0C 4ZUHA 2QGRA 4Y71A 2AIQA 3RXOA 1JMOH 2BB4A 2HPQH 2IOTA 1CA8B 1HAIH 1PFXC 2ZHWH 1CA0B 1Z1JA 1J9CH 3UOUA 3ATWA 2ZHDA 1NRNH 4Q7XA 3RMNH 1BZXE 1MQ6A 3SUFA 2G52A 4H42U 2GX4A 3RC5A 6ESTA 4JK6A 2P3TB 2VWLA 2PR3A 1UVSH 1RTKA 4ISNA 2QV1A 3TH4H 1IQHA 1Q2WA 1SG8B 4BAMB 1MQ5A 3DA9B 1GI0A 2A32A 3BN9A 2J92A 2GKVE 2BDGA 1ANEA 1SR5C 2BTCE 2FI4E 2FOAA 1P01A 3QN7A 1UCYK 3E91A 1IOEA 1UHBB 3RXGA 1DVAH 3LGYA 1AN1E 1ZSJA 3SNDA 2Z7FE 3AAUA 3P6ZB 4GHQA 1G37A 2O9QA 5FAHA 1Z8GA 2KAIB 4HGCA 1TMTH 1GVKB 4DG4A 1T4VH 1OWJA 1CGJE 2Z9LA 1GHBG 3ZVCA 2FODA 3RP2A 1DWEH 1Y3WA 1MTVA 1SL3A 1ELTA 1P02A 1UK2A 1QURH 1YCPM 1MCTA 1J17T 3C27B 3M7QA 1TE0A 1BUIA 4I8LA 3NK8A 3SOSA 2Z3EA 5C1XA 2PSXA 2Y5GA 3S69A 3MU1A 1GI5A 1TGSZ 3LOXA 1DPOA 4JYVH 1GWAA 3QZQA 1C1VH 1NRQH 2PKSB 1UTOA 3T27A 3V7TA 2GV7A 1GDUA 3UQVA