1L1GA

The structure of porcine pancreatic elastase complexed with xenon and bromide, cryoprotected with glycerol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE 1
publication title Xenon derivatization of halide-soaked protein crystals.
pubmed doi rcsb
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l1gA01
8KME2 4BNRA 2PWXA 5H4IB 3L3TA 2OP9A 3GCNA 4MVNA 3TJUA 3S9BA 1AO5A 1DICA 2OBOA 3AVZA 4TPYA 1HFDA 2BVRH 1ZSKA 3SGAE 2ZU4A 2H9HA 1FY4A 1SFIA 1ETTH 3T2NA 1AVXA 2C4FH 3C1KA 3BEFB 2PKSC 3DT0H 1EZXC 5EW2H 3QTVH 4BXWA 1GI1A 1DM4B 3TJVA 1J8AA 1JRSA 2BX4A 1O3AA 3RXHA 5DP9A 5C1YA 2VH6A 1O3EA 3MYWA 1FV9A 1BTYA 2ZGXH 4O9VA 1DSUA 1HYLA 5A8YA 3RXDA 1DXWA 3M3SA 3QLPH 1MH0A 4WWYA 4B76A 4I8GA 2AH4X 3JZ2B 1MBMA 1IOEA 1O3GA 4TWYA 2ZFFH 4HFPB 1K21H 2FX4A 2FOGA 1O3LA 2XC4A 1FPCH 2ZC9H 1PPBH 2YNBA 2Q1JA 1TE0A 3LGUA 1ZR0A 4K69A 2JH0D 1MZAA 2QY0B 1QB6A 2Y82A 4E06H 1O3FA 2ZHEH 4X1SU 2FOHA 4X6MA 3OU0A 3VXEH 1GMHF 2XRCA 1MTVA 1GI6A 1NRRH 4LXBH 4ZKOU 1UMAH 3MHWU 2AERH 3GICB 2XNIA 4Y7BA 4O97A 5IYTA 4BAHB 1G3EA 3LC5A 1X7AC 3EA9A 5FBIA 1O34A 4INKA 1VZQH 4K1EA 3GYMA 2GMTB 3MFJA 1L2EA 1O5FH 2B5TB 1J16A 1C1VH 1LVMA 3UNRA 2F9BH 3LGYA 4DG4A 2ZGHA 1TX7A 3LC3A 1NY22 3GCTG 4JZIA 1EUFA 3M7QA 4Q80A 1S0RA 2FPZA 1LPGB 4D9RA 1DSTA 2AFQB 4X8VH 1SGNE 1PYTD 4ISHH 1RXPA 1O2TA 4KTSA 1O2IA 4UFDH 3T29A 1NFYA 1C2MA 2AIQA 1TOMH 1UK4A 3PROA 4DCDA 1FZZA 1QJ6B 3TGJE 5I25A 2O8MA 1MTUA 1INCA 1BRAA 2BDHA 1JBUH 1C5PA 2CN0H 3EYDA 3DUXH 3PWCA 4UFGH 1AN1E 2AIPA 1FY1A 1C1SA 3LH1A 2KAIA 4GPGA 3FP7E 3FFGA 2Z6BD 4BTTB 2DE9A 3TITA 4TY6A 1QFKH 1TALA 2PW8H 2ZDKA 1CU1A 1C9PA 1P2OA 1TPAE 3LIWA 1O2VA 1C2FA 2BY7X 3UQOA 1K1PA 4KELA 5C5NA 1XKBC 2FI3E 4WXIA 1IQLA 1P2NA 2H6MA 3D49H 3VB4A 3W95A 1O2JA 1F5LA 2BD9A 1BUIA 2ZKSA 4MG3A 1P02A 5LPRA 1YP9A 1UHBB 3EA8A 3SU1A 4ZXXH 2ZZUH 2VIDA 1Y3UA 4ASHA 5BRRE 4AOQA 3GDSA 2BD5A 2HRVA 5JYIA 1DLEA 1D3QB 1QL7A 3A7VA 4GSOA 3VXFH 1PJPA 2BX3A 2W3KA 3UOPA 4YOGA 4A5TS 2ZDNA 3QUMP 1YPEH 1JWTA 1GHAF 1MKWK 1C2JA 4GCHF 4BXSA 4CRDA 4I8JA 5TJXA 5JDUB 3RLWH 1THPB 4AB9A 1TOCB 1EOJA 4DY7B 5EU8A 1HB0B 2GX4A 1CBWC 3RXBA 3RXGA 1ESAA 2F9PA 1GMDG 1O39A 2VIWA 4X6NA 1HAIH 3ZZ6A 2OLGA 1XUIA 3MU0A 4X8SH 1KXDA 1O3DA 1VITF 2G00A 4AFQA 6CHAC 3BTWE 1UTOA 2F9OA 2WV5A 1C1NA 1FIZA 2R9PA 5EGMA 1C1UH 4NZLA 1C2DA 4ABEA 1ELVA 1ZMLA 2ZGJA 4H42U 4XSKU 3TU7H 3IITA 3F9EA 4QT8C 3C27B 2XCFA 1QRWA 5C67A 4AYYB 1HAHH 3Q3YA 1FONA 2PGBB 2Q6DA 5GCHF 3LKWA 5TCAA 2BY6X 3A7ZA 2Y5HA 1IQFA 2HOBA 1QQUA 1SLWB 1SGPE 5AFZH 4JYUH 1AFQB 1VCWA 2BQ6B 3RXSA 2VIQA 1ZHMA 3OY5U 1DX5M 4OGXA 1FPHH 1Y3VA 1G37A 1W3CA 1GVZA 4NSVA 2FMJA 2QXGA 1UTNA 2VWOA 1QJ7B 1QCPA 3PMAB 3MH5A 1AHTH 4FU7A 3SNCA 1OWKA 1W13U 2ZU5A 2M5TA 2V35A 1GL0E 1IQIA 2H2ZA 2QXHA 1TMTH 3FANA 1C1WH 2AYWA 4UD9H 4AFUA 1PPHE 4K1SA 3RC6A 4ABHA 1NO9H 4NFEA 3RXLA 1FY5A 1DANH 2GTBA 1O3CA 5EXMA 5IDKA 3LH3A 2RG3A 1OYQA 3KIDU 2WYJA 4FU9A 4PROA 3NWUA 4IBLH 1W8BH 1TNJA 2F91A 2TIOA 2BDBA 1ZTKA 5LGOA 1C1OA 4A1TA 3RXUA 1GJ4H 4TYDA 1Z6EA 1ZJKA 1AE8H 4O3TA 4U2WA 1V2QT 1GJ9B 3U8TH 2C8YB 2ZTZA 3DA9B 1C2KA 1A0HB 1T4UH 5E0JA 1RTFB 4KP0A 4JCNA 2F9VA 1WTGH 2ZCKP 1VGCB 3PLKA 2ZDLA 1TMBH 2FX6A 2G4TA 1ZMNA 1ACBE 2SGPE 3PM3A 5EQQA 5JBCS 1CT0E 4FU8A 1CBWB 2GDDA 1CSOE 1C5LH 3TK5A 2BHGA 1A7SA 4IC6A 5BPEA 3ZZ8A 1SR5C 1TLDA 1MAYA 4ZKRU 4MPVA 1RGQA 1ZMJA 1HLTH 2ZO3H 1C2GA 3FP8E 6CHAB 1EZQA 1BQYA 1DDJA 4B75A 2ALVA 3E6PH 4Y11E 4MNYA 2O9QA 1UK2A 5A0BA 2A4OA 4ZKNU 2P93A 2WPLS 3ZVGA 5E2PA 2FS8A 3E0PB 5FHTA 1SMFE 1Z8RA 4IMQA 4CRGA 2ZHFH 1Q2WA 3MNSA 2W7SA 1C5WB 1IQKA 4Y10E 1AWHB 1CGIE 3BTGE 2J9NA 5EXLA 1TQ7B 1EKBB 2ZHDA 4FUHA 4GVUA 1AB9C 4NA9H 1EJMA 1NN6A 3QN7A 2ZHQH 3SORA 4D9QA 4VGCB 3SI3H 2OTVA 1GHZA 2AMQA 3FVFB 3F6UH 1F92A 3TH4H 1K2I1 3SV6A 2C8ZB 2PHBA 2BDGA 1GBLA 1GBCA 2GCTC 5AVDA 4AFZA 1Z7KA 1PQ7A 3PMBB 4Q7XA 1GJBB 1UVSH 2O8WA 1GWAA 1V2ST 1UCYH 3P8FA 1BA8B 1NESE 2DE8A 5ESBA 1GJDB 1ELDE 1NM6A 3E3TA 2QXIA 1UTMA 2F83A 1YBWA 2BOKA 5T3HA 1T7CA 4MQAA 3A7WA 3ITIA 1AKSA 2WPIS 1MTNB 4DOQA 2ANMH 2G55A 1SGDE 3ZVCA 3M35A 1K9OE 6LPRA 3SZNA 6ESTA 5GWZA 5C20A 5FXLA 3ATLA 1Z8JB 2ZU2A 1C5UA 2NU4E 3GISB 5FCKA 2ZCHP 1GI3A 4Y8ZA 1C4V2 3N7OA 2GZ9A 3TLOA 2BXUH 3RC4A 3BTEE 4LZ1H 1C5RA 1BJUA 4A7IB 1M9UA 4NIYA 5I46H 1L4ZA 1SHYA 4ABBA 1GBTA 3FZZA 3HATH 2ANKH 3ELAH 1ELCA 1WSSH 2HVXA 1EPTC 4J1YA 2AEIH 1GI2A 1KXAA 2TBSA 3VEQB 2XBXA 1HPGA 2A31A 3K6YA 4E7NA 1MKXK 3OTJE 3KQDA 3UPEA 2IN2A 2XBVA 1BTPA 2R2MB 1LKBA 1BCUH 3IWMA 3ODFA 1CA0B 2SGEE 2NWNA 1YYY1 4A92A 1S82A 2W7UA 4X1PU 3SHAH 1OXGA 1JMOH 4ABIA 1GBKA 1Y5UT 3SUGA 1A3EH 1DY8A 1ANEA 1O3KA 1F7ZA 1LVOA 1NRPH 5F8ZA 2J4IA 3KHVA 1OYTH 2Z7FE 1NT1A 1WAYB 1QNJA 3RXMA 4A6LA 9ESTA 1FIWA 2GT7A 1P09A 4HGCA 3MU4A 1ABIH 1HAZB 4R8TB 2IOTA 3RXOA 3SUEA 2BZAA 1C5TA 2GCTB 3UOUA 4AGKA 1Y3WA 2HPPH 1Y59T 2ZIQH 2ZFPH 4YZUA 4BAOB 1OWHA 1FY3A 1GG6B 2J38A 3GY7A 1CE5A 3SJ8A 5JB9S 3NKKA 2BOHB 2TGAA 3RXVA 1A61H 1GVKB 5DG6A 3M61U 2VB0A 5DK1A 1O2GH 1W7XH 2H1UA 3KCGH 1N6YA 1O2QA 5GXPA 5HYOA 2A7HA 1S5SA 2B0FA 1LQDB 1VJAU 1QBNA 1G9IE 2BVXH 1O35A 3TH2H 1C1TA 2ZU3A 1GJ5H 3M36A 4O3UA 5EW1H 1SOTA 3UWIA 3NXPA 1CHOG 4ZROA 1FAXA 4U01A 2FOBA 1WTHD 1H4WA 2BLWA 2ANYA 3Q3KA 1OWJA 2FI5E 1GBFA 4I7YH 3UR6A 2YOLA 2JETB 2ZPQA 3D65E 2Y5FA 1ZHPA 3ATMA 4SGAE 1SQAA 2VVVA 4D7FA 4IMZA 2ZQ2A 4THNH 1UTJA 1EPTB 4J2YB 3UFAA 4H4FA 1O38A 1EXFA 1HV7A 5J4SA 2VWLA 1MZDA 2BMGB 2VJ1A 3RLYH 1GDUA 4Y76A 4CR5A 1O2ZA 5CE1A 1XVMA 2EEKA 1YM0A 3T62A 1FN8A 5GPIB 2WPKS 1AQ7A 1ZSJA 3RMLH 5HM2A 1BDAA 1W7GH 1MMJN 5HGGA 4INHA 1V2UT 3H7OA 1BRBE 1MAXA 1K1OA 1T8MA 3AW0A 3E16B 2GMTC 5DP7A 3UNQA 1LHFH 3M37A 1B0FA 1DY9A 1KXEA 1SL3A 1CHGA 1HJAC 1F5KU 2EI6A 4CREA 2J94A 3MNBA 1EB2A 2ULLA 1TA6A 2NU3E 1A5IA 1F5RA 1AI8H 1RS0A 5DKMA 3U1JB 4YOIA 1DE7H 2XWAA 4AFSA 2D8WA 5GJ4B 2R0KA 4HTCH 1F0UA 1LMWB 3PMHB 1P0SH 1GDQA 3T27A 1KY9A 3PWBA 4I8HA 1O2MA 1VCQA 2JH5D 3SNEA 1IQMA 1BTUA 4UE7H 1LHDH 5EQRA 2A4QA 1OOKB 5T6FA 3M3TA 3S9CA 3A8BA 1XM1A 4JK6A 1SSXA 1SGIB 3P17H 3F9HA 2D2DA 1QGFA 1AD8H 2EI8A 1EZSC 1BTWA 2Y6TA 1TNKA 1C1PA 1AE5A 1O3JA 1GI7B 2QC2A 3K65B 2BD3A 1G3CA 1XXFA 1A2CH 2Z9JA 1P2JA 1G36A 1ZPCA 1E37B 1HRTH 2H5CA 1BJVA 3EE0B 3RXPA 5EG4A 2THFB 3MMGA 7GCHF 3ZZ7A 5LH8A 2FYQA 3T5FH 4DIIH 1L1GA 1Y3YA 4XBDA 2VVCA 1RIWC 4X2YA 3SJOA 3ZZBA 3R0FA 3DHKH 4RKJB 2QCYA 4JZFH 3LPRA 4WMFA 5DO4H 3ENSB 1P2IA 1B7XB 3SNDA 2UWLA 5L2YH 3RXJA 1OX1A 1TBQH 4NSYA 2SFAA 1SLUB 3SI4H 1G2LA 1J9CH 1OWIA 2PLXA 1O36A 3ZVDA 2OC1A 2TGTA 2HALA 2QAAA 1C1MA 1QA0A 1S83A 1DUEA 3EDXB 2A2XH 3QO6A 4GUXA 1QL8A 2QF3A 1HAPH 1O2NA 1TIOA 3RDZA 2UUJB 3HK3B 3CP7A 1YCPK 1HJAB 1H8IH 3P6ZB 3RMOH 4OS5A 4LZ4B 1FAKH 4CH8B 1YLDA 2ZHWH 1TX6A 3PO1B 1P9UA 1S85A 3P95A 5HMAA 5PTPA 3EAJA 4IGDA 1W2KH 4AX9H 3TK9A 3AAUA 4KTCA 3TJOA 3T25A 1F0RA 1O2KA 1BMNH 1V2PT 3MU8A 4ABGA 4Q7YA 1AFQC 4K2YA 4F49A 3CENA 1BBRK 1G3BA 2YNAA 1RJXB 3P8GA 1JIMA 1C2IA 1P04A 3BTQE 3FP6E 4MNXA 1HIAB 4NIWA 3RXQA 3A82A 3QK1A 4CRFA 5F03A 1W11U 2BB4A 1ELBA 3F9FA 4FXGH 2BQ7B 4H6SB 3ZVBA 2HNTF 1J15A 1V2JT 4CBOA 3STJA 2OUAA 3BSQA 4FUDA 3PLPA 1Z8IB 1C2EA 1LHGH 1ANCA 1W0YH 3R3GB 1ELTA 3SU0A 2FEQH 1AIXH 1DLKB 1RIWB 3A7XA 5JBBS 8LPRA 4Y7AA 4O03A 1H9LB 5E0GA 1ZYOA 7KMEH 1HJ8A 3MO6A 1EAUA 1EASA 2VWNA 3V7TA 1PFXC 2Y80A 2ODPA 4X2XA 1PQ5A 1V2VT 3S7KB 3SNBA 4Y0ZE 2JH6D 1N8OC 1V2MT 1GHVH 5EPNA 1Y8TA 2JKHA 1UJ1A 4AZ2B 4DURA 3MNXA 1FMGA 1VGCC 1EATA 2W26A 1P2QA 1ZTLA 1MCVA 1HAVA 2ZGCA 2G5VA 5DJ7A 2BY8X 3RXAA 4WF8A 3QTOH 4XFQA 2A4RA 1LTOA 1DWCH 1SLXB 2J34A 1DWBH 1T8NA 1XXDA 4KGAA 1SPJA 2PKAB 2P95A 2EI7A 1WQVH 3QDZB 1QL9A 1H9HE 3LGTA 2TGPZ 2PTNA 1QRZA 2SNVA 4NWLA 5F8XA 4JZDH 3TK6A 4SGBE 2HNTE 4HZHA 3A89A 5A09A 1TGSZ 1HXEH 3A7TA 3ZVFA 1YCPM 1KDQA 2VGCB 3B8JA 1ZGVA 3M5OA 3Q3XA 3M5LA 3A7YA 1GI4A 5TCCA 1CT2E 2LPRA 3AW1A 1GI0A 1EQ9A 4DIHH 3Q76A 1Z1JA 3L6PA 3SN8A 5FCRA 3GDVA 3SGBE 2VH0A 1B5GH 1GJ6A 1MD7A 3U8OH 2A5AA 1FNIA 4WXVA 2AGGX 1SFQB 2VIPA 1K22H 1EX3A 4UFEH 2ZFRH 3GDUA 2VNTA 1AU8A 4K60A 4VGCC 1XVOA 4ABFA 8GCHF 4XBBA 1A46H 3TNTA 2P59A 1TBRH 3MWIU 3E8LA 1OPHB 4ISOA 1A5GH 4X8UH 3KNXA 1H8DH 2FIRH 3DFJA 2FOCA 1GHBG 3MOCA 2SGFE 2ANWA 4TPIZ 3URCA 1T4VH 3M5NA 1MCTA 1BTZA 1O33A 1MQ5A 4CRCA 1O3BA 4JZ1A 1CGHA 2AGEX 2PSYA 3S69A 5JPMH 4IN2A 2CXVA 1XUGA 2STAE 3G01A 1FQ3A 2BD7A 2BM2A 1XMNB 3GY6A 1BHXF 1EZUC 2Z3CA 1Y5BT 1MTNC 4X2VA 2C90B 3TVJB 1BTXA 5F8TA 2CMYA 5ABWA 5T6DA 1N8OB 2O8LA 3VGCC 3SJIA 3PTBA 1UVTH 2FOEA 2ZCLP 1PPEE 3VB6A 2XYAA 3SV8A 5HM9A 4XBCA 1XKAC 3HGNA 5C3NA 1ELFA 3STIA 3RXFA 3VFEA 1A0JA 1OSSA 1EOLA 2OQ5A 3KEEA 2AMPA 2PTCE 2ZDVH 4Z0KA 4TWWA 5FX5A 1PPFE 1BOQA 2Z9GA 4X1QU 1Z8GA 2V3HH 3SUFA 1OKXA 4WH8A 1TWXB 1VCPA 2ODYB 3A8CA 1P05A 1TGCA 2WPJS 3ZZAA 1L0ZA 1G30B 2BD8A 3RU4E 3JZ1B 4D7GA 3LONA 2FS9A 3PMJA 3ZZ9A 4TY7A 2ZP0H 1O30A 2A5IA 1P03A 4KTUA 1TABE 4OS4A 3U98H 4FVBA 1KLIH 2VIVA 3SU4A 3UR9A 1EAXA 3S7HB 2FXRA 1CA0C 1EAWA 1P12E 3SV9A 3LJJA 3P8OA 1C4Y2 1TGTA 2ZFTA 1TGNA 3E0NB 3BIUH 3ZVEA 1UO6A 1GL1A 1OWDA 4Y71A 2H9EH 1O2YA 1LO6A 1SGTA 1DXPA 1LDTT 1O3HA 2Y5GA 1C1RA 2OQUA 1LPKB 1SOZA 3VB3A 2PSXA 2XC0A 3SHCH 1BMLA 1THRH 2FTLE 2A2QH 1NU9A 4WH6A 1C5NH 4RN6A 4AORA 2HGTH 4FUBA 1GPZA 1BT7A 2FI4E 5ETXA 1AUTC 2NU1E 2P16A 3BIVH 1GG6C 2G51A 1S6FA 4BOHA 1P9SA 3GCTF 1TA2A 2UUYA 1GMHG 3M5MA 3LJOA 1OP8A 1TRNA 2BLOA 1ELEE 2Z94A 3F9GA 4MNVA 5FAHA 3RC5A 3SV7A 4YESB 1CVWH 1D6WA 3SQEE 2VU8E 2CGAA 3SU2A 1SHHB 3VGCB 1GHYH 2BY9X 5CMXH 2J95A 2FP7B 1GBIA 3TIUA 4DJZB 1SQTA 3ATKA 1C5SA 1C5XB 2KAIB 3HGPA 5DGJA 4NG9H 1N1LA 1QR3E 4DVAU 3IG6B 2F3CE 1XX9A 2JETC 3BG4B 1GBAA 1A3BH 4HI3A 1OWEA 4X1RU 5FPSA 2QA9E 1QRXA 2K1QA 3KQBA 4I31A 4KKDA 1P06A 4NGAH 3BTFE 3MNCA 4Q2KA 5EPYA 2J2UA 3ZZ4A 5EQSA 3PLBA 1U6QA 4INLA 3BV9B 4WMEA 1C5ZB 1HXFH 3RM2H 4CH2B 1HUTH 2BLQA 3ZZCA 1QQ4A 3GYLB 4FUJA 3A83A 1GBJA 2UWOA 4NWKA 1GHWH 1NFUA 1BMMH 3KGPA 3Q00A 1H1BA 3B23B 1D3DB 1YGCH 1NZQH 3M3VA 1C5MD 1O3PB 2CHAB 1GBHA 3RMNH 2D1JA 1KTSB 3AASA 2ODQA 2ZU1A 2A32A 3LT3A 1IHTH 2ZPSA 1QIXB 3BEUA 2HWLB 3KN2A 2P3FH 3ZYDA 1ZPBA 1WUNH 4OS2A 2FLBH 1FLEE 3TPIZ 1GMDF 2F9NA 1Q31A 1BBRE 1TYNA 4JZEH 1P01A 2XXLA 3RMMH 2DUCA 3A80A 3BTTE 1UHBA 2ZI2H 4IC5A 1PPCE 4I8LA 1TB6H 3A87A 2VVUA 1O2UA 3LU9B 3P70B 1O5GH 1IQJA 5A8XA 2Y7XA 4AYVB 1KSNA 1DT2A 5L6NH 3UIRA 5L30H 1TNLA 2GCHG 4JK5A 1AMHA 3MO9A 2CJIA 5C5OA 1O3MA 3MO3A 3QGNB 1QTFA 4OS1A 1O2LA 3S9AA 3HKIB 1LPZB 1P2MA 4ZUHA 1DFPA 2GV6A 3MH6A 1SI5H 5DPAA 1O2HA 3FZDA 1PPGE 5LPFA 5AF9H 1MUEB 1GBDA 4F4OC 5FBEA 2HNTC 3RU4T 2STBE 2I6SA 1Y5AT 1EJAA 3SJ9A 1ARBA 1EP5A 1O3NA 2IJOB 2C93B 2BY5X 4FUGA 1QURH 1E36B 4CRBA 4AG2A 2ZGBH 2A5KA 5GCHG 2P3TB 1GHBF 2VWMA 2ZQ1A 3RP2A 1SB1H 1SGRE 1LVYA 4B74A 2Z3EA 3A88A 2IPHA 4WJG2 2GVFA 2C8WB 3LOXA 2J92A 1VR1H 3BTDE 1TGBA 3RXCA 3BN9A 3PTNA 1CQQA 1E35B 1V6DA 1ZRBA 4X8TH 4BTIB 1GMCG 1E38B 1UTLM 1V2NT 4Z6AH 1PQAA 2D26C 2PV9B 2C3SA 4GAWA 3PO1C 1GCTB 1SGCA 4YT6H 1V2LT 3M7UA 2FDAA 5G4BA 1SVPA 2O8UA 1MBQA 1A0LA 3BTME 1NC6A 2ZECA 3WY8A 4JMYA 4B2BA 6GCHG 1HCGA 1C2HA 3E1XB 1SG8B 3GY2A 4K3JA 1VJ9U 3H7TA 1QJ1B 1AFEH 2BYAX 1O5BB 1ZZZA 1K1IA 1TRYA 1HJ9A 1UK3A 1L4DA 3U1IB 1S6HA 3RXKA 5GDSH 2AMDA 5AFYH 4Y8YA 1NPMA 4K1TA 2QYIA 3OY6U 3LGIA 1YC0A 5CHAC 1P57B 3UQVA 3ATIA 2B8OH 1LKAA 3EA7A 3GY5A 1TRMA 1O3OA 1W10U 1ZRKA 1YPHE 2RDLA 1TNIA 1TBZH 2ZA5A 1P11E 4NIXA 5A2MH 1TMUH 3SJKA 4NA8A 1IAUA 2A7JA 1HGTH 3QGJA 5EXNA 1C5OH 2ZDMA 4Y79A 2H9TH 2FLRH 2Z9LA 5JBAS 1D6RA 4FUFA 2Z9IA 3K6ZA 2VIOA 3A84A 5DP3A 1D9IA 3A8DA 1SGQE 1IQNA 1YPGH 1B0EA 1AWFH 4NA7A 1E0FD 3PYHA 5B6OA 3D62A 2FZZA 1MKXH 1KXFA 2BLVA 1AKSB 2QXJA 4LOYH 4E7RG 1NS3A 1C4U2 1O2OA 4CHAB 1D3TB 2SNWA 3RM0H 1GBMA 5C2ZA 3NK8A 4IS5A 2WPHS 4U32A 2G4UA 2RCEA 3GY4A 4X2WA 1TQ0B 1NRNH 3SV2H 3QZQA 1TX8A 1TPSA 4Y8XA 1QHRB 2WYGA 1EJNA 5ESTE 1CT4E 3GCOA 1FDPA 4UEHH 2GKVE 3BEIB 1Q3XA 2ZFQH 4WY3A 2VGCC 4BAMB 3TGIE 1GBBA 1EP6A 2GD4B 2LNCA 4ABDA 1BRCE 3GCHB 4WVPE 4FUCA 4YTAA 4XE4A 1L1JA 1S81A 3CS7A 3UWJH 1OS8A 2B9LA 2CF8H 2OD3B 4ZMAH 1LQEA 1Z71A 3GY3A 5CHAB 4UDWH 1MQ6A 3P8NA 1JRTA 1HAGE 3O8BA 1VITH 1O37A 3BF6H 3KQCA 2ZFSA 1MU6B 2QV1A 1G32B 8ESTE 2UWPA 1NRQH 1O2WA 4GLYA 4B2CA 4YLQH 3K2UA 1NFWA 4NZQA 4Y0YE 2PKSB 2PGQB 1ARCA 4YM9A 1TNHA 1UTKA 2G81E 1EAIA 2V0BA 4RKOB 1FI8A 5A0CA 3UTUH 3O8CA 2XCNA 3M7TA 3PB1E 1FY8E 4ZAEA 2FM2A 1TPPA 4ISIH 3EGKH 3PV4A 2FOAA 1SGYE 2G8TA 1UCYK 5DP4A 1O5AB 2TGDA 3VB7A 3RUOA 1V2WT 5K7RA 1ZLRA 1XUHA 2W5EA 1BMAA 1C2LA 3SO3A 1BHXB 2O8TA 3V13A 1HNEE 3U9AH 1L1NA 2XTTB 2CV3A 2RA0A 2WV4A 4CRAA 1ETRH 1QBVH 2SGDE 1NROH 1D3PB 2Z9KA 1WQSA 3SU3A 4XDEA 2ILNA 3A85A 5C1UA 3BTKE 3MI4A 2TPIZ 4OGYA 4YLUA 1HDTH 2F9UA 2GCHF 2ZWLH 3RXRA 1RD3B 2OBQA 3ODDA 4X0WU 1GJAB 1CHOF 3OYPA 2H5DA 1F2SE 1GHXH 1QY6A 4DT7B 2GP9B 1AUJA 4ZHLU 1P2KA 4B71A 1O5CB 2A45B 1RFNA 1FXYA 3RXTA 1QB9A 1ZTJA 3T28A 4I32A 5A8ZA 1ID5H 1WV7H 1QB1A 2P8OC 3HK6B 3W94A 4B2AA 2BDCA 3BG8A 3H5CB 5E0HA 4B1TA 1TFXA 2HPQH 2ZTYA 1LHEH 5LPEA 1BB0B 4NCYA 1LVBA 1P10A 1O2SA 2OXSA 2ZNKH 5EODA 1GCDA 1YF4A 4UONA 1DS2E 1AZ8A 4ZXYH 1G3DA 1GJ7B 2SGQE 2PUXB 3A8AA 5FX6A 2AGIX 3ZV8A 4JYVH 4D8NA 1RTKA 4UFFH 2WUCA 5EOKA 1K1NA 3SNAA 4NIVA 2ZDAH 2GGVB 1PQ8A 4X6OA 1O5DH 2SGAA 5A0AE 1GMCF 1IQHA 1C5QA 3SW2B 2ZPRA 3U8RH 4ZKSU 2OCVB 1LCYA 2VINA 4FUEA 1UTQA 1UVUH 1GI5A 4AGJA 1YPJH 1IQEA 4GHQA 1K1LA 1IQGA 1ETSH 2GV7A 3A86A 2Q6GA 6GCHF 1EPTA 3MU1A 3ZZ3A 1O2XA 1V2OT 1ORFA 2ZG0H 4U30A 1DWDH 1CA8B 1O5EH 4DGJA 3ZV9A 1TONA 1DOJA 4X1NU 1T32A 1CO7E 1W12U 1GJ8B 4BANB 3P92A 1ZSLA 2ASUB 4I33A 1HAXB 4K8YA 1JIRA 4MPXA 1O0DH 5F6MA 3BG4C 3E90B 3ESTA 4BAKB 1NRSH 1RRKA 1V2TT 3TH3H 2NU2E 2FO9A 1AVGH 1T8LA 2PR3A 4D76A 3D23A 2A7CA 3F68H 1DUAA 1YCPH 3I29A 2ZF0H 4FVDA 4Y6DA 3SQHE 3V12A 1PPZA 5FPYA 1ZGIA 1UTPA 1Z1IA 2ALPA 1MTSA 1ANDA 1YPKH 2A4GA 3E91A 2G5NA 2Y7ZA 2FESH 1CGJE 3V0XA 3SUDA 2CF9H 3ZZ5A 3KF2A 5AHGH 2EC9H 1ELGA 3CS0A 1GGDC 4OS7A 1O3IA 3NUMA 1TAWA 3QWCH 2I6QA 2P8OB 1KTTB 2RA3A 4WMDA 1EB1H 1K1JA 2V3OH 2PFEA 4YT7H 1WU1A 2BD2A 1A5HA 1W0ZU 2CHAC 1ESTA 1V2RT 3UNSA 3V3MA 1Z6JH 1BBRH 1AGJA 4ABJA 2FTMA 4GHTA 1YPHC 3F1SB 1DVAH 4IW4E 5GIBA 1E34B 1KLJH 2G52A 2R3UA 2BD4A 2Q6FA 7GCHG 4ZHMU 1KYNA 1OP0A 4ISNA 4R0IA 2W3IA 4M7GA 1GVLA 5E2OA 1NU7B 1HAYB 2V6NA 1PYTC 1YLCA 4ESTE 1O2RA 1P3EA 4AG1A 3ZZDA 5JBTA 3UUZA 1JXPA 2GT8A 1HAOH 1G2MA 2QF0A 1GDNA 2EA3A 2XC5A 1KLTA 1A4WH 1MTWA 2GZ7A 1J14A 3ZVAA 5JB8S 1A1RA 1ELAA 2BVSH 1IHSH 1AVWA 3RU4D 3OX7U 3MH4A 1MKWH 1S84A 3NCLA 4YOJA 1SGEE 1NTPA 3NPSA 1K28D 3SBKA 2GDEH 4A1VA 1SC8U 4BAQB 1DWEH 5T6GA 1D4PB 2FOFA 1MU8B 2B7DH 1BITA 3KQEA 1KXCA 1SGFA 1ZHRA 3URDA 3KL6A 1BIOA 3FAOA 1HBTH 1T8OA 3MTYA 1UVOA 2R2WU 2ZEBA 1QBOA 4H6TA 3AAVA 4OS6A 3MH7A 1GGDB 2UUFB 3BTHE 2BZ6H 3DFLA 1Y3XA 1RTLA 2GZ8A 3T26A 1H9IE 2OC0A 4AB8A 1TNGA 4JYTA 4MPWA 4CBNA 2FODA 1V2KT 2NU0E 1W14U 2A0QB 1HAVB 2ESTE 3MU5A 4K8BA 1SBWA 2BDYA 4X6PA 4NFFA 1GCTC 1AZZA 1ZOMA 4B73A 2XBYA 5L2ZH 2QIQA 2XW9A 9LPRA 1OP2A 1XUJA 1WCZA 2BXTH 1HIAA 2XWBI 5DP5A 4RSPA 4E05H 3L33A 1P8VC 3LGWA 1T31A 1AB9B 1P3CA 4BTUB 1KIGH 2QGRA 3SU6A 1WBGB 2C8XB 1GI9B 1GJCB 1BZXE 5E8EH 3RXIA 1KXBA 3NZIA 3SU5A 4K5ZA 5HXFA 4CR9A 3B9FH 5FPTA 2XBWA 1KDQB 4LK4A 4XOJA 4ABAA 2WINI 7ESTE 1YPMH 2OC7A 4AN7A 1GHAG 4GCHG 3LDXH 1FUJA 3O8DA 3HPTB 5K0HA 3I77A 1SGFG 1SQOA 3Q77A 4DW2U 3ZYEA 3GOVB 4A1XA 1O2PA 1AY6H 3VB5A 4ZHAA 3A81A 2P3UB 3QZRA 5J4QA 1UVPA 1THSH 1F0SA 1O32A 3ATWA 3U69H 2UUKB 4Q7ZA 1VITG 3LGVA 1S0QA 1YKTA 1UCYE 1C9TA 1LHCH 2OINA 4MTBA 4ISLA 1O31A 3DD2H 1K1MA 2FWWA 5C1XA 3QX5H 2PKAA 2QN5T 4MNWA 2A1DB 3TGKE 1F0TA 1FN6A 5DP6A 2HLCA 2PUQH 3OSYA 1ZJDA 2TRMA 5DP8A 1XUFA 1FJSA 3HKJB 1TPOA 2P94A 2BQWB 2AS9A 3TNSA 3RXEA 1GBEA 1XUKA 4I8KA 4CHAC 3UY9A 4MDSA 3SOSA 3S0NA 2FOMB 1V3XA 2R3YA 2ZTXA 2BDIA 1BRUP 1C1QA 2OC8A 1C5YB 2FYRA 8GCHG 2Y81A 1ZPZA 3SGQE 3EQ0H 1ABJH 3I78A 4ZH8A 2WUBA 1DITH 5SGAE 2WPMS 4FUIA 1WYKA 3VPKA 1YPLH 7LPRA 4MLFB 1WOFA 1ANBA 3GY8A 1JOUB 1BTHH 2BDAA 3UREA 1QA7A 4IN1A 2R0LA 1GI8B 3K9XB 1C5VA 1NFXA 1ESBA 3GCHC 4MPUA 2BTCE 3TJNA 1SLVB 2Z3DA 1MD8A 3O8RA 1N6XA 1DPOA 1J17T 4YO9A
chains in the Genus database with same CATH superfamily
8KME2 4BNRA 2PWXA 5H4IB 3L3TA 2OP9A 3GCNA 4MVNA 3TJUA 3S9BA 3F3BA 1AO5A 1DICA 2OBOA 3AVZA 4TPYA 1HFDA 2BVRH 2KCAA 1ZSKA 3SGAE 2ZU4A 2H9HA 1FY4A 1SFIA 1ETTH 3T2NA 1AVXA 2C4FH 2LELA 3C1KA 3BEFB 2PKSC 3DT0H 1EZXC 5EW2H 3QTVH 4BXWA 1GI1A 1DM4B 2EQNA 3TJVA 1J8AA 1JRSA 2BX4A 1O3AA 3RXHA 5DP9A 5C1YA 2VH6A 1O3EA 3MYWA 1FV9A 1BTYA 2ZGXH 3F0PA 4O9VA 1DSUA 1HYLA 5A8YA 3RXDA 3NRLA 1DXWA 3M3SA 3QLPH 1MH0A 4WWYA 4B76A 4I8GA 2AH4X 3JZ2B 1MBMA 1IOEA 2QE7D 1O3GA 4TWYA 2ZFFH 4HFPB 1K21H 2FX4A 2FOGA 1O3LA 2XC4A 1FPCH 2ZC9H 1PPBH 2YNBA 2Q1JA 1TE0A 3LGUA 1ZR0A 4K69A 2JH0D 1MZAA 2QY0B 1QB6A 2Y82A 4E06H 1O3FA 2ZHEH 4X1SU 4B6EA 2FOHA 4X6MA 3OU0A 3VXEH 1GMHF 2XRCA 1MTVA 1GI6A 4P02A 3OE7D 1NRRH 4LXBH 4ZKOU 1UMAH 3MHWU 2AERH 3OAAD 3GICB 2XNIA 4Y7BA 4O97A 3F2GA 5IYTA 1G3EA 4BAHB 3LC5A 1X7AC 3EA9A 5FBIA 1O34A 4INKA 1VZQH 4K1EA 3GYMA 2GMTB 3MFJA 1L2EA 1O5FH 2B5TB 1J16A 1C1VH 1LVMA 3UNRA 2F9BH 3LGYA 4DG4A 2ZGHA 1TX7A 3LC3A 1NY22 3GCTG 2V3MA 4JZIA 1EUFA 3M7QA 4Q80A 1S0RA 2FPZA 1LPGB 4D9RA 1DSTA 2AFQB 4X8VH 1SGNE 1PYTD 4ISHH 1RXPA 1O2TA 4KTSA 1O2IA 2PP6A 4UFDH 3T29A 1NFYA 1C2MA 2AIQA 1TOMH 1UK4A 3PROA 4DCDA 1FZZA 1QJ6B 3TGJE 5I25A 2O8MA 1MTUA 1INCA 1BRAA 2BDHA 1JBUH 1C5PA 2CN0H 3EYDA 3DUXH 3PWCA 4UFGH 1AN1E 2AIPA 1FY1A 1C1SA 3LH1A 2KAIA 4GPGA 3FP7E 3FFGA 2Z6BD 4BTTB 1W0KD 2DE9A 3TITA 4TY6A 1QFKH 1TALA 5DN6D 2PW8H 2ZDKA 1CU1A 4YXWD 1C9PA 1P2OA 1TPAE 3LIWA 1O2VA 1C2FA 2BY7X 3UQOA 1K1PA 4KELA 5C5NA 1XKBC 2FI3E 4WXIA 1IQLA 1P2NA 2H6MA 3D49H 3VB4A 3W95A 1O2JA 1F5LA 2BD9A 1BUIA 2ZKSA 4MG3A 1P02A 5LPRA 1YP9A 1UHBB 3EA8A 3SU1A 4ZXXH 2ZZUH 2VIDA 1Y3UA 4ASHA 5BRRE 4AOQA 3GDSA 3N7EA 2BD5A 2HRVA 5JYIA 1DLEA 1D3QB 1QL7A 3A7VA 4GSOA 3VXFH 1PJPA 2BX3A 2W3KA 3UOPA 4YOGA 4A5TS 2ZDNA 3QUMP 1YPEH 1JWTA 1GHAF 1MKWK 1C2JA 4GCHF 4BXSA 4CRDA 1S6LA 4I8JA 5TJXA 5JDUB 3PRDA 1THPB 3RLWH 4AB9A 2KCYA 1TOCB 1EOJA 4DY7B 5EU8A 1HB0B 2GX4A 2J98B 1CBWC 3RXBA 3RXGA 1ESAA 2F9PA 1GMDG 1O39A 2VIWA 4X6NA 1HAIH 3ZZ6A 2OLGA 1XUIA 3MU0A 4X8SH 1EFRD 1KXDA 1O3DA 1VITF 2G00A 4AFQA 6CHAC 3BTWE 1UTOA 2F9OA 2WV5A 1C1NA 1FIZA 2R9PA 3H09A 5EGMA 1C1UH 4NZLA 1C2DA 4ABEA 1ELVA 1ZMLA 2ZGJA 4H42U 4XSKU 3TU7H 5C94A 3IITA 3F9EA 4QT8C 3C27B 2XCFA 1QRWA 5C67A 4AYYB 1HAHH 3Q3YA 1FONA 2PGBB 2Q6DA 5GCHF 3LKWA 5TCAA 2BY6X 3A7ZA 2Y5HA 1IQFA 2HOBA 1QQUA 1SLWB 1SGPE 5AFZH 4JYUH 1AFQB 1VCWA 2BQ6B 3RXSA 2VIQA 1ZHMA 3OY5U 1DX5M 4OGXA 1FPHH 1Y3VA 1G37A 1W3CA 1GVZA 4NSVA 2FMJA 2QXGA 1UTNA 2VWOA 1QJ7B 1QCPA 3PMAB 3MH5A 1AHTH 4FU7A 3SNCA 1OWKA 1W13U 2ZU5A 2EY4C 2M5TA 2V35A 1GL0E 1IQIA 2H2ZA 2QXHA 1TMTH 3FANA 1C1WH 2AYWA 3N7DA 4UD9H 4AFUA 1PPHE 4K1SA 3RC6A 4ABHA 1NO9H 4NFEA 3RXLA 1FY5A 1DANH 2GTBA 1O3CA 5EXMA 5IDKA 3LH3A 2RG3A 1OYQA 3KIDU 2WYJA 4FU9A 4PROA 3NWUA 4IBLH 1W8BH 1TNJA 2F91A 2TIOA 2BDBA 1ZTKA 5LGOA 1C1OA 2JJ1D 2RDEA 3PV5A 4A1TA 3RXUA 1GJ4H 4TYDA 1Z6EA 1ZJKA 1AE8H 4O3TA 4U2WA 1V2QT 1GJ9B 3U8TH 3FN8A 2C8YB 2IPQX 2ZTZA 3DA9B 1C2KA 1A0HB 1T4UH 5E0JA 1RTFB 4KP0A 4JCNA 2F9VA 1WTGH 2ZCKP 1VGCB 3PLKA 2ZDLA 1TMBH 2FX6A 2G4TA 1ZMNA 1ACBE 2SGPE 3PM3A 5EQQA 3PRBA 5JBCS 1CT0E 4FU8A 1CBWB 2GDDA 1CSOE 1C5LH 3TK5A 2BHGA 1A7SA 4IC6A 5BPEA 3ZZ8A 1SR5C 1TLDA 1MAYA 4ZKRU 4MPVA 2KFWA 1RGQA 1ZMJA 1HLTH 2ZO3H 1C2GA 3FP8E 6CHAB 4XRNA 1EZQA 1BQYA 1DDJA 4B75A 2ALVA 3E6PH 4Y11E 4MNYA 2O9QA 1UK2A 5A0BA 2A4OA 4ZKNU 2P93A 2WPLS 3ZVGA 2KR7A 5E2PA 2FS8A 3E0PB 5FHTA 2AHME 1SMFE 1Z8RA 3OTPA 4IMQA 4CRGA 2ZHFH 1Q2WA 3MNSA 2YMSC 2W7SA 1C5WB 1IQKA 4Y10E 1AWHB 3VG8A 1CGIE 3BTGE 2J9NA 5EXLA 1TQ7B 1EKBB 2ZHDA 4FUHA 4GVUA 4RI0A 1AB9C 2K8IA 4NA9H 1EJMA 1NN6A 3QN7A 2ZHQH 4B6FA 3SORA 4D9QA 4VGCB 3SI3H 2OTVA 3DSPA 1GHZA 2AMQA 3FVFB 3F6UH 1F92A 3TH4H 1K2I1 3SV6A 2C8ZB 2PHBA 2BDGA 1GBLA 1GBCA 2GCTC 5AVDA 4AFZA 1Z7KA 1PQ7A 2XOKD 3PMBB 4Q7XA 1GJBB 1UVSH 2O8WA 1GWAA 1V2ST 1UCYH 3P8FA 1BA8B 1NESE 2DE8A 3CNRA 1GJDB 5ESBA 1ELDE 1NM6A 3E3TA 2QXIA 1UTMA 1E79D 2F83A 1YBWA 2BOKA 5T3HA 1T7CA 4MQAA 3A7WA 3ITIA 1AKSA 2WPIS 1MTNB 4DOQA 2ANMH 3F2FA 2G55A 1SGDE 3ZVCA 3M35A 1K9OE 3W1EA 6LPRA 3N99A 3SZNA 6ESTA 5GWZA 5C20A 5FXLA 3ATLA 4HG6A 1Z8JB 2ZU2A 1C5UA 2NU4E 3GISB 5FCKA 2ZCHP 1OHHD 1GI3A 4Y8ZA 1C4V2 3N7OA 2GZ9A 3TLOA 2BXUH 3RC4A 3BTEE 4LZ1H 1C5RA 1BJUA 4A7IB 1M9UA 4NIYA 5I46H 1L4ZA 1SHYA 1NBME 4ABBA 1GBTA 3FZZA 3HATH 2ANKH 3ELAH 1ELCA 1WSSH 2HVXA 1EPTC 1H8HD 3UAIC 4J1YA 2AEIH 1GI2A 1COWD 1KXAA 2TBSA 3VEQB 2XBXA 1HPGA 2LP6A 2A31A 3K6YA 4E7NA 1MKXK 3OTJE 3KQDA 3UPEA 2IN2A 2XBVA 1BTPA 2R2MB 1LKBA 1BCUH 3IWMA 3ODFA 1CA0B 2SGEE 2NWNA 1YYY1 4A92A 1S82A 2W7UA 4X1PU 3SHAH 1OXGA 1JMOH 4ABIA 1GBKA 1Y5UT 3FO8D 3SUGA 1A3EH 1DY8A 2IJD1 1ANEA 1O3KA 1F7ZA 1LVOA 1NRPH 5F8ZA 2J4IA 3KHVA 1OYTH 2Z7FE 1NT1A 3KQ5A 1WAYB 1QNJA 3RXMA 4A6LA 9ESTA 1FIWA 2GT7A 1P09A 4HGCA 2M2AA 1ABIH 3MU4A 1HAZB 4R8TB 2IOTA 3RXOA 3SUEA 2BZAA 1C5TA 2GCTB 3UOUA 4AGKA 1Y3WA 2HPPH 1Y59T 2ZIQH 2ZFPH 4YZUA 4BAOB 1OWHA 1FY3A 1GG6B 2J38A 3GY7A 1CE5A 3SJ8A 5JB9S 3NKKA 2BOHB 2TGAA 3RXVA 1A61H 1GVKB 5DG6A 3M61U 2VB0A 5DK1A 1O2GH 1W7XH 2H1UA 3KCGH 2V7QD 1N6YA 1O2QA 5GXPA 5HYOA 2A7HA 1S5SA 2B0FA 1LQDB 1VJAU 1QBNA 1G9IE 2BVXH 1YWUA 1O35A 3TH2H 1C1TA 2ZU3A 4ACBA 1GJ5H 3M36A 4O3UA 5EW1H 1SOTA 3UWIA 3NXPA 1CHOG 4ZROA 1FAXA 4U01A 2FOBA 1WTHD 1H4WA 2BLWA 2ANYA 3Q3KA 1OWJA 2FI5E 1GBFA 4I7YH 3UR6A 2YOLA 2JETB 2ZPQA 3D65E 2Y5FA 1ZHPA 3ATMA 4SGAE 1SQAA 2VVVA 4D7FA 4IMZA 2ZQ2A 4THNH 1UTJA 1EPTB 4J2YB 3UFAA 4H4FA 1O38A 1EXFA 4Q4LA 1HV7A 5J4SA 2VWLA 1MZDA 2BMGB 2VJ1A 3RLYH 1GDUA 4Y76A 4CR5A 1O2ZA 5CE1A 1XVMA 5B6LA 2EEKA 1YM0A 3T62A 1FN8A 5GPIB 2WPKS 1AQ7A 4ASUD 1ZSJA 3RMLH 5HM2A 1BDAA 1W7GH 2WPDD 1MMJN 5HGGA 2KCOA 4INHA 1V2UT 3H7OA 1BRBE 1MAXA 1K1OA 1T8MA 3AW0A 3E16B 2GMTC 5DP7A 3UNQA 1LHFH 3M37A 1B0FA 1DY9A 1KXEA 1SL3A 5EJLA 1CHGA 1HJAC 1F5KU 2EI6A 4CREA 2J94A 3MNBA 1EB2A 2ULLA 1TA6A 2NU3E 1A5IA 1F5RA 1AI8H 1K0HA 1RS0A 5DKMA 3U1JB 4YOIA 1DE7H 2XWAA 4AFSA 2D8WA 5GJ4B 2R0KA 4HTCH 1F0UA 1LMWB 3PMHB 1P0SH 1GDQA 3T27A 1KY9A 3PWBA 4I8HA 1O2MA 1VCQA 2JH5D 3SNEA 1IQMA 1BTUA 4UE7H 1LHDH 3GS9A 5EQRA 2A4QA 1OOKB 5T6FA 3M3TA 3S9CA 4FETA 3A8BA 1XM1A 4JK6A 1SSXA 1SGIB 2KM0A 3F9HA 2D2DA 3P17H 2W6ID 1QGFA 2QF4A 1AD8H 2EI8A 1EZSC 1BTWA 2Y6TA 1TNKA 1C1PA 1AE5A 1O3JA 1GI7B 2QC2A 3K65B 2BD3A 1G3CA 1XXFA 1A2CH 2Z9JA 1P2JA 1G36A 1ZPCA 1E37B 1HRTH 2H5CA 1BJVA 3EE0B 3RXPA 5EG4A 2THFB 3MMGA 7GCHF 3ZZ7A 5LH8A 2FYQA 3T5FH 4DIIH 1L1GA 1Y3YA 4XBDA 2VVCA 1RIWC 4X2YA 3SJOA 3ZZBA 3R0FA 3DHKH 4RKJB 2QCYA 4JZFH 3LPRA 4WMFA 5DO4H 3ENSB 3DCLA 1P2IA 1B7XB 3SNDA 2UWLA 5L2YH 3RXJA 1OX1A 1TBQH 4NSYA 2SFAA 1SLUB 3SI4H 1G2LA 1J9CH 1OWIA 2PLXA 1O36A 3ZVDA 2OC1A 2TGTA 2HALA 2QAAA 3WWBA 1C1MA 1QA0A 1S83A 1DUEA 3EDXB 2A2XH 3QO6A 4GUXA 1QL8A 2QF3A 1HAPH 1O2NA 1TIOA 3RDZA 2UUJB 3HK3B 3CP7A 1YCPK 1HJAB 2YMSD 1H8IH 1VKYA 5EIYA 3P6ZB 3RMOH 4OS5A 4LZ4B 1FAKH 4CH8B 2W6JD 1YLDA 2ZHWH 1TX6A 3PO1B 3F2HA 1P9UA 1S85A 3P95A 5HMAA 5PTPA 3EAJA 4IGDA 1W2KH 4AX9H 3TK9A 3AAUA 4KTCA 3TJOA 3T25A 1F0RA 1O2KA 1BMNH 1V2PT 3MU8A 5EJ1A 4ABGA 4Q7YA 1AFQC 4K2YA 4F49A 3CENA 1BBRK 1G3BA 2YNAA 1RJXB 3P8GA 1JIMA 1C2IA 1P04A 3BTQE 3FP6E 4MNXA 1HIAB 4NIWA 3RXQA 3A82A 3QK1A 4CRFA 5F03A 1W11U 2BB4A 1ELBA 3F9FA 4FXGH 2BQ7B 4H6SB 3ZVBA 2HNTF 1J15A 1V2JT 4CBOA 3STJA 2OUAA 3BSQA 4FUDA 3PLPA 1Z8IB 1C2EA 1LHGH 1ANCA 1W0YH 3R3GB 1ELTA 2XNDD 2FEQH 1AIXH 3SU0A 1DLKB 1RIWB 3A7XA 5JBBS 4M9FA 8LPRA 4Y7AA 4O03A 1H9LB 5E0GA 5C0UA 1ZYOA 7KMEH 1HJ8A 3MO6A 1EAUA 1EASA 2VWNA 3V7TA 1PFXC 2Y80A 2ODPA 4X2XA 1PQ5A 1V2VT 3S7KB 3SNBA 4Y0ZE 2JH6D 1N8OC 1V2MT 1GHVH 5EPNA 1Y8TA 2JKHA 1UJ1A 4AZ2B 4DURA 3MNXA 1FMGA 1VGCC 1EATA 2W26A 2F43B 1P2QA 1ZTLA 1MCVA 1HAVA 2ZGCA 2G5VA 5DJ7A 2BY8X 3RXAA 4WF8A 3QTOH 4XFQA 2A4RA 1LTOA 1DWCH 1SLXB 2J34A 1DWBH 1T8NA 1XXDA 4KGAA 1SPJA 2PKAB 2P95A 2EI7A 1WQVH 2L74A 3QDZB 1QL9A 1H9HE 3LGTA 2TGPZ 2PTNA 1QRZA 2SNVA 4NWLA 5F8XA 4JZDH 5HIZA 4SGBE 5T1VA 3TK6A 2HNTE 4HZHA 3A89A 4XD7D 5A09A 1TGSZ 1HXEH 3A7TA 3ZVFA 1YCPM 1KDQA 2VGCB 3B8JA 1ZGVA 5CHBA 3M5OA 3Q3XA 3M5LA 3A7YA 1GI4A 5KGOA 5TCCA 4ACAA 1CT2E 2LPRA 3AW1A 1GI0A 1EQ9A 2JDID 3Q76A 4DIHH 1Z1JA 3L6PA 3SN8A 5FCRA 3GDVA 3SGBE 2VH0A 1B5GH 1GJ6A 1MD7A 3U8OH 2A5AA 1FNIA 4WXVA 2AGGX 1SFQB 2VIPA 1K22H 1EX3A 4UFEH 2ZFRH 3GDUA 2VNTA 1AU8A 4K60A 4VGCC 1XVOA 4ABFA 8GCHF 4XBBA 1A46H 3TNTA 3MQKC 2P59A 1TBRH 3MWIU 3E8LA 1OPHB 4ISOA 1A5GH 4X8UH 3KNXA 1H8DH 2FIRH 3DFJA 2FOCA 1GHBG 3OFND 3MOCA 2SGFE 2ANWA 5CDFE 4TPIZ 3URCA 1T4VH 3M5NA 1MCTA 1BTZA 1O33A 1MQ5A 4CRCA 1O3BA 4JZ1A 1CGHA 2AGEX 2PSYA 3S69A 5JPMH 4IN2A 2CXVA 1XUGA 2STAE 3G01A 1FQ3A 2BD7A 2BM2A 1XMNB 3GY6A 1BHXF 1EZUC 2Z3CA 2WZQA 1Y5BT 1MTNC 4X2VA 2C90B 3TVJB 1BTXA 5F8TA 2CMYA 5ABWA 5T6DA 1N8OB 4Z1MD 2O8LA 3VGCC 3SJIA 3PTBA 1UVTH 2FOEA 2ZCLP 1PPEE 3VB6A 2XYAA 3SV8A 5HM9A 4XBCA 1XKAC 3HGNA 4FOUC 5C3NA 1ELFA 3STIA 3RXFA 3VFEA 1A0JA 1OSSA 1EOLA 2OQ5A 3KEEA 2AMPA 2PTCE 2ZDVH 4Z0KA 4TWWA 5FX5A 1PPFE 1BOQA 2Z9GA 4X1QU 1Z8GA 2V3HH 3SUFA 1OKXA 4WH8A 1TWXB 1VCPA 2ODYB 3A8CA 1P05A 1TGCA 2WPJS 3ZZAA 2RFKC 1L0ZA 1G30B 2BD8A 3RU4E 3JZ1B 4D7GA 3LONA 2FS9A 3OEHD 3PMJA 4TY7A 3ZZ9A 2K0QA 2ZP0H 1O30A 2A5IA 1P03A 4KTUA 1TABE 4OS4A 3U98H 4FVBA 1KLIH 2VIVA 3SU4A 1W0JD 3UR9A 5KEDA 1EAXA 3S7HB 2FXRA 1CA0C 1EAWA 1P12E 2JIZD 3SV9A 3LJJA 3P8OA 1C4Y2 3U28C 1TGTA 2ZFTA 1TGNA 3SYJA 3E0NB 3BIUH 3ZVEA 1UO6A 1GL1A 1OWDA 4Y71A 2H9EH 1O2YA 1LO6A 1SGTA 1DXPA 1LDTT 1O3HA 2Y5GA 1C1RA 2OQUA 1LPKB 1SOZA 3VB3A 2PSXA 2XC0A 3SHCH 1BMLA 1THRH 2FTLE 2A2QH 1NU9A 4WH6A 1C5NH 2KZ4A 4RN6A 4AORA 2HGTH 4FUBA 2JJ2D 1GPZA 1BT7A 2FI4E 5ETXA 1AUTC 2NU1E 2P16A 3BIVH 1GG6C 2G51A 1S6FA 4BOHA 1P9SA 3GCTF 1TA2A 2UUYA 1GMHG 3M5MA 3LJOA 1OP8A 1TRNA 2BLOA 1ELEE 2Z94A 3F9GA 4MNVA 5FAHA 3RC5A 3SV7A 4YESB 1CVWH 1D6WA 3SQEE 2VU8E 2CGAA 3SU2A 1SHHB 3VGCB 1GHYH 2BY9X 5CMXH 2J95A 2FP7B 1GBIA 2GJGA 3TIUA 2VBCA 4DJZB 1SQTA 3ATKA 1C5SA 1C5XB 2KAIB 3HGPA 5DGJA 4NG9H 1N1LA 1QR3E 4DVAU 3IG6B 2F3CE 1XX9A 2JETC 3BG4B 1A3BH 1GBAA 4HI3A 1OWEA 4X1RU 5FPSA 2QA9E 1QRXA 2K1QA 3KQBA 4I31A 4KKDA 1P06A 4NGAH 3BTFE 3MNCA 4Q2KA 5EPYA 2J2UA 3ZZ4A 5EQSA 3PLBA 1U6QA 4INLA 3BV9B 4WMEA 1C5ZB 1HXFH 3RM2H 4CH2B 1HUTH 2BLQA 3ZZCA 1QQ4A 3GYLB 4FUJA 3A83A 1GBJA 2UWOA 4NWKA 1GHWH 1NFUA 1BMMH 3KGPA 3Q00A 1H1BA 3B23B 1D3DB 1YGCH 1NZQH 3M3VA 1C5MD 1O3PB 2CHAB 1GBHA 3RMNH 2D1JA 1KTSB 3AASA 2ODQA 2ZU1A 2A32A 3LT3A 1IHTH 2ZPSA 1QIXB 3F0OA 3FKSD 3BEUA 1SKYE 2HWLB 3KN2A 2P3FH 3ZYDA 2KCPA 2WV9A 1ZPBA 1WUNH 4OS2A 2FLBH 1FLEE 3TPIZ 1GMDF 2F9NA 1Q31A 3OEED 1BBRE 1TYNA 4JZEH 1P01A 2XXLA 3RMMH 1YLNA 2DUCA 4OM9A 3A80A 3BTTE 1UHBA 2ZI2H 4IC5A 1PPCE 4I8LA 1TB6H 3ZIAD 1NBMD 3A87A 2VVUA 1O2UA 3LU9B 3P70B 1O5GH 1IQJA 5A8XA 2Y7XA 4AYVB 1KSNA 1DT2A 5L6NH 3UIRA 1SQRA 5L30H 1TNLA 2GCHG 4JK5A 1AMHA 3MO9A 2CJIA 5C5OA 1O3MA 3MO3A 3QGNB 1QTFA 4OS1A 1O2LA 5HIYA 3S9AA 3HKIB 1LPZB 1P2MA 4ZUHA 1DFPA 2GV6A 3MH6A 1SI5H 5DPAA 1O2HA 3FZDA 4F55A 1PPGE 2J98A 5LPFA 5AF9H 1MUEB 1GBDA 4F4OC 1E1RD 5FBEA 2HNTC 3RU4T 2STBE 2I6SA 1Y5AT 1EJAA 3SJ9A 1ARBA 1EP5A 4DT4A 1O3NA 2IJOB 2C93B 2BY5X 4FUGA 1QURH 1E36B 4CRBA 4AG2A 2ZGBH 2A5KA 5GCHG 2P3TB 1GHBF 2VWMA 2ZQ1A 2F4LA 3RP2A 1SB1H 1SGRE 1LVYA 4B74A 2Z3EA 3A88A 2IPHA 4WJG2 2GVFA 2C8WB 3LOXA 5C0TA 2KX4A 2J92A 1VR1H 3BTDE 1TGBA 3RXCA 3BN9A 3PTNA 1CQQA 1E35B 1V6DA 1ZRBA 4X8TH 4BTIB 1GMCG 1E38B 1UTLM 1V2NT 4Z6AH 1PQAA 2D26C 2PV9B 2C3SA 4GAWA 3PO1C 1GCTB 1SGCA 4YT6H 1V2LT 3M7UA 2FDAA 5G4BA 1SVPA 2O8UA 1MBQA 1A0LA 3BTME 1NC6A 2ZECA 3WY8A 4JMYA 4B2BA 6GCHG 1HCGA 1C2HA 3E1XB 1SG8B 3GY2A 4K3JA 1VJ9U 3H7TA 1QJ1B 1AFEH 2BYAX 1O5BB 1ZZZA 1K1IA 1TRYA 1HJ9A 1UK3A 1L4DA 3U1IB 1S6HA 3RXKA 5GDSH 3SZEA 2AMDA 5AFYH 4Y8YA 1NPMA 4K1TA 2QYIA 3OY6U 3LGIA 1YC0A 5CHAC 3PV2A 1P57B 3UQVA 3ATIA 2B8OH 1H8ED 1LKAA 3EA7A 2J97A 3GY5A 1TRMA 1O3OA 1W10U 1ZRKA 1YPHE 2RDLA 1TNIA 1TBZH 2ZA5A 1P11E 4NIXA 5A2MH 1TMUH 3SJKA 4NA8A 1IAUA 2A7JA 1HGTH 3QGJA 5EXNA 5HKKD 1C5OH 2ZDMA 4Y79A 2H9TH 2FLRH 2Z9LA 5JBAS 1D6RA 4FUFA 2Z9IA 3K6ZA 2VIOA 3A84A 5DP3A 1D9IA 3A8DA 1SGQE 1IQNA 1YPGH 1B0EA 1AWFH 4NA7A 1E0FD 3PYHA 5B6OA 3D62A 2FZZA 1MKXH 1KXFA 2BLVA 1AKSB 2QXJA 4LOYH 4E7RG 1NS3A 1C4U2 1O2OA 4CHAB 1D3TB 2SNWA 1QZ8A 3RM0H 1GBMA 5C2ZA 3NK8A 4IS5A 2WPHS 4U32A 2G4UA 2RCEA 3GY4A 4X2WA 1TQ0B 1NRNH 3SV2H 3QZQA 1TX8A 1TPSA 4Y8XA 1QHRB 2WYGA 1EJNA 5ESTE 1CT4E 3GCOA 1FDPA 4UEHH 2GKVE 3BEIB 1Q3XA 2ZFQH 4WY3A 2VGCC 4BAMB 3TGIE 2HVYB 1KMHB 1GBBA 1EP6A 2GD4B 2LNCA 4ABDA 1BRCE 3GCHB 4WVPE 4FUCA 4YTAA 4XE4A 1L1JA 1S81A 3CS7A 3UWJH 1OS8A 2B9LA 2CF8H 2OD3B 4ZMAH 1LQEA 1Z71A 3GY3A 5CHAB 4UDWH 1MQ6A 3P8NA 1JRTA 1HAGE 3O8BA 1VITH 1WXRA 1O37A 3BF6H 3KQCA 2ZFSA 1MU6B 2QV1A 1G32B 8ESTE 2UWPA 1NRQH 1O2WA 4GLYA 4B2CA 4YLQH 3K2UA 1NFWA 4Q63A 4NZQA 4Y0YE 2PKSB 2PGQB 1ARCA 4YM9A 1TNHA 1UTKA 2G81E 1EAIA 4I86A 2V0BA 4RKOB 1FI8A 5A0CA 3UTUH 3O8CA 2XCNA 3M7TA 3PB1E 3DSOA 1FY8E 4ZAEA 2FM2A 1TPPA 4ISIH 3EGKH 3PV4A 2FOAA 1SGYE 5IK2D 2G8TA 1UCYK 5DP4A 1O5AB 2TGDA 3VB7A 3RUOA 1V2WT 5K7RA 1ZLRA 1XUHA 2W5EA 2L6OA 1BMAA 3KYFA 1C2LA 3SO3A 1BHXB 2O8TA 3V13A 1HNEE 3U9AH 1L1NA 2XTTB 2CV3A 2RA0A 2WV4A 4CRAA 1ETRH 1QBVH 2SGDE 1NROH 1D3PB 2Z9KA 1WQSA 3SU3A 4XDEA 2ILNA 3A85A 5C1UA 3BTKE 3MI4A 2TPIZ 4OGYA 4YLUA 1HDTH 2F9UA 2GCHF 2ZWLH 4ZCNA 3RXRA 1RD3B 2OBQA 3ODDA 4X0WU 1GJAB 1CHOF 3OYPA 2H5DA 1F2SE 1GHXH 1QY6A 4DT7B 2GP9B 1AUJA 4ZHLU 1P2KA 4B71A 1O5CB 2A45B 1RFNA 1FXYA 3RXTA 1QB9A 1ZTJA 3T28A 4I32A 5A8ZA 1ID5H 1WV7H 1QB1A 2P8OC 3HK6B 3W94A 4B2AA 2BDCA 3BG8A 3H5CB 5E0HA 5DSFA 4B1TA 1TFXA 2HPQH 2ZTYA 1LHEH 5LPEA 1BB0B 4NCYA 1LVBA 1P10A 1E1QD 1O2SA 2OXSA 2ZNKH 2J5UA 5EODA 1GCDA 5KECA 1YF4A 4UONA 1DS2E 1AZ8A 4ZXYH 1G3DA 1GJ7B 2SGQE 2PUXB 3A8AA 5FX6A 2AGIX 5GNDA 3ZV8A 4JYVH 4D8NA 1BMFD 1RTKA 4UFFH 2WUCA 5EOKA 1K1NA 3SNAA 4NIVA 2ZDAH 2GGVB 1PQ8A 4X6OA 1O5DH 2SGAA 5A0AE 1GMCF 1IQHA 1C5QA 3SW2B 2ZPRA 3U8RH 4ZKSU 2OCVB 1LCYA 2VINA 4FUEA 1UTQA 1UVUH 1GI5A 4AGJA 1YPJH 1IQEA 4GHQA 1K1LA 1IQGA 1ETSH 2GV7A 3A86A 2Q6GA 6GCHF 1EPTA 3MU1A 3ZZ3A 1O2XA 1V2OT 1ORFA 2ZG0H 4U30A 1DWDH 1CA8B 1O5EH 4DGJA 3ZV9A 1TONA 1DOJA 4X1NU 1T32A 3FOAA 1CO7E 1W12U 1GJ8B 4BANB 3P92A 1ZSLA 4P00A 2ASUB 4I33A 1HAXB 4K8YA 5FL7D 1JIRA 1YY3A 4MPXA 1O0DH 5F6MA 3BG4C 3E90B 3ESTA 4BAKB 1NRSH 1RRKA 1V2TT 3TH3H 2NU2E 2FO9A 1AVGH 1T8LA 2PR3A 4D76A 3D23A 2A7CA 3F68H 1DUAA 1YCPH 3I29A 2ZF0H 4FVDA 4Y6DA 2WHXA 3SQHE 3V12A 1PPZA 5FPYA 1ZGIA 1UTPA 1Z1IA 2ALPA 1MTSA 1ANDA 1YPKH 2QF5A 2A4GA 3E91A 2G5NA 2Y7ZA 2FESH 1CGJE 3V0XA 3SUDA 2CF9H 3ZZ5A 3KF2A 5AHGH 2EC9H 1ELGA 3CS0A 1GGDC 4OS7A 1O3IA 3NUMA 1TAWA 3QWCH 2I6QA 2P8OB 1KTTB 2RA3A 4WMDA 1EB1H 1K1JA 2V3OH 2PFEA 4YT7H 1WU1A 2BD2A 1A5HA 1W0ZU 2CHAC 1ESTA 1V2RT 3UNSA 3V3MA 1Z6JH 1BBRH 1AGJA 4ABJA 2FTMA 4GHTA 1YPHC 3F1SB 1DVAH 4IW4E 5GIBA 1E34B 1KLJH 2G52A 2R3UA 2BD4A 2Q6FA 7GCHG 4ZHMU 1KYNA 1OP0A 4ISNA 4R0IA 2W3IA 4M7GA 1GVLA 5E2OA 1NU7B 1HAYB 2V6NA 1PYTC 1YLCA 4ESTE 1O2RA 1P3EA 4AG1A 3ZZDA 5C17A 5JBTA 3UUZA 1JXPA 2GT8A 1HAOH 1G2MA 2QF0A 1GDNA 2EA3A 2XC5A 1KLTA 1A4WH 1MTWA 2GZ7A 1J14A 3ZVAA 5JB8S 1A1RA 1ELAA 2WSSD 2BVSH 1IHSH 1AVWA 3RU4D 3OX7U 3MH4A 1MKWH 1S84A 3NCLA 4YOJA 1SGEE 1NTPA 3KYGA 3NPSA 1K28D 3SBKA 2GDEH 4A1VA 1SC8U 4BAQB 1DWEH 5T6GA 1D4PB 2FOFA 1MU8B 2B7DH 1BITA 3KQEA 1KXCA 1SGFA 1ZHRA 5F53A 3URDA 3KL6A 1BIOA 3FAOA 1HBTH 1T8OA 3MTYA 1UVOA 2R2WU 2ZEBA 1QBOA 4H6TA 3AAVA 3UB0A 4OS6A 3MH7A 2CK3D 1GGDB 2UUFB 3BTHE 2BZ6H 5EJZA 3DFLA 1Y3XA 4RT0A 1RTLA 2GZ8A 3T26A 1H9IE 4RT1A 2OC0A 4AB8A 1TNGA 4JYTA 4MPWA 4CBNA 2FODA 1V2KT 2NU0E 1W14U 2A0QB 3DSGA 4F48B 1HAVB 2ESTE 3MU5A 4K8BA 2YMSB 1SBWA 2BDYA 4X6PA 4NFFA 1GCTC 1AZZA 1ZOMA 4B73A 2XBYA 5L2ZH 2QIQA 2XW9A 9LPRA 1OP2A 1XUJA 1WCZA 2BXTH 1HIAA 2XWBI 5DP5A 4RSPA 3WWFA 3L33A 1P8VC 3LGWA 4E05H 1T31A 1AB9B 1P3CA 4BTUB 1KIGH 2QGRA 3SU6A 1WBGB 2C8XB 1GI9B 1GJCB 1BZXE 5E8EH 3RXIA 1KXBA 3NZIA 3SU5A 4K5ZA 5HXFA 4CR9A 3B9FH 5FPTA 2XBWA 1KDQB 4LK4A 4XOJA 4ABAA 2WINI 7ESTE 1YPMH 2OC7A 4AN7A 1GHAG 4GCHG 3LDXH 1FUJA 3O8DA 3HPTB 5K0HA 3I77A 1SGFG 3AK5A 1SQOA 3Q77A 4DW2U 3ZYEA 3GOVB 1MABB 4A1XA 1O2PA 1AY6H 3VB5A 4TT3D 4ZHAA 3A81A 2P3UB 3QZRA 5J4QA 1UVPA 3EE7A 1THSH 1F0SA 1O32A 3ATWA 3U69H 2UUKB 4Q7ZA 1VITG 3LGVA 1S0QA 1YKTA 1UCYE 1C9TA 1LHCH 2OINA 4MTBA 4ISLA 1O31A 3DD2H 1K1MA 2FWWA 3WW7A 5C1XA 3QX5H 2PKAA 2QN5T 4MNWA 2A1DB 2OK5A 3TGKE 1F0TA 1FN6A 5DP6A 2HLCA 2PUQH 4AC9A 3OSYA 1ZJDA 2TRMA 5DP8A 1XUFA 1FJSA 3HKJB 1TPOA 2P94A 2BQWB 2AS9A 3TNSA 3RXEA 1GBEA 1XUKA 4I8KA 4CHAC 3UY9A 4MDSA 3SOSA 3S0NA 2FOMB 1V3XA 2R3YA 2ZTXA 2BDIA 1BRUP 1C1QA 2OC8A 1C5YB 2FYRA 8GCHG 2Y81A 1ZPZA 3SGQE 3EQ0H 1WDIA 1ABJH 3I78A 4ZH8A 2WUBA 1DITH 5SGAE 2WPMS 4FUIA 1WYKA 3VPKA 1YPLH 7LPRA 2HLDD 1WOFA 4MLFB 1UW7A 1ANBA 1FX0B 3GY8A 1JOUB 1BTHH 2BDAA 3UREA 1QA7A 4IN1A 2R0LA 1GI8B 3K9XB 1C5VA 1NFXA 1ESBA 3GCHC 4MPUA 2BTCE 3TJNA 1SLVB 2Z3DA 4TSFD 1MD8A 3O8RA 1N6XA 1DPOA 1J17T 4YO9A
chains in the Genus database with same CATH topology
8KME2 4BNRA 2PWXA 5H4IB 3L3TA 2OP9A 3GCNA 4MVNA 3TJUA 3S9BA 1AO5A 1DICA 2OBOA 3AVZA 4TPYA 1HFDA 2BVRH 1ZSKA 3SGAE 2ZU4A 2H9HA 1FY4A 1SFIA 1ETTH 3T2NA 1AVXA 2C4FH 3C1KA 3BEFB 2PKSC 3DT0H 1EZXC 5EW2H 3QTVH 4BXWA 1GI1A 1DM4B 3TJVA 1J8AA 1JRSA 2BX4A 1O3AA 3RXHA 5DP9A 5C1YA 2VH6A 1O3EA 3MYWA 1FV9A 1BTYA 2ZGXH 4O9VA 1DSUA 1HYLA 5A8YA 3RXDA 1DXWA 3M3SA 3QLPH 1MH0A 4WWYA 4B76A 4I8GA 2AH4X 3JZ2B 1MBMA 1IOEA 1O3GA 4TWYA 2ZFFH 4HFPB 1K21H 2FX4A 2FOGA 1O3LA 2XC4A 1FPCH 2ZC9H 1PPBH 2YNBA 2Q1JA 1TE0A 3LGUA 1ZR0A 4K69A 2JH0D 1MZAA 2QY0B 1QB6A 2Y82A 4E06H 1O3FA 2ZHEH 4X1SU 2FOHA 4X6MA 3OU0A 3VXEH 1GMHF 2XRCA 1MTVA 1GI6A 1NRRH 4LXBH 4ZKOU 1UMAH 3MHWU 2AERH 3GICB 2XNIA 4Y7BA 4O97A 5IYTA 4BAHB 1G3EA 3LC5A 1X7AC 3EA9A 5FBIA 1O34A 4INKA 1VZQH 4K1EA 3GYMA 2GMTB 3MFJA 1L2EA 1O5FH 2B5TB 1J16A 1C1VH 1LVMA 3UNRA 2F9BH 3LGYA 4DG4A 2ZGHA 1TX7A 3LC3A 1NY22 3GCTG 4JZIA 1EUFA 3M7QA 4Q80A 1S0RA 2FPZA 1LPGB 4D9RA 1DSTA 2AFQB 4X8VH 1SGNE 1PYTD 4ISHH 1RXPA 1O2TA 4KTSA 1O2IA 4UFDH 3T29A 1NFYA 1C2MA 2AIQA 1TOMH 1UK4A 3PROA 4DCDA 1FZZA 1QJ6B 3TGJE 5I25A 2O8MA 1MTUA 1INCA 1BRAA 2BDHA 1JBUH 1C5PA 2CN0H 3EYDA 3DUXH 3PWCA 4UFGH 1AN1E 2AIPA 1FY1A 1C1SA 3LH1A 2KAIA 4GPGA 3FP7E 3FFGA 2Z6BD 4BTTB 2DE9A 3TITA 4TY6A 1QFKH 1TALA 2PW8H 2ZDKA 1CU1A 1C9PA 1P2OA 1TPAE 3LIWA 1O2VA 1C2FA 2BY7X 3UQOA 1K1PA 4KELA 5C5NA 1XKBC 2FI3E 4WXIA 1IQLA 1P2NA 2H6MA 3D49H 3VB4A 3W95A 1O2JA 1F5LA 2BD9A 1BUIA 2ZKSA 4MG3A 1P02A 5LPRA 1YP9A 1UHBB 3EA8A 3SU1A 4ZXXH 2ZZUH 2VIDA 1Y3UA 4ASHA 5BRRE 4AOQA 3GDSA 2BD5A 2HRVA 5JYIA 1DLEA 1D3QB 1QL7A 3A7VA 4GSOA 3VXFH 1PJPA 2BX3A 2W3KA 3UOPA 4YOGA 4A5TS 2ZDNA 3QUMP 1YPEH 1JWTA 1GHAF 1MKWK 1C2JA 4GCHF 4BXSA 4CRDA 4I8JA 5TJXA 5JDUB 3RLWH 1THPB 4AB9A 1TOCB 1EOJA 4DY7B 5EU8A 1HB0B 2GX4A 1CBWC 3RXBA 3RXGA 1ESAA 2F9PA 1GMDG 1O39A 2VIWA 4X6NA 1HAIH 3ZZ6A 2OLGA 1XUIA 3MU0A 4X8SH 1KXDA 1O3DA 1VITF 2G00A 4AFQA 6CHAC 3BTWE 1UTOA 2F9OA 2WV5A 1C1NA 1FIZA 2R9PA 5EGMA 1C1UH 4NZLA 1C2DA 4ABEA 1ELVA 1ZMLA 2ZGJA 4H42U 4XSKU 3TU7H 3IITA 3F9EA 4QT8C 3C27B 2XCFA 1QRWA 5C67A 4AYYB 1HAHH 3Q3YA 1FONA 2PGBB 2Q6DA 5GCHF 3LKWA 5TCAA 2BY6X 3A7ZA 2Y5HA 1IQFA 2HOBA 1QQUA 1SLWB 1SGPE 5AFZH 4JYUH 1AFQB 1VCWA 2BQ6B 3RXSA 2VIQA 1ZHMA 3OY5U 1DX5M 4OGXA 1FPHH 1Y3VA 1G37A 1W3CA 1GVZA 4NSVA 2FMJA 2QXGA 1UTNA 2VWOA 1QJ7B 1QCPA 3PMAB 3MH5A 1AHTH 4FU7A 3SNCA 1OWKA 1W13U 2ZU5A 2M5TA 2V35A 1GL0E 1IQIA 2H2ZA 2QXHA 1TMTH 3FANA 1C1WH 2AYWA 4UD9H 4AFUA 1PPHE 4K1SA 3RC6A 4ABHA 1NO9H 4NFEA 3RXLA 1FY5A 1DANH 2GTBA 1O3CA 5EXMA 5IDKA 3LH3A 2RG3A 1OYQA 3KIDU 2WYJA 4FU9A 4PROA 3NWUA 4IBLH 1W8BH 1TNJA 2F91A 2TIOA 2BDBA 1ZTKA 5LGOA 1C1OA 4A1TA 3RXUA 1GJ4H 4TYDA 1Z6EA 1ZJKA 1AE8H 4O3TA 4U2WA 1V2QT 1GJ9B 3U8TH 2C8YB 2ZTZA 3DA9B 1C2KA 1A0HB 1T4UH 5E0JA 1RTFB 4KP0A 4JCNA 2F9VA 1WTGH 2ZCKP 1VGCB 3PLKA 2ZDLA 1TMBH 2FX6A 2G4TA 1ZMNA 1ACBE 2SGPE 3PM3A 5EQQA 5JBCS 1CT0E 4FU8A 1CBWB 2GDDA 1CSOE 1C5LH 3TK5A 2BHGA 1A7SA 4IC6A 5BPEA 3ZZ8A 1SR5C 1TLDA 1MAYA 4ZKRU 4MPVA 1RGQA 1ZMJA 1HLTH 2ZO3H 1C2GA 3FP8E 6CHAB 1EZQA 1BQYA 1DDJA 4B75A 2ALVA 3E6PH 4Y11E 4MNYA 2O9QA 1UK2A 5A0BA 2A4OA 4ZKNU 2P93A 2WPLS 3ZVGA 5E2PA 2FS8A 3E0PB 5FHTA 1SMFE 1Z8RA 4IMQA 4CRGA 2ZHFH 1Q2WA 3MNSA 2W7SA 1C5WB 1IQKA 4Y10E 1AWHB 1CGIE 3BTGE 2J9NA 5EXLA 1TQ7B 1EKBB 2ZHDA 4FUHA 4GVUA 1AB9C 4NA9H 1EJMA 1NN6A 3QN7A 2ZHQH 3SORA 4D9QA 4VGCB 3SI3H 2OTVA 1GHZA 2AMQA 3FVFB 3F6UH 1F92A 3TH4H 1K2I1 3SV6A 2C8ZB 2PHBA 2BDGA 1GBLA 1GBCA 2GCTC 5AVDA 4AFZA 1Z7KA 1PQ7A 3PMBB 4Q7XA 1GJBB 1UVSH 2O8WA 1GWAA 1V2ST 1UCYH 3P8FA 1BA8B 1NESE 2DE8A 5ESBA 1GJDB 1ELDE 1NM6A 3E3TA 2QXIA 1UTMA 2F83A 1YBWA 2BOKA 5T3HA 1T7CA 4MQAA 3A7WA 3ITIA 1AKSA 2WPIS 1MTNB 4DOQA 2ANMH 2G55A 1SGDE 3ZVCA 3M35A 1K9OE 6LPRA 3SZNA 6ESTA 5GWZA 5C20A 5FXLA 3ATLA 1Z8JB 2ZU2A 1C5UA 2NU4E 3GISB 5FCKA 2ZCHP 1GI3A 4Y8ZA 1C4V2 3N7OA 2GZ9A 3TLOA 2BXUH 3RC4A 3BTEE 4LZ1H 1C5RA 1BJUA 4A7IB 1M9UA 4NIYA 5I46H 1L4ZA 1SHYA 4ABBA 1GBTA 3FZZA 3HATH 2ANKH 3ELAH 1ELCA 1WSSH 2HVXA 1EPTC 4J1YA 2AEIH 1GI2A 1KXAA 2TBSA 3VEQB 2XBXA 1HPGA 2A31A 3K6YA 4E7NA 1MKXK 3OTJE 3KQDA 3UPEA 2IN2A 2XBVA 1BTPA 2R2MB 1LKBA 1BCUH 3IWMA 3ODFA 1CA0B 2SGEE 2NWNA 1YYY1 4A92A 1S82A 2W7UA 4X1PU 3SHAH 1OXGA 1JMOH 4ABIA 1GBKA 1Y5UT 3SUGA 1A3EH 1DY8A 1ANEA 1O3KA 1F7ZA 1LVOA 1NRPH 5F8ZA 2J4IA 3KHVA 1OYTH 2Z7FE 1NT1A 1WAYB 1QNJA 3RXMA 4A6LA 9ESTA 1FIWA 2GT7A 1P09A 4HGCA 3MU4A 1ABIH 1HAZB 4R8TB 2IOTA 3RXOA 3SUEA 2BZAA 1C5TA 2GCTB 3UOUA 4AGKA 1Y3WA 2HPPH 1Y59T 2ZIQH 2ZFPH 4YZUA 4BAOB 1OWHA 1FY3A 1GG6B 2J38A 3GY7A 1CE5A 3SJ8A 5JB9S 3NKKA 2BOHB 2TGAA 3RXVA 1A61H 1GVKB 5DG6A 3M61U 2VB0A 5DK1A 1O2GH 1W7XH 2H1UA 3KCGH 1N6YA 1O2QA 5GXPA 5HYOA 2A7HA 1S5SA 2B0FA 1LQDB 1VJAU 1QBNA 1G9IE 2BVXH 1O35A 3TH2H 1C1TA 2ZU3A 1GJ5H 3M36A 4O3UA 5EW1H 1SOTA 3UWIA 3NXPA 1CHOG 4ZROA 1FAXA 4U01A 2FOBA 1WTHD 1H4WA 2BLWA 2ANYA 3Q3KA 1OWJA 2FI5E 1GBFA 4I7YH 3UR6A 2YOLA 2JETB 2ZPQA 3D65E 2Y5FA 1ZHPA 3ATMA 4SGAE 1SQAA 2VVVA 4D7FA 4IMZA 2ZQ2A 4THNH 1UTJA 1EPTB 4J2YB 3UFAA 4H4FA 1O38A 1EXFA 1HV7A 5J4SA 2VWLA 1MZDA 2BMGB 2VJ1A 3RLYH 1GDUA 4Y76A 4CR5A 1O2ZA 5CE1A 1XVMA 2EEKA 1YM0A 3T62A 1FN8A 5GPIB 2WPKS 1AQ7A 1ZSJA 3RMLH 5HM2A 1BDAA 1W7GH 1MMJN 5HGGA 4INHA 1V2UT 3H7OA 1BRBE 1MAXA 1K1OA 1T8MA 3AW0A 3E16B 2GMTC 5DP7A 3UNQA 1LHFH 3M37A 1B0FA 1DY9A 1KXEA 1SL3A 1CHGA 1HJAC 1F5KU 2EI6A 4CREA 2J94A 3MNBA 1EB2A 2ULLA 1TA6A 2NU3E 1A5IA 1F5RA 1AI8H 1RS0A 5DKMA 3U1JB 4YOIA 1DE7H 2XWAA 4AFSA 2D8WA 5GJ4B 2R0KA 4HTCH 1F0UA 1LMWB 3PMHB 1P0SH 1GDQA 3T27A 1KY9A 3PWBA 4I8HA 1O2MA 1VCQA 2JH5D 3SNEA 1IQMA 1BTUA 4UE7H 1LHDH 5EQRA 2A4QA 1OOKB 5T6FA 3M3TA 3S9CA 3A8BA 1XM1A 4JK6A 1SSXA 1SGIB 3P17H 3F9HA 2D2DA 1QGFA 1AD8H 2EI8A 1EZSC 1BTWA 2Y6TA 1TNKA 1C1PA 1AE5A 1O3JA 1GI7B 2QC2A 3K65B 2BD3A 1G3CA 1XXFA 1A2CH 2Z9JA 1P2JA 1G36A 1ZPCA 1E37B 1HRTH 2H5CA 1BJVA 3EE0B 3RXPA 5EG4A 2THFB 3MMGA 7GCHF 3ZZ7A 5LH8A 2FYQA 3T5FH 4DIIH 1L1GA 1Y3YA 4XBDA 2VVCA 1RIWC 4X2YA 3SJOA 3ZZBA 3R0FA 3DHKH 4RKJB 2QCYA 4JZFH 3LPRA 4WMFA 5DO4H 3ENSB 1P2IA 1B7XB 3SNDA 2UWLA 5L2YH 3RXJA 1OX1A 1TBQH 4NSYA 2SFAA 1SLUB 3SI4H 1G2LA 1J9CH 1OWIA 2PLXA 1O36A 3ZVDA 2OC1A 2TGTA 2HALA 2QAAA 1C1MA 1QA0A 1S83A 1DUEA 3EDXB 2A2XH 3QO6A 4GUXA 1QL8A 2QF3A 1HAPH 1O2NA 1TIOA 3RDZA 2UUJB 3HK3B 3CP7A 1YCPK 1HJAB 1H8IH 3P6ZB 3RMOH 4OS5A 4LZ4B 1FAKH 4CH8B 1YLDA 2ZHWH 1TX6A 3PO1B 1P9UA 1S85A 3P95A 5HMAA 5PTPA 3EAJA 4IGDA 1W2KH 4AX9H 3TK9A 3AAUA 4KTCA 3TJOA 3T25A 1F0RA 1O2KA 1BMNH 1V2PT 3MU8A 4ABGA 4Q7YA 1AFQC 4K2YA 4F49A 3CENA 1BBRK 1G3BA 2YNAA 1RJXB 3P8GA 1JIMA 1C2IA 1P04A 3BTQE 3FP6E 4MNXA 1HIAB 4NIWA 3RXQA 3A82A 3QK1A 4CRFA 5F03A 1W11U 2BB4A 1ELBA 3F9FA 4FXGH 2BQ7B 4H6SB 3ZVBA 2HNTF 1J15A 1V2JT 4CBOA 3STJA 2OUAA 3BSQA 4FUDA 3PLPA 1Z8IB 1C2EA 1LHGH 1ANCA 1W0YH 3R3GB 1ELTA 3SU0A 2FEQH 1AIXH 1DLKB 1RIWB 3A7XA 5JBBS 8LPRA 4Y7AA 4O03A 1H9LB 5E0GA 1ZYOA 7KMEH 1HJ8A 3MO6A 1EAUA 1EASA 2VWNA 3V7TA 1PFXC 2Y80A 2ODPA 4X2XA 1PQ5A 1V2VT 3S7KB 3SNBA 4Y0ZE 2JH6D 1N8OC 1V2MT 1GHVH 5EPNA 1Y8TA 2JKHA 1UJ1A 4AZ2B 4DURA 3MNXA 1FMGA 1VGCC 1EATA 2W26A 1P2QA 1ZTLA 1MCVA 1HAVA 2ZGCA 2G5VA 5DJ7A 2BY8X 3RXAA 4WF8A 3QTOH 4XFQA 2A4RA 1LTOA 1DWCH 1SLXB 2J34A 1DWBH 1T8NA 1XXDA 4KGAA 1SPJA 2PKAB 2P95A 2EI7A 1WQVH 3QDZB 1QL9A 1H9HE 3LGTA 2TGPZ 2PTNA 1QRZA 2SNVA 4NWLA 5F8XA 4JZDH 3TK6A 4SGBE 2HNTE 4HZHA 3A89A 5A09A 1TGSZ 1HXEH 3A7TA 3ZVFA 1YCPM 1KDQA 2VGCB 3B8JA 1ZGVA 3M5OA 3Q3XA 3M5LA 3A7YA 1GI4A 5TCCA 1CT2E 2LPRA 3AW1A 1GI0A 1EQ9A 4DIHH 3Q76A 1Z1JA 3L6PA 3SN8A 5FCRA 3GDVA 3SGBE 2VH0A 1B5GH 1GJ6A 1MD7A 3U8OH 2A5AA 1FNIA 4WXVA 2AGGX 1SFQB 2VIPA 1K22H 1EX3A 4UFEH 2ZFRH 3GDUA 2VNTA 1AU8A 4K60A 4VGCC 1XVOA 4ABFA 8GCHF 4XBBA 1A46H 3TNTA 2P59A 1TBRH 3MWIU 3E8LA 1OPHB 4ISOA 1A5GH 4X8UH 3KNXA 1H8DH 2FIRH 3DFJA 2FOCA 1GHBG 3MOCA 2SGFE 2ANWA 4TPIZ 3URCA 1T4VH 3M5NA 1MCTA 1BTZA 1O33A 1MQ5A 4CRCA 1O3BA 4JZ1A 1CGHA 2AGEX 2PSYA 3S69A 5JPMH 4IN2A 2CXVA 1XUGA 2STAE 3G01A 1FQ3A 2BD7A 2BM2A 1XMNB 3GY6A 1BHXF 1EZUC 2Z3CA 1Y5BT 1MTNC 4X2VA 2C90B 3TVJB