1AN1E

Leech-derived tryptase inhibitor/trypsin complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
222
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords TRYPSIN
publication title Structure of the complex of leech-derived tryptase inhibitor (LDTI) with trypsin and modeling of the LDTI-tryptase system.
pubmed doi rcsb
source organism Sus scrofa
total genus 57
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E02
1P2JA 4ABDA 1TOCB 5JBCS 2ZHQH 4AYYB 4OS5A 4Y0ZE 1E0FD 1EZXC 2WUBA 2FLBH 4X0WU 1SB1H 4BAQB 3ZZ7A 1GI0A 1VJ9U 1HGTH 4JYVH 4M7GA 1O36A 2W5EA 3SJIA 1BRAA 1A46H 1NN6A 1Y59T 4NSYA 3TPIZ 1HIAA 2D1JA 1UVOA 3F6UH 1DXWA 1C2EA 5TJXA 1IOEA 4XFQA 1AKSB 1Z6EA 3V0XA 1J16A 3UUZA 3P8FA 3IG6B 3TJUA 2QGRA 1PYTC 4YLQH 1O5CB 1LDTT 2Q6GA 3RMLH 1QBOA 2O8WA 1KXDA 3GCTF 4UE7H 3BTFE 4Q7YA 3CS7A 1JXPA 1TQ0B 1YF4A 5FCKA 4B1TA 1QB9A 1K21H 1YPEH 2FM2A 2STBE 1HJ9A 5EW2H 3MU5A 3FP6E 1ZJKA 2W3IA 3T62A 1FNIA 2NU3E 1Y8TA 1CO7E 1DWEH 1EZQA 2QYIA 4WJG2 1GJ5H 3R3GB 3MO9A 1JIMA 2ZF0H 1L0ZA 4NFFA 4KTCA 2WPKS 1SBWA 2V35A 1A5IA 3EA7A 2SGDE 3KQEA 1TYNA 1ZHRA 1A0HB 1O2RA 3ZZ5A 3DUXH 1SGQE 4OGYA 2ZGJA 3L6PA 3U98H 4A92A 1K1OA 5EXNA 1C2KA 1Y3XA 1SGIB 1E36B 1XUJA 1SGFA 2OBQA 1MBQA 2J34A 1U6QA 2B8OH 4I33A 4OGXA 1GBEA 4Y8YA 1QRXA 1IAUA 2TGDA 3KIDU 1DXPA 3HPTB 1O31A 3RXLA 2VB0A 5HMAA 4GCHF 4BAMB 3U8OH 4ZAEA 3H7TA 1HUTH 1YP9A 1GBTA 3GDUA 3RP2A 1YKTA 1O2GH 1ZHMA 1KDQA 1XM1A 3MH4A 5FX6A 1GVLA 4FU9A 4X6PA 2A4RA 1V2RT 1G2MA 3N7OA 2BLQA 1NU7B 3M5LA 2EEKA 1DUEA 3E1XB 1XMNB 3V7TA 3PWCA 2VWMA 3QLPH 2OCVB 1GBJA 3A81A 1UK3A 3DA9B 4Y7AA 3OY5U 3BIVH 4DIHH 1JMOH 4IN1A 3UY9A 3BIUH 4B2AA 4CREA 1F2SE 2CF9H 1GGDC 3UNSA 1ZRBA 5JB8S 1FIZA 1F0UA 3UR9A 2ODPA 3RXKA 3MH5A 1B7XB 5TCCA 2BX4A 3SV8A 1GJCB 2VNTA 2BQWB 4K1EA 1V2TT 3HATH 1ABIH 5B6OA 3SHCH 1BHXB 1JWTA 1TIOA 1DS2E 2D8WA 4MNXA 3FP8E 1DDJA 5BRRE 1AGJA 3A87A 5DP4A 5EQRA 1SGYE 5SGAE 2FIRH 2A4GA 2EI6A 3EYDA 3S69A 2BQ7B 3U9AH 3BG4C 1HAOH 4NA9H 1O30A 2BTCE 2BY7X 2GV6A 3I77A 4MPWA 4UDWH 1PFXC 2Y81A 1DOJA 5C20A 4HI3A 3MH6A 1CHOF 4KELA 3RMOH 2O8TA 1C5VA 1O33A 1P0SH 1IQGA 1ZHPA 1O35A 1HJ8A 2ZU2A 3KQCA 3P95A 2XC0A 1HB0B 4AFSA 4AZ2B 1UCYE 3RXPA 2KAIA 5AFYH 2ZPRA 1C5PA 1ZRKA 1Q31A 3Q00A 4CRCA 3SW2B 3S7HB 2Z9IA 1BMNH 2BVXH 1S84A 3MNBA 3RXDA 3HK6B 1TLDA 1Y3YA 4ISIH 2HWLB 3RXUA 4LXBH 1V2JT 4AB9A 1UVUH 4YOIA 1P9SA 3E8LA 1P02A 3URDA 2CJIA 1WYKA 1QA0A 2BB4A 1CT0E 4HGCA 1SGRE 4FUHA 1ELBA 4RKJB 4WH6A 2SGQE 1UHBA 4NFEA 2BDBA 1GJBB 3GCOA 1TNIA 1C4V2 1YPLH 4HZHA 5DP5A 1AQ7A 1ZPZA 4JZFH 1FDPA 5EW1H 2P16A 4PROA 1YPHE 1RRKA 1GDNA 4FUBA 7KMEH 9LPRA 3ITIA 2G4UA 3GCTG 1OX1A 2C90B 3MWIU 4NZQA 3Q3XA 1TOMH 3KF2A 4WWYA 5AFZH 2QAAA 4B2CA 1AUTC 1C9TA 3NXPA 3P8GA 4QT8C 1VR1H 1GI2A 1Z71A 2EC9H 1ETRH 1PJPA 2BD4A 1K22H 2FOMB 2V3HH 4YLUA 1FQ3A 1IQIA 1NRRH 1SR5C 2D26C 3VB6A 3LC5A 2EI8A 5FX5A 1HAVB 2ZCKP 1MU6B 5E2PA 4X8TH 1UVPA 1G2LA 1EQ9A 3SORA 1C5OH 1C5SA 3LU9B 4H4FA 1QRZA 3PM3A 3W95A 4UONA 3LJJA 1G36A 2OLGA 1A3BH 2ZFFH 1AHTH 2J94A 2QC2A 1C1PA 3RXEA 4X1PU 1GJAB 3I29A 1TGBA 3A86A 3T28A 4B2BA 2A4QA 1ELAA 3PTBA 1J8AA 4K8BA 1FY1A 1OS8A 1Z6JH 3A84A 1SOZA 2HNTE 2VGCC 1DFPA 2P93A 2FEQH 2FWWA 1S83A 4GCHG 4YOJA 2PTNA 3FZZA 3TH4H 1XUHA 4SGAE 1TNHA 3S9AA 4INHA 3OYPA 1GBBA 2XYAA 5DP3A 4TYDA 3CS0A 5FBIA 4LZ4B 1LPKB 3UIRA 4ZMAH 4CRGA 1L1NA 1CA8B 2VGCB 1GHBF 2Z9JA 5EODA 5GIBA 3LPRA 2R3UA 1HAPH 1LCYA 1D6WA 1OWIA 3L33A 3PTNA 4ABEA 1TPAE 1UK4A 4CHAB 1IQFA 1N8OB 1DWBH 1GJ8B 3EE0B 1MZAA 4GLYA 1IQNA 2P3UB 1BDAA 3EA8A 1TABE 1EATA 3EGKH 1C4Y2 2PGBB 2F91A 2A7HA 3DFLA 1D3DB 1EP5A 3KGPA 1A61H 5FXLA 4ZHAA 1C2GA 2ANMH 1O2YA 2LNCA 5IDKA 2XBWA 1BTYA 1SGCA 4K3JA 4IW4E 3PLBA 1F5RA 3A85A 7ESTE 1TGSZ 1WTGH 2ZDMA 5AF9H 2UUYA 1F5LA 3NCLA 1D6RA 3PMBB 3LH3A 3SHAH 3STIA 2GT8A 2W3KA 2A5IA 1AN1E 1C5ZB 5FAHA 5ABWA 1ZTJA 2W7SA 4KTSA 1F0RA 4GAWA 1L2EA 1EXFA 1XVMA 2BD3A 5L2YH 1EX3A 2TIOA 1FIWA 2XRCA 3SV2H 3BN9A 2F9OA 3TH3H 1OYQA 1FN6A 1ZGIA 2JH5D 1ZMJA 3UOPA 4X2XA 1CT4E 2EI7A 2DUCA 4E7RG 2WYJA 1CHOG 1RTKA 3SN8A 2H9EH 1OPHB 1IQEA 3H7OA 2J92A 3E0NB 4DVAU 1UK2A 1P2MA 1GL1A 2ZCLP 4I8LA 3B23B 1QGFA 2HNTF 1GHWH 1O2TA 1WTHD 1AKSA 5F8ZA 1ARCA 2NU0E 1V2PT 2QN5T 1C2FA 3M36A 2C4FH 2ESTE 3VFEA 1UCYH 3DFJA 3A82A 1BA8B 1WAYB 3RUOA 3SNEA 2WPMS 3QZRA 1ARBA 1FAXA 3TK6A 1O5EH 1BTPA 2YOLA 3LONA 1L1GA 5GXPA 3SNDA 2GDEH 4GUXA 4B71A 1Q2WA 4E05H 2ZFQH 1NFUA 3TJOA 1ZLRA 4NIXA 4BXWA 1QR3E 3PV4A 4CBNA 5GJ4B 2ZHWH 1NRQH 1TMTH 1BTWA 1T8LA 3BTDE 3Q77A 3F9GA 1PQ8A 1ZSJA 1WQVH 1ELEE 5F8TA 2BZ6H 1C9PA 2J4IA 2VVVA 1HJAC 1L1JA 1OWKA 2BVSH 3SV9A 1UTMA 1TMUH 4B74A 1HXFH 1RGQA 1GI3A 1LO6A 1SVPA 2HRVA 4IBLH 4UD9H 3BTGE 1FY4A 3A80A 1TBZH 1O2WA 2G55A 4X8UH 1GHZA 2AMPA 1QJ1B 1XXDA 3E16B 3LOXA 3C27B 1W2KH 2SNWA 1HJAB 5LPFA 1GJ4H 1P12E 2H5DA 1FAKH 2NU4E 3ZVFA 2PSYA 1B0FA 4A1XA 2GZ8A 1G3BA 1WV7H 5AHGH 2BM2A 1P3CA 2GT7A 1FLEE 1GDQA 1SQTA 1HAZB 2XWBI 2BDYA 2G5NA 1BCUH 3KQDA 1IQJA 2SGPE 1UVSH 2Z3DA 1TMBH 3EA9A 4GVUA 1P8VC 1E37B 3GCHC 3SNAA 2ZCHP 1GWAA 1UTOA 3HKJB 1N6XA 3A7VA 2RDLA 4WXVA 5C1XA 1GBCA 1K1JA 1NT1A 2FOEA 5T6DA 1TRNA 1FJSA 1W10U 1X7AC 2R9PA 3GCHB 2A7CA 4I32A 3B9FH 3Q3YA 4IGDA 1ZOMA 2THFB 1V2OT 1P01A 1PQ7A 1CVWH 1W7XH 2WPHS 1GBIA 2FESH 2ZHFH 3BV9B 1QL8A 4NA8A 1C1MA 4H6SB 1SHYA 1VCQA 4ZHMU 1GHBG 2B7DH 1O39A 3LGIA 1BJUA 2ANWA 4BAKB 3A7XA 1P2OA 1HAGE 1V2NT 5C5OA 4U2WA 3QK1A 1Y5BT 1G30B 5FPTA 1BBRE 4O97A 5ESTE 3MTYA 3K65B 1EJAA 2ZFSA 2F9UA 5EGMA 1UO6A 2XBXA 4BTIB 4ZKNU 1IQHA 3DD2H 1EP6A 1O2SA 3BTQE 1AI8H 3RXGA 4ABIA 4AFUA 1MMJN 2J95A 4ISNA 2OBOA 2FX4A 3ODFA 2PKAB 4X6NA 1SGEE 3LGYA 3LH1A 1D4PB 3BEFB 3JZ1B 3T26A 4BTUB 4X6OA 1QQ4A 1VJAU 6GCHF 1Z7KA 2CMYA 2OTVA 4E7NA 1E38B 3SU1A 2P94A 2A1DB 2AGEX 2SGEE 3MNSA 4JCNA 1AFEH 3QO6A 1RTFB 2BZAA 4Q2KA 5F6MA 1LHDH 2G51A 2Z3CA 5HGGA 3MU1A 1SGTA 3GICB 2XNIA 3ZVCA 2BDAA 4A6LA 1MTWA 3GYLB 1GDUA 3QGNB 1AZ8A 2HOBA 2ZDAH 3U8TH 3S0NA 1L4ZA 3ATMA 1WBGB 3KHVA 2ZGHA 1NO9H 1UTPA 1TBRH 1MTSA 1O3LA 1L4DA 2H2ZA 3QN7A 1O32A 3RXRA 2GMTC 1YPHC 4U30A 4BAOB 3VB3A 3A8BA 2NWNA 1BRBE 3A7WA 1C2DA 1P2KA 3ZZ8A 3ZV8A 2V6NA 3MOCA 4D9RA 4Y10E 1V3XA 1C1SA 3ZZ9A 2GMTB 1CHGA 3M37A 1SFQB 1ANBA 3P70B 1OYTH 2Y7ZA 3MU0A 2BDHA 1EJMA 2OP9A 2TRMA 3QTVH 1AWFH 1C5TA 1C5MD 1A2CH 1YC0A 2Y7XA 8GCHF 3OSYA 2B0FA 1AO5A 1CSOE 1C5NH 1HAVA 2OQUA 3ZVDA 4MLFB 4TY6A 1ZR0A 3SGAE 3PLKA 2AH4X 2XBYA 1NC6A 2OUAA 2PV9B 1HAIH 1AE5A 1TNGA 1QHRB 1C2LA 8KME2 1GVZA 3ZZAA 3RU4E 5GPIB 1NRPH 2YNBA 2O8MA 3UWIA 3RXIA 3SJ9A 2I6SA 3ZZ4A 2P3TB 1NFWA 3ATLA 4DJZB 2V0BA 2C8YB 2JKHA 2HNTC 2XCNA 5GWZA 4BOHA 3GY6A 5EQQA 2ZQ1A 1GHYH 4OS1A 5LPEA 1QY6A 2QIQA 2BXTH 1P10A 1TE0A 4I31A 1SGNE 1JBUH 5A0BA 1KXCA 1S81A 4AYVB 1SFIA 2G8TA 3ENSB 3M5NA 3T2NA 3GOVB 4HTCH 2BLWA 3RXCA 3K9XB 3EAJA 3M5MA 4SGBE 1MUEB 2Q6FA 2ZI2H 1EAIA 2BHGA 3QWCH 1W0ZU 2VVUA 2ZP0H 1LVBA 1ELFA 1NRSH 2ZKSA 1SGPE 3LC3A 1GVKB 4MPXA 1GGDB 2WYGA 4IC6A 3O8RA 4IMZA 1MTVA 2G81E 2TGPZ 2DE8A 1C1UH 1GI7B 2UWLA 2ZZUH 4IMQA 9ESTA 1EZSC 1A5GH 4DGJA 4NIYA 1DLKB 1QTFA 5JYIA 1W0YH 2RCEA 1OWHA 2H5CA 4Q80A 4WMFA 1F0TA 4A1TA 4MNVA 2VIWA 1T32A 2AS9A 3F9FA 2VINA 1BBRH 2Y5FA 5LGOA 1K1IA 4FXGH 4X6MA 5EU8A 4Y8XA 4LOYH 1HAXB 2A32A 1ZPBA 1LHFH 1HV7A 1DANH 3TNSA 1QB6A 1NRNH 3SU4A 4AN7A 1Y3VA 1CGIE 3BG4B 3GY8A 2ZDVH 4TY7A 2AEIH 1ZSLA 1GBFA 3RC6A 1O3PB 2J2UA 2QY0B 5DP9A 4GSOA 6GCHG 5E0GA 1PPCE 1O2XA 1IQKA 3KEEA 3TLOA 2O8UA 3K6ZA 3TK5A 1QJ6B 4Z0KA 3LKWA 2ZFPH 1TNKA 3MI4A 3GDSA 2Z9GA 1SLVB 3MH7A 3SNCA 3D65E 2BD7A 4DY7B 4CRBA 2GZ7A 1V2ST 1C1RA 2G4TA 1HIAB 1TGNA 3ATKA 1A5HA 5C67A 2BDCA 4YOGA 2DE9A 3TNTA 2QCYA 5GDSH 2GCTC 1AD8H 1BRUP 1V2KT 2NU2E 3LGUA 5BPEA 1BITA 2WPLS 2TBSA 2W7UA 4DURA 1EPTC 4I7YH 1AWHB 2VWLA 4Y0YE 1O3GA 2QXJA 8ESTE 1O5DH 2Z7FE 5LPRA 5EG4A 3A8CA 2GCTB 4CBOA 2ZIQH 1P04A 1BUIA 1EPTB 3ZZ6A 3M7QA 2STAE 4AOQA 1TONA 2HLCA 1QFKH 1AU8A 1RJXB 5T6GA 2R2WU 1OSSA 2FOCA 2GGVB 3BTKE 1CT2E 4FUJA 3TH2H 1ZMNA 2VU8E 4GHQA 3WY8A 1S0RA 4ISOA 5F8XA 2K1QA 1AVXA 3M7TA 2BY8X 3OX7U 3PWBA 1ABJH 4X2WA 5AVDA 1Z1JA 1DICA 4OS4A 2F83A 8GCHG 3ATIA 3ZV9A 3LGWA 1YLCA 3SUEA 1F5KU 3TGJE 2ZU3A 3SNBA 4FU8A 3SV7A 4U32A 3RXAA 1GJ6A 1LHCH 2A7JA 2C93B 1LTOA 1GMCF 2ZTYA 1S5SA 1BBRK 1YPKH 3Q76A 4WXIA 2XWAA 4ZROA 3D62A 1GJ7B 3A8DA 4ABGA 3T5FH 2ZFTA 2PGQB 2BVRH 4O9VA 2ZQ2A 4Q7ZA 2OC0A 1AVWA 1LVOA 3A7TA 3RC4A 3SU2A 1TX6A 1SLUB 4DIIH 1ACBE 3E6PH 1DX5M 1TQ7B 3AAUA 3UNRA 3C1KA 1THSH 1ESAA 1KXEA 4FUCA 1ELDE 1UTNA 1GL0E 2ZGXH 4KGAA 3PMAB 5HM9A 4GPGA 1EASA 2HPPH 7LPRA 1O2QA 2IOTA 3T29A 3M35A 4F4OC 1PYTD 3UPEA 2TGAA 2WINI 4ABJA 1LVYA 1C5RA 1RD3B 1P2IA 3NZIA 3SI4H 1FONA 4CRDA 4I8GA 1Y5AT 2ANYA 2FXRA 4Z6AH 1O3BA 2FO9A 1J15A 1O3NA 2WUCA 3KN2A 4ZKRU 1EB1H 1HAHH 1ZTKA 1GPZA 1WOFA 3TU7H 5LH8A 4ABAA 1BTXA 1P3EA 3DHKH 4FUIA 5T6FA 1FZZA 4CH8B 1E35B 2P3FH 1ESBA 3ZZ3A 1AFQC 2PKAA 1C5XB 1V2QT 1TPSA 1NROH 2M5TA 1XUKA 1T8MA 2V3OH 1FY8E 2YNAA 1D9IA 3M7UA 2OXSA 1AFQB 2BD2A 3JZ2B 2B5TB 2ULLA 3MNCA 5K7RA 4MPVA 4A5TS 4YT6H 2ZFRH 1O5AB 2H9HA 4MPUA 4AORA 4Y11E 1GBAA 3RXFA 3TVJB 1RXPA 1EAXA 2FYRA 2FTLE 1CE5A 1S0QA 1VCPA 3GYMA 3CENA 4DG4A 5T3HA 1ANDA 1A3EH 1GBMA 4NIVA 3A7YA 3SI3H 4AG2A 1MTUA 2A5KA 3PROA 4Y7BA 1OKXA 2ILNA 4BANB 3BTTE 1T8OA 3W94A 4JZEH 1TA2A 3TJVA 2CGAA 4H42U 3O8CA 5DG6A 4THNH 1BQYA 1UTJA 2XCFA 1NS3A 3RXJA 1C5UA 1LMWB 1XKBC 2UUFB 4OS7A 1NFXA 3I78A 1AB9C 5EQSA 3E90B 3SQEE 4AFQA 3V3MA 2PLXA 1DSUA 3UQOA 1K28D 2Z3EA 1AUJA 1MKWH 1ZGVA 1C2HA 1H8DH 1UHBB 1RIWC 2C8ZB 1CQQA 1K2I1 4INKA 2G5VA 5PTPA 4DOQA 4K8YA 3GISB 1FMGA 1QNJA 4K2YA 1AB9B 1E34B 1W11U 4UFFH 3VXEH 8LPRA 1O2HA 2QF3A 1KXBA 1HBTH 5DPAA 3VPKA 4FVDA 1JRTA 1P11E 1LHGH 2HALA 2UUJB 4DW2U 1QJ7B 5L2ZH 1GI4A 1LKAA 1TX7A 2R3YA 2ZPQA 1LPZB 4UFGH 3A89A 1AVGH 2BX3A 2FI5E 1YPJH 1TRMA 2C3SA 1GG6C 1FXYA 2F9BH 3M3VA 3NK8A 4A7IB 3PMJA 1MTNC 2ZU1A 4NSVA 4BAHB 1MAYA 3EQ0H 3H5CB 3LJOA 1MD8A 2VH0A 4H6TA 1DWCH 2ZGBH 3KCGH 3S9CA 2HPQH 5GCHF 1TPOA 3TITA 1KLTA 1GG6B 1ZPCA 1OP2A 1O2JA 1O2OA 1MTNB 2A2XH 1YCPM 3TGKE 1KTSB 1TALA 1A4WH 4D8NA 2AFQB 1JOUB 1CGHA 1DT2A 2R0LA 1GMCG 4U01A 4IS5A 1PPBH 2GKVE 3HK3B 1QURH 1W12U 4FUFA 3STJA 1SPJA 4AB8A 1C1VH 1H4WA 1V6DA 2ALVA 1TAWA 1Z1IA 1KXAA 1QL9A 1S6HA 1SL3A 2GD4B 3LGVA 3UR6A 4ABBA 1FPHH 4WH8A 2Y5GA 2Y82A 1G32B 1SLWB 4Q7XA 5E0JA 4FUDA 1GBHA 1UTLM 1TPPA 1WQSA 2AMQA 4D9QA 1UCYK 3MMGA 2IPHA 3RMMH 1BMAA 3GY3A 1O3CA 2VIPA 4X2YA 1HRTH 1AE8H 2BD8A 1P2NA 1UJ1A 1O34A 2RG3A 4AGJA 1DPOA 1FN8A 5IYTA 2R0KA 1MKWK 1W3CA 1TWXB 3EDXB 1O3KA 3BSQA 1LKBA 4K1TA 2ZDLA 5HXFA 1SC8U 3AW1A 2G52A 3NUMA 4X1NU 1MCVA 4Y8ZA 2WPIS 1O3EA 4J2YB 1O2ZA 3NKKA 1SQOA 1AMHA 4JYTA 4IN2A 3GY2A 2GZ9A 1SMFE 4WVPE 4XBBA 3DT0H 1XKAC 5I25A 1OWDA 1MCTA 2PFEA 1CU1A 3F1SB 3SGBE 3ZVBA 1WCZA 2AGGX 4LK4A 2F9VA 4R0IA 1OWJA 4RSPA 1A7SA 1KLJH 4ZHLU 1P06A 2BYAX 3CP7A 1BMMH 4R8TB 3SOSA 4O3UA 3ELAH 3BTWE 1ID5H 5F03A 3RM2H 3RXSA 3SJOA 2F9PA 4I8JA 1V2VT 3URCA 5DK1A 5C2ZA 4NGAH 5E2OA 4NIWA 1MAXA 1KY9A 3LT3A 1ANEA 1ELTA 1YM0A 2F3CE 1GJDB 2AGIX 1NESE 4RN6A 1YBWA 1O2KA 3VB5A 1QB1A 1O2PA 1C5QA 1ANCA 4ISHH 2P95A 4X1RU 1EUFA 1UTQA 7GCHF 1DITH 4MQAA 2R2MB 2BY6X 1JRSA 3MYWA 2VIDA 5CMXH 2AIQA 3ZZDA 2FPZA 3SQHE 2BQ6B 1T4VH 3P8OA 2P8OC 1VITF 4WY3A 2BY9X 6CHAC 1NM6A 1C2IA 2H9TH 1BTHH 3RLWH 3F9HA 1RFNA 1GHXH 3NPSA 1OXGA 1GI9B 2QXIA 1BTUA 3SJ8A 1QBNA 1MQ6A 1EPTA 4MTBA 1FPCH 1ZYOA 1QBVH 2P8OB 3UNQA 1FI8A 6CHAB 2FI3E 1DM4B 5L30H 4ZH8A 1SSXA 2LPRA 2ZU4A 1BJVA 2VWNA 4UFEH 3BTME 1W13U 3P17H 1FUJA 1GI5A 5A8YA 4FU7A 3GY5A 3SUDA 3KNXA 2XC5A 3RDZA 4CH2B 2AYWA 1ZTLA 5A2MH 4OS2A 2Y80A 1HLTH 2ZDKA 4CR9A 5C1UA 2FS8A 4ZXYH 4WF8A 2ASUB 4FUGA 3SU0A 2FDAA 2JH0D 3SO3A 1N1LA 3U1IB 1P57B 1C5WB 1C1WH 5DGJA 3S9BA 3MHWU 3M61U 5G4BA 1S85A 2ZU5A 3MO6A 2G00A 4X2VA 3BTHE 4BTTB 1YPMH 3FZDA 4ABHA 1O3IA 5TCAA 4K1SA 5GCHG 3RXOA 1F7ZA 1KYNA 4XOJA 1GHAF 4X1QU 1VZQH 3SU3A 3E0PB 1GI8B 3UTUH 1EAWA 2Y6TA 1D3QB 3VEQB 2ODYB 1T31A 1PQ5A 4MDSA 5L6NH 2OQ5A 2PTCE 1ELCA 1O3AA 3ZVEA 2Z9KA 1K1PA 3UWJH 3HKIB 3TIUA 1S82A 1DWDH 1O3MA 1O5GH 1O3FA 2A0QB 1WSSH 3SV6A 1YGCH 1IHSH 4OS6A 4CRAA 2A31A 4O3TA 3U1JB 2GCHF 1GJ9B 1C1QA 2XBVA 3PLPA 4NA7A 1BOQA 2GX4A 1SHHB 3F9EA 4NWKA 3GY7A 1HFDA 1A0JA 2W26A 4Y76A 3O8BA 3VB4A 1VITH 5E8EH 3UFAA 1OOKB 2FYQA 4XE4A 1ETSH 1Y5UT 3D49H 2CHAC 1TX8A 1OP0A 2FTMA 2VIOA 1FV9A 1C4U2 2CXVA 1VGCC 1HXEH 1O3DA 2F9NA 2BD9A 2P59A 1C1TA 2BY5X 1N6YA 4YESB 2GV7A 2SGAA 1G9IE 1EOJA 1AZZA 1ETTH 4B75A 2CHAB 2GVFA 3OTJE 3Q3KA 3D23A 5FBEA 1VGCB 1J9CH 1MBMA 2ZDNA 1KLIH 5H4IB 3SUGA 3IITA 1SI5H 2RA3A 1SOTA 3LIWA 1Y3UA 2WV5A 1SGFG 3GCNA 1O3HA 5JB9S 2SGFE 1BRCE 3R0FA 3RU4D 1GCDA 4MNWA 1TRYA 1XUGA 2FOGA 3M5OA 1Z8RA 5JPMH 4CRFA 2FOFA 2J38A 3HGPA 2OC1A 3MU8A 4ISLA 5A09A 1GBDA 4LZ1H 1JIRA 4CR5A 1HDTH 1B0EA 1H8IH 3AAVA 3BEIB 2FS9A 5DP7A 5I46H 1EZUC 1SQAA 4I8KA 6LPRA 1RTLA 1TBQH 1GMDF 2ZECA 3TGIE 3RXQA 4FVBA 2JH6D 1T8NA 1EB2A 1O2IA 5EPNA 1J14A 1NFYA 1UVTH 3AW0A 1BMLA 3ESTA 3QGJA 1GBLA 4O03A 5DP8A 1O38A 4D76A 1O2LA 1YLDA 2OC8A 1BTZA 2ZGCA 1V2MT 2Z6BD 1BZXE 1ZMLA 1ZZZA 2J9NA 3SU6A 1O2NA 1NU9A 2A2QH 4ESTE 4Y71A 3B8JA 1DUAA 1H1BA 4AG1A 4ASHA 1BT7A 7GCHG 1GBKA 5C3NA 1S6FA 1FY5A 1GMHF 1KIGH 1CA0C 1YPGH 2C8XB 1PPGE 4Y79A 2O8LA 2BLOA 1VITG 1DY9A 1QQUA 1KTTB 4AFZA 4J1YA 1DY8A 4D7GA 1PPHE 2FZZA 1H9IE 3M3SA 2ODQA 1TGTA 4YO9A 3RC5A 1QCPA 1CA0B 5FPYA 3K2UA 2BD5A 5A8ZA 4MNYA 4ZXXH 3VXFH 1GCTC 4JK5A 3ZZCA 1W7GH 2PUQH 3E91A 1QL7A 1XX9A 3RLYH 2RA0A 3GDVA 4XDEA 5DO4H 1QRWA 2H6MA 2BOHB 5A0CA 4TPIZ 3SBKA 1G3CA 2NU1E 2PSXA 2QA9E 3ZYDA 1P2QA 2PR3A 3QZQA 1GCTB 1ELVA 2GTBA 3G01A 2VIVA 3PO1C 2VIQA 2AERH 4WMDA 4XBDA 2CN0H 1ESTA 2TGTA 2ZO3H 3RXVA 3HGNA 5DJ7A 5CE1A 4X8SH 4ZKOU 1J17T 2VJ1A 1YYY1 2PHBA 1TNJA 1G37A 2QF0A 3PO1B 1KDQB 2Y5HA 1O5FH 2FLRH 2PUXB 2Z94A 3QX5H 3NWUA 2ZEBA 3KQBA 1GHAG 5EXLA 5A8XA 2ZPSA 2ZA5A 4CHAC 1N8OC 1XVOA 3TK9A 3BEUA 3MFJA 3A8AA 3FANA 3M3TA 4A1VA 1A0LA 3P92A 2UWOA 3MNXA 5EXMA 4AGKA 1O2UA 1HAYB 1ZJDA 2Q6DA 3FFGA 2OINA 2OC7A 1D3TB 1K1LA 1LVMA 2ZTXA 4DT7B 3BTEE 1MH0A 1O2MA 1HNEE 2ZHDA 1V2UT 2HVXA 1DSTA 4JZIA 2FOAA 1LPGB 1D3PB 1ORFA 4KTUA 3UREA 3TJNA 1VCWA 2GCHG 3ZVGA 1BIOA 4TWWA 4MVNA 1BB0B 3QDZB 3ODDA 3RMNH 3SUFA 1SG8B 2GDDA 1Z8JB 1ZSKA 4K60A 4B76A 3KL6A 2FOHA 3O8DA 3T27A 4ABFA 1GI6A 1TNLA 2ANKH 4GHTA 1O3JA 3E3TA 1LHEH 4KP0A 3L3TA 3AASA 4UEHH 2PW8H 3PYHA 2JETC 2PWXA 6ESTA 3LGTA 4DCDA 1C2JA 1TB6H 2A5AA 2BMGB 1IHTH 4YTAA 3UQVA 4YM9A 4K5ZA 1H9HE 1C5YB 4HFPB 5HM2A 1H9LB 2IJOB 3SGQE 3ZZBA 4XBCA 3RXHA 1Z8GA 1DVAH 2IN2A 1NTPA 4Y6DA 3VGCC 5E0HA 1EJNA 2ZG0H 2JETB 4AX9H 2CV3A 1AIXH 3BF6H 2KAIB 3MO3A 1QA7A 3VB7A 3P6ZB 2TPIZ 3ZYEA 1WUNH 5JBBS 3RM0H 1O5BB 2FODA 3S7KB 4JZ1A 1O3OA 1THRH 1PQAA 4ZKSU 5J4SA 1EKBB 3RU4T 3VGCB 1P05A 1SLXB 2I6QA 1OWEA 1YCPH 2GP9B 1IQLA 1DE7H 2FOBA 2XW9A 4X1SU 3FAOA 5FCRA 1TGCA 2FMJA 1C5LH 1V2LT 1GMDG 2UWPA 4D7FA 3T25A 2AMDA 1DLEA 2Z9LA 2BDIA 5A0AE 1MKXH 1G3EA 1PPZA 5JBAS 2XTTB 3RXTA 1TFXA 1K1MA 1GHVH 3ZVAA 1W14U 1XUIA 5DP6A 5EPYA 2FP7B 1C1OA 4INLA 1WU1A 3SU5A 4FUEA 4XSKU 1MQ5A 1BHXF 2ZTZA 4KKDA 1PPEE 4JYUH 5DKMA 1RIWB 2A4OA 5JBTA 5JDUB 1NZQH 3F68H 2A45B 2CF8H 1GMHG 1MD7A 1CGJE 4B73A 1EAUA 1NPMA 1CBWC 3FP7E 1W8BH 1Z8IB 4IC5A 1NY22 4K69A 3PMHB 3V13A 4NCYA 2FI4E 2BDGA 3SZNA 3GY4A 2O9QA 3V12A 4JMYA 3AVZA 1XXFA 1K1NA 1CBWB 4WMEA 3U8RH 1TA6A 4VGCC 3QTOH 1SGDE 2ZNKH 3OY6U 3RXBA 1LQEA 1HCGA 5J4QA 2BLVA 3QUMP 1F92A 3IWMA 1UMAH 1EOLA 2D2DA 5C5NA 1AY6H 2VWOA 4I8HA 2Q1JA 2C8WB 1IQMA 2VH6A 4RKOB 3ATWA 3LDXH 5HYOA 4VGCB 1P09A 1HYLA 3UOUA 1F0SA 2H1UA 1G3DA 5ESBA 1O2VA 1B5GH 4NG9H 4BXSA 2PKSC 3U69H 1Q3XA 2QXGA 1KXFA 1V2WT 2AIPA 1INCA 2ZHEH 3OU0A 1GI1A 1C1NA 1LQDB 1O37A 5EOKA 2HGTH 1T4UH 2ZWLH 2QV1A 4BNRA 1Y3WA 2PKSB 4MG3A 4NZLA 4ZUHA 1QIXB 2WV4A 1THPB 3A7ZA 4X8VH 5CHAC 1XUFA 2WPJS 1MZDA 1T7CA 1YCPK 2SNVA 1FY3A 2VVCA 4F49A 2XC4A 5FHTA 1P03A 5C1YA 1KSNA 1HPGA 1RS0A 1K9OE 1P9UA 2XXLA 3P8NA 4E06H 2SFAA 1A1RA 1MKXK 1OP8A 2FX6A 2QXHA 4TWYA 4YT7H 5CHAB 3SJKA 4JK6A 4YZUA 2BOKA 3FVFB 1PPFE 5FPSA 4NWLA 5ETXA 2ZC9H 3BG8A 3K6YA 4JZDH 2BXUH 2UUKB 4UFDH 1O0DH 5K0HA 2OD3B 3A88A 4TPYA 3A83A 3RXMA 1MU8B 3MU4A 2B9LA 1UTKA 2ALPA 1ELGA 1M9UA 3PB1E 2EA3A 1C2MA
chains in the Genus database with same CATH superfamily
1P2JA 4ABDA 1TOCB 5JBCS 2ZHQH 4AYYB 4OS5A 4Y0ZE 1E0FD 1EZXC 2WUBA 2FLBH 4X0WU 1SB1H 2L74A 4BAQB 3ZZ7A 1GI0A 5KECA 1VJ9U 5HIYA 1HGTH 4JYVH 4M7GA 1O36A 2W5EA 3SJIA 1BRAA 1A46H 1NN6A 1Y59T 4NSYA 3TPIZ 1HIAA 2D1JA 1UVOA 3F6UH 3OAAD 1DXWA 1C2EA 5TJXA 1IOEA 4XFQA 1AKSB 1Z6EA 3V0XA 1J16A 3UUZA 3P8FA 3IG6B 3TJUA 2QGRA 1PYTC 4YLQH 1O5CB 1LDTT 2Q6GA 3RMLH 2WZQA 1QBOA 2O8WA 1KXDA 3GCTF 4UE7H 3BTFE 4Q7YA 3CS7A 1JXPA 1TQ0B 1YF4A 5FCKA 4B1TA 1QB9A 1K21H 1YPEH 2FM2A 2STBE 2EY4C 1HJ9A 2W6ID 5EW2H 3MU5A 3FP6E 3OTPA 1ZJKA 2W3IA 3T62A 1FNIA 2NU3E 1Y8TA 1CO7E 1DWEH 1EZQA 2QYIA 4WJG2 1GJ5H 3R3GB 3MO9A 1JIMA 2ZF0H 4I86A 1E1RD 1L0ZA 4KTCA 4NFFA 2WPKS 1SBWA 2V35A 1A5IA 3EA7A 2SGDE 3KQEA 1TYNA 1ZHRA 1A0HB 1O2RA 3ZZ5A 3DUXH 1SGQE 4OGYA 2ZGJA 3L6PA 3U98H 4A92A 1K1OA 5EXNA 1C2KA 1Y3XA 1SGIB 1E36B 1XUJA 1SGFA 2OBQA 1MBQA 2J34A 1U6QA 2B8OH 4I33A 4OGXA 1GBEA 4Y8YA 1QRXA 1IAUA 2TGDA 2CK3D 3KIDU 1DXPA 3HPTB 1O31A 3RXLA 2VB0A 5HMAA 4GCHF 4BAMB 3U8OH 5CHBA 4ZAEA 3H7TA 1HUTH 1YP9A 1GBTA 3GDUA 3RP2A 1YKTA 1O2GH 1ZHMA 1KDQA 1XM1A 3MH4A 5FX6A 1GVLA 4FU9A 4X6PA 2A4RA 1V2RT 1G2MA 3N7OA 2BLQA 1NU7B 3M5LA 2EEKA 1DUEA 3E1XB 3WWFA 1XMNB 3V7TA 3PWCA 2VWMA 3QLPH 2OCVB 1GBJA 3A81A 1UK3A 3DA9B 4Y7AA 3N7DA 3OY5U 3BIVH 4DIHH 1JMOH 4IN1A 3UY9A 3ZIAD 3BIUH 4B2AA 4CREA 1F2SE 2CF9H 1GGDC 3UNSA 1ZRBA 5JB8S 1FIZA 3F0PA 1F0UA 3VG8A 3UR9A 2ODPA 3RXKA 3MH5A 1B7XB 5TCCA 2BX4A 2V3MA 1GJCB 2M2AA 2XNDD 2VNTA 2BQWB 3SV8A 4K1EA 1EFRD 1V2TT 3HATH 1ABIH 5B6OA 3SHCH 1BHXB 1JWTA 1TIOA 1DS2E 2D8WA 4MNXA 3FP8E 3UB0A 1DDJA 5BRRE 1AGJA 3A87A 5DP4A 5EQRA 1SGYE 5SGAE 2FIRH 2A4GA 4FETA 2EI6A 3EYDA 3S69A 2BQ7B 3U9AH 3BG4C 1HAOH 4NA9H 1O30A 2BTCE 2BY7X 2GV6A 3FO8D 3I77A 4MPWA 4UDWH 1PFXC 4Z1MD 2Y81A 1DOJA 5C20A 4HI3A 3MH6A 1CHOF 4KELA 3RMOH 2GJGA 2O8TA 1C5VA 1O33A 1P0SH 1IQGA 1YLNA 1ZHPA 2F4LA 1O35A 1HJ8A 2ZU2A 3KQCA 3P95A 2XC0A 1HB0B 4AFSA 4AZ2B 1UCYE 3RXPA 2KAIA 5AFYH 2ZPRA 1C5PA 1ZRKA 1Q31A 3Q00A 4CRCA 3SW2B 3S7HB 2Z9IA 1BMNH 2BVXH 1COWD 1S84A 3MNBA 2QF4A 3HK6B 1TLDA 3RXDA 1Y3YA 4ISIH 2HWLB 3RXUA 4LXBH 1V2JT 4AB9A 1UVUH 4YOIA 1P9SA 3E8LA 1P02A 3URDA 2CJIA 1WYKA 1QA0A 2BB4A 1CT0E 4HGCA 1SGRE 4FUHA 1ELBA 4RKJB 4WH6A 2SGQE 1UHBA 2V7QD 2BDBA 4NFEA 1GJBB 3GCOA 1TNIA 1C4V2 1YPLH 4HZHA 5DP5A 1AQ7A 1ZPZA 4JZFH 1FDPA 5EW1H 2P16A 4PROA 1YPHE 1RRKA 1GDNA 4FUBA 2KM0A 7KMEH 9LPRA 3ITIA 2G4UA 3GCTG 1OX1A 2C90B 3MWIU 4NZQA 3Q3XA 1TOMH 3KF2A 4WWYA 5AFZH 2QAAA 4B2CA 1AUTC 1C9TA 3NXPA 3H09A 3P8GA 4QT8C 1VR1H 1GI2A 1Z71A 2KX4A 2EC9H 1ETRH 1PJPA 2BD4A 1K22H 2FOMB 3OE7D 2V3HH 4YLUA 1FQ3A 1IQIA 1NRRH 3F2FA 1SR5C 2D26C 3VB6A 2YMSD 3LC5A 2EI8A 5FX5A 1HAVB 2ZCKP 1MU6B 5E2PA 4X8TH 1UVPA 1G2LA 1EQ9A 3SORA 1C5OH 1C5SA 3LU9B 4H4FA 1QRZA 3PM3A 3W95A 1OHHD 4UONA 3LJJA 1G36A 2OLGA 1A3BH 2ZFFH 1AHTH 2J94A 3CNRA 2QC2A 1C1PA 3RXEA 2J97A 4P00A 1GJAB 4X1PU 3I29A 1TGBA 3A86A 3T28A 3EE7A 4B2BA 2A4QA 1ELAA 2PP6A 3PTBA 1J8AA 4K8BA 1FY1A 1OS8A 1Z6JH 3A84A 1SOZA 2HNTE 2VGCC 1DFPA 2P93A 2FEQH 2FWWA 1S83A 4GCHG 4YOJA 2PTNA 3FZZA 3TH4H 1XUHA 4SGAE 1TNHA 3S9AA 4INHA 3OYPA 1GBBA 2XYAA 2LP6A 5DP3A 4TYDA 3CS0A 5FBIA 4LZ4B 1LPKB 3UIRA 4ZMAH 4CRGA 1L1NA 1CA8B 2VGCB 1GHBF 2Z9JA 5EODA 5GIBA 3LPRA 2R3UA 1HAPH 1LCYA 1D6WA 1OWIA 3L33A 3PTNA 4ABEA 5CDFE 1TPAE 1UK4A 4CHAB 1IQFA 1N8OB 1DWBH 1GJ8B 3EE0B 1MZAA 3F0OA 4GLYA 1IQNA 2P3UB 1W0JD 1BDAA 3EA8A 1TABE 1EATA 3EGKH 1C4Y2 2PGBB 2F91A 2A7HA 3DFLA 1D3DB 1EP5A 3KGPA 1A61H 5FXLA 4ZHAA 1C2GA 2ANMH 1O2YA 3FN8A 2LNCA 5IDKA 2XBWA 1BTYA 1SGCA 4K3JA 4IW4E 3PLBA 1F5RA 3A85A 7ESTE 1TGSZ 1WTGH 2ZDMA 5AF9H 2UUYA 1F5LA 3NCLA 1D6RA 3PMBB 5C0UA 3LH3A 3SHAH 3STIA 2GT8A 2W3KA 2A5IA 1AN1E 1C5ZB 5FAHA 5ABWA 1ZTJA 2W7SA 4KTSA 1F0RA 4GAWA 1L2EA 1EXFA 1XVMA 2BD3A 5L2YH 5KGOA 1EX3A 2TIOA 2JJ2D 1FIWA 2XRCA 4DT4A 3F2HA 3SV2H 3BN9A 2F9OA 3TH3H 1OYQA 1FN6A 1ZGIA 2JH5D 1ZMJA 3UOPA 4X2XA 1CT4E 2EI7A 2DUCA 2EQNA 4E7RG 2WYJA 1CHOG 1RTKA 3SN8A 2H9EH 1OPHB 1IQEA 3H7OA 2J92A 3E0NB 4DVAU 1UK2A 1P2MA 1GL1A 2ZCLP 5T1VA 4I8LA 3B23B 1QGFA 2HNTF 1GHWH 1O2TA 1WTHD 1AKSA 5F8ZA 1ARCA 2NU0E 1V2PT 2QN5T 1C2FA 3M36A 2C4FH 2ESTE 3VFEA 1UCYH 3DFJA 3A82A 1BA8B 1WAYB 3RUOA 3SNEA 2WPMS 3QZRA 1ARBA 1FAXA 3TK6A 1O5EH 1BTPA 2YOLA 3LONA 1L1GA 5GXPA 3SNDA 2GDEH 4GUXA 4B71A 3PV5A 1Q2WA 4E05H 2ZFQH 1NFUA 3TJOA 1ZLRA 3F3BA 4NIXA 4BXWA 1QR3E 3PV4A 4CBNA 5GJ4B 2ZHWH 1NRQH 1TMTH 3FOAA 1BTWA 1T8LA 3BTDE 3Q77A 3F9GA 1PQ8A 1ZSJA 1WQVH 1ELEE 5F8TA 2BZ6H 1C9PA 2J4IA 2VVVA 1HJAC 1L1JA 1OWKA 2BVSH 3SV9A 1UTMA 1TMUH 4B74A 1HXFH 1RGQA 1GI3A 1LO6A 1SVPA 2HRVA 4IBLH 4UD9H 3BTGE 1FY4A 3A80A 1TBZH 1O2WA 2G55A 4X8UH 1GHZA 1NBME 2AMPA 1QJ1B 1XXDA 3E16B 3LOXA 2HVYB 2W6JD 3C27B 1W2KH 2SNWA 1HJAB 5LPFA 1GJ4H 1P12E 2H5DA 1FAKH 2NU4E 3ZVFA 2PSYA 1B0FA 4A1XA 2GZ8A 1G3BA 1WV7H 5AHGH 2BM2A 1P3CA 2GT7A 1FLEE 1GDQA 1SQTA 1HAZB 2XWBI 2BDYA 2G5NA 1BCUH 3KQDA 1IQJA 2SGPE 1UVSH 2Z3DA 3GS9A 1TMBH 3EA9A 2AHME 4GVUA 1P8VC 1E37B 3GCHC 3SNAA 2ZCHP 1E79D 5EJ1A 1GWAA 1UTOA 3HKJB 1N6XA 3A7VA 2RDLA 4WXVA 5C1XA 1GBCA 1K1JA 1NT1A 3F2GA 2FOEA 5T6DA 1TRNA 1FJSA 1W10U 1X7AC 2R9PA 3GCHB 2A7CA 4I32A 3B9FH 3Q3YA 4IGDA 1ZOMA 2THFB 1V2OT 1P01A 1PQ7A 1CVWH 1W7XH 2WPHS 1GBIA 2FESH 2ZHFH 3BV9B 1QL8A 4NA8A 1C1MA 4H6SB 1SHYA 1VCQA 4ZHMU 1GHBG 3DSOA 2B7DH 1O39A 3LGIA 1BJUA 2ANWA 4BAKB 3A7XA 1P2OA 1HAGE 1V2NT 5C5OA 4U2WA 3QK1A 1Y5BT 1G30B 5FPTA 1BBRE 4O97A 5ESTE 3MTYA 3K65B 1EJAA 2ZFSA 2F9UA 5EGMA 1UO6A 2XBXA 4BTIB 4ZKNU 2KFWA 1IQHA 3DD2H 1EP6A 1O2SA 3BTQE 1AI8H 3RXGA 4ABIA 4AFUA 1MMJN 2J95A 4ISNA 2OBOA 2FX4A 3ODFA 2PKAB 4X6NA 1SGEE 3LGYA 2WSSD 3LH1A 1D4PB 3BEFB 3JZ1B 3T26A 4BTUB 4X6OA 1QQ4A 1VJAU 6GCHF 1Z7KA 2CMYA 2OTVA 4E7NA 1E38B 3SU1A 2P94A 2A1DB 2AGEX 2SGEE 3MNSA 4JCNA 1AFEH 3QO6A 2JIZD 1RTFB 2BZAA 4Q2KA 5F6MA 1LHDH 2G51A 2Z3CA 5HGGA 3MU1A 1SGTA 3GICB 2XNIA 3ZVCA 2BDAA 4A6LA 1UW7A 1MTWA 3GYLB 1GDUA 3QGNB 1AZ8A 2HOBA 2ZDAH 3U8TH 3S0NA 1L4ZA 3ATMA 1WBGB 3KHVA 2ZGHA 1NO9H 1UTPA 1TBRH 1MTSA 1O3LA 1L4DA 2H2ZA 2RFKC 4ACAA 3QN7A 1O32A 3RXRA 2GMTC 1YPHC 4U30A 4BAOB 3VB3A 3A8BA 2NWNA 3WW7A 1BRBE 3A7WA 1C2DA 1P2KA 3ZZ8A 3ZV8A 2V6NA 1MABB 3MOCA 4D9RA 4Y10E 1V3XA 1C1SA 3ZZ9A 2GMTB 1CHGA 3M37A 1SFQB 1ANBA 3P70B 1OYTH 2Y7ZA 3MU0A 2BDHA 1EJMA 2OP9A 2TRMA 3QTVH 1AWFH 1C5TA 1C5MD 1A2CH 1YC0A 2Y7XA 8GCHF 3OSYA 2B0FA 1AO5A 1CSOE 1C5NH 1HAVA 2OQUA 3ZVDA 4B6FA 4MLFB 4TY6A 1ZR0A 3SGAE 3PLKA 2AH4X 2XBYA 1NC6A 2OUAA 2PV9B 1HAIH 1AE5A 1TNGA 1QHRB 1C2LA 8KME2 1GVZA 3ZZAA 3RU4E 5GPIB 1NRPH 2YNBA 2O8MA 3UWIA 3RXIA 3SJ9A 2I6SA 3ZZ4A 2P3TB 1NFWA 3ATLA 4DJZB 2V0BA 2C8YB 2JKHA 2HNTC 2XCNA 5GWZA 4BOHA 3GY6A 5EQQA 2ZQ1A 1GHYH 4OS1A 5LPEA 1QY6A 2QIQA 2BXTH 2KCOA 1P10A 1TE0A 4I31A 1SGNE 1JBUH 5A0BA 1KXCA 1S81A 4AYVB 1SFIA 2G8TA 4TSFD 2HLDD 3ENSB 3M5NA 4YXWD 3T2NA 3GOVB 4HTCH 2BLWA 3RXCA 3K9XB 3EAJA 3M5MA 4SGBE 1MUEB 2Q6FA 2ZI2H 1EAIA 2BHGA 3QWCH 1W0ZU 2VVUA 2ZP0H 1LVBA 1ELFA 1NRSH 2ZKSA 1SGPE 3LC3A 1GVKB 4MPXA 1GGDB 2WYGA 4IC6A 3O8RA 4IMZA 1MTVA 2G81E 2TGPZ 2DE8A 1C1UH 1GI7B 2UWLA 2ZZUH 4IMQA 9ESTA 1EZSC 3DSGA 1A5GH 4DGJA 4NIYA 1DLKB 1QTFA 5JYIA 1W0YH 2RCEA 1OWHA 2H5CA 4Q80A 4WMFA 1F0TA 4A1TA 4MNVA 2VIWA 1T32A 2AS9A 3F9FA 2VINA 1BBRH 2Y5FA 5LGOA 1K1IA 4FXGH 4XD7D 4X6MA 5EU8A 4Y8XA 4LOYH 2KCAA 1HAXB 2A32A 1ZPBA 1LHFH 1HV7A 1DANH 3TNSA 1QB6A 1NRNH 1SKYE 3SU4A 4AN7A 1Y3VA 1CGIE 3BG4B 3GY8A 2ZDVH 4TY7A 2AEIH 1ZSLA 1GBFA 3RC6A 1O3PB 2J2UA 2QY0B 5DP9A 4GSOA 6GCHG 5E0GA 1PPCE 1O2XA 1IQKA 3KEEA 3TLOA 2O8UA 2K8IA 3K6ZA 3TK5A 5IK2D 1QJ6B 4Z0KA 3LKWA 2ZFPH 1TNKA 3MI4A 3GDSA 2Z9GA 1SLVB 3MH7A 3SNCA 3D65E 3W1EA 2BD7A 4DY7B 4CRBA 2GZ7A 1V2ST 3N99A 1C1RA 2G4TA 1HIAB 1TGNA 3ATKA 1A5HA 5C67A 2BDCA 4YOGA 2DE9A 3TNTA 2QCYA 5GDSH 2GCTC 1AD8H 1BRUP 1V2KT 2NU2E 3LGUA 5BPEA 1BITA 2WPLS 2TBSA 2W7UA 3KYFA 4DURA 1EPTC 4I7YH 1AWHB 2VWLA 4Y0YE 1O3GA 2QXJA 8ESTE 1O5DH 2Z7FE 5LPRA 5EG4A 1WXRA 3A8CA 2GCTB 4CBOA 2ZIQH 1P04A 1BUIA 1EPTB 3ZZ6A 3M7QA 2STAE 4AOQA 1TONA 2HLCA 1QFKH 1AU8A 1RJXB 1WDIA 5T6GA 2R2WU 1OSSA 2FOCA 2GGVB 3BTKE 1CT2E 4FUJA 3TH2H 1ZMNA 2VU8E 4GHQA 3WY8A 1S0RA 4ISOA 5F8XA 2K1QA 1AVXA 3M7TA 2BY8X 3OX7U 3PWBA 1ABJH 4X2WA 5AVDA 1Z1JA 1DICA 4OS4A 2F83A 8GCHG 3ATIA 3ZV9A 3LGWA 1YLCA 3SUEA 1F5KU 3TGJE 2ZU3A 3SNBA 4FU8A 3SV7A 4U32A 3RXAA 1GJ6A 1LHCH 2A7JA 2C93B 1LTOA 1GMCF 2ZTYA 1S5SA 1BBRK 1YPKH 3Q76A 4WXIA 2XWAA 4ZROA 3D62A 1GJ7B 3A8DA 4ABGA 3T5FH 2ZFTA 2PGQB 2BVRH 4O9VA 2ZQ2A 4Q7ZA 2OC0A 1AVWA 1LVOA 3A7TA 3RC4A 3SU2A 1TX6A 1SLUB 4DIIH 1ACBE 3E6PH 1DX5M 1TQ7B 3AAUA 3UNRA 3C1KA 1THSH 1ESAA 1KXEA 4FUCA 1ELDE 1UTNA 1GL0E 5DN6D 2ZGXH 4KGAA 3PMAB 5HM9A 4GPGA 1EASA 2HPPH 7LPRA 1O2QA 2IOTA 3T29A 3M35A 4F4OC 1PYTD 3UPEA 2TGAA 2WINI 4ABJA 3N7EA 1LVYA 1C5RA 1RD3B 1P2IA 3NZIA 3DSPA 3SI4H 1FONA 4CRDA 4I8GA 2K0QA 1Y5AT 2ANYA 2FXRA 4Z6AH 1O3BA 2FO9A 1J15A 4TT3D 1O3NA 2WUCA 3KN2A 4ZKRU 1EB1H 1HAHH 1ZTKA 1GPZA 1WOFA 3TU7H 5LH8A 4ABAA 1BTXA 1P3EA 3DHKH 4FUIA 5T6FA 1FZZA 4CH8B 1E35B 2P3FH 1ESBA 3ZZ3A 1AFQC 2PKAA 5C0TA 1C5XB 1V2QT 1TPSA 3PRDA 1NROH 2M5TA 1XUKA 1T8MA 2V3OH 1FY8E 2YNAA 1D9IA 1YWUA 3M7UA 2OXSA 1AFQB 2BD2A 3JZ2B 2B5TB 2ULLA 3MNCA 5K7RA 4MPVA 4OM9A 4A5TS 4YT6H 2ZFRH 1O5AB 2H9HA 4MPUA 4AORA 4Y11E 1GBAA 3RXFA 3TVJB 1RXPA 1EAXA 2FYRA 2FTLE 1CE5A 1S0QA 1KMHB 1VCPA 3GYMA 3CENA 4DG4A 5T3HA 1ANDA 3PRBA 1A3EH 3OEHD 1GBMA 4NIVA 3A7YA 3SI3H 4AG2A 1MTUA 2A5KA 3PROA 4Y7BA 1OKXA 2ILNA 4BANB 3BTTE 1T8OA 3W94A 4JZEH 1TA2A 3TJVA 2CGAA 4H42U 4Q4LA 3O8CA 5DG6A 4THNH 1BQYA 1UTJA 2XCFA 1NS3A 3RXJA 1C5UA 1LMWB 1XKBC 2UUFB 4OS7A 1NFXA 3I78A 1AB9C 5EQSA 4F48B 3E90B 3SQEE 4AFQA 3V3MA 2PLXA 1DSUA 3UQOA 1K28D 2Z3EA 1AUJA 1MKWH 1ZGVA 1C2HA 1H8DH 1UHBB 1RIWC 2C8ZB 1CQQA 1K2I1 4INKA 2G5VA 5PTPA 4DOQA 4K8YA 3GISB 1FMGA 1QNJA 4K2YA 1AB9B 1E34B 1W11U 4UFFH 3VXEH 8LPRA 1O2HA 2QF3A 1KXBA 1HBTH 5DPAA 3VPKA 4FVDA 1JRTA 1P11E 1LHGH 2HALA 2UUJB 4DW2U 5GNDA 1QJ7B 5L2ZH 1GI4A 1LKAA 1TX7A 4RT0A 2R3YA 2ZPQA 1LPZB 4UFGH 3A89A 1AVGH 2BX3A 2FI5E 5C17A 1YPJH 1TRMA 2C3SA 1GG6C 1FXYA 2F9BH 3M3VA 3NK8A 4A7IB 3PMJA 4B6EA 1MTNC 2ZU1A 4NSVA 5EJZA 4BAHB 1MAYA 3EQ0H 3H5CB 3LJOA 1MD8A 2VH0A 4RI0A 4H6TA 1DWCH 2ZGBH 3KCGH 3S9CA 2HPQH 5GCHF 1TPOA 3TITA 1KLTA 1GG6B 1ZPCA 1OP2A 1O2JA 1O2OA 1MTNB 2A2XH 1YCPM 3TGKE 1KTSB 1TALA 1A4WH 4D8NA 2AFQB 1JOUB 1CGHA 1DT2A 2R0LA 1GMCG 4U01A 4IS5A 1PPBH 2GKVE 3HK3B 1QURH 1W12U 3SYJA 4FUFA 3STJA 1SPJA 4AB8A 1C1VH 1H4WA 1V6DA 2ALVA 3KYGA 1TAWA 1Z1IA 1KXAA 1QL9A 1S6HA 1SL3A 2GD4B 3LGVA 3UR6A 4ABBA 1FPHH 4WH8A 2Y5GA 2Y82A 1G32B 1SLWB 4Q7XA 5E0JA 4FUDA 1GBHA 1UTLM 1TPPA 1WQSA 2AMQA 4D9QA 1UCYK 3MMGA 2IPHA 3RMMH 1BMAA 3GY3A 1O3CA 2VIPA 4X2YA 1HRTH 1AE8H 2BD8A 1P2NA 1UJ1A 1O34A 2RG3A 4AGJA 1DPOA 4ASUD 1FN8A 5IYTA 2R0KA 1MKWK 1W3CA 1TWXB 3EDXB 1O3KA 3BSQA 1LKBA 4K1TA 2ZDLA 5HXFA 1SC8U 3AW1A 2G52A 3NUMA 4X1NU 1MCVA 4Y8ZA 2WPIS 1O3EA 4J2YB 1O2ZA 3NKKA 2J98B 1SQOA 1AMHA 4JYTA 4IN2A 3GY2A 2GZ9A 1SMFE 4WVPE 4XBBA 3DT0H 1XKAC 5I25A 1OWDA 1MCTA 2PFEA 1CU1A 3F1SB 3SGBE 3ZVBA 5EIYA 1WCZA 2AGGX 4LK4A 2F9VA 4R0IA 1OWJA 4RSPA 1A7SA 1KLJH 4ZHLU 1P06A 2BYAX 3CP7A 1BMMH 4R8TB 3SOSA 2QF5A 4O3UA 3ELAH 3BTWE 1ID5H 5F03A 3RM2H 3RXSA 3SJOA 2F9PA 4I8JA 1V2VT 3URCA 5DK1A 5C2ZA 4NGAH 5E2OA 4NIWA 1MAXA 1KY9A 3LT3A 1ANEA 1ELTA 1YM0A 2F3CE 1GJDB 2AGIX 1NESE 4RN6A 1YBWA 1O2KA 3VB5A 1QB1A 1O2PA 1C5QA 1ANCA 4ISHH 2P95A 2VBCA 4X1RU 1EUFA 1UTQA 2XOKD 2F43B 7GCHF 1DITH 4MQAA 2R2MB 2BY6X 2JJ1D 1JRSA 3MYWA 2VIDA 4M9FA 5CMXH 3PV2A 2AIQA 3ZZDA 2FPZA 3SQHE 2BQ6B 1T4VH 3P8OA 2P8OC 1VITF 4WY3A 2BY9X 6CHAC 1NM6A 1C2IA 2H9TH 1BTHH 3RLWH 3F9HA 1RFNA 5HKKD 1GHXH 3MQKC 3NPSA 1OXGA 1GI9B 2QXIA 1BTUA 3SJ8A 1QBNA 1MQ6A 1EPTA 4MTBA 1FPCH 1ZYOA 1QBVH 2P8OB 3UNQA 1FI8A 4ZCNA 1QZ8A 6CHAB 2FI3E 1DM4B 5L30H 4ZH8A 2WPDD 1SSXA 2LPRA 2ZU4A 1BJVA 2VWNA 4UFEH 3BTME 1W13U 3P17H 1FUJA 1GI5A 5A8YA 4FU7A 3GY5A 3SUDA 3KNXA 2XC5A 3RDZA 4CH2B 2AYWA 1ZTLA 5A2MH 4OS2A 2Y80A 1HLTH 2ZDKA 4CR9A 5C1UA 2FS8A 4ZXYH 4WF8A 2ASUB 4FUGA 3SU0A 2FDAA 2JH0D 3SO3A 1N1LA 3U1IB 1P57B 1C5WB 3SZEA 1C1WH 2LELA 5DGJA 3S9BA 3MHWU 3M61U 5G4BA 1S85A 2ZU5A 3MO6A 2G00A 4X2VA 1E1QD 3BTHE 4BTTB 1YPMH 3FZDA 4ABHA 1O3IA 5TCAA 4K1SA 5GCHG 3RXOA 1F7ZA 1KYNA 4XOJA 1GHAF 4X1QU 1VZQH 3SU3A 5HIZA 3E0PB 1GI8B 3UTUH 1EAWA 2Y6TA 1D3QB 3VEQB 2ODYB 1T31A 1PQ5A 4MDSA 5L6NH 2OQ5A 2PTCE 1ELCA 1O3AA 3UAIC 3ZVEA 2Z9KA 1K1PA 3UWJH 3HKIB 3TIUA 1S82A 1DWDH 1O3MA 1O5GH 1O3FA 3NRLA 2A0QB 1WSSH 1VKYA 3SV6A 1YGCH 1IHSH 4OS6A 4CRAA 2A31A 4O3TA 3U1JB 2GCHF 1GJ9B 1C1QA 2XBVA 3PLPA 4NA7A 1BOQA 2GX4A 1SHHB 3F9EA 4NWKA 3GY7A 1HFDA 1A0JA 2W26A 4Y76A 3O8BA 3VB4A 1VITH 5E8EH 3UFAA 1OOKB 2FYQA 4XE4A 1ETSH 1Y5UT 3D49H 2CHAC 1TX8A 1OP0A 2FTMA 2VIOA 1FV9A 1C4U2 2CXVA 1VGCC 1HXEH 1O3DA 2F9NA 2BD9A 2P59A 1C1TA 2BY5X 1N6YA 4YESB 2GV7A 2SGAA 4P02A 1G9IE 1EOJA 1AZZA 1ETTH 4B75A 2CHAB 2GVFA 3OTJE 3Q3KA 3D23A 5FBEA 1VGCB 1J9CH 1MBMA 2ZDNA 1KLIH 5H4IB 3SUGA 3IITA 1SI5H 2RA3A 1SOTA 3LIWA 1Y3UA 2WV5A 1SGFG 3GCNA 1O3HA 5JB9S 2SGFE 1BRCE 3R0FA 3RU4D 1GCDA 4MNWA 1TRYA 1XUGA 5EJLA 2FOGA 3M5OA 1Z8RA 5JPMH 4CRFA 2FOFA 2J38A 3HGPA 2OC1A 3MU8A 4ISLA 5A09A 1GBDA 4LZ1H 1JIRA 4CR5A 1HDTH 1B0EA 1H8IH 3AAVA 3BEIB 2FS9A 5DP7A 5I46H 2L6OA 1EZUC 1SQAA 4I8KA 6LPRA 1RTLA 1TBQH 1GMDF 2ZECA 3TGIE 3RXQA 2QE7D 4FVBA 2JH6D 1T8NA 1EB2A 1O2IA 5EPNA 1J14A 1NFYA 1UVTH 3AW0A 1BMLA 3ESTA 3QGJA 1GBLA 4O03A 5DP8A 1O38A 1H8ED 1O2LA 1YLDA 2OC8A 1BTZA 2ZGCA 4D76A 1V2MT 2Z6BD 1BZXE 1ZMLA 1ZZZA 2J9NA 3SU6A 1O2NA 1NU9A 2A2QH 4ESTE 4Y71A 2WV9A 1DUAA 1H1BA 3B8JA 4AG1A 2JDID 4ASHA 1BT7A 7GCHG 1GBKA 5C3NA 1S6FA 1FY5A 1GMHF 1KIGH 4HG6A 1CA0C 1YPGH 2C8XB 1PPGE 4Y79A 2O8LA 2BLOA 3U28C 1VITG 1DY9A 1QQUA 1KTTB 4AFZA 4J1YA 1DY8A 4D7GA 5F53A 1PPHE 2FZZA 1H9IE 3M3SA 2ODQA 1TGTA 4YO9A 3RC5A 1QCPA 1CA0B 5FPYA 3K2UA 2BD5A 5A8ZA 2KR7A 4MNYA 4ZXXH 3VXFH 1GCTC 4JK5A 4AC9A 3ZZCA 4XRNA 1W7GH 2PUQH 3E91A 1QL7A 1XX9A 3RLYH 2RA0A 3GDVA 4XDEA 5DO4H 1QRWA 1BMFD 2H6MA 2BOHB 5A0CA 4TPIZ 3SBKA 1G3CA 2NU1E 2PSXA 2QA9E 3ZYDA 1P2QA 2PR3A 3QZQA 1GCTB 1ELVA 2GTBA 3G01A 2VIVA 3PO1C 2VIQA 2AERH 2KCYA 4WMDA 4XBDA 2CN0H 2RDEA 5C94A 1ESTA 2TGTA 2ZO3H 4RT1A 3RXVA 3HGNA 5DJ7A 5CE1A 4X8SH 4ZKOU 1J17T 2VJ1A 1YYY1 2PHBA 1TNJA 1G37A 2QF0A 3PO1B 1KDQB 2Y5HA 1O5FH 2FLRH 2PUXB 2Z94A 3QX5H 3NWUA 2ZEBA 2KZ4A 3KQBA 1GHAG 5EXLA 5A8XA 2ZPSA 3AK5A 2ZA5A 4CHAC 1N8OC 1XVOA 3TK9A 3BEUA 3MFJA 3A8AA 3FANA 3M3TA 4A1VA 1A0LA 5B6LA 3P92A 2UWOA 3MNXA 5EXMA 4AGKA 1O2UA 1HAYB 1ZJDA 2Q6DA 3FFGA 2OINA 2OC7A 1D3TB 1K1LA 1LVMA 2ZTXA 3DCLA 4DT7B 3BTEE 1MH0A 1O2MA 1HNEE 2ZHDA 1V2UT 2HVXA 1DSTA 4JZIA 2FOAA 1LPGB 1D3PB 1ORFA 4KTUA 3UREA 3TJNA 1VCWA 2GCHG 3ZVGA 1BIOA 4TWWA 4MVNA 1BB0B 3QDZB 3ODDA 3RMNH 3SUFA 1SG8B 2GDDA 1Z8JB 1ZSKA 4K60A 4B76A 2J98A 3KL6A 2FOHA 3O8DA 5KEDA 3T27A 4ABFA 1GI6A 1TNLA 2ANKH 4GHTA 2J5UA 1O3JA 3E3TA 1LHEH 4KP0A 3L3TA 3AASA 4UEHH 2PW8H 3PYHA 2JETC 2PWXA 6ESTA 1H8HD 3LGTA 4DCDA 1C2JA 1TB6H 2A5AA 2BMGB 1IHTH 4YTAA 3UQVA 4YM9A 4K5ZA 1H9HE 1C5YB 4HFPB 5HM2A 1H9LB 2IJOB 3SGQE 2IPQX 3ZZBA 4XBCA 3RXHA 1Z8GA 1DVAH 2IN2A 1NTPA 4Y6DA 3VGCC 5E0HA 1EJNA 2ZG0H 2JETB 4AX9H 2CV3A 1AIXH 3BF6H 2KAIB 3MO3A 1QA7A 3VB7A 3P6ZB 2TPIZ 3ZYEA 1WUNH 5JBBS 3RM0H 1O5BB 2FODA 3S7KB 4JZ1A 1O3OA 1THRH 1PQAA 4ZKSU 5J4SA 1EKBB 1S6LA 3RU4T 3VGCB 1P05A 1SLXB 2I6QA 4ACBA 1OWEA 1YCPH 2GP9B 1IQLA 1DE7H 2FOBA 2XW9A 4X1SU 3FAOA 5FCRA 1TGCA 2FMJA 1C5LH 1V2LT 1GMDG 2IJD1 2UWPA 4D7FA 3T25A 2AMDA 1DLEA 2Z9LA 2BDIA 5A0AE 1MKXH 1G3EA 1PPZA 5JBAS 2XTTB 3RXTA 1TFXA 3OEED 1K1MA 1GHVH 2OK5A 3ZVAA 1W14U 1XUIA 5DP6A 5EPYA 2WHXA 2FP7B 1C1OA 4INLA 1WU1A 3SU5A 4FUEA 4XSKU 1MQ5A 1BHXF 2ZTZA 3FKSD 4KKDA 1PPEE 4JYUH 5DKMA 1RIWB 2A4OA 4F55A 5JBTA 5JDUB 1NZQH 3F68H 2A45B 2CF8H 1GMHG 1MD7A 1CGJE 4B73A 1EAUA 1NPMA 1CBWC 3FP7E 1W8BH 1Z8IB 4IC5A 1NY22 4K69A 3PMHB 3V13A 4NCYA 2FI4E 2BDGA 3SZNA 3GY4A 2O9QA 3V12A 4JMYA 5DSFA 3AVZA 1XXFA 1K1NA 1CBWB 4WMEA 3U8RH 1TA6A 4VGCC 3QTOH 1SGDE 2ZNKH 3OY6U 3RXBA 1LQEA 1HCGA 1YY3A 5J4QA 2BLVA 3QUMP 1F92A 3IWMA 1UMAH 1EOLA 5FL7D 2D2DA 5C5NA 1AY6H 2VWOA 4I8HA 2Q1JA 2C8WB 1IQMA 2VH6A 4RKOB 3ATWA 3LDXH 5HYOA 4VGCB 1P09A 1HYLA 3UOUA 1F0SA 2H1UA 1G3DA 1SQRA 5ESBA 1O2VA 1B5GH 4NG9H 3WWBA 4BXSA 2PKSC 3U69H 1K0HA 1Q3XA 2QXGA 1KXFA 1W0KD 1V2WT 2AIPA 1INCA 2ZHEH 3OU0A 1GI1A 1C1NA 1LQDB 1O37A 5EOKA 2HGTH 3KQ5A 1T4UH 2ZWLH 2QV1A 4BNRA 1Y3WA 2PKSB 4MG3A 4NZLA 4ZUHA 1QIXB 2WV4A 1THPB 3A7ZA 4X8VH 5CHAC 1XUFA 2WPJS 1MZDA 1FX0B 1T7CA 1YCPK 2SNVA 1FY3A 2VVCA 4F49A 2XC4A 2YMSC 5FHTA 1P03A 5C1YA 1KSNA 1HPGA 4FOUC 1RS0A 1K9OE 1P9UA 2XXLA 3P8NA 4E06H 2SFAA 1A1RA 1MKXK 1OP8A 2FX6A 2QXHA 4TWYA 4YT7H 5CHAB 3SJKA 4JK6A 4YZUA 2BOKA 3FVFB 1PPFE 5FPSA 4NWLA 2YMSB 5ETXA 2ZC9H 3BG8A 3K6YA 4JZDH 1NBMD 2BXUH 2UUKB 4UFDH 1O0DH 5K0HA 4Q63A 2OD3B 3A88A 4TPYA 2KCPA 3A83A 3RXMA 1MU8B 3MU4A 3OFND 2B9LA 1UTKA 2ALPA 1ELGA 1M9UA 3PB1E 2EA3A 1C2MA
chains in the Genus database with same CATH topology
1P2JA 4ABDA 1TOCB 5JBCS 2ZHQH 4AYYB 4OS5A 4Y0ZE 1E0FD 1EZXC 2WUBA 2FLBH 4X0WU 1SB1H 4BAQB 3ZZ7A 1GI0A 1VJ9U 1HGTH 4JYVH 4M7GA 1O36A 2W5EA 3SJIA 1BRAA 1A46H 1NN6A 1Y59T 4NSYA 3TPIZ 1HIAA 2D1JA 1UVOA 3F6UH 1DXWA 1C2EA 5TJXA 1IOEA 4XFQA 1AKSB 1Z6EA 3V0XA 1J16A 3UUZA 3P8FA 3IG6B 3TJUA 2QGRA 1PYTC 4YLQH 1O5CB 1LDTT 2Q6GA 3RMLH 1QBOA 2O8WA 1KXDA 3GCTF 4UE7H 3BTFE 4Q7YA 3CS7A 1JXPA 1TQ0B 1YF4A 5FCKA 4B1TA 1QB9A 1K21H 1YPEH 2FM2A 2STBE 1HJ9A 5EW2H 3MU5A 3FP6E 1ZJKA 2W3IA 3T62A 1FNIA 2NU3E 1Y8TA 1CO7E 1DWEH 1EZQA 2QYIA 4WJG2 1GJ5H 3R3GB 3MO9A 1JIMA 2ZF0H 1L0ZA 4NFFA 4KTCA 2WPKS 1SBWA 2V35A 1A5IA 3EA7A 2SGDE 3KQEA 1TYNA 1ZHRA 1A0HB 1O2RA 3ZZ5A 3DUXH 1SGQE 4OGYA 2ZGJA 3L6PA 3U98H 4A92A 1K1OA 5EXNA 1C2KA 1Y3XA 1SGIB 1E36B 1XUJA 1SGFA 2OBQA 1MBQA 2J34A 1U6QA 2B8OH 4I33A 4OGXA 1GBEA 4Y8YA 1QRXA 1IAUA 2TGDA 3KIDU 1DXPA 3HPTB 1O31A 3RXLA 2VB0A 5HMAA 4GCHF 4BAMB 3U8OH 4ZAEA 3H7TA 1HUTH 1YP9A 1GBTA 3GDUA 3RP2A 1YKTA 1O2GH 1ZHMA 1KDQA 1XM1A 3MH4A 5FX6A 1GVLA 4FU9A 4X6PA 2A4RA 1V2RT 1G2MA 3N7OA 2BLQA 1NU7B 3M5LA 2EEKA 1DUEA 3E1XB 1XMNB 3V7TA 3PWCA 2VWMA 3QLPH 2OCVB 1GBJA 3A81A 1UK3A 3DA9B 4Y7AA 3OY5U 3BIVH 4DIHH 1JMOH 4IN1A 3UY9A 3BIUH 4B2AA 4CREA 1F2SE 2CF9H 1GGDC 3UNSA 1ZRBA 5JB8S 1FIZA 1F0UA 3UR9A 2ODPA 3RXKA 3MH5A 1B7XB 5TCCA 2BX4A 3SV8A 1GJCB 2VNTA 2BQWB 4K1EA 1V2TT 3HATH 1ABIH 5B6OA 3SHCH 1BHXB 1JWTA 1TIOA 1DS2E 2D8WA 4MNXA 3FP8E 1DDJA 5BRRE 1AGJA 3A87A 5DP4A 5EQRA 1SGYE 5SGAE 2FIRH 2A4GA 2EI6A 3EYDA 3S69A 2BQ7B 3U9AH 3BG4C 1HAOH 4NA9H 1O30A 2BTCE 2BY7X 2GV6A 3I77A 4MPWA 4UDWH 1PFXC 2Y81A 1DOJA 5C20A 4HI3A 3MH6A 1CHOF 4KELA 3RMOH 2O8TA 1C5VA 1O33A 1P0SH 1IQGA 1ZHPA 1O35A 1HJ8A 2ZU2A 3KQCA 3P95A 2XC0A 1HB0B 4AFSA 4AZ2B 1UCYE 3RXPA 2KAIA 5AFYH 2ZPRA 1C5PA 1ZRKA 1Q31A 3Q00A 4CRCA 3SW2B 3S7HB 2Z9IA 1BMNH 2BVXH 1S84A 3MNBA 3RXDA 3HK6B 1TLDA 1Y3YA 4ISIH 2HWLB 3RXUA 4LXBH 1V2JT 4AB9A 1UVUH 4YOIA 1P9SA 3E8LA 1P02A 3URDA 2CJIA 1WYKA 1QA0A 2BB4A 1CT0E 4HGCA 1SGRE 4FUHA 1ELBA 4RKJB 4WH6A 2SGQE 1UHBA 4NFEA 2BDBA 1GJBB 3GCOA 1TNIA 1C4V2 1YPLH 4HZHA 5DP5A 1AQ7A 1ZPZA 4JZFH 1FDPA 5EW1H 2P16A 4PROA 1YPHE 1RRKA 1GDNA 4FUBA 7KMEH 9LPRA 3ITIA 2G4UA 3GCTG 1OX1A 2C90B 3MWIU 4NZQA 3Q3XA 1TOMH 3KF2A 4WWYA 5AFZH 2QAAA 4B2CA 1AUTC 1C9TA 3NXPA 3P8GA 4QT8C 1VR1H 1GI2A 1Z71A 2EC9H 1ETRH 1PJPA 2BD4A 1K22H 2FOMB 2V3HH 4YLUA 1FQ3A 1IQIA 1NRRH 1SR5C 2D26C 3VB6A 3LC5A 2EI8A 5FX5A 1HAVB 2ZCKP 1MU6B 5E2PA 4X8TH 1UVPA 1G2LA 1EQ9A 3SORA 1C5OH 1C5SA 3LU9B 4H4FA 1QRZA 3PM3A 3W95A 4UONA 3LJJA 1G36A 2OLGA 1A3BH 2ZFFH 1AHTH 2J94A 2QC2A 1C1PA 3RXEA 4X1PU 1GJAB 3I29A 1TGBA 3A86A 3T28A 4B2BA 2A4QA 1ELAA 3PTBA 1J8AA 4K8BA 1FY1A 1OS8A 1Z6JH 3A84A 1SOZA 2HNTE 2VGCC 1DFPA 2P93A 2FEQH 2FWWA 1S83A 4GCHG 4YOJA 2PTNA 3FZZA 3TH4H 1XUHA 4SGAE 1TNHA 3S9AA 4INHA 3OYPA 1GBBA 2XYAA 5DP3A 4TYDA 3CS0A 5FBIA 4LZ4B 1LPKB 3UIRA 4ZMAH 4CRGA 1L1NA 1CA8B 2VGCB 1GHBF 2Z9JA 5EODA 5GIBA 3LPRA 2R3UA 1HAPH 1LCYA 1D6WA 1OWIA 3L33A 3PTNA 4ABEA 1TPAE 1UK4A 4CHAB 1IQFA 1N8OB 1DWBH 1GJ8B 3EE0B 1MZAA 4GLYA 1IQNA 2P3UB 1BDAA 3EA8A 1TABE 1EATA 3EGKH 1C4Y2 2PGBB 2F91A 2A7HA 3DFLA 1D3DB 1EP5A 3KGPA 1A61H 5FXLA 4ZHAA 1C2GA 2ANMH 1O2YA 2LNCA 5IDKA 2XBWA 1BTYA 1SGCA 4K3JA 4IW4E 3PLBA 1F5RA 3A85A 7ESTE 1TGSZ 1WTGH 2ZDMA 5AF9H 2UUYA 1F5LA 3NCLA 1D6RA 3PMBB 3LH3A 3SHAH 3STIA 2GT8A 2W3KA 2A5IA 1AN1E 1C5ZB 5FAHA 5ABWA 1ZTJA 2W7SA 4KTSA 1F0RA 4GAWA 1L2EA 1EXFA 1XVMA 2BD3A 5L2YH 1EX3A 2TIOA 1FIWA 2XRCA 3SV2H 3BN9A 2F9OA 3TH3H 1OYQA 1FN6A 1ZGIA 2JH5D 1ZMJA 3UOPA 4X2XA 1CT4E 2EI7A 2DUCA 4E7RG 2WYJA 1CHOG 1RTKA 3SN8A 2H9EH 1OPHB 1IQEA 3H7OA 2J92A 3E0NB 4DVAU 1UK2A 1P2MA 1GL1A 2ZCLP 4I8LA 3B23B 1QGFA 2HNTF 1GHWH 1O2TA 1WTHD 1AKSA 5F8ZA 1ARCA 2NU0E 1V2PT 2QN5T 1C2FA 3M36A 2C4FH 2ESTE 3VFEA 1UCYH 3DFJA 3A82A 1BA8B 1WAYB 3RUOA 3SNEA 2WPMS 3QZRA 1ARBA 1FAXA 3TK6A 1O5EH 1BTPA 2YOLA 3LONA 1L1GA 5GXPA 3SNDA 2GDEH 4GUXA 4B71A 1Q2WA 4E05H 2ZFQH 1NFUA 3TJOA 1ZLRA 4NIXA 4BXWA 1QR3E 3PV4A 4CBNA 5GJ4B 2ZHWH 1NRQH 1TMTH 1BTWA 1T8LA 3BTDE 3Q77A 3F9GA 1PQ8A 1ZSJA 1WQVH 1ELEE 5F8TA 2BZ6H 1C9PA 2J4IA 2VVVA 1HJAC 1L1JA 1OWKA 2BVSH 3SV9A 1UTMA 1TMUH 4B74A 1HXFH 1RGQA 1GI3A 1LO6A 1SVPA 2HRVA 4IBLH 4UD9H 3BTGE 1FY4A 3A80A 1TBZH 1O2WA 2G55A 4X8UH 1GHZA 2AMPA 1QJ1B 1XXDA 3E16B 3LOXA 3C27B 1W2KH 2SNWA 1HJAB 5LPFA 1GJ4H 1P12E 2H5DA 1FAKH 2NU4E 3ZVFA 2PSYA 1B0FA 4A1XA 2GZ8A 1G3BA 1WV7H 5AHGH 2BM2A 1P3CA 2GT7A 1FLEE 1GDQA 1SQTA 1HAZB 2XWBI 2BDYA 2G5NA 1BCUH 3KQDA 1IQJA 2SGPE 1UVSH 2Z3DA 1TMBH 3EA9A 4GVUA 1P8VC 1E37B 3GCHC 3SNAA 2ZCHP 1GWAA 1UTOA 3HKJB 1N6XA 3A7VA 2RDLA 4WXVA 5C1XA 1GBCA 1K1JA 1NT1A 2FOEA 5T6DA 1TRNA 1FJSA 1W10U 1X7AC 2R9PA 3GCHB 2A7CA 4I32A 3B9FH 3Q3YA 4IGDA 1ZOMA 2THFB 1V2OT 1P01A 1PQ7A 1CVWH 1W7XH 2WPHS 1GBIA 2FESH 2ZHFH 3BV9B 1QL8A 4NA8A 1C1MA 4H6SB 1SHYA 1VCQA 4ZHMU 1GHBG 2B7DH 1O39A 3LGIA 1BJUA 2ANWA 4BAKB 3A7XA 1P2OA 1HAGE 1V2NT 5C5OA 4U2WA 3QK1A 1Y5BT 1G30B 5FPTA 1BBRE 4O97A 5ESTE 3MTYA 3K65B 1EJAA 2ZFSA 2F9UA 5EGMA 1UO6A 2XBXA 4BTIB 4ZKNU 1IQHA 3DD2H 1EP6A 1O2SA 3BTQE 1AI8H 3RXGA 4ABIA 4AFUA 1MMJN 2J95A 4ISNA 2OBOA 2FX4A 3ODFA 2PKAB 4X6NA 1SGEE 3LGYA 3LH1A 1D4PB 3BEFB 3JZ1B 3T26A 4BTUB 4X6OA 1QQ4A 1VJAU 6GCHF 1Z7KA 2CMYA 2OTVA 4E7NA 1E38B 3SU1A 2P94A 2A1DB 2AGEX 2SGEE 3MNSA 4JCNA 1AFEH 3QO6A 1RTFB 2BZAA 4Q2KA 5F6MA 1LHDH 2G51A 2Z3CA 5HGGA 3MU1A 1SGTA 3GICB 2XNIA 3ZVCA 2BDAA 4A6LA 1MTWA 3GYLB 1GDUA 3QGNB 1AZ8A 2HOBA 2ZDAH 3U8TH 3S0NA 1L4ZA 3ATMA 1WBGB 3KHVA 2ZGHA 1NO9H 1UTPA 1TBRH 1MTSA 1O3LA 1L4DA 2H2ZA 3QN7A 1O32A 3RXRA 2GMTC 1YPHC 4U30A 4BAOB 3VB3A 3A8BA 2NWNA 1BRBE 3A7WA 1C2DA 1P2KA 3ZZ8A 3ZV8A 2V6NA 3MOCA 4D9RA 4Y10E 1V3XA 1C1SA 3ZZ9A 2GMTB 1CHGA 3M37A 1SFQB 1ANBA 3P70B 1OYTH 2Y7ZA 3MU0A 2BDHA 1EJMA 2OP9A 2TRMA 3QTVH 1AWFH 1C5TA 1C5MD 1A2CH 1YC0A 2Y7XA 8GCHF 3OSYA 2B0FA 1AO5A 1CSOE 1C5NH 1HAVA 2OQUA 3ZVDA 4MLFB 4TY6A 1ZR0A 3SGAE 3PLKA 2AH4X 2XBYA 1NC6A 2OUAA 2PV9B 1HAIH 1AE5A 1TNGA 1QHRB 1C2LA 8KME2 1GVZA 3ZZAA 3RU4E 5GPIB 1NRPH 2YNBA 2O8MA 3UWIA 3RXIA 3SJ9A 2I6SA 3ZZ4A 2P3TB 1NFWA 3ATLA 4DJZB 2V0BA 2C8YB 2JKHA 2HNTC 2XCNA 5GWZA 4BOHA 3GY6A 5EQQA 2ZQ1A 1GHYH 4OS1A 5LPEA 1QY6A 2QIQA 2BXTH 1P10A 1TE0A 4I31A 1SGNE 1JBUH 5A0BA 1KXCA 1S81A 4AYVB 1SFIA 2G8TA 3ENSB 3M5NA 3T2NA 3GOVB 4HTCH 2BLWA 3RXCA 3K9XB 3EAJA 3M5MA 4SGBE 1MUEB 2Q6FA 2ZI2H 1EAIA 2BHGA 3QWCH 1W0ZU 2VVUA 2ZP0H 1LVBA 1ELFA 1NRSH 2ZKSA 1SGPE 3LC3A 1GVKB 4MPXA 1GGDB 2WYGA 4IC6A 3O8RA 4IMZA 1MTVA 2G81E 2TGPZ 2DE8A 1C1UH 1GI7B 2UWLA 2ZZUH 4IMQA 9ESTA 1EZSC 1A5GH 4DGJA 4NIYA 1DLKB 1QTFA 5JYIA 1W0YH 2RCEA 1OWHA 2H5CA 4Q80A 4WMFA 1F0TA 4A1TA 4MNVA 2VIWA 1T32A 2AS9A 3F9FA 2VINA 1BBRH 2Y5FA 5LGOA 1K1IA 4FXGH 4X6MA 5EU8A 4Y8XA 4LOYH 1HAXB 2A32A 1ZPBA 1LHFH 1HV7A 1DANH 3TNSA 1QB6A 1NRNH 3SU4A 4AN7A 1Y3VA 1CGIE 3BG4B 3GY8A 2ZDVH 4TY7A 2AEIH 1ZSLA 1GBFA 3RC6A 1O3PB 2J2UA 2QY0B 5DP9A 4GSOA 6GCHG 5E0GA 1PPCE 1O2XA 1IQKA 3KEEA 3TLOA 2O8UA 3K6ZA 3TK5A 1QJ6B 4Z0KA 3LKWA 2ZFPH 1TNKA 3MI4A 3GDSA 2Z9GA 1SLVB 3MH7A 3SNCA 3D65E 2BD7A 4DY7B 4CRBA 2GZ7A 1V2ST 1C1RA 2G4TA 1HIAB 1TGNA 3ATKA 1A5HA 5C67A 2BDCA 4YOGA 2DE9A 3TNTA 2QCYA 5GDSH 2GCTC 1AD8H 1BRUP 1V2KT 2NU2E 3LGUA 5BPEA 1BITA 2WPLS 2TBSA 2W7UA 4DURA 1EPTC 4I7YH 1AWHB 2VWLA 4Y0YE 1O3GA 2QXJA 8ESTE 1O5DH 2Z7FE 5LPRA 5EG4A 3A8CA 2GCTB 4CBOA 2ZIQH 1P04A 1BUIA 1EPTB 3ZZ6A 3M7QA 2STAE 4AOQA 1TONA 2HLCA 1QFKH 1AU8A 1RJXB 5T6GA 2R2WU 1OSSA 2FOCA 2GGVB 3BTKE 1CT2E 4FUJA 3TH2H 1ZMNA 2VU8E 4GHQA 3WY8A 1S0RA 4ISOA 5F8XA 2K1QA 1AVXA 3M7TA 2BY8X 3OX7U 3PWBA 1ABJH 4X2WA 5AVDA 1Z1JA 1DICA 4OS4A 2F83A 8GCHG 3ATIA 3ZV9A 3LGWA 1YLCA 3SUEA 1F5KU 3TGJE 2ZU3A 3SNBA 4FU8A 3SV7A 4U32A 3RXAA 1GJ6A 1LHCH 2A7JA 2C93B 1LTOA 1GMCF 2ZTYA 1S5SA 1BBRK 1YPKH 3Q76A 4WXIA 2XWAA 4ZROA 3D62A 1GJ7B 3A8DA 4ABGA 3T5FH 2ZFTA 2PGQB 2BVRH 4O9VA 2ZQ2A 4Q7ZA 2OC0A 1AVWA 1LVOA 3A7TA 3RC4A 3SU2A 1TX6A 1SLUB 4DIIH 1ACBE 3E6PH 1DX5M 1TQ7B 3AAUA 3UNRA 3C1KA 1THSH 1ESAA 1KXEA 4FUCA 1ELDE 1UTNA 1GL0E 2ZGXH 4KGAA