1AN1E

Leech-derived tryptase inhibitor/trypsin complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
222
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the complex of leech-derived tryptase inhibitor (LDTI) with trypsin and modeling of the LDTI-tryptase system.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (serine protease/inhibitor)
total genus 57
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E02
1EJMA 1VGCC 3R0FA 1AE5A 1HAYB 3SW2B 1O5AB 3AAVA 2EI8A 2PGQB 1EP6A 1F0RA 3TK6A 1O5FH 1IHTH 2HRVA 4YM9A 1W0ZU 3PLPA 1JBUH 2ESTE 3SI4H 1BTYA 2Z6BD 4X6PA 2Z9JA 3TGIE 3RXLA 1LVYA 1PYTC 3AAUA 2A32A 1EX3A 3S9CA 3FFGA 1P57B 1SGIB 4FUHA 2JETC 3F68H 1AB9B 1SHYA 3FZDA 3LT3A 2QIQA 3A8CA 3HKJB 2O8TA 4DIIH 5TCAA 1GWAA 3BEUA 3KF2A 1P04A 3BTFE 1OYTH 2VH0A 2R3YA 4U01A 1L4DA 1NZQH 3ATWA 1PPFE 1AY6H 4ZHLU 1XVOA 2R9PA 1BMNH 3SGQE 3GICB 3RXKA 1NY22 1KTSB 3DD2H 4I7YH 1IQGA 3HGNA 1FIZA 1HAGE 4GAWA 4ESTE 1XXDA 5F8TA 2ZIQH 3LJJA 1P2OA 2A45B 2PTCE 3RU4T 1QBOA 1OYQA 3RU4E 1O3EA 4O3TA 1E35B 1ANDA 2AGEX 3KHVA 1DXPA 1AU8A 1P2JA 1JXPA 2CF8H 2G4UA 3LC5A 3MU8A 3UIRA 1IOEA 3OX7U 5AF9H 3DUXH 3SJIA 1E34B 1Z1IA 1YGCH 2B7DH 1EAWA 3BG4C 1AKSB 5A0CA 2QAAA 2ZGJA 1SGEE 1S82A 2BDHA 3L33A 1AGJA 3VXEH 5HM2A 2AIQA 3A7TA 1ELDE 3OY6U 2ILNA 1HNEE 1O2QA 2GVFA 3VGCB 2CHAC 2HNTC 1P2QA 1ZGIA 2CXVA 1GCTC 2ZFRH 4FU8A 4KKDA 1FY5A 2BOHB 1XXFA 1Z6JH 2BVRH 1TE0A 1G3BA 1XKAC 1ZHPA 1VITH 3OY5U 1LDTT 4B2CA 1V2MT 5EW1H 1GDUA 4J1YA 2VWNA 3EYDA 1O2JA 2CJIA 1C5WB 2VU8E 1KXEA 2A1DB 1V2PT 2THFB 1ID5H 1WYKA 2WPIS 3SNAA 2ASUB 1A3BH 5T6GA 1GJ8B 5JB8S 6CHAB 2ZO3H 2GD4B 5EPYA 5FPSA 2J9NA 3URDA 1HAXB 3L6PA 1HAZB 1MCTA 2P94A 1O35A 3Q76A 1P3EA 1GVKB 1XUKA 3F9EA 3PTBA 4A1XA 4BAOB 4YTAA 4BAMB 3TU7H 4YLUA 4DY7B 4WWYA 1SGCA 1EOLA 1ETRH 1HAHH 5F03A 4WXVA 6GCHG 1SFQB 1Y5AT 1XUIA 5DP6A 1HDTH 3LONA 1F5KU 2ZCHP 1TX8A 2ZTXA 2FPZA 3NKKA 4CR5A 2P8OB 1AVGH 1SVPA 4M7GA 3RC6A 2DUCA 1C1SA 2BTCE 3RXOA 2OQ5A 4CRBA 1AFQB 3SJ9A 3TGKE 4MG3A 4ABAA 3MNSA 1Z8RA 1BITA 4X1PU 3MO9A 2AMPA 5FCRA 4BAKB 3NWUA 1GHYH 1T31A 4Y7AA 4JZFH 4QT8C 3T5FH 1GDQA 2STBE 1O3OA 1NFYA 2PWXA 2J38A 3KN2A 3UQOA 5EQQA 1B0EA 1O2HA 1QB9A 1UVTH 2CV3A 3ZVFA 4X2YA 2J4IA 3W95A 1IQMA 1FQ3A 1KDQB 2AGIX 5DP4A 1MCVA 3A88A 2XNIA 4CRDA 1YPKH 3N7OA 3SV2H 1PPEE 2ZQ1A 3SGBE 3BF6H 1O2VA 1YPGH 5C67A 3M36A 2QY0B 2ZU4A 1GI1A 3TJOA 1E37B 1C2FA 3RXDA 2FEQH 4PROA 1Y3WA 2ZEBA 3K65B 3ZZ6A 2QA9E 4XDEA 5K7RA 4XFQA 1IQJA 1GCDA 4X8VH 3M5MA 5BRRE 1PQ8A 2YOLA 3VEQB 1HAVB 1JRSA 1S0RA 5C2ZA 1K22H 1ZTJA 1LHDH 1V2ST 2GDDA 4Y0ZE 1HXEH 1K28D 1HIAB 3PMBB 1W8BH 2J34A 2QXHA 3C27B 1WV7H 1SPJA 2BQ6B 1S5SA 4GHTA 2A2XH 1HJAC 5DGJA 2A4GA 1O0DH 4CRGA 1B7XB 1MTWA 1UVPA 1GBFA 1CBWC 1QL7A 1TBQH 2W3IA 4X0WU 1ACBE 2G52A 2ZP0H 4ABBA 5JBTA 2R3UA 2J2UA 1XMNB 4E7NA 5FX5A 1SGTA 1C5UA 2Q6FA 1MD7A 3RXMA 1ELFA 1MKXH 2KAIB 1YCPK 4HFPB 1O2NA 2OC0A 3HATH 1TOMH 1WQVH 1C2GA 4BNRA 1SQAA 3P95A 1MU8B 2VGCC 4MLFB 3SNBA 2EI6A 4D7FA 1C1QA 1FXYA 4IC5A 1VCQA 3AW0A 1CU1A 1TRYA 3TLOA 3MU0A 4Y11E 1KYNA 3MFJA 3TIUA 3TNTA 4DIHH 1TQ0B 2Z9LA 2VIOA 1D6WA 1TNGA 4B76A 2ZGHA 3IG6B 1EZQA 4ZH8A 3SHAH 2ZTYA 1EP5A 1V3XA 3LDXH 5HM9A 2BM2A 1Z8JB 4IN1A 1IQKA 1GBCA 1DS2E 1C5ZB 1BTXA 3GY5A 5H4IB 1O31A 4GLYA 1O3GA 1T4UH 2G55A 1GJBB 3EQ0H 2OXSA 3E90B 5JPMH 1AKSA 2ANKH 3EA7A 3GCTG 4NSVA 3SQEE 3FANA 3STIA 1TONA 1AB9C 4LOYH 1TA2A 3IWMA 4GHQA 1W7GH 1AWHB 1Q31A 1TGSZ 1Y3XA 4WMEA 4NG9H 1WBGB 3BV9B 1DPOA 4Y8XA 2P93A 1UCYE 3MOCA 1Y59T 4AFZA 2CF9H 1LHCH 1P11E 4O97A 4Y8ZA 5G4BA 1TAWA 1Y3VA 3RDZA 4ZAEA 1UVOA 1GBJA 3ATMA 2FIRH 4JYUH 4XBDA 1AHTH 1YPEH 4CRCA 3UPEA 4LZ1H 2H1UA 2FWWA 5C3NA 3ZYDA 1UMAH 2XBXA 1AZZA 3RXEA 2VIVA 1U6QA 3KQDA 1ZSJA 3BN9A 3SU1A 2BY7X 3ODFA 2QF0A 1T4VH 3MNXA 2W7UA 2D2DA 2VIWA 2FOBA 3A8AA 1V2QT 2LPRA 1O3FA 2BD9A 4D8NA 1C5SA 1J17T 5FAHA 2GKVE 3RU4D 5DP5A 3Q3XA 2OD3B 1EKBB 2BD3A 1WCZA 2OUAA 1DVAH 2BLWA 2ZFFH 2AMQA 1N8OB 3MO3A 2CN0H 3RC5A 1SL3A 1C5OH 1TIOA 3VGCC 3B9FH 1FMGA 3BEIB 4NWLA 1MMJN 1ZRBA 1K1PA 1EASA 5DK1A 1V2TT 2WPLS 1TGBA 6ESTA 5J4SA 1Z1JA 4Y0YE 3A86A 4K1SA 2ZU2A 4JZIA 3STJA 4A1TA 2B0FA 1L4ZA 2Y5GA 1N6YA 3K2UA 4AFQA 1C2IA 4K8BA 4Q2KA 2K1QA 1IHSH 1XUHA 1RS0A 1C1MA 3PWBA 4VGCC 3U1IB 1ZSKA 4I8KA 2H9HA 1O2SA 2RDLA 2VJ1A 2ZFTA 3PB1E 2XWAA 3M3VA 4U2WA 1C2LA 2C8WB 1N6XA 3QZRA 4UONA 4TWWA 1DSUA 3PWCA 1MU6B 1CE5A 1IQNA 1ZMLA 2ZDLA 1A3EH 2BLOA 5A2MH 3A85A 1CO7E 1NFXA 1SGPE 1C5PA 4X1NU 2BLQA 1AUTC 3T26A 3MH4A 4JZ1A 4X1SU 4FUDA 4JZDH 2BQ7B 5HGGA 3SZNA 4YLQH 1KDQA 3UTUH 4BOHA 4CH8B 1NRQH 2I6QA 1QB1A 1C2HA 1YP9A 1C1OA 5DPAA 1IQEA 1C4U2 1YLCA 2O8LA 1A5IA 1INCA 2ODYB 3TH4H 1K9OE 1BTUA 2D26C 2TRMA 1OOKB 2GCHG 2HALA 1CT2E 1GI6A 1ZOMA 3ELAH 3G01A 1MAXA 1AMHA 1NT1A 2FTLE 4MTBA 1AN1E 1C1PA 1L2EA 1O2OA 5L30H 5EXNA 1SGRE 1VJAU 1BDAA 1WTGH 1GJDB 1C5TA 2TGTA 4ZKOU 1RGQA 1BJUA 3Q77A 2A7HA 1VCWA 1AFQC 1O2WA 3RXUA 1BHXF 1TA6A 1FAXA 4JMYA 3ATIA 4MNVA 1ELBA 4YESB 4DT7B 1BUIA 1BMAA 3BTTE 2PR3A 1EZSC 2F9UA 4ISNA 1HIAA 3ZVGA 2WYJA 2GCHF 3RP2A 1TPAE 4ABDA 1SLWB 2ODPA 3GYLB 2R2MB 5E0GA 2ZPSA 1P01A 2Y7ZA 4D7GA 4X8SH 2ZDKA 2WINI 3A7WA 1GMCF 1YPMH 3ITIA 3RXAA 5TCCA 4DCDA 5GXPA 4MPWA 1UTOA 2V3HH 3SV7A 1P05A 3VB7A 2XBYA 3SHCH 1ELAA 3T27A 5ESBA 3UNSA 1EJNA 1DUAA 1ESBA 4Y79A 2WUBA 3QTVH 9ESTA 1E0FD 1PQAA 2KAIA 1W0YH 5E2OA 2WYGA 1BT7A 1KXFA 1RRKA 1LPKB 3P8OA 3MTYA 2FYQA 4IS5A 4CRAA 3MO6A 4A92A 1S85A 1O37A 3BTWE 1FN8A 2BDBA 3SBKA 1CQQA 1BA8B 2WPKS 4ZHAA 2FDAA 3P92A 1ZMJA 4ZHMU 1Y3UA 4AX9H 3TK9A 1DWCH 4THNH 3U9AH 1CGHA 1C2EA 1Y5BT 4AFSA 1EZXC 1V2UT 4YOJA 2SNVA 1GI7B 1A1RA 4FUIA 2BD4A 1A0JA 3LOXA 1XM1A 1VZQH 1SHHB 5L6NH 4H42U 1OWIA 1GI9B 2BZ6H 1AVWA 1DE7H 5EQSA 2WUCA 1NRPH 4FU9A 2A5IA 1XVMA 3TJVA 2VVUA 4X6OA 8KME2 3SV8A 1QR3E 3E0PB 1KLTA 1UTLM 1BTZA 3BIVH 2FOCA 3A89A 1OWHA 1BRBE 3RM2H 1GI2A 3A7XA 4GVUA 4NA9H 2BD5A 2A5KA 3SV9A 3SU3A 2FODA 1LVOA 5FPTA 1C5VA 2BY5X 1SC8U 4NA7A 2TPIZ 2PW8H 2UUKB 1F5RA 1O34A 4MVNA 4BXWA 4YOIA 1GI5A 2XWBI 1HV7A 1OSSA 2OCVB 1W2KH 3PLBA 1E36B 1F7ZA 1C2KA 3BG8A 4B75A 1ANCA 2Q6DA 4CREA 2ZHWH 2G8TA 2ZKSA 3MMGA 3SJ8A 3P70B 1UHBB 1V2KT 1V2RT 2ZGCA 2Y6TA 1LVBA 3LU9B 3UOUA 1MUEB 2H9EH 2ZU5A 3L3TA 2HLCA 1O2GH 4BAHB 2QF3A 1XUFA 1F0UA 4ISOA 1A61H 2SNWA 4YOGA 5T6FA 1BTPA 2PHBA 3A8BA 1LKAA 5GJ4B 2F9OA 4B74A 2GV6A 1QY6A 1C2DA 5EPNA 3U8RH 1GG6B 3NUMA 1PPHE 1O39A 4MQAA 3SUGA 1NU7B 1LHGH 1MH0A 4KGAA 5EXMA 1GBBA 3S9AA 3VPKA 3P8FA 4E05H 2WPMS 2Y5HA 1TLDA 2ZGBH 3EAJA 1ETTH 3KCGH 2Z94A 3K6YA 3KGPA 3M7UA 2V35A 3TVJB 1GJ6A 4Q7ZA 2H5DA 1TBZH 2QN5T 1GGDC 4H4FA 2V3OH 2GZ9A 1ZPBA 1WOFA 1EOJA 1BB0B 3FZZA 2VVVA 4AB8A 1SG8B 4I8LA 4BAQB 4AG1A 1IQLA 1OPHB 1HYLA 1PJPA 1W3CA 1S81A 1J14A 3RXBA 2ZFSA 1GHXH 5A8XA 3MNBA 2GT7A 5L2ZH 1GBIA 4K1TA 8LPRA 1FIWA 1N8OC 2G51A 2C90B 2C93B 1JIRA 1BRUP 1TALA 3CENA 1UTJA 2P3FH 3F9GA 1THSH 2JKHA 3T62A 1EXFA 1EB2A 1UCYH 3UWIA 1RTLA 1ZRKA 1HJ9A 1MD8A 2BY6X 4GSOA 2ULLA 3I29A 3RMLH 4ASHA 1EJAA 2XC4A 4BTIB 2TGPZ 4NIWA 1MZAA 4H6SB 3ZVAA 1UVUH 4RN6A 1C2MA 2BHGA 2P3TB 4U30A 2FOMB 2V6NA 1O2TA 1TPOA 2G81E 2NU4E 4B73A 4I8JA 3EA9A 5EXLA 4OS1A 4KELA 1FY4A 1O5CB 2ZHEH 1WAYB 2HPPH 2ZWLH 5CHAC 1WSSH 3T29A 5FPYA 3TK5A 2AMDA 2FOHA 4CRFA 2PUQH 1SGFG 1GJ4H 4BXSA 3OYPA 5AHGH 2P16A 3HK6B 2P59A 3RXGA 1K2I1 1MBMA 1A2CH 1KXDA 3D49H 1T8MA 1GJ9B 2IOTA 2XBVA 3A83A 1O33A 3SU4A 1C4V2 2RA3A 1H9HE 2ZA5A 4ISLA 2V0BA 1O3NA 2W3KA 2VWLA 2NU3E 1GBKA 3GDVA 2F9NA 3AASA 4JYTA 4A6LA 1HFDA 3SV6A 2G5VA 1K21H 2PLXA 3DT0H 3P8GA 3EDXB 1QRXA 2ZDVH 1H1BA 3SI3H 4IC6A 2JH0D 1DWBH 3GY3A 2GZ8A 2PFEA 1GBHA 4Y8YA 2HVXA 2FX4A 1OWJA 3SU6A 3MU1A 7KMEH 3PYHA 2FESH 1SGNE 5C5OA 4E7RG 2Z3EA 2AEIH 2Z9KA 3KEEA 1FN6A 1VR1H 4XOJA 4AYVB 3PM3A 1AWFH 4I8HA 4WJG2 4ZXYH 4NGAH 5JBCS 1H8IH 1KXBA 5JBBS 4ABJA 2Z3DA 4FXGH 2QXIA 1Y5UT 5A09A 4B2AA 1P12E 1UVSH 2ANYA 2EC9H 2ZZUH 3QGNB 1O2PA 1QQ4A 4Y71A 3KQEA 2BXTH 1XKBC 3SQHE 2A4QA 4WY3A 1DUEA 3GY4A 2H9TH 1FY1A 4ABHA 2XW9A 4TPIZ 3ZZ3A 1C1NA 2D8WA 5DG6A 5A0AE 1ARCA 3ZZ5A 2ZG0H 1QJ1B 3A87A 1VGCB 1GVLA 4TY6A 1RXPA 1D3PB 1C1RA 3BSQA 4UFFH 3P6ZB 1A7SA 2G5NA 2PGBB 4MNWA 4ABGA 1P09A 1K1NA 4DG4A 1QURH 2SFAA 3ZZBA 1Q2WA 1RFNA 1O32A 1GHBG 2TGAA 3KQBA 4Y10E 1ESTA 1KLJH 1SQOA 4YT6H 1C1TA 1GBDA 1GJ7B 4D9QA 1L1GA 1DFPA 2VIPA 2A4RA 1QRZA 2Z7FE 3RXHA 4FUGA 5EQRA 4JK6A 1P9UA 1D3TB 4NZLA 4AZ2B 5I25A 4TY7A 1MKWH 1UHBA 4LK4A 1W14U 4YZUA 1MKXK 3LGYA 4AOQA 3OU0A 5LH8A 4CBOA 1C5LH 3MU5A 4XSKU 4D76A 1W13U 2GGVB 5GCHG 1Z8GA 1DLEA 1UTPA 1WTHD 2F9BH 1GHBF 5HXFA 5DP9A 1O3HA 1HAIH 1DY9A 1SLXB 3QK1A 3UR6A 1HJ8A 1TNHA 3I77A 3LGVA 3E1XB 4Z0KA 4NIYA 1GBTA 2CMYA 2ODQA 5GDSH 3BTME 1SGYE 1YM0A 2I6SA 1LMWB 1G32B 2HOBA 4NFFA 2BLVA 5SGAE 1VITG 1IQFA 5AFYH 2GCTB 1SLVB 2FXRA 5FX6A 1F0SA 3C1KA 5GCHF 3TJNA 2Y5FA 1V6DA 2PV9B 1SB1H 1V2WT 2ZNKH 5JBAS 1XX9A 2FI5E 3GY8A 2BYAX 3ENSB 1RJXB 2A7CA 1GL1A 1XUGA 1HCGA 3SN8A 1LKBA 3FP8E 2SGPE 1UK3A 3LIWA 2ZDNA 1TMBH 2A4OA 2O8UA 5E2PA 4IW4E 2ZPQA 5BPEA 3ZVCA 3ZZ4A 1AD8H 2ZU1A 3QUMP 1LQDB 1NROH 1NU9A 1AZ8A 1FJSA 2BMGB 1GCTB 2HNTF 3MH5A 3ZVDA 1RTKA 1ZYOA 3MI4A 3O8RA 1SOZA 4TYDA 1QB6A 3VFEA 1AQ7A 1VITF 2Q1JA 2HGTH 5A8YA 1A5HA 1FY3A 2FX6A 1DT2A 1EPTB 4AYYB 5LGOA 3QO6A 1TBRH 2BD7A 1GG6C 3OTJE 3A81A 5E8EH 4Q7YA 1HPGA 1TFXA 2C8XB 1BIOA 5T3HA 3KL6A 3UREA 1GBEA 1QNJA 4YO9A 3O8DA 3RXFA 1K1MA 2FOGA 4NFEA 5GIBA 3BTQE 4MPUA 1NC6A 4FUFA 2C4FH 2ANWA 4J2YB 1OKXA 3SUEA 4SGBE 4FUCA 3V13A 1ZPZA 1YBWA 2GMTB 3GY6A 1SBWA 1P03A 1OP8A 3UFAA 3LGWA 1PPBH 3PO1B 4K2YA 1GBMA 5LPFA 1O38A 1G3EA 1T8OA 1DICA 3U98H 2OQUA 4OGXA 1LVMA 1SGDE 2R0LA 2XRCA 6CHAC 3A80A 1ZSLA 5DO4H 4ZMAH 1TABE 1UTMA 1YLDA 5DP3A 1EAUA 3GOVB 3QGJA 4UE7H 3IITA 5IYTA 3E0NB 1HXFH 2FOFA 1G37A 3F9HA 2C8ZB 1O3DA 2VNTA 1AFEH 1FI8A 1BBRH 1V2JT 2ANMH 1YF4A 1TMUH 4CH2B 5A0BA 1P9SA 1S6HA 1F2SE 2A31A 3QLPH 1GMCG 2P8OC 1TNLA 4I32A 1HB0B 1BTWA 4GCHG 5C1YA 3M3SA 2FMJA 4AFUA 1K1LA 4NSYA 1BHXB 1HAVA 1GI0A 1SSXA 3ZZCA 5C5NA 3PMHB 5FBIA 1XUJA 1DITH 1CA0B 1D4PB 1YC0A 3M61U 3LC3A 2GTBA 1F92A 1O3BA 2BDYA 3ATKA 1CT0E 3SORA 2GDEH 2QV1A 4DOQA 4GCHF 1DWEH 3F6UH 1C5QA 3DHKH 1HAOH 1QJ6B 2A7JA 3HGPA 4UEHH 1ANBA 1FY8E 2RA0A 3GCOA 4OS6A 3Q3KA 1C1VH 2XYAA 1KY9A 2BVXH 4NIVA 2Q6GA 1LTOA 2OBQA 1O2IA 4KP0A 3LJOA 4ZKNU 2GP9B 3BEFB 2Z9IA 1V2NT 2ZU3A 4LZ4B 4DVAU 5C1XA 1RD3B 2NU1E 1S0QA 3RXVA 1FUJA 1W12U 1P2MA 4CBNA 3PV4A 1Z8IB 1BCUH 2W7SA 2QXGA 1DANH 3GYMA 1TX6A 4IMQA 1DXWA 3QN7A 2WV5A 3HKIB 4Y6DA 1O5BB 2FI4E 1TNIA 1GHWH 4UFEH 4INKA 1MBQA 1ZJKA 3NZIA 1OWKA 4INHA 1AO5A 2UUFB 1O2UA 3ESTA 1GI8B 1O2KA 2GV7A 1HRTH 1NESE 2FLRH 2ZHQH 5DJ7A 4OS7A 1CA8B 1TX7A 4WXIA 2VGCB 1QRWA 5HYOA 2J95A 1OP2A 1AIXH 1FZZA 1J15A 2Y82A 1ESAA 2AS9A 1CSOE 1KSNA 1ELTA 3ZZDA 1PPCE 1FV9A 1QGFA 4IN2A 1C5NH 3KIDU 3EE0B 1RIWB 3DFJA 2FYRA 5EW2H 1LQEA 3I78A 3GISB 4R0IA 2BQWB 3F1SB 1JWTA 1EB1H 1BZXE 1HLTH 1C1WH 2IJOB 4RKOB 1J9CH 3DFLA 3D65E 7GCHF 4B1TA 3UQVA 1MTUA 1TPPA 4JCNA 1TPSA 1ELGA 1FLEE 3NXPA 2VB0A 4D9RA 5C1UA 1QCPA 2BB4A 3D62A 2BXUH 1MTVA 2CGAA 2AIPA 1O30A 1A0LA 4A1VA 1V2LT 1GMDG 1IAUA 2BOKA 3A7VA 3E8LA 3UNQA 1CHOG 1TGTA 2TIOA 1KLIH 1H8DH 3AVZA 3UUZA 1P2NA 1QIXB 2OC8A 1SLUB 1GJAB 5CE1A 3PLKA 1E38B 2FS9A 2AFQB 1Z71A 1UK4A 2W5EA 1GVZA 1YPLH 6LPRA 4YT7H 4IMZA 4ISIH 1CVWH 1EPTA 2Y81A 2TGDA 5L2YH 3SNEA 1T8NA 2ALPA 1OWEA 1WUNH 4INLA 2XC5A 5GWZA 1K1JA 4Y76A 3S7HB 4DJZB 1KTTB 3LKWA 2ZFPH 1FNIA 1O2XA 3SU0A 1GMDF 3A82A 1P2KA 1ZR0A 5FCKA 1BBRE 2DE9A 2GCTC 4ZROA 1CHOF 5F8ZA 2ZGXH 4Y7BA 2BX4A 4ISHH 2BD2A 5CMXH 3BTHE 2G00A 3JZ1B 3UY9A 3S7KB 3SJOA 1C5XB 1H4WA 1X7AC 3EGKH 1OP0A 4Q80A 3RXRA 3PTNA 3TNSA 3QTOH 3TGJE 2VIDA 1JMOH 4CHAB 1JOUB 2NU0E 5ETXA 5F8XA 3RXQA 1D6RA 1YKTA 3MNCA 1MZDA 1TNJA 1QFKH 3VB3A 3O8BA 1PFXC 3A7ZA 1FPHH 1CGIE 3D23A 4I8GA 5E0HA 1G3DA 1P06A 1TOCB 1S83A 1TGCA 3AW1A 4K1EA 2VIQA 4GPGA 3QDZB 3W94A 3CP7A 4O03A 4VGCB 1EPTC 3RMMH 2BD8A 2O8WA 1Y8TA 2YNAA 3FVFB 1P0SH 1BMMH 3BTEE 1ABIH 4NZQA 2OLGA 4OS5A 4HTCH 2WPJS 4X8UH 1AE8H 1P2IA 4JYVH 3SNCA 4ABEA 5F6MA 3M5LA 3BTGE 5E0JA 2ZCLP 4ZUHA 1LO6A 1TGNA 1TQ7B 4WMFA 2O9QA 2VVCA 2ZC9H 4XBBA 4UFDH 3UR9A 2GMTC 1SQTA 3TPIZ 3ZZ7A 1B5GH 1G3CA 4UD9H 3PO1C 2BY8X 2XXLA 1O3KA 1CT4E 2EI7A 1A46H 4WH6A 5J4QA 1NM6A 1BMLA 3RMNH 4BTUB 2UWPA 1GI3A 2W26A 1UCYK 5DP8A 3LH1A 1M9UA 3K6ZA 1A0HB 1A5GH 4AGJA 5B6OA 2BX3A 4X6MA 4K8YA 4FUBA 1S84A 2ZHFH 2GX4A 1SR5C 5TJXA 4KTCA 1EAXA 3E6PH 2ZPRA 2HWLB 1QA7A 2ZI2H 3ZVEA 4SGAE 5K0HA 4F49A 4TWYA 2FI3E 1LPZB 1YPHE 5IDKA 1BRCE 2OC1A 1LHFH 1OXGA 2PKSB 3MWIU 5EGMA 4X2XA 3GCHB 2A5AA 6GCHF 1C2JA 1CGJE 2PSYA 3UOPA 2WV4A 3WY8A 1FPCH 1UTQA 2Y7XA 3RUOA 2SGFE 2Y80A 3MHWU 1NPMA 1FDPA 3SO3A 1ETSH 4MPVA 3B23B 1AVXA 4LXBH 3GY7A 1C9PA 1ZZZA 2FS8A 3SU5A 2AERH 3QZQA 4X1RU 2VWOA 3TH3H 1HAPH 1CA0C 2GZ7A 1AI8H 1GJ5H 3BTKE 1OWDA 2ZCKP 2Z9GA 2ZFQH 3H7OA 5JYIA 4Q7XA 3PMJA 1UTNA 1Q3XA 3M7TA 1C4Y2 3JZ2B 2FZZA 1QBVH 1DDJA 3V0XA 1ZJDA 2NWNA 1BRAA 3SNDA 1Z6EA 2XCNA 2B8OH 3HPTB 1SMFE 2UUJB 3MYWA 7ESTE 1OX1A 3QX5H 2EEKA 1G2LA 1GBAA 3RMOH 3RXTA 1J8AA 5ESTE 2OC7A 1EQ9A 1ZLRA 2ZTZA 1MTNB 3H5CB 4ABIA 1UJ1A 3LGTA 1EZUC 1YCPH 1ZHRA 1ZTKA 1ZGVA 3MH6A 3V7TA 4NWKA 1ARBA 4KTSA 1MAYA 4O3UA 1QQUA 2O8MA 4BTTB 4MDSA 2SGAA 4HI3A 3HK3B 1GHZA 2VINA 2C3SA 3RXCA 2AYWA 4WF8A 2JH6D 4H6TA 1LCYA 4I33A 1EUFA 2P3UB 3M5NA 3ZZ8A 4AG2A 2F9VA 1TMTH 4WH8A 3FP6E 3LGUA 1O3CA 3RXPA 2FLBH 5EOKA 4OGYA 3UNRA 1TNKA 4GUXA 3LH3A 5DKMA 1UO6A 1GHAG 3BTDE 3R3GB 1FAKH 2RCEA 2YNBA 2RG3A 2JETB 4KTUA 1O5GH 2PKAB 3CS0A 2BDAA 1UTKA 2P95A 1G36A 1O2LA 1MTSA 3M3TA 1O2YA 2J92A 4X1QU 1O3JA 4O9VA 2QYIA 3P8NA 2FO9A 3FAOA 2B5TB 4BANB 2BDGA 1QJ7B 4Z6AH 2VH6A 1PQ7A 1NO9H 2HNTE 8GCHG 3LGIA 2F3CE 2STAE 1RIWC 3SUDA 1TWXB 3VB5A 1P3CA 4K69A 1CHGA 2SGDE 4B2BA 3RLWH 2EA3A 5HMAA 3MU4A 3U69H 1ELVA 1O3PB 1MKWK 1GHAF 1NFUA 2ZHDA 4I31A 1W10U 2AH4X 1SFIA 1O5DH 1T7CA 4FUEA 1LPGB 1ZTLA 2UWOA 2XCFA 3E16B 3ZV8A 4AN7A 3SJKA 2QXJA 2AGGX 2OINA 3Q00A 4OS4A 1EATA 4FUJA 1NTPA 5JB9S 1AUJA 1BOQA 4RSPA 1ELCA 3F9FA 1DY8A 3ZYEA 3RXIA 1GI4A 1YCPM 3PMAB 3BG4B 1P02A 3GCNA 4OS2A 8GCHF 3M35A 3RXSA 2BDCA 5EG4A 3M5OA 1D3QB 2F83A 1TRNA 2GT8A 3P17H 1OS8A 1GDNA 3A8DA 1V2OT 5A8ZA 5T6DA 5EODA 2J94A 2CHAB 1WQSA 3U1JB 4A7IB 3E91A 4WMDA 2ZDAH 2BDIA 5DP7A 3EA8A 1NN6A 4U32A 1O3MA 2TBSA 5ABWA 1H9LB 3GCTF 2FOEA 3H7TA 4JZEH 1G30B 3SOSA 1O5EH 2PTNA 4FVBA 3S9BA 4IBLH 3SUFA 2ZQ2A 1L1NA 4NA8A 1GGDB 2QGRA 3M7QA 1O36A 1GL0E 3DA9B 5C20A 3VB6A 1JIMA 5LPEA 3NCLA 4AORA 3T2NA 1NRRH 1HGTH 1PPGE 3ODDA 1C5YB 2BY9X 2XTTB 1ZPCA 2IN2A 3GY2A 1GPZA 3M37A 4X2VA 1DX5M 3CS7A 5EU8A 4FU7A 1WU1A 4CHAC 3TJUA 2OP9A 4AGKA 1MQ5A 2ZDMA 3ATLA 1D9IA 1ELEE 4ZKRU 5I46H 1YYY1 1T32A 2H5CA 3RLYH 1THPB 3NK8A 3KNXA 5JDUB 1HBTH 1S6FA 1P10A 1SGQE 8ESTE 1C5RA 1IQHA 1C1UH 5AFZH 3A84A 1L0ZA 1NFWA 2IPHA 3TITA 4DGJA 4F4OC 3A7YA 2JH5D 1P8VC 7LPRA 1UK2A 3T25A 1G9IE 1VCPA 1VJ9U 1N1LA 2BVSH 1KIGH 1RTFB 3K9XB 4NCYA 1PPZA 1O2RA 4IGDA 1DSTA 1NRSH 3KQCA 5CHAB 5FXLA 1FONA 1QL8A 4E06H 2FTMA 3RM0H 3MH7A 1BQYA 4R8TB 2R2WU 4TPYA 3S69A 1QBNA 3TH2H 4FVDA 2D1JA 4A5TS 1BTHH 3GDUA 1C9TA 1J16A 1D3DB 2A2QH 3E3TA 3SGAE 1SGFA 3ZZ9A 3VB4A 1O2ZA 1GMHG 1DLKB 1C5MD 1O3AA 4HZHA 1SOTA 2QCYA 1T8LA 1KXAA 2PUXB 1O3LA 5PTPA 4XE4A 2XC0A 3LPRA 4DURA 1DM4B 1F5LA 2H2ZA 1YPJH 3SU2A 5GPIB 2HPQH 3PROA 1BBRK 1QL9A 3QWCH 4K3JA 2C8YB 2UUYA 1G2MA 1PQ5A 4RKJB 4B71A 1GBLA 1QA0A 2OBOA 3V12A 2G4TA 2B9LA 4WVPE 1ZHMA 1Z7KA 2H6MA 1EAIA 4ABFA 1TB6H 4AB9A 1ORFA 2R0KA 1GMHF 4UFGH 4HGCA 5FBEA 5LPRA 2ALVA 3V3MA 1A4WH 1F0TA 2PKSC 3Q3YA 1GHVH 9LPRA 1IQIA 1TRMA 1DWDH 1ABJH 3GCHC 2M5TA 2F9PA 1MQ6A 5FHTA 3RXJA 1ZMNA 2DE8A 1NRNH 2QC2A 2ZECA 3UWJH 4X2WA 4ZKSU 3ZVBA 3U8TH 1QTFA 2WPHS 1HJAB 1H9IE 1ANEA 1TYNA 1KXCA 3URCA 2UWLA 3OSYA 3U8OH 2SGEE 3ZZAA 3O8CA 1BJVA 1CBWB 2FM2A 2NU2E 2ZF0H 1DOJA 2PSXA 4K60A 1K1OA 3RC4A 1JRTA 1QHRB 1W7XH 2FP7B 2A0QB 1THRH 1NS3A 1V2VT 2VWMA 3BIUH 1O2MA 4MNXA 4MPXA 1LHEH 2LNCA 4UDWH 4MNYA 2PKAA 3NPSA 1L1JA 4ZXXH 4XBCA 2BZAA 1SI5H 1O3IA 2Z3CA 2XBWA 7GCHG 1B0FA 3S0NA 3VXFH 2FOAA 5AVDA 4X8TH 4K5ZA 3T28A 1YPHC 2F91A 4JK5A 2SGQE 4NIXA 3B8JA 1K1IA 1GJCB 1PYTD 2OTVA 4X6NA 1Y3YA 1HUTH 1MTNC 3GDSA 3FP7E 4DW2U 4CR9A 1W11U 3ZV9A
chains in the Genus database with same CATH superfamily
1EJMA 1VGCC 3R0FA 1AE5A 1HAYB 3SW2B 2K8IA 1O5AB 3AAVA 2EI8A 2PGQB 1EP6A 1F0RA 3TK6A 1O5FH 1IHTH 2HRVA 4YM9A 1W0ZU 3PLPA 3OE7D 1JBUH 2ESTE 3SI4H 1BTYA 2Z6BD 4X6PA 2XOKD 2Z9JA 1SQRA 3TGIE 3RXLA 1LVYA 1PYTC 3AAUA 2A32A 1EX3A 3NRLA 1H8HD 2JJ1D 3S9CA 3FFGA 1P57B 1SGIB 4FUHA 2JETC 3F68H 1AB9B 1SHYA 3FZDA 3LT3A 2QIQA 3A8CA 3HKJB 5CHBA 2O8TA 4DIIH 5TCAA 1GWAA 3BEUA 4F55A 3KF2A 1P04A 3BTFE 1OYTH 2VH0A 2R3YA 4U01A 1L4DA 1NZQH 3ATWA 1PPFE 1AY6H 4ZHLU 1XVOA 2R9PA 1BMNH 3SGQE 3GICB 3RXKA 1NY22 1KTSB 2JJ2D 3DD2H 4I7YH 1IQGA 3HGNA 1FIZA 1HAGE 4GAWA 4ESTE 1XXDA 5F8TA 2ZIQH 3LJJA 1P2OA 2A45B 2PTCE 3RU4T 1QBOA 1OYQA 3RU4E 1O3EA 4O3TA 5KECA 1E35B 1ANDA 2AGEX 3KHVA 1DXPA 1AU8A 1P2JA 1JXPA 2CF8H 2G4UA 3LC5A 3MU8A 3UIRA 1IOEA 3OX7U 5AF9H 3DUXH 3SJIA 1E34B 1Z1IA 1YGCH 2B7DH 1EAWA 3BG4C 1AKSB 5A0CA 2QAAA 2ZGJA 1SGEE 1S82A 2BDHA 2V3MA 4ASUD 3L33A 1AGJA 3VXEH 5HM2A 2AIQA 3A7TA 1ELDE 3OY6U 2ILNA 1HNEE 1O2QA 2GVFA 3VGCB 2CHAC 2HVYB 2HNTC 1P2QA 1ZGIA 2CXVA 1GCTC 3EE7A 2ZFRH 4FU8A 4KKDA 1FY5A 2BOHB 1XXFA 1Z6JH 2BVRH 1TE0A 1G3BA 5C17A 1XKAC 1ZHPA 1VITH 3OY5U 1LDTT 4B2CA 1V2MT 5EW1H 1GDUA 4J1YA 2VWNA 3EYDA 1O2JA 2CJIA 1C5WB 2VU8E 1KXEA 2A1DB 1V2PT 2THFB 1ID5H 1WYKA 2WPIS 3SNAA 2ASUB 1A3BH 2WZQA 5T6GA 5KEDA 1GJ8B 5JB8S 6CHAB 2ZO3H 2GD4B 5EPYA 5FPSA 2J9NA 1YY3A 3URDA 3UB0A 1HAXB 2W6ID 3L6PA 1HAZB 1MCTA 2P94A 1O35A 3Q76A 1P3EA 1GVKB 1XUKA 3F9EA 3PTBA 4A1XA 4BAOB 4YTAA 4BAMB 3TU7H 4YLUA 3F2FA 4WWYA 1SGCA 1EOLA 1ETRH 4DY7B 1HAHH 5F03A 4WXVA 6GCHG 1SFQB 1Y5AT 1XUIA 5DP6A 1HDTH 3LONA 1F5KU 2ZCHP 1TX8A 2ZTXA 2FPZA 3NKKA 4CR5A 2P8OB 1AVGH 1SVPA 4M7GA 3RC6A 2DUCA 1C1SA 2BTCE 3RXOA 2OQ5A 4CRBA 1AFQB 3SJ9A 3TGKE 4MG3A 2YMSB 3MNSA 4ABAA 1Z8RA 1BITA 2F43B 4DT4A 4X1PU 3MO9A 2AMPA 5FCRA 4BAKB 3NWUA 1GHYH 1T31A 4Y7AA 4JZFH 4QT8C 3PRDA 3T5FH 1GDQA 2STBE 1O3OA 1NFYA 2PWXA 2J38A 3KN2A 3UQOA 5EQQA 1B0EA 1O2HA 1QB9A 1UVTH 2RDEA 2CV3A 3ZVFA 4X2YA 2J4IA 3W95A 1IQMA 5KGOA 1FQ3A 1KDQB 2AGIX 5DP4A 1MCVA 3A88A 2XNIA 4CRDA 1YPKH 3N7OA 3SV2H 1PPEE 2ZQ1A 3SGBE 3BF6H 1O2VA 1YPGH 5C67A 3M36A 2QY0B 2ZU4A 1GI1A 3TJOA 1E37B 1C2FA 3RXDA 2FEQH 4PROA 1Y3WA 2ZEBA 3K65B 3ZZ6A 2QA9E 4XDEA 5K7RA 4XFQA 1IQJA 1GCDA 4X8VH 3M5MA 5BRRE 2HLDD 1PQ8A 2YOLA 3VEQB 1HAVB 1JRSA 1S0RA 1YWUA 5C2ZA 1K22H 1ZTJA 1LHDH 1V2ST 2GDDA 4Y0ZE 1HXEH 3WWFA 1K28D 1HIAB 3PMBB 1W8BH 2J34A 2QXHA 3C27B 1WV7H 2M2AA 1SPJA 2BQ6B 1S5SA 4GHTA 2A2XH 1HJAC 5DGJA 2A4GA 1O0DH 4CRGA 1B7XB 1MTWA 1UVPA 1GBFA 1CBWC 1QL7A 1TBQH 2W3IA 4X0WU 1ACBE 2G52A 2ZP0H 4ABBA 5JBTA 2R3UA 2J2UA 1XMNB 4E7NA 5FX5A 1S6LA 1SGTA 1C5UA 2Q6FA 1MD7A 3RXMA 1ELFA 1MKXH 2L6OA 2KAIB 1YCPK 4HFPB 1O2NA 2OC0A 3HATH 1TOMH 1WQVH 1C2GA 4BNRA 1SQAA 3P95A 1COWD 1MU8B 2VGCC 4MLFB 3SNBA 2EI6A 4D7FA 1C1QA 1FXYA 4IC5A 1VCQA 3AW0A 1CU1A 3ZIAD 1TRYA 3TLOA 3MU0A 4Y11E 1KYNA 3MFJA 3TIUA 3TNTA 4DIHH 1TQ0B 2Z9LA 2VIOA 1D6WA 3FKSD 1TNGA 4B76A 2ZGHA 3IG6B 1EZQA 4ZH8A 3SHAH 2ZTYA 2J98B 1EP5A 1V3XA 3LDXH 5HM9A 2BM2A 1Z8JB 4IN1A 1IQKA 1GBCA 1DS2E 1C5ZB 1BTXA 3GY5A 5H4IB 1O31A 4GLYA 1O3GA 1T4UH 2G55A 1GJBB 3EQ0H 2OXSA 3E90B 5JPMH 1AKSA 2ANKH 3EA7A 3GCTG 4NSVA 3SQEE 3FANA 3STIA 1TONA 1AB9C 4LOYH 1TA2A 3IWMA 4GHQA 1W7GH 1AWHB 1Q31A 1TGSZ 1Y3XA 3OEED 4WMEA 4NG9H 1WBGB 3BV9B 1DPOA 3F0PA 4Y8XA 2P93A 2GJGA 1UCYE 3MOCA 1Y59T 4AFZA 2CF9H 1LHCH 1P11E 4O97A 4Y8ZA 5G4BA 1TAWA 1Y3VA 3RDZA 4ZAEA 1UVOA 1GBJA 3ATMA 2FIRH 4JYUH 4XBDA 1AHTH 1YPEH 3SZEA 4CRCA 3UPEA 4LZ1H 2H1UA 2FWWA 5C3NA 3ZYDA 1UMAH 2XBXA 1AZZA 3RXEA 2VIVA 1U6QA 3KQDA 1ZSJA 3BN9A 3SU1A 2BY7X 3ODFA 2QF0A 1T4VH 3MNXA 2W7UA 2D2DA 2VIWA 2FOBA 3A8AA 1V2QT 2LPRA 1O3FA 2BD9A 4D8NA 2KCPA 2VBCA 1C5SA 1J17T 3KYFA 5FAHA 2GKVE 3RU4D 5DP5A 3Q3XA 2OD3B 1EKBB 2BD3A 1WCZA 2OUAA 1DVAH 2BLWA 2ZFFH 2AMQA 1N8OB 3MO3A 2CN0H 3RC5A 1SL3A 1C5OH 1TIOA 4RT1A 3VGCC 3B9FH 1FMGA 3BEIB 4NWLA 1MMJN 1ZRBA 1K1PA 1EASA 5DK1A 1V2TT 2WPLS 1TGBA 6ESTA 5J4SA 1Z1JA 4Y0YE 3A86A 4K1SA 2ZU2A 4JZIA 3STJA 4A1TA 2B0FA 1L4ZA 2Y5GA 1N6YA 3K2UA 4AFQA 1C2IA 4K8BA 4Q2KA 2K1QA 1IHSH 1XUHA 1RS0A 1C1MA 3PWBA 4VGCC 3U1IB 1ZSKA 4I8KA 2H9HA 1O2SA 2RDLA 2VJ1A 2ZFTA 3PB1E 2XWAA 3M3VA 4U2WA 1C2LA 2C8WB 1N6XA 3QZRA 4UONA 4TWWA 1DSUA 3PWCA 1MU6B 1CE5A 1IQNA 1ZMLA 5B6LA 2ZDLA 1A3EH 4YXWD 2BLOA 5A2MH 3A85A 1CO7E 1NFXA 3N7DA 1SGPE 1C5PA 1H8ED 4X1NU 2BLQA 1AUTC 3T26A 3MH4A 4JZ1A 4X1SU 4FUDA 4JZDH 2BQ7B 5HGGA 3SZNA 1BMFD 4YLQH 2YMSD 1KDQA 3UTUH 4BOHA 1QZ8A 4CH8B 1NRQH 2I6QA 1QB1A 1C2HA 1YP9A 1C1OA 5DPAA 1IQEA 1C4U2 1YLCA 2O8LA 1A5IA 1INCA 2ODYB 3TH4H 1K9OE 1BTUA 2D26C 2TRMA 1OOKB 2GCHG 2HALA 1CT2E 1GI6A 1ZOMA 3ELAH 3G01A 1MAXA 1AMHA 1NT1A 2FTLE 4MTBA 4XD7D 1AN1E 1C1PA 1L2EA 1O2OA 5L30H 5EXNA 1SGRE 1VJAU 1BDAA 1WTGH 1GJDB 1C5TA 3DSGA 2TGTA 4ZKOU 1RGQA 1BJUA 3Q77A 2A7HA 1VCWA 1AFQC 1O2WA 3RXUA 2YMSC 1BHXF 5C94A 1TA6A 1FAXA 4JMYA 4ZCNA 3ATIA 4MNVA 1ELBA 4YESB 4DT7B 1BUIA 1BMAA 3BTTE 2PR3A 1EZSC 2F9UA 4ISNA 1HIAA 3ZVGA 2WYJA 2GCHF 3RP2A 1TPAE 4ABDA 1SLWB 2ODPA 3GYLB 2R2MB 5E0GA 2ZPSA 1P01A 2Y7ZA 3WW7A 4X8SH 4D7GA 2ZDKA 2WINI 3A7WA 1GMCF 1YPMH 3ITIA 3RXAA 5TCCA 4DCDA 5GXPA 4MPWA 1UTOA 2V3HH 3SV7A 1P05A 3VB7A 2XBYA 3SHCH 1ELAA 3T27A 5ESBA 3UNSA 1EJNA 1DUAA 1ESBA 4Y79A 2WUBA 3QTVH 9ESTA 1E0FD 1PQAA 2KAIA 1W0YH 5E2OA 2WYGA 1BT7A 1KXFA 1RRKA 1LPKB 3P8OA 3MTYA 2FYQA 4IS5A 4CRAA 3MO6A 4A92A 1S85A 1O37A 1W0KD 3BTWE 1W0JD 2QE7D 1FN8A 2BDBA 3SBKA 1CQQA 1BA8B 2WPKS 4ZHAA 2FDAA 3P92A 1ZMJA 4ZHMU 1Y3UA 4AX9H 3TK9A 1OHHD 1DWCH 4THNH 3U9AH 1CGHA 1C2EA 1Y5BT 4AFSA 2J98A 1EZXC 1V2UT 4YOJA 2SNVA 1GI7B 1A1RA 4FUIA 2BD4A 1A0JA 3LOXA 1XM1A 1VZQH 1SHHB 5L6NH 4H42U 1OWIA 1GI9B 2BZ6H 1AVWA 5EJ1A 1DE7H 5EQSA 2WUCA 1NRPH 4FU9A 2A5IA 1XVMA 3TJVA 2VVUA 4X6OA 3PV2A 3SV8A 8KME2 1QR3E 3E0PB 3OAAD 1KLTA 1UTLM 1BTZA 3BIVH 2FOCA 3A89A 1OWHA 1BRBE 3RM2H 1GI2A 3A7XA 4GVUA 4NA9H 2BD5A 2A5KA 3SV9A 4P00A 3SU3A 2FODA 1LVOA 5DSFA 5FPTA 1C5VA 2BY5X 1SC8U 4NA7A 2TPIZ 2KM0A 2PW8H 2UUKB 1F5RA 1O34A 4MVNA 4BXWA 4YOIA 1GI5A 2XWBI 5EIYA 1HV7A 1OSSA 1W2KH 2OCVB 3OFND 3PLBA 1E36B 1F7ZA 2WSSD 1C2KA 3BG8A 5CDFE 4B75A 1ANCA 2Q6DA 4CREA 4FETA 2ZHWH 2G8TA 2ZKSA 3MMGA 3SJ8A 3P70B 4P02A 1UHBB 1V2KT 1V2RT 2ZGCA 2Y6TA 1LVBA 3LU9B 5IK2D 3UOUA 1MUEB 2H9EH 2ZU5A 3L3TA 4TT3D 2HLCA 1O2GH 4BAHB 2QF3A 1XUFA 1F0UA 4ISOA 1A61H 2SNWA 4YOGA 2IJD1 5T6FA 1BTPA 2PHBA 3A8BA 1LKAA 5GJ4B 2F9OA 4B74A 3F2HA 2GV6A 1QY6A 1C2DA 5EPNA 3U8RH 1GG6B 3NUMA 1PPHE 1O39A 4MQAA 3SUGA 1NU7B 1LHGH 1MH0A 4KGAA 5EXMA 1GBBA 3S9AA 3VPKA 3P8FA 4E05H 2WPMS 2Y5HA 1TLDA 2ZGBH 3EAJA 1ETTH 3KCGH 2Z94A 3K6YA 3KGPA 3M7UA 2V35A 3TVJB 1GJ6A 4Q7ZA 2H5DA 1TBZH 2QN5T 1GGDC 4H4FA 2V3OH 2GZ9A 1ZPBA 1WOFA 1EOJA 1BB0B 3FZZA 2VVVA 4AB8A 1SG8B 4I8LA 4BAQB 4AG1A 1IQLA 1OPHB 1HYLA 1PJPA 1W3CA 3VG8A 1S81A 1J14A 3F0OA 3RXBA 2ZFSA 1GHXH 5A8XA 3MNBA 2GT7A 5L2ZH 1GBIA 4K1TA 8LPRA 1FIWA 2JDID 1N8OC 2G51A 2C90B 2C93B 1JIRA 1BRUP 1TALA 3CENA 1UTJA 2P3FH 3F9GA 1THSH 2JKHA 3T62A 1K0HA 1EXFA 1EB2A 1UCYH 3UWIA 1RTLA 1ZRKA 1HJ9A 1MD8A 2BY6X 4GSOA 2ULLA 3I29A 3RMLH 4ASHA 1EJAA 2XC4A 4BTIB 2TGPZ 4NIWA 3H09A 1MZAA 4H6SB 3ZVAA 1UVUH 4RN6A 1C2MA 2BHGA 2P3TB 4U30A 2FOMB 2V6NA 1O2TA 1TPOA 2G81E 2NU4E 5HIZA 4B73A 4I8JA 3EA9A 5EXLA 4OS1A 4KELA 1FY4A 2W6JD 1O5CB 2ZHEH 1WAYB 2HPPH 2ZWLH 5CHAC 1WSSH 3T29A 5FPYA 3TK5A 2AMDA 2FOHA 4CRFA 2PUQH 1SGFG 1GJ4H 1FX0B 4BXSA 3OYPA 5AHGH 2P16A 3HK6B 2P59A 3RXGA 1K2I1 1MBMA 1A2CH 3FN8A 1KXDA 3D49H 1T8MA 1GJ9B 2IOTA 2LELA 2XBVA 3A83A 1O33A 3SU4A 1C4V2 2RA3A 1H9HE 2ZA5A 3MQKC 4ISLA 2V0BA 1O3NA 2W3KA 2VWLA 2NU3E 1GBKA 3GDVA 2F9NA 3AASA 4JYTA 4A6LA 1HFDA 3SV6A 1UW7A 2G5VA 1K21H 2PLXA 3DT0H 3P8GA 3EDXB 1QRXA 2ZDVH 1H1BA 3SI3H 4IC6A 2JH0D 1DWBH 3GY3A 2GZ8A 2PFEA 1GBHA 4Y8YA 2HVXA 2FX4A 1OWJA 3SU6A 3MU1A 7KMEH 3PYHA 2FESH 1SGNE 5C5OA 4E7RG 2Z3EA 2AEIH 2Z9KA 3KEEA 1FN6A 1VR1H 4XOJA 4AYVB 3PM3A 1AWFH 4I8HA 4WJG2 4ZXYH 2RFKC 4NGAH 5JBCS 1H8IH 1KXBA 4I86A 5JBBS 4ABJA 2KCYA 2Z3DA 4FXGH 2QXIA 1Y5UT 5A09A 4B2AA 1P12E 1UVSH 2ANYA 2EC9H 2ZZUH 3QGNB 1O2PA 1QQ4A 4Y71A 3KQEA 2BXTH 1XKBC 3SQHE 2A4QA 4WY3A 1DUEA 3GY4A 2H9TH 1FY1A 4ABHA 2XW9A 4TPIZ 3ZZ3A 1C1NA 2D8WA 5DG6A 5A0AE 1ARCA 3ZZ5A 2ZG0H 1QJ1B 3A87A 1VGCB 1GVLA 4TY6A 4ACBA 1RXPA 1D3PB 1C1RA 3BSQA 4UFFH 3P6ZB 1A7SA 2G5NA 2PGBB 4MNWA 4ABGA 1P09A 1K1NA 4DG4A 1QURH 2SFAA 3ZZBA 1Q2WA 1RFNA 1O32A 1GHBG 2TGAA 3KQBA 4Y10E 1ESTA 1KLJH 1SQOA 4YT6H 1C1TA 1GBDA 3N99A 1GJ7B 4D9QA 1L1GA 1DFPA 2VIPA 2A4RA 1QRZA 2Z7FE 3RXHA 4FUGA 5EQRA 4JK6A 1P9UA 1D3TB 4NZLA 4AZ2B 5I25A 4TY7A 1MKWH 1UHBA 4LK4A 1W14U 4YZUA 1MKXK 2QF4A 3LGYA 4AOQA 3OU0A 5LH8A 4CBOA 1C5LH 3MU5A 4XSKU 4D76A 1W13U 2GGVB 5GCHG 1Z8GA 1DLEA 1UTPA 1WTHD 2F9BH 1GHBF 5HXFA 5DP9A 1MABB 1O3HA 1HAIH 1DY9A 1SLXB 3QK1A 4ACAA 3UR6A 1HJ8A 1TNHA 2KFWA 3I77A 3LGVA 3E1XB 3AK5A 4Z0KA 4NIYA 1GBTA 2CMYA 2ODQA 5GDSH 3BTME 1SGYE 1YM0A 2I6SA 1LMWB 1G32B 2HOBA 4NFFA 2BLVA 5SGAE 1VITG 1IQFA 5AFYH 3FOAA 2GCTB 1SLVB 2FXRA 5FX6A 1F0SA 3C1KA 5GCHF 3TJNA 2Y5FA 1V6DA 5C0TA 2PV9B 1SB1H 1V2WT 2ZNKH 5JBAS 1XX9A 2FI5E 3GY8A 2BYAX 3ENSB 1RJXB 2A7CA 1GL1A 1XUGA 1HCGA 3SN8A 1LKBA 3FP8E 2SGPE 1UK3A 3LIWA 2ZDNA 1TMBH 2A4OA 2O8UA 5E2PA 4IW4E 2ZPQA 5BPEA 3ZVCA 3ZZ4A 1AD8H 2ZU1A 3QUMP 1LQDB 1KMHB 1NROH 1AZ8A 1FJSA 1NU9A 2BMGB 1GCTB 2HNTF 3MH5A 3ZVDA 1RTKA 1ZYOA 3MI4A 3O8RA 1SOZA 4TYDA 4Q63A 1QB6A 3VFEA 1AQ7A 1VITF 2Q1JA 2HGTH 2JIZD 5A8YA 1A5HA 1FY3A 2KCAA 2FX6A 1DT2A 1EPTB 4AYYB 5LGOA 3QO6A 1TBRH 2BD7A 1GG6C 3OTJE 3A81A 5E8EH 4Q7YA 1HPGA 1TFXA 2C8XB 1BIOA 5T3HA 3KL6A 3UREA 1GBEA 1QNJA 4YO9A 3O8DA 3RXFA 1K1MA 2FOGA 4NFEA 5GIBA 3BTQE 4MPUA 1WXRA 1NC6A 4FUFA 2C4FH 2ANWA 4J2YB 1OKXA 3SUEA 4SGBE 4FUCA 3V13A 1ZPZA 1YBWA 2GMTB 2V7QD 3GY6A 1SBWA 1P03A 1OP8A 3UFAA 3LGWA 1PPBH 3OTPA 3PO1B 4K2YA 1GBMA 5LPFA 1O38A 1G3EA 2IPQX 1T8OA 1DICA 3U98H 2OQUA 4OGXA 1LVMA 1SGDE 2R0LA 2XRCA 6CHAC 3A80A 1ZSLA 5DO4H 4ZMAH 1TABE 1UTMA 1YLDA 5DP3A 1EAUA 3GOVB 3QGJA 4UE7H 3IITA 5IYTA 2F4LA 3E0NB 1HXFH 1SKYE 2FOFA 1G37A 2QF5A 3F9HA 2C8ZB 1O3DA 2VNTA 1AFEH 1FI8A 1BBRH 1V2JT 2ANMH 1YF4A 1TMUH 4CH2B 5A0BA 1P9SA 1S6HA 1F2SE 2A31A 3QLPH 1GMCG 2P8OC 1TNLA 4I32A 1HB0B 1BTWA 4GCHG 5C1YA 3M3SA 2FMJA 3PV5A 4AFUA 1K1LA 4NSYA 1BHXB 1HAVA 1GI0A 1SSXA 3ZZCA 5C5NA 3PMHB 5FBIA 1XUJA 1DITH 1CA0B 1D4PB 1YC0A 2J5UA 2LP6A 3M61U 3LC3A 2GTBA 1F92A 1O3BA 2BDYA 3ATKA 1CT0E 3SORA 2GDEH 2QV1A 3UAIC 4DOQA 4GCHF 4RT0A 1DWEH 3F6UH 1C5QA 3DHKH 1HAOH 1QJ6B 2A7JA 3HGPA 4UEHH 1ANBA 1FY8E 2RA0A 3GCOA 4OS6A 3Q3KA 1C1VH 2XYAA 1KY9A 2BVXH 4NIVA 2Q6GA 1LTOA 2OBQA 1O2IA 4KP0A 3LJOA 4ZKNU 2GP9B 3BEFB 2Z9IA 1V2NT 2ZU3A 4LZ4B 4DVAU 5C1XA 1RD3B 2NU1E 1S0QA 3RXVA 1FUJA 1W12U 1P2MA 4CBNA 3PV4A 1Z8IB 1BCUH 3OEHD 2W7SA 2QXGA 1DANH 3GYMA 1TX6A 4IMQA 4B6FA 1DXWA 3QN7A 2WV5A 3HKIB 4Y6DA 1O5BB 2FI4E 1TNIA 1GHWH 4UFEH 4INKA 1MBQA 1ZJKA 3NZIA 1OWKA 4INHA 5C0UA 1AO5A 2UUFB 1O2UA 3ESTA 1GI8B 1O2KA 2GV7A 1HRTH 1NESE 2FLRH 2ZHQH 5DJ7A 4OS7A 1CA8B 1TX7A 4WXIA 2VGCB 1QRWA 5HYOA 2J95A 1OP2A 1AIXH 1FZZA 1J15A 2Y82A 1ESAA 2AS9A 1CSOE 1KSNA 1ELTA 3ZZDA 1PPCE 1FV9A 1QGFA 4IN2A 1C5NH 3KIDU 3EE0B 2EQNA 1RIWB 3DFJA 2FYRA 5EW2H 1LQEA 3I78A 3KQ5A 3GISB 4R0IA 2BQWB 3F1SB 1JWTA 1EB1H 1BZXE 1HLTH 1C1WH 2IJOB 4RKOB 1J9CH 3DFLA 3D65E 7GCHF 4B1TA 3UQVA 5HIYA 1MTUA 1TPPA 4JCNA 1TPSA 1ELGA 1FLEE 3NXPA 2VB0A 4D9RA 5C1UA 1QCPA 2BB4A 2KR7A 3D62A 2BXUH 1MTVA 2CGAA 2AIPA 1O30A 1A0LA 4A1VA 1V2LT 1GMDG 1IAUA 2BOKA 3A7VA 3E8LA 3UNQA 1CHOG 1TGTA 2TIOA 1KLIH 1H8DH 3AVZA 3UUZA 1P2NA 2KCOA 1QIXB 2OC8A 1SLUB 1GJAB 5CE1A 3PLKA 1E38B 5FL7D 2FS9A 2AFQB 1Z71A 1UK4A 2W5EA 1GVZA 1YPLH 6LPRA 4YT7H 4IMZA 4ISIH 1CVWH 1EPTA 3W1EA 2Y81A 2TGDA 5L2YH 3SNEA 1T8NA 2ALPA 1OWEA 1WUNH 4INLA 2XC5A 5GWZA 1K1JA 4Y76A 3S7HB 4DJZB 1KTTB 3LKWA 2ZFPH 1FNIA 1O2XA 2OK5A 3SU0A 1GMDF 3A82A 1P2KA 1ZR0A 5FCKA 1BBRE 2DE9A 2GCTC 4ZROA 1CHOF 5F8ZA 2ZGXH 4Y7BA 2BX4A 4ISHH 2BD2A 3FO8D 5CMXH 3BTHE 2G00A 3JZ1B 3UY9A 3S7KB 3SJOA 1C5XB 1H4WA 1X7AC 3EGKH 1OP0A 4Q80A 3RXRA 3PTNA 3TNSA 3QTOH 3TGJE 2VIDA 1JMOH 4CHAB 1JOUB 2NU0E 5ETXA 5F8XA 3RXQA 1D6RA 4B6EA 1YKTA 3MNCA 2PP6A 1MZDA 1TNJA 1QFKH 3VB3A 3O8BA 1PFXC 3A7ZA 1FPHH 1CGIE 3D23A 4I8GA 5E0HA 1G3DA 1P06A 1TOCB 1S83A 1TGCA 3AW1A 4K1EA 2VIQA 4GPGA 3QDZB 3W94A 3CP7A 4O03A 4VGCB 1EPTC 3RMMH 5HKKD 2BD8A 2O8WA 1Y8TA 2YNAA 3FVFB 1P0SH 1BMMH 3BTEE 1ABIH 4NZQA 2OLGA 4OS5A 4HTCH 2WPJS 4X8UH 1AE8H 1P2IA 4JYVH 3SNCA 4ABEA 4M9FA 5F6MA 3M5LA 3BTGE 2KX4A 5E0JA 2ZCLP 4ZUHA 1LO6A 1TGNA 1E1QD 1TQ7B 4WMFA 2O9QA 2VVCA 2ZC9H 4XBBA 4UFDH 3UR9A 2GMTC 1SQTA 3TPIZ 3ZZ7A 2J97A 1B5GH 1G3CA 4UD9H 3PO1C 2BY8X 2XXLA 1O3KA 1CT4E 2EI7A 1A46H 4WH6A 5J4QA 1NM6A 1BMLA 2WPDD 3RMNH 4BTUB 2UWPA 1GI3A 1NBME 2W26A 1UCYK 5DP8A 5GNDA 3LH1A 2WHXA 1M9UA 3K6ZA 1A0HB 1A5GH 4AGJA 5B6OA 2BX3A 4X6MA 4K8YA 4FUBA 1S84A 2ZHFH 2GX4A 1SR5C 5TJXA 4KTCA 1EAXA 3E6PH 2ZPRA 2HWLB 1QA7A 2ZI2H 3ZVEA 4SGAE 5K0HA 4F49A 4TWYA 2FI3E 1LPZB 1YPHE 5IDKA 1BRCE 2OC1A 3DSPA 1LHFH 1OXGA 2PKSB 3MWIU 5EGMA 4X2XA 3GCHB 2A5AA 6GCHF 1C2JA 1CGJE 2PSYA 3UOPA 2WV4A 3WY8A 1FPCH 1UTQA 2Y7XA 3RUOA 2SGFE 2Y80A 3MHWU 1NPMA 1FDPA 3SO3A 1ETSH 4MPVA 3B23B 1AVXA 4LXBH 3GY7A 1C9PA 1ZZZA 2FS8A 3SU5A 2AERH 3QZQA 4X1RU 2VWOA 5F53A 3TH3H 1HAPH 1CA0C 2GZ7A 1AI8H 1GJ5H 3BTKE 1OWDA 2ZCKP 4Q4LA 2Z9GA 2ZFQH 3H7OA 5JYIA 3F3BA 3PMJA 1UTNA 4Q7XA 5EJZA 1Q3XA 3M7TA 1C4Y2 3JZ2B 2FZZA 1QBVH 1DDJA 3V0XA 1ZJDA 2NWNA 1BRAA 3SNDA 1Z6EA 2XCNA 2B8OH 3HPTB 1SMFE 3GS9A 2UUJB 3MYWA 7ESTE 1OX1A 3QX5H 2EEKA 1G2LA 1GBAA 3RMOH 3RXTA 1J8AA 5EJLA 5ESTE 2OC7A 1EQ9A 1ZLRA 2ZTZA 1MTNB 3H5CB 4ABIA 1E1RD 1UJ1A 3LGTA 1EZUC 1YCPH 1ZHRA 1ZTKA 1ZGVA 3MH6A 3V7TA 4NWKA 1ARBA 4KTSA 1MAYA 4O3UA 1QQUA 2O8MA 4BTTB 4MDSA 2SGAA 4HI3A 3HK3B 1GHZA 2VINA 2C3SA 2AHME 3RXCA 2AYWA 4WF8A 2JH6D 4H6TA 1LCYA 4I33A 1EUFA 2P3UB 3M5NA 2WV9A 3ZZ8A 4AG2A 2F9VA 1TMTH 4WH8A 3FP6E 3LGUA 1O3CA 3RXPA 2FLBH 5EOKA 4OGYA 3UNRA 1TNKA 4GUXA 3LH3A 5DKMA 1UO6A 1GHAG 3BTDE 3R3GB 4HG6A 1FAKH 2RCEA 2YNBA 2RG3A 2JETB 4KTUA 1O5GH 2PKAB 3CS0A 2BDAA 1UTKA 2P95A 1G36A 1O2LA 1MTSA 3M3TA 1O2YA 2J92A 4X1QU 1O3JA 4O9VA 2QYIA 3P8NA 2FO9A 3FAOA 2B5TB 4RI0A 4BANB 2BDGA 1QJ7B 4Z6AH 2VH6A 1PQ7A 1NO9H 2HNTE 8GCHG 3LGIA 2F3CE 2STAE 1RIWC 3DCLA 3SUDA 1TWXB 3VB5A 1P3CA 4K69A 1CHGA 2SGDE 4B2BA 3RLWH 2EA3A 5HMAA 3MU4A 3U69H 1ELVA 1O3PB 1MKWK 1GHAF 1NFUA 2ZHDA 4I31A 1W10U 2AH4X 1SFIA 1O5DH 1T7CA 4FUEA 1LPGB 1ZTLA 2UWOA 2XCFA 3E16B 3ZV8A 4AN7A 3SJKA 2QXJA 2AGGX 2OINA 3Q00A 4OS4A 1EATA 4FUJA 1NTPA 5JB9S 2CK3D 1AUJA 1BOQA 4RSPA 1ELCA 3F9FA 1DY8A 3ZYEA 3RXIA 1GI4A 1YCPM 3PMAB 3BG4B 1P02A 3GCNA 4OS2A 8GCHF 3M35A 3RXSA 2BDCA 5EG4A 3M5OA 1D3QB 2F83A 1TRNA 2GT8A 3P17H 1OS8A 1GDNA 4XRNA 3A8DA 1V2OT 5A8ZA 5T6DA 4Z1MD 5EODA 2J94A 2CHAB 1WQSA 3U1JB 1WDIA 4A7IB 3E91A 4WMDA 2ZDAH 2BDIA 5DP7A 3EA8A 1NN6A 4U32A 1O3MA 2TBSA 1EFRD 5ABWA 1H9LB 3PRBA 3KYGA 4AC9A 3GCTF 2FOEA 3H7TA 4JZEH 1G30B 3SOSA 1O5EH 2PTNA 4FVBA 3S9BA 4IBLH 3SUFA 2ZQ2A 1L1NA 4NA8A 1GGDB 5DN6D 2QGRA 3M7QA 1O36A 1GL0E 3DA9B 5C20A 3VB6A 1JIMA 5LPEA 3NCLA 4AORA 3T2NA 1NRRH 1VKYA 1HGTH 1PPGE 3ODDA 1C5YB 2BY9X 2XTTB 1ZPCA 2IN2A 3GY2A 1GPZA 3M37A 4X2VA 1DX5M 3CS7A 5EU8A 4FU7A 1WU1A 4CHAC 3TJUA 2OP9A 4AGKA 1MQ5A 2ZDMA 3ATLA 1D9IA 1ELEE 4ZKRU 5I46H 1YYY1 1T32A 2H5CA 3RLYH 1THPB 3NK8A 3KNXA 5JDUB 1HBTH 1S6FA 1P10A 1SGQE 3SYJA 8ESTE 2XNDD 2EY4C 1C5RA 1IQHA 1C1UH 5AFZH 4F48B 3A84A 1L0ZA 1NFWA 2IPHA 3TITA 2L74A 4DGJA 2K0QA 4F4OC 3A7YA 2JH5D 1P8VC 7LPRA 3DSOA 1UK2A 3T25A 1G9IE 1VCPA 1VJ9U 1N1LA 2BVSH 1KIGH 1RTFB 3K9XB 4NCYA 1PPZA 1O2RA 4IGDA 1DSTA 1NRSH 3KQCA 5CHAB 5FXLA 1FONA 1QL8A 4E06H 2FTMA 3RM0H 3MH7A 1BQYA 4R8TB 1E79D 2R2WU 3F2GA 4TPYA 1QBNA 3S69A 4FVDA 3TH2H 2D1JA 4A5TS 1BTHH 3GDUA 1C9TA 1J16A 1D3DB 2A2QH 3E3TA 3SGAE 1SGFA 3ZZ9A 3VB4A 1O2ZA 1GMHG 1DLKB 1C5MD 1O3AA 4HZHA 1SOTA 2QCYA 1T8LA 1KXAA 2PUXB 1O3LA 5PTPA 4XE4A 2XC0A 3LPRA 4DURA 1DM4B 1F5LA 2H2ZA 1YPJH 3SU2A 5GPIB 2HPQH 3PROA 1BBRK 1QL9A 3QWCH 4K3JA 2C8YB 2UUYA 1G2MA 1PQ5A 4RKJB 4B71A 1GBLA 1QA0A 2OBOA 3V12A 2G4TA 2B9LA 4WVPE 1ZHMA 1Z7KA 2H6MA 4OM9A 1EAIA 4ABFA 1TB6H 4AB9A 1ORFA 1NBMD 2R0KA 1GMHF 3WWBA 4UFGH 4HGCA 5FBEA 5LPRA 2ALVA 3V3MA 1A4WH 1F0TA 2PKSC 3Q3YA 1GHVH 4TSFD 9LPRA 1IQIA 1TRMA 1DWDH 1ABJH 3GCHC 2M5TA 2F9PA 1MQ6A 5FHTA 3RXJA 1ZMNA 2DE8A 1NRNH 2QC2A 2ZECA 3UWJH 4X2WA 4ZKSU 3ZVBA 3U8TH 1QTFA 2WPHS 1HJAB 1H9IE 1ANEA 1TYNA 1KXCA 3URCA 2UWLA 3OSYA 3U8OH 2SGEE 3ZZAA 3O8CA 1BJVA 1CBWB 2FM2A 2NU2E 2ZF0H 1DOJA 2PSXA 4K60A 3U28C 2KZ4A 1K1OA 3RC4A 1JRTA 1QHRB 1W7XH 2FP7B 2A0QB 1THRH 1NS3A 1V2VT 2VWMA 3BIUH 1O2MA 4MNXA 4MPXA 1LHEH 2LNCA 4UDWH 4MNYA 2PKAA 3N7EA 3NPSA 1L1JA 4ZXXH 4XBCA 2BZAA 1SI5H 1O3IA 2Z3CA 2XBWA 7GCHG 1B0FA 3S0NA 3VXFH 2FOAA 5AVDA 5T1VA 4X8TH 4K5ZA 3T28A 1YPHC 2F91A 4JK5A 2SGQE 4NIXA 3CNRA 3B8JA 1K1IA 1GJCB 1PYTD 4FOUC 2OTVA 4X6NA 1Y3YA 1HUTH 1MTNC 3GDSA 3FP7E 4DW2U 4CR9A 1W11U 1YLNA 3ZV9A
chains in the Genus database with same CATH topology
1EJMA 1VGCC 3R0FA 1AE5A 1HAYB 3SW2B 1O5AB 3AAVA 2EI8A 2PGQB 1EP6A 1F0RA 3TK6A 1O5FH 1IHTH 2HRVA 4YM9A 1W0ZU 3PLPA 1JBUH 2ESTE 3SI4H 1BTYA 2Z6BD 4X6PA 2Z9JA 3TGIE 3RXLA 1LVYA 1PYTC 3AAUA 2A32A 1EX3A 3S9CA 3FFGA 1P57B 1SGIB 4FUHA 2JETC 3F68H 1AB9B 1SHYA 3FZDA 3LT3A 2QIQA 3A8CA 3HKJB 2O8TA 4DIIH 5TCAA 1GWAA 3BEUA 3KF2A 1P04A 3BTFE 1OYTH 2VH0A 2R3YA 4U01A 1L4DA 1NZQH 3ATWA 1PPFE 1AY6H 4ZHLU 1XVOA 2R9PA 1BMNH 3SGQE 3GICB 3RXKA 1NY22 1KTSB 3DD2H 4I7YH 1IQGA 3HGNA 1FIZA 1HAGE 4GAWA 4ESTE 1XXDA 5F8TA 2ZIQH 3LJJA 1P2OA 2A45B 2PTCE 3RU4T 1QBOA 1OYQA 3RU4E 1O3EA 4O3TA 1E35B 1ANDA 2AGEX 3KHVA 1DXPA 1AU8A 1P2JA 1JXPA 2CF8H 2G4UA 3LC5A 3MU8A 3UIRA 1IOEA 3OX7U 5AF9H 3DUXH 3SJIA 1E34B 1Z1IA 1YGCH 2B7DH 1EAWA 3BG4C 1AKSB 5A0CA 2QAAA 2ZGJA 1SGEE 1S82A 2BDHA 3L33A 1AGJA 3VXEH 5HM2A 2AIQA 3A7TA 1ELDE 3OY6U 2ILNA 1HNEE 1O2QA 2GVFA 3VGCB 2CHAC 2HNTC 1P2QA 1ZGIA 2CXVA 1GCTC 2ZFRH 4FU8A 4KKDA 1FY5A 2BOHB 1XXFA 1Z6JH 2BVRH 1TE0A 1G3BA 1XKAC 1ZHPA 1VITH 3OY5U 1LDTT 4B2CA 1V2MT 5EW1H 1GDUA 4J1YA 2VWNA 3EYDA 1O2JA 2CJIA 1C5WB 2VU8E 1KXEA 2A1DB 1V2PT 2THFB 1ID5H 1WYKA 2WPIS 3SNAA 2ASUB 1A3BH 5T6GA 1GJ8B 5JB8S 6CHAB 2ZO3H 2GD4B 5EPYA 5FPSA 2J9NA 3URDA 1HAXB 3L6PA 1HAZB 1MCTA 2P94A 1O35A 3Q76A 1P3EA 1GVKB 1XUKA 3F9EA 3PTBA 4A1XA 4BAOB 4YTAA 4BAMB 3TU7H 4YLUA 4DY7B 4WWYA 1SGCA 1EOLA 1ETRH 1HAHH 5F03A 4WXVA 6GCHG 1SFQB 1Y5AT 1XUIA 5DP6A 1HDTH 3LONA 1F5KU 2ZCHP 1TX8A 2ZTXA 2FPZA 3NKKA 4CR5A 2P8OB 1AVGH 1SVPA 4M7GA 3RC6A 2DUCA 1C1SA 2BTCE 3RXOA 2OQ5A 4CRBA 1AFQB 3SJ9A 3TGKE 4MG3A 4ABAA 3MNSA 1Z8RA 1BITA 4X1PU 3MO9A 2AMPA 5FCRA 4BAKB 3NWUA 1GHYH 1T31A 4Y7AA 4JZFH 4QT8C 3T5FH 1GDQA 2STBE 1O3OA 1NFYA 2PWXA 2J38A 3KN2A 3UQOA 5EQQA 1B0EA 1O2HA 1QB9A 1UVTH 2CV3A 3ZVFA 4X2YA 2J4IA 3W95A 1IQMA 1FQ3A 1KDQB 2AGIX 5DP4A 1MCVA 3A88A 2XNIA 4CRDA 1YPKH 3N7OA 3SV2H 1PPEE 2ZQ1A 3SGBE 3BF6H 1O2VA 1YPGH 5C67A 3M36A 2QY0B 2ZU4A 1GI1A 3TJOA 1E37B 1C2FA 3RXDA 2FEQH 4PROA 1Y3WA 2ZEBA 3K65B 3ZZ6A 2QA9E 4XDEA 5K7RA 4XFQA 1IQJA 1GCDA 4X8VH 3M5MA 5BRRE 1PQ8A 2YOLA 3VEQB 1HAVB 1JRSA 1S0RA 5C2ZA 1K22H 1ZTJA 1LHDH 1V2ST 2GDDA 4Y0ZE 1HXEH 1K28D 1HIAB 3PMBB 1W8BH 2J34A 2QXHA 3C27B 1WV7H 1SPJA 2BQ6B 1S5SA 4GHTA 2A2XH 1HJAC 5DGJA 2A4GA 1O0DH 4CRGA 1B7XB 1MTWA 1UVPA 1GBFA 1CBWC 1QL7A 1TBQH 2W3IA 4X0WU 1ACBE 2G52A 2ZP0H 4ABBA 5JBTA 2R3UA 2J2UA 1XMNB 4E7NA 5FX5A 1SGTA 1C5UA 2Q6FA 1MD7A 3RXMA 1ELFA 1MKXH 2KAIB 1YCPK 4HFPB 1O2NA 2OC0A 3HATH 1TOMH 1WQVH 1C2GA 4BNRA 1SQAA 3P95A 1MU8B 2VGCC 4MLFB 3SNBA 2EI6A 4D7FA 1C1QA 1FXYA 4IC5A 1VCQA 3AW0A 1CU1A 1TRYA 3TLOA 3MU0A 4Y11E 1KYNA 3MFJA 3TIUA 3TNTA 4DIHH 1TQ0B 2Z9LA 2VIOA 1D6WA 1TNGA 4B76A 2ZGHA 3IG6B 1EZQA 4ZH8A 3SHAH 2ZTYA 1EP5A 1V3XA 3LDXH 5HM9A 2BM2A 1Z8JB 4IN1A 1IQKA 1GBCA 1DS2E 1C5ZB 1BTXA 3GY5A 5H4IB 1O31A 4GLYA 1O3GA 1T4UH 2G55A 1GJBB 3EQ0H 2OXSA 3E90B 5JPMH 1AKSA 2ANKH 3EA7A 3GCTG 4NSVA 3SQEE 3FANA 3STIA 1TONA 1AB9C 4LOYH 1TA2A 3IWMA 4GHQA 1W7GH 1AWHB 1Q31A 1TGSZ 1Y3XA 4WMEA 4NG9H 1WBGB 3BV9B 1DPOA 4Y8XA 2P93A 1UCYE 3MOCA 1Y59T 4AFZA 2CF9H 1LHCH 1P11E 4O97A 4Y8ZA 5G4BA 1TAWA 1Y3VA 3RDZA 4ZAEA 1UVOA 1GBJA 3ATMA 2FIRH 4JYUH 4XBDA 1AHTH 1YPEH 4CRCA 3UPEA 4LZ1H 2H1UA 2FWWA 5C3NA 3ZYDA 1UMAH 2XBXA 1AZZA 3RXEA 2VIVA 1U6QA 3KQDA 1ZSJA 3BN9A 3SU1A 2BY7X 3ODFA 2QF0A 1T4VH 3MNXA 2W7UA 2D2DA 2VIWA 2FOBA 3A8AA 1V2QT 2LPRA 1O3FA 2BD9A 4D8NA 1C5SA 1J17T 5FAHA 2GKVE 3RU4D 5DP5A 3Q3XA 2OD3B 1EKBB 2BD3A 1WCZA 2OUAA 1DVAH 2BLWA 2ZFFH 2AMQA 1N8OB 3MO3A 2CN0H 3RC5A 1SL3A 1C5OH 1TIOA 3VGCC 3B9FH 1FMGA 3BEIB 4NWLA 1MMJN 1ZRBA 1K1PA 1EASA 5DK1A 1V2TT 2WPLS 1TGBA 6ESTA 5J4SA 1Z1JA 4Y0YE 3A86A 4K1SA 2ZU2A 4JZIA 3STJA 4A1TA 2B0FA 1L4ZA 2Y5GA 1N6YA 3K2UA 4AFQA 1C2IA 4K8BA 4Q2KA 2K1QA 1IHSH 1XUHA 1RS0A 1C1MA 3PWBA 4VGCC 3U1IB 1ZSKA 4I8KA 2H9HA 1O2SA 2RDLA 2VJ1A 2ZFTA 3PB1E 2XWAA 3M3VA 4U2WA 1C2LA 2C8WB 1N6XA 3QZRA 4UONA 4TWWA 1DSUA 3PWCA 1MU6B 1CE5A 1IQNA 1ZMLA 2ZDLA 1A3EH 2BLOA 5A2MH 3A85A 1CO7E 1NFXA 1SGPE 1C5PA 4X1NU 2BLQA 1AUTC 3T26A 3MH4A 4JZ1A 4X1SU 4FUDA 4JZDH 2BQ7B 5HGGA 3SZNA 4YLQH 1KDQA 3UTUH 4BOHA 4CH8B 1NRQH 2I6QA 1QB1A 1C2HA 1YP9A 1C1OA 5DPAA 1IQEA 1C4U2 1YLCA 2O8LA 1A5IA 1INCA 2ODYB 3TH4H 1K9OE 1BTUA 2D26C 2TRMA 1OOKB 2GCHG 2HALA 1CT2E 1GI6A 1ZOMA 3ELAH 3G01A 1MAXA 1AMHA 1NT1A 2FTLE 4MTBA 1AN1E 1C1PA 1L2EA 1O2OA 5L30H 5EXNA 1SGRE 1VJAU 1BDAA 1WTGH 1GJDB 1C5TA 2TGTA 4ZKOU 1RGQA 1BJUA 3Q77A 2A7HA 1VCWA 1AFQC 1O2WA 3RXUA 1BHXF 1TA6A 1FAXA 4JMYA 3ATIA 4MNVA 1ELBA 4YESB 4DT7B 1BUIA 1BMAA 3BTTE 2PR3A 1EZSC 2F9UA 4ISNA 1HIAA 3ZVGA 2WYJA 2GCHF 3RP2A 1TPAE 4ABDA 1SLWB 2ODPA 3GYLB 2R2MB 5E0GA 2ZPSA 1P01A 2Y7ZA 4D7GA 4X8SH 2ZDKA 2WINI 3A7WA 1GMCF 1YPMH 3ITIA 3RXAA 5TCCA 4DCDA 5GXPA 4MPWA 1UTOA 2V3HH 3SV7A 1P05A 3VB7A 2XBYA 3SHCH 1ELAA 3T27A 5ESBA 3UNSA 1EJNA 1DUAA 1ESBA 4Y79A 2WUBA 3QTVH 9ESTA 1E0FD 1PQAA 2KAIA 1W0YH 5E2OA 2WYGA 1BT7A 1KXFA 1RRKA 1LPKB 3P8OA 3MTYA 2FYQA 4IS5A 4CRAA 3MO6A 4A92A 1S85A 1O37A 3BTWE 1FN8A 2BDBA 3SBKA 1CQQA 1BA8B 2WPKS 4ZHAA 2FDAA 3P92A 1ZMJA 4ZHMU 1Y3UA 4AX9H 3TK9A 1DWCH 4THNH 3U9AH 1CGHA 1C2EA 1Y5BT 4AFSA 1EZXC 1V2UT 4YOJA 2SNVA 1GI7B 1A1RA 4FUIA 2BD4A 1A0JA 3LOXA 1XM1A 1VZQH 1SHHB 5L6NH 4H42U 1OWIA 1GI9B 2BZ6H 1AVWA 1DE7H 5EQSA 2WUCA 1NRPH 4FU9A 2A5IA 1XVMA 3TJVA 2VVUA 4X6OA 8KME2 3SV8A 1QR3E 3E0PB 1KLTA 1UTLM 1BTZA 3BIVH 2FOCA 3A89A 1OWHA 1BRBE 3RM2H 1GI2A 3A7XA 4GVUA 4NA9H 2BD5A 2A5KA 3SV9A 3SU3A 2FODA 1LVOA 5FPTA 1C5VA 2BY5X 1SC8U 4NA7A 2TPIZ 2PW8H 2UUKB 1F5RA 1O34A 4MVNA 4BXWA 4YOIA 1GI5A 2XWBI 1HV7A 1OSSA 2OCVB 1W2KH 3PLBA 1E36B 1F7ZA 1C2KA 3BG8A 4B75A 1ANCA 2Q6DA 4CREA 2ZHWH 2G8TA 2ZKSA 3MMGA 3SJ8A 3P70B 1UHBB 1V2KT 1V2RT 2ZGCA 2Y6TA 1LVBA 3LU9B 3UOUA 1MUEB 2H9EH 2ZU5A 3L3TA 2HLCA 1O2GH 4BAHB 2QF3A 1XUFA 1F0UA 4ISOA 1A61H 2SNWA 4YOGA 5T6FA 1BTPA 2PHBA 3A8BA 1LKAA 5GJ4B 2F9OA 4B74A 2GV6A 1QY6A 1C2DA 5EPNA 3U8RH 1GG6B 3NUMA 1PPHE 1O39A 4MQAA 3SUGA 1NU7B 1LHGH 1MH0A 4KGAA 5EXMA 1GBBA 3S9AA 3VPKA 3P8FA 4E05H 2WPMS 2Y5HA 1TLDA 2ZGBH 3EAJA 1ETTH 3KCGH 2Z94A 3K6YA 3KGPA 3M7UA 2V35A 3TVJB 1GJ6A 4Q7ZA 2H5DA 1TBZH 2QN5T 1GGDC 4H4FA 2V3OH 2GZ9A 1ZPBA 1WOFA 1EOJA 1BB0B 3FZZA 2VVVA 4AB8A 1SG8B 4I8LA 4BAQB 4AG1A 1IQLA 1OPHB 1HYLA 1PJPA 1W3CA 1S81A 1J14A 3RXBA 2ZFSA 1GHXH 5A8XA 3MNBA 2GT7A 5L2ZH 1GBIA 4K1TA 8LPRA 1FIWA 1N8OC 2G51A 2C90B 2C93B 1JIRA 1BRUP 1TALA 3CENA 1UTJA 2P3FH 3F9GA 1THSH 2JKHA 3T62A 1EXFA 1EB2A 1UCYH 3UWIA 1RTLA 1ZRKA 1HJ9A 1MD8A 2BY6X 4GSOA 2ULLA 3I29A 3RMLH 4ASHA 1EJAA 2XC4A 4BTIB 2TGPZ 4NIWA 1MZAA 4H6SB 3ZVAA 1UVUH 4RN6A 1C2MA 2BHGA 2P3TB 4U30A 2FOMB 2V6NA 1O2TA 1TPOA 2G81E 2NU4E 4B73A 4I8JA 3EA9A 5EXLA 4OS1A 4KELA 1FY4A 1O5CB 2ZHEH 1WAYB 2HPPH 2ZWLH 5CHAC 1WSSH 3T29A 5FPYA 3TK5A 2AMDA 2FOHA 4CRFA 2PUQH 1SGFG 1GJ4H 4BXSA 3OYPA 5AHGH 2P16A 3HK6B 2P59A 3RXGA 1K2I1 1MBMA 1A2CH 1KXDA 3D49H 1T8MA 1GJ9B 2IOTA 2XBVA 3A83A 1O33A 3SU4A 1C4V2 2RA3A 1H9HE 2ZA5A 4ISLA 2V0BA 1O3NA 2W3KA 2VWLA 2NU3E 1GBKA 3GDVA 2F9NA 3AASA 4JYTA 4A6LA 1HFDA 3SV6A 2G5VA 1K21H 2PLXA 3DT0H 3P8GA 3EDXB 1QRXA 2ZDVH 1H1BA 3SI3H 4IC6A 2JH0D 1DWBH 3GY3A 2GZ8A 2PFEA 1GBHA 4Y8YA 2HVXA 2FX4A 1OWJA 3SU6A 3MU1A 7KMEH 3PYHA 2FESH 1SGNE 5C5OA 4E7RG 2Z3EA 2AEIH 2Z9KA 3KEEA 1FN6A 1VR1H 4XOJA 4AYVB 3PM3A 1AWFH 4I8HA 4WJG2 4ZXYH 4NGAH 5JBCS 1H8IH 1KXBA 5JBBS 4ABJA 2Z3DA 4FXGH 2QXIA 1Y5UT 5A09A 4B2AA 1P12E 1UVSH 2ANYA 2EC9H 2ZZUH 3QGNB 1O2PA 1QQ4A 4Y71A 3KQEA 2BXTH 1XKBC 3SQHE 2A4QA 4WY3A 1DUEA 3GY4A 2H9TH 1FY1A 4ABHA 2XW9A 4TPIZ 3ZZ3A 1C1NA 2D8WA 5DG6A 5A0AE 1ARCA 3ZZ5A 2ZG0H 1QJ1B 3A87A 1VGCB 1GVLA 4TY6A 1RXPA 1D3PB 1C1RA 3BSQA 4UFFH 3P6ZB 1A7SA 2G5NA 2PGBB 4MNWA 4ABGA 1P09A 1K1NA 4DG4A 1QURH 2SFAA 3ZZBA 1Q2WA 1RFNA 1O32A 1GHBG 2TGAA 3KQBA 4Y10E 1ESTA 1KLJH 1SQOA 4YT6H 1C1TA 1GBDA 1GJ7B 4D9QA 1L1GA 1DFPA 2VIPA 2A4RA 1QRZA 2Z7FE 3RXHA 4FUGA 5EQRA 4JK6A 1P9UA 1D3TB 4NZLA 4AZ2B 5I25A 4TY7A 1MKWH 1UHBA 4LK4A 1W14U 4YZUA 1MKXK 3LGYA 4AOQA 3OU0A 5LH8A 4CBOA 1C5LH 3MU5A 4XSKU 4D76A 1W13U 2GGVB 5GCHG