1AN1E

Leech-derived tryptase inhibitor/trypsin complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
222
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the complex of leech-derived tryptase inhibitor (LDTI) with trypsin and modeling of the LDTI-tryptase system.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (serine protease/inhibitor)
total genus 57
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1an1E02
1AWFH 1A2CH 3TJVA 4JK5A 5JB9S 1RXPA 2WYGA 4K1TA 3O8CA 1QJ6B 1HAYB 2ZI2H 2HOBA 1DITH 1GBJA 4Y7BA 3I78A 4IS5A 2BHGA 5A0AE 2ZQ1A 4Y8ZA 1DSUA 3FP6E 1ZJKA 2R2MB 5C2ZA 3SHAH 2A45B 5LH8A 1NPMA 3SO3A 1FIWA 4NCYA 1HB0B 1NTPA 2FOAA 3A83A 1WQSA 1GG6B 4KTCA 1ZPBA 4X2XA 1K1PA 4MDSA 1UCYK 2Y80A 3NXPA 4ABBA 1CBWB 1E36B 2XC4A 1AZZA 4GHTA 1ZMJA 3LDXH 3GYMA 1NU7B 1LVMA 1ESAA 2J4IA 2STAE 1HCGA 5E0HA 5L2YH 2G5NA 1DSTA 1HIAA 3RXEA 1T8NA 2BLVA 4BAQB 1IQIA 1GI4A 1ZHMA 5GIBA 1ZSLA 1BITA 4Q7YA 3EA9A 1FN8A 2HPPH 4B74A 1N8OC 4A6LA 1P11E 2VIDA 1Y8TA 3FZZA 4U01A 1DVAH 3MTYA 4F49A 2BY6X 1NU9A 3LC5A 2GKVE 3GY7A 1MZDA 4A5TS 4HI3A 2I6SA 1Z8IB 2V3OH 1OYTH 1XUFA 1BTXA 2FOFA 1V2TT 1INCA 1O38A 2QXJA 4DGJA 1F5RA 1P06A 1KY9A 2BY5X 2TGAA 4X8SH 4NGAH 5FPSA 3LC3A 1P12E 5C1XA 1PPCE 1CA8B 2FEQH 1TQ0B 8GCHF 2CMYA 1QQUA 1G3CA 2ZTYA 2B0FA 3BV9B 1AVXA 4BXSA 3TGJE 3EA7A 4ZHMU 2Z3EA 4NA9H 2AERH 1UK3A 1H1BA 2H9EH 2AGIX 4KGAA 4B2CA 4XBDA 4R8TB 4LXBH 4MVNA 4H6SB 1MTSA 1BHXF 2YOLA 4CH8B 4HZHA 2BQWB 1EZQA 1NM6A 1SFIA 3KQBA 1XUHA 1P2KA 3BG4C 3U8TH 3FAOA 4ZKOU 1ZMNA 1EP5A 1BB0B 3M7TA 1EPTB 3L6PA 4MLFB 4NSYA 2W7SA 1RIWB 2PHBA 1K1IA 1KXBA 1V2KT 2GMTC 1JBUH 2FESH 4K3JA 1F0TA 2XW9A 1QBOA 3ZVGA 1QFKH 4CRBA 1HJ8A 3ZZCA 4Y8XA 2J92A 1DWEH 3A8BA 5HYOA 2D8WA 3MNBA 1VCQA 1SSXA 3VB6A 1MQ6A 3GY4A 1O31A 2FYQA 2ZHFH 1QJ7B 4WMEA 3PWBA 1GHBF 3RXSA 2BY7X 4X2VA 4WJG2 3SUDA 3HKIB 1Y5UT 3D65E 4FVDA 1J15A 4NIWA 2ZFRH 1OWIA 4X6MA 2XBYA 3RXPA 1O2IA 3ZYDA 3S9AA 4XSKU 3LGUA 1GDQA 4CRCA 4UFFH 1AB9B 1PJPA 5JPMH 1O39A 3SNAA 4FUHA 4WWYA 3SUGA 1MKWK 1NY22 3V13A 4WY3A 2FI3E 2XRCA 4OS7A 1D4PB 1P57B 2J34A 3RXAA 3S9CA 4K8YA 1DY9A 1ID5H 2OCVB 1O30A 1GI5A 1AN1E 3RXTA 1P2JA 2VWOA 1FNIA 5PTPA 3SQHE 1HAIH 2BYAX 4ABEA 5A8ZA 3DT0H 1Z1JA 2OXSA 5AVDA 4BAKB 2YNBA 1TB6H 1BMNH 4NIYA 2HRVA 2VWLA 1YCPH 3SV6A 2B7DH 3RXRA 3OY5U 1UK2A 2ZHQH 1O3EA 4CBOA 1CQQA 1LKAA 2OC8A 3FFGA 1GVLA 1UVTH 2BDGA 1GCTC 3PTNA 4MTBA 1JRSA 2P3FH 3SJOA 1OWKA 1J8AA 4K2YA 4TPIZ 1SQOA 2ZGCA 3T2NA 3F9FA 2GCHG 3LU9B 2G5VA 1GJAB 2ZIQH 4GVUA 4LOYH 2FOHA 2EEKA 1MTUA 4ZKNU 1A3EH 4I8GA 4UONA 1HAZB 1O2KA 1XXDA 1SOTA 3QZQA 2A31A 1YF4A 5EPYA 2F9VA 2NWNA 4DT7B 1WAYB 3GDUA 1MD7A 4JZ1A 1TX7A 3SOSA 1BRBE 1O3IA 1GHVH 1AO5A 2BVXH 5EOKA 1PFXC 5FPTA 3PLPA 3KQEA 1FUJA 1TRYA 1D3PB 5A8XA 3MU5A 1FIZA 3M35A 2G4TA 1RD3B 1PPBH 2TBSA 2SGDE 1QL9A 2FO9A 1QHRB 2DE9A 4B71A 1MKXH 1GJ9B 1VITG 2ZPRA 3BTTE 2VJ1A 3UWIA 3BTDE 1FONA 5BPEA 4ABAA 1NFXA 1AHTH 3ATIA 3UWJH 1AKSB 2H9TH 2HNTF 3RU4D 3ZVAA 1OP8A 4RSPA 1C2DA 3F9EA 2XCNA 4QT8C 3U8RH 2Z9LA 5EXLA 1UVOA 1V2VT 5F8ZA 1BMMH 4WMDA 1ELGA 3LIWA 1MU8B 1GI0A 1ZJDA 1UO6A 2P94A 4FU8A 3GY2A 3BSQA 4FU7A 4WXIA 2CGAA 1TOCB 1FQ3A 2QN5T 3HGNA 1MUEB 1XUIA 1TA2A 4YTAA 1PYTC 1FY4A 3PMAB 4I31A 2BY9X 1FPHH 1XVMA 1C1QA 1KXFA 1GI3A 3B8JA 2V3HH 1LDTT 2F9OA 4YZUA 4CRGA 1OOKB 2OP9A 1Q2WA 2ALVA 2UUJB 2CF9H 2D2DA 2SGFE 3M3TA 3ATLA 5EQRA 1KYNA 3T62A 3TU7H 3RDZA 1DLEA 3VB3A 1NROH 2R0LA 2HGTH 3VB7A 2AMQA 1J14A 1ZR0A 2Z9JA 3LH1A 1ZSJA 1BUIA 1GDUA 1O5BB 1TABE 2BLWA 1GI6A 1O2XA 5TCAA 3MU0A 4ZH8A 1IQMA 1T8MA 1YPLH 1SGTA 2BX4A 4ISIH 1ZLRA 4LK4A 3A8AA 1TRNA 3A7ZA 3QTOH 4ABHA 2B9LA 1GVZA 1X7AC 1XX9A 1VGCB 1H4WA 3P8FA 4LZ4B 2BDAA 3M61U 1TE0A 1TGBA 2AMPA 1V2ST 2VGCC 1D3QB 1VITF 1C5UA 3PWCA 1ANEA 1UCYH 3UNRA 1F92A 1ETTH 2TGTA 2ZQ2A 3P8OA 2A7CA 3M7QA 2SGEE 4YOGA 1TPPA 3BG4B 4MNXA 4DW2U 1LVYA 4NA8A 1Z1IA 1F0RA 1WBGB 3ZYEA 1SGPE 3VB4A 2ZGJA 4GCHG 1RRKA 3QK1A 4OS5A 3P8NA 5DP6A 2PSXA 1NO9H 2GMTB 2C8ZB 2QC2A 1DWDH 4FVBA 1A1RA 3NPSA 1MZAA 4NSVA 2ZU4A 3TVJB 1O2WA 4A1TA 1IQJA 2W26A 2ZDNA 4JYTA 4BAMB 1O3DA 2RA0A 1NS3A 4IN2A 3MFJA 1UHBB 1HAVB 1LHCH 1GGDC 2C4FH 2FMJA 3PLKA 1PPHE 3SU5A 3SV7A 1NZQH 4RKJB 1DANH 5C5NA 1KXAA 3MI4A 1TNKA 2F9PA 2P59A 1CHGA 4BAOB 1TOMH 5JBCS 1NRNH 3MNXA 1A61H 1K1OA 2ZEBA 1ZMLA 4THNH 5LGOA 2FIRH 3E1XB 1Y3WA 3V12A 1OKXA 1QURH 1L4ZA 1KLJH 4YLUA 2BY8X 1RIWC 1DPOA 1HV7A 1P02A 2OD3B 1FJSA 1H8IH 1SLUB 5T6FA 5L6NH 3ZZBA 1K22H 5T6DA 1SLVB 2ZECA 5A09A 4IMQA 2C8WB 1S85A 5AF9H 2XC0A 3TNSA 1GCDA 2AEIH 1IQKA 2M5TA 2PV9B 2STBE 2D1JA 1ELVA 1THSH 2VWMA 1EP6A 4GSOA 1LMWB 4UFGH 1TFXA 3AW1A 2LNCA 4Y7AA 4FUFA 1C9TA 1BTZA 1QIXB 3K9XB 3UIRA 4I8JA 4U2WA 1IAUA 2CXVA 2BX3A 1V2WT 1XUGA 1GCTB 3K2UA 4OGYA 5E2OA 3OU0A 2WPLS 1NRPH 3U69H 2H9HA 4GCHF 1C1VH 5TJXA 1P2MA 1LKBA 1LPGB 1GMCG 1P2QA 2BLQA 2PFEA 3SJ9A 3A7VA 3QZRA 4WH8A 3RMNH 2QF3A 1IQNA 3SORA 4SGBE 6GCHG 1DOJA 1H8DH 2ZC9H 1EATA 1AU8A 4CBNA 1GBAA 3M3SA 1T7CA 3VFEA 4WXVA 1GMHF 2A5KA 1LPKB 1GMDG 1O2QA 1WQVH 1YC0A 4GHQA 1NESE 1KDQA 1WOFA 2PGBB 4Q2KA 3RXQA 2PLXA 4I7YH 3E8LA 1GBMA 1HUTH 2XCFA 1RJXB 4ZHAA 4ESTE 1SLWB 3RXBA 1W0YH 5E8EH 5J4QA 4AFQA 1AUTC 1QA0A 5IYTA 5DG6A 1ESTA 2WINI 1C5LH 3BTHE 4K60A 2SFAA 4E05H 4D9RA 4CRAA 5JB8S 4KKDA 1O0DH 5B6OA 2G55A 3GDSA 2A7JA 1THRH 1O5GH 1S0RA 1OWHA 3SU3A 1GBIA 1FXYA 2Z6BD 3HGPA 1N6XA 4JMYA 1Z8JB 3SU1A 1OS8A 1UJ1A 2IPHA 2ZU2A 4AB9A 4DIIH 1N1LA 1XUKA 2ASUB 5DKMA 2JKHA 2UUYA 3DD2H 1C1SA 4AGJA 5F8XA 2XTTB 5FCKA 4ZMAH 3A7XA 4ZUHA 4GPGA 2W5EA 2FS8A 2H2ZA 1Y3YA 1DWBH 1BBRK 1V3XA 1RS0A 2ODYB 2ZNKH 2G00A 3Q77A 4YM9A 4XBBA 1ORFA 3A8DA 4XE4A 1Y3UA 2ZWLH 1A46H 2KAIB 1NN6A 3GCTG 1K28D 1OP2A 2P16A 4Y10E 2V0BA 2A4GA 1UTQA 2GTBA 3IWMA 1YLCA 1C5TA 3V3MA 4X8VH 2GVFA 1DLKB 2FWWA 4Y79A 1VJAU 4O3TA 1ACBE 1C1OA 2ZFTA 4BTTB 1L1JA 4IC6A 2ZFSA 1AWHB 1Z8GA 3RXUA 6GCHF 2Q6GA 3ZZAA 5ETXA 3RMMH 2XNIA 3M3VA 1FDPA 3A8CA 1LTOA 2BLOA 1CU1A 1P05A 2G81E 1NRSH 2GX4A 3K65B 1C4V2 8LPRA 2OLGA 3H7OA 3RC5A 4X6NA 3CENA 3M5OA 5EQQA 1AFQC 1GBKA 3GOVB 3HK6B 5C3NA 2ANKH 3GCHB 3A82A 1B7XB 1PPGE 2Z9IA 1MTWA 2XXLA 1TONA 1SGCA 2F9BH 2O8LA 3N7OA 3UTUH 4AZ2B 3A7WA 1ELBA 3FANA 1GVKB 2Q6DA 2IOTA 2VGCB 1C5YB 4UFDH 4IC5A 4TYDA 1F5LA 4HGCA 3SZNA 2AGGX 3SI4H 2OBOA 3U1IB 3UNSA 1QB9A 2YNAA 3Q3XA 3F1SB 3D23A 1PPEE 2VH6A 4X1SU 4K5ZA 1JRTA 1V2LT 2BDCA 1DX5M 3FVFB 3MWIU 3RMLH 4CR9A 1UVPA 3ZVFA 2EA3A 4UE7H 4AG1A 3SJ8A 4CREA 1WSSH 2W3IA 1ZRKA 2WV5A 1EZXC 4AOQA 1AVWA 2EI8A 1VGCC 1C2GA 3RXLA 8ESTE 4INHA 3TH3H 3SW2B 1GGDB 4AN7A 3L3TA 3TK6A 3IITA 4WMFA 4GLYA 2VIWA 1EASA 4AX9H 1SMFE 3K6YA 5GPIB 1Z6EA 9ESTA 3DHKH 5EXNA 4X2YA 1P3EA 3S0NA 5DP8A 2VIVA 1O5AB 1O37A 1ZYOA 1YCPM 1V2OT 4ZAEA 4DCDA 1GHWH 4X6PA 2GZ7A 2AIPA 1VZQH 1IQFA 1ELCA 5FCRA 4UD9H 3QO6A 2CHAC 1C5XB 3LJOA 1QA7A 3BTEE 1DDJA 1UTNA 2RG3A 4YT7H 1A5GH 4D8NA 5A2MH 5LPRA 3TJNA 1TALA 4B75A 3QLPH 1HIAB 2UWOA 3M5MA 1EAWA 5DK1A 5HGGA 2C90B 1EX3A 1CVWH 2OQUA 2FTLE 4DIHH 3SJKA 1ETRH 3BTGE 2PKAA 3Q3KA 1CO7E 2G51A 1ELTA 2FYRA 4X2WA 2VVCA 4MNYA 2HVXA 3JZ2B 3U9AH 1CE5A 3ENSB 3P17H 4BNRA 3TK9A 4JYVH 1QNJA 1QBNA 1Y5BT 2OBQA 2XYAA 3ZZ8A 1CGIE 3TGKE 3MNCA 2XBXA 5FPYA 3NUMA 2V35A 3RM0H 2XBWA 1BBRE 1GHZA 1BZXE 1S5SA 2R3YA 4D9QA 1HPGA 1TPOA 3KGPA 1KXCA 1P2NA 3SQEE 4Q7ZA 3OYPA 2BD8A 3U8OH 1FV9A 3KQDA 2FOBA 3C1KA 4NIXA 4X6OA 1QY6A 1PQ5A 4TY6A 1C2IA 4F4OC 1C4U2 2Y5GA 3TLOA 1GJ5H 1HRTH 3SGBE 1W8BH 3F6UH 1AKSA 1G30B 2SNWA 5HMAA 1GL0E 4X1NU 3LPRA 5L2ZH 1O3GA 2ZG0H 1RTKA 1YPJH 3ZZ3A 2C93B 4IGDA 3KHVA 5HM9A 2A4QA 2Z9KA 1O2ZA 5EG4A 1GI2A 1M9UA 4JZIA 1TBQH 2FXRA 3U98H 1EAUA 2XWBI 3RXIA 2B8OH 1EXFA 1NRRH 1C5VA 1SQAA 3RXHA 4O3UA 3A89A 1B0FA 3OTJE 1TNLA 1Z8RA 3P6ZB 3ODDA 1TGCA 3TK5A 2ZTZA 1C1MA 3TITA 4KP0A 1TA6A 2ZU3A 3P95A 3ZVEA 3L33A 1THPB 3B9FH 1MCVA 4DURA 1HFDA 1YBWA 1G3DA 2HPQH 4Z6AH 3ESTA 1E35B 1GBEA 4CR5A 3MHWU 7KMEH 3RXKA 2PW8H 1KXDA 3ZVCA 5FX5A 1E37B 2Y81A 3EQ0H 1TNIA 2QY0B 4BOHA 5CE1A 1TIOA 1BA8B 3LJJA 1PPFE 3CP7A 1VCPA 3SNEA 1TNHA 1O2TA 3T28A 1ZGIA 2NU1E 3UOUA 3SNDA 2ANMH 2WYJA 4E7RG 1NFWA 2O9QA 2BZ6H 5BRRE 4AFUA 2J38A 3GY5A 1EJNA 3BTME 1QB6A 1CGJE 1KIGH 3LGVA 4XFQA 1BRAA 2J2UA 1UVSH 1MTVA 1L1NA 4FUJA 2VB0A 1W10U 4MPXA 1YPGH 2FX4A 1C5MD 1JIMA 1C5SA 1O2OA 2QCYA 1F7ZA 1AFQB 1WTHD 4Q7XA 3PMBB 2BD7A 2OUAA 5DP5A 2OC1A 2TRMA 4J2YB 3STJA 3VPKA 3MU1A 3PB1E 3KN2A 1O3OA 4MNWA 5CMXH 1Z6JH 2ZHEH 1EOLA 3BEUA 2ANYA 5GWZA 2GCHF 1C5ZB 3UPEA 1UK4A 1NFUA 2TGDA 4JZEH 5DP9A 3EA8A 5EODA 3HATH 4Y76A 2NU0E 1LHGH 3LGTA 3SNBA 4MNVA 2BD3A 1SGIB 2DUCA 1H9HE 1J17T 1SHYA 2BD2A 2FS9A 2VWNA 4ABFA 3OX7U 1LVOA 4XDEA 1V6DA 2ZO3H 1P03A 5DJ7A 1MBQA 1O3AA 4K1SA 1ANDA 1SC8U 4MQAA 1HAVA 3RXCA 4FXGH 1LHEH 3A84A 1C1PA 3GCHC 3PLBA 3TPIZ 3PMHB 3S7KB 4D7GA 1VR1H 1SBWA 2GT7A 2QA9E 1AFEH 3MNSA 1E34B 5AFZH 1ARBA 1O2JA 1V2MT 1SGFA 4IMZA 1PYTD 3SU6A 1O3HA 3STIA 4B73A 2ZDLA 3UOPA 2VIOA 1BTWA 2JH5D 1EUFA 2HLCA 1TNGA 1TGTA 1AQ7A 2BDHA 3FP7E 2F9NA 1L2EA 3BTKE 2P3UB 5F8TA 1A5IA 4MPVA 3F9GA 2Y6TA 3GY3A 2PGQB 1C1UH 1JXPA 1JIRA 4H6TA 4U32A 3E3TA 2O8UA 4TWYA 3RXJA 7LPRA 2AIQA 3LGYA 2QYIA 3E16B 1MCTA 4Q80A 1A5HA 3DFLA 3SV2H 1ANBA 1GBLA 1WV7H 4NZQA 3V0XA 2CHAB 2SGPE 4K1EA 3TH4H 4PROA 1DXPA 3Q76A 3RM2H 1T4UH 1VITH 1BTUA 1O2NA 1O3KA 4O03A 3RLYH 5GXPA 1O2YA 1B0EA 5EU8A 1HLTH 3ZVBA 1LHFH 2Z3DA 1ZTKA 3AAUA 1HXEH 1BMAA 3HKJB 1GBCA 1QBVH 1ZTLA 4ZHLU 2Y7ZA 3VGCB 3QN7A 2XC5A 1W2KH 1ELAA 2O8WA 3RU4T 5EPNA 4X1PU 3A88A 1FI8A 1XXFA 2FOMB 1O3FA 2WUBA 3NCLA 1O32A 1C2KA 3EAJA 2QXIA 3URDA 2JH6D 1V2JT 3NKKA 4CHAC 1GJBB 4INLA 1BT7A 1HXFH 3AW0A 2Q6FA 1O2HA 4ABJA 1G36A 4DJZB 4E7NA 6CHAC 2O8TA 2VIPA 4JZDH 1FY5A 4OS4A 5FBEA 4K69A 1P10A 2H5DA 2A2XH 1XVOA 1JMOH 1TBRH 1BTYA 1MQ5A 1FZZA 3F68H 1D6RA 3T29A 3BTWE 5L30H 4WH6A 1O3BA 2FOGA 3PM3A 1VJ9U 1CT0E 1K9OE 1P04A 4X1RU 1D3TB 1YCPK 3Q3YA 2OTVA 1O2LA 5DP3A 3RXMA 1HDTH 1WUNH 2W7UA 5C20A 4AB8A 3TIUA 2ESTE 4FUBA 1YM0A 2RCEA 3MH5A 4H4FA 2WPJS 4FUDA 1DUAA 5T3HA 1QTFA 3A87A 3ODFA 3ZZ7A 1W12U 3KL6A 1F5KU 1AMHA 1O3NA 1OYQA 1UTJA 2ZPSA 3M5NA 4ABIA 3S7HB 3H5CB 3SI3H 3UQVA 3SGAE 2QIQA 1TWXB 1OPHB 1TBZH 1WU1A 1O34A 2PSYA 4I33A 3P92A 4NWLA 7GCHG 3SJIA 3RXOA 2H1UA 1YPMH 2WPKS 1ARCA 5E0GA 3ZZ4A 1DUEA 3R3GB 1KSNA 2Z3CA 1MKWH 5FHTA 1Q3XA 3RC4A 1GHYH 2BVSH 4Y0YE 4AORA 5A0CA 1C1WH 3GISB 3OY6U 1O3LA 3QDZB 3LH3A 8KME2 5C67A 3LT3A 1ESBA 2BQ7B 1A7SA 2R3UA 1IHSH 5EQSA 1AI8H 5JBAS 1GBDA 3FZDA 5E0JA 1SI5H 3K6ZA 1IQEA 5JYIA 1ABIH 4YOJA 4HFPB 5ESTE 1HJ9A 1HJAC 5J4SA 2Y7XA 3AAVA 3UFAA 3U1JB 3T25A 3UNQA 2RDLA 1MKXK 3O8DA 1ZPCA 2AGEX 1PQAA 2BD4A 3URCA 1S6FA 1XMNB 2ZU5A 1C2EA 2VINA 5JBTA 4YLQH 1IOEA 1NT1A 3QX5H 4OS6A 2CJIA 3MH7A 3SU0A 4B2BA 2FPZA 1C5NH 3S9BA 1PQ8A 1G3EA 4KTUA 3VEQB 2FOCA 2A0QB 1GPZA 5GJ4B 1Z71A 3H7TA 1CGHA 1GBFA 2THFB 2DE8A 1E38B 5EW1H 1CA0C 4ISOA 5ABWA 5C1UA 1J9CH 2XWAA 3T27A 1MD8A 2NU3E 2GV7A 2C3SA 4UDWH 1GL1A 1GMCF 1ABJH 1UTLM 3MU8A 1QGFA 2PKSC 4NWKA 3V7TA 2ZHWH 5C1YA 4FUEA 1DICA 1TMBH 4A1VA 1QCPA 2BZAA 5AHGH 1KDQB 1O2PA 1SVPA 1SR5C 1GMDF 1IHTH 1V2UT 1C1TA 1UVUH 1O5FH 1V2RT 3A7YA 1LO6A 3RP2A 2UUKB 3A80A 4NA7A 3SU2A 3M7UA 1BIOA 2ZDVH 5K7RA 4AYVB 1FMGA 2H5CA 5DPAA 4AYYB 2LPRA 2BQ6B 2FTMA 4Y11E 1OWJA 4XBCA 3NWUA 4I8LA 3Q00A 1P3CA 3GY6A 3EE0B 1EPTA 1BJUA 1ZPZA 3MH6A 5TCCA 5LPFA 2BDBA 1HAPH 3I77A 1ZHRA 2QF0A 3TH2H 2OC7A 2P8OC 4NIVA 4YO9A 1GI9B 1H9IE 1UTMA 3VXFH 2ZDKA 4D7FA 2GD4B 4ZKRU 1GHBG 1FN6A 1NFYA 2BD5A 1GJ7B 2UWPA 2PTNA 4JK6A 1G2MA 1TX6A 2A7HA 1LPZB 2ANWA 4D76A 2VVUA 4M7GA 3GCTF 5K0HA 4JYUH 1MMJN 1TRMA 2F9UA 2FP7B 4E06H 3BTFE 2P95A 1OWDA 3R0FA 5GDSH 4B2AA 1TGNA 2AYWA 1QR3E 4NG9H 1DXWA 2EI6A 1W7XH 1U6QA 2IJOB 2AFQB 3AASA 4RN6A 1GJ4H 3ZZ5A 2BVRH 1GJ6A 2ZZUH 4MG3A 2WUCA 2P3TB 5H4IB 2TPIZ 1BDAA 1W13U 1AVGH 1GHAG 1W3CA 1AE8H 1XUJA 3ZZDA 1A3BH 1CSOE 4CRDA 3RXVA 2F83A 5FAHA 1FLEE 1L0ZA 3MOCA 4CHAB 2ZU1A 1DFPA 1AUJA 1RTFB 4X8TH 3BIVH 4Y71A 6CHAB 1SB1H 3VB5A 4ISHH 4FU9A 1C5PA 5HXFA 1YGCH 3MYWA 1FPCH 2OINA 2CN0H 2SNVA 1ELFA 2RA3A 1ZRBA 3KIDU 2HNTC 1S0QA 1K1NA 1TMUH 2ZCLP 1Y3VA 3WY8A 5F6MA 3A86A 2BM2A 2BMGB 2W3KA 3BF6H 1C1NA 2ZFPH 1DS2E 1SL3A 1DE7H 3VGCC 2EC9H 3UQOA 1AE5A 3O8RA 1GBHA 1EAIA 3LGIA 2ZGBH 3SHCH 1EOJA 1K1LA 4DG4A 4IW4E 1O3PB 2ODQA 1F2SE 2ZGXH 3LKWA 3ITIA 1NRQH 2C8XB 1ZTJA 1BQYA 4AG2A 1UMAH 2H6MA 4DVAU 2AH4X 4UFEH 1ELEE 1S84A 3PV4A 1YLDA 4A92A 1YPHC 2NU4E 2CF8H 3ZZ6A 1S82A 3DA9B 4VGCC 4YOIA 3SN8A 1BMLA 1FAKH 3RXGA 4X0WU 1A0JA 1C2HA 1W11U 1DWCH 4RKOB 4I8HA 3GDVA 1MTNC 5ESBA 3QTVH 3M5LA 3PTBA 5LPEA 3GCNA 3PYHA 6LPRA 1DY8A 1V2QT 2HNTE 2ZDMA 3LGWA 3E0PB 3LOXA 4LZ1H 1FAXA 3M36A 1C2MA 4OS1A 1GHAF 1Y3XA 1Y5AT 1KLIH 1YP9A 1O2GH 2ZFFH 5EXMA 3HK3B 3C27B 3B23B 4TPYA 5EGMA 1L1GA 2JETC 1HJAB 1AIXH 1DM4B 4YESB 3ZVDA 1P9UA 1TMTH 1QB1A 2VU8E 1JWTA 1SG8B 1BHXB 1OWEA 3T26A 3UR9A 3DFJA 2ALPA 2FLBH 1G32B 1YPHE 1KTTB 1D9IA 3JZ1B 1K21H 1GI7B 1QJ1B 1RTLA 2PKAB 1HAOH 1BRCE 1QQ4A 2NU2E 1SGFG 4TY7A 3SU4A 1LQDB 1VCWA 4ZXXH 5JBBS 2EI7A 4A1XA 1Y59T 2VVVA 1G37A 1O3CA 2JH0D 1HAXB 5FBIA 1C4Y2 1LQEA 1AY6H 2PUXB 2PTCE 2BXTH 3QUMP 1GDNA 2P93A 1CA0B 1UCYE 1T8OA 2FZZA 1DT2A 1EZUC 2BDYA 1EJAA 1W0ZU 4ISLA 2D26C 2Z7FE 2BB4A 5CHAB 3BG8A 5F03A 2PKSB 4MPUA 1UTPA 1O36A 1BCUH 1GJ8B 2GDEH 3QGNB 2F3CE 2ZPQA 3SV8A 3UREA 2GV6A 2UUFB 1QL7A 5DP4A 5A8YA 3A7TA 1S83A 2BDIA 2GCTB 3AVZA 3SBKA 2BOKA 2A32A 3O8BA 2FI4E 3UUZA 1SGQE 1FY8E 2J94A 1TLDA 1RFNA 2ZKSA 3MO3A 5G4BA 2ZFQH 2A4OA 3D62A 1GBBA 1FY1A 1TQ7B 3TGIE 1SGNE 3GY8A 3OSYA 4JZFH 4ZROA 3M37A 1B5GH 2Y5FA 1BBRH 4GAWA 1MAYA 1SHHB 5JDUB 2WPMS 2FODA 3BN9A 4IN1A 1O2RA 1GI8B 2AS9A 3SUFA 1WCZA 1E0FD 2WPHS 4ZXYH 2Q1JA 1ANCA 4AFSA 1W14U 3RU4E 2BOHB 2I6QA 4BANB 4B76A 5T6GA 7ESTE 2VNTA 1XM1A 4ABGA 1SGYE 1PQ7A 1PPZA 4FUIA 5E2PA 1MH0A 4K8BA 3ZV9A 3W94A 1JOUB 2P8OB 2ZF0H 3RXFA 1CT2E 4INKA 5A0BA 1MU6B 4BAHB 1BJVA 1OXGA 1HGTH 1YKTA 3PO1C 1P9SA 2C8YB 4AGKA 1OX1A 2BXUH 1UHBA 4NZLA 4TWWA 1BOQA 1P2OA 1N8OB 2AMDA 4KTSA 6ESTA 2VH0A 3IG6B 2OC0A 2ZGHA 4GUXA 2UWLA 2HWLB 3A81A 4Y6DA 2QV1A 1XKBC 5SGAE 3KQCA 1V2NT 5I46H 1WYKA 1O33A 2GZ9A 1HAGE 2QGRA 1ZGVA 2CV3A 1EB1H 2ZCHP 4OS2A 2PR3A 3RUOA 2BTCE 4CRFA 1GG6C 3ATWA 1S81A 2GP9B 1G2LA 4Z0KA 4BXWA 3RXDA 1AZ8A 1CBWC 1HBTH 3TJUA 1LVBA 1C1RA 4O9VA 2F91A 3EDXB 5GCHG 2ZHDA 3ATKA 2J95A 1OSSA 1A0HB 4NFEA 1EJMA 2A1DB 1GI1A 2Y82A 1EZSC 1O5EH 3TNTA 5IDKA 2WPIS 2GT8A 1KLTA 5DGJA 1O2MA 1YYY1 3P70B 1YPKH 3SGQE 4H42U 1RGQA 2A2QH 4NFFA 1LHDH 1A0LA 1O3MA 1G3BA 1O5DH 2V6NA 2ODPA 5I25A 1K1MA 2BD9A 1P2IA 9LPRA 2R0KA 1SOZA 3MU4A 3D49H 2ZA5A 3KF2A 4ABDA 1C2FA 1D3DB 1F0UA 1UTKA 1GMHG 2FI5E 2GZ8A 4U30A 5FXLA 3W95A 4DOQA 3GCOA 1ZOMA 5DO4H 1G9IE 2FLRH 5FX6A 1L4DA 1IQGA 1EQ9A 1F0SA 4FUGA 1GJDB 3S69A 2QXHA 4WF8A 1AGJA 3E91A 3RLWH 4VGCB 1C5RA 3MO6A 2R9PA 1TX8A 4X1QU 3E90B 2QXGA 2FDAA 1C2LA 1SLXB 1C9PA 1EPTC 1TPAE 1QRXA 4I32A 1EKBB 2FOEA 1BTHH 2FX6A 2XBVA 1S6HA 1MTNB 2SGAA 1GBTA 1O2UA 1CHOG 1H9LB 1TGSZ 2FM2A 3GYLB 1O5CB 5AFYH 3PMJA 4JCNA 1SGEE 1AD8H 3RMOH 2TGPZ 2HALA 4R0IA 1CT4E 1BTPA 2SGQE 1P0SH 5GCHF 2TIOA 3TJOA 5DP7A 1ETSH 3BIUH 1T31A 2A5AA 1OP0A 3P8GA 2JETB 3F9HA 4YT6H 1GWAA 3SUEA 1MBMA 4Y0ZE 4B1TA 2QAAA 1SPJA 2PUQH 3MMGA 3T5FH 2KAIA 1TYNA 1T4VH 3E6PH 1LCYA 1BRUP 1FY3A 5C5OA 3ZZ9A 1T32A 1EB2A 4WVPE 1AB9C 1IQLA 1C5QA 1ZHPA 4BTUB 1C5OH 2ILNA 1GJCB 3EGKH 1GHXH 3RC6A 4ASHA 1O35A 2A4RA 4SGAE 1MAXA 1K1JA 3UR6A 1IQHA 3KNXA 1A4WH 1O2SA 1O3JA 1Z7KA 5HM2A 1V2PT 3ATMA 2PWXA 2WV4A 3NZIA 2ZCKP 2ZTXA 2VIQA 1KTSB 4Y8YA 1YPEH 4ZKSU 1XKAC 1SGRE 1ZZZA 1HNEE 1ZSKA 2Y5HA 1C2JA 3G01A 4BTIB 1SQTA 1P8VC 4I8KA 4MPWA 4XOJA 1W7GH 1TAWA 3A85A 3BEFB 4J1YA 3NK8A 5EW2H 1QL8A 3DUXH 4KELA 2ZP0H 2A5IA 3FP8E 1NC6A 2IN2A 4DY7B 3SV9A 3VXEH 3ELAH 2Z94A 4FUCA 2ULLA 3UY9A 4X8UH 3BEIB 1EAXA 3GICB 2B5TB 1TPSA 3CS0A 4A7IB 1K2I1 1CHOF 4AFZA 1TNJA 1N6YA 2GDDA 2G4UA 4ISNA 1C5WB 3KCGH 3CS7A 2O8MA 1QRWA 3SNCA 2Z9GA 3MO9A 3LONA 1Q31A 2G8TA 1ELDE 4UEHH 4CH2B 3QWCH 3E0NB 2ZDAH 1J16A 2J9NA 3ZV8A 1SGDE 4O97A 4OGXA 3KEEA 5CHAC 1HAHH 3I29A 1P09A 2GGVB 3MH4A 3EYDA 2R2WU 4IBLH 2K1QA 1KXEA 7GCHF 3QGJA 1O2VA 8GCHG 1QRZA 2OQ5A 3BTQE 1D6WA 1T8LA 3HPTB 1UTOA 4HTCH 1HYLA 2GCTC 2G52A 1WTGH 1P01A 3PO1B 3PROA 1SFQB
chains in the Genus database with same CATH superfamily
1AWFH 1A2CH 3TJVA 4JK5A 5JB9S 1RXPA 2WYGA 4K1TA 3O8CA 1QJ6B 1W0KD 1HAYB 2ZI2H 2HOBA 1DITH 1GBJA 4Y7BA 3I78A 4IS5A 2BHGA 5A0AE 2ZQ1A 4Y8ZA 1DSUA 3FP6E 1ZJKA 2R2MB 5C2ZA 3SHAH 2A45B 5LH8A 1NPMA 3W1EA 3SO3A 1FIWA 4NCYA 1HB0B 1NTPA 2FOAA 5DN6D 3A83A 3DSPA 1WQSA 1GG6B 4KTCA 1ZPBA 4X2XA 1K1PA 4MDSA 1UCYK 2Y80A 3NXPA 4ABBA 1CBWB 1E36B 2XC4A 1AZZA 4GHTA 1ZMJA 3LDXH 3GYMA 1NU7B 1LVMA 1ESAA 2J4IA 2STAE 1HCGA 5E0HA 5L2YH 2G5NA 1DSTA 1HIAA 3RXEA 4FETA 1T8NA 2BLVA 4BAQB 1IQIA 1GI4A 1ZHMA 5GIBA 1ZSLA 1BITA 4Q7YA 3EA9A 1FN8A 2HPPH 4B74A 1N8OC 4A6LA 1P11E 2VIDA 1Y8TA 2YMSB 3FZZA 4U01A 1DVAH 3MTYA 4F49A 2BY6X 1NU9A 3LC5A 2GKVE 3GY7A 1MZDA 4A5TS 4HI3A 2I6SA 1Z8IB 2V3OH 1OYTH 1XUFA 1BTXA 2FOFA 1V2TT 1INCA 1O38A 2QXJA 4DGJA 1F5RA 1P06A 1KY9A 2BY5X 2TGAA 4AC9A 4X8SH 4NGAH 2AHME 3N7EA 5FPSA 3LC3A 1P12E 5C1XA 1PPCE 1CA8B 2FEQH 1TQ0B 8GCHF 2CMYA 1QQUA 1G3CA 2ZTYA 2B0FA 3BV9B 1AVXA 4BXSA 3TGJE 3EA7A 4ZHMU 2Z3EA 4NA9H 2AERH 1UK3A 3PRBA 1H1BA 2H9EH 2AGIX 4KGAA 4B2CA 4XBDA 4R8TB 4LXBH 4MVNA 4H6SB 3FKSD 1MTSA 1BHXF 2YOLA 3DSGA 4HZHA 4CH8B 2BQWB 4RT0A 1EZQA 1NM6A 1SFIA 3KQBA 1XUHA 1P2KA 3BG4C 3U8TH 3FAOA 4ZKOU 1ZMNA 1EFRD 1EP5A 1BB0B 3M7TA 1EPTB 3L6PA 4MLFB 4NSYA 2W7SA 1RIWB 3SYJA 2PHBA 1K1IA 1KXBA 1V2KT 2GMTC 1JBUH 2FESH 4K3JA 2KCYA 1F0TA 2XW9A 1QBOA 3ZVGA 1QFKH 4CRBA 1HJ8A 3ZZCA 4Y8XA 2J92A 1DWEH 3A8BA 5HYOA 2D8WA 3MNBA 1VCQA 1SSXA 3VB6A 1MQ6A 3GY4A 1O31A 2FYQA 2IPQX 2ZHFH 1QJ7B 4WMEA 3PWBA 1GHBF 3RXSA 2BY7X 4X2VA 2K8IA 4WJG2 3SUDA 3HKIB 1Y5UT 3D65E 4FVDA 1J15A 4NIWA 2ZFRH 1OWIA 4X6MA 2XBYA 3RXPA 1O2IA 3ZYDA 3S9AA 4XSKU 3LGUA 1GDQA 4CRCA 4UFFH 1OHHD 1AB9B 1PJPA 5JPMH 1O39A 3SNAA 4FUHA 4WWYA 3SUGA 1MKWK 1NY22 3VG8A 3V13A 4WY3A 2FI3E 2XRCA 4OS7A 1D4PB 1P57B 2J34A 3RXAA 3S9CA 4K8YA 1DY9A 1ID5H 2OCVB 1O30A 1GI5A 1AN1E 3RXTA 1P2JA 2VWOA 1FNIA 5PTPA 3SQHE 1HAIH 2BYAX 4ABEA 5A8ZA 3DT0H 1Z1JA 2OXSA 5AVDA 4BAKB 2YNBA 1TB6H 1BMNH 4NIYA 2HRVA 2VWLA 1YCPH 3SV6A 2B7DH 3RXRA 3OY5U 1UK2A 2ZHQH 1O3EA 4CBOA 1CQQA 1LKAA 2OC8A 3FFGA 1GVLA 1UVTH 2BDGA 1GCTC 3PTNA 4MTBA 1JRSA 2P3FH 3SJOA 1OWKA 1J8AA 4K2YA 2QE7D 4TPIZ 1SQOA 2ZGCA 3T2NA 3F9FA 2GCHG 3LU9B 2G5VA 1GJAB 1MABB 2ZIQH 4GVUA 4LOYH 2FOHA 2EEKA 1MTUA 4ZKNU 1A3EH 4I8GA 5GNDA 4UONA 1HAZB 1O2KA 1XXDA 1SOTA 3QZQA 2A31A 1YF4A 5EPYA 2F9VA 2NWNA 2J97A 4DT7B 1WAYB 3GDUA 1MD7A 4JZ1A 1TX7A 3SOSA 1BRBE 1O3IA 1GHVH 1AO5A 2BVXH 2XOKD 3F3BA 5EOKA 1PFXC 5FPTA 3PLPA 3KQEA 1FUJA 1TRYA 4Z1MD 1D3PB 3CNRA 5A8XA 3MU5A 1FIZA 3M35A 2G4TA 1RD3B 1PPBH 2TBSA 2SGDE 1QL9A 5B6LA 2FO9A 1QHRB 1NBME 2DE9A 4B71A 1MKXH 1GJ9B 1VITG 2ZPRA 3BTTE 2VJ1A 3UWIA 3BTDE 1FONA 5BPEA 4ABAA 1NFXA 1AHTH 3ATIA 3UWJH 1AKSB 2H9TH 5C0UA 2HNTF 3RU4D 3ZVAA 1OP8A 4RSPA 1C2DA 3F9EA 2XCNA 4QT8C 4RI0A 3U8RH 2Z9LA 5EXLA 1UVOA 1V2VT 5F8ZA 1BMMH 4WMDA 1ELGA 3LIWA 1MU8B 1GI0A 1ZJDA 1UO6A 2P94A 4FU8A 1SQRA 3FOAA 3GY2A 3BSQA 4FU7A 4WXIA 2CGAA 1TOCB 1FQ3A 2QN5T 3HGNA 1MUEB 1XUIA 1TA2A 4YTAA 1PYTC 1FY4A 3PMAB 4I31A 2BY9X 1FPHH 1XVMA 1C1QA 1KXFA 1GI3A 3B8JA 2V3HH 1LDTT 2F9OA 4YZUA 4CRGA 1OOKB 2OP9A 5T1VA 1Q2WA 2ALVA 2UUJB 2CF9H 2D2DA 2SGFE 3M3TA 3ATLA 5EQRA 1KYNA 3T62A 3TU7H 3RDZA 1DLEA 3VB3A 1NROH 2R0LA 2HGTH 3VB7A 2AMQA 1J14A 1ZR0A 2Z9JA 3LH1A 1ZSJA 1BUIA 1GDUA 1O5BB 1TABE 3OFND 2BLWA 1GI6A 1O2XA 5TCAA 5DSFA 2VBCA 3MU0A 4ZH8A 1IQMA 1T8MA 1YPLH 1SGTA 2BX4A 4ISIH 1ZLRA 4LK4A 3A8AA 1TRNA 3A7ZA 3QTOH 4ABHA 2B9LA 1GVZA 1X7AC 1XX9A 1VGCB 1H4WA 3P8FA 4LZ4B 2BDAA 3M61U 1TE0A 1TGBA 2AMPA 1V2ST 2VGCC 1D3QB 1VITF 1C5UA 3PWCA 1ANEA 1UCYH 3UNRA 1F92A 1ETTH 2TGTA 2ZQ2A 3P8OA 2A7CA 3M7QA 2SGEE 4YOGA 1TPPA 3BG4B 4MNXA 4DW2U 1LVYA 4NA8A 1Z1IA 1F0RA 1WBGB 3ZYEA 1SGPE 3VB4A 2ZGJA 4GCHG 1RRKA 3QK1A 4OS5A 3P8NA 5DP6A 2PSXA 1NO9H 2GMTB 2C8ZB 2QC2A 1DWDH 4FVBA 1A1RA 3NPSA 1MZAA 4NSVA 2ZU4A 3TVJB 1O2WA 4A1TA 1IQJA 2W26A 2ZDNA 3UAIC 4JYTA 4BAMB 4B6EA 1O3DA 2RA0A 1NS3A 3F2FA 4IN2A 3MFJA 1UHBB 1HAVB 1LHCH 1GGDC 2C4FH 2FMJA 3PLKA 1PPHE 3SU5A 3PV2A 3SV7A 1NZQH 4RKJB 1DANH 5C5NA 1KXAA 3MI4A 1TNKA 2F9PA 2YMSD 2P59A 1CHGA 4BAOB 1TOMH 5JBCS 1NRNH 3MNXA 1A61H 1K1OA 2ZEBA 1ZMLA 4THNH 5LGOA 2FIRH 1W0JD 3E1XB 1Y3WA 3V12A 2CK3D 1OKXA 1QURH 1L4ZA 1KLJH 5CDFE 4YLUA 2BY8X 1RIWC 1DPOA 1HV7A 2W6ID 1P02A 1FJSA 1H8IH 1SLUB 2OD3B 5T6FA 5L6NH 3ZZBA 1K22H 5T6DA 1SLVB 2ZECA 1E1RD 5A09A 4IMQA 2C8WB 1S85A 4P02A 5AF9H 2XC0A 3TNSA 1GCDA 2AEIH 1IQKA 2M5TA 2PV9B 2STBE 2D1JA 1ELVA 1THSH 2VWMA 1EP6A 4GSOA 1LMWB 4UFGH 4F48B 1TFXA 1VKYA 3AW1A 2LNCA 4Y7AA 4FUFA 1C9TA 1BTZA 1QIXB 3K9XB 3UIRA 4I8JA 4U2WA 4OM9A 1IAUA 2CXVA 2BX3A 1V2WT 1XUGA 1GCTB 3K2UA 4OGYA 5E2OA 3OU0A 2WPLS 3AK5A 1NRPH 2KX4A 3U69H 2H9HA 4GCHF 1C1VH 5TJXA 1P2MA 1LKBA 1LPGB 1GMCG 1P2QA 2BLQA 2PFEA 5HIZA 3SJ9A 3A7VA 3QZRA 4WH8A 3RMNH 2QF3A 1IQNA 2HLDD 3SORA 4SGBE 6GCHG 1DOJA 1H8DH 2ZC9H 1EATA 1AU8A 4CBNA 1GBAA 3M3SA 1T7CA 3VFEA 4WXVA 1GMHF 2A5KA 1LPKB 1GMDG 1O2QA 1WQVH 1YC0A 4GHQA 1NESE 1KDQA 1WOFA 5EIYA 2PGBB 4Q2KA 3RXQA 2PLXA 4I7YH 3U28C 3E8LA 1GBMA 1HUTH 2XCFA 1RJXB 4ZHAA 4ESTE 1SLWB 3RXBA 1W0YH 5E8EH 5J4QA 4AFQA 1AUTC 1QA0A 3NRLA 4ACAA 5IYTA 5DG6A 1ESTA 2WINI 1C5LH 3BTHE 4K60A 2SFAA 4E05H 4D9RA 4CRAA 5JB8S 4KKDA 1O0DH 5B6OA 2G55A 3GDSA 2A7JA 1THRH 1O5GH 1S0RA 1OWHA 3SU3A 1GBIA 1FXYA 2Z6BD 3HGPA 1N6XA 4JMYA 1Z8JB 3SU1A 1OS8A 1UJ1A 2IPHA 2ZU2A 4AB9A 4DIIH 1N1LA 1XUKA 2ASUB 5DKMA 2JKHA 2UUYA 3DD2H 1C1SA 4AGJA 5F8XA 2XTTB 5FCKA 4ZMAH 3A7XA 4ZUHA 4GPGA 2W5EA 2FS8A 2H2ZA 1Y3YA 1DWBH 1BBRK 1V3XA 1RS0A 2ODYB 2ZNKH 2G00A 3Q77A 4YM9A 4XBBA 1ORFA 3A8DA 4XE4A 1Y3UA 2ZWLH 1A46H 2KAIB 1NN6A 3GCTG 1K28D 1OP2A 2P16A 4Y10E 2V0BA 2A4GA 1UTQA 2GTBA 3IWMA 1YLCA 1C5TA 3V3MA 4X8VH 2GVFA 1DLKB 2FWWA 4Y79A 1VJAU 4O3TA 1ACBE 1C1OA 2ZFTA 4BTTB 1L1JA 4IC6A 2ZFSA 1AWHB 1Z8GA 3RXUA 6GCHF 2Q6GA 3ZZAA 5ETXA 3RMMH 2XNIA 3M3VA 1FDPA 3A8CA 2OK5A 1LTOA 2BLOA 1CU1A 1P05A 2G81E 1NRSH 2GX4A 3K65B 1C4V2 8LPRA 2OLGA 3H7OA 3H09A 2V3MA 3RC5A 4X6NA 3CENA 3M5OA 5EQQA 1AFQC 3MQKC 1GBKA 3GOVB 3HK6B 5C3NA 2ANKH 3GCHB 3A82A 1B7XB 1PPGE 3GS9A 2Z9IA 1MTWA 2XXLA 1TONA 1SGCA 2F9BH 2O8LA 3KYGA 3N7OA 3UTUH 4AZ2B 3A7WA 1ELBA 1BMFD 3FANA 2RDEA 1FX0B 5EJZA 1GVKB 2Q6DA 2IOTA 1SKYE 2VGCB 1C5YB 4UFDH 4IC5A 4TYDA 1F5LA 4HGCA 3SZNA 2AGGX 3SI4H 2OBOA 3U1IB 3UNSA 1QB9A 2YNAA 3Q3XA 3F1SB 3D23A 1PPEE 2VH6A 4X1SU 3OTPA 4K5ZA 1JRTA 1V2LT 2BDCA 1DX5M 3FVFB 3MWIU 3RMLH 4CR9A 1UVPA 3ZVFA 2EA3A 4UE7H 4AG1A 3SJ8A 4CREA 1WSSH 2W3IA 1ZRKA 2WV5A 1EZXC 4AOQA 1AVWA 2EI8A 1VGCC 2F43B 1C2GA 2J98B 3RXLA 8ESTE 4INHA 3TH3H 3SW2B 1GGDB 4AN7A 3L3TA 3TK6A 3IITA 1WDIA 4WMFA 1YWUA 4GLYA 2VIWA 1EASA 2J5UA 4AX9H 1SMFE 3K6YA 5GPIB 1Z6EA 9ESTA 3DHKH 5EXNA 4X2YA 1P3EA 3S0NA 5DP8A 2VIVA 1O5AB 1O37A 1ZYOA 1YCPM 1V2OT 4ZAEA 4DCDA 1GHWH 4X6PA 2WZQA 2GZ7A 2AIPA 1VZQH 1IQFA 1ELCA 5FCRA 4UD9H 3QO6A 2CHAC 1C5XB 3LJOA 1QA7A 3BTEE 1DDJA 1UTNA 2RG3A 4YT7H 1A5GH 4D8NA 5A2MH 5LPRA 3TJNA 1TALA 4B75A 3QLPH 1HIAB 2UWOA 3M5MA 1EAWA 1KMHB 5DK1A 5HGGA 2C90B 1EX3A 1CVWH 2OQUA 2FTLE 4DIHH 3SJKA 1ETRH 3BTGE 2PKAA 3Q3KA 1CO7E 2G51A 1ELTA 2FYRA 4X2WA 2VVCA 4MNYA 2HVXA 3JZ2B 3U9AH 1CE5A 3ENSB 3P17H 4BNRA 3TK9A 4JYVH 1QNJA 3F0OA 1QBNA 1Y5BT 2OBQA 2XYAA 3ZZ8A 1CGIE 5IK2D 3TGKE 3KYFA 3MNCA 2XBXA 5FPYA 3NUMA 2V35A 3RM0H 2XBWA 3PRDA 1BBRE 1GHZA 1COWD 1BZXE 1S5SA 2R3YA 4D9QA 1HPGA 1TPOA 3KGPA 1KXCA 1P2NA 3SQEE 4Q7ZA 3OYPA 2BD8A 3U8OH 1FV9A 3KQDA 2FOBA 3C1KA 4NIXA 2L74A 4X6OA 1QY6A 1PQ5A 4TY6A 1C2IA 4F4OC 1C4U2 2Y5GA 5C17A 3TLOA 1GJ5H 1HRTH 2QF4A 3SGBE 1W8BH 3F6UH 1AKSA 1G30B 2SNWA 5HMAA 1GL0E 4X1NU 3LPRA 5L2ZH 1O3GA 2ZG0H 1RTKA 1YPJH 3ZZ3A 2C93B 4IGDA 3KHVA 2JJ2D 5HM9A 2A4QA 2Z9KA 1O2ZA 5EG4A 1GI2A 1M9UA 4JZIA 3F2GA 1TBQH 2FXRA 3U98H 1EAUA 2XWBI 3RXIA 2B8OH 1EXFA 1NRRH 1C5VA 1SQAA 3RXHA 4O3UA 3WW7A 3A89A 1B0FA 3OTJE 1TNLA 1Z8RA 3P6ZB 3ODDA 1TGCA 3TK5A 2ZTZA 1C1MA 3TITA 5EJ1A 4KP0A 1TA6A 2ZU3A 3P95A 3ZVEA 3L33A 1THPB 3B9FH 1MCVA 4DURA 1HFDA 1YBWA 1G3DA 2HPQH 2KCOA 4Z6AH 3ESTA 1E35B 1GBEA 1NBMD 3MHWU 4CR5A 7KMEH 3RXKA 2PW8H 1KXDA 3ZVCA 5FX5A 1E37B 2Y81A 3EQ0H 1TNIA 2QY0B 4BOHA 5CE1A 1TIOA 4HG6A 1BA8B 3LJJA 1PPFE 3CP7A 3WWFA 1VCPA 3SNEA 1TNHA 1O2TA 3T28A 1ZGIA 2NU1E 3UOUA 3SNDA 2ANMH 2WYJA 3OEED 4E7RG 1NFWA 2O9QA 2BZ6H 5BRRE 4AFUA 2J38A 4Q4LA 3GY5A 1EJNA 3BTME 1QB6A 1CGJE 1KIGH 3LGVA 4XFQA 3WWBA 1BRAA 2J2UA 1UVSH 1MTVA 1L1NA 4FUJA 2VB0A 1W10U 4MPXA 1YPGH 2FX4A 1C5MD 1JIMA 1C5SA 1O2OA 2QCYA 1F7ZA 1AFQB 1WTHD 4Q7XA 3PMBB 2BD7A 2OUAA 2JIZD 5DP5A 2OC1A 2TRMA 4J2YB 3STJA 3VPKA 3MU1A 3PB1E 3KN2A 1O3OA 4MNWA 5CMXH 1Z6JH 2ZHEH 1EOLA 3BEUA 2ANYA 5GWZA 2GCHF 1C5ZB 3UPEA 1UK4A 1NFUA 2TGDA 4JZEH 5DP9A 3EA8A 5EODA 3HATH 1H8ED 4Y76A 2NU0E 1LHGH 3LGTA 3SNBA 4MNVA 2BD3A 1SGIB 2DUCA 1H9HE 1J17T 2RFKC 1SHYA 2BD2A 2FS9A 2VWNA 4ABFA 3OX7U 1LVOA 4XRNA 2EQNA 4XDEA 1V6DA 2ZO3H 1P03A 5DJ7A 3DCLA 1MBQA 1O3AA 4K1SA 1ANDA 1SC8U 4MQAA 1HAVA 3RXCA 4FXGH 1LHEH 3A84A 1E1QD 1C1PA 3GCHC 3PLBA 3TPIZ 3PMHB 3S7KB 4D7GA 1VR1H 1SBWA 2GT7A 2QA9E 1AFEH 3MNSA 1E34B 5AFZH 1ARBA 1O2JA 1V2MT 1SGFA 4IMZA 1PYTD 3SU6A 1O3HA 3STIA 4B73A 2ZDLA 3UOPA 2VIOA 1BTWA 2JH5D 1EUFA 2HLCA 1TNGA 1TGTA 1AQ7A 2BDHA 3FP7E 2F9NA 1L2EA 3BTKE 5CHBA 2P3UB 5F8TA 1A5IA 4MPVA 3F9GA 2Y6TA 3GY3A 2PGQB 1C1UH 1JXPA 1JIRA 4H6TA 4U32A 2F4LA 3E3TA 2O8UA 4TWYA 3RXJA 7LPRA 2AIQA 3LGYA 2QYIA 3E16B 1MCTA 4Q80A 1A5HA 3DFLA 3SV2H 1ANBA 1GBLA 1WV7H 4NZQA 3V0XA 2CHAB 2SGPE 4K1EA 2W6JD 3TH4H 4PROA 1DXPA 3Q76A 3RM2H 1T4UH 1VITH 4I86A 1BTUA 1O2NA 1O3KA 4O03A 3RLYH 5GXPA 1O2YA 1B0EA 5EU8A 2KR7A 1HLTH 3ZVBA 1LHFH 2Z3DA 1ZTKA 3AAUA 1HXEH 5HIYA 1BMAA 3HKJB 1GBCA 1QBVH 1ZTLA 4ZHLU 2Y7ZA 3VGCB 3QN7A 3FO8D 2XC5A 1W2KH 1ELAA 2O8WA 3RU4T 5EPNA 1UW7A 4X1PU 3A88A 1FI8A 4YXWD 1XXFA 2FOMB 1O3FA 2WUBA 3NCLA 1O32A 3DSOA 1C2KA 3EAJA 2QXIA 3URDA 2JH6D 1V2JT 5HKKD 3ZIAD 3NKKA 4CHAC 1GJBB 4INLA 1BT7A 1HXFH 3AW0A 2Q6FA 1O2HA 4ABJA 1G36A 4DJZB 1E79D 4E7NA 6CHAC 2O8TA 2VIPA 4JZDH 1FY5A 4OS4A 2V7QD 5FBEA 4K69A 1P10A 2H5DA 2A2XH 1XVOA 1JMOH 1TBRH 1BTYA 1MQ5A 1FZZA 3F68H 1D6RA 3T29A 3BTWE 5L30H 2GJGA 1O3BA 4WH6A 2FOGA 3PM3A 1VJ9U 1CT0E 1K9OE 1P04A 4X1RU 1D3TB 1YCPK 3Q3YA 2OTVA 1O2LA 5DP3A 3RXMA 1HDTH 1WUNH 2W7UA 5C20A 4AB8A 3TIUA 2ESTE 4FUBA 1YM0A 2RCEA 3MH5A 4H4FA 2WPJS 4FUDA 1DUAA 5T3HA 1QTFA 3A87A 3ODFA 3ZZ7A 1W12U 3KL6A 1F5KU 1AMHA 1O3NA 1OYQA 1UTJA 2ZPSA 3M5NA 4ABIA 3S7HB 3H5CB 3SI3H 3UQVA 3SGAE 2QIQA 1TWXB 1OPHB 1TBZH 1WU1A 1O34A 2PSYA 4I33A 3P92A 4NWLA 7GCHG 3SJIA 3RXOA 2H1UA 1YPMH 2WPKS 1ARCA 5E0GA 3ZZ4A 1DUEA 2WPDD 3R3GB 1KSNA 2Z3CA 1MKWH 5FHTA 1Q3XA 3RC4A 1GHYH 2BVSH 4Y0YE 4AORA 5A0CA 1C1WH 3GISB 3OY6U 1O3LA 3QDZB 3LH3A 8KME2 5C67A 3LT3A 1ESBA 2BQ7B 1A7SA 2R3UA 1IHSH 5EQSA 1AI8H 5JBAS 1GBDA 3FZDA 5E0JA 1SI5H 3K6ZA 1IQEA 2HVYB 5JYIA 1ABIH 4YOJA 4HFPB 5ESTE 1HJ9A 1HJAC 5J4SA 2Y7XA 3AAVA 3UFAA 3U1JB 3T25A 3UNQA 3KQ5A 2RDLA 1MKXK 3O8DA 4ACBA 1ZPCA 2AGEX 1PQAA 2BD4A 2JDID 2LELA 3URCA 1S6FA 1XMNB 2ZU5A 1C2EA 2VINA 5JBTA 4YLQH 1IOEA 1NT1A 3QX5H 4OS6A 2CJIA 3MH7A 3SU0A 4B2BA 2FPZA 1C5NH 3S9BA 1PQ8A 1G3EA 4KTUA 3VEQB 2FOCA 4ZCNA 2A0QB 2KCPA 1GPZA 3OE7D 5GJ4B 1Z71A 3H7TA 1CGHA 1GBFA 2THFB 2DE8A 1E38B 5EW1H 1CA0C 4ISOA 5ABWA 5C1UA 1J9CH 2XWAA 3T27A 1MD8A 2NU3E 2GV7A 2C3SA 4UDWH 1GL1A 1GMCF 1ABJH 1UTLM 3MU8A 1QGFA 2PKSC 4NWKA 3V7TA 2ZHWH 5C1YA 4FUEA 1DICA 1TMBH 4A1VA 1QCPA 2BZAA 5AHGH 1KDQB 1O2PA 1SVPA 1SR5C 1GMDF 1IHTH 1V2UT 3EE7A 1C1TA 1UVUH 1O5FH 1V2RT 3A7YA 1LO6A 3RP2A 2UUKB 3A80A 4NA7A 3SU2A 3M7UA 1BIOA 2ZDVH 5K7RA 4AYVB 1FMGA 2H5CA 5DPAA 3OEHD 4AYYB 2LPRA 2BQ6B 2FTMA 4Y11E 1OWJA 4XBCA 3NWUA 4I8LA 3Q00A 1P3CA 3GY6A 3EE0B 5C0TA 1EPTA 1BJUA 3F0PA 1ZPZA 3MH6A 5TCCA 5LPFA 2BDBA 1HAPH 3I77A 1ZHRA 2QF0A 4TT3D 3TH2H 2OC7A 2P8OC 4NIVA 4YO9A 1GI9B 1H9IE 1H8HD 1UTMA 3VXFH 2ZDKA 4D7FA 2GD4B 4ZKRU 1GHBG 1FN6A 1NFYA 2BD5A 1GJ7B 2UWPA 2PTNA 4JK6A 1G2MA 1TX6A 2A7HA 1LPZB 2ANWA 4D76A 2VVUA 4M7GA 3GCTF 5K0HA 4JYUH 1MMJN 2LP6A 1TRMA 2F9UA 2FP7B 4E06H 3BTFE 2P95A 1OWDA 3R0FA 5GDSH 4B2AA 1TGNA 2AYWA 1QR3E 4NG9H 1DXWA 2EI6A 1W7XH 1U6QA 2IJOB 2AFQB 3AASA 4RN6A 1GJ4H 3ZZ5A 2BVRH 1GJ6A 2ZZUH 4MG3A 2XNDD 2WUCA 2P3TB 5H4IB 2TPIZ 1BDAA 1W13U 1AVGH 1GHAG 1W3CA 1AE8H 1XUJA 3ZZDA 1A3BH 1CSOE 3PV5A 4CRDA 3RXVA 2F83A 5KEDA 5FAHA 1FLEE 1L0ZA 3MOCA 4CHAB 2ZU1A 1DFPA 1AUJA 1RTFB 5EJLA 4X8TH 3BIVH 4Y71A 6CHAB 1SB1H 3VB5A 4ISHH 4FU9A 1C5PA 5HXFA 1YGCH 3MYWA 1FPCH 2OINA 2CN0H 2SNVA 1ELFA 2RA3A 1ZRBA 3KIDU 2HNTC 1S0QA 1K1NA 1TMUH 2ZCLP 1Y3VA 3WY8A 5F6MA 3A86A 2BM2A 2BMGB 2W3KA 3BF6H 1C1NA 2ZFPH 1DS2E 1SL3A 2QF5A 1DE7H 3VGCC 2EC9H 5KECA 3UQOA 1AE5A 3O8RA 1GBHA 1EAIA 3LGIA 2ZGBH 3SHCH 1EOJA 1K1LA 4DG4A 4IW4E 1O3PB 2ODQA 1F2SE 2ZGXH 3LKWA 3ITIA 1QZ8A 1NRQH 2C8XB 1ZTJA 1BQYA 4AG2A 1UMAH 2H6MA 4DVAU 2AH4X 4UFEH 1ELEE 1S84A 3PV4A 1YLDA 4A92A 1YPHC 2NU4E 2CF8H 3ZZ6A 1S82A 3DA9B 2M2AA 4VGCC 4YOIA 3SN8A 1BMLA 1FAKH 3RXGA 4X0WU 1A0JA 1C2HA 1W11U 1DWCH 4RKOB 4I8HA 3GDVA 1MTNC 5ESBA 3QTVH 3M5LA 3PTBA 4TSFD 5LPEA 3GCNA 3PYHA 6LPRA 1DY8A 1V2QT 2HNTE 2ZDMA 3LGWA 3E0PB 3LOXA 4LZ1H 1FAXA 3M36A 1C2MA 4OS1A 1GHAF 2WSSD 1Y3XA 1Y5AT 1KLIH 1YP9A 1O2GH 2ZFFH 5EXMA 3HK3B 3C27B 3B23B 4TPYA 5EGMA 1L1GA 4FOUC 2JETC 1HJAB 1AIXH 1DM4B 4YESB 3N99A 3ZVDA 1P9UA 1TMTH 1QB1A 2VU8E 1JWTA 1SG8B 1BHXB 2L6OA 1OWEA 3T26A 3UR9A 3DFJA 2ALPA 2FLBH 1G32B 1YPHE 1KTTB 1D9IA 3JZ1B 1K21H 1GI7B 1QJ1B 1RTLA 2PKAB 1HAOH 1BRCE 1QQ4A 2NU2E 1SGFG 4TY7A 3SU4A 1LQDB 1VCWA 4ZXXH 5JBBS 2EI7A 4A1XA 1Y59T 2VVVA 1G37A 1O3CA 2JH0D 3F2HA 1HAXB 5FBIA 1C4Y2 1LQEA 1AY6H 2PUXB 2PTCE 2BXTH 3QUMP 1GDNA 2P93A 1CA0B 1UCYE 1T8OA 2FZZA 1DT2A 1EZUC 2BDYA 1EJAA 1W0ZU 4ISLA 2D26C 2Z7FE 2BB4A 5CHAB 3BG8A 5F03A 2PKSB 4MPUA 1UTPA 1O36A 1BCUH 1GJ8B 4P00A 4RT1A 2GDEH 3QGNB 2F3CE 2ZPQA 2KZ4A 3SV8A 1K0HA 3UREA 5FL7D 2GV6A 2UUFB 1QL7A 5F53A 5DP4A 5A8YA 3A7TA 1S83A 2BDIA 2GCTB 3AVZA 3SBKA 2BOKA 2A32A 3O8BA 2FI4E 3UUZA 1SGQE 1FY8E 2J94A 1TLDA 1RFNA 2ZKSA 3MO3A 5G4BA 2ZFQH 2A4OA 3D62A 1GBBA 1FY1A 1TQ7B 4M9FA 3TGIE 1SGNE 3GY8A 3OSYA 4JZFH 4ZROA 3M37A 1B5GH 2Y5FA 1BBRH 4GAWA 1MAYA 1SHHB 5JDUB 2WPMS 2FODA 3BN9A 4IN1A 1O2RA 1GI8B 2AS9A 3SUFA 4B6FA 1WCZA 1E0FD 2WPHS 4ZXYH 2Q1JA 1ANCA 4AFSA 1W14U 3RU4E 2BOHB 2I6QA 4BANB 4B76A 5T6GA 7ESTE 2VNTA 1XM1A 4ABGA 1SGYE 1PQ7A 1PPZA 4FUIA 4Q63A 5E2PA 1MH0A 4K8BA 3ZV9A 3W94A 1JOUB 2P8OB 2ZF0H 3RXFA 1CT2E 4INKA 5A0BA 1MU6B 4BAHB 1BJVA 1OXGA 1HGTH 1YKTA 3PO1C 1P9SA 2C8YB 4AGKA 1OX1A 2BXUH 1UHBA 4NZLA 4TWWA 1BOQA 1P2OA 1N8OB 2AMDA 4KTSA 5C94A 6ESTA 2VH0A 1S6LA 1WXRA 3IG6B 2OC0A 2ZGHA 4GUXA 2UWLA 2HWLB 3A81A 4Y6DA 2QV1A 1XKBC 5SGAE 3KQCA 1V2NT 5I46H 1WYKA 1O33A 2GZ9A 1HAGE 2QGRA 1ZGVA 2CV3A 1EB1H 2JJ1D 2ZCHP 4OS2A 2PR3A 3RUOA 2BTCE 4CRFA 1GG6C 3ATWA 1S81A 2GP9B 1G2LA 4Z0KA 4BXWA 3RXDA 1AZ8A 1CBWC 1HBTH 3TJUA 1LVBA 1C1RA 4O9VA 2F91A 3EDXB 5GCHG 2ZHDA 3ATKA 2J95A 1OSSA 1A0HB 4NFEA 1EJMA 2A1DB 1GI1A 2Y82A 2YMSC 1EZSC 1O5EH 3TNTA 5IDKA 2WPIS 2GT8A 1KLTA 5DGJA 1O2MA 1YYY1 3P70B 1YPKH 3SGQE 4H42U 1RGQA 2A2QH 4NFFA 1LHDH 1A0LA 1O3MA 1G3BA 1O5DH 2V6NA 2ODPA 5I25A 1K1MA 2BD9A 1P2IA 9LPRA 2R0KA 1SOZA 1YLNA 3MU4A 3D49H 2ZA5A 3KF2A 4ABDA 1C2FA 1D3DB 1F0UA 1UTKA 1GMHG 2FI5E 2GZ8A 4U30A 5FXLA 3W95A 2EY4C 4DOQA 3GCOA 1ZOMA 5DO4H 1G9IE 2FLRH 5FX6A 1L4DA 1IQGA 1EQ9A 2IJD1 1F0SA 4FUGA 1GJDB 3S69A 4DT4A 2QXHA 4WF8A 1AGJA 3E91A 3RLWH 4VGCB 1C5RA 3MO6A 2R9PA 1TX8A 4X1QU 3E90B 2QXGA 2FDAA 1C2LA 1SLXB 1C9PA 1EPTC 1TPAE 1QRXA 1YY3A 4I32A 1EKBB 2FOEA 1BTHH 2FX6A 2XBVA 1S6HA 1MTNB 2SGAA 1GBTA 1O2UA 1CHOG 2K0QA 1H9LB 1TGSZ 2FM2A 3GYLB 1O5CB 5AFYH 3PMJA 4F55A 4JCNA 1SGEE 1AD8H 3RMOH 2TGPZ 2HALA 4R0IA 1CT4E 1BTPA 2SGQE 1P0SH 5GCHF 2TIOA 3TJOA 5DP7A 1ETSH 3BIUH 1T31A 2A5AA 1OP0A 3P8GA 2JETB 3F9HA 2WV9A 4YT6H 1GWAA 3SUEA 1MBMA 4Y0ZE 4B1TA 2QAAA 1SPJA 2PUQH 3MMGA 3T5FH 2KAIA 1TYNA 1T4VH 3E6PH 1LCYA 1BRUP 1FY3A 5C5OA 3ZZ9A 1T32A 1EB2A 4WVPE 1AB9C 1IQLA 1C5QA 1ZHPA 4BTUB 1C5OH 2ILNA 2KFWA 1GJCB 3EGKH 1GHXH 3RC6A 4ASHA 1O35A 2A4RA 4SGAE 1MAXA 1K1JA 3UR6A 1IQHA 3KNXA 1A4WH 1O2SA 1O3JA 2KM0A 1Z7KA 5HM2A 1V2PT 3ATMA 2PWXA 2WV4A 3NZIA 2ZCKP 2ZTXA 2VIQA 1KTSB 4Y8YA 1YPEH 4ZKSU 1XKAC 1SGRE 1ZZZA 1HNEE 1ZSKA 2Y5HA 1C2JA 3G01A 4BTIB 1SQTA 1P8VC 4I8KA 4MPWA 4XOJA 1W7GH 1TAWA 3A85A 3BEFB 4J1YA 3NK8A 5EW2H 1QL8A 3DUXH 4KELA 2ZP0H 2A5IA 3FP8E 1NC6A 2IN2A 4DY7B 3SV9A 3N7DA 3VXEH 3ELAH 2Z94A 4FUCA 2ULLA 3UY9A 4X8UH 2KCAA 3BEIB 1EAXA 3GICB 2B5TB 1TPSA 3CS0A 4A7IB 1K2I1 1CHOF 4AFZA 1TNJA 1N6YA 3UB0A 2GDDA 2G4UA 4ISNA 1C5WB 3KCGH 4XD7D 3CS7A 2O8MA 4ASUD 1QRWA 3SNCA 3SZEA 2Z9GA 3MO9A 3LONA 1Q31A 2G8TA 1ELDE 4UEHH 5KGOA 4CH2B 3QWCH 3E0NB 2ZDAH 1J16A 2J9NA 3ZV8A 1SGDE 4O97A 4OGXA 3KEEA 2WHXA 5CHAC 1HAHH 3I29A 1P09A 2GGVB 3MH4A 3EYDA 2R2WU 4IBLH 2K1QA 1KXEA 7GCHF 3QGJA 1O2VA 8GCHG 1QRZA 2OQ5A 3OAAD 3BTQE 1D6WA 1T8LA 3HPTB 1UTOA 4HTCH 1HYLA 2GCTC 2J98A 2G52A 1WTGH 2PP6A 1P01A 3PO1B 3PROA 1SFQB 3FN8A
chains in the Genus database with same CATH topology
1AWFH 1A2CH 3TJVA 4JK5A 5JB9S 1RXPA 2WYGA 4K1TA 3O8CA 1QJ6B 1HAYB 2ZI2H 2HOBA 1DITH 1GBJA 4Y7BA 3I78A 4IS5A 2BHGA 5A0AE 2ZQ1A 4Y8ZA 1DSUA 3FP6E 1ZJKA 2R2MB 5C2ZA 3SHAH 2A45B 5LH8A 1NPMA 3SO3A 1FIWA 4NCYA 1HB0B 1NTPA 2FOAA 3A83A 1WQSA 1GG6B 4KTCA 1ZPBA 4X2XA 1K1PA 4MDSA 1UCYK 2Y80A 3NXPA 4ABBA 1CBWB 1E36B 2XC4A 1AZZA 4GHTA 1ZMJA 3LDXH 3GYMA 1NU7B 1LVMA 1ESAA 2J4IA 2STAE 1HCGA 5E0HA 5L2YH 2G5NA 1DSTA 1HIAA 3RXEA 1T8NA 2BLVA 4BAQB 1IQIA 1GI4A 1ZHMA 5GIBA 1ZSLA 1BITA 4Q7YA 3EA9A 1FN8A 2HPPH 4B74A 1N8OC 4A6LA 1P11E 2VIDA 1Y8TA 3FZZA 4U01A 1DVAH 3MTYA 4F49A 2BY6X 1NU9A 3LC5A 2GKVE 3GY7A 1MZDA 4A5TS 4HI3A 2I6SA 1Z8IB 2V3OH 1OYTH 1XUFA 1BTXA 2FOFA 1V2TT 1INCA 1O38A 2QXJA 4DGJA 1F5RA 1P06A 1KY9A 2BY5X 2TGAA 4X8SH 4NGAH 5FPSA 3LC3A 1P12E 5C1XA 1PPCE 1CA8B 2FEQH 1TQ0B 8GCHF 2CMYA 1QQUA 1G3CA 2ZTYA 2B0FA 3BV9B 1AVXA 4BXSA 3TGJE 3EA7A 4ZHMU 2Z3EA 4NA9H 2AERH 1UK3A 1H1BA 2H9EH 2AGIX 4KGAA 4B2CA 4XBDA 4R8TB 4LXBH 4MVNA 4H6SB 1MTSA 1BHXF 2YOLA 4CH8B 4HZHA 2BQWB 1EZQA 1NM6A 1SFIA 3KQBA 1XUHA 1P2KA 3BG4C 3U8TH 3FAOA 4ZKOU 1ZMNA 1EP5A 1BB0B 3M7TA 1EPTB 3L6PA 4MLFB 4NSYA 2W7SA 1RIWB 2PHBA 1K1IA 1KXBA 1V2KT 2GMTC 1JBUH 2FESH 4K3JA 1F0TA 2XW9A 1QBOA 3ZVGA 1QFKH 4CRBA 1HJ8A 3ZZCA 4Y8XA 2J92A 1DWEH 3A8BA 5HYOA 2D8WA 3MNBA 1VCQA 1SSXA 3VB6A 1MQ6A 3GY4A 1O31A 2FYQA 2ZHFH 1QJ7B 4WMEA 3PWBA 1GHBF 3RXSA 2BY7X 4X2VA 4WJG2 3SUDA 3HKIB 1Y5UT 3D65E 4FVDA 1J15A 4NIWA 2ZFRH 1OWIA 4X6MA 2XBYA 3RXPA 1O2IA 3ZYDA 3S9AA 4XSKU 3LGUA 1GDQA 4CRCA 4UFFH 1AB9B 1PJPA 5JPMH 1O39A 3SNAA 4FUHA 4WWYA 3SUGA 1MKWK 1NY22 3V13A 4WY3A 2FI3E 2XRCA 4OS7A 1D4PB 1P57B 2J34A 3RXAA 3S9CA 4K8YA 1DY9A 1ID5H 2OCVB 1O30A 1GI5A 1AN1E 3RXTA 1P2JA 2VWOA 1FNIA 5PTPA 3SQHE 1HAIH 2BYAX 4ABEA 5A8ZA 3DT0H 1Z1JA 2OXSA 5AVDA 4BAKB 2YNBA 1TB6H 1BMNH 4NIYA 2HRVA 2VWLA 1YCPH 3SV6A 2B7DH 3RXRA 3OY5U 1UK2A 2ZHQH 1O3EA 4CBOA 1CQQA 1LKAA 2OC8A 3FFGA 1GVLA 1UVTH 2BDGA 1GCTC 3PTNA 4MTBA 1JRSA 2P3FH 3SJOA 1OWKA 1J8AA 4K2YA 4TPIZ 1SQOA 2ZGCA 3T2NA 3F9FA 2GCHG 3LU9B 2G5VA 1GJAB 2ZIQH 4GVUA 4LOYH 2FOHA 2EEKA 1MTUA 4ZKNU 1A3EH 4I8GA 4UONA 1HAZB 1O2KA 1XXDA 1SOTA 3QZQA 2A31A 1YF4A 5EPYA 2F9VA 2NWNA 4DT7B 1WAYB 3GDUA 1MD7A 4JZ1A 1TX7A 3SOSA 1BRBE 1O3IA 1GHVH 1AO5A 2BVXH 5EOKA 1PFXC 5FPTA 3PLPA 3KQEA 1FUJA 1TRYA 1D3PB 5A8XA 3MU5A 1FIZA 3M35A 2G4TA 1RD3B 1PPBH 2TBSA 2SGDE 1QL9A 2FO9A 1QHRB 2DE9A 4B71A 1MKXH 1GJ9B 1VITG 2ZPRA 3BTTE 2VJ1A 3UWIA 3BTDE 1FONA 5BPEA 4ABAA 1NFXA 1AHTH 3ATIA 3UWJH 1AKSB 2H9TH 2HNTF 3RU4D 3ZVAA 1OP8A 4RSPA 1C2DA 3F9EA 2XCNA 4QT8C 3U8RH 2Z9LA 5EXLA 1UVOA 1V2VT 5F8ZA 1BMMH 4WMDA 1ELGA 3LIWA 1MU8B 1GI0A 1ZJDA 1UO6A 2P94A 4FU8A 3GY2A 3BSQA 4FU7A 4WXIA 2CGAA 1TOCB 1FQ3A 2QN5T 3HGNA 1MUEB 1XUIA 1TA2A 4YTAA 1PYTC 1FY4A 3PMAB 4I31A 2BY9X 1FPHH 1XVMA 1C1QA 1KXFA 1GI3A 3B8JA 2V3HH 1LDTT 2F9OA 4YZUA 4CRGA 1OOKB 2OP9A 1Q2WA 2ALVA 2UUJB 2CF9H 2D2DA 2SGFE 3M3TA 3ATLA 5EQRA 1KYNA 3T62A 3TU7H 3RDZA 1DLEA 3VB3A 1NROH 2R0LA 2HGTH 3VB7A 2AMQA 1J14A 1ZR0A 2Z9JA 3LH1A 1ZSJA 1BUIA 1GDUA 1O5BB 1TABE 2BLWA 1GI6A 1O2XA 5TCAA 3MU0A 4ZH8A 1IQMA 1T8MA 1YPLH 1SGTA 2BX4A 4ISIH 1ZLRA 4LK4A 3A8AA 1TRNA 3A7ZA 3QTOH 4ABHA 2B9LA 1GVZA 1X7AC 1XX9A 1VGCB 1H4WA 3P8FA 4LZ4B 2BDAA 3M61U 1TE0A 1TGBA 2AMPA 1V2ST 2VGCC 1D3QB 1VITF 1C5UA 3PWCA 1ANEA 1UCYH 3UNRA 1F92A 1ETTH 2TGTA 2ZQ2A 3P8OA 2A7CA 3M7QA 2SGEE 4YOGA 1TPPA 3BG4B 4MNXA 4DW2U 1LVYA 4NA8A 1Z1IA 1F0RA 1WBGB 3ZYEA 1SGPE 3VB4A 2ZGJA 4GCHG 1RRKA 3QK1A 4OS5A 3P8NA 5DP6A 2PSXA 1NO9H 2GMTB 2C8ZB 2QC2A 1DWDH 4FVBA 1A1RA 3NPSA 1MZAA 4NSVA 2ZU4A 3TVJB 1O2WA 4A1TA 1IQJA 2W26A 2ZDNA 4JYTA 4BAMB 1O3DA 2RA0A 1NS3A 4IN2A 3MFJA 1UHBB 1HAVB 1LHCH 1GGDC 2C4FH 2FMJA 3PLKA 1PPHE 3SU5A 3SV7A 1NZQH 4RKJB 1DANH 5C5NA 1KXAA 3MI4A 1TNKA 2F9PA 2P59A 1CHGA 4BAOB 1TOMH 5JBCS 1NRNH 3MNXA 1A61H 1K1OA 2ZEBA 1ZMLA 4THNH 5LGOA 2FIRH 3E1XB 1Y3WA 3V12A 1OKXA 1QURH 1L4ZA 1KLJH 4YLUA 2BY8X 1RIWC 1DPOA 1HV7A 1P02A 2OD3B 1FJSA 1H8IH 1SLUB 5T6FA 5L6NH 3ZZBA 1K22H 5T6DA 1SLVB 2ZECA 5A09A 4IMQA 2C8WB 1S85A 5AF9H 2XC0A 3TNSA 1GCDA 2AEIH 1IQKA 2M5TA 2PV9B 2STBE 2D1JA 1ELVA 1THSH 2VWMA 1EP6A 4GSOA 1LMWB 4UFGH 1TFXA 3AW1A 2LNCA 4Y7AA 4FUFA 1C9TA 1BTZA 1QIXB 3K9XB 3UIRA 4I8JA 4U2WA 1IAUA 2CXVA 2BX3A 1V2WT 1XUGA 1GCTB 3K2UA 4OGYA 5E2OA 3OU0A 2WPLS 1NRPH 3U69H 2H9HA 4GCHF 1C1VH 5TJXA 1P2MA 1LKBA 1LPGB 1GMCG 1P2QA 2BLQA 2PFEA 3SJ9A 3A7VA 3QZRA 4WH8A 3RMNH 2QF3A 1IQNA 3SORA 4SGBE 6GCHG 1DOJA 1H8DH 2ZC9H 1EATA 1AU8A 4CBNA 1GBAA 3M3SA 1T7CA 3VFEA 4WXVA 1GMHF 2A5KA 1LPKB 1GMDG 1O2QA 1WQVH 1YC0A 4GHQA 1NESE 1KDQA 1WOFA 2PGBB 4Q2KA 3RXQA 2PLXA 4I7YH 3E8LA 1GBMA 1HUTH 2XCFA 1RJXB 4ZHAA 4ESTE 1SLWB 3RXBA 1W0YH 5E8EH 5J4QA 4AFQA 1AUTC 1QA0A 5IYTA 5DG6A 1ESTA 2WINI 1C5LH 3BTHE 4K60A 2SFAA 4E05H 4D9RA 4CRAA 5JB8S 4KKDA 1O0DH 5B6OA 2G55A 3GDSA 2A7JA 1THRH 1O5GH 1S0RA 1OWHA 3SU3A 1GBIA 1FXYA 2Z6BD 3HGPA 1N6XA 4JMYA 1Z8JB 3SU1A 1OS8A 1UJ1A 2IPHA 2ZU2A 4AB9A 4DIIH 1N1LA 1XUKA 2ASUB 5DKMA 2JKHA 2UUYA 3DD2H 1C1SA 4AGJA 5F8XA 2XTTB 5FCKA 4ZMAH 3A7XA 4ZUHA 4GPGA 2W5EA 2FS8A 2H2ZA 1Y3YA 1DWBH 1BBRK 1V3XA 1RS0A 2ODYB 2ZNKH 2G00A 3Q77A 4YM9A 4XBBA 1ORFA 3A8DA 4XE4A 1Y3UA 2ZWLH 1A46H 2KAIB 1NN6A 3GCTG 1K28D 1OP2A 2P16A 4Y10E 2V0BA 2A4GA 1UTQA 2GTBA 3IWMA 1YLCA 1C5TA 3V3MA 4X8VH 2GVFA 1DLKB 2FWWA 4Y79A 1VJAU 4O3TA 1ACBE 1C1OA 2ZFTA 4BTTB 1L1JA 4IC6A 2ZFSA 1AWHB 1Z8GA 3RXUA 6GCHF 2Q6GA 3ZZAA 5ETXA 3RMMH 2XNIA 3M3VA 1FDPA 3A8CA 1LTOA 2BLOA 1CU1A 1P05A 2G81E 1NRSH 2GX4A 3K65B 1C4V2 8LPRA 2OLGA 3H7OA 3RC5A 4X6NA 3CENA 3M5OA 5EQQA 1AFQC 1GBKA 3GOVB 3HK6B 5C3NA 2ANKH 3GCHB 3A82A 1B7XB 1PPGE 2Z9IA 1MTWA 2XXLA 1TONA 1SGCA 2F9BH 2O8LA 3N7OA 3UTUH 4AZ2B 3A7WA 1ELBA 3FANA 1GVKB 2Q6DA 2IOTA 2VGCB 1C5YB 4UFDH 4IC5A 4TYDA 1F5LA 4HGCA 3SZNA 2AGGX 3SI4H 2OBOA 3U1IB 3UNSA 1QB9A 2YNAA 3Q3XA 3F1SB 3D23A 1PPEE 2VH6A 4X1SU 4K5ZA 1JRTA 1V2LT 2BDCA 1DX5M 3FVFB 3MWIU 3RMLH 4CR9A 1UVPA 3ZVFA 2EA3A 4UE7H 4AG1A 3SJ8A 4CREA 1WSSH 2W3IA 1ZRKA 2WV5A 1EZXC 4AOQA 1AVWA 2EI8A 1VGCC 1C2GA 3RXLA 8ESTE 4INHA 3TH3H 3SW2B 1GGDB 4AN7A 3L3TA 3TK6A 3IITA 4WMFA 4GLYA 2VIWA 1EASA 4AX9H 1SMFE 3K6YA 5GPIB 1Z6EA 9ESTA 3DHKH 5EXNA 4X2YA 1P3EA 3S0NA 5DP8A 2VIVA 1O5AB 1O37A 1ZYOA 1YCPM 1V2OT 4ZAEA 4DCDA 1GHWH 4X6PA 2GZ7A 2AIPA 1VZQH 1IQFA 1ELCA 5FCRA 4UD9H 3QO6A 2CHAC 1C5XB 3LJOA 1QA7A 3BTEE 1DDJA 1UTNA 2RG3A 4YT7H 1A5GH 4D8NA 5A2MH 5LPRA 3TJNA 1TALA 4B75A 3QLPH 1HIAB 2UWOA 3M5MA 1EAWA 5DK1A 5HGGA 2C90B 1EX3A 1CVWH 2OQUA 2FTLE 4DIHH 3SJKA 1ETRH 3BTGE 2PKAA 3Q3KA 1CO7E 2G51A 1ELTA 2FYRA 4X2WA 2VVCA 4MNYA 2HVXA 3JZ2B 3U9AH 1CE5A 3ENSB 3P17H 4BNRA 3TK9A 4JYVH 1QNJA 1QBNA 1Y5BT 2OBQA 2XYAA 3ZZ8A 1CGIE 3TGKE 3MNCA 2XBXA 5FPYA 3NUMA 2V35A 3RM0H 2XBWA 1BBRE 1GHZA 1BZXE 1S5SA 2R3YA 4D9QA 1HPGA 1TPOA 3KGPA 1KXCA 1P2NA 3SQEE 4Q7ZA 3OYPA 2BD8A 3U8OH 1FV9A 3KQDA 2FOBA 3C1KA 4NIXA 4X6OA 1QY6A 1PQ5A 4TY6A 1C2IA 4F4OC 1C4U2 2Y5GA 3TLOA 1GJ5H 1HRTH 3SGBE 1W8BH 3F6UH 1AKSA 1G30B 2SNWA 5HMAA 1GL0E 4X1NU 3LPRA 5L2ZH 1O3GA 2ZG0H 1RTKA 1YPJH 3ZZ3A 2C93B 4IGDA 3KHVA 5HM9A 2A4QA 2Z9KA 1O2ZA 5EG4A 1GI2A 1M9UA 4JZIA 1TBQH 2FXRA 3U98H 1EAUA 2XWBI 3RXIA 2B8OH 1EXFA 1NRRH 1C5VA 1SQAA 3RXHA 4O3UA 3A89A 1B0FA 3OTJE 1TNLA 1Z8RA 3P6ZB 3ODDA 1TGCA 3TK5A 2ZTZA 1C1MA 3TITA 4KP0A 1TA6A 2ZU3A 3P95A 3ZVEA 3L33A 1THPB 3B9FH 1MCVA 4DURA 1HFDA 1YBWA 1G3DA 2HPQH 4Z6AH 3ESTA 1E35B 1GBEA 4CR5A 3MHWU 7KMEH 3RXKA 2PW8H 1KXDA 3ZVCA 5FX5A 1E37B 2Y81A 3EQ0H 1TNIA 2QY0B 4BOHA 5CE1A 1TIOA 1BA8B 3LJJA 1PPFE 3CP7A 1VCPA 3SNEA 1TNHA 1O2TA 3T28A 1ZGIA 2NU1E 3UOUA 3SNDA 2ANMH 2WYJA 4E7RG 1NFWA 2O9QA 2BZ6H 5BRRE 4AFUA 2J38A 3GY5A 1EJNA 3BTME 1QB6A 1CGJE 1KIGH 3LGVA 4XFQA 1BRAA 2J2UA 1UVSH 1MTVA 1L1NA 4FUJA 2VB0A 1W10U 4MPXA 1YPGH 2FX4A 1C5MD 1JIMA 1C5SA 1O2OA 2QCYA 1F7ZA 1AFQB 1WTHD 4Q7XA 3PMBB 2BD7A 2OUAA 5DP5A 2OC1A 2TRMA 4J2YB 3STJA 3VPKA 3MU1A 3PB1E 3KN2A 1O3OA 4MNWA 5CMXH 1Z6JH 2ZHEH 1EOLA 3BEUA 2ANYA 5GWZA 2GCHF 1C5ZB 3UPEA 1UK4A 1NFUA 2TGDA 4JZEH 5DP9A 3EA8A 5EODA