1NTPA

Use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA02
2KAIA 1O2SA 2VINA 4K69A 2GZ8A 2BYAX 2PW8H 4J1YA 1P01A 3EQ0H 2OQUA 1QJ6B 1D3DB 1O38A 3FP6E 1P2NA 3MU5A 2JKHA 3BG4C 5I46H 4CREA 1UTPA 2BXUH 1L1GA 2QXIA 2V6NA 1ZJKA 1O31A 4JK5A 2ZU5A 5GXPA 1ELAA 4NGAH 4OS7A 3OU0A 1F92A 1P04A 1IHSH 4WH8A 3TNTA 4X1NU 1P12E 1DT2A 2AGGX 1WSSH 1AE8H 1F5RA 3A83A 1PPZA 1O2NA 1YM0A 3SGAE 4IC6A 2H6MA 4Q80A 1AU8A 1LKBA 1EZUC 6GCHF 3PMJA 5C1XA 1P09A 2OCVB 3LJJA 3KIDU 1DSUA 1A0LA 1P2KA 2C3SA 4XBDA 3MH4A 3ZV9A 4CRBA 1Y5UT 3MU1A 1TOCB 1C2DA 1C1TA 5G4BA 4XDEA 3SJIA 5F6MA 1EAXA 2ZU4A 3BSQA 3FP8E 4GLYA 3A7ZA 3UQVA 2OXSA 3NXPA 1TRNA 1AQ7A 4E06H 1TLDA 2BX3A 4FUCA 1YPMH 1FV9A 1BRAA 4Q7ZA 6GCHG 2Z9LA 1GI8B 2ZDVH 5DKMA 4B73A 3SU5A 5DPAA 2A4GA 2PSYA 4XBCA 1C5PA 4TWWA 1SLVB 1V6DA 1W3CA 4TY6A 2J94A 1TNKA 5J4SA 1AZZA 2BY9X 3RXSA 5E2OA 4FU7A 2W7UA 1FAXA 5A8ZA 5JBTA 4DURA 1QBOA 1QR3E 1TWXB 1C5WB 1BJVA 1S0RA 2JH5D 2ZTYA 3MNSA 3EGKH 1VJAU 1XVMA 1Y5BT 4NFEA 1HIAB 1T31A 1CGHA 1H9IE 2PUQH 2V3HH 1EB2A 4X2VA 1G3CA 2PGBB 3SGQE 1GWAA 1L4DA 3T2NA 1XUGA 3UNRA 2FOAA 2ZKSA 4BAOB 2QC2A 3SOSA 1DANH 1ANEA 3AAUA 2I6SA 1ZJDA 4FVBA 4VGCC 4Q7XA 3STJA 4FUFA 3BTDE 1DXPA 1KXBA 1UVPA 3E90B 1AO5A 1GBHA 2P95A 2BLOA 4RKJB 2Y6TA 1K1PA 2XBVA 1Q2WA 1OWKA 2A7CA 1AD8H 5J4QA 4I7YH 2A5KA 1HAOH 1Z8JB 3QLPH 3FAOA 3MHWU 2D2DA 3EYDA 1GI2A 2XCNA 2GCHG 2P8OB 1TRMA 2BD5A 1IQMA 2BY7X 1BCUH 1QRXA 3RM0H 4LZ4B 1O2KA 1SPJA 4ISIH 1BRCE 1C2KA 3RXFA 1QB6A 1QTFA 4A7IB 1QHRB 3AVZA 1A5HA 3RXIA 1E35B 2OUAA 5C5OA 1SGNE 3SUFA 1A0JA 3JZ2B 2EC9H 3A81A 1HCGA 2XBWA 1DSTA 1O5EH 3A7TA 3ATMA 1OWDA 4ISOA 2JETC 3NZIA 3W95A 4Y79A 2ODQA 2ZGHA 1EASA 4LXBH 1GBKA 4M7GA 1L0ZA 4X2YA 1P8VC 1FY8E 4BNRA 2CV3A 1AGJA 1MQ6A 3ZZ9A 1C5UA 2A7JA 3OX7U 5CHAC 1WV7H 4X1QU 1C1NA 1GMDG 5E2PA 1XMNB 1CE5A 1FN8A 1GBFA 1QL9A 2NU0E 3ENSB 1LPGB 3K6ZA 3BEUA 3GY8A 3P95A 4WH6A 1S6HA 2P59A 3F9HA 1GI9B 2XC4A 1FPHH 3VB3A 3CS7A 3FP7E 1SG8B 3QO6A 1GBTA 2Q1JA 3RXHA 2GT8A 1AWHB 3MO9A 1BHXF 4ZROA 1L1NA 1KTSB 1O3NA 3AW1A 2BD8A 4THNH 1W0YH 1BQYA 1T4UH 1TRYA 1K1IA 1O34A 2VVVA 4FUJA 4BAMB 1AVXA 2CHAB 4DOQA 3TIUA 2W5EA 3S69A 3RXGA 1Z8IB 1HLTH 1HJAB 1C5RA 3RXCA 1O0DH 1QGFA 3HKIB 3ZVAA 4JZ1A 3P8FA 5JBBS 4KTCA 1C5OH 1GJDB 4X6PA 3D49H 3QTVH 1FUJA 2ZHEH 3R3GB 2YNBA 1LDTT 1GVKB 2CGAA 3MNXA 1C1UH 2WPIS 2VWOA 2ZDLA 1IHTH 1XXDA 1O36A 3T62A 1PQ8A 4TY7A 1GHAG 1X7AC 3SQHE 1ELTA 1XUHA 2AFQB 4LK4A 1QBNA 2BZ6H 4O3TA 4AG1A 3F9FA 3WY8A 3SN8A 1MKXH 1A0HB 1PPHE 2H1UA 4ABEA 3RMLH 1PPCE 5PTPA 5JYIA 1AVWA 2ZFTA 1GPZA 3QUMP 1DY8A 4I8LA 3U1IB 3S7KB 1GI7B 3QX5H 1NRQH 1GHBF 4NA7A 5ABWA 1CGIE 3QN7A 3PO1B 1Z1IA 3VXFH 1ZLRA 3OTJE 1GCTC 3RXVA 3SU4A 3LC5A 1Y3YA 2GD4B 1HXEH 2WPJS 1T8MA 2EI8A 2F91A 1F0SA 4YOJA 1WAYB 1MKWK 1JIRA 3I29A 2QIQA 3UQOA 2WINI 5E0GA 1SGTA 1ETTH 1TOMH 4NZQA 1E36B 1N8OC 1NRNH 2XC5A 4UDWH 1ZRKA 1YBWA 4WWYA 4D9RA 5C5NA 1LPZB 2ZEBA 5GCHF 1GHBG 3LJOA 3TGIE 1QA0A 5EG4A 5DP7A 4FUGA 1O5DH 1B5GH 1TNIA 4DG4A 1ZSJA 4DIHH 3RC5A 4CBOA 1BT7A 1EB1H 1NU7B 3MO3A 4CH8B 1GJ7B 5GCHG 1GHVH 3RLYH 1RS0A 1O3EA 1QFKH 5FBIA 4AOQA 1QQUA 2PKSC 2Z9KA 1O3CA 1GG6C 1NO9H 1LHFH 4X6OA 2FS8A 1TNHA 3LH1A 2Y5FA 2C8WB 4JYVH 4AYVB 1KDQB 2W26A 1IAUA 4ZKSU 4FU9A 3SUGA 1GVZA 2ZGCA 2FPZA 4B2BA 1Y8TA 1QL7A 4X0WU 3NK8A 1A61H 2B5TB 2BZAA 1OOKB 3BTFE 1VGCB 1QIXB 2RA3A 9ESTA 2F83A 3M5OA 1GI4A 4MPXA 1SB1H 1CSOE 2FTLE 1PPGE 1DWEH 4K8BA 1C1WH 2PFEA 3SJKA 2BDYA 1TX8A 2VH6A 2PGQB 2WUBA 5FBEA 3KQCA 2VIPA 3BG4B 3HGNA 1QURH 2QGRA 3CP7A 1D6RA 1GDQA 1P0SH 5F8TA 1DLKB 1GJ5H 5DP5A 3HK3B 1GDUA 1BTYA 2RA0A 1BA8B 3SBKA 3S9BA 4ABGA 1VZQH 2FOCA 4XFQA 1S5SA 1ABIH 2OQ5A 4UFEH 2H9TH 3S7HB 1AFQC 1Y3UA 2PKAB 2VIOA 2DE8A 1K21H 4AB8A 1BTWA 1YPLH 1OP0A 1QRWA 4O97A 1D3TB 2XTTB 3SHCH 2BY5X 4FU8A 2HNTE 1Y3WA 4ZKNU 1ZR0A 3DFJA 1P2QA 4B76A 1OX1A 4CRFA 1C2LA 1TE0A 5LPEA 1TGNA 2BVRH 2B0FA 3MI4A 1TFXA 1YYY1 4O9VA 1A2CH 4AFUA 3RXPA 5E0JA 1W12U 1UK3A 1SLXB 1C5LH 1YF4A 1O3GA 1OWJA 2GVFA 3RXLA 5HYOA 4A1VA 4ZMAH 3GISB 5AFYH 1TGSZ 1LVOA 1KLTA 3V7TA 1RTLA 1CQQA 2QXGA 1T4VH 4Y0YE 1Q31A 2GP9B 4GCHF 1ELVA 1V3XA 4ABFA 1GBBA 5C1UA 1UVOA 2O8LA 3PROA 1SGFA 2XW9A 1ARBA 2GTBA 5T3HA 1KDQA 2EEKA 3ZZ7A 5K7RA 1W11U 3BEIB 1Z1JA 2AEIH 2BVXH 1UTNA 3M5MA 4JZDH 1OSSA 1DUAA 3VEQB 2GDEH 2ANYA 1XKAC 4NA8A 4AGKA 1KXFA 1O3FA 1PPEE 4VGCB 1ELBA 1GI0A 1D6WA 4JZFH 1J16A 1TBRH 4RKOB 3SNBA 1O2OA 1SGQE 2WYGA 1AMHA 4INKA 1NRSH 1SFIA 1LPKB 4MNXA 3LDXH 1G3EA 1ZGIA 1O5BB 4D7FA 1ZPCA 2IPHA 3ZZAA 2P93A 3QDZB 4F49A 5JBCS 1JRTA 1S83A 5TJXA 3ATKA 3UREA 2IJOB 1EAWA 3NCLA 4K60A 4Y8YA 1MBQA 1P02A 4NZLA 3A8BA 3T26A 1O3PB 4BTIB 2JETB 2G5VA 4ZUHA 4NIWA 4AX9H 3PYHA 1F0RA 1MZDA 2J4IA 2PKAA 4MTBA 1BITA 1GMHF 1BB0B 1WTGH 1P2OA 2AH4X 1E37B 1C2IA 4ZHAA 2GX4A 1WQSA 1ORFA 1MTUA 3ZVBA 1C2FA 1B0EA 2ZC9H 5CHAB 5EU8A 3BTME 4BOHA 4AFQA 1SGRE 2TBSA 1WUNH 1ZOMA 5EODA 1SLWB 4YT6H 1V2RT 2F9OA 3A80A 1O2GH 3RXBA 1CA0C 5GDSH 1ANDA 1EZQA 3BN9A 3T29A 1SFQB 1RTKA 2WPHS 1GMHG 3GICB 2ZI2H 1SI5H 1P06A 3VGCC 1VCPA 1UCYH 3BTGE 1P2JA 2SFAA 2BDGA 1MTVA 2BMGB 4X1RU 4OGYA 1THSH 1NFXA 2BLWA 2FEQH 4CRAA 3V12A 1GHXH 1ELFA 2G00A 5AFZH 2BDCA 2AGEX 1W7XH 2SGEE 4A5TS 1N6XA 3I78A 3BIUH 1O2VA 1P9UA 1HBTH 1DFPA 2P94A 1LTOA 5IDKA 4H42U 2BB4A 2ZNKH 3SU0A 4H6TA 2C90B 2VIDA 2C8XB 4IN1A 3S0NA 1C4V2 2BY6X 2V35A 3ATLA 1O2IA 3ZZBA 1IQKA 1HYLA 1XUJA 1GJ8B 1N1LA 3EA7A 1DWBH 2AIQA 1O3MA 2Z9GA 1NN6A 1TABE 4DIIH 1GVLA 5EGMA 4H4FA 1UTQA 3Q00A 1V2JT 3U1JB 2B8OH 3LKWA 3MU0A 4GAWA 5I25A 3UR6A 1C5ZB 2XBXA 5A8YA 4ZKOU 1HAZB 2ZPSA 1GCTB 2OINA 1N6YA 4JYUH 3L3TA 4ZKRU 1SC8U 1WBGB 3TU7H 1GBEA 1KY9A 4BXWA 4K1SA 3KNXA 2ILNA 2XCFA 3PLBA 1PQ7A 3TH4H 3F9GA 1O30A 1E0FD 4MPVA 1EJAA 5A0BA 2ZCKP 2K1QA 1YPHE 1N8OB 1HGTH 1LO6A 2H9HA 2ZDNA 1HAIH 4X1PU 1GL1A 1XKBC 1EJNA 2FYRA 1QNJA 1OYTH 2ZDAH 3QZQA 4ABJA 4LOYH 2GMTC 2QY0B 3A8AA 2PHBA 4WMFA 4AFZA 4MVNA 8ESTE 3DD2H 1O2LA 4RSPA 1LVYA 2QCYA 2Z3DA 1MCTA 1BHXB 3RXOA 1LQDB 2CN0H 1ZHPA 2R0LA 5EPYA 1T32A 3FANA 3SV9A 3DA9B 3MU8A 1O2PA 1NT1A 3NKKA 1C5XB 2SGFE 1PQ5A 4X8UH 1CT2E 1V2PT 2A7HA 5JDUB 4NFFA 5GJ4B 1QJ7B 1A3EH 1AWFH 2PKSB 3U8OH 2A5AA 1EAIA 1L4ZA 5A0AE 1BOQA 1GG6B 4ZXXH 4D76A 2PUXB 2B9LA 4WXVA 1FY5A 1KLJH 5HGGA 3M7TA 1A3BH 2GCHF 2JH0D 4I31A 4IMZA 1C9TA 1W14U 1IQJA 1GL0E 2G52A 3CENA 4JZIA 2ZWLH 2Z6BD 1GI5A 1P57B 4JMYA 1ZTLA 1O2WA 5L30H 4WXIA 3ZVGA 2OLGA 1GI3A 5TCAA 3ZZ5A 3MH6A 2H5DA 2W7SA 2ASUB 3A82A 2QXHA 2A2QH 1H8IH 3SU3A 3SUEA 3LOXA 1DS2E 2ZPRA 1G2MA 4WVPE 1BJUA 2DE9A 5JB8S 1H9LB 5DP9A 4R0IA 5B6OA 1CHOG 2ZGBH 1JWTA 5JBAS 1ANCA 3RC6A 3A8DA 1GMDF 3TK5A 2ZHQH 3LONA 3E0NB 2F9NA 2WPKS 2XBYA 2W3IA 4HFPB 1O3OA 3MOCA 1WOFA 3A8CA 4CRGA 3M37A 3QZRA 1ETRH 2UUKB 1FQ3A 1TMUH 1YCPM 2VGCC 4YZUA 1AB9C 1CO7E 4NSYA 3M5NA 1PYTD 1AFQB 3VB4A 2OD3B 9LPRA 1SBWA 3L6PA 2PTNA 4Q2KA 4D7GA 1FI8A 2BVSH 3SW2B 5FPYA 1INCA 2AS9A 1A5GH 1SGDE 3N7OA 2Z9IA 2J92A 2OC1A 1EOLA 1C9PA 2ZTZA 1DUEA 4NIYA 1BRUP 4X2XA 3QK1A 1ZRBA 1JMOH 4B74A 3BEFB 4HI3A 3TK6A 2VH0A 2ZTXA 5LPRA 1V2LT 4SGAE 4UFGH 3ZVDA 2H5CA 1TX7A 4UFFH 1GHAF 1O2ZA 1SOZA 3GCHC 5ETXA 3GYLB 3RXJA 1P3CA 2GCTC 4BTUB 3RMOH 1AIXH 1K1LA 1S85A 4K1TA 2BQ6B 3PWBA 5C1YA 3D62A 1ACBE 3LT3A 1YGCH 1HIAA 3TH2H 6ESTA 1UK4A 4UONA 2AMQA 1TQ0B 1F0TA 3UWIA 1ESBA 1UTKA 1BTUA 3NUMA 4Y8ZA 1YP9A 4IGDA 2P3UB 1W7GH 2O9QA 4I8KA 1WU1A 4I8JA 4Y76A 1SVPA 2ANKH 1AHTH 2THFB 2AMDA 2FLBH 1G2LA 1BMLA 4O03A 1C2MA 1AY6H 4ZH8A 1THRH 1CGJE 3RMMH 4U01A 1O3HA 1KXCA 4BAKB 1HV7A 2QYIA 3Q76A 1C5MD 3LGWA 1MZAA 1V2OT 3EA9A 3MU4A 1W8BH 4KGAA 3A84A 3T5FH 4JK6A 3OY6U 1TBQH 2PR3A 2WUCA 1ZZZA 2IN2A 5A0CA 5ESTE 4TWYA 3SO3A 4ZHMU 2BHGA 4X8TH 3URCA 4A92A 1O5AB 4CHAC 1YCPK 4DGJA 1VR1H 1C1SA 1RTFB 3ZVEA 1NRPH 1HAYB 4IS5A 1G3BA 3A7XA 1D3PB 2FXRA 1OS8A 1EOJA 4UFDH 3VB6A 1MH0A 3GDVA 4XOJA 5DP3A 3NPSA 3SV7A 1DM4B 3HPTB 3VFEA 1GHYH 1EAUA 4XSKU 1V2ST 5AVDA 5E0HA 1J17T 3PLKA 1W2KH 3ZZ6A 1UTJA 1TX6A 3PMAB 3EDXB 2CF8H 3QGJA 1LVBA 2GZ7A 2UUFB 3FVFB 3U8RH 1ZSLA 4AFSA 1W0ZU 4Y10E 1Z8RA 1A7SA 3LU9B 2OP9A 5EPNA 2ALVA 2WYJA 2R9PA 3K6YA 1CA0B 1K9OE 5FX6A 5GWZA 3L33A 3SU2A 3QWCH 3GCTG 1LQEA 1MD7A 1MTWA 2F9VA 1GJ6A 1UO6A 1W10U 2Z9JA 4OS4A 2ZHFH 3VGCB 2O8MA 4WMDA 1EZXC 7LPRA 1DLEA 2A4RA 3G01A 4X6MA 2BY8X 4FUHA 1EUFA 2FOGA 5H4IB 2A1DB 1EPTC 5L6NH 1C1RA 3RU4T 3EAJA 1ZPBA 3A85A 4JYTA 5EQQA 5AF9H 1QQ4A 3UY9A 2HRVA 2SGPE 1O3DA 1TNJA 4Q7YA 4ZXYH 4YM9A 3RLWH 3O8BA 1Y3XA 1C2JA 1TGBA 2OTVA 2SNWA 1SHHB 1G36A 5GIBA 2QF0A 4X8SH 2R3UA 2UWPA 2Z3EA 2ZDKA 4R8TB 2ZF0H 2FM2A 1K2I1 4CH2B 1RFNA 2Z3CA 2QF3A 2Y7XA 3BTEE 1ELDE 3EE0B 2XNIA 2QV1A 4DVAU 1CT0E 2BOHB 3A7VA 3RXTA 3UWJH 1FMGA 3RMNH 1HJ8A 3TJVA 1ZMLA 3RM2H 2SGAA 3E3TA 1P03A 1TA6A 3M36A 2Q6FA 1QB1A 1LHGH 1EKBB 2FDAA 5DO4H 4QT8C 5FHTA 3GY5A 4MPWA 2NU2E 2Y80A 1MMJN 1DE7H 3QTOH 2R3YA 2I6QA 2WV5A 2HOBA 1TONA 1IQLA 1CBWC 3LGTA 1F5KU 5T6DA 3VB7A 3PMBB 1NESE 1TAWA 1SHYA 1YLCA 4MDSA 3AASA 3MNCA 1O2RA 1SGEE 2F9PA 1W13U 3JZ1B 4YLQH 4ABIA 1FIWA 1HUTH 1C5TA 5HM2A 2BD7A 1C4Y2 7ESTE 3SNCA 3EA8A 5L2ZH 1MKXK 1U6QA 4KKDA 1S81A 2VVCA 2G4UA 3RDZA 5DJ7A 2GMTB 1UMAH 3H7TA 1RIWC 2J2UA 1NFUA 2GZ9A 3MMGA 3P6ZB 3ODFA 2LPRA 3NWUA 1LHDH 3SNEA 2VWLA 1MTNC 2V3OH 1O5GH 1K28D 2QXJA 3MTYA 1UTLM 5DP8A 1C5VA 4TPIZ 1V2VT 4I33A 3BG8A 3F1SB 3VXEH 2TRMA 5DG6A 4XE4A 1UVSH 1HFDA 5GPIB 1C2HA 3P17H 3STIA 5FCRA 1F7ZA 2FI4E 5A2MH 4IC5A 1GBAA 3RXUA 2A4QA 3GDSA 2PLXA 4NIVA 1OWIA 1XXFA 1FNIA 1C2GA 3LGYA 4MQAA 2BLQA 3PV4A 2G8TA 1RD3B 3SNDA 3ZZ8A 4ISHH 2G81E 3AAVA 1GMCF 1T8OA 1QA7A 1ZPZA 4FXGH 1DY9A 2ZP0H 1IQNA 4CR9A 3T27A 4I8GA 3BTWE 1Y59T 3SV8A 2D26C 3U98H 5FXLA 7GCHG 1QRZA 4SGBE 1BMMH 1J14A 1WTHD 3KCGH 1NPMA 3SORA 3TJUA 2BD2A 3AW0A 3SJOA 3TPIZ 2HNTF 1GBIA 3RXMA 1C1QA 1GJBB 1NM6A 1SGFG 1O2XA 5EXNA 2B7DH 1AVGH 1GMCG 2TIOA 2H9EH 1UTMA 4MPUA 2CMYA 3UR9A 8LPRA 4FUEA 2ESTE 2ZO3H 1A1RA 1Y3VA 1BBRE 1ZYOA 3KL6A 2VGCB 2V0BA 1KSNA 1B7XB 1FLEE 5EQRA 1AB9B 3M61U 1BTPA 1P05A 3SZNA 2QN5T 4OS5A 4E7NA 3E0PB 1C4U2 4O3UA 2G51A 2PV9B 5HM9A 3T25A 1BUIA 1K1JA 4GVUA 1O37A 1Y5AT 4BAQB 3RU4E 2GV6A 4K1EA 1DDJA 1A5IA 4OS2A 1ESTA 1TMTH 1O3KA 3E8LA 5C20A 1MUEB 4XBBA 1DX5M 4JCNA 3ELAH 1IQIA 1TALA 3SNAA 2GV7A 4DCDA 3E1XB 3A88A 4KTUA 2ZDMA 1TQ7B 1E34B 4BTTB 3I77A 3GCHB 1MQ5A 3BTQE 1V2TT 1B0FA 1P3EA 3TH3H 2GCTB 1BTXA 1UCYE 1O33A 2P3FH 5C67A 1O3JA 1XX9A 3UOUA 4NCYA 2BD9A 3RC4A 3SGBE 4YTAA 1H1BA 2O8TA 5DP6A 2VWMA 3C1KA 4AN7A 1SGIB 1V2NT 2F9UA 2FO9A 4OS1A 2HVXA 2A32A 3QGNB 2J38A 4MNYA 5FCKA 1JRSA 1C5SA 3LGIA 3GOVB 4HTCH 3SU1A 2BX4A 2ZU3A 3BTKE 1PPBH 4E05H 1K1NA 1OYQA 4TYDA 1HAGE 1NROH 2NU4E 1P2IA 3RXRA 3LGVA 1O2YA 1JXPA 3C27B 4JZEH 2HNTC 1SGYE 3V3MA 4CBNA 2XRCA 2BLVA 1QY6A 1Z8GA 1ZMNA 4DT7B 2FMJA 3A86A 1S82A 3PM3A 1T8NA 2ODYB 4ASHA 2EA3A 2CXVA 4X2WA 2VB0A 4CHAB 2BD3A 5T6GA 4X8VH 2ZFPH 3URDA 1ABJH 3O8DA 5C2ZA 3U69H 2ALPA 1FXYA 3TGKE 4A1XA 2BM2A 1GI6A 2VVUA 2FYQA 5AHGH 2CF9H 5FPTA 2Z94A 1MU6B 1QL8A 3BF6H 3VB5A 3O8RA 3SHAH 1FPCH 2ZU2A 2HPPH 4F4OC 2GT7A 2NU1E 1L1JA 1UVTH 4KTSA 1CVWH 2WPMS 1V2QT 1NU9A 3M7QA 2A45B 2VU8E 1ESAA 2ZFSA 1YPEH 2FOHA 4GPGA 1XVOA 2M5TA 1P10A 3RXDA 3M3VA 3UPEA 1XM1A 4E7RG 3KQEA 3GY2A 3K2UA 3U8TH 1SSXA 1GBLA 1O3AA 1MAYA 2DUCA 3K65B 1QBVH 1C1PA 1UJ1A 1P9SA 1GGDC 3ZVCA 1BBRK 2Y7ZA 4A6LA 1JOUB 1Z6EA 2ANWA 7KMEH 4B1TA 1A46H 1DITH 1ZSKA 2PSXA 4BAHB 2FX6A 2XWBI 1ID5H 1YPJH 3TLOA 1FAKH 1GBJA 1OKXA 1KXAA 1YCPH 3LC3A 3ZYEA 1EPTB 1CHOF 1MKWH 5BRRE 4AZ2B 1EZSC 4IMQA 4U30A 3T28A 1KXDA 2QAAA 2BQ7B 1TIOA 4UD9H 5A8XA 1BTZA 1HJ9A 3R0FA 1O5CB 1RJXB 2TGDA 1TBZH 4ZAEA 3F68H 4ZHLU 2C93B 1ARCA 3GDUA 2TGTA 1PYTC 3H5CB 1G9IE 1MTSA 4YO9A 1AFEH 3P8GA 4Z0KA 1D9IA 1O35A 3LIWA 2PTCE 2A4OA 1NC6A 4GSOA 2ODPA 4WMEA 3GY4A 2ZFQH 1C5YB 3UUZA 2TGAA 1AUTC 5EXLA 1VJ9U 3K9XB 3S9CA 5DK1A 5IYTA 1YPGH 4NWLA 4UE7H 4HGCA 4UEHH 2IOTA 2NWNA 1BTHH 1UCYK 4WY3A 3ITIA 1V2KT 2STAE 2XYAA 2YOLA 3MFJA 3B8JA 4CR5A 3D23A 1SQTA 1CBWB 4OGXA 2A2XH 2TPIZ 2AYWA 3V0XA 4Y7BA 1SL3A 2D1JA 4YOIA 1GJCB 3DHKH 4MNWA 3E91A 3RU4D 2A0QB 5F8ZA 1EJMA 1OPHB 2ZQ1A 1UK2A 3P92A 1IQHA 1PFXC 1BRBE 2PWXA 1IQFA 1O3BA 3TVJB 4AB9A 2STBE 1KLIH 4B2AA 4K5ZA 1TNLA 3TJOA 1RIWB 4OS6A 2TGPZ 4PROA 1M9UA 4WF8A 4AG2A 1BMAA 5F03A 3ZZ3A 3A7WA 1MTNB 2ZGJA 1DWCH 1O2TA 6CHAC 3PWCA 1RGQA 1J8AA 3SJ8A 3PLPA 5LPFA 1FDPA 1GBCA 4AYYB 3DFLA 1XUFA 3ZV8A 2UWOA 1V2UT 2FI5E 5FX5A 3A7YA 1HB0B 3U9AH 2GGVB 3MWIU 3RXAA 5EW2H 3SV2H 1FONA 5L2YH 3SJ9A 4ABHA 5K0HA 1EPTA 1QJ1B 1ZHRA 2EI6A 3HGPA 3DUXH 1C1OA 2BDHA 2G5NA 1SR5C 1MCVA 1NRRH 4B71A 1GJ4H 2A5IA 3IG6B 4I32A 4ISNA 2F3CE 2YNAA 1K1OA 1TPPA 1J9CH 1AUJA 2FS9A 2EI7A 1S0QA 1JIMA 1O2MA 1YPHC 2ZA5A 2VIVA 4KELA 2J95A 1DICA 3GCNA 2GDDA 3KQDA 5LGOA 4ABDA 1C5NH 1MD8A 3B9FH 1FZZA 3RXQA 2ZFRH 2BDIA 1HDTH 3Q77A 4DY7B 2Q6DA 1Z6JH 2ZHDA 2H2ZA 5CMXH 2RG3A 2UUYA 2R2MB 3GY3A 3MNBA 4WJG2 3RXKA 1LHEH 1G37A 1KYNA 1ELGA 1AKSB 4GHTA 4AGJA 5EOKA 1O32A 1TMBH 2ZIQH 2F9BH 1TYNA 1G3DA 1EP6A 1SLUB 2OC7A 4RN6A 1THPB 1P11E 4A1TA 2WPLS 4TPYA 1OWHA 2ZQ2A 3GCTF 4X1SU 3M7UA 1S6FA 1CA8B 2AMPA 2FOBA 4ESTE 1TGCA 1G32B 3ODDA 2Z7FE 4NIXA 4GHQA 3SQEE 2BQWB 2ZECA 1GI1A 3Q3XA 5BPEA 1GHZA 3M3SA 1LVMA 3LH3A 3FZDA 2BXTH 1ZGVA 2Q6GA 4Y0ZE 1BDAA 1NZQH 3M35A 1EP5A 3TK9A 1VCWA 1YPKH 3RP2A 3M3TA 1G30B 3PTBA 4AORA 2FI3E 2ZPQA 3ATIA 3B23B 1EX3A 4HZHA 1YC0A 3LGUA 5FPSA 3F9EA 1YLDA 4IBLH 4ABBA 1LMWB 3BTTE 3MH7A 1FIZA 1C5QA 5FAHA 4LZ1H 1C2EA 1ZHMA 1TGTA 1S84A 1KIGH 4H6SB 2FTMA 3MH5A 2D8WA 2LNCA 4U32A 1JBUH 2R2WU 2J34A 4DJZB 2SGQE 1Z71A 4K2YA 1HRTH 2G4TA 4Y71A 5C3NA 4MLFB 5LH8A 1CU1A 2JH6D 3FFGA 2G55A 1UHBB 2XC0A 5JPMH 3S9AA 1OP8A 2AERH 1HXFH 3OY5U 5DP4A 3CS0A 1MBMA 4BXSA 3SU6A 1O2QA 1GJ9B 4NG9H 1F0UA 2O8UA 2SNVA 1WQVH 2P8OC 4Y8XA 2FOEA 2Y81A 1ELEE 1SMFE 1NFYA 2ANMH 1F5LA 3H7OA 3DT0H 2FIRH 3SI4H 3BV9B 1F2SE 5HXFA 1Z7KA 3UNSA 5EW1H 2Y5HA 1Q3XA 4ISLA 1IQGA 2BOKA 1MU8B 1OWEA 3MYWA 4CRDA 1AKSA 1IOEA 3HK6B 3KN2A 3M5LA 3UTUH 4U2WA 1NTPA 1HAVB 2ZU1A 1PPFE 4ABAA 3GYMA 5A09A 3BIVH 4FVDA 3UIRA 1V2MT 1CT4E 3ZVFA 1FY4A 1K1MA 3BTHE 1GBDA 2AGIX 3P8OA 1XUKA 3KGPA 1UVUH 1MAXA 5E8EH 4I8HA 1ZMJA 2VIQA 1VITH 2ZGXH 5EXMA 4MNVA 2ZFFH 5HMAA 4YLUA 1HAPH 3GY6A 1GHWH 2RCEA 3OSYA 2ZCLP 3UOPA 4X6NA 3Q3KA 5T6FA 1GJAB 4Y6DA 2SGDE 2FWWA 2ZHWH 3KQBA 1HNEE 1LCYA 1IQEA 1TB6H 3SUDA 3A87A 1A4WH 2CHAC 1GGDB 2XWAA 3E6PH 1HJAC 1GBMA 2C4FH 1RRKA 7GCHF 1J15A 2OC0A 2FP7B 3SI3H 3FZZA 4IN2A 1LKAA 1PJPA 1LHCH 3KHVA 3ZZCA 4INHA 1HAHH 1O5FH 5JB9S 1BMNH 4GUXA 4YT7H 4CRCA 4B75A 3IWMA 4K3JA 5F8XA 2ZG0H 4MG3A 3KEEA 4Z6AH 1DPOA 5EQSA 2P16A 1WYKA 1WCZA 3Q3YA 4FUIA 1DOJA 2KAIB 2FLRH 4D8NA 8KME2 1GCDA 3IITA 3A89A 2GKVE 2HLCA 2O8WA 2QA9E 4J2YB 3F6UH 3UFAA 3HKJB 1E38B 3PB1E 1YKTA 1O2UA 1P2MA 2VJ1A 4NSVA 3UNQA 3VPKA 1ANBA 1CHGA 1O3LA 2HWLB 2BDBA 1UHBA 4GCHG 4B2CA 1VITF 1DWDH 2FODA 1NFWA 1EQ9A 2C8ZB 3LPRA 1ZTKA 1TPSA 1VCQA 3PMHB 1UTOA 3PO1C 5SGAE 2HALA 4YESB 3W94A 2NU3E 3ESTA 1EXFA 3TNSA 5TCCA 2BD4A 3P70B 1RXPA 1NY22 1PQAA 3RXEA 1SGPE 1O39A 2A31A 2UUJB 1BBRH 1T7CA 1ZTJA 1BIOA 3GCOA 2BDAA 3D65E 5DGJA 1GDNA 1KXEA 1HAXB 1QB9A 2W3KA 1TA2A 2Y5GA 2C8YB 2P3TB 2BTCE 2J9NA 4FUDA 1VITG 3ZYDA 1HAVA 1O2HA 2FOMB 3P8NA 4FUBA 3HATH 1QCPA 1K22H 1C1VH 2FZZA 1KTTB 1L2EA 1AI8H 3TGJE 2ULLA 2VIWA 3OYPA 1BZXE 1OXGA 1DVAH 3RUOA 1AE5A 1HPGA 3PTNA 1SQOA 4BANB 1FN6A 5CE1A 3KF2A 3E16B 2OBOA 4KP0A 2OBQA 3V13A 1NS3A 2FOFA 2VWNA 1AZ8A 1FY1A 4NA9H 1O3IA 2OC8A 2R0KA 8GCHF 3SV6A 1ETSH 4Y7AA 6CHAB 1D4PB 2ZZUH 4D9QA 2RDLA 4IW4E 3MO6A 1TPAE 3GY7A 2WV4A 1T8LA 1FY3A 3ATWA 5ESBA 1OP2A 4Y11E 1H8DH 1C1MA 4K8YA 1ELCA 1O2JA 1TNGA 2XXLA 4NWKA 2Y82A 1D3QB 3TITA 2HPQH 2FX4A 1EATA 3ZZ4A 3O8CA 3ZZDA 2CJIA 1SGCA 1SOTA 2VNTA 1TPOA 1DXWA 2AIPA 2ZCHP 2FESH 2UWLA 4INLA 1V2WT 4YOGA 1FJSA 1H4WA 1H9HE 8GCHG 1AN1E 3TJNA 6LPRA 1SQAA 1VGCC 1XUIA 2HGTH 4DW2U
chains in the Genus database with same CATH superfamily
2KAIA 1O2SA 2VINA 4K69A 2GZ8A 2BYAX 2PW8H 4J1YA 1P01A 3EQ0H 2OQUA 1QJ6B 1D3DB 1O38A 3DSOA 3FP6E 1P2NA 3MU5A 2JKHA 3BG4C 3DSGA 5I46H 4CREA 1UTPA 2BXUH 1L1GA 2QXIA 2V6NA 1E1RD 1ZJKA 1O31A 4JK5A 2ZU5A 5GXPA 1ELAA 4NGAH 4OS7A 3OU0A 1F92A 1P04A 1IHSH 4WH8A 3TNTA 5GNDA 4X1NU 1P12E 1DT2A 2AGGX 1WSSH 1AE8H 1F5RA 3A83A 1PPZA 1O2NA 1YM0A 3SGAE 4IC6A 2H6MA 4Q80A 1AU8A 1LKBA 1EZUC 6GCHF 3OTPA 3PMJA 5C1XA 1P09A 2OCVB 3LJJA 3KIDU 1WDIA 1DSUA 1A0LA 1P2KA 2C3SA 3PV5A 4XBDA 3MH4A 3ZV9A 4CRBA 1Y5UT 3MU1A 1TOCB 1C2DA 1C1TA 5G4BA 4XDEA 3SJIA 5F6MA 1EAXA 2ZU4A 3BSQA 3FP8E 4GLYA 3A7ZA 3UQVA 2OXSA 4ACBA 3NXPA 1TRNA 1AQ7A 4OM9A 4E06H 1TLDA 2BX3A 2V7QD 4FUCA 1YPMH 1FV9A 1BRAA 4Q7ZA 6GCHG 2Z9LA 1GI8B 2ZDVH 5DKMA 4B73A 3SU5A 5DPAA 2A4GA 2PSYA 4XBCA 1C5PA 4TWWA 1SLVB 1V6DA 1W3CA 4TY6A 2J94A 1TNKA 5J4SA 1AZZA 2BY9X 2J98B 3RXSA 5E2OA 4FU7A 2W7UA 1FAXA 5A8ZA 5JBTA 4DURA 1QBOA 1QR3E 1TWXB 1C5WB 1BJVA 1S0RA 2JH5D 2ZTYA 3MNSA 3EGKH 1VJAU 1XVMA 1Y5BT 4NFEA 1HIAB 1T31A 1CGHA 1H9IE 2PUQH 2V3HH 4XD7D 1EB2A 4X2VA 1G3CA 2PGBB 3SGQE 1GWAA 1L4DA 3T2NA 2JJ1D 1XUGA 3UNRA 2FOAA 2ZKSA 4BAOB 2QC2A 3SOSA 1DANH 1ANEA 3AAUA 2I6SA 1ZJDA 2IJD1 4FVBA 4VGCC 4Q7XA 3STJA 4FUFA 3BTDE 1DXPA 1KXBA 1UVPA 3E90B 1AO5A 1GBHA 2P95A 2BLOA 4RKJB 2Y6TA 1K1PA 2XBVA 1Q2WA 1OWKA 2A7CA 1AD8H 5J4QA 4I7YH 2A5KA 1HAOH 2K8IA 1Z8JB 3QLPH 3FAOA 3MHWU 2D2DA 3EYDA 1GI2A 2XCNA 3F2HA 2GCHG 2P8OB 1TRMA 2BD5A 1IQMA 2BY7X 1BCUH 1QRXA 3RM0H 4LZ4B 1O2KA 1SPJA 4ISIH 1BRCE 1C2KA 3RXFA 1QB6A 1QTFA 4A7IB 1QHRB 3AVZA 1A5HA 3RXIA 1E35B 2OUAA 5C5OA 1SGNE 3SUFA 1A0JA 3JZ2B 2EC9H 3A81A 3WW7A 1HCGA 2XBWA 1DSTA 1O5EH 3A7TA 3ATMA 1OWDA 4ISOA 2JETC 3NZIA 3W95A 4Y79A 2ODQA 2ZGHA 1EASA 4LXBH 1GBKA 4M7GA 1L0ZA 4X2YA 1P8VC 1FY8E 2LELA 4BNRA 2CV3A 1AGJA 1MQ6A 3ZZ9A 1C5UA 2A7JA 3OX7U 5CHAC 1WV7H 4X1QU 1C1NA 1GMDG 5E2PA 4DT4A 1XMNB 1CE5A 1FN8A 1GBFA 1QL9A 2NU0E 3ENSB 1LPGB 3K6ZA 3BEUA 3GY8A 4F55A 3P95A 4WH6A 1S6HA 2P59A 3F9HA 1GI9B 2XC4A 1FPHH 3VB3A 3CS7A 3FP7E 1SG8B 3QO6A 1GBTA 2Q1JA 4Q63A 3RXHA 2GT8A 1AWHB 3MO9A 1BHXF 4ZROA 1L1NA 1KTSB 1O3NA 3AW1A 2BD8A 4YXWD 4THNH 1W0YH 1BQYA 1T4UH 1TRYA 1K1IA 1O34A 2VVVA 4FUJA 4BAMB 1AVXA 2CHAB 4DOQA 3TIUA 2W5EA 3S69A 3RXGA 1Z8IB 1HLTH 1HJAB 1C5RA 3RXCA 1O0DH 1QGFA 3HKIB 3ZVAA 2KM0A 4JZ1A 3P8FA 5JBBS 4KTCA 1C5OH 1GJDB 4Q4LA 4X6PA 3D49H 3QTVH 1FUJA 2ZHEH 4TT3D 3R3GB 5HKKD 2YNBA 1LDTT 1GVKB 2CGAA 3MNXA 1C1UH 2WPIS 2VWOA 2ZDLA 1IHTH 1XXDA 1O36A 3T62A 1PQ8A 4TY7A 1GHAG 1X7AC 3SQHE 1ELTA 1XUHA 2AFQB 4LK4A 1QBNA 2BZ6H 4O3TA 4AG1A 3F9FA 3WY8A 3SN8A 1MKXH 1A0HB 2L6OA 1PPHE 2H1UA 4ABEA 3RMLH 1PPCE 5PTPA 5JYIA 1AVWA 2ZFTA 1GPZA 3QUMP 1DY8A 4I8LA 3U1IB 4B6EA 3S7KB 1GI7B 3QX5H 1NRQH 1GHBF 4NA7A 5ABWA 1CGIE 3QN7A 3PO1B 1Z1IA 3VXFH 1ZLRA 3OTJE 1GCTC 3RXVA 3SU4A 3LC5A 1Y3YA 2GD4B 1HXEH 2WPJS 1T8MA 2EI8A 2F91A 1F0SA 4YOJA 1WAYB 1MKWK 1JIRA 3I29A 2QIQA 3UQOA 2WINI 5E0GA 1SGTA 1ETTH 1TOMH 4NZQA 1E36B 1N8OC 1NRNH 2XC5A 4UDWH 1ZRKA 1YBWA 4WWYA 4D9RA 5C5NA 1LPZB 2ZEBA 4XRNA 5GCHF 1GHBG 3LJOA 3TGIE 1QA0A 5EG4A 5DP7A 4FUGA 1O5DH 1B5GH 1TNIA 3OFND 3H09A 4DG4A 1ZSJA 4DIHH 3RC5A 4CBOA 1BT7A 1EB1H 1NU7B 3MO3A 4CH8B 1GJ7B 5GCHG 1GHVH 3RLYH 1RS0A 1O3EA 1QFKH 5FBIA 4AOQA 3W1EA 1QQUA 2PKSC 2Z9KA 1O3CA 1GG6C 1NO9H 1LHFH 4X6OA 2FS8A 1TNHA 3LH1A 2Y5FA 2C8WB 4JYVH 4AYVB 1KDQB 2W26A 1IAUA 4ZKSU 4FU9A 3SUGA 1GVZA 2ZGCA 2FPZA 4B2BA 1Y8TA 1QL7A 4X0WU 3NK8A 1A61H 2B5TB 2BZAA 2XNDD 1OOKB 3BTFE 1VGCB 1QIXB 2RA3A 9ESTA 2L74A 2F83A 3M5OA 1GI4A 4MPXA 1SB1H 1CSOE 2FTLE 1PPGE 1DWEH 4K8BA 1C1WH 2PFEA 3SJKA 2BDYA 1TX8A 2VH6A 2PGQB 2WUBA 5FBEA 3KQCA 2VIPA 3BG4B 3HGNA 1QURH 2QGRA 3CP7A 1D6RA 1GDQA 1P0SH 5F8TA 1DLKB 1GJ5H 5DP5A 3HK3B 1GDUA 1BTYA 2RA0A 1BA8B 5KECA 3SBKA 3S9BA 4ABGA 1VZQH 2FOCA 4XFQA 1S5SA 1ABIH 2OQ5A 4UFEH 2H9TH 3S7HB 3GS9A 3NRLA 1AFQC 1Y3UA 2KX4A 2PKAB 2VIOA 2DE8A 1K21H 4AB8A 1BTWA 1YPLH 1OP0A 1QRWA 4O97A 1D3TB 2XTTB 3SHCH 2BY5X 4FU8A 2HNTE 1Y3WA 4ZKNU 1ZR0A 3DFJA 1P2QA 4B76A 1OX1A 4CRFA 1C2LA 1TE0A 5LPEA 1TGNA 2BVRH 2B0FA 3MI4A 1TFXA 1YYY1 4O9VA 1A2CH 4AFUA 3RXPA 5E0JA 1W12U 1UK3A 5T1VA 1SLXB 1C5LH 1YF4A 1O3GA 1OWJA 2GVFA 3RXLA 5HYOA 4A1VA 4ZMAH 3GISB 5AFYH 1TGSZ 1BMFD 1LVOA 1KLTA 3V7TA 1RTLA 1CQQA 2QXGA 1T4VH 4Y0YE 1Q31A 2GP9B 4GCHF 1ELVA 1V3XA 4ABFA 1GBBA 5C1UA 1UVOA 2O8LA 3PRDA 3PROA 1SGFA 2XW9A 1ARBA 2GTBA 5T3HA 1KDQA 2EEKA 3ZZ7A 5K7RA 1W11U 3BEIB 1Z1JA 2AEIH 2BVXH 1UTNA 5EJ1A 3M5MA 4JZDH 1OSSA 1DUAA 3VEQB 2GDEH 2ANYA 1XKAC 4NA8A 4AGKA 1KXFA 1O3FA 1PPEE 4VGCB 1ELBA 1GI0A 1D6WA 4JZFH 1J16A 1TBRH 4RKOB 3SNBA 3FN8A 1O2OA 1SGQE 2WYGA 1AMHA 4INKA 1NRSH 1SFIA 1LPKB 4MNXA 3LDXH 1G3EA 1ZGIA 1O5BB 4D7FA 1ZPCA 2IPHA 3ZZAA 2P93A 3QDZB 4F49A 5JBCS 1JRTA 1S83A 5TJXA 3ATKA 3UREA 2IJOB 1EAWA 3NCLA 4K60A 4Y8YA 1MBQA 1P02A 4NZLA 3A8BA 2KCYA 3T26A 1O3PB 4BTIB 2JETB 2G5VA 4ZUHA 4NIWA 4AX9H 3PYHA 1F0RA 1MZDA 2J4IA 2PKAA 4MTBA 4AC9A 1BITA 1GMHF 1BB0B 1WTGH 1P2OA 2AH4X 1E37B 1C2IA 4ZHAA 2GX4A 1WQSA 1ORFA 1MTUA 3ZVBA 1C2FA 1B0EA 2ZC9H 5CHAB 5EU8A 3BTME 4BOHA 2IPQX 4AFQA 3KQ5A 1SGRE 2TBSA 1WUNH 1ZOMA 5EODA 1SLWB 4YT6H 1V2RT 2F9OA 3A80A 1O2GH 3RXBA 1CA0C 5GDSH 1ANDA 1EZQA 3BN9A 3T29A 1SFQB 1RTKA 2WPHS 1GMHG 2RDEA 3GICB 2ZI2H 1SI5H 1MABB 1P06A 3VGCC 1SKYE 1VCPA 2JIZD 1UCYH 3BTGE 1P2JA 2SFAA 2BDGA 1MTVA 2BMGB 4X1RU 4OGYA 1THSH 1NFXA 2BLWA 2FEQH 4CRAA 3V12A 1GHXH 1ELFA 2G00A 5AFZH 2BDCA 2AGEX 1W7XH 2SGEE 4A5TS 1N6XA 5CDFE 3I78A 3BIUH 1O2VA 1P9UA 1HBTH 1DFPA 2P94A 1LTOA 5IDKA 5KEDA 4H42U 2BB4A 2ZNKH 1FX0B 3SU0A 4H6TA 2C90B 2VIDA 2C8XB 4IN1A 3S0NA 1C4V2 2BY6X 2V35A 3UAIC 2WSSD 3ATLA 1O2IA 3ZZBA 1IQKA 1HYLA 1XUJA 1GJ8B 1N1LA 3EA7A 1DWBH 2AIQA 1O3MA 2Z9GA 1NN6A 2J97A 1TABE 4DIIH 1GVLA 5EGMA 4H4FA 1UTQA 3Q00A 1V2JT 3U1JB 2B8OH 3LKWA 3MU0A 4GAWA 5I25A 3UR6A 1C5ZB 2XBXA 5A8YA 4ZKOU 1HAZB 2ZPSA 3PV2A 1GCTB 2OINA 5DN6D 1N6YA 4JYUH 3L3TA 4P02A 1SC8U 1WBGB 4ZKRU 1GBEA 1KY9A 3TU7H 4BXWA 4K1SA 3KNXA 2ILNA 2XCFA 3PLBA 1PQ7A 3TH4H 3F9GA 1O30A 1E0FD 4MPVA 1EJAA 5A0BA 2ZCKP 3AK5A 2K1QA 1YPHE 1N8OB 1HGTH 1LO6A 2H9HA 2ZDNA 1HAIH 4X1PU 1GL1A 1XKBC 1EJNA 2FYRA 1QNJA 1OYTH 2ZDAH 3QZQA 4ABJA 4LOYH 2GMTC 2QY0B 3A8AA 2PHBA 4WMFA 4AFZA 4MVNA 8ESTE 3DD2H 1O2LA 4RSPA 1LVYA 2QCYA 2Z3DA 1MCTA 1BHXB 3RXOA 1LQDB 2CN0H 1ZHPA 2R0LA 5EPYA 1OHHD 1T32A 3FANA 3SV9A 3DA9B 3MU8A 1O2PA 1NT1A 3NKKA 1C5XB 2SGFE 1PQ5A 4X8UH 1CT2E 1V2PT 2A7HA 5JDUB 4NFFA 5GJ4B 1QJ7B 1A3EH 1AWFH 2PKSB 3U8OH 2A5AA 1EAIA 1L4ZA 5A0AE 1VKYA 1BOQA 1GG6B 4ZXXH 4D76A 2PUXB 2B9LA 4WXVA 1FY5A 1KLJH 5HGGA 3M7TA 1A3BH 2GCHF 2JH0D 4I31A 4IMZA 1C9TA 2KCOA 1W14U 1IQJA 1GL0E 2G52A 3CENA 4JZIA 2ZWLH 2Z6BD 1GI5A 1P57B 4JMYA 1ZTLA 3DCLA 1O2WA 5L30H 4WXIA 3ZVGA 2OLGA 1GI3A 5TCAA 3ZZ5A 3MH6A 2H5DA 2W7SA 2ASUB 3A82A 2QXHA 2A2QH 1H8IH 3SU3A 3SUEA 3LOXA 1DS2E 2ZPRA 1G2MA 4WVPE 1BJUA 2DE9A 5JB8S 1H9LB 5DP9A 4R0IA 5B6OA 1CHOG 2ZGBH 1JWTA 5JBAS 1ANCA 3RC6A 3A8DA 1GMDF 3TK5A 2ZHQH 3LONA 3E0NB 4M9FA 2F9NA 2WPKS 2XBYA 2W3IA 4HFPB 1O3OA 3FO8D 3MOCA 1WOFA 3A8CA 4CRGA 3M37A 3QZRA 1ETRH 2UUKB 1FQ3A 1TMUH 1YCPM 2VGCC 4ACAA 4YZUA 1AB9C 1CO7E 2HVYB 4NSYA 3M5NA 1PYTD 1AFQB 3VB4A 2OD3B 9LPRA 1SBWA 3L6PA 2PTNA 4Q2KA 4D7GA 1FI8A 2BVSH 3SW2B 5FPYA 1INCA 2AS9A 1A5GH 1SGDE 3N7OA 2Z9IA 2J92A 2OC1A 1EOLA 1C9PA 2ZTZA 1DUEA 4NIYA 1BRUP 4X2XA 3QK1A 1ZRBA 1JMOH 4B74A 3BEFB 2JJ2D 4HI3A 3TK6A 2VH0A 2ZTXA 5LPRA 1V2LT 5CHBA 4SGAE 4UFGH 4RI0A 3ZVDA 2H5CA 1TX7A 4UFFH 1GHAF 1O2ZA 1SOZA 3GCHC 5EJLA 5ETXA 3GYLB 2J5UA 3RXJA 1P3CA 2GCTC 2J98A 4BTUB 3RMOH 1AIXH 4RT1A 3F2GA 1K1LA 1S85A 4K1TA 2BQ6B 3PWBA 5C1YA 3D62A 1ACBE 3LT3A 1YGCH 1HIAA 3TH2H 6ESTA 1UK4A 4UONA 2AMQA 1TQ0B 1F0TA 3UWIA 1ESBA 1UTKA 1BTUA 3NUMA 4Y8ZA 1YP9A 4IGDA 2P3UB 1W7GH 2O9QA 4I8KA 1WU1A 4I8JA 4Y76A 1SVPA 2ANKH 1AHTH 2THFB 2AMDA 2FLBH 1G2LA 1BMLA 4O03A 2XOKD 1C2MA 1AY6H 4ZH8A 3SYJA 1THRH 1CGJE 3RMMH 4U01A 1O3HA 1KXCA 4BAKB 1HV7A 2QYIA 3Q76A 1C5MD 3LGWA 1MZAA 1V2OT 3EA9A 3MU4A 1W8BH 3PRBA 3SZEA 4KGAA 3A84A 3T5FH 4JK6A 3KYGA 3OY6U 1TBQH 2PR3A 2LP6A 2WUCA 1ZZZA 2IN2A 3N99A 5A0CA 5ESTE 4TWYA 3SO3A 4ZHMU 2BHGA 4X8TH 3URCA 4A92A 1O5AB 2K0QA 4CHAC 1YCPK 4DGJA 1VR1H 1C1SA 1RTFB 3ZVEA 1NRPH 1HAYB 4IS5A 1G3BA 3A7XA 1D3PB 2FXRA 1OS8A 1EOJA 3FKSD 4UFDH 3VB6A 1MH0A 3GDVA 4XOJA 5DP3A 3NPSA 3SV7A 1DM4B 3HPTB 3VFEA 1GHYH 1EAUA 4XSKU 1V2ST 5AVDA 5E0HA 1E79D 1J17T 3PLKA 1W2KH 3ZZ6A 1UTJA 1TX6A 3PMAB 4P00A 3EDXB 5F53A 2CF8H 3QGJA 1LVBA 2GZ7A 2UUFB 3FVFB 3U8RH 1ZSLA 4AFSA 1W0ZU 4Y10E 1Z8RA 1A7SA 3LU9B 2EQNA 2OP9A 5EPNA 2ALVA 2WYJA 2R9PA 1S6LA 1CA0B 1K9OE 3K6YA 2GJGA 5FX6A 5GWZA 3L33A 3SU2A 3QWCH 3GCTG 1LQEA 1MD7A 1MTWA 2F9VA 1GJ6A 1YY3A 1UO6A 1W10U 2Z9JA 4OS4A 2ZHFH 3VGCB 2O8MA 4WMDA 1EZXC 7LPRA 1DLEA 2A4RA 3G01A 4X6MA 2BY8X 4FUHA 1EUFA 2FOGA 3N7EA 5H4IB 2A1DB 1EPTC 5L6NH 1C1RA 3RU4T 3EAJA 3F2FA 1ZPBA 3A85A 4JYTA 5EQQA 5AF9H 1QQ4A 3UY9A 2HRVA 2SGPE 1O3DA 1TNJA 4Q7YA 4ZXYH 4YM9A 3RLWH 3O8BA 1Y3XA 1C2JA 1TGBA 2OTVA 2SNWA 1SHHB 1G36A 5GIBA 2QF0A 4X8SH 2R3UA 2UWPA 2Z3EA 2ZDKA 4R8TB 2ZF0H 2FM2A 1K2I1 4CH2B 1RFNA 2Z3CA 2QF3A 2Y7XA 3BTEE 1ELDE 3EE0B 2XNIA 2QV1A 4DVAU 1CT0E 2BOHB 3A7VA 3RXTA 3UWJH 1FMGA 3EE7A 1HJ8A 3RMNH 3TJVA 1ZMLA 3RM2H 2SGAA 2WV9A 3E3TA 1P03A 1TA6A 3M36A 2Q6FA 1QB1A 1LHGH 1EKBB 2FDAA 5DO4H 4QT8C 5FHTA 3GY5A 4MPWA 1QZ8A 2NU2E 2Y80A 1MMJN 1DE7H 3QTOH 2R3YA 2I6QA 2WV5A 2HOBA 1TONA 1IQLA 1CBWC 5EIYA 3LGTA 1F5KU 2KZ4A 5T6DA 3DSPA 2W6JD 3VB7A 3PMBB 2WPDD 1NESE 1TAWA 1SHYA 1YLCA 4MDSA 3AASA 3MNCA 1O2RA 1SGEE 2F9PA 1W13U 3JZ1B 4YLQH 3MQKC 4ABIA 1FIWA 1HUTH 1C5TA 5HM2A 2BD7A 1C4Y2 7ESTE 3SNCA 3EA8A 5DSFA 5L2ZH 1MKXK 1U6QA 4KKDA 1S81A 2VVCA 2G4UA 3RDZA 5DJ7A 2GMTB 1UMAH 3H7TA 1RIWC 2J2UA 1NFUA 1YLNA 2GZ9A 3MMGA 2YMSC 3P6ZB 3ODFA 2LPRA 3NWUA 1LHDH 2KCAA 3SNEA 2VWLA 1MTNC 2V3OH 1O5GH 1K28D 2QXJA 3MTYA 1UTLM 5DP8A 1C5VA 4TPIZ 1V2VT 4I33A 3BG8A 3F1SB 3VXEH 2TRMA 4RT0A 5DG6A 4XE4A 1UVSH 3WWFA 1HFDA 5GPIB 1C2HA 3P17H 3STIA 5FCRA 1F7ZA 2FI4E 2WHXA 5A2MH 5C0UA 4IC5A 1GBAA 3RXUA 2A4QA 3GDSA 2PLXA 4NIVA 1OWIA 1XXFA 1FNIA 1C2GA 3LGYA 4MQAA 1EFRD 2BLQA 3PV4A 2G8TA 1RD3B 3SNDA 3ZZ8A 4ISHH 2G81E 3AAVA 1GMCF 1T8OA 1QA7A 1ZPZA 1W0KD 4FXGH 1DY9A 2ZP0H 1IQNA 4CR9A 2WZQA 5HIYA 3T27A 3U28C 4I8GA 3BTWE 1Y59T 3SV8A 2D26C 3U98H 5FXLA 7GCHG 1QRZA 4SGBE 1BMMH 1J14A 1WTHD 3KCGH 1NPMA 3SORA 3TJUA 2BD2A 3AW0A 3SJOA 3TPIZ 2HNTF 1GBIA 3RXMA 1C1QA 1GJBB 1NM6A 1SGFG 1O2XA 1COWD 5EXNA 2B7DH 1AVGH 1GMCG 2TIOA 2H9EH 1UTMA 4MPUA 2CMYA 3UR9A 8LPRA 4FUEA 2ESTE 2ZO3H 1A1RA 1Y3VA 1BBRE 1ZYOA 3KL6A 2VGCB 2V0BA 1KSNA 1B7XB 1FLEE 5EQRA 1AB9B 3M61U 1BTPA 1NBME 1P05A 3SZNA 2QN5T 4OS5A 4E7NA 3E0PB 1C4U2 4O3UA 2G51A 2PV9B 5HM9A 3T25A 1BUIA 1K1JA 4GVUA 1O37A 1Y5AT 4BAQB 3RU4E 2GV6A 4K1EA 1DDJA 1A5IA 4OS2A 1ESTA 5C0TA 1TMTH 1O3KA 4F48B 3E8LA 5C20A 1MUEB 4XBBA 1DX5M 4JCNA 3ELAH 1IQIA 1TALA 3SNAA 2GV7A 4DCDA 3E1XB 3A88A 4KTUA 2ZDMA 1TQ7B 5HIZA 1E34B 4BTTB 3I77A 3GCHB 1MQ5A 3BTQE 1V2TT 1B0FA 1P3EA 3TH3H 2GCTB 1YWUA 1BTXA 1UCYE 1O33A 2P3FH 5C67A 1O3JA 1XX9A 3UOUA 4NCYA 2BD9A 3RC4A 3SGBE 5B6LA 4YTAA 1H1BA 2O8TA 3N7DA 5DP6A 2VWMA 3C1KA 4AN7A 1SGIB 1V2NT 2F9UA 2FO9A 1SQRA 4OS1A 2HVXA 2A32A 3QGNB 2J38A 4MNYA 5FCKA 1JRSA 1C5SA 1UW7A 3LGIA 4HG6A 3GOVB 4HTCH 3SU1A 2BX4A 2ZU3A 3BTKE 2PP6A 1PPBH 4E05H 1K1NA 1OYQA 4TYDA 3WWBA 1HAGE 1NROH 2NU4E 1P2IA 3RXRA 3LGVA 1O2YA 1JXPA 3C27B 4JZEH 2HNTC 1SGYE 3V3MA 4CBNA 2XRCA 2BLVA 1QY6A 3OAAD 1Z8GA 3UB0A 1ZMNA 4DT7B 2FMJA 3A86A 1S82A 3PM3A 1T8NA 2ODYB 4ASHA 2EA3A 2CXVA 4X2WA 2VB0A 4CHAB 2BD3A 5T6GA 4X8VH 2ZFPH 3URDA 5C17A 1ABJH 3O8DA 5C2ZA 3U69H 2ALPA 1FXYA 3TGKE 4A1XA 2BM2A 1GI6A 2VVUA 2FYQA 3FOAA 5AHGH 2CF9H 5FPTA 2KCPA 2Z94A 1MU6B 1QL8A 3BF6H 3VB5A 3O8RA 3SHAH 1FPCH 2ZU2A 2HPPH 4F4OC 2GT7A 2NU1E 1L1JA 1UVTH 4KTSA 1CVWH 2WPMS 1V2QT 1NU9A 3M7QA 2A45B 2VU8E 1ESAA 2ZFSA 3KYFA 1YPEH 2FOHA 4GPGA 1XVOA 2M5TA 1P10A 3RXDA 3M3VA 1W0JD 3UPEA 1XM1A 4E7RG 3KQEA 3GY2A 3K2UA 3OEED 3U8TH 1SSXA 1GBLA 1O3AA 1MAYA 2DUCA 3K65B 3OEHD 5C94A 1QBVH 1C1PA 1UJ1A 1P9SA 1GGDC 3ZVCA 1BBRK 2Y7ZA 4A6LA 1JOUB 1Z6EA 2ANWA 7KMEH 4B1TA 1A46H 1DITH 1ZSKA 2PSXA 4BAHB 2FX6A 2XWBI 1ID5H 1YPJH 3TLOA 1FAKH 1GBJA 1OKXA 1KXAA 1YCPH 3LC3A 3ZYEA 1EPTB 1CHOF 1MKWH 5BRRE 4AZ2B 5FL7D 1EZSC 4IMQA 4U30A 3T28A 1KXDA 2QAAA 2BQ7B 1TIOA 4UD9H 5A8XA 1BTZA 1HJ9A 3R0FA 4ASUD 1O5CB 1RJXB 2TGDA 1TBZH 4ZAEA 3F68H 4ZHLU 2C93B 2JDID 1ARCA 3GDUA 2TGTA 1PYTC 3H5CB 1E1QD 1G9IE 1MTSA 4YO9A 1AFEH 3P8GA 4Z0KA 1D9IA 1O35A 3LIWA 2PTCE 2A4OA 1NC6A 4GSOA 2ODPA 4WMEA 3GY4A 2ZFQH 1C5YB 3UUZA 2TGAA 1AUTC 5EXLA 1VJ9U 3K9XB 3S9CA 2V3MA 5DK1A 5IYTA 1YPGH 4NWLA 4UE7H 4HGCA 4UEHH 2IOTA 2NWNA 1BTHH 1UCYK 4WY3A 3F3BA 3ITIA 1V2KT 2STAE 2XYAA 2YOLA 1NBMD 3MFJA 3B8JA 4CR5A 3D23A 1SQTA 1CBWB 4OGXA 2A2XH 2TPIZ 2AYWA 3V0XA 4Y7BA 1SL3A 2D1JA 4YOIA 1GJCB 4FETA 3DHKH 4MNWA 3E91A 3RU4D 2A0QB 5F8ZA 1EJMA 1OPHB 2ZQ1A 1UK2A 3P92A 1IQHA 1PFXC 1BRBE 2PWXA 1IQFA 1O3BA 3TVJB 4AB9A 2STBE 1KLIH 4B2AA 4K5ZA 1TNLA 3TJOA 5IK2D 1RIWB 4OS6A 2TGPZ 2YMSB 4PROA 1M9UA 4WF8A 4AG2A 1BMAA 5F03A 3ZZ3A 3A7WA 1MTNB 2ZGJA 1DWCH 1O2TA 6CHAC 3PWCA 1RGQA 1J8AA 3SJ8A 3PLPA 5LPFA 1FDPA 1GBCA 3F0PA 4AYYB 3DFLA 1XUFA 3ZV8A 2UWOA 1V2UT 2FI5E 5FX5A 3A7YA 1HB0B 3U9AH 2GGVB 3MWIU 3RXAA 5EW2H 5KGOA 3SV2H 1FONA 5L2YH 3SJ9A 4ABHA 5K0HA 1EPTA 1QJ1B 1ZHRA 2EI6A 3HGPA 3DUXH 1C1OA 2BDHA 2G5NA 1SR5C 1MCVA 1NRRH 4B71A 1GJ4H 2A5IA 3IG6B 4I32A 4ISNA 2F3CE 2YNAA 3CNRA 1K1OA 1TPPA 1J9CH 1AUJA 2FS9A 2EI7A 1S0QA 1JIMA 1O2MA 1YPHC 2ZA5A 2KFWA 1H8HD 2VIVA 4KELA 2J95A 1DICA 3GCNA 2GDDA 3KQDA 5LGOA 4ABDA 1C5NH 1MD8A 3B9FH 1FZZA 3RXQA 2ZFRH 2BDIA 1HDTH 3Q77A 4DY7B 2Q6DA 1Z6JH 2ZHDA 2H2ZA 3VG8A 5CMXH 2RG3A 2UUYA 5EJZA 3OE7D 2R2MB 3GY3A 3MNBA 4WJG2 3RXKA 1LHEH 1G37A 1KYNA 1ELGA 1KMHB 1AKSB 4GHTA 4AGJA 5EOKA 1O32A 1TMBH 2ZIQH 2F9BH 1TYNA 1G3DA 1EP6A 2HLDD 1SLUB 2OC7A 4RN6A 1THPB 1P11E 4A1TA 2WPLS 4TPYA 1OWHA 2ZQ2A 3GCTF 4X1SU 3M7UA 1S6FA 1CA8B 2AMPA 2FOBA 4ESTE 1TGCA 1G32B 3ODDA 2Z7FE 4NIXA 4GHQA 4TSFD 3SQEE 2BQWB 2ZECA 1GI1A 3Q3XA 5BPEA 1GHZA 3M3SA 1LVMA 3LH3A 3FZDA 2BXTH 1ZGVA 2Q6GA 4Y0ZE 1BDAA 1NZQH 3M35A 1EP5A 3TK9A 1VCWA 1YPKH 3RP2A 3M3TA 1G30B 3PTBA 4AORA 2FI3E 2ZPQA 3ATIA 3B23B 1EX3A 4HZHA 1YC0A 3LGUA 5FPSA 3F9EA 1YLDA 4IBLH 4ABBA 1LMWB 3BTTE 3MH7A 1FIZA 1C5QA 2F43B 5FAHA 4LZ1H 1C2EA 1ZHMA 1TGTA 1S84A 1KIGH 4H6SB 2FTMA 3MH5A 2D8WA 2LNCA 4U32A 1JBUH 2R2WU 2J34A 4DJZB 2SGQE 1Z71A 4K2YA 1HRTH 2G4TA 4Y71A 5C3NA 3ZIAD 4MLFB 5LH8A 1CU1A 2JH6D 2M2AA 3FFGA 2G55A 1UHBB 2XC0A 5JPMH 3S9AA 1OP8A 2AERH 1HXFH 3OY5U 5DP4A 3CS0A 1MBMA 4BXSA 3SU6A 1O2QA 1GJ9B 4NG9H 1F0UA 2O8UA 2SNVA 1WQVH 2P8OC 4Y8XA 2FOEA 2Y81A 1ELEE 1SMFE 2RFKC 1NFYA 2ANMH 1F5LA 3H7OA 3DT0H 2FIRH 3SI4H 4ZCNA 3BV9B 1F2SE 5HXFA 1Z7KA 3UNSA 5EW1H 2Y5HA 1Q3XA 4ISLA 1IQGA 2BOKA 1MU8B 1OWEA 3MYWA 4CRDA 1AKSA 1IOEA 3HK6B 3KN2A 3M5LA 3UTUH 4U2WA 1NTPA 1HAVB 2ZU1A 1PPFE 2QF5A 4ABAA 3GYMA 5A09A 3BIVH 4FVDA 3UIRA 1V2MT 1CT4E 3ZVFA 1FY4A 1K1MA 3BTHE 1GBDA 2AGIX 3P8OA 1XUKA 3KGPA 1UVUH 1MAXA 5E8EH 4I8HA 1ZMJA 2VIQA 1VITH 2ZGXH 5EXMA 4MNVA 2ZFFH 5HMAA 4YLUA 1HAPH 3GY6A 1GHWH 2W6ID 2RCEA 3OSYA 2ZCLP 1K0HA 3UOPA 4X6NA 3Q3KA 5T6FA 1GJAB 1H8ED 4Y6DA 2SGDE 2FWWA 2QF4A 2ZHWH 3KQBA 1HNEE 1LCYA 1IQEA 1TB6H 3SUDA 3A87A 1A4WH 2CHAC 1GGDB 2XWAA 3E6PH 1HJAC 1GBMA 2C4FH 1RRKA 7GCHF 1J15A 2OC0A 2FP7B 3SI3H 3FZZA 4IN2A 1LKAA 1PJPA 1LHCH 3KHVA 3ZZCA 4I86A 4INHA 1HAHH 1O5FH 5JB9S 1BMNH 4GUXA 4YT7H 2QE7D 4CRCA 4B75A 3IWMA 4K3JA 5F8XA 2ZG0H 4MG3A 3KEEA 4Z6AH 1DPOA 5EQSA 2P16A 1WYKA 1WCZA 3F0OA 3Q3YA 1DOJA 4FOUC 2F4LA 4FUIA 2KAIB 2FLRH 4D8NA 2YMSD 8KME2 1GCDA 3IITA 3A89A 2GKVE 2HLCA 2O8WA 2QA9E 4J2YB 3F6UH 3UFAA 3HKJB 1E38B 3PB1E 1YKTA 1O2UA 1P2MA 2VJ1A 4NSVA 3UNQA 3VPKA 1ANBA 1CHGA 1O3LA 2HWLB 2BDBA 1UHBA 4GCHG 2OK5A 4B2CA 1VITF 1DWDH 2FODA 1NFWA 1EQ9A 2C8ZB 3LPRA 1ZTKA 1TPSA 1VCQA 3PMHB 1UTOA 3PO1C 5SGAE 2HALA 4YESB 3W94A 2NU3E 3ESTA 1EXFA 3TNSA 5TCCA 2BD4A 3P70B 1RXPA 1NY22 1PQAA 3RXEA 4Z1MD 1SGPE 1O39A 2A31A 2UUJB 1BBRH 1T7CA 1ZTJA 1BIOA 3GCOA 2BDAA 3D65E 5DGJA 1GDNA 1KXEA 1HAXB 1QB9A 2W3KA 1TA2A 2Y5GA 2C8YB 2P3TB 2BTCE 2J9NA 4FUDA 1VITG 3ZYDA 1HAVA 1O2HA 2FOMB 2VBCA 3P8NA 4FUBA 3HATH 1QCPA 1K22H 1WXRA 1C1VH 2FZZA 1KTTB 1L2EA 1AI8H 3TGJE 2ULLA 2VIWA 3OYPA 1BZXE 1OXGA 1DVAH 3RUOA 1AE5A 1HPGA 3PTNA 1SQOA 4BANB 1FN6A 5CE1A 3KF2A 3E16B 2OBOA 4KP0A 2OBQA 3V13A 1NS3A 2FOFA 2VWNA 1AZ8A 1FY1A 4NA9H 1O3IA 2OC8A 2R0KA 8GCHF 3SV6A 1ETSH 4Y7AA 6CHAB 2CK3D 1D4PB 2ZZUH 4D9QA 2KR7A 2EY4C 2RDLA 4IW4E 3MO6A 1TPAE 3GY7A 2WV4A 1T8LA 1FY3A 3ATWA 5ESBA 1OP2A 4Y11E 1H8DH 1C1MA 4K8YA 1ELCA 1O2JA 1TNGA 2XXLA 2AHME 4NWKA 2Y82A 1D3QB 3TITA 2HPQH 2FX4A 1EATA 3ZZ4A 3O8CA 3ZZDA 2CJIA 1SGCA 1SOTA 2VNTA 1TPOA 1DXWA 2AIPA 2ZCHP 2FESH 2UWLA 4INLA 1V2WT 4YOGA 1FJSA 1H4WA 1H9HE 8GCHG 1AN1E 3TJNA 6LPRA 1SQAA 1VGCC 1XUIA 4B6FA 2HGTH 4DW2U
chains in the Genus database with same CATH topology
2KAIA 1O2SA 2VINA 4K69A 2GZ8A 2BYAX 2PW8H 4J1YA 1P01A 3EQ0H 2OQUA 1QJ6B 1D3DB 1O38A 3FP6E 1P2NA 3MU5A 2JKHA 3BG4C 5I46H 4CREA 1UTPA 2BXUH 1L1GA 2QXIA 2V6NA 1ZJKA 1O31A 4JK5A 2ZU5A 5GXPA 1ELAA 4NGAH 4OS7A 3OU0A 1F92A 1P04A 1IHSH 4WH8A 3TNTA 4X1NU 1P12E 1DT2A 2AGGX 1WSSH 1AE8H 1F5RA 3A83A 1PPZA 1O2NA 1YM0A 3SGAE 4IC6A 2H6MA 4Q80A 1AU8A 1LKBA 1EZUC 6GCHF 3PMJA 5C1XA 1P09A 2OCVB 3LJJA 3KIDU 1DSUA 1A0LA 1P2KA 2C3SA 4XBDA 3MH4A 3ZV9A 4CRBA 1Y5UT 3MU1A 1TOCB 1C2DA 1C1TA 5G4BA 4XDEA 3SJIA 5F6MA 1EAXA 2ZU4A 3BSQA 3FP8E 4GLYA 3A7ZA 3UQVA 2OXSA 3NXPA 1TRNA 1AQ7A 4E06H 1TLDA 2BX3A 4FUCA 1YPMH 1FV9A 1BRAA 4Q7ZA 6GCHG 2Z9LA 1GI8B 2ZDVH 5DKMA 4B73A 3SU5A 5DPAA 2A4GA 2PSYA 4XBCA 1C5PA 4TWWA 1SLVB 1V6DA 1W3CA 4TY6A 2J94A 1TNKA 5J4SA 1AZZA 2BY9X 3RXSA 5E2OA 4FU7A 2W7UA 1FAXA 5A8ZA 5JBTA 4DURA 1QBOA 1QR3E 1TWXB 1C5WB 1BJVA 1S0RA 2JH5D 2ZTYA 3MNSA 3EGKH 1VJAU 1XVMA 1Y5BT 4NFEA 1HIAB 1T31A 1CGHA 1H9IE 2PUQH 2V3HH 1EB2A 4X2VA 1G3CA 2PGBB 3SGQE 1GWAA 1L4DA 3T2NA 1XUGA 3UNRA 2FOAA 2ZKSA 4BAOB 2QC2A 3SOSA 1DANH 1ANEA 3AAUA 2I6SA 1ZJDA 4FVBA 4VGCC 4Q7XA 3STJA 4FUFA 3BTDE 1DXPA 1KXBA 1UVPA 3E90B 1AO5A 1GBHA 2P95A 2BLOA 4RKJB 2Y6TA 1K1PA 2XBVA 1Q2WA 1OWKA 2A7CA 1AD8H 5J4QA 4I7YH 2A5KA 1HAOH 1Z8JB 3QLPH 3FAOA 3MHWU 2D2DA 3EYDA 1GI2A 2XCNA 2GCHG 2P8OB 1TRMA 2BD5A 1IQMA 2BY7X 1BCUH 1QRXA 3RM0H 4LZ4B 1O2KA 1SPJA 4ISIH 1BRCE 1C2KA 3RXFA 1QB6A 1QTFA 4A7IB 1QHRB 3AVZA 1A5HA 3RXIA 1E35B 2OUAA 5C5OA 1SGNE 3SUFA 1A0JA 3JZ2B 2EC9H 3A81A 1HCGA 2XBWA 1DSTA 1O5EH 3A7TA 3ATMA 1OWDA 4ISOA 2JETC 3NZIA 3W95A 4Y79A 2ODQA 2ZGHA 1EASA 4LXBH 1GBKA 4M7GA 1L0ZA 4X2YA 1P8VC 1FY8E 4BNRA 2CV3A 1AGJA 1MQ6A 3ZZ9A 1C5UA 2A7JA 3OX7U 5CHAC 1WV7H 4X1QU 1C1NA 1GMDG 5E2PA 1XMNB 1CE5A 1FN8A 1GBFA 1QL9A 2NU0E 3ENSB 1LPGB 3K6ZA 3BEUA 3GY8A 3P95A 4WH6A 1S6HA 2P59A 3F9HA 1GI9B 2XC4A 1FPHH 3VB3A 3CS7A 3FP7E 1SG8B 3QO6A 1GBTA 2Q1JA 3RXHA 2GT8A 1AWHB 3MO9A 1BHXF 4ZROA 1L1NA 1KTSB 1O3NA 3AW1A 2BD8A 4THNH 1W0YH 1BQYA 1T4UH 1TRYA 1K1IA 1O34A 2VVVA 4FUJA 4BAMB 1AVXA 2CHAB 4DOQA 3TIUA 2W5EA 3S69A 3RXGA 1Z8IB 1HLTH 1HJAB 1C5RA 3RXCA 1O0DH 1QGFA 3HKIB 3ZVAA 4JZ1A 3P8FA 5JBBS 4KTCA 1C5OH 1GJDB 4X6PA 3D49H 3QTVH 1FUJA 2ZHEH 3R3GB 2YNBA 1LDTT 1GVKB 2CGAA 3MNXA 1C1UH 2WPIS 2VWOA 2ZDLA 1IHTH 1XXDA 1O36A 3T62A 1PQ8A 4TY7A 1GHAG 1X7AC 3SQHE 1ELTA 1XUHA 2AFQB 4LK4A 1QBNA 2BZ6H 4O3TA 4AG1A 3F9FA 3WY8A 3SN8A 1MKXH 1A0HB 1PPHE 2H1UA 4ABEA 3RMLH 1PPCE 5PTPA 5JYIA 1AVWA 2ZFTA 1GPZA 3QUMP 1DY8A 4I8LA 3U1IB 3S7KB 1GI7B 3QX5H 1NRQH 1GHBF 4NA7A 5ABWA 1CGIE 3QN7A 3PO1B 1Z1IA 3VXFH 1ZLRA 3OTJE 1GCTC 3RXVA 3SU4A 3LC5A 1Y3YA 2GD4B 1HXEH 2WPJS 1T8MA 2EI8A 2F91A 1F0SA 4YOJA 1WAYB 1MKWK 1JIRA 3I29A 2QIQA 3UQOA 2WINI 5E0GA 1SGTA 1ETTH 1TOMH 4NZQA 1E36B 1N8OC 1NRNH 2XC5A 4UDWH 1ZRKA 1YBWA 4WWYA 4D9RA 5C5NA 1LPZB 2ZEBA 5GCHF 1GHBG 3LJOA 3TGIE 1QA0A 5EG4A 5DP7A 4FUGA 1O5DH 1B5GH 1TNIA 4DG4A 1ZSJA 4DIHH 3RC5A 4CBOA 1BT7A 1EB1H 1NU7B 3MO3A 4CH8B 1GJ7B 5GCHG 1GHVH 3RLYH 1RS0A 1O3EA 1QFKH 5FBIA 4AOQA 1QQUA 2PKSC 2Z9KA 1O3CA 1GG6C 1NO9H 1LHFH 4X6OA 2FS8A 1TNHA 3LH1A 2Y5FA 2C8WB 4JYVH 4AYVB 1KDQB 2W26A 1IAUA 4ZKSU 4FU9A 3SUGA 1GVZA 2ZGCA 2FPZA 4B2BA 1Y8TA 1QL7A 4X0WU 3NK8A 1A61H 2B5TB 2BZAA 1OOKB 3BTFE 1VGCB 1QIXB 2RA3A 9ESTA 2F83A 3M5OA 1GI4A 4MPXA 1SB1H 1CSOE 2FTLE 1PPGE 1DWEH 4K8BA 1C1WH 2PFEA 3SJKA 2BDYA 1TX8A 2VH6A 2PGQB 2WUBA 5FBEA 3KQCA 2VIPA 3BG4B 3HGNA 1QURH 2QGRA 3CP7A 1D6RA 1GDQA 1P0SH 5F8TA 1DLKB 1GJ5H 5DP5A 3HK3B 1GDUA 1BTYA 2RA0A 1BA8B 3SBKA 3S9BA 4ABGA 1VZQH 2FOCA 4XFQA 1S5SA 1ABIH 2OQ5A 4UFEH 2H9TH 3S7HB 1AFQC 1Y3UA 2PKAB 2VIOA 2DE8A 1K21H 4AB8A 1BTWA 1YPLH 1OP0A 1QRWA 4O97A 1D3TB 2XTTB 3SHCH 2BY5X 4FU8A 2HNTE 1Y3WA 4ZKNU 1ZR0A 3DFJA 1P2QA 4B76A 1OX1A 4CRFA 1C2LA 1TE0A 5LPEA 1TGNA 2BVRH 2B0FA 3MI4A 1TFXA 1YYY1 4O9VA 1A2CH 4AFUA 3RXPA 5E0JA 1W12U 1UK3A 1SLXB 1C5LH 1YF4A 1O3GA 1OWJA 2GVFA 3RXLA 5HYOA 4A1VA 4ZMAH 3GISB 5AFYH 1TGSZ 1LVOA 1KLTA 3V7TA 1RTLA 1CQQA 2QXGA 1T4VH 4Y0YE 1Q31A 2GP9B 4GCHF 1ELVA 1V3XA 4ABFA 1GBBA 5C1UA 1UVOA 2O8LA 3PROA 1SGFA 2XW9A 1ARBA 2GTBA 5T3HA 1KDQA 2EEKA 3ZZ7A 5K7RA 1W11U 3BEIB 1Z1JA 2AEIH 2BVXH 1UTNA 3M5MA 4JZDH 1OSSA 1DUAA 3VEQB 2GDEH 2ANYA 1XKAC 4NA8A 4AGKA 1KXFA 1O3FA 1PPEE 4VGCB 1ELBA 1GI0A 1D6WA 4JZFH 1J16A 1TBRH 4RKOB 3SNBA 1O2OA 1SGQE 2WYGA 1AMHA 4INKA 1NRSH 1SFIA 1LPKB 4MNXA 3LDXH 1G3EA 1ZGIA 1O5BB 4D7FA 1ZPCA 2IPHA 3ZZAA 2P93A 3QDZB 4F49A 5JBCS 1JRTA 1S83A 5TJXA 3ATKA 3UREA 2IJOB 1EAWA 3NCLA 4K60A 4Y8YA 1MBQA 1P02A 4NZLA 3A8BA 3T26A 1O3PB 4BTIB 2JETB 2G5VA 4ZUHA 4NIWA 4AX9H 3PYHA 1F0RA 1MZDA 2J4IA 2PKAA 4MTBA 1BITA 1GMHF 1BB0B 1WTGH 1P2OA 2AH4X 1E37B 1C2IA 4ZHAA 2GX4A 1WQSA 1ORFA 1MTUA 3ZVBA 1C2FA 1B0EA 2ZC9H 5CHAB 5EU8A 3BTME 4BOHA 4AFQA 1SGRE 2TBSA 1WUNH 1ZOMA 5EODA 1SLWB 4YT6H 1V2RT 2F9OA 3A80A 1O2GH 3RXBA 1CA0C 5GDSH 1ANDA 1EZQA 3BN9A 3T29A 1SFQB 1RTKA 2WPHS 1GMHG 3GICB 2ZI2H 1SI5H 1P06A 3VGCC 1VCPA 1UCYH 3BTGE 1P2JA 2SFAA 2BDGA 1MTVA 2BMGB 4X1RU 4OGYA 1THSH 1NFXA 2BLWA 2FEQH 4CRAA 3V12A 1GHXH 1ELFA 2G00A 5AFZH 2BDCA 2AGEX 1W7XH 2SGEE 4A5TS 1N6XA 3I78A 3BIUH 1O2VA 1P9UA 1HBTH 1DFPA 2P94A 1LTOA 5IDKA 4H42U 2BB4A 2ZNKH 3SU0A 4H6TA 2C90B 2VIDA 2C8XB 4IN1A 3S0NA 1C4V2 2BY6X 2V35A 3ATLA 1O2IA 3ZZBA 1IQKA 1HYLA 1XUJA 1GJ8B 1N1LA 3EA7A 1DWBH 2AIQA 1O3MA 2Z9GA 1NN6A 1TABE 4DIIH 1GVLA 5EGMA 4H4FA 1UTQA 3Q00A 1V2JT 3U1JB 2B8OH 3LKWA 3MU0A 4GAWA 5I25A 3UR6A 1C5ZB 2XBXA 5A8YA 4ZKOU 1HAZB 2ZPSA 1GCTB 2OINA 1N6YA 4JYUH 3L3TA 4ZKRU 1SC8U 1WBGB 3TU7H 1GBEA 1KY9A 4BXWA 4K1SA 3KNXA 2ILNA 2XCFA 3PLBA 1PQ7A 3TH4H 3F9GA 1O30A 1E0FD 4MPVA 1EJAA 5A0BA 2ZCKP 2K1QA 1YPHE 1N8OB 1HGTH 1LO6A 2H9HA 2ZDNA 1HAIH 4X1PU 1GL1A 1XKBC 1EJNA 2FYRA 1QNJA 1OYTH 2ZDAH 3QZQA 4ABJA 4LOYH 2GMTC 2QY0B 3A8AA 2PHBA 4WMFA 4AFZA 4MVNA 8ESTE 3DD2H 1O2LA 4RSPA 1LVYA 2QCYA 2Z3DA 1MCTA 1BHXB 3RXOA 1LQDB 2CN0H 1ZHPA 2R0LA 5EPYA 1T32A 3FANA 3SV9A 3DA9B 3MU8A 1O2PA 1NT1A 3NKKA 1C5XB 2SGFE 1PQ5A 4X8UH 1CT2E 1V2PT 2A7HA 5JDUB 4NFFA 5GJ4B 1QJ7B 1A3EH 1AWFH 2PKSB 3U8OH 2A5AA 1EAIA 1L4ZA 5A0AE 1BOQA 1GG6B 4ZXXH 4D76A 2PUXB 2B9LA 4WXVA 1FY5A 1KLJH 5HGGA 3M7TA 1A3BH 2GCHF 2JH0D 4I31A 4IMZA 1C9TA 1W14U 1IQJA 1GL0E 2G52A 3CENA 4JZIA 2ZWLH 2Z6BD 1GI5A 1P57B 4JMYA 1ZTLA 1O2WA 5L30H 4WXIA 3ZVGA 2OLGA 1GI3A 5TCAA 3ZZ5A 3MH6A 2H5DA 2W7SA 2ASUB 3A82A 2QXHA 2A2QH 1H8IH 3SU3A 3SUEA 3LOXA 1DS2E 2ZPRA 1G2MA 4WVPE 1BJUA 2DE9A 5JB8S 1H9LB 5DP9A 4R0IA 5B6OA 1CHOG 2ZGBH 1JWTA 5JBAS 1ANCA 3RC6A 3A8DA 1GMDF 3TK5A 2ZHQH 3LONA 3E0NB 2F9NA 2WPKS 2XBYA 2W3IA 4HFPB 1O3OA 3MOCA 1WOFA 3A8CA 4CRGA 3M37A 3QZRA 1ETRH 2UUKB 1FQ3A 1TMUH 1YCPM 2VGCC 4YZUA 1AB9C 1CO7E 4NSYA 3M5NA 1PYTD 1AFQB 3VB4A 2OD3B 9LPRA 1SBWA 3L6PA 2PTNA 4Q2KA 4D7GA 1FI8A 2BVSH 3SW2B 5FPYA 1INCA 2AS9A 1A5GH 1SGDE 3N7OA 2Z9IA 2J92A 2OC1A 1EOLA 1C9PA 2ZTZA 1DUEA 4NIYA 1BRUP 4X2XA 3QK1A 1ZRBA 1JMOH 4B74A 3BEFB 4HI3A 3TK6A 2VH0A 2ZTXA 5LPRA 1V2LT 4SGAE 4UFGH 3ZVDA 2H5CA 1TX7A 4UFFH 1GHAF 1O2ZA 1SOZA 3GCHC 5ETXA 3GYLB 3RXJA 1P3CA 2GCTC 4BTUB 3RMOH 1AIXH 1K1LA 1S85A 4K1TA 2BQ6B 3PWBA 5C1YA 3D62A 1ACBE 3LT3A 1YGCH 1HIAA 3TH2H 6ESTA 1UK4A 4UONA 2AMQA 1TQ0B 1F0TA 3UWIA 1ESBA 1UTKA 1BTUA 3NUMA 4Y8ZA 1YP9A 4IGDA 2P3UB 1W7GH 2O9QA 4I8KA 1WU1A 4I8JA 4Y76A 1SVPA 2ANKH 1AHTH 2THFB 2AMDA 2FLBH 1G2LA 1BMLA 4O03A 1C2MA 1AY6H 4ZH8A 1THRH 1CGJE 3RMMH 4U01A 1O3HA 1KXCA 4BAKB 1HV7A 2QYIA 3Q76A 1C5MD 3LGWA 1MZAA 1V2OT 3EA9A 3MU4A 1W8BH 4KGAA 3A84A 3T5FH 4JK6A 3OY6U 1TBQH 2PR3A 2WUCA 1ZZZA 2IN2A 5A0CA 5ESTE 4TWYA 3SO3A 4ZHMU 2BHGA 4X8TH 3URCA 4A92A 1O5AB 4CHAC 1YCPK 4DGJA 1VR1H 1C1SA 1RTFB 3ZVEA 1NRPH 1HAYB 4IS5A 1G3BA 3A7XA 1D3PB 2FXRA 1OS8A 1EOJA 4UFDH 3VB6A 1MH0A 3GDVA 4XOJA 5DP3A 3NPSA 3SV7A 1DM4B 3HPTB 3VFEA 1GHYH 1EAUA 4XSKU 1V2ST 5AVDA 5E0HA 1J17T 3PLKA 1W2KH 3ZZ6A 1UTJA 1TX6A 3PMAB 3EDXB 2CF8H 3QGJA 1LVBA 2GZ7A 2UUFB 3FVFB 3U8RH 1ZSLA 4AFSA 1W0ZU 4Y10E 1Z8RA 1A7SA 3LU9B 2OP9A 5EPNA 2ALVA 2WYJA 2R9PA 3K6YA 1CA0B 1K9OE 5FX6A 5GWZA 3L33A 3SU2A 3QWC