1NTPA

Use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
molecule keywords BETA-TRYPSIN
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA02
1W8BH 1Z8RA 3SJ8A 3S0NA 1S83A 1SGRE 3DA9B 1FJSA 1F5LA 3MU5A 5C3NA 5EG4A 4O3TA 1C2LA 3D62A 1L0ZA 4AX9H 4K8BA 1SG8B 2AIPA 4MPVA 3GY2A 2XWBI 2BZ6H 3GICB 5H4IB 1J9CH 3M35A 3SJ9A 1O2MA 4IC6A 1GG6B 1GCTB 3TGIE 2FOCA 2ODPA 3BEFB 1O3HA 1YPHC 4Q2KA 1MTVA 3KQDA 1EJNA 1N6XA 1ETSH 1ANEA 1PYTC 1T8LA 1GJAB 4WY3A 2OQUA 2SGQE 1P0SH 3F9EA 3NK8A 3KGPA 2XNIA 3EE0B 1ELTA 2BVSH 2VIWA 4K69A 1TNIA 1C2FA 2OC8A 5C1XA 2OLGA 1O3NA 1QBNA 4FUDA 5T3HA 1ZPZA 4ZMAH 1BTWA 3VGCB 1MTNC 2BLOA 1TGSZ 3GISB 1WCZA 3M3SA 4WMFA 1LPGB 3S9CA 1RS0A 4XFQA 2ZU1A 1OP8A 1AKSA 3BF6H 1MZAA 1C2JA 5EXLA 3RXKA 1BRAA 3ZVAA 2DUCA 1SQTA 4ISIH 3U8RH 3SJOA 2Z3DA 1K2I1 4CHAC 4H6SB 2HVXA 4MG3A 1GJ6A 1D3TB 3KCGH 3RXJA 4AFUA 2QF3A 1BDAA 2FOAA 3QGJA 4UDWH 2QC2A 3PWCA 1EAWA 1NRNH 2G52A 4GLYA 1PQ5A 3KL6A 3TITA 4AGJA 1CA0C 1GBLA 2A7JA 4CR9A 1MTNB 5AVDA 1HAYB 1WU1A 2ODYB 2FZZA 1GDQA 1AU8A 1PQ7A 1TNLA 2BDBA 3PMJA 3SJKA 1MQ6A 3TK6A 1Y5BT 3RDZA 2Y81A 3F68H 1RGQA 2J2UA 1CT4E 5A09A 1TONA 1AFQB 1FV9A 3UIRA 3BTFE 1HV7A 3TK5A 3Q3YA 1V2TT 2ZDKA 4U32A 2BDGA 4MNVA 4B1TA 1BMLA 2QYIA 1Z7KA 3A80A 4I33A 5EPNA 1WBGB 5C1UA 2GMTC 1GDUA 1GVZA 1T8MA 3MI4A 4BTUB 2BLWA 1FN8A 5E8EH 2VJ1A 2WV5A 1IQNA 1Y5UT 1KLIH 3QLPH 3K6ZA 4CREA 5A0AE 1KXDA 2PKAB 1A5GH 4X6PA 3MO3A 1K1IA 5FBIA 2FI4E 3SGBE 1F0TA 1W3CA 4HZHA 2HNTC 1UHBA 2VH6A 4ABBA 5DP9A 3NXPA 3OTJE 5DGJA 3LGTA 4IN1A 4JCNA 4AN7A 1SQOA 2J95A 2G8TA 1UMAH 1B5GH 3K65B 4THNH 5L30H 2NWNA 1XMNB 1TA6A 2Z6BD 1CHOF 2YNBA 2R9PA 1A3EH 1LHCH 4CRFA 3V3MA 1IHTH 3SV2H 3DT0H 2ZFFH 1EZXC 2A45B 2NU2E 4GHQA 1UTKA 2ESTE 3GY3A 3KF2A 3M7TA 5GIBA 3SV7A 1S84A 1C1MA 2ZWLH 1P2IA 2D1JA 1GL1A 3I29A 1F5RA 2PW8H 4Y7AA 5EOKA 2UUKB 3KQBA 4UFGH 2ZHFH 5HM9A 1O32A 3P95A 4K8YA 1NU9A 1P2KA 4ZKNU 4KP0A 5A8XA 2VIDA 1C1VH 1TIOA 2ZHQH 2GMTB 1MTUA 5C67A 4MPUA 2D8WA 3MOCA 4XBBA 3RLYH 1ESBA 5JBAS 2BXTH 4BXSA 1V2ST 1BMNH 3E0NB 2G00A 5DP6A 1V6DA 5T6GA 1O2HA 2ZF0H 3ZZ8A 2A0QB 1TABE 1BITA 4DOQA 1V2MT 1TB6H 2NU1E 1MD8A 1H8IH 4UONA 1YCPM 1YPHE 2EI6A 1O5CB 3TJNA 4CRAA 1AUJA 4MNYA 2GX4A 1GMHF 3SNEA 5JB8S 1ZRKA 2VNTA 3UY9A 3SU6A 1SGYE 1O3KA 2ZCKP 3RXMA 1MU8B 1GMCF 4FUFA 2KAIB 2AMPA 3M5NA 2Y5HA 1V2KT 3SV9A 1HAOH 1LHEH 2PSXA 3HKJB 1H1BA 1XUJA 2XRCA 3U98H 4O03A 1GWAA 2GDEH 1HFDA 4LZ4B 2Z3EA 2ZGBH 5FHTA 2BD3A 3PB1E 3PLPA 1BTHH 3A85A 2JH5D 4VGCB 2A5KA 1ZMNA 1UCYE 2ZKSA 3A84A 1PPGE 1HDTH 2ZPSA 2M5TA 2F91A 4ISLA 2W7SA 5SGAE 2QA9E 4ESTE 2Y6TA 5DJ7A 5A2MH 4ZKSU 4E05H 1SFIA 2EI8A 2Z3CA 3MH4A 1DWBH 2SGEE 3KQEA 4K3JA 1GJ8B 4X8SH 2G5VA 3M5OA 3HGNA 3GCHC 1KIGH 3NPSA 2ZTXA 2BX3A 2BDIA 3WY8A 1HAGE 4AYVB 3MTYA 1Y5AT 2OC7A 1AB9C 1UHBB 2FESH 2H5DA 4X2XA 3VB3A 4AG1A 1EP6A 1QFKH 3RMMH 2O9QA 1DVAH 5IYTA 1VCWA 2P3FH 3QO6A 5DP8A 1CA8B 1FY1A 1P2QA 3V13A 4CRDA 4OGXA 2IJOB 3HPTB 1JMOH 2ANYA 3ZV8A 4BXWA 3A82A 1QJ7B 4ZUHA 1GI2A 5T6DA 3E91A 3N7OA 2TBSA 4FUHA 1GBIA 2PUQH 3MH5A 3E0PB 1GJ5H 1OWDA 2V35A 4B2AA 1E38B 1SI5H 1D3PB 1O2IA 3MNSA 2A5IA 2G51A 4NA7A 4ASHA 3E8LA 4JZDH 1OWIA 2FI5E 2WYJA 2BY7X 3QGNB 4X1NU 2SGFE 3MNBA 2OBOA 2VU8E 3S9AA 2H9HA 1AD8H 1KYNA 2CMYA 1MTSA 1P03A 1V2OT 1QJ6B 1W7XH 2BDYA 1BZXE 1A7SA 5DG6A 1P06A 2XBWA 1KXBA 1EOJA 1WUNH 3EA8A 3JZ2B 1LMWB 3A8CA 5DP5A 1OWEA 4DIIH 1BOQA 5EW1H 4K2YA 1NU7B 3SGAE 2ZTYA 4NFEA 1PFXC 4TYDA 3RXUA 1GGDB 1BIOA 4X6NA 3ZZ4A 1HPGA 3SUEA 1EZQA 1F92A 4UD9H 1ESTA 1OPHB 1QRWA 2BQ7B 3MMGA 1JWTA 1XVOA 3IITA 1Y3VA 2HALA 3A7VA 4B75A 1AUTC 3LGYA 3RXDA 2FO9A 1Y3UA 4ABIA 1SLVB 3PTNA 2B0FA 1AI8H 1O3DA 1O3IA 2ZDNA 1IQJA 2SGDE 1T4UH 3O8CA 1VJAU 2GVFA 3DFJA 1F7ZA 2BD5A 3MWIU 1O3BA 2OC0A 3SU2A 4BTTB 3ENSB 3TK9A 1ZHPA 1FN6A 4U01A 2ZFTA 2BQWB 3PLBA 2F9OA 4JYTA 4B76A 3Q00A 7ESTE 2R2MB 4OS5A 5GWZA 3SU5A 1EZSC 3V7TA 1G3EA 1NZQH 3H7TA 4XE4A 4AGKA 4A5TS 2ZU2A 1C2MA 1SHHB 3AASA 4WWYA 1O2SA 2B5TB 4B71A 4FUIA 2GD4B 4ISHH 7LPRA 2AFQB 1DLKB 1QR3E 4XBDA 4R8TB 1J16A 3M3TA 1ABJH 1PPFE 3FZDA 4NSYA 3ZZ5A 1C2DA 3AAUA 1V2UT 4DW2U 2ZDMA 3RXCA 5LPEA 2C8YB 1N6YA 1TX7A 3L3TA 4X1RU 3AAVA 1C5WB 1THRH 2ZGJA 2Y5GA 3RXHA 5TCCA 3D23A 1ABIH 4IBLH 5ESTE 5TJXA 1A61H 3SNDA 2VH0A 2ZDVH 3BTQE 3URDA 2TPIZ 5FBEA 2VVUA 1JRSA 1CQQA 3PYHA 1UVTH 1AZZA 2QF0A 4CBNA 1TGTA 2BB4A 1TNGA 2D2DA 4AB9A 1Y3YA 3QTOH 3QX5H 1O5DH 1TNHA 2ZHWH 4CRCA 2A4RA 4NA9H 1IOEA 3B8JA 3VB6A 4XOJA 1ZGVA 3SV8A 1L1GA 4AOQA 4I7YH 3SNAA 3U8TH 4ABGA 2GT8A 2XBVA 1JBUH 3M61U 2TGDA 2A2QH 2FXRA 2PR3A 1S5SA 2BOHB 4HGCA 1CSOE 1IQEA 1O34A 2XC0A 3EA7A 2A4OA 5IDKA 1FUJA 1AFQC 1GJDB 5E0GA 1SGFG 2VGCC 1ANCA 1X7AC 2ZHDA 2P3UB 2AH4X 3RM2H 1O2VA 4NIWA 3RXTA 4X2YA 4SGAE 1P01A 3H7OA 1LKAA 1GCTC 1AIXH 1P04A 2C8ZB 3ZZ3A 1BTYA 1N8OB 1O39A 2WYGA 2ASUB 4Y7BA 3SUDA 5K0HA 1O5AB 4I8KA 4JK5A 1LQEA 2VVVA 1GI0A 1O2XA 1WQSA 2ILNA 2GCTC 3GY5A 3QN7A 1HJAB 1XUFA 3ODFA 1BJVA 1K1MA 2F9VA 2O8LA 2XYAA 3RM0H 1SLXB 2BD7A 1IQHA 2R0KA 3A7WA 1A5HA 1GDNA 3OSYA 2VIQA 2A32A 4X0WU 1SOTA 2PKSB 3SV6A 4YT6H 5E2OA 2ZC9H 3RXGA 3TJVA 2W3IA 1F5KU 2ALVA 3BEUA 1EB1H 1A2CH 1FQ3A 1DICA 1YLCA 4ZKOU 1WV7H 1HNEE 2HLCA 4WXVA 1KDQA 4Y8XA 1O3GA 1OWHA 3BN9A 3GY4A 3ATMA 3M7UA 5L2ZH 3BTGE 2DE9A 4YLQH 3ZVCA 3Q76A 1SPJA 1YC0A 1TAWA 1ELVA 2OUAA 4GHTA 3ZVFA 4D7GA 2BHGA 1C5SA 2H5CA 2UWPA 2ZCHP 3A8BA 5EW2H 3Q3XA 3UOPA 1H9IE 4UFEH 2PV9B 4CH2B 1C4Y2 2AMQA 1FXYA 1MKXK 1T7CA 3LONA 3O8DA 1C5TA 2ZDLA 1DT2A 2CN0H 2ZU3A 3SZNA 3F1SB 2BDCA 2PTNA 1PJPA 1AY6H 1HAZB 4I8GA 1QQUA 2C4FH 5A8ZA 2TGTA 1ZHRA 4HTCH 4X8TH 1HAVB 4JZIA 2Y7ZA 1MTWA 2GV7A 4WXIA 4HFPB 1RTKA 2BD2A 5T6FA 1EATA 2A4GA 3VXFH 2B9LA 2J38A 3IG6B 2GTBA 1QB6A 3A8AA 1S6FA 1UCYH 1QA0A 1C1WH 1NS3A 4XBCA 2ANWA 3A87A 2HOBA 3A8DA 1EJMA 5J4QA 1UVUH 4F49A 2BY8X 4AORA 4WMDA 2VVCA 3T2NA 1GI3A 1DWCH 2PTCE 3VEQB 1VZQH 3BG8A 1A0HB 1BTPA 1GCDA 2NU0E 4X8UH 2CV3A 5G4BA 2EA3A 4YT7H 2LPRA 2Z9KA 3BIUH 5JBBS 4Y6DA 1QB9A 3R3GB 5E0JA 3PM3A 2BQ6B 3ZVDA 2BX4A 1FZZA 1FI8A 3GY8A 1S0RA 4NWKA 5DP3A 4IGDA 1OYQA 2FX4A 4MDSA 1ARCA 3F9FA 1TMUH 1GJ4H 2IN2A 1XUGA 4BAKB 3SHAH 1MMJN 5GXPA 6ESTA 1G3BA 1NRPH 3ZV9A 9ESTA 1TQ7B 1GBBA 2C8WB 2KAIA 3LPRA 2FLRH 1QY6A 2FYQA 1ZLRA 3S7HB 3RU4E 1SSXA 1C5VA 1KLTA 3KHVA 1BRBE 3AW0A 3EQ0H 1C1QA 1ZTKA 1S6HA 2OBQA 2CF8H 1TX8A 4OS1A 1AE8H 3KQCA 2GCHF 4DURA 1ELBA 2CF9H 3ZVBA 1J8AA 3T29A 3VFEA 4X6OA 1MAYA 2GKVE 1HAPH 3RXIA 1O5EH 4FVDA 2RCEA 2JH6D 1SLUB 1C5LH 2IOTA 2ZU5A 1W0ZU 3Q3KA 3ZVEA 5JPMH 2FM2A 2A7CA 3JZ1B 2Y82A 4ZKRU 3W94A 4KTCA 1ZGIA 3MYWA 3UQOA 1L4ZA 5CE1A 2ZQ1A 1O3EA 2GCTB 3SU0A 1MH0A 2BD9A 1THPB 2VIVA 3AVZA 4K60A 3P70B 1ELDE 4ZHMU 1GBEA 4CHAB 6GCHF 2D26C 4ZXXH 3BIVH 4Y8YA 1DSUA 4B2CA 1P57B 2BTCE 5E2PA 3EA9A 3SJIA 1GJ7B 2BY5X 4RSPA 1P3EA 1ZSKA 3GCTF 2VIPA 4YM9A 2G4TA 2F9BH 2HPPH 1P10A 1TQ0B 5FPSA 1AVXA 1RIWC 1P09A 2OXSA 1UK3A 1GHVH 2O8UA 2WINI 1XKBC 2SGAA 3ATKA 4XSKU 1DANH 3LGVA 2FOHA 2R3YA 1QCPA 3RC6A 1MCVA 3BSQA 1LPZB 3SBKA 1YKTA 1S81A 1FONA 3LOXA 1PYTD 1CGIE 3HK3B 5DO4H 3RXEA 1GHYH 2WPLS 2BOKA 1EAXA 8GCHG 1O5FH 1NM6A 3ZYDA 1ZTJA 3RU4D 1G32B 3UFAA 1LQDB 1P2JA 3HGPA 1HUTH 4IMQA 3MH7A 4ZHAA 2QXHA 2GZ9A 1MKWH 2AGGX 1UTPA 4INKA 2Y80A 2ZGHA 5FPTA 1FPHH 3B23B 1GI6A 3LJOA 1D3DB 2Z7FE 3STJA 3D49H 1QL9A 2SFAA 1O0DH 3T5FH 1O2RA 1AZ8A 1GHAF 3T25A 1AQ7A 2QXGA 1SGEE 4MNXA 4BAQB 2VB0A 8LPRA 2BDAA 1CGHA 5EODA 3UWJH 4DT7B 5BRRE 2ZECA 4Q80A 4JMYA 1TALA 1BBRK 1ZJKA 3SNBA 1U6QA 3BTHE 4INHA 5BPEA 1RRKA 1LHFH 2ANMH 4A1TA 4UFFH 3BTWE 1TMTH 1C4U2 1ZMLA 1P9SA 2QN5T 1O3FA 4FU8A 2VIOA 1DX5M 1D6WA 3RXVA 1NRSH 2UWOA 5A8YA 2WPKS 1H9LB 1F2SE 3T62A 5L2YH 5F8XA 1AKSB 3UNSA 1W11U 2P8OC 1FDPA 1IQFA 1W14U 2P3TB 1SLWB 1Z8JB 1UK2A 1O38A 1ZZZA 4MVNA 1AWFH 1OP2A 1NFYA 1OXGA 3TH2H 1CE5A 1KLJH 1SBWA 3RLWH 2FMJA 1V2PT 1NRQH 3TJUA 1C1RA 1TOMH 1O37A 1VGCB 1KXCA 2ZO3H 1BMAA 1GMHG 1O3JA 3EYDA 3PWBA 2OD3B 3KEEA 1ELFA 4NCYA 4CR5A 1GI8B 4NGAH 3CS0A 4ZROA 3MH6A 1T8NA 1A0LA 1XXDA 1O2TA 2TIOA 1K1OA 1PPBH 1TRNA 2JETC 1TBQH 4FVBA 3CP7A 3O8RA 1O3AA 4MQAA 2BYAX 1B0FA 1SR5C 3VGCC 4B74A 4ZH8A 1O3LA 2Q6FA 3MO6A 4CBOA 1BCUH 3QDZB 1FY3A 1XXFA 2FOMB 1XKAC 2CGAA 4BNRA 2BVXH 2J92A 3MU1A 4X1QU 4TWWA 5EPYA 1RIWB 1E37B 2FWWA 2V3HH 4A92A 8ESTE 4BTIB 1ZYOA 1P8VC 2QGRA 2XWAA 1ESAA 3RMOH 3QTVH 3NZIA 1OWJA 3TGKE 1TBRH 2J34A 3I78A 1WOFA 2ZDAH 4HI3A 3F6UH 1GHWH 2I6QA 2WPMS 2QXJA 4GAWA 4A7IB 4ZAEA 1CU1A 1BB0B 4ABHA 2O8TA 2RG3A 4K1TA 2BY6X 2JH0D 2QV1A 3U8OH 1K21H 1OWKA 2R2WU 1GJ9B 1QJ1B 2P16A 1BT7A 1KTTB 5F6MA 1TGCA 1DXWA 3OY5U 1GMDG 1ZSJA 4X6MA 2OQ5A 3M5LA 1O33A 2WPIS 3ELAH 1P11E 3L33A 2ZHEH 5GDSH 3UPEA 2J9NA 1F0UA 5CMXH 4FXGH 1L4DA 1RTFB 3LU9B 4O3UA 2W5EA 1AN1E 1P3CA 2WUCA 5EXMA 1NY22 1IAUA 4LK4A 5AFZH 1GI4A 3RXBA 2AS9A 3PMHB 2ZI2H 4I31A 3RP2A 3UREA 3VB7A 4YO9A 1LTOA 1G30B 1YPMH 1K22H 3A83A 3R0FA 1JIMA 1YLDA 3UNQA 1EJAA 1LCYA 1LO6A 2R3UA 3P8NA 2XCNA 3T28A 1GBCA 1YPLH 4ABJA 2K1QA 2P59A 2A1DB 4Z0KA 1DUAA 3P8OA 2C8XB 4WMEA 2HPQH 1NN6A 1BRCE 1XX9A 1ELAA 2DE8A 1PPZA 1O2UA 3DUXH 2XXLA 1DPOA 1VITH 2ZPQA 1V2WT 3UWIA 1EAIA 4JZFH 1QQ4A 3RXFA 1HXEH 2Z9IA 3OX7U 1H8DH 2CXVA 2THFB 2CHAB 3QUMP 3AW1A 5GPIB 1QTFA 1GI7B 1XUIA 1MBMA 2HRVA 3M7QA 1C5OH 2XC4A 1CO7E 1P2MA 5AF9H 2QIQA 4R0IA 1GBKA 4MNWA 1PPHE 3EAJA 3GCNA 3NUMA 1EX3A 4Y10E 1IQLA 5FCRA 3LDXH 1T32A 3TVJB 7KMEH 3BTME 1K28D 1NT1A 1CHGA 1GJBB 5HMAA 5HYOA 1V2RT 4LZ1H 1CBWB 2PKAA 2VWMA 2ZGCA 1TE0A 1Z6EA 4X8VH 1NFWA 3M5MA 1O5GH 3ZVGA 4WF8A 4MPXA 5FAHA 4OS6A 1WSSH 4Q7ZA 3A86A 2B8OH 4D9QA 3SU4A 1Y8TA 1T31A 1CGJE 1ZPBA 2IPHA 2XCFA 1DFPA 1Y3XA 1BQYA 5JBCS 1LHGH 2A5AA 4KELA 2BD8A 3D65E 3M3VA 2BLQA 4K5ZA 4Y11E 1O2LA 1V2QT 2BXUH 1DY9A 4U2WA 1C4V2 1ELCA 1AMHA 1FY5A 7GCHF 4FUGA 1VCPA 3K9XB 2A31A 1GHBF 1V2JT 3C27B 1HXFH 1L2EA 1TNJA 2ZQ2A 1G37A 5EU8A 2PFEA 1W2KH 2FX6A 1GHAG 3S7KB 1HJAC 1KXFA 1PQ8A 4BAHB 4FUJA 5AFYH 4ISNA 3ZZAA 1QB1A 1FY4A 3UOUA 1CBWC 1T4VH 3RXOA 1QGFA 1TRMA 1UTNA 4GUXA 3TNSA 1C5PA 1C5UA 2ANKH 1O2OA 1K1PA 2QXIA 1DWDH 2GGVB 2UUYA 3KNXA 1ELGA 2WUBA 4LOYH 1MKXH 1WTGH 1ZTLA 3PO1B 2ZEBA 1P12E 2UUJB 3GY6A 1KDQB 3SI3H 1GBTA 1LHDH 1Y59T 3PMAB 5FXLA 2EEKA 1TFXA 1P05A 2UWLA 1YCPH 3SW2B 3RXLA 2ZU4A 4F4OC 3KIDU 4DVAU 1GBFA 2AGEX 1UK4A 4U30A 4NZQA 2HGTH 4TY6A 4O9VA 1GPZA 3NWUA 3TH3H 2GP9B 3FFGA 5JDUB 1SGQE 1UCYK 3OU0A 4YTAA 1QA7A 1NFXA 3RXQA 3SU1A 1IHSH 1S85A 1W10U 1AHTH 3V0XA 1B7XB 3LIWA 3RXAA 3E16B 1O2NA 1C1OA 5ETXA 2V6NA 3VB4A 1OKXA 1ANDA 2F83A 1P2NA 1AB9B 2G55A 4YLUA 2C93B 1LDTT 4XDEA 1GMDF 1BJUA 2C3SA 3GYLB 4Y71A 3MNCA 2FEQH 1QL8A 4JK6A 1UTLM 5FPYA 4K1EA 3TIUA 1GI5A 3LH3A 5DP4A 4UEHH 4DY7B 3RMLH 1RTLA 2F3CE 4I8LA 1O35A 1CT0E 2FPZA 3FZZA 1GI1A 1CT2E 4UE7H 1DXPA 3P8GA 4IC5A 5EQQA 4AYYB 5ABWA 1TYNA 1WYKA 1O3CA 1SOZA 3E6PH 1HIAB 4E7RG 1TPSA 4DG4A 3E1XB 2O8WA 1A3BH 3K6YA 2V0BA 1EOLA 1OX1A 3DD2H 2SNVA 1DLEA 1L1NA 3A88A 3MHWU 2FOEA 1VITF 1W0YH 1V2NT 5C20A 3ZZ6A 1K1LA 1TRYA 2HNTE 2ZZUH 1HLTH 5HXFA 4JYUH 2QAAA 5DKMA 1ZR0A 3MO9A 1TX6A 1C2IA 1FPCH 1DY8A 1TA2A 2P94A 1YPGH 1DDJA 4DIHH 2SGPE 4Y8ZA 3TPIZ 5K7RA 3GCOA 1ETTH 3P92A 1YPEH 1K1JA 1ZHMA 3LKWA 1ID5H 3QZQA 1YYY1 2AYWA 1SGCA 1GJCB 3A81A 2R0LA 4OS7A 3ZZDA 4D8NA 3BTEE 3MU4A 2H6MA 4FU9A 1HYLA 1FAKH 1C5XB 5DK1A 4J1YA 1AE5A 2GV6A 3KN2A 1SVPA 5DP7A 3GCTG 5LPFA 2PGQB 1XUKA 2AERH 1C5MD 1TMBH 3K2UA 1TLDA 3PO1C 3QK1A 1C2GA 1PQAA 4MPWA 1HAIH 2H1UA 5FX6A 2F9UA 5LGOA 1ELEE 3U69H 2O8MA 8KME2 1AVWA 1O36A 3MFJA 1JRTA 2BLVA 1HGTH 1GBMA 1BRUP 1E35B 1A0JA 4DJZB 1Q2WA 1SL3A 4NZLA 3TLOA 2QCYA 3ZYEA 1MAXA 1DM4B 2ZA5A 1F0RA 1KXAA 1MUEB 1HJ8A 1UTQA 2BZAA 2FP7B 3GDUA 3MNXA 1MQ5A 3LGUA 3RU4T 3BTTE 1C1SA 4Q7XA 4BAOB 1IQIA 1W7GH 2YOLA 3ATIA 1FIWA 4NIXA 4AFQA 5AHGH 1HIAA 3VPKA 1SGIB 2VGCB 1C5YB 4IS5A 1TGNA 2XC5A 3F9GA 1O2YA 1GMCG 3S9BA 3T27A 4AFZA 2OC1A 4LXBH 1M9UA 2P95A 3E90B 1MKWK 2GDDA 1C1NA 2XBXA 2OTVA 2ZTZA 4NIYA 1Z8IB 1GBHA 2ZG0H 3TJOA 5LH8A 1Y3WA 3ATLA 1QBVH 1DE7H 3GOVB 2HWLB 1UTMA 2Z9GA 4ABFA 1FLEE 4RN6A 4JZ1A 1OS8A 1E0FD 3ZZ9A 4KGAA 3CENA 3I77A 2FDAA 2FI3E 2P93A 3ZZ7A 3RC4A 2YNAA 3UQVA 1BBRE 1Z1JA 1N8OC 1BTZA 2PSYA 4IW4E 4D9RA 2JKHA 3RMNH 4WH6A 1TPOA 2QY0B 4BAMB 1QHRB 1GVKB 4JYVH 1NESE 2ULLA 3G01A 4Y0YE 1N1LA 5TCAA 2FLBH 1Z71A 1IQMA 3QZRA 3RC5A 3TGJE 1TBZH 4GVUA 2BM2A 3B9FH 2H2ZA 2OCVB 3HK6B 1EUFA 1EAUA 1TPAE 4H6TA 4GCHG 2GZ8A 4WJG2 4FUCA 3PLKA 1JOUB 3TNTA 1EPTB 5L6NH 4CRBA 2G81E 1CA0B 5PTPA 3EDXB 5GCHG 1BMMH 2PKSC 2XW9A 2J94A 2STAE 1AVGH 1ARBA 1E34B 2C90B 1O30A 2Z9LA 2SNWA 2Q1JA 3FP8E 4UFDH 1LVOA 1V2VT 2A2XH 1O31A 2Y7XA 1EQ9A 5F8TA 3GDSA 5C1YA 3SOSA 3DFLA 1KTSB 5HM2A 5I25A 2Q6DA 1SHYA 5FX5A 2VWNA 3PTBA 4D7FA 4X1SU 1SGTA 1GBDA 1C5ZB 4A6LA 1O2JA 3QWCH 4RKJB 2RA0A 1G2MA 3NKKA 3SNCA 1QRXA 1JXPA 3BV9B 1RJXB 4CRGA 1V2LT 3GYMA 4I8JA 4NSVA 1P02A 1H9HE 5CHAC 1W12U 3LGWA 1TPPA 2HNTF 1PPCE 3M37A 1Z6JH 1ZPCA 6LPRA 1UTJA 1G36A 1C2EA 1OYTH 3FP7E 1MD7A 3IWMA 5F8ZA 3E3TA 3UUZA 1QNJA 1GG6C 2BDHA 1LVBA 3C1KA 5JBTA 1UVPA 3FAOA 2V3OH 1D3QB 1GVLA 3SGQE 1LPKB 3LH1A 3ODDA 1IQKA 6CHAC 4X1PU 3SQEE 1QRZA 1XUHA 8GCHF 1VITG 4OS2A 3SU3A 1NC6A 1RFNA 4AFSA 2W3KA 4YESB 1W13U 4FUEA 3A89A 2RA3A 3CS7A 1EKBB 1TOCB 4VGCC 2EI7A 1O2PA 1WTHD 1KSNA 3HKIB 4I32A 2ZGXH 1XVMA 4H4FA 4TY7A 1YM0A 4YZUA 4B2BA 4B73A 1O2ZA 5B6OA 2W7UA 3TH4H 3H5CB 3DHKH 2WPHS 4DGJA 4KTSA 2JETB 1G9IE 7GCHG 1D9IA 1BUIA 1SB1H 4NIVA 1GBAA 1C9TA 1YGCH 4Y0ZE 3P17H 4Z6AH 4TWYA 1A1RA 1INCA 5J4SA 4AZ2B 3GY7A 4AB8A 1HJ9A 1LKBA 1LVMA 4J2YB 4NFFA 1O2QA 2F9PA 3BG4B 4H42U 3SUFA 1C5NH 1E36B 4O97A 2GT7A 1SGDE 2OP9A 4NG9H 4PROA 1YCPK 1ZMJA 1NRRH 3UR9A 2CHAC 2BD4A 2RDLA 3BEIB 4Y79A 1ANBA 1O5BB 4I8HA 3U1IB 1MZDA 1IQGA 3OYPA 2GZ7A 1QL7A 3GCHB 1SMFE 2FODA 1G3DA 4GCHF 5EGMA 1DWEH 1C2HA 1RXPA 4TPYA 1VGCC 3U9AH 2FS8A 5FCKA 1HCGA 1THSH 1L1JA 1A4WH 1EP5A 4X2VA 1FIZA 2PGBB 1O3PB 3PROA 1J14A 2ZIQH 2TGAA 2Z94A 4ABDA 4KKDA 6GCHG 3MU8A 2I6SA 4NWLA 2AGIX 1SGPE 4E7NA 1F0SA 3SUGA 3ZZBA 5JYIA 1SFQB 2NU3E 1MCTA 1FAXA 1OP0A 3RUOA 1GHBG 3FANA 3VXEH 4GSOA 3S69A 4TPIZ 3O8BA 1ACBE 2ZFQH 2ZFPH 2G5NA 4NA8A 1ORFA 1CHOG 3PMBB 1SGNE 4X2WA 3SHCH 1G2LA 3M36A 4WH8A 1QURH 5EQRA 1WAYB 1YPKH 1J15A 2STBE 1QIXB 1EB2A 1ETRH 4Y76A 1J17T 2PWXA 1D4PB 1HB0B 3GDVA 5DPAA 1TWXB 4INLA 2OINA 1AO5A 3RXPA 1AFEH 3L6PA 1ZJDA 3LGIA 2VWOA 1HAHH 5ESBA 4ABEA 1UJ1A 1DUEA 2FOGA 1TNKA 3LC5A 1RD3B 5HGGA 1HAVA 3ATWA 5C5OA 4D76A 2BMGB 1C1TA 3ESTA 4FU7A 1A5IA 3ITIA 2TGPZ 2FTLE 4MTBA 2B7DH 5I46H 2PHBA 3BG4C 4WVPE 1EASA 1FNIA 4YOIA 4CH8B 1KXEA 2P8OB 1DITH 3FP6E 1HAXB 1UVOA 4BANB 1TGBA 3SI4H 5EXNA 4DCDA 1DOJA 2VWLA 1C1UH 1YP9A 4MLFB 1C2KA 3LT3A 1PPEE 3T26A 2LNCA 2FOBA 2CJIA 1HBTH 1G3CA 2WPJS 1MU6B 3FVFB 3ZZCA 3OY6U 1AGJA 1O2WA 1OOKB 3A7TA 3SO3A 3F9HA 4A1VA 2ZFRH 1EXFA 1SGFA 4FUBA 5C5NA 1Z1IA 2FTMA 2ZCLP 3LC3A 4Q7YA 2ZP0H 1EPTC 3A7YA 3PV4A 2AIQA 4JZEH 1NFUA 1DSTA 4ZXYH 1P9UA 6CHAB 2FYRA 4QT8C 1K1NA 3BTKE 2W26A 3A7XA 3RXSA 2FOFA 2XBYA 5JB9S 1ZRBA 3W95A 4OS4A 4GPGA 1OSSA 4BOHA 2AEIH 2NU4E 4ISOA 1K9OE 1P2OA 3EGKH 1BHXF 2VINA 2ZFSA 2Z9JA 4IN2A 4AG2A 2PUXB 4YOGA 1BHXB 1MBQA 1VCQA 1BTXA 1GI9B 3NCLA 3URCA 1NROH 4SGBE 1UVSH 4YOJA 1FMGA 1GL0E 1VJ9U 3UR6A 3BTDE 5E0HA 2WV4A 1HRTH 1YF4A 5C2ZA 4OGYA 5GJ4B 2Y5FA 4M7GA 2FS9A 2UUFB 2G4UA 1C5RA 2FIRH 5CHAB 1BBRH 5F03A 1GHZA 1V3XA 2TRMA 2BY9X 3SORA 3MU0A 3U1JB 1EZUC 5A0BA 1S0QA 1SC8U 1UTOA 3SN8A 1O3MA 2J4IA 4E06H 1EPTA 1O2KA 1QBOA 3STIA 1C5QA 1XM1A 4K1SA 1WQVH 3HATH 3P8FA 5EQSA 1SQAA 2H9TH 2EC9H 2H9EH 2BVRH 1H4WA 1BA8B 2AMDA 1D6RA 4KTUA 4A1XA 3Q77A 1JIRA 1KY9A 3A7ZA 1NO9H 2ZPRA 2ZNKH 9LPRA 1CVWH 4RKOB 1NTPA 2F9NA 1GGDC 1YBWA 1NPMA 1AWHB 1BTUA 1GBJA 1UO6A 1YPJH 3UTUH 2ALPA 5LPRA 3SQHE 2ODQA 1C1PA 1B0EA 5A0CA 1T8OA 5GCHF 1ZSLA 1ZOMA 3VB5A 4ZHLU 1S82A 2Q6GA 2PLXA 2XTTB 1VR1H 2A4QA 1LVYA 3TU7H 3LJJA 2A7HA 3RXRA 3V12A 4ABAA 1O2GH 1O3OA 1GHXH 3UNRA 1Q31A 1C9PA 2GCHG 1FY8E 3P6ZB 4IMZA 1Z8GA 1Q3XA 1A46H 1DS2E
chains in the Genus database with same CATH superfamily
1W8BH 1Z8RA 3SJ8A 1COWD 1S83A 3S0NA 1SGRE 3DA9B 1FJSA 1F5LA 3MU5A 1UW7A 5C3NA 5EG4A 4O3TA 1C2LA 3D62A 1L0ZA 4AX9H 4K8BA 1SG8B 2AIPA 4MPVA 3GY2A 2XWBI 2BZ6H 3GICB 5H4IB 1J9CH 3M35A 3SJ9A 1O2MA 4IC6A 1GG6B 1GCTB 3TGIE 2FOCA 2ODPA 1W0KD 3BEFB 1O3HA 1YPHC 4Q2KA 1MTVA 3KQDA 1EJNA 1N6XA 1ETSH 1ANEA 1PYTC 5DSFA 1T8LA 1GJAB 4WY3A 2OQUA 2SGQE 1P0SH 3F9EA 3NK8A 3KGPA 2XNIA 3EE0B 1ELTA 2BVSH 2VIWA 4K69A 1TNIA 1C2FA 2OC8A 5C1XA 2OLGA 1O3NA 1QBNA 4FUDA 5T3HA 1ZPZA 4ZMAH 1BTWA 2KCPA 1MTNC 3VGCB 2BLOA 1TGSZ 3GISB 1WCZA 3M3SA 4WMFA 1LPGB 3S9CA 1RS0A 4XFQA 2ZU1A 1OP8A 1AKSA 3BF6H 1MZAA 1C2JA 2RFKC 5EXLA 3RXKA 1BRAA 3ZVAA 2DUCA 2QF5A 1SQTA 4ISIH 3U8RH 3SJOA 2Z3DA 1K2I1 4CHAC 4H6SB 2HVXA 4MG3A 1GJ6A 1D3TB 3KCGH 3RXJA 4AFUA 2QF3A 1BDAA 2FOAA 3QGJA 3OEED 4UDWH 2QC2A 3PWCA 1EAWA 1NRNH 2G52A 4GLYA 1PQ5A 3KL6A 3TITA 4AGJA 1CA0C 1GBLA 2A7JA 4CR9A 1MTNB 5AVDA 1HAYB 1WU1A 2ODYB 2FZZA 1GDQA 1AU8A 1PQ7A 1TNLA 2BDBA 3PMJA 3SJKA 1MQ6A 3TK6A 1Y5BT 3RDZA 2Y81A 4ACAA 3F68H 1RGQA 2J2UA 1CT4E 5A09A 1TONA 1AFQB 1FV9A 1E1RD 3UIRA 3BTFE 1HV7A 3TK5A 3Q3YA 5IK2D 1V2TT 2ZDKA 4U32A 2BDGA 4FOUC 4MNVA 4B1TA 1BMLA 1S6LA 2QYIA 1Z7KA 3A80A 4I33A 5EPNA 1WBGB 5C1UA 2GMTC 1GDUA 1GVZA 1T8MA 3MI4A 4BTUB 2BLWA 1FN8A 4RI0A 5E8EH 2VJ1A 2WV5A 1IQNA 1Y5UT 1KLIH 3QLPH 2YMSB 3K6ZA 4CREA 5A0AE 1KXDA 2PKAB 1A5GH 2JJ2D 4X6PA 3MO3A 1K1IA 5FBIA 2FI4E 3SGBE 1F0TA 1W3CA 4HZHA 2HNTC 1UHBA 2VH6A 4ABBA 5DP9A 3NXPA 4Q4LA 3OTJE 5DGJA 3LGTA 4IN1A 4JCNA 4AN7A 1SQOA 2J95A 2G8TA 1UMAH 1B5GH 3K65B 4THNH 5L30H 2NWNA 1XMNB 1TA6A 2Z6BD 1CHOF 2YNBA 2M2AA 2R9PA 1A3EH 1LHCH 4CRFA 3V3MA 1IHTH 3SV2H 3DT0H 2ZFFH 1EZXC 2A45B 2NU2E 4GHQA 1UTKA 2ESTE 3GY3A 3KF2A 3M7TA 5GIBA 3SV7A 1S84A 1C1MA 2ZWLH 5CHBA 3U28C 1P2IA 2D1JA 4F48B 1GL1A 3I29A 1F5RA 2PW8H 4Y7AA 3NRLA 5EOKA 2UUKB 3KQBA 4UFGH 2ZHFH 5HM9A 1O32A 3OEHD 3P95A 4K8YA 1NU9A 1P2KA 4ZKNU 4KP0A 5A8XA 4B6EA 2VIDA 1C1VH 1TIOA 2ZHQH 2GMTB 1MTUA 2JDID 4MPUA 2D8WA 3MOCA 4XBBA 3RLYH 1ESBA 5C67A 5JBAS 1NBMD 2BXTH 3F0PA 2KCAA 4BXSA 1V2ST 1BMNH 3E0NB 2G00A 5DP6A 1V6DA 5T6GA 2EY4C 1O2HA 2ZF0H 3ZZ8A 2A0QB 1TABE 1BITA 4DOQA 1V2MT 1TB6H 2WV9A 2NU1E 1MD8A 1H8IH 4UONA 1YCPM 1YPHE 2EI6A 1O5CB 3TJNA 4CRAA 1AUJA 4MNYA 2K8IA 2GX4A 1GMHF 3SNEA 5JB8S 1ZRKA 2VNTA 3UY9A 3SU6A 1SGYE 1O3KA 2ZCKP 3RXMA 1SKYE 1MU8B 1GMCF 4FUFA 2KAIB 2AMPA 3M5NA 5EJLA 3FN8A 2Y5HA 1V2KT 3VG8A 3SV9A 1HAOH 3F3BA 1LHEH 2PSXA 3HKJB 1H1BA 1XUJA 2XRCA 3U98H 4O03A 1GWAA 2GDEH 1HFDA 4LZ4B 2Z3EA 2ZGBH 5FHTA 2BD3A 3PB1E 3PLPA 1BTHH 3A85A 2JH5D 1E79D 4VGCB 2A5KA 1ZMNA 1UCYE 2ZKSA 3A84A 1PPGE 1HDTH 2ZPSA 2M5TA 2F91A 4ISLA 2W7SA 5SGAE 2QA9E 4ESTE 2Y6TA 5DJ7A 5A2MH 4ZKSU 4E05H 1SFIA 2EI8A 2Z3CA 3MH4A 1DWBH 2SGEE 3KQEA 4K3JA 5EJZA 1GJ8B 4X8SH 2G5VA 3M5OA 3HGNA 3GCHC 1KIGH 3NPSA 2ZTXA 3N7EA 2BX3A 2BDIA 3WY8A 1HAGE 4AYVB 3MTYA 1Y5AT 2OC7A 1AB9C 1UHBB 2FESH 2H5DA 4X2XA 3VB3A 4AG1A 1EP6A 1QFKH 3RMMH 2O9QA 1DVAH 5IYTA 3EE7A 1VCWA 2P3FH 3QO6A 1W0JD 5DP8A 1CA8B 1FY1A 1P2QA 3V13A 4CRDA 4OGXA 2IJOB 3HPTB 1JMOH 2ANYA 3ZV8A 4BXWA 3A82A 1QJ7B 4ZUHA 1GI2A 5T6DA 3E91A 3N7OA 2TBSA 4FUHA 1GBIA 2PUQH 3MH5A 3E0PB 1GJ5H 1OWDA 4FETA 2V35A 4B2AA 1E38B 1SI5H 1D3PB 1O2IA 3MNSA 2A5IA 2G51A 4NA7A 4ASHA 3E8LA 4JZDH 1OWIA 2FI5E 2WYJA 2BY7X 3QGNB 4X1NU 2SGFE 3MNBA 2OBOA 3KYGA 2VU8E 3S9AA 2H9HA 1AD8H 1KYNA 2CMYA 1MTSA 1P03A 1V2OT 1QJ6B 1W7XH 2BDYA 1BZXE 2JJ1D 1A7SA 4HG6A 5DG6A 1P06A 2XBWA 1KXBA 1EOJA 1WUNH 3EA8A 3JZ2B 1LMWB 2EQNA 3A8CA 5DN6D 5DP5A 1OWEA 4DIIH 1BOQA 5EW1H 4K2YA 1NU7B 3UAIC 3SGAE 2ZTYA 4NFEA 1PFXC 1WDIA 4TYDA 3RXUA 1GGDB 1BIOA 4X6NA 3ZZ4A 1HPGA 3SUEA 1EZQA 1F92A 4UD9H 1ESTA 1OPHB 1QRWA 2BQ7B 3MMGA 1JWTA 1XVOA 2J98B 3IITA 1Y3VA 2HALA 3A7VA 4B75A 1AUTC 3LGYA 3RXDA 2FO9A 1Y3UA 4ABIA 1SLVB 3PTNA 2B0FA 1AI8H 2KCYA 1O3DA 1O3IA 2ZDNA 1IQJA 2SGDE 1T4UH 4ZCNA 3O8CA 1VJAU 2GVFA 2IJD1 1F7ZA 3DFJA 2BD5A 3MWIU 1O3BA 2OC0A 3SU2A 4BTTB 3ENSB 3TK9A 1ZHPA 1FN6A 4U01A 2ZFTA 2BQWB 3PLBA 2F9OA 4JYTA 5KGOA 4B76A 3Q00A 7ESTE 2R2MB 4OS5A 5GWZA 3SU5A 1EZSC 3V7TA 1G3EA 1NZQH 3H7TA 4XE4A 4AGKA 4A5TS 2ZU2A 1C2MA 1SHHB 3AASA 4WWYA 1O2SA 2B5TB 4B71A 4FUIA 2GD4B 4ISHH 7LPRA 2AFQB 1DLKB 4M9FA 1QR3E 4XBDA 4R8TB 1J16A 3M3TA 1ABJH 1PPFE 3FZDA 4NSYA 3ZZ5A 1C2DA 3AAUA 1V2UT 4DW2U 2ZDMA 3RXCA 5LPEA 2C8YB 1N6YA 1TX7A 3L3TA 4X1RU 3AAVA 1C5WB 1THRH 2ZGJA 2Y5GA 2V7QD 3RXHA 5TCCA 3D23A 1ABIH 4IBLH 5ESTE 5TJXA 1A61H 3SNDA 2VH0A 2ZDVH 3BTQE 3URDA 2TPIZ 5FBEA 2VVUA 1JRSA 1CQQA 2JIZD 3PYHA 1UVTH 1AZZA 2QF0A 4CBNA 1TGTA 2BB4A 1TNGA 2D2DA 4AB9A 1Y3YA 3QTOH 3QX5H 1O5DH 1EFRD 1TNHA 2ZHWH 4CRCA 2A4RA 4NA9H 1IOEA 3B8JA 3VB6A 4XOJA 1ZGVA 3SV8A 1L1GA 4AOQA 4I7YH 3SNAA 3U8TH 4ABGA 2GT8A 2XBVA 1JBUH 3M61U 2TGDA 2A2QH 2FXRA 2PR3A 1S5SA 2BOHB 4HGCA 1CSOE 1IQEA 1O34A 2XC0A 2W6JD 3EA7A 2A4OA 5IDKA 1FUJA 1AFQC 1GJDB 5E0GA 1SGFG 2VGCC 1ANCA 1X7AC 2ZHDA 2P3UB 2AH4X 3RM2H 4TSFD 1O2VA 4NIWA 1WXRA 3RXTA 3FOAA 4SGAE 4X2YA 1P01A 3H7OA 1LKAA 2HVYB 1GCTC 1AIXH 1P04A 2C8ZB 3ZZ3A 1BTYA 1N8OB 1O39A 2WYGA 2ASUB 4Y7BA 3SUDA 5K0HA 1O5AB 4I8KA 4JK5A 1LQEA 2VVVA 1GI0A 1O2XA 1WQSA 2ILNA 2GCTC 3GY5A 3QN7A 1HJAB 1XUFA 3ODFA 1BJVA 1K1MA 2F9VA 2O8LA 2XYAA 3RM0H 1SLXB 2BD7A 1IQHA 2R0KA 5HIZA 3A7WA 1A5HA 1GDNA 5C0UA 3OSYA 2VIQA 3OTPA 2A32A 4X0WU 1SOTA 2PKSB 3SV6A 4YT6H 5E2OA 2ZC9H 3RXGA 3TJVA 2W3IA 1F5KU 2ALVA 3BEUA 1YY3A 1EB1H 1A2CH 1FQ3A 1DICA 1YLCA 4ZKOU 1WV7H 1HNEE 2HLCA 4WXVA 1KDQA 4Y8XA 1O3GA 1OWHA 3BN9A 3GY4A 3ATMA 3M7UA 5L2ZH 3BTGE 2DE9A 4YLQH 3ZVCA 3Q76A 1SPJA 1YC0A 1TAWA 1ELVA 2OUAA 4GHTA 3ZVFA 4D7GA 2BHGA 1C5SA 2H5CA 2UWPA 2ZCHP 3A8BA 5EW2H 3Q3XA 3UOPA 3F2FA 1H9IE 4UFEH 2PV9B 4CH2B 1C4Y2 2AMQA 1FXYA 1VKYA 1MKXK 1T7CA 3LONA 3O8DA 1C5TA 2ZDLA 1DT2A 2CN0H 2IPQX 2ZU3A 3SZNA 3F1SB 2BDCA 2PTNA 1PJPA 1AY6H 1HAZB 4I8GA 4XD7D 2WHXA 1QQUA 2C4FH 5A8ZA 2TGTA 1ZHRA 4HTCH 4X8TH 1HAVB 4JZIA 2Y7ZA 1MTWA 2GV7A 4WXIA 4HFPB 1RTKA 2BD2A 5T6FA 1EATA 2A4GA 3VXFH 2B9LA 2J38A 3IG6B 2GTBA 1QB6A 3A8AA 1S6FA 1UCYH 1QA0A 1C1WH 1NS3A 4XBCA 2ANWA 3A87A 2HOBA 3A8DA 1EJMA 5J4QA 1UVUH 4F49A 2BY8X 4AORA 2PP6A 4WMDA 2VVCA 4Q63A 3T2NA 1GI3A 1DWCH 2PTCE 3VEQB 1VZQH 3BG8A 1A0HB 1BTPA 1GCDA 2NU0E 4X8UH 2CV3A 5G4BA 2EA3A 4YT7H 2LPRA 2Z9KA 3BIUH 5JBBS 4Y6DA 1QB9A 3R3GB 5E0JA 3PM3A 2BQ6B 3ZVDA 2BX4A 1FZZA 1FI8A 3GY8A 1S0RA 4NWKA 5DP3A 4IGDA 4P02A 1OYQA 2FX4A 4MDSA 1ARCA 3F9FA 1TMUH 4YXWD 1GJ4H 2IN2A 1XUGA 4BAKB 3SHAH 1MMJN 5GXPA 6ESTA 1G3BA 1NRPH 5C94A 3ZV9A 9ESTA 3FO8D 1TQ7B 1GBBA 2C8WB 2KAIA 3LPRA 2FLRH 1QY6A 2FYQA 1ZLRA 3S7HB 3RU4E 1SSXA 3MQKC 4P00A 1C5VA 1KLTA 3KHVA 4F55A 2LP6A 1BRBE 3AW0A 3EQ0H 1C1QA 1ZTKA 1S6HA 2OBQA 2CF8H 1TX8A 4OS1A 1AE8H 3KQCA 2GCHF 4DURA 1ELBA 2CF9H 3ZVBA 1J8AA 3T29A 5T1VA 3VFEA 4X6OA 1MAYA 2GKVE 2VBCA 1HAPH 3RXIA 1O5EH 4FVDA 2RCEA 2JH6D 1SLUB 1C5LH 2IOTA 2ZU5A 3N99A 1W0ZU 3Q3KA 3ZVEA 5JPMH 5EJ1A 2FM2A 2A7CA 3JZ1B 2Y82A 4ZKRU 3W94A 4KTCA 1ZGIA 3MYWA 3UQOA 1L4ZA 5CE1A 2ZQ1A 1O3EA 2GCTB 2F43B 3WWBA 3SU0A 1MH0A 2BD9A 1THPB 2VIVA 3AVZA 4K60A 3P70B 1ELDE 4ZHMU 1GBEA 4Z1MD 4CHAB 6GCHF 2D26C 4ZXXH 3BIVH 4Y8YA 1DSUA 4B2CA 1P57B 2BTCE 5E2PA 3EA9A 3SJIA 1GJ7B 2BY5X 4RSPA 1P3EA 1ZSKA 3GCTF 2VIPA 4YM9A 2G4TA 2F9BH 2HPPH 1P10A 1TQ0B 5FPSA 1AVXA 1RIWC 1P09A 2OXSA 1UK3A 1GHVH 2O8UA 2WINI 1XKBC 2SGAA 3ATKA 4XSKU 1DANH 3LGVA 3UB0A 2FOHA 2R3YA 1QCPA 3RC6A 1MCVA 3BSQA 1LPZB 3SBKA 1YKTA 1S81A 2J5UA 1FONA 3LOXA 1PYTD 1CGIE 3HK3B 5DO4H 3RXEA 1GHYH 2WPLS 3PRBA 2BOKA 1EAXA 8GCHG 1O5FH 1NM6A 3ZYDA 1ZTJA 3RU4D 1G32B 3UFAA 1LQDB 1P2JA 3HGPA 1HUTH 4IMQA 3MH7A 4ZHAA 2QXHA 2GZ9A 1MKWH 2AGGX 1UTPA 4INKA 2Y80A 2ZGHA 5FPTA 1FPHH 3B23B 1GI6A 4TT3D 3LJOA 1D3DB 2Z7FE 3STJA 3D49H 1QL9A 2SFAA 1O0DH 3ZIAD 3T5FH 1O2RA 1AZ8A 1GHAF 3T25A 1AQ7A 2QXGA 3FKSD 1SGEE 4MNXA 4BAQB 2VB0A 8LPRA 2BDAA 1CGHA 5EODA 3UWJH 4DT7B 5BRRE 2ZECA 4Q80A 4JMYA 1TALA 1BBRK 1ZJKA 4AC9A 3SNBA 1U6QA 3BTHE 4INHA 5BPEA 1RRKA 1LHFH 2ANMH 4A1TA 4UFFH 3BTWE 1TMTH 1C4U2 1ZMLA 1P9SA 2QN5T 1O3FA 4FU8A 2VIOA 1DX5M 1D6WA 3RXVA 1NRSH 2UWOA 5A8YA 2WPKS 1H9LB 2OK5A 1F2SE 3T62A 5L2YH 5F8XA 1AKSB 3UNSA 1W11U 2P8OC 1FDPA 1IQFA 1W14U 2P3TB 1SLWB 1Z8JB 1UK2A 1O38A 1ZZZA 4MVNA 1AWFH 3WW7A 1OP2A 1NFYA 3DSGA 1OXGA 3TH2H 1CE5A 1KLJH 1SBWA 3RLWH 2FMJA 1V2PT 1NRQH 3TJUA 1C1RA 1TOMH 1O37A 1VGCB 1KXCA 2ZO3H 1BMAA 1GMHG 1O3JA 3EYDA 3PWBA 2OD3B 3KEEA 1ELFA 4NCYA 4CR5A 1GI8B 4NGAH 3CS0A 4ZROA 3MH6A 1T8NA 1A0LA 1XXDA 2W6ID 1O2TA 2TIOA 1K1OA 1PPBH 1TRNA 2JETC 1TBQH 4FVBA 3CP7A 3O8RA 1O3AA 4MQAA 2BYAX 1B0FA 1SR5C 3VGCC 4B74A 4ZH8A 1O3LA 2Q6FA 3MO6A 4CBOA 1BCUH 3QDZB 1FY3A 1XXFA 2FOMB 1XKAC 2CGAA 3OAAD 4BNRA 2BVXH 2J92A 3F0OA 3MU1A 4TWWA 4X1QU 5EPYA 1RIWB 1E37B 2FWWA 2V3HH 4A92A 8ESTE 4BTIB 1ZYOA 1P8VC 2QGRA 2XWAA 1ESAA 3RMOH 3QTVH 3NZIA 1OWJA 3TGKE 1TBRH 2J34A 3I78A 1WOFA 2ZDAH 4HI3A 3F6UH 1GHWH 2I6QA 2WPMS 2QXJA 4GAWA 4A7IB 4ZAEA 1CU1A 3F2HA 1BB0B 4ABHA 2O8TA 2RG3A 4K1TA 2BY6X 2JH0D 2QV1A 3U8OH 1K21H 1OWKA 2R2WU 4RT1A 1GJ9B 1QJ1B 2P16A 1BT7A 1KTTB 5F6MA 1TGCA 1DXWA 3OY5U 1GMDG 1ZSJA 4X6MA 2OQ5A 3M5LA 1O33A 2WPIS 3ELAH 1P11E 3L33A 2ZHEH 5GDSH 3UPEA 2J9NA 1F0UA 5CMXH 4FXGH 1L4DA 1RTFB 2KR7A 3LU9B 4O3UA 2W5EA 1AN1E 1P3CA 2WUCA 5EXMA 1NY22 1IAUA 4LK4A 5AFZH 1GI4A 3RXBA 2AS9A 3PMHB 2ZI2H 4I31A 3RP2A 3UREA 3VB7A 4YO9A 1LTOA 1G30B 1YPMH 1K22H 3A83A 3R0FA 1JIMA 1YLDA 3UNQA 1EJAA 1LCYA 1LO6A 2R3UA 3P8NA 2XCNA 3T28A 1GBCA 1YPLH 4ABJA 2K1QA 2P59A 2A1DB 4Z0KA 1DUAA 3P8OA 2C8XB 4WMEA 2HPQH 1NN6A 1BRCE 1XX9A 1ELAA 2DE8A 1PPZA 1O2UA 3DUXH 2XXLA 1DPOA 1VITH 2ZPQA 1V2WT 3UWIA 1EAIA 4JZFH 1QQ4A 3RXFA 1HXEH 2Z9IA 3OX7U 1H8DH 2CXVA 2THFB 2CHAB 1SQRA 3QUMP 3AW1A 5GPIB 1QTFA 1GI7B 1XUIA 1MBMA 2HRVA 3M7QA 1C5OH 2XC4A 1CO7E 1P2MA 5AF9H 2QIQA 4R0IA 1GBKA 4MNWA 1PPHE 3EAJA 3GCNA 3NUMA 1EX3A 4Y10E 1IQLA 5FCRA 3LDXH 1T32A 3TVJB 7KMEH 3BTME 1K28D 1NT1A 1CHGA 1GJBB 5HMAA 5HYOA 3DSOA 1V2RT 4LZ1H 1CBWB 5CDFE 2PKAA 2VWMA 2ZGCA 1TE0A 1Z6EA 4X8VH 1NFWA 3M5MA 1O5GH 3ZVGA 4WF8A 4MPXA 5FAHA 4OS6A 1WSSH 4Q7ZA 3A86A 2B8OH 4D9QA 3SU4A 1Y8TA 1T31A 1CGJE 1ZPBA 2IPHA 2XCFA 1DFPA 1Y3XA 1BQYA 5JBCS 1LHGH 2A5AA 4KELA 2BD8A 3D65E 3M3VA 2BLQA 4K5ZA 4Y11E 1O2LA 1V2QT 2BXUH 1DY9A 4U2WA 1C4V2 1ELCA 1AMHA 1FY5A 7GCHF 4FUGA 1VCPA 3K9XB 2A31A 1GHBF 1V2JT 3C27B 5HIYA 2KFWA 1HXFH 4B6FA 1L2EA 1TNJA 2ZQ2A 2QF4A 1G37A 5EU8A 2PFEA 1W2KH 2FX6A 1GHAG 3S7KB 1HJAC 1KXFA 1PQ8A 4BAHB 4FUJA 5AFYH 3W1EA 4ISNA 3ZZAA 1QB1A 1FY4A 3UOUA 1CBWC 1T4VH 3RXOA 1QGFA 1TRMA 1UTNA 4GUXA 3TNSA 1C5PA 1C5UA 2UUYA 1E1QD 1K1PA 1O2OA 1DWDH 2ANKH 2GGVB 2QXIA 3KNXA 1ELGA 2WUBA 4LOYH 1MKXH 1WTGH 1ZTLA 3PO1B 2ZEBA 1P12E 2UUJB 3GY6A 1KDQB 3SI3H 1GBTA 1LHDH 1Y59T 3PMAB 5FXLA 2EEKA 1TFXA 1P05A 2UWLA 2J98A 1YCPH 3SW2B 3RXLA 2ZU4A 4F4OC 3KIDU 4DVAU 1GBFA 2AGEX 1UK4A 4U30A 4NZQA 2HGTH 4TY6A 4O9VA 1GPZA 3NWUA 3TH3H 2GP9B 3FFGA 5JDUB 1SGQE 1UCYK 3OU0A 4YTAA 1QA7A 1NFXA 3RXQA 3PRDA 3SU1A 1IHSH 1S85A 1W10U 1AHTH 3V0XA 1B7XB 3LIWA 3RXAA 3E16B 1O2NA 1C1OA 3F2GA 3WWFA 5ETXA 2V6NA 3VB4A 1OKXA 1ANDA 2F83A 1P2NA 1AB9B 2G55A 4YLUA 2C93B 1LDTT 3OE7D 4XDEA 1GMDF 2K0QA 1BJUA 2C3SA 3GYLB 4Y71A 3MNCA 2FEQH 1QL8A 4JK6A 1UTLM 5FPYA 4K1EA 3TIUA 1BMFD 1GI5A 3LH3A 5DP4A 4UEHH 4DY7B 3RMLH 1RTLA 2L6OA 2F3CE 4I8LA 1O35A 5KECA 1CT0E 2FPZA 3FZZA 1GI1A 1CT2E 4UE7H 1DXPA 3P8GA 4IC5A 5EQQA 4AYYB 5ABWA 1TYNA 1WYKA 1O3CA 1SOZA 3E6PH 1HIAB 4E7RG 1TPSA 5B6LA 4DG4A 3E1XB 2O8WA 1A3BH 3K6YA 2V0BA 1EOLA 1OX1A 3DD2H 2SNVA 1DLEA 1L1NA 3A88A 3MHWU 2FOEA 1VITF 1W0YH 1V2NT 5C20A 3ZZ6A 1K1LA 3SYJA 3N7DA 1KMHB 1TRYA 2HNTE 2ZZUH 1HLTH 5HXFA 4JYUH 2QAAA 5DKMA 1ZR0A 3MO9A 1TX6A 1C2IA 1FPCH 1DY8A 1TA2A 2P94A 1YPGH 1DDJA 4DIHH 2SGPE 4Y8ZA 3PV2A 3TPIZ 5K7RA 3GCOA 1ETTH 3P92A 1YPEH 1K1JA 1ZHMA 3LKWA 4ASUD 1ID5H 3QZQA 1YYY1 2AYWA 1SGCA 1GJCB 3A81A 2R0LA 4OS7A 3ZZDA 4D8NA 1YWUA 3BTEE 3MU4A 2H6MA 4FU9A 1HYLA 1FAKH 1C5XB 5DK1A 4J1YA 1AE5A 2GV6A 3KN2A 1SVPA 5DP7A 3GCTG 5LPFA 2PGQB 1XUKA 2AERH 1C5MD 1TMBH 3K2UA 1TLDA 3PO1C 3QK1A 1C2GA 1PQAA 4MPWA 4DT4A 1HAIH 2H1UA 5FX6A 2F9UA 5LGOA 1ELEE 3U69H 5F53A 2O8MA 8KME2 1AVWA 1O36A 3MFJA 1JRTA 2BLVA 1HGTH 1GBMA 1BRUP 1E35B 1A0JA 4DJZB 1Q2WA 1SL3A 4NZLA 3TLOA 1OHHD 2QCYA 3ZYEA 1MAXA 1DM4B 2ZA5A 1F0RA 2AHME 1KXAA 1MUEB 1HJ8A 1UTQA 2BZAA 2FP7B 2XNDD 3GDUA 2J97A 3MNXA 1MQ5A 3LGUA 3RU4T 3BTTE 1C1SA 4Q7XA 5EIYA 4BAOB 1IQIA 1MABB 1W7GH 2YOLA 3ATIA 1FIWA 4NIXA 4AFQA 5AHGH 1HIAA 3GS9A 3VPKA 1SGIB 2VGCB 1C5YB 4IS5A 1TGNA 2XC5A 3F9GA 1O2YA 1GMCG 3S9BA 3T27A 4AFZA 2OC1A 4LXBH 1M9UA 2P95A 3E90B 1MKWK 2GDDA 1C1NA 2XBXA 2OTVA 2ZTZA 4OM9A 4NIYA 1Z8IB 1GBHA 2ZG0H 3TJOA 5LH8A 1Y3WA 3ATLA 1QBVH 1DE7H 3GOVB 2HWLB 1UTMA 2Z9GA 4ABFA 1FLEE 4RN6A 4JZ1A 1OS8A 1E0FD 3ZZ9A 4KGAA 3CENA 3I77A 2FDAA 2FI3E 2P93A 2XOKD 3ZZ7A 3RC4A 2YNAA 3UQVA 2KM0A 1BBRE 1Z1JA 1N8OC 1BTZA 2PSYA 4IW4E 4D9RA 2JKHA 3RMNH 4WH6A 1TPOA 2QY0B 4BAMB 1QHRB 1GVKB 4JYVH 1NESE 2ULLA 3G01A 4Y0YE 1N1LA 5TCAA 2FLBH 1Z71A 1IQMA 3QZRA 3RC5A 3TGJE 1TBZH 4GVUA 2BM2A 3B9FH 2H2ZA 2OCVB 3HK6B 1EUFA 1EAUA 1TPAE 3PV5A 4H6TA 4GCHG 2GZ8A 4WJG2 4FUCA 3PLKA 1JOUB 3TNTA 1EPTB 5L6NH 4CRBA 2G81E 1CA0B 5PTPA 3EDXB 5GCHG 1BMMH 2PKSC 2XW9A 2J94A 2STAE 1AVGH 1ARBA 1E34B 2C90B 3KQ5A 1O30A 2Z9LA 2SNWA 2Q1JA 3FP8E 4UFDH 1LVOA 1V2VT 2A2XH 1O31A 2Y7XA 1EQ9A 5F8TA 3GDSA 5C1YA 3SOSA 3DFLA 1KTSB 1H8HD 5HM2A 5I25A 5KEDA 2Q6DA 1SHYA 5FX5A 2VWNA 3PTBA 4D7FA 4X1SU 1SGTA 1GBDA 3H09A 1C5ZB 4A6LA 1O2JA 3QWCH 4RKJB 2RA0A 1G2MA 3NKKA 3SNCA 1QRXA 1H8ED 1JXPA 3BV9B 1RJXB 4CRGA 1V2LT 3GYMA 4I8JA 4NSVA 1P02A 1H9HE 5CHAC 2WSSD 1W12U 3LGWA 1TPPA 2HNTF 1PPCE 3M37A 1Z6JH 1ZPCA 6LPRA 1UTJA 1G36A 1C2EA 1OYTH 3FP7E 1MD7A 3IWMA 5F8ZA 3E3TA 3UUZA 1QNJA 1GG6C 2BDHA 1LVBA 3C1KA 5JBTA 1UVPA 3FAOA 3AK5A 2V3OH 1D3QB 1GVLA 3SGQE 1LPKB 3LH1A 5GNDA 3ODDA 1IQKA 6CHAC 4X1PU 3DCLA 1QRZA 1XUHA 3SQEE 8GCHF 1VITG 4OS2A 3SU3A 1NC6A 1RFNA 4AFSA 2W3KA 4YESB 1W13U 4FUEA 3A89A 2RA3A 3CS7A 1EKBB 1TOCB 4VGCC 2EI7A 1O2PA 3KYFA 1WTHD 1KSNA 3HKIB 2KCOA 2ZGXH 4I32A 1XVMA 4H4FA 4TY7A 1YM0A 4YZUA 2KZ4A 4B2BA 4B73A 4XRNA 1O2ZA 5B6OA 2W7UA 3TH4H 2YMSC 3H5CB 3DHKH 2WPHS 4DGJA 4KTSA 4ACBA 2JETB 1G9IE 7GCHG 1D9IA 1BUIA 1SB1H 4NIVA 1GBAA 1C9TA 1YGCH 4Y0ZE 3P17H 4Z6AH 4TWYA 1A1RA 1INCA 5J4SA 4AZ2B 3GY7A 4AB8A 1HJ9A 1LKBA 1LVMA 4J2YB 4NFFA 1O2QA 2F9PA 3BG4B 4H42U 3SUFA 1C5NH 1E36B 4O97A 2GT7A 1SGDE 2OP9A 4NG9H 4PROA 1YCPK 1ZMJA 1NRRH 3UR9A 2CHAC 2BD4A 2RDLA 3BEIB 2RDEA 3CNRA 4Y79A 1ANBA 1O5BB 4I8HA 3U1IB 1MZDA 1IQGA 2LELA 3OYPA 2GZ7A 1QL7A 3GCHB 1SMFE 2FODA 1G3DA 4GCHF 5EGMA 1DWEH 1C2HA 1RXPA 4TPYA 1VGCC 3U9AH 2FS8A 5FCKA 1HCGA 1THSH 1L1JA 1A4WH 1EP5A 4X2VA 1FIZA 1FX0B 2PGBB 1O3PB 5FL7D 3PROA 1J14A 2ZIQH 2TGAA 2Z94A 4ABDA 4KKDA 6GCHG 3MU8A 2I6SA 4NWLA 2AGIX 1SGPE 4E7NA 1F0SA 3SUGA 3ZZBA 5JYIA 1SFQB 2NU3E 1MCTA 1FAXA 1OP0A 3RUOA 1GHBG 3FANA 3VXEH 4GSOA 3S69A 4TPIZ 3O8BA 1ACBE 2ZFQH 2ZFPH 2G5NA 4NA8A 4RT0A 1ORFA 1CHOG 4I86A 3PMBB 1SGNE 4X2WA 3SHCH 1G2LA 3M36A 4WH8A 1QURH 5EQRA 2QE7D 1WAYB 1YPKH 1J15A 2STBE 1QIXB 1EB2A 1ETRH 4Y76A 1J17T 2PWXA 1D4PB 1HB0B 3GDVA 5DPAA 1TWXB 4INLA 2OINA 1AO5A 3RXPA 1AFEH 3L6PA 1ZJDA 3LGIA 2VWOA 1HAHH 5ESBA 4ABEA 1UJ1A 1DUEA 2FOGA 1TNKA 3LC5A 1RD3B 5HGGA 1HAVA 3ATWA 5C5OA 4D76A 2BMGB 1C1TA 3ESTA 4FU7A 1A5IA 3ITIA 2TGPZ 2FTLE 4MTBA 2B7DH 5I46H 2PHBA 3BG4C 4WVPE 1K0HA 1EASA 1FNIA 4YOIA 4CH8B 1KXEA 2V3MA 2P8OB 1DITH 3OFND 3FP6E 1HAXB 1UVOA 4BANB 1QZ8A 1TGBA 3SI4H 5EXNA 4DCDA 1DOJA 2VWLA 1C1UH 1YP9A 4MLFB 1C2KA 1YLNA 3LT3A 1PPEE 3T26A 2LNCA 2FOBA 2CJIA 3DSPA 1HBTH 1G3CA 2WPJS 1MU6B 3FVFB 3ZZCA 3OY6U 1AGJA 1O2WA 1OOKB 3A7TA 3SO3A 3F9HA 2HLDD 4A1VA 2ZFRH 1EXFA 1SGFA 4FUBA 5C5NA 1Z1IA 2FTMA 2KX4A 2ZCLP 3LC3A 4Q7YA 2ZP0H 1EPTC 3A7YA 2GJGA 2AIQA 3PV4A 1NFUA 1DSTA 4JZEH 1P9UA 4ZXYH 6CHAB 2FYRA 4QT8C 1K1NA 3BTKE 2W26A 3A7XA 3RXSA 2FOFA 2XBYA 5JB9S 1ZRBA 3W95A 4OS4A 4GPGA 1OSSA 3SZEA 4BOHA 2AEIH 2NU4E 4ISOA 1K9OE 1P2OA 3EGKH 1BHXF 2VINA 2ZFSA 2Z9JA 4IN2A 4AG2A 2PUXB 4YOGA 1BHXB 1MBQA 1VCQA 1BTXA 1GI9B 3NCLA 3URCA 1NROH 4SGBE 1UVSH 4YOJA 1FMGA 1GL0E 1VJ9U 3UR6A 3BTDE 5E0HA 2WV4A 1HRTH 2YMSD 1YF4A 5C2ZA 4OGYA 5GJ4B 2Y5FA 4M7GA 2FS9A 2UUFB 2G4UA 1C5RA 2L74A 2FIRH 5CHAB 1BBRH 5F03A 1GHZA 1NBME 1V3XA 2TRMA 2BY9X 3SORA 3MU0A 3U1JB 1EZUC 5A0BA 1S0QA 1SC8U 1UTOA 3SN8A 1O3MA 2J4IA 4E06H 1EPTA 5C0TA 1O2KA 1QBOA 3STIA 1C5QA 1XM1A 4K1SA 1WQVH 3HATH 3P8FA 5EQSA 1SQAA 2H9TH 2EC9H 2H9EH 2BVRH 1H4WA 1BA8B 2AMDA 1D6RA 4KTUA 4A1XA 3Q77A 1JIRA 1KY9A 3A7ZA 1NO9H 2ZPRA 2ZNKH 9LPRA 1CVWH 2WPDD 1NTPA 4RKOB 2F9NA 1GGDC 1YBWA 1NPMA 1AWHB 1BTUA 1GBJA 1UO6A 1YPJH 3UTUH 2ALPA 5LPRA 3SQHE 2ODQA 1C1PA 1B0EA 5HKKD 5A0CA 1T8OA 5GCHF 1ZSLA 1ZOMA 3VB5A 4ZHLU 1S82A 2Q6GA 2WZQA 2PLXA 2XTTB 1VR1H 2A4QA 1LVYA 3TU7H 3LJJA 2A7HA 2CK3D 3RXRA 3V12A 4ABAA 1O2GH 1O3OA 1GHXH 3UNRA 1Q31A 1C9PA 5C17A 2GCHG 1FY8E 3P6ZB 4IMZA 1Z8GA 1Q3XA 2F4LA 1A46H 1DS2E
chains in the Genus database with same CATH topology
1W8BH 1Z8RA 3SJ8A 3S0NA 1S83A 1SGRE 3DA9B 1FJSA 1F5LA 3MU5A 5C3NA 5EG4A 4O3TA 1C2LA 3D62A 1L0ZA 4AX9H 4K8BA 1SG8B 2AIPA 4MPVA 3GY2A 2XWBI 2BZ6H 3GICB 5H4IB 1J9CH 3M35A 3SJ9A 1O2MA 4IC6A 1GG6B 1GCTB 3TGIE 2FOCA 2ODPA 3BEFB 1O3HA 1YPHC 4Q2KA 1MTVA 3KQDA 1EJNA 1N6XA 1ETSH 1ANEA 1PYTC 1T8LA 1GJAB 4WY3A 2OQUA 2SGQE 1P0SH 3F9EA 3NK8A 3KGPA 2XNIA 3EE0B 1ELTA 2BVSH 2VIWA 4K69A 1TNIA 1C2FA 2OC8A 5C1XA 2OLGA 1O3NA 1QBNA 4FUDA 5T3HA 1ZPZA 4ZMAH 1BTWA 3VGCB 1MTNC 2BLOA 1TGSZ 3GISB 1WCZA 3M3SA 4WMFA 1LPGB 3S9CA 1RS0A 4XFQA 2ZU1A 1OP8A 1AKSA 3BF6H 1MZAA 1C2JA 5EXLA 3RXKA 1BRAA 3ZVAA 2DUCA 1SQTA 4ISIH 3U8RH 3SJOA 2Z3DA 1K2I1 4CHAC 4H6SB 2HVXA 4MG3A 1GJ6A 1D3TB 3KCGH 3RXJA 4AFUA 2QF3A 1BDAA 2FOAA 3QGJA 4UDWH 2QC2A 3PWCA 1EAWA 1NRNH 2G52A 4GLYA 1PQ5A 3KL6A 3TITA 4AGJA 1CA0C 1GBLA 2A7JA 4CR9A 1MTNB 5AVDA 1HAYB 1WU1A 2ODYB 2FZZA 1GDQA 1AU8A 1PQ7A 1TNLA 2BDBA 3PMJA 3SJKA 1MQ6A 3TK6A 1Y5BT 3RDZA 2Y81A 3F68H 1RGQA 2J2UA 1CT4E 5A09A 1TONA 1AFQB 1FV9A 3UIRA 3BTFE 1HV7A 3TK5A 3Q3YA 1V2TT 2ZDKA 4U32A 2BDGA 4MNVA 4B1TA 1BMLA 2QYIA 1Z7KA 3A80A 4I33A 5EPNA 1WBGB 5C1UA 2GMTC 1GDUA 1GVZA 1T8MA 3MI4A 4BTUB 2BLWA 1FN8A 5E8EH 2VJ1A 2WV5A 1IQNA 1Y5UT 1KLIH 3QLPH 3K6ZA 4CREA 5A0AE 1KXDA 2PKAB 1A5GH 4X6PA 3MO3A 1K1IA 5FBIA 2FI4E 3SGBE 1F0TA 1W3CA 4HZHA 2HNTC 1UHBA 2VH6A 4ABBA 5DP9A 3NXPA 3OTJE 5DGJA 3LGTA 4IN1A 4JCNA 4AN7A 1SQOA 2J95A 2G8TA 1UMAH 1B5GH 3K65B 4THNH 5L30H 2NWNA 1XMNB 1TA6A 2Z6BD 1CHOF 2YNBA 2R9PA 1A3EH 1LHCH 4CRFA 3V3MA 1IHTH 3SV2H 3DT0H 2ZFFH 1EZXC 2A45B 2NU2E 4GHQA 1UTKA 2ESTE 3GY3A 3KF2A 3M7TA 5GIBA 3SV7A 1S84A 1C1MA 2ZWLH 1P2IA 2D1JA 1GL1A 3I29A 1F5RA 2PW8H 4Y7AA 5EOKA 2UUKB 3KQBA 4UFGH 2ZHFH 5HM9A 1O32A 3P95A 4K8YA 1NU9A 1P2KA 4ZKNU 4KP0A 5A8XA 2VIDA 1C1VH 1TIOA 2ZHQH 2GMTB 1MTUA 5C67A 4MPUA 2D8WA 3MOCA 4XBBA 3RLYH 1ESBA 5JBAS 2BXTH 4BXSA 1V2ST 1BMNH 3E0NB 2G00A 5DP6A 1V6DA 5T6GA 1O2HA 2ZF0H 3ZZ8A 2A0QB 1TABE 1BITA 4DOQA 1V2MT 1TB6H 2NU1E 1MD8A 1H8IH 4UONA 1YCPM 1YPHE 2EI6A 1O5CB 3TJNA 4CRAA 1AUJA 4MNYA 2GX4A 1GMHF 3SNEA 5JB8S 1ZRKA 2VNTA 3UY9A 3SU6A 1SGYE 1O3KA 2ZCKP 3RXMA 1MU8B 1GMCF 4FUFA 2KAIB 2AMPA 3M5NA 2Y5HA 1V2KT 3SV9A 1HAOH 1LHEH 2PSXA 3HKJB 1H1BA 1XUJA 2XRCA 3U98H 4O03A 1GWAA 2GDEH 1HFDA 4LZ4B 2Z3EA 2ZGBH 5FHTA 2BD3A 3PB1E 3PLPA 1BTHH 3A85A 2JH5D 4VGCB 2A5KA 1ZMNA 1UCYE 2ZKSA 3A84A 1PPGE 1HDTH 2ZPSA 2M5TA 2F91A 4ISLA 2W7SA 5SGAE 2QA9E 4ESTE 2Y6TA 5DJ7A 5A2MH 4ZKSU 4E05H 1SFIA 2EI8A 2Z3CA 3MH4A 1DWBH 2SGEE 3KQEA 4K3JA 1GJ8B 4X8SH 2G5VA 3M5OA 3HGNA 3GCHC 1KIGH 3NPSA 2ZTXA 2BX3A 2BDIA 3WY8A 1HAGE 4AYVB 3MTYA 1Y5AT 2OC7A 1AB9C 1UHBB 2FESH 2H5DA 4X2XA 3VB3A 4AG1A 1EP6A 1QFKH 3RMMH 2O9QA 1DVAH 5IYTA 1VCWA 2P3FH 3QO6A 5DP8A 1CA8B 1FY1A 1P2QA 3V13A 4CRDA 4OGXA 2IJOB 3HPTB 1JMOH 2ANYA 3ZV8A 4BXWA 3A82A 1QJ7B 4ZUHA 1GI2A 5T6DA 3E91A 3N7OA 2TBSA 4FUHA 1GBIA 2PUQH 3MH5A 3E0PB 1GJ5H 1OWDA 2V35A 4B2AA 1E38B 1SI5H 1D3PB 1O2IA 3MNSA 2A5IA 2G51A 4NA7A 4ASHA 3E8LA 4JZDH 1OWIA 2FI5E 2WYJA 2BY7X 3QGNB 4X1NU 2SGFE 3MNBA 2OBOA 2VU8E 3S9AA 2H9HA 1AD8H 1KYNA 2CMYA 1MTSA 1P03A 1V2OT 1QJ6B 1W7XH 2BDYA 1BZXE 1A7SA 5DG6A 1P06A 2XBWA 1KXBA 1EOJA 1WUNH 3EA8A 3JZ2B 1LMWB 3A8CA 5DP5A 1OWEA 4DIIH 1BOQA 5EW1H 4K2YA 1NU7B 3SGAE 2ZTYA 4NFEA 1PFXC 4TYDA 3RXUA 1GGDB 1BIOA 4X6NA 3ZZ4A 1HPGA 3SUEA 1EZQA 1F92A 4UD9H 1ESTA 1OPHB 1QRWA 2BQ7B 3MMGA 1JWTA 1XVOA 3IITA 1Y3VA 2HALA 3A7VA 4B75A 1AUTC 3LGYA 3RXDA 2FO9A 1Y3UA 4ABIA 1SLVB 3PTNA 2B0FA 1AI8H 1O3DA 1O3IA 2ZDNA 1IQJA 2SGDE 1T4UH 3O8CA 1VJAU 2GVFA 3DFJA 1F7ZA 2BD5A 3MWIU 1O3BA 2OC0A 3SU2A 4BTTB 3ENSB 3TK9A 1ZHPA 1FN6A 4U01A 2ZFTA 2BQWB 3PLBA 2F9OA 4JYTA 4B76A 3Q00A 7ESTE 2R2MB 4OS5A 5GWZA 3SU5A 1EZSC 3V7TA 1G3EA 1NZQH 3H7TA 4XE4A 4AGKA 4A5TS 2ZU2A 1C2MA 1SHHB 3AASA 4WWYA 1O2SA 2B5TB 4B71A 4FUIA 2GD4B 4ISHH 7LPRA 2AFQB 1DLKB 1QR3E 4XBDA 4R8TB 1J16A 3M3TA 1ABJH 1PPFE 3FZDA 4NSYA 3ZZ5A 1C2DA 3AAUA 1V2UT 4DW2U 2ZDMA 3RXCA 5LPEA 2C8YB 1N6YA 1TX7A 3L3TA 4X1RU 3AAVA 1C5WB 1THRH 2ZGJA 2Y5GA 3RXHA 5TCCA 3D23A 1ABIH 4IBLH 5ESTE 5TJXA 1A61H 3SNDA 2VH0A 2ZDVH 3BTQE 3URDA 2TPIZ 5FBEA 2VVUA 1JRSA 1CQQA 3PYHA 1UVTH 1AZZA 2QF0A 4CBNA 1TGTA 2BB4A 1TNGA 2D2DA 4AB9A 1Y3YA 3QTOH 3QX5H 1O5DH 1TNHA 2ZHWH 4CRCA 2A4RA 4NA9H 1IOEA 3B8JA 3VB6A 4XOJA 1ZGVA 3SV8A 1L1GA 4AOQA 4I7YH 3SNAA 3U8TH 4ABGA 2GT8A 2XBVA 1JBUH 3M61U 2TGDA 2A2QH 2FXRA 2PR3A 1S5SA 2BOHB 4HGCA 1CSOE 1IQEA 1O34A 2XC0A 3EA7A 2A4OA 5IDKA 1FUJA 1AFQC 1GJDB 5E0GA 1SGFG 2VGCC 1ANCA 1X7AC 2ZHDA 2P3UB 2AH4X 3RM2H 1O2VA 4NIWA 3RXTA 4X2YA 4SGAE 1P01A 3H7OA 1LKAA 1GCTC 1AIXH 1P04A 2C8ZB 3ZZ3A 1BTYA 1N8OB 1O39A 2WYGA 2ASUB 4Y7BA 3SUDA 5K0HA 1O5AB 4I8KA 4JK5A 1LQEA 2VVVA 1GI0A 1O2XA 1WQSA 2ILNA 2GCTC 3GY5A 3QN7A 1HJAB 1XUFA 3ODFA 1BJVA 1K1MA 2F9VA 2O8LA 2XYAA 3RM0H 1SLXB 2BD7A 1IQHA 2R0KA 3A7WA 1A5HA 1GDNA 3OSYA 2VIQA 2A32A 4X0WU 1SOTA 2PKSB 3SV6A 4YT6H 5E2OA 2ZC9H 3RXGA 3TJVA 2W3IA 1F5KU 2ALVA 3BEUA 1EB1H 1A2CH 1FQ3A 1DICA 1YLCA 4ZKOU 1WV7H 1HNEE 2HLCA 4WXVA 1KDQA 4Y8XA 1O3GA 1OWHA 3BN9A 3GY4A 3ATMA 3M7UA 5L2ZH 3BTGE 2DE9A 4YLQH 3ZVCA 3Q76A 1SPJA 1YC0A 1TAWA 1ELVA 2OUAA 4GHTA 3ZVFA 4D7GA 2BHGA 1C5SA 2H5CA 2UWPA 2ZCHP 3A8BA 5EW2H 3Q3XA 3UOPA 1H9IE 4UFEH 2PV9B 4CH2B 1C4Y2 2AMQA 1FXYA 1MKXK 1T7CA 3LONA 3O8DA 1C5TA 2ZDLA 1DT2A 2CN0H 2ZU3A 3SZNA 3F1SB 2BDCA 2PTNA 1PJPA 1AY6H 1HAZB 4I8GA 1QQUA 2C4FH 5A8ZA 2TGTA 1ZHRA 4HTCH 4X8TH 1HAVB 4JZIA 2Y7ZA 1MTWA 2GV7A 4WXIA 4HFPB 1RTKA 2BD2A 5T6FA 1EATA 2A4GA 3VXFH 2B9LA 2J38A 3IG6B 2GTBA 1QB6A 3A8AA 1S6FA 1UCYH 1QA0A 1C1WH 1NS3A 4XBCA 2ANWA 3A87A 2HOBA 3A8DA 1EJMA 5J4QA 1UVUH 4F49A 2BY8X 4AORA 4WMDA 2VVCA 3T2NA 1GI3A 1DWCH 2PTCE 3VEQB 1VZQH 3BG8A 1A0HB 1BTPA 1GCDA 2NU0E 4X8UH 2CV3A 5G4BA 2EA3A 4YT7H 2LPRA 2Z9KA 3BIUH 5JBBS 4Y6DA 1QB9A 3R3GB 5E0JA 3PM3A 2BQ6B 3ZVDA 2BX4A 1FZZA 1FI8A 3GY8A 1S0RA 4NWKA 5DP3A 4IGDA 1OYQA 2FX4A 4MDSA 1ARCA 3F9FA 1TMUH 1GJ4H 2IN2A 1XUGA 4BAKB 3SHAH 1MMJN 5GXPA 6ESTA 1G3BA 1NRPH 3ZV9A 9ESTA 1TQ7B 1GBBA 2C8WB 2KAIA 3LPRA 2FLRH 1QY6A 2FYQA 1ZLRA 3S7HB 3RU4E 1SSXA 1C5VA 1KLTA 3KHVA 1BRBE 3AW0A 3EQ0H 1C1QA 1ZTKA 1S6HA 2OBQA 2CF8H 1TX8A 4OS1A 1AE8H 3KQCA 2GCHF 4DURA 1ELBA 2CF9H 3ZVBA 1J8AA 3T29A 3VFEA 4X6OA 1MAYA 2GKVE 1HAPH 3RXIA 1O5EH 4FVDA 2RCEA 2JH6D 1SLUB 1C5LH 2IOTA 2ZU5A 1W0ZU 3Q3KA 3ZVEA 5JPMH 2FM2A 2A7CA 3JZ1B 2Y82A 4ZKRU 3W94A 4KTCA 1ZGIA 3MYWA 3UQOA 1L4ZA 5CE1A 2ZQ1A 1O3EA 2GCTB 3SU0A 1MH0A 2BD9A 1THPB 2VIVA 3AVZA 4K60A 3P70B 1ELDE 4ZHMU 1GBEA 4CHAB 6GCHF 2D26C 4ZXXH 3BIVH 4Y8YA 1DSUA 4B2CA 1P57B 2BTCE 5E2PA 3EA9A 3SJIA 1GJ7B 2BY5X 4RSPA 1P3EA 1ZSKA 3GCTF 2VIPA 4YM9A 2G4TA 2F9BH 2HPPH 1P10A 1TQ0B 5FPSA 1AVXA 1RIWC 1P09A 2OXSA 1UK3A 1GHVH 2O8UA 2WINI 1XKBC 2SGAA 3ATKA 4XSKU 1DANH 3LGVA 2FOHA 2R3YA 1QCPA 3RC6A 1MCVA 3BSQA 1LPZB 3SBKA 1YKTA 1S81A 1FONA 3LOXA 1PYTD 1CGIE 3HK3B 5DO4H 3RXEA 1GHYH 2WPLS 2BOKA 1EAXA 8GCHG 1O5FH 1NM6A 3ZYDA 1ZTJA 3RU4D 1G32B 3UFAA 1LQDB 1P2JA 3HGPA 1HUTH 4IMQA 3MH7A 4ZHAA 2QXHA 2GZ9A 1MKWH 2AGGX 1UTPA 4INKA 2Y80A 2ZGHA 5FPTA 1FPHH 3B23B 1GI6A 3LJOA 1D3DB 2Z7FE 3STJA 3D49H 1QL9A 2SFAA 1O0DH 3T5FH 1O2RA 1AZ8A 1GHAF 3T25A 1AQ7A 2QXGA 1SGEE 4MNXA 4BAQB 2VB0A 8LPRA 2BDAA 1CGHA 5EODA 3UWJH 4DT7B 5BRRE 2ZECA 4Q80A 4JMYA 1TALA 1BBRK 1ZJKA 3SNBA 1U6QA 3BTHE 4INHA 5BPEA 1RRKA 1LHFH 2ANMH 4A1TA 4UFFH 3BTWE 1TMTH 1C4U2 1ZMLA 1P9SA 2QN5T 1O3FA 4FU8A 2VIOA 1DX5M 1D6WA 3RXVA 1NRSH 2UWOA 5A8YA 2WPKS 1H9LB 1F2SE 3T62A 5L2YH 5F8XA 1AKSB 3UNSA 1W11U 2P8OC 1FDPA 1IQFA 1W14U 2P3TB 1SLWB 1Z8JB 1UK2A 1O38A 1ZZZA 4MVNA 1AWFH 1OP2A 1NFYA 1OXGA 3TH2H 1CE5A 1KLJH 1SBWA 3RLWH 2FMJA 1V2PT 1NRQH 3TJUA 1C1RA 1TOMH 1O37A 1VGCB 1KXCA 2ZO3H 1BMAA 1GMHG 1O3JA 3EYDA 3PWBA 2OD3B 3KEEA 1ELFA 4NCYA 4CR5A 1GI8B 4NGAH 3CS0A 4ZROA 3MH6A 1T8NA 1A0LA 1XXDA 1O2TA 2TIOA 1K1OA 1PPBH 1TRNA 2JETC 1TBQH 4FVBA 3CP7A 3O8RA 1O3AA 4MQAA 2BYAX 1B0FA 1SR5C 3VGCC 4B74A 4ZH8A 1O3LA 2Q6FA 3MO6A 4CBOA 1BCUH 3QDZB 1FY3A 1XXFA 2FOMB 1XKAC 2CGAA 4BNRA 2BVXH 2J92A 3MU1A 4X1QU 4TWWA 5EPYA 1RIWB