1NTPA

Use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
molecule keywords BETA-TRYPSIN
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA02
1ZRKA 4ISOA 2D2DA 2F83A 3RXGA 3VB5A 5E0HA 4LZ1H 3KEEA 2A4OA 4Y8ZA 2EI6A 1ZPBA 1CA0C 3DUXH 2Y5GA 4Y8XA 1H9IE 3PM3A 1ID5H 5E2PA 4AX9H 1SLXB 2Z6BD 2BY9X 1TLDA 1YPHE 2HVXA 3NUMA 2ANWA 1EPTC 2F9OA 2PLXA 3P8FA 3EE0B 1EZUC 2TRMA 1ZHMA 3O8BA 3BTME 2OCVB 4IW4E 3BTTE 4NIVA 1YF4A 3VB3A 1VJ9U 3GY4A 3RMOH 1OWIA 1QGFA 1O2PA 2A4RA 4WMDA 1IQIA 3BG4C 5C1UA 1ZRBA 1V2KT 2ASUB 1V2QT 1AE5A 1RXPA 4MNXA 3Q00A 3RU4T 3M3VA 5ESBA 3A8CA 1EP6A 1ABJH 1MTNC 1L1GA 1QB6A 3STJA 5I25A 4MNYA 2DUCA 1YCPK 1P09A 4MNVA 4IN2A 1C5LH 1ZSJA 4WWYA 5GCHF 1PQ7A 1VCWA 5A8ZA 3A8DA 3FP8E 4UD9H 3SZNA 3EA8A 1WSSH 2W26A 1LHDH 3KN2A 1IQLA 4IBLH 5HGGA 3RXSA 5DGJA 5EW1H 1UO6A 4JYUH 2C4FH 1NRQH 1T8OA 1W11U 2A2XH 3ATIA 2HLCA 1DPOA 2FO9A 1O32A 1ZHRA 4WXVA 4INLA 2SGPE 1GVZA 2O8MA 1XUJA 3PO1C 1HBTH 1OWHA 1XKAC 1TMUH 1PQAA 4R8TB 1C1TA 3PYHA 2UUKB 1C2LA 4D9RA 3MWIU 2ALPA 1YPLH 1FY5A 2F9NA 1P11E 1C4V2 1HJAC 3MO6A 4Z6AH 2FOEA 2VWNA 1GMHF 3ZZBA 4YLQH 2O8TA 2FZZA 2QAAA 2AIQA 4TPIZ 1L4ZA 5F8TA 1NN6A 3MYWA 1A5IA 3M5OA 1C1UH 1H9LB 3F68H 3LIWA 3G01A 3DFLA 1PPEE 4OS5A 4ABFA 2Z7FE 1MQ5A 1TFXA 1Z6JH 3GICB 4O3UA 5FCRA 1O2OA 3F9EA 1ZLRA 3P70B 4X2XA 4ZKSU 1BHXB 2AYWA 5T6FA 1C1NA 1P04A 2FTLE 2ZGBH 4AFSA 2BY6X 4MPXA 1YLCA 1AVGH 2Y6TA 4ISLA 4Q80A 1GI0A 5C1YA 1AUTC 1LVOA 1XXDA 3P8OA 1TX7A 1DFPA 1MBQA 1LPGB 1NESE 2O8LA 3QN7A 2THFB 1O38A 4INHA 2WV4A 4YLUA 1BRCE 2BDAA 3PLBA 1TE0A 2CF9H 1V2JT 2CJIA 1K1LA 1K1NA 1IQKA 2F9BH 3N7OA 5IYTA 6CHAC 3A85A 3RLWH 2GGVB 4NIWA 4HTCH 5EW2H 1EXFA 5A0BA 3ESTA 2PWXA 1TRMA 1K1OA 4AYVB 3R3GB 3UNSA 1C5ZB 1FY8E 1V3XA 2G51A 2HPQH 3DA9B 4Y7BA 3LJOA 5GJ4B 3T27A 1XX9A 1J16A 2FOAA 3VB6A 1DLKB 2XC5A 3SNDA 1Y3YA 2BQ7B 2F9UA 1GPZA 2BD4A 4A1XA 1EPTA 1GDUA 4GUXA 1C2DA 2BLWA 2NU1E 3AW0A 3LGTA 1DT2A 2JETC 1TGSZ 3SO3A 1QB9A 2CF8H 3UY9A 4MPUA 5JPMH 3LONA 5DPAA 2R2WU 1AFEH 2FI4E 2ZA5A 3RXEA 4AZ2B 1K1IA 4Q2KA 3HK6B 1G3CA 3ZZDA 5J4QA 4GHQA 2ZTYA 1UVPA 2PGBB 5FCKA 2PKAB 1N8OC 3FZDA 3ZZ5A 1BJUA 3SW2B 1HCGA 1GI4A 1EASA 4TYDA 3VPKA 1SG8B 5FX6A 3Q77A 2AMDA 4IGDA 3RXDA 1BJVA 4CH8B 3MH6A 4AB9A 2VVCA 1SGYE 3OY6U 1G9IE 1C5PA 4OS4A 2JETB 2ZCHP 3RC5A 3E0NB 3KL6A 1UTQA 4X1PU 4WMFA 2FX6A 3UWJH 2ZDAH 1O3GA 1KLJH 3M7UA 2PUQH 3ZZ8A 1P57B 3ENSB 2H5CA 1KXDA 3RXAA 1YCPM 1AFQB 1BTWA 1SHYA 1UK4A 1O3AA 3VXEH 2QYIA 2ODPA 2D8WA 5GPIB 4ABJA 3SJ9A 2IOTA 5EGMA 3BIUH 5A8XA 1BT7A 2OXSA 1CA8B 1L1NA 1OX1A 1TPOA 4ABHA 1DXPA 4HI3A 4BOHA 1WQSA 4K5ZA 1LVYA 1KSNA 1VR1H 4NFEA 1PYTD 2ZTZA 1ELFA 1ABIH 1F0SA 1EJAA 5FBIA 4A5TS 3EA9A 2LPRA 3QWCH 2ZDMA 2H9TH 1DUAA 1MZAA 1THRH 2ANKH 1O3KA 3SGBE 3T2NA 3ZV9A 1FN6A 3O8RA 3TGKE 1LPKB 2P59A 3MH5A 3PROA 2ALVA 1CHOG 1AGJA 3AVZA 1O34A 3HATH 2H9HA 4GVUA 4BAHB 3RUOA 2OBQA 3TJNA 3V3MA 1IQJA 3BN9A 2BQWB 2RCEA 3LKWA 1T8MA 2BD9A 4D9QA 3D65E 3A81A 3GCNA 3PTNA 1AIXH 4I8KA 2Q6FA 1T8NA 4Y11E 2H1UA 2Z9IA 4CHAC 1C5YB 1GBHA 1O3FA 3HKJB 5EXNA 3HPTB 1P06A 1XM1A 2A7CA 1C5MD 3I78A 1ARBA 1YYY1 4CRFA 1MD8A 1BB0B 1MU8B 2BVXH 4AB8A 3GYLB 4IMZA 1QR3E 3KQEA 3SBKA 1G30B 1YM0A 4R0IA 4SGBE 1ZSKA 1H4WA 2ODQA 3Q3KA 1THPB 2BTCE 1D6WA 3F9GA 2IPHA 2QC2A 3QZQA 1EJNA 1GI9B 1QIXB 4DJZB 2ZNKH 1S83A 1A2CH 2Y80A 1GI8B 4Y6DA 1GBBA 4GCHG 3BG8A 1NC6A 1BMNH 1QA7A 1A0HB 4FU9A 3H7OA 1AFQC 1GJ4H 3ZZ4A 1O2KA 3E3TA 4F4OC 1SQOA 2ZCKP 4I8GA 4YOJA 7GCHG 2ZDNA 2PW8H 2G5VA 3A7TA 3PWCA 2QXHA 3PWBA 5EPYA 2ZHWH 1A3EH 2FM2A 3V12A 4H6TA 1GJBB 3ZZ3A 2ZFQH 1W7XH 3A82A 3KIDU 4MVNA 2GD4B 1A46H 2BDYA 4LOYH 4ISIH 3ODFA 2BVRH 3M5NA 1KDQA 1N6XA 2YNAA 5C2ZA 4ZXXH 2F9PA 4NGAH 4U30A 5DKMA 3A86A 3U69H 3VFEA 5AFZH 1MUEB 2AS9A 1AO5A 1AI8H 1Z8RA 1NRSH 1S0RA 4YT7H 1DITH 2A1DB 3E8LA 5HM9A 2C3SA 4JYVH 1BTUA 4E05H 1H9HE 1QJ1B 2G55A 1D4PB 3RMNH 3SNEA 1PPHE 1GHXH 2RDLA 2LNCA 4A1VA 2TGAA 3RU4D 1PPCE 2XCFA 1FPHH 4OGYA 1CBWC 2QA9E 3GY3A 2OINA 1LPZB 3NCLA 1H8DH 6LPRA 4CR5A 3V0XA 5T6GA 2ZWLH 4NA8A 3SUGA 4BTIB 5JBAS 1HDTH 4CHAB 1MCVA 1T7CA 1C5QA 1OP2A 4JCNA 1K28D 3LC5A 4B73A 1AU8A 1MH0A 2ZHFH 1C1SA 2GVFA 2BDIA 2PFEA 2H2ZA 1DVAH 1GJ5H 1C2GA 3LC3A 4B71A 2GX4A 1EOJA 4JMYA 2WINI 5JDUB 1EX3A 4KGAA 1QL9A 5C5OA 3TPIZ 1Y5UT 3SJKA 4BTTB 4A6LA 3CENA 3BSQA 1GBTA 1TNHA 3C1KA 3HGNA 2VIDA 3Q3YA 3H7TA 2PTNA 2W7SA 1CU1A 2J2UA 3ZV8A 2J95A 1DE7H 3LGYA 1SBWA 1AKSB 1NROH 2GCHG 3NPSA 4U32A 2NU4E 1SQAA 1JRSA 1CBWB 5K0HA 1C9PA 4RN6A 1ORFA 4UFDH 4ABDA 3AASA 1ELVA 1UCYH 1BRUP 3LGIA 4Z0KA 3RMLH 3EDXB 1GBIA 1ETSH 1O5DH 5EQRA 3RXJA 2G4UA 1BTZA 4ISNA 2XC0A 2OC8A 1A4WH 4NIXA 1ZMNA 3GDSA 1TPAE 3RP2A 1SOZA 2PSYA 1EZSC 5LPEA 1AWHB 1FQ3A 3MNBA 1V6DA 1V2ST 1LVBA 3QK1A 1JXPA 1PQ8A 3NWUA 2A4QA 1W0ZU 2OQUA 3UR6A 3T25A 4X2VA 3L33A 9ESTA 3BEIB 6ESTA 3A7VA 4FUFA 4I8JA 3SNAA 1TQ0B 2PV9B 1EZXC 1AN1E 2BXTH 3T62A 2VU8E 3BTEE 3LPRA 1J9CH 1E37B 4JZIA 1O2ZA 1C4U2 1GBJA 1E36B 1TYNA 3GCHB 1IQGA 4MPWA 4Y76A 2HALA 1PPFE 3PTBA 1AD8H 2CGAA 5EODA 2Z9GA 1SGEE 1YGCH 3O8CA 2BYAX 1D3TB 1ZGVA 1N1LA 3RXHA 1GBDA 3DT0H 1NTPA 5FAHA 1GDQA 1O5BB 1CA0B 1Z8GA 3TH2H 1AE8H 1EZQA 1YKTA 3TH4H 5A8YA 1CT4E 3U9AH 4TWWA 2BD7A 2CMYA 2ZHQH 4H42U 3RXTA 4FUBA 4NA7A 1SLVB 5JYIA 5BPEA 3ZZ7A 7ESTE 3RDZA 1GL1A 4A92A 1CHOF 1UK2A 3QGNB 1Y8TA 1P2KA 4D7GA 4Q7ZA 5I46H 5L6NH 1ESTA 4E7RG 1BITA 2Z3CA 2SFAA 2CN0H 3EAJA 1MTVA 3SNBA 2B0FA 1L0ZA 1QL8A 1Z1IA 2NU3E 1GMDG 1TX8A 3EA7A 1RIWC 1SGIB 5EPNA 1O5AB 3UUZA 3UWIA 1UTOA 4Y7AA 2STAE 4CH2B 2BY8X 2ANYA 5DP6A 1PJPA 1K1PA 3F9HA 3PLKA 1HAXB 4A7IB 1UJ1A 4NWKA 1GBCA 5HYOA 3U1IB 1O5FH 1QY6A 1O3IA 1FZZA 2P95A 3OU0A 2W5EA 1ETRH 5FXLA 3MHWU 1UVOA 1Y5BT 2ZDVH 5G4BA 3PMBB 3TK5A 1VITF 1MKWH 1KXFA 2FMJA 2FOMB 1GCTB 1F92A 1Z7KA 1EQ9A 2FODA 2GZ8A 2VIQA 1G37A 3RXQA 4AG1A 4K2YA 4GSOA 3CS7A 2BQ6B 4MG3A 3LJJA 1UTMA 1O0DH 1J17T 1DWBH 1O33A 2ZKSA 4AOQA 2R0LA 1GHYH 2SGFE 1ESBA 4GCHF 4LXBH 2ZGJA 1QRZA 2BZ6H 1O5GH 2G5NA 5T6DA 2PR3A 1GJ8B 4D7FA 1UCYK 1A1RA 1G3EA 1QHRB 1OKXA 4UFGH 1ZYOA 3TNTA 4DW2U 2EI8A 1JBUH 1MAYA 1NO9H 1O2MA 1GJCB 1MMJN 1T4VH 5HMAA 3LH1A 2J34A 2QXIA 1GBAA 1XUHA 1WV7H 2ZG0H 1IQHA 4I31A 3M7TA 2ZTXA 3P17H 1FONA 3MTYA 5T3HA 4F49A 2ILNA 2UUJB 4X8UH 2VIPA 1F0RA 1JOUB 2ZO3H 4ABBA 2SGQE 3ZZCA 4AGJA 2F91A 5LGOA 1TALA 5E0JA 1SI5H 2BLQA 3URDA 1ELBA 2XNIA 1B0EA 2J92A 1O35A 4K60A 2A31A 3ZVBA 1YPKH 4X0WU 1RJXB 2BD2A 1KDQB 1BMAA 2Y5FA 4FUHA 2B9LA 2OD3B 5F03A 3MU5A 3GY5A 1AB9B 2BMGB 2W3KA 3M5MA 1H1BA 2YOLA 2GT7A 1RIWB 2Q1JA 1EAUA 2JKHA 4BTUB 2CHAC 1KY9A 1DSTA 4ZH8A 1FN8A 1CGHA 1T4UH 1DS2E 4RKJB 1HJ8A 1KXEA 2AIPA 3S9BA 2VGCC 3M37A 4BAMB 1WYKA 1JMOH 3SUDA 1K22H 4ISHH 5CE1A 1A0JA 5DP3A 5EXMA 4NIYA 4NWLA 1GI1A 3OX7U 3LGUA 2FPZA 2BLVA 4K1TA 2Q6DA 2NU0E 1KLIH 1S82A 5TCCA 3FVFB 2AMQA 1AB9C 1TBRH 2C93B 2FYRA 2Y82A 3S9AA 1MTWA 1O3CA 4OS6A 3S7HB 4JZDH 1QBNA 3GY8A 3M35A 2FXRA 1W12U 2BB4A 4FU8A 5F6MA 1DUEA 1Y59T 2FTMA 4XFQA 1ZZZA 5ABWA 4O9VA 1C5OH 3JZ1B 1SGFA 2BM2A 2VWOA 1AY6H 3SU3A 2BVSH 3RXFA 1BBRK 1C5RA 1GMHG 1IQFA 1BOQA 1ETTH 3UOPA 2VVUA 3TJVA 3RXPA 2VINA 1TA6A 2PUXB 2FOHA 1YCPH 1L1JA 1EAXA 1V2TT 1F7ZA 1HAVB 1FXYA 1HNEE 2Z3DA 2VH6A 3F6UH 2PSXA 1QA0A 1CO7E 5C3NA 4KTSA 2VIOA 2P3FH 8ESTE 1YPGH 3FANA 1TNGA 1OWKA 4H4FA 1O3MA 1SQTA 1SHHB 1UVTH 2ZZUH 1EKBB 1QB1A 1ZMLA 3QO6A 4WH8A 4BAOB 2WYJA 5JBTA 3RXRA 2QIQA 1TGCA 3ITIA 1G2LA 4K8YA 4JK5A 2PKSC 3SU0A 4J2YB 3A89A 2CV3A 3SU5A 3SV9A 2ANMH 1F0TA 1TIOA 1BTYA 2RA0A 2Z3EA 4TY6A 1ESAA 4I8HA 3SORA 4CRAA 3BTWE 2BLOA 3SI3H 1L4DA 4Q7YA 4Y71A 2G4TA 4TPYA 4XSKU 1TRYA 1OS8A 1O3LA 4ZAEA 3TITA 1HPGA 1Y3VA 2H5DA 1W8BH 4AGKA 3RC6A 1SMFE 1V2NT 4WXIA 2UWLA 1GWAA 1AZZA 1SOTA 3FP6E 3ODDA 5IDKA 3SUEA 3S9CA 1ZJKA 3BV9B 1ZJDA 3B9FH 1P10A 2KAIA 1WCZA 1SPJA 1HAIH 3RXOA 1O30A 2PKSB 1GJ9B 4JZ1A 2QGRA 1BA8B 3OYPA 1MBMA 1ELCA 1VJAU 1G2MA 4BXWA 4XE4A 1F0UA 1C5SA 1O2QA 8KME2 2BDCA 2WYGA 3QZRA 1FPCH 1UHBA 2VIWA 1Z71A 2BHGA 4FVDA 4KTCA 1DDJA 2B7DH 2P93A 3BIVH 4Y79A 1FY1A 4ABIA 1S81A 2FOBA 3TH3H 1KYNA 1GMCF 4SGAE 4ASHA 1O31A 2ZC9H 1P2JA 7GCHF 2YNBA 5E0GA 4U01A 1FAKH 1PPZA 3P6ZB 3A83A 1HIAB 3RM0H 1HAGE 1Y3UA 2DE8A 1DWDH 2XYAA 1C2EA 2B5TB 3E90B 2GV7A 3VGCB 1P2NA 3KF2A 5EG4A 1YLDA 4TWYA 4VGCB 1FAXA 1O3NA 1AKSA 2Z9KA 1MKXK 2BD5A 3TK9A 1O3PB 3K9XB 1JIMA 1GHBG 4ZUHA 1O3EA 1VITH 1K21H 1UCYE 1O37A 3UTUH 2UWPA 3ZVFA 4AG2A 4BAKB 2WPMS 2ZDKA 4X8SH 1V2OT 4WF8A 3GDUA 2R0KA 3K6ZA 4CR9A 1FV9A 4ZKNU 4KP0A 4GAWA 5E8EH 2IJOB 2FESH 1GJDB 1NRNH 1FY3A 4IMQA 1XVOA 3TLOA 3BTDE 2QXJA 3ZVDA 3NKKA 3GOVB 2A2QH 2GV6A 2G8TA 5A0AE 1BDAA 2ZQ2A 2GZ7A 3SU1A 1O2XA 2R3YA 2ZDLA 1TGBA 1BBRH 1XKBC 4MLFB 4X1SU 1W3CA 3ZYDA 3LDXH 5H4IB 3MNSA 2BY7X 1IQNA 2GCTC 1YPEH 3A7XA 3WY8A 1P02A 1YC0A 2NWNA 2GMTB 1O3BA 1BMMH 4X6MA 2SNWA 4BNRA 5F8XA 2ZU3A 4I7YH 1GHAG 4ESTE 1O5EH 1OSSA 3SHCH 1DY9A 3CP7A 1MTUA 3OTJE 1SGNE 2OBOA 3AAVA 1BZXE 9LPRA 1TBQH 3T26A 1D3DB 2XXLA 3A7ZA 1SGTA 2ZEBA 1YBWA 3SU2A 5AHGH 5LH8A 3RMMH 2G81E 3UOUA 1O2JA 1S85A 1UHBB 3SOSA 2FEQH 3LOXA 1MTSA 4WVPE 1O2LA 1C1MA 2CXVA 1Q3XA 4GLYA 1NY22 2OC1A 1P03A 4DT7B 1O36A 1W7GH 1NT1A 2QN5T 1SFQB 4X6PA 2XBWA 3AW1A 4U2WA 3ZZ6A 1XUIA 1T32A 3QDZB 1GCTC 3E1XB 2GMTC 4FUDA 4RKOB 5BRRE 4UDWH 4CBNA 2P16A 4THNH 2A5AA 1KXBA 2I6QA 4Y10E 1WU1A 2PHBA 3I29A 1GHVH 4MDSA 4DURA 1TOCB 2BX4A 2UWOA 3D23A 1V2MT 2HNTC 1AWFH 2V3HH 3IWMA 3UNQA 1BTPA 3Q76A 3GDVA 1P9SA 4ZKOU 4I8LA 5F8ZA 2AGEX 1C2HA 3SQEE 2P94A 4B2CA 1RS0A 3S0NA 1HUTH 1IQMA 2ZFSA 1IHTH 5EQQA 8GCHF 1E35B 3RXKA 2QY0B 4CREA 5ESTE 3L6PA 2P8OB 3RLYH 2D1JA 1P2OA 1ACBE 1P8VC 2FS9A 4X2WA 1NFUA 1BUIA 1P9UA 4WY3A 3S7KB 3BTGE 3AAUA 3MU0A 6GCHF 1HAZB 3DD2H 2XC4A 1GBEA 3Q3XA 4MQAA 1MQ6A 3KHVA 2TIOA 2ZPQA 1QRWA 3A80A 1ZOMA 4X8TH 3VXFH 3QUMP 1CT0E 1M9UA 2Z94A 3SGQE 1C2KA 3KCGH 1GI6A 3BTQE 1FMGA 4D76A 2JH0D 4WJG2 2ZU2A 5PTPA 1V2PT 2RA3A 1V2UT 1Z1JA 3SJOA 1PPBH 3E0PB 1Y3XA 1ANBA 2BY5X 1QURH 1IHSH 1RTFB 1WTHD 4OS7A 1OP8A 1GBKA 2BD3A 1NM6A 1TONA 4ABAA 1WBGB 3K2UA 1LDTT 3F9FA 5A0CA 1A3BH 3A88A 3BF6H 3I77A 5GXPA 1SFIA 3F1SB 2B8OH 2W7UA 3SJIA 1BHXF 4UONA 1C5TA 1FJSA 2XRCA 2KAIB 4Y8YA 2WPHS 1QQ4A 1C5NH 2VNTA 1OOKB 1NFXA 4BANB 3D62A 2VGCB 1A7SA 5EU8A 1AVWA 2ZF0H 4FUJA 2SGEE 5LPRA 4NSYA 1NRPH 1AUJA 1AMHA 3U8RH 1P2MA 4OGXA 2ESTE 4FUGA 3FZZA 1S6HA 2BDHA 3ATLA 3A7WA 1GDNA 2WPKS 3P95A 1OPHB 1C4Y2 1MZDA 5DJ7A 2DE9A 1UVUH 3KGPA 1LQDB 1TGNA 1NU9A 2BDBA 1C9TA 4B2BA 1O2HA 3UQOA 5FHTA 1SGDE 3VB4A 1WQVH 3A87A 3SV7A 3BEFB 2FDAA 1G3BA 4NZQA 4GPGA 5CHAC 3ZVEA 1NS3A 2XW9A 1TOMH 1GMDF 4HZHA 1HIAA 5E2OA 1LHGH 1HAHH 2ZHEH 1LHCH 4WH6A 1V2VT 3MMGA 3OSYA 1OP0A 1T31A 2ZU4A 2IN2A 1GHAF 2PKAA 1KIGH 2WPIS 2AGIX 3SHAH 1E0FD 1YPMH 2EA3A 1MD7A 1SL3A 2ZPSA 5A09A 1C5XB 1P3CA 3GYMA 5AVDA 1ELDE 3T5FH 1ZTKA 3JZ2B 3ZVAA 3QLPH 4NSVA 1TABE 1YP9A 3TVJB 2J9NA 1TNJA 2ZCLP 1HXEH 1A61H 2GT8A 1HJ9A 5EQSA 3BTFE 1UTNA 1ZHPA 5DP9A 1ARCA 4RSPA 2GZ9A 2TGPZ 1W0YH 2Y5HA 4D8NA 2HNTF 4KTUA 2ZFPH 6GCHG 3ZVCA 4K1SA 3MO9A 4IC5A 4UEHH 2M5TA 3B23B 1AQ7A 2BOHB 1GI2A 1LCYA 1X7AC 1OWJA 2STBE 4ABEA 1WTGH 2FIRH 2SNVA 1GHZA 1C1WH 1PPGE 3TJUA 3BG4B 4YOIA 2BZAA 1PQ5A 3B8JA 4B1TA 1D3QB 2FX4A 1GJAB 2P3TB 1CGJE 1UMAH 5B6OA 1EP5A 2R9PA 4E7NA 8GCHG 1C2FA 1AZ8A 2C90B 1THSH 2GKVE 1P2IA 2FOGA 3MNXA 1KXAA 1ZMJA 3UIRA 3SN8A 5C1XA 1EB1H 1O2YA 4YM9A 2ZI2H 4BXSA 1F2SE 1K9OE 3TIUA 4ABGA 4B76A 2FI5E 2W3IA 2UUYA 1OWEA 4X1NU 5JBBS 2WPJS 1ELAA 1DM4B 2HGTH 1TPPA 2QF3A 2SGDE 2C8WB 2HNTE 1ZPCA 3BTKE 2ZFRH 1LVMA 1RTLA 3MH4A 3M36A 5AF9H 2CHAB 4K3JA 1RRKA 1LKBA 4UFFH 4XBCA 2Z9JA 1GCDA 1TQ7B 2ZU5A 4OS2A 1GI5A 3SQHE 3UFAA 2BOKA 4O3TA 4X2YA 1WAYB 5GWZA 2UUFB 2ZPRA 2FI3E 3M3SA 1D6RA 3SI4H 1S6FA 3RXIA 3DHKH 1G36A 4B2AA 3MU4A 1HJAB 3UQVA 3E16B 5DP7A 1SR5C 1QTFA 4OS1A 1GVKB 1TRNA 3SGAE 1DWCH 3GY7A 4FUEA 2A7JA 3PLPA 1SB1H 1SC8U 3VGCC 1NZQH 5L2ZH 1C1OA 7LPRA 1FDPA 1VZQH 3RXMA 1B0FA 4ZMAH 3TK6A 1QBVH 3PB1E 4AFZA 5L30H 5DK1A 4XBDA 3GY2A 1GHWH 1LMWB 4WMEA 3P92A 1IAUA 3SJ8A 1B7XB 1ZTLA 5K7RA 4CRGA 2C8XB 2AERH 2GDEH 1HXFH 2OP9A 2Y81A 4NFFA 1CGIE 3U1JB 4PROA 1TX6A 1GI3A 3GCTF 5LPFA 1P3EA 1LO6A 4YTAA 1TBZH 1C5UA 3QGJA 1S84A 1O2NA 1TGTA 1V2WT 3LH3A 1HAYB 4IN1A 1P12E 1HAVA 3EQ0H 1RGQA 1O2UA 2GTBA 1UK3A 3TJOA 3SV2H 1SSXA 1MAXA 4B75A 2GP9B 1S5SA 3IITA 3PV4A 4DOQA 3MH7A 4YESB 5DO4H 1NFWA 4CBOA 5JB8S 2GCTB 4AFUA 1FIWA 2QF0A 5L2YH 5AFYH 1PFXC 3PMJA 4JZEH 1GHBF 1C5VA 3W94A 1D3PB 2FOCA 1XUKA 3A8AA 2VIVA 3ATMA 3ELAH 3RXUA 1MU6B 2ODYB 1VCQA 4ZKRU 1OXGA 4JZFH 1O2TA 2TGDA 5C5NA 3P8GA 4ZROA 4DVAU 1GG6B 2O9QA 1NU7B 2FYQA 2HWLB 1GL0E 4YOGA 5ETXA 5FPYA 2ZIQH 1GMCG 3IG6B 1H8IH 3HKIB 3D49H 4DIIH 5SGAE 4NZLA 2A4GA 1MTNB 5DP4A 5EXLA 2ZGXH 2BXUH 2XWAA 1LKAA 4DGJA 3P8NA 1WUNH 1DOJA 4Q7XA 1TB6H 3FP7E 1O5CB 1QFKH 1ZR0A 3MU1A 4JYTA 4KKDA 1CT2E 1XVMA 2VJ1A 1A0LA 4YZUA 3URCA 1Y5AT 4ZHLU 1N8OB 4O97A 1EATA 1VGCB 1Z8JB 5J4SA 1TNKA 2H6MA 2A5IA 1C2JA 4XBBA 1G32B 4K1EA 1SGCA 1SGFG 3ATKA 1SGQE 1O3JA 1UTLM 3TU7H 1BIOA 2XWBI 2AFQB 3E91A 1C2MA 3LGWA 1UVSH 4Y0ZE 4NG9H 4K8BA 5FPSA 1UTKA 3A84A 5HXFA 1ELTA 1SGPE 4MTBA 4FVBA 2D26C 3PO1B 1TA2A 2ZFTA 3SV6A 5TCAA 2G52A 4TY7A 1ELEE 2ZGHA 3HK3B 2JH5D 3V13A 3TGIE 3TGJE 1DXWA 1J8AA 2ZHDA 3STIA 2A0QB 1P01A 2V6NA 4NCYA 1F5LA 4FUCA 3UNRA 1Q31A 1GBMA 2GDDA 2Z9LA 1F5RA 1LQEA 1AVXA 2XBVA 3PMAB 2XBYA 1TNLA 1UTPA 1XUFA 1TNIA 1JIRA 1VGCC 4VGCC 5DP8A 5FPTA 1P2QA 1LHFH 3BEUA 5FX5A 2FWWA 4CRDA 1N6YA 2OC7A 3MFJA 2PTCE 1O2VA 2VB0A 1EOLA 1TPSA 2EC9H 4XDEA 1WOFA 2QCYA 4B74A 3ZVGA 2FOFA 3U8TH 4UFEH 3A8BA 1D9IA 3LT3A 5A2MH 3GISB 1O2SA 2BD8A 5GDSH 1O2RA 2ZU1A 3RM2H 2PGQB 1HYLA 1ZSLA 4GHTA 1V2LT 1W2KH 2HOBA 2FS8A 2AEIH 1GG6C 1W13U 1JWTA 2J4IA 5DG6A 3S69A 2HPPH 1E34B 1KTTB 1Z8IB 1KXCA 1EAIA 4X1QU 4FU7A 4AYYB 2ZFFH 1EB2A 1TMBH 2WUBA 5JB9S 2G00A 3PMHB 1K1JA 4IC6A 4UE7H 6CHAB 3DFJA 4ZXYH 2XCNA 1BTHH 3CS0A 1ELGA 5CMXH 3GY6A 2OUAA 2VVVA 1O39A 1VITG 1LHEH 1TWXB 3MO3A 2EI7A 3UPEA 2AMPA 1FI8A 3L3TA 1BTXA 4I33A 3A7YA 1XMNB 1YPHC 2OQ5A 1GVLA 3ATWA 1TAWA 5HM2A 1U6QA 4Y0YE 3SNCA 4QT8C 1QCPA 1J14A 3ZYEA 1CE5A 1Z6EA 1A5GH 1FUJA 1GGDC 2QV1A 3M61U 1OYTH 1T8LA 3EGKH 1G3DA 4DG4A 1DLEA 2A32A 1HFDA 2V0BA 3ZZ9A 2JH6D 1DICA 1GJ7B 4IS5A 1P0SH 3W95A 1CVWH 2SGAA 5CHAB 4DCDA 1SLUB 3BTHE 1AHTH 3KQBA 4YO9A 3T28A 1EAWA 1DWEH 2TBSA 2I6SA 2ZP0H 1LTOA 1ANCA 1YPJH 1O3DA 4AN7A 1NFYA 4X6NA 2Y7XA 3QTOH 2VWLA 2J38A 1CHGA 1BRBE 1Q2WA 3VEQB 4O03A 2V3OH 1JRTA 1GJ6A 1GBFA 1K2I1 1W10U 2RG3A 4HFPB 2TPIZ 1ANEA 1E38B 2H9EH 1J15A 3M5LA 1FY4A 4J1YA 1HAOH 4AORA 1ZTJA 1QQUA 2OTVA 4X1RU 4X8VH 1O2IA 2A45B 2O8UA 1C1PA 3LGVA 1EUFA 3MNCA 4M7GA 3T29A 1SVPA 5JBCS 3O8DA 1INCA 1V2RT 1GI7B 1NRRH 2ZQ1A 1BQYA 1QL7A 3SU6A 2F3CE 3U8OH 2HRVA 2EEKA 1HRTH 5TJXA 1BBRE 1C1VH 4NA9H 3MI4A 1ZPZA 2J94A 1CQQA 2P8OC 2VH0A 3LU9B 5DP5A 2R2MB 4LZ4B 1HAPH 2V35A 2XTTB 3K6YA 1KTSB 1FIZA 2P3UB 1Y3WA 4FXGH 4XOJA 4KELA 1HB0B 3KNXA 2Q6GA 4A1TA 1OYQA 2AH4X 1HV7A 1QRXA 4CRCA 1DANH 3KQCA 3VB7A 4YT6H 3SUFA 1IOEA 2WUCA 3RXCA 4ZHMU 1O2WA 2FLRH 1RD3B 2ZECA 1C1QA 1SLWB 5GIBA 7KMEH 2NU2E 1MKWK 1O2GH 2Y7ZA 3RXBA 4DY7B 3M3TA 1C1RA 1RTKA 2WPLS 1P05A 2BDGA 3HGPA 3NZIA 2FLBH 3QTVH 1MKXH 4K69A 1UTJA 3FFGA 1GGDB 4X6OA 1K1MA 3GCOA 1L2EA 2TGTA 4BAQB 4I32A 3QX5H 3MOCA 3UREA 1A5HA 1HLTH 2VWMA 2ZGCA 2OC0A 3TNSA 3M7QA 1PYTC 1ZGIA 1EJMA 4H6SB 2F9VA 1C5WB 4ZHAA 1FNIA 1HGTH 1KLTA 3RXLA 1VCPA 3EYDA 3RC4A 2GCHF 3NK8A 1F5KU 5EOKA 2R3UA 2A5KA 1QBOA 3FAOA 4HGCA 3SU4A 3ZZAA 1C2IA 3NXPA 2C8YB 1O3OA 4E06H 1BCUH 1BMLA 3UR9A 2O8WA 2ULLA 1RFNA 3GCTG 1OWDA 1QJ6B 1S0QA 1FLEE 1DX5M 3K65B 3SV8A 3MU8A 4JK6A 5FBEA 4CRBA 2K1QA 3V7TA 3R0FA 1BRAA 1DSUA 4MNWA 1XUGA 1B5GH 1QNJA 2FP7B 1TMTH 4MPVA 1QJ7B 1ANDA 1IQEA 4LK4A 1NPMA 1EPTB 2OLGA 2A7HA 1O3HA 2BX3A 5GCHG 5C20A 3RXVA 1MCTA 3H5CB 8LPRA 2C8ZB 1SGRE 4DIHH 2WV5A 1DY8A 3OY5U 3KQDA 2AGGX 4AFQA 1CSOE 1W14U 1GBLA 1XXFA 5C67A 2QXGA 4INKA 3GCHC 3U98H 4FUIA 3E6PH 3RU4E 2XBXA 3C27B
chains in the Genus database with same CATH superfamily
1NBME 1ZRKA 4ISOA 2D2DA 2F83A 3RXGA 3VB5A 5E0HA 4LZ1H 3KEEA 2A4OA 4Y8ZA 2EI6A 1ZPBA 1CA0C 3DUXH 2Y5GA 4Y8XA 1H9IE 3PM3A 1ID5H 5E2PA 4AX9H 1SLXB 2Z6BD 2BY9X 1TLDA 1YPHE 2HVXA 3NUMA 2ANWA 1EPTC 2F9OA 2PLXA 3P8FA 3EE0B 1EZUC 2TRMA 1ZHMA 3O8BA 3BTME 2OCVB 4IW4E 3BTTE 4NIVA 1YF4A 3VB3A 1VJ9U 3GY4A 3RMOH 1OWIA 1QGFA 1O2PA 2A4RA 4WMDA 1IQIA 3BG4C 2LELA 5C1UA 1ZRBA 1V2KT 2ASUB 1V2QT 1AE5A 1RXPA 4MNXA 3Q00A 3RU4T 3M3VA 5ESBA 3A8CA 1EP6A 1ABJH 1MTNC 1L1GA 1QB6A 3STJA 5I25A 4MNYA 2DUCA 1YCPK 1P09A 4MNVA 4IN2A 1C5LH 1ZSJA 4WWYA 5GCHF 1PQ7A 1VCWA 5A8ZA 3A8DA 3FP8E 2JDID 4UD9H 3SZNA 3EA8A 1WSSH 2W26A 1LHDH 3KN2A 1IQLA 4IBLH 5HGGA 3RXSA 5DGJA 2QF5A 5EW1H 1UO6A 4JYUH 2C4FH 1NRQH 1T8OA 1W11U 2A2XH 3ATIA 2HLCA 1DPOA 2FO9A 1O32A 1ZHRA 4WXVA 4INLA 2SGPE 1GVZA 2O8MA 1XUJA 3PO1C 1HBTH 1OWHA 3F2FA 1XKAC 1TMUH 1PQAA 4R8TB 1C1TA 3PYHA 2UUKB 1C2LA 4D9RA 3MWIU 2ALPA 1YPLH 1FY5A 2F9NA 1P11E 1C4V2 1HJAC 3MO6A 4Z6AH 2FOEA 2VWNA 1GMHF 3ZZBA 4YLQH 2O8TA 2FZZA 2QAAA 2AIQA 4TPIZ 1L4ZA 5F8TA 1NN6A 3MYWA 1A5IA 3M5OA 5IK2D 1C1UH 1H9LB 3F68H 3LIWA 3G01A 3DFLA 2WPDD 3WW7A 1PPEE 4ASUD 4OS5A 4ABFA 2Z7FE 1MQ5A 1TFXA 1Z6JH 4TT3D 3GICB 4O3UA 5FCRA 1O2OA 3F9EA 1ZLRA 3P70B 4X2XA 4ZKSU 1BHXB 2AYWA 5T6FA 1C1NA 1P04A 2FTLE 2ZGBH 4AFSA 2BY6X 4MPXA 1YLCA 1AVGH 2Y6TA 4ISLA 4Q80A 1GI0A 5C1YA 1AUTC 1LVOA 1XXDA 3P8OA 1TX7A 1DFPA 1MBQA 1LPGB 1NESE 2O8LA 3QN7A 2THFB 1O38A 4INHA 2WV4A 4YLUA 1BRCE 2BDAA 3PLBA 1TE0A 2CF9H 1V2JT 2CJIA 1K1LA 1K1NA 1IQKA 2F9BH 3N7OA 5IYTA 6CHAC 3A85A 3RLWH 2GGVB 4NIWA 4HTCH 5EW2H 1EXFA 5A0BA 3ESTA 2PWXA 1TRMA 1K1OA 4AYVB 3R3GB 3UNSA 1C5ZB 1FY8E 1V3XA 2G51A 2HPQH 3DA9B 4Y7BA 3LJOA 5GJ4B 3T27A 1XX9A 1J16A 2FOAA 3VB6A 1DLKB 2XC5A 4B6EA 3SNDA 1Y3YA 4M9FA 2BQ7B 2F9UA 1GPZA 2BD4A 4A1XA 1EPTA 2V7QD 1GDUA 4GUXA 1C2DA 2BLWA 2NU1E 3AW0A 3LGTA 1DT2A 2JETC 1TGSZ 3SO3A 1QB9A 2CF8H 3UY9A 4MPUA 5JPMH 3LONA 5DPAA 2R2WU 1AFEH 2FI4E 2ZA5A 3RXEA 4AZ2B 1K1IA 4Q2KA 3HK6B 1G3CA 3ZZDA 2KCYA 5J4QA 4RI0A 4GHQA 2ZTYA 1UVPA 2PGBB 5FCKA 2PKAB 1N8OC 3FZDA 3ZZ5A 1BJUA 3SW2B 3DSPA 1HCGA 1GI4A 1EASA 4TYDA 3VPKA 1SG8B 5FX6A 3Q77A 2AMDA 4IGDA 3RXDA 1BJVA 4CH8B 3MH6A 4AB9A 2VVCA 1SGYE 3OY6U 1G9IE 1C5PA 4OS4A 2JETB 2ZCHP 3F0OA 3RC5A 3E0NB 3KL6A 1UTQA 4X1PU 4WMFA 2FX6A 3UWJH 2ZDAH 1O3GA 1KLJH 3M7UA 2PUQH 3ZZ8A 1P57B 3ENSB 2H5CA 1KXDA 3RXAA 2KCOA 1YCPM 1AFQB 1BTWA 1SHYA 1UK4A 4F48B 1O3AA 3VXEH 4Q4LA 2QYIA 2ODPA 2D8WA 5GPIB 4ABJA 3SJ9A 2IOTA 5EGMA 3BIUH 5A8XA 1BT7A 2OXSA 1CA8B 1L1NA 1OX1A 2KR7A 1TPOA 4ABHA 1DXPA 4HI3A 4BOHA 1WQSA 4K5ZA 1LVYA 1KSNA 1VR1H 4NFEA 1PYTD 2ZTZA 1ELFA 1ABIH 3W1EA 1F0SA 1EJAA 5FBIA 4A5TS 3EA9A 2LPRA 3QWCH 2ZDMA 2H9TH 1DUAA 1MZAA 1THRH 2ANKH 1O3KA 3SGBE 3T2NA 3ZV9A 1FN6A 3O8RA 3TGKE 2J5UA 1LPKB 2P59A 3MH5A 3PROA 2ALVA 1CHOG 1AGJA 3AVZA 1O34A 3HATH 2H9HA 4GVUA 4BAHB 3RUOA 2OBQA 3PV5A 3TJNA 3V3MA 1IQJA 3BN9A 2BQWB 2RCEA 3LKWA 1T8MA 2BD9A 4D9QA 3D65E 3A81A 3GCNA 3PTNA 1AIXH 4I8KA 2Q6FA 1T8NA 4Y11E 3WWBA 2H1UA 2Z9IA 4CHAC 1C5YB 1GBHA 1O3FA 3HKJB 5EXNA 3HPTB 1P06A 1XM1A 2A7CA 1C5MD 3I78A 1ARBA 1YYY1 4CRFA 1MD8A 1BB0B 1MU8B 2BVXH 4AB8A 2WV9A 3GYLB 4IMZA 1QR3E 3KQEA 3SBKA 1G30B 1YM0A 3OEED 4R0IA 4SGBE 3UAIC 1ZSKA 1H4WA 2ODQA 3Q3KA 1THPB 2BTCE 1D6WA 2YMSD 3F9GA 2IPHA 2QC2A 3OTPA 3QZQA 1EJNA 1GI9B 1QIXB 4DJZB 2ZNKH 1S83A 1A2CH 2Y80A 1GI8B 4Y6DA 1GBBA 4GCHG 3BG8A 1NC6A 1BMNH 1QA7A 5KECA 1A0HB 1KMHB 4FU9A 3H7OA 1AFQC 1GJ4H 3ZZ4A 1O2KA 3E3TA 4F4OC 1SQOA 2ZCKP 4I8GA 4YOJA 7GCHG 2ZDNA 2PW8H 2G5VA 3A7TA 3PWCA 2QXHA 3PWBA 5EPYA 2ZHWH 1A3EH 2FM2A 3V12A 4H6TA 1GJBB 3ZZ3A 2ZFQH 1W7XH 3A82A 3KIDU 4MVNA 2GD4B 1A46H 2BDYA 2GJGA 4ISIH 4LOYH 3ODFA 2BVRH 3M5NA 4ACBA 1KDQA 1N6XA 2YNAA 5C2ZA 4ZXXH 2F9PA 4NGAH 4U30A 5DKMA 3A86A 3U69H 3VFEA 5AFZH 1MUEB 2AS9A 1AO5A 1AI8H 1Z8RA 1NRSH 1S0RA 4YT7H 1DITH 2A1DB 3E8LA 5EIYA 5HM9A 2C3SA 4JYVH 1BTUA 4E05H 2J98B 1H9HE 1QJ1B 2G55A 1D4PB 3RMNH 3SNEA 1PPHE 2K0QA 1GHXH 2RDLA 2LNCA 4A1VA 2TGAA 3RU4D 1PPCE 2XCFA 1FPHH 4OGYA 1CBWC 2QA9E 3GY3A 2OINA 1LPZB 3NCLA 1H8DH 2PP6A 6LPRA 4CR5A 3V0XA 5T6GA 2ZWLH 4NA8A 3SUGA 4BTIB 5JBAS 1HDTH 4CHAB 1MCVA 1T7CA 1C5QA 1OP2A 4JCNA 1K28D 3LC5A 4B73A 1AU8A 1MH0A 2ZHFH 2KFWA 1C1SA 2GVFA 2BDIA 2PFEA 2H2ZA 1DVAH 1GJ5H 1C2GA 3LC3A 4B71A 2GX4A 1EOJA 4JMYA 2WINI 5JDUB 1EX3A 4KGAA 1QL9A 2HLDD 5C5OA 3TPIZ 1Y5UT 3SJKA 4BTTB 4A6LA 2WZQA 3CENA 3BSQA 1GBTA 1TNHA 3C1KA 1W0JD 3HGNA 2VIDA 3Q3YA 3H7TA 2PTNA 2W7SA 1CU1A 2J2UA 3ZV8A 2J95A 1DE7H 3LGYA 1SBWA 1AKSB 1NROH 2GCHG 3NPSA 4U32A 2NU4E 1SQAA 1JRSA 1CBWB 5K0HA 1C9PA 4RN6A 1ORFA 4UFDH 4ABDA 3AASA 1ELVA 1UCYH 1BRUP 3LGIA 4Z0KA 3RMLH 3EDXB 1GBIA 1ETSH 1O5DH 5EQRA 3RXJA 2G4UA 1BTZA 4ISNA 2XC0A 3MQKC 2OC8A 3SYJA 1A4WH 4NIXA 1ZMNA 3GDSA 1TPAE 3RP2A 1SOZA 2PSYA 3H09A 1EZSC 5LPEA 1AWHB 1FQ3A 3MNBA 1V6DA 1V2ST 1LVBA 3QK1A 1JXPA 1PQ8A 3NWUA 2A4QA 1W0ZU 2OQUA 3UR6A 3T25A 4X2VA 3L33A 9ESTA 3BEIB 6ESTA 2M2AA 3A7VA 4FUFA 5HKKD 4I8JA 3SNAA 1TQ0B 2PV9B 1EZXC 1AN1E 2BXTH 1E1RD 3T62A 2VU8E 3BTEE 3LPRA 1J9CH 1E37B 4JZIA 5C94A 1O2ZA 1C4U2 1GBJA 1E36B 2F43B 1TYNA 3GCHB 1IQGA 4MPWA 4Y76A 2HALA 1PPFE 3PTBA 1AD8H 2CGAA 5EODA 2Z9GA 2KCAA 1SGEE 1YGCH 3NRLA 3O8CA 2BYAX 1D3TB 1ZGVA 1N1LA 3RXHA 1GBDA 3DT0H 1NTPA 5FAHA 1GDQA 4FETA 3F2GA 1O5BB 1CA0B 1Z8GA 3TH2H 1AE8H 1EZQA 1YKTA 3TH4H 5A8YA 1CT4E 3U9AH 4TWWA 2BD7A 2CMYA 2ZHQH 4H42U 3RXTA 4FUBA 1YWUA 4NA7A 1SLVB 5JYIA 5BPEA 3ZZ7A 7ESTE 3RDZA 1GL1A 4A92A 1CHOF 1UK2A 3QGNB 1Y8TA 1P2KA 4D7GA 4Q7ZA 5I46H 5L6NH 5CHBA 1ESTA 4E7RG 1BITA 2KX4A 2Z3CA 2SFAA 2CN0H 3EAJA 1MTVA 3SNBA 2B0FA 1L0ZA 1QL8A 1Z1IA 2NU3E 3N7DA 1GMDG 1TX8A 3EA7A 1RIWC 1SGIB 5EPNA 1O5AB 3UUZA 3UWIA 1UTOA 3PRBA 4Y7AA 2STAE 4CH2B 2BY8X 2ANYA 5DP6A 1PJPA 1K1PA 3F9HA 3PLKA 1HAXB 4A7IB 1UJ1A 4NWKA 1GBCA 5HYOA 3U1IB 1O5FH 1QY6A 1O3IA 1FZZA 2P95A 3OU0A 1ETRH 2W5EA 5FXLA 3MHWU 1UVOA 1Y5BT 2ZDVH 5G4BA 3PMBB 3TK5A 1VITF 1MKWH 1KXFA 2FMJA 2FOMB 4ACAA 1GCTB 1F92A 1Z7KA 1EQ9A 2FODA 2GZ8A 2VIQA 1G37A 3RXQA 4AG1A 4K2YA 4GSOA 3CS7A 2BQ6B 4MG3A 3LJJA 3ZIAD 1UTMA 2JJ1D 1COWD 1O0DH 1J17T 1DWBH 1O33A 2ZKSA 4AOQA 2R0LA 1GHYH 2SGFE 1ESBA 4GCHF 4LXBH 2ZGJA 1QRZA 2BZ6H 5EJLA 1O5GH 2G5NA 5T6DA 2PR3A 1GJ8B 4D7FA 1UCYK 1A1RA 1G3EA 1QHRB 1OKXA 4UFGH 1ZYOA 2KM0A 3TNTA 4DW2U 2EI8A 1JBUH 1MAYA 1NO9H 1O2MA 1GJCB 1MMJN 1T4VH 5HMAA 3LH1A 2J34A 2QXIA 5EJ1A 1GBAA 1XUHA 1WV7H 2ZG0H 1IQHA 4I31A 3M7TA 2ZTXA 3P17H 1FONA 3MTYA 5T3HA 4F49A 2ILNA 2UUJB 4X8UH 2VIPA 5DN6D 1F0RA 1JOUB 2ZO3H 4ABBA 2SGQE 3ZZCA 4AGJA 2F91A 1MABB 5LGOA 1TALA 5E0JA 1SI5H 2BLQA 3URDA 1ELBA 4DT4A 2XNIA 1B0EA 2J92A 1O35A 4K60A 2A31A 3ZVBA 1YPKH 4X0WU 1RJXB 2BD2A 1KDQB 1BMAA 2Y5FA 4FUHA 2B9LA 2OD3B 5F03A 3MU5A 3GY5A 1AB9B 4XRNA 3UB0A 2BMGB 2W3KA 3M5MA 1H1BA 2YOLA 2GT7A 1RIWB 2Q1JA 1EAUA 1H8ED 2JKHA 4BTUB 2CHAC 1KY9A 1DSTA 3GS9A 4ZH8A 1FN8A 1CGHA 1T4UH 1DS2E 3FKSD 4RKJB 1HJ8A 1KXEA 5GNDA 2AIPA 3S9BA 2VGCC 3M37A 4BAMB 2XOKD 1WYKA 1JMOH 3SUDA 1K22H 4ISHH 5CE1A 1A0JA 5DP3A 5EXMA 4NIYA 4NWLA 1GI1A 3OX7U 3LGUA 2FPZA 2BLVA 4K1TA 2Q6DA 2NU0E 1KLIH 1S82A 5TCCA 3FVFB 2AMQA 1AB9C 1TBRH 2C93B 2FYRA 2Y82A 3S9AA 2IPQX 1MTWA 1O3CA 4OS6A 3S7HB 4JZDH 1QBNA 3GY8A 3M35A 2FXRA 1W12U 2BB4A 4FU8A 5F6MA 1DUEA 1Y59T 2FTMA 2EQNA 4XFQA 1ZZZA 3DSGA 5ABWA 4O9VA 1C5OH 3JZ1B 1SGFA 2BM2A 2VWOA 1AY6H 3SU3A 2BVSH 3RXFA 1BBRK 1C5RA 1GMHG 1IQFA 1BOQA 1ETTH 3UOPA 2VVUA 3TJVA 3RXPA 2VINA 1TA6A 2PUXB 2FOHA 1YCPH 1L1JA 1EAXA 1V2TT 1F7ZA 1HAVB 1FXYA 1HNEE 2Z3DA 2VH6A 3F6UH 2PSXA 1QA0A 1CO7E 5C3NA 4KTSA 2CK3D 2VIOA 2P3FH 8ESTE 1YPGH 2QF4A 1TNGA 1OWKA 3FANA 4H4FA 1O3MA 1SQTA 1SHHB 1UVTH 2ZZUH 1EKBB 1QB1A 1ZMLA 3QO6A 4WH8A 4BAOB 2J97A 2WYJA 5JBTA 3F0PA 3RXRA 2QIQA 1TGCA 3ITIA 1G2LA 4K8YA 4JK5A 2PKSC 3SU0A 4J2YB 3A89A 2CV3A 3SU5A 3SV9A 2ANMH 1F0TA 1TIOA 1BTYA 2RA0A 2Z3EA 4TY6A 1ESAA 4I8HA 3SORA 4CRAA 3BTWE 2XNDD 4RT0A 2BLOA 3SI3H 1L4DA 4Q7YA 4Y71A 2G4TA 4TPYA 4XSKU 1TRYA 1OS8A 1O3LA 4TSFD 4ZAEA 3TITA 1HPGA 1Y3VA 2H5DA 1W8BH 4AGKA 3RC6A 1SMFE 1V2NT 4WXIA 2UWLA 1GWAA 1AZZA 1SOTA 3FP6E 3ODDA 5IDKA 3SUEA 3S9CA 1ZJKA 3BV9B 1ZJDA 3SZEA 3B9FH 4ZCNA 1P10A 2KAIA 1WCZA 1YY3A 1SPJA 3F2HA 1HAIH 3RXOA 1O30A 2PKSB 4Q63A 1GJ9B 4JZ1A 2QGRA 1BA8B 3OYPA 1MBMA 1ELCA 1VJAU 1G2MA 4BXWA 4XE4A 1F0UA 1C5SA 1O2QA 8KME2 2BDCA 1UW7A 2WYGA 3QZRA 1FPCH 1UHBA 2VIWA 1Z71A 2BHGA 4FVDA 4KTCA 1DDJA 2B7DH 2P93A 3BIVH 4Y79A 1FY1A 4ABIA 1S81A 2FOBA 3TH3H 1KYNA 1GMCF 4SGAE 4ASHA 1O31A 2ZC9H 1P2JA 7GCHF 2YNBA 5E0GA 4U01A 1FAKH 1PPZA 3P6ZB 3A83A 1HIAB 3RM0H 1HAGE 1Y3UA 2DE8A 1DWDH 2XYAA 1C2EA 2B5TB 3E90B 2GV7A 3VGCB 1P2NA 3KF2A 5EG4A 1YLDA 4TWYA 4VGCB 1FAXA 1O3NA 1AKSA 2Z9KA 1MKXK 2BD5A 3TK9A 1O3PB 3K9XB 1JIMA 2AHME 1GHBG 4ZUHA 1O3EA 1VITH 1K21H 1UCYE 1O37A 3UTUH 2UWPA 3ZVFA 4AG2A 4BAKB 2WPMS 2ZDKA 4X8SH 1V2OT 4WF8A 3GDUA 2R0KA 3K6ZA 4CR9A 1FV9A 4ZKNU 4KP0A 4GAWA 5E8EH 2IJOB 2FESH 1GJDB 1NRNH 1FY3A 4IMQA 1XVOA 3TLOA 3BTDE 2QXJA 3ZVDA 3NKKA 3GOVB 2A2QH 2GV6A 2G8TA 5A0AE 1BDAA 2ZQ2A 2GZ7A 3SU1A 1O2XA 1OHHD 2R3YA 2ZDLA 1TGBA 1BBRH 1XKBC 4MLFB 4X1SU 1W3CA 3ZYDA 3LDXH 5H4IB 3MNSA 5T1VA 2BY7X 1IQNA 2GCTC 5B6LA 1YPEH 3A7XA 3WY8A 1P02A 1YC0A 2NWNA 4P00A 2GMTB 1O3BA 1BMMH 4X6MA 2SNWA 4BNRA 5F8XA 2ZU3A 4I7YH 1GHAG 4ESTE 1O5EH 1OSSA 3SHCH 1DY9A 3CP7A 1MTUA 3OTJE 1SGNE 2OBOA 3AAVA 1BZXE 9LPRA 1TBQH 3T26A 1D3DB 2XXLA 3A7ZA 1SGTA 2ZEBA 1YBWA 3SU2A 5AHGH 5LH8A 3RMMH 2G81E 3UOUA 1O2JA 1S85A 1UHBB 3SOSA 2FEQH 3U28C 3LOXA 1MTSA 4WVPE 1O2LA 1C1MA 2CXVA 1Q3XA 4GLYA 1NY22 2OC1A 1P03A 4DT7B 1O36A 1W7GH 1NT1A 2QN5T 1SFQB 4X6PA 1W0KD 2XBWA 3AW1A 5DSFA 4U2WA 3ZZ6A 1XUIA 1T32A 3QDZB 2OK5A 4XD7D 1GCTC 3E1XB 2GMTC 4FUDA 4RKOB 5BRRE 4UDWH 4CBNA 2P16A 4THNH 2A5AA 1KXBA 2I6QA 4Y10E 2F4LA 1WU1A 2PHBA 3I29A 1GHVH 4MDSA 4DURA 1TOCB 2BX4A 2UWOA 3D23A 1V2MT 2HNTC 1AWFH 2V3HH 3IWMA 3UNQA 1BTPA 3Q76A 3GDVA 1P9SA 4ZKOU 4I8LA 5F8ZA 2AGEX 1C2HA 3SQEE 2P94A 4B2CA 1RS0A 3S0NA 1HUTH 1IQMA 2ZFSA 5C17A 1IHTH 5EQQA 4I86A 8GCHF 1E35B 3KYFA 3RXKA 2QY0B 4CREA 1EFRD 5ESTE 3L6PA 2P8OB 3RLYH 2D1JA 1YLNA 1P2OA 1ACBE 1P8VC 2FS9A 4X2WA 1NFUA 1BUIA 1P9UA 4WY3A 3S7KB 3BTGE 3AAUA 1H8HD 3MU0A 6GCHF 1HAZB 3DD2H 2XC4A 1GBEA 3Q3XA 4MQAA 1E1QD 1MQ6A 2TIOA 2ZPQA 3KHVA 1QRWA 3A80A 1ZOMA 4X8TH 3VXFH 3QUMP 1CT0E 1M9UA 2Z94A 3SGQE 1C2KA 3KCGH 1GI6A 3BTQE 1FMGA 4D76A 2JH0D 4WJG2 2ZU2A 5PTPA 1V2PT 2RA3A 1V2UT 1Z1JA 3SJOA 1PPBH 3E0PB 1Y3XA 1ANBA 2BY5X 1QURH 1IHSH 1RTFB 1WTHD 4OS7A 1OP8A 1GBKA 2BD3A 1NM6A 1S6LA 1TONA 4ABAA 1WBGB 3K2UA 1LDTT 3F9FA 5A0CA 1A3BH 3A88A 3BF6H 3I77A 5GXPA 1SFIA 3F1SB 2B8OH 2W7UA 3OEHD 1BHXF 3SJIA 5F53A 4UONA 1C5TA 1FJSA 2XRCA 2KAIB 4Y8YA 2WPHS 1QQ4A 1C5NH 2VNTA 1OOKB 1NFXA 4BANB 3D62A 2VGCB 1A7SA 5EU8A 1AVWA 2ZF0H 4FUJA 2SGEE 5LPRA 4NSYA 1NRPH 1AUJA 1AMHA 3U8RH 1P2MA 4OGXA 2ESTE 4FUGA 4P02A 3FZZA 1S6HA 2BDHA 3ATLA 3A7WA 1GDNA 2WPKS 3P95A 1OPHB 5FL7D 1C4Y2 1MZDA 5DJ7A 2DE9A 1UVUH 3KGPA 1LQDB 4FOUC 1TGNA 1NU9A 2BDBA 1C9TA 5HIYA 1O2HA 3UQOA 3PV2A 4B2BA 5FHTA 1SGDE 3VB4A 1WQVH 3A87A 3SV7A 1VKYA 3BEFB 2FDAA 1G3BA 4NZQA 4GPGA 5CHAC 3ZVEA 1NS3A 2XW9A 1TOMH 1GMDF 4HZHA 1HIAA 5E2OA 1LHGH 1HAHH 2ZHEH 1LHCH 4WH6A 1V2VT 3MMGA 3OSYA 1OP0A 1T31A 2ZU4A 2IN2A 1GHAF 2PKAA 1KIGH 2WPIS 2AGIX 3SHAH 1E0FD 1YPMH 2EA3A 1MD7A 1SL3A 2ZPSA 5A09A 1C5XB 1P3CA 5C0TA 2WHXA 3GYMA 5AVDA 1ELDE 3T5FH 1ZTKA 3JZ2B 3ZVAA 3QLPH 4NSVA 1TABE 1YP9A 3TVJB 2J9NA 1TNJA 2ZCLP 1HXEH 1A61H 3EE7A 3N99A 2GT8A 1HJ9A 5EQSA 3BTFE 1UTNA 1ZHPA 5DP9A 1ARCA 4RSPA 2GZ9A 2TGPZ 1W0YH 2Y5HA 4D8NA 2HNTF 4KTUA 2ZFPH 3VG8A 6GCHG 3ZVCA 4K1SA 3MO9A 4IC5A 4UEHH 2M5TA 3B23B 1AQ7A 2BOHB 1GI2A 1LCYA 1X7AC 1OWJA 2STBE 4ABEA 1WTGH 2FIRH 2SNVA 1WXRA 1GHZA 1C1WH 1PPGE 3TJUA 3BG4B 4YOIA 2BZAA 1PQ5A 3B8JA 4B1TA 2WSSD 1D3QB 2FX4A 1GJAB 2P3TB 1CGJE 1UMAH 5B6OA 1EP5A 2R9PA 4E7NA 8GCHG 1C2FA 1AZ8A 2C90B 1THSH 2GKVE 1P2IA 2FOGA 3MNXA 1KXAA 1ZMJA 3UIRA 3SN8A 5C1XA 1EB1H 2QE7D 1O2YA 4YM9A 2ZI2H 4BXSA 1F2SE 1K9OE 3TIUA 4ABGA 4B76A 2FI5E 2JIZD 1K0HA 2UUYA 1OWEA 2W3IA 4X1NU 5JBBS 2WPJS 1ELAA 3OFND 1DM4B 2HGTH 2W6ID 1TPPA 2QF3A 2SGDE 2C8WB 5KGOA 2HNTE 1ZPCA 3F3BA 3BTKE 2ZFRH 1LVMA 1RTLA 3MH4A 3M36A 5AF9H 2CHAB 4K3JA 1RRKA 1LKBA 4UFFH 4XBCA 2Z9JA 1GCDA 1TQ7B 2ZU5A 4OS2A 1GI5A 3SQHE 3UFAA 2BOKA 4O3TA 4X2YA 1WAYB 4AC9A 5GWZA 2UUFB 2ZPRA 2FI3E 3M3SA 1D6RA 4OM9A 3SI4H 1S6FA 3RXIA 3DHKH 1G36A 4B2AA 3MU4A 1HJAB 3UQVA 3E16B 5DP7A 1SR5C 1QTFA 4OS1A 1GVKB 1TRNA 3SGAE 1DWCH 3GY7A 4FUEA 2A7JA 3PLPA 1SB1H 1SC8U 3VGCC 1NZQH 5L2ZH 1C1OA 7LPRA 2IJD1 3FO8D 1FDPA 1VZQH 3RXMA 1B0FA 4ZMAH 3TK6A 1QBVH 3PB1E 4AFZA 5L30H 1E79D 5DK1A 4XBDA 2YMSC 3GY2A 1GHWH 1LMWB 4WMEA 3P92A 1IAUA 3SJ8A 1B7XB 1ZTLA 5K7RA 4CRGA 2C8XB 2AERH 2GDEH 1HXFH 2OP9A 2Y81A 4NFFA 1CGIE 3U1JB 4PROA 1TX6A 1GI3A 3GCTF 5LPFA 1P3EA 1LO6A 4YTAA 1TBZH 1C5UA 3QGJA 1S84A 1O2NA 1TGTA 1V2WT 3LH3A 2V3MA 3KYGA 1HAYB 4IN1A 1P12E 1HAVA 3EQ0H 1RGQA 1O2UA 2RFKC 2GTBA 1UK3A 3TJOA 3SV2H 1SSXA 1MAXA 4B75A 2KZ4A 2GP9B 1S5SA 3IITA 3PV4A 4DOQA 3MH7A 4YESB 5DO4H 1NFWA 4CBOA 5JB8S 2GCTB 4AFUA 1FIWA 2QF0A 5L2YH 5AFYH 1PFXC 3PMJA 4JZEH 1GHBF 2YMSB 1C5VA 3W94A 1D3PB 2FOCA 5C0UA 1XUKA 3A8AA 2VIVA 3ATMA 3CNRA 3ELAH 3RXUA 1MU6B 3PRDA 1FX0B 2ODYB 1VCQA 4ZKRU 1OXGA 4JZFH 1O2TA 2TGDA 5C5NA 3OE7D 3P8GA 4ZROA 4DVAU 1GG6B 2O9QA 1NU7B 2FYQA 2HWLB 1GL0E 4YOGA 4F55A 5ETXA 5FPYA 2ZIQH 1GMCG 5KEDA 3IG6B 1H8IH 3HKIB 3D49H 4DIIH 5SGAE 4NZLA 2A4GA 3WWFA 1MTNB 5DP4A 5EXLA 2ZGXH 2BXUH 2XWAA 1LKAA 4DGJA 3P8NA 1WUNH 3AK5A 1DOJA 4Q7XA 1TB6H 3FP7E 1O5CB 1QFKH 1ZR0A 3MU1A 4JYTA 4KKDA 1CT2E 1XVMA 2VJ1A 1A0LA 4YZUA 3URCA 1Y5AT 4ZHLU 1N8OB 4O97A 1EATA 4HG6A 1VGCB 1Z8JB 5J4SA 1TNKA 2H6MA 2A5IA 1C2JA 4XBBA 1G32B 4K1EA 5HIZA 2W6JD 1SGCA 1SGFG 3ATKA 1SGQE 1O3JA 1UTLM 3TU7H 1BIOA 2XWBI 2AFQB 3E91A 1C2MA 3LGWA 1UVSH 4Y0ZE 4NG9H 4K8BA 5FPSA 1UTKA 5CDFE 3A84A 5HXFA 1ELTA 1SGPE 4MTBA 4FVBA 2D26C 3PO1B 1TA2A 2ZFTA 3SV6A 5TCAA 2EY4C 2G52A 4TY7A 1ELEE 2ZGHA 3HK3B 2JH5D 2JJ2D 3V13A 3TGIE 3TGJE 1DXWA 1J8AA 2ZHDA 3STIA 2A0QB 1P01A 2V6NA 4NCYA 1F5LA 4FUCA 3UNRA 1Q31A 1GBMA 2KCPA 2GDDA 2Z9LA 1F5RA 1LQEA 1AVXA 2XBVA 3PMAB 2XBYA 1TNLA 1UTPA 1XUFA 1TNIA 1JIRA 1VGCC 4VGCC 5DP8A 5FPTA 1P2QA 1LHFH 3BEUA 5FX5A 2FWWA 2K8IA 4CRDA 1NBMD 1N6YA 2OC7A 3MFJA 2PTCE 1O2VA 2VB0A 1EOLA 1TPSA 2EC9H 4XDEA 1WOFA 2QCYA 4B74A 3ZVGA 2FOFA 3U8TH 4UFEH 3A8BA 1D9IA 3LT3A 5A2MH 3GISB 1O2SA 2BD8A 5GDSH 1O2RA 2ZU1A 3RM2H 2PGQB 3N7EA 1HYLA 1ZSLA 2L74A 4GHTA 1V2LT 1W2KH 2HOBA 2FS8A 4RT1A 2HVYB 2AEIH 1GG6C 1W13U 1JWTA 2J4IA 5DG6A 3S69A 2HPPH 1E34B 1KTTB 1Z8IB 1KXCA 1EAIA 4X1QU 4FU7A 4AYYB 2ZFFH 1EB2A 1TMBH 2WUBA 5JB9S 2G00A 1WDIA 1K1JA 3PMHB 4IC6A 4UE7H 6CHAB 3DSOA 3DFJA 4ZXYH 2XCNA 1BTHH 3CS0A 1ELGA 5CMXH 3GY6A 2OUAA 2VVVA 1O39A 1VITG 1LHEH 1TWXB 3MO3A 2EI7A 3UPEA 2AMPA 1FI8A 3L3TA 1BTXA 4I33A 3A7YA 1XMNB 1YPHC 2OQ5A 1GVLA 3ATWA 1TAWA 5HM2A 1U6QA 4Y0YE 3SNCA 4QT8C 1QCPA 1J14A 3ZYEA 1CE5A 1Z6EA 1A5GH 1FUJA 1GGDC 2QV1A 3M61U 1T8LA 1OYTH 3EGKH 1G3DA 4DG4A 1DLEA 2A32A 1HFDA 2V0BA 3ZZ9A 2JH6D 1DICA 1GJ7B 4IS5A 1P0SH 3W95A 1CVWH 2SGAA 5CHAB 4DCDA 1SLUB 1QZ8A 3BTHE 1AHTH 3KQBA 4YO9A 3T28A 1EAWA 1DWEH 2TBSA 2I6SA 2ZP0H 1LTOA 1SKYE 1ANCA 1YPJH 1O3DA 4AN7A 1NFYA 4X6NA 2Y7XA 3QTOH 2VWLA 2J38A 1CHGA 1BRBE 1Q2WA 3VEQB 4O03A 2V3OH 1JRTA 1GJ6A 1GBFA 1K2I1 1W10U 2RG3A 4HFPB 2TPIZ 1ANEA 1E38B 2H9EH 1J15A 3FOAA 3M5LA 1FY4A 4J1YA 1HAOH 4AORA 1ZTJA 1QQUA 2OTVA 4X1RU 4X8VH 1O2IA 2A45B 2O8UA 1C1PA 3LGVA 3OAAD 1EUFA 3MNCA 4M7GA 3T29A 1SVPA 5JBCS 3O8DA 1INCA 1V2RT 1GI7B 1NRRH 2ZQ1A 1BQYA 1QL7A 3SU6A 2F3CE 1BMFD 3U8OH 2HRVA 2EEKA 1HRTH 5TJXA 1BBRE 1C1VH 4NA9H 3MI4A 1ZPZA 2J94A 1CQQA 2P8OC 2VH0A 4B6FA 3LU9B 5DP5A 2R2MB 4LZ4B 1HAPH 2V35A 2XTTB 3K6YA 1KTSB 1FIZA 2P3UB 2RDEA 1Y3WA 4FXGH 4XOJA 4KELA 1HB0B 3KNXA 2Q6GA 4A1TA 1OYQA 2AH4X 1HV7A 1QRXA 4CRCA 1DANH 3KQCA 3VB7A 4YT6H 3SUFA 1IOEA 2WUCA 3RXCA 4ZHMU 1O2WA 2FLRH 1RD3B 2ZECA 1C1QA 1SLWB 5GIBA 7KMEH 2NU2E 1MKWK 1O2GH 2Y7ZA 3RXBA 4DY7B 3M3TA 1C1RA 1RTKA 2J98A 2WPLS 2L6OA 1P05A 2BDGA 3HGPA 3NZIA 2FLBH 3QTVH 1MKXH 4K69A 1UTJA 3FFGA 1GGDB 4X6OA 1K1MA 3GCOA 1L2EA 2TGTA 4BAQB 4I32A 3QX5H 3MOCA 3UREA 1A5HA 1HLTH 2VWMA 2ZGCA 2OC0A 1SQRA 3TNSA 4Z1MD 3M7QA 1PYTC 1ZGIA 1EJMA 4H6SB 2F9VA 1C5WB 4ZHAA 4YXWD 1FNIA 1HGTH 1KLTA 3RXLA 1VCPA 3EYDA 2LP6A 3RC4A 2GCHF 2VBCA 3NK8A 1F5KU 5EOKA 2R3UA 2A5KA 1QBOA 3FAOA 4HGCA 3SU4A 3ZZAA 1C2IA 3NXPA 2C8YB 1O3OA 4E06H 1BCUH 1BMLA 3UR9A 2O8WA 2ULLA 1RFNA 3GCTG 1OWDA 1QJ6B 1S0QA 1FLEE 1DX5M 3K65B 3SV8A 3MU8A 4JK6A 5FBEA 4CRBA 2K1QA 3V7TA 3R0FA 1BRAA 1DSUA 4MNWA 1XUGA 1B5GH 1QNJA 2FP7B 1TMTH 4MPVA 1QJ7B 1ANDA 1IQEA 4LK4A 1NPMA 1EPTB 2OLGA 2A7HA 1O3HA 2BX3A 5GCHG 5C20A 3RXVA 1MCTA 3H5CB 3FN8A 3KQ5A 8LPRA 2C8ZB 1SGRE 4DIHH 2WV5A 1DY8A 5EJZA 3OY5U 3KQDA 2AGGX 4AFQA 1CSOE 1W14U 1GBLA 1XXFA 3DCLA 5C67A 2QXGA 4INKA 3GCHC 3U98H 4FUIA 3E6PH 3RU4E 2XBXA 3C27B
chains in the Genus database with same CATH topology
1ZRKA 4ISOA 2D2DA 2F83A 3RXGA 3VB5A 5E0HA 4LZ1H 3KEEA 2A4OA 4Y8ZA 2EI6A 1ZPBA 1CA0C 3DUXH 2Y5GA 4Y8XA 1H9IE 3PM3A 1ID5H 5E2PA 4AX9H 1SLXB 2Z6BD 2BY9X 1TLDA 1YPHE 2HVXA 3NUMA 2ANWA 1EPTC 2F9OA 2PLXA 3P8FA 3EE0B 1EZUC 2TRMA 1ZHMA 3O8BA 3BTME 2OCVB 4IW4E 3BTTE 4NIVA 1YF4A 3VB3A 1VJ9U 3GY4A 3RMOH 1OWIA 1QGFA 1O2PA 2A4RA 4WMDA 1IQIA 3BG4C 5C1UA 1ZRBA 1V2KT 2ASUB 1V2QT 1AE5A 1RXPA 4MNXA 3Q00A 3RU4T 3M3VA 5ESBA 3A8CA 1EP6A 1ABJH 1MTNC 1L1GA 1QB6A 3STJA 5I25A 4MNYA 2DUCA 1YCPK 1P09A 4MNVA 4IN2A 1C5LH 1ZSJA 4WWYA 5GCHF 1PQ7A 1VCWA 5A8ZA 3A8DA 3FP8E 4UD9H 3SZNA 3EA8A 1WSSH 2W26A 1LHDH 3KN2A 1IQLA 4IBLH 5HGGA 3RXSA 5DGJA 5EW1H 1UO6A 4JYUH 2C4FH 1NRQH 1T8OA 1W11U 2A2XH 3ATIA 2HLCA 1DPOA 2FO9A 1O32A 1ZHRA 4WXVA 4INLA 2SGPE 1GVZA 2O8MA 1XUJA 3PO1C 1HBTH 1OWHA 1XKAC 1TMUH 1PQAA 4R8TB 1C1TA 3PYHA 2UUKB 1C2LA 4D9RA 3MWIU 2ALPA 1YPLH 1FY5A 2F9NA 1P11E 1C4V2 1HJAC 3MO6A 4Z6AH 2FOEA 2VWNA 1GMHF 3ZZBA 4YLQH 2O8TA 2FZZA 2QAAA 2AIQA 4TPIZ 1L4ZA 5F8TA 1NN6A 3MYWA 1A5IA 3M5OA 1C1UH 1H9LB 3F68H 3LIWA 3G01A 3DFLA 1PPEE 4OS5A 4ABFA 2Z7FE 1MQ5A 1TFXA 1Z6JH 3GICB 4O3UA 5FCRA 1O2OA 3F9EA 1ZLRA 3P70B 4X2XA 4ZKSU 1BHXB 2AYWA 5T6FA 1C1NA 1P04A 2FTLE 2ZGBH 4AFSA 2BY6X 4MPXA 1YLCA 1AVGH 2Y6TA 4ISLA 4Q80A 1GI0A 5C1YA 1AUTC 1LVOA 1XXDA 3P8OA 1TX7A 1DFPA 1MBQA 1LPGB 1NESE 2O8LA 3QN7A 2THFB 1O38A 4INHA 2WV4A 4YLUA 1BRCE 2BDAA 3PLBA 1TE0A 2CF9H 1V2JT 2CJIA 1K1LA 1K1NA 1IQKA 2F9BH 3N7OA 5IYTA 6CHAC 3A85A 3RLWH 2GGVB 4NIWA 4HTCH 5EW2H 1EXFA 5A0BA 3ESTA 2PWXA 1TRMA 1K1OA 4AYVB 3R3GB 3UNSA 1C5ZB 1FY8E 1V3XA 2G51A 2HPQH 3DA9B 4Y7BA 3LJOA 5GJ4B 3T27A 1XX9A 1J16A 2FOAA 3VB6A 1DLKB 2XC5A 3SNDA 1Y3YA 2BQ7B 2F9UA 1GPZA 2BD4A 4A1XA 1EPTA 1GDUA 4GUXA 1C2DA 2BLWA 2NU1E 3AW0A 3LGTA 1DT2A 2JETC 1TGSZ 3SO3A 1QB9A 2CF8H 3UY9A 4MPUA 5JPMH 3LONA 5DPAA 2R2WU 1AFEH 2FI4E 2ZA5A 3RXEA 4AZ2B 1K1IA 4Q2KA 3HK6B 1G3CA 3ZZDA 5J4QA 4GHQA 2ZTYA 1UVPA 2PGBB 5FCKA 2PKAB 1N8OC 3FZDA 3ZZ5A 1BJUA 3SW2B 1HCGA 1GI4A 1EASA 4TYDA 3VPKA 1SG8B 5FX6A 3Q77A 2AMDA 4IGDA 3RXDA 1BJVA 4CH8B 3MH6A 4AB9A 2VVCA 1SGYE 3OY6U 1G9IE 1C5PA 4OS4A 2JETB 2ZCHP 3RC5A 3E0NB 3KL6A 1UTQA 4X1PU 4WMFA 2FX6A 3UWJH 2ZDAH 1O3GA 1KLJH 3M7UA 2PUQH 3ZZ8A 1P57B 3ENSB 2H5CA 1KXDA 3RXAA 1YCPM 1AFQB 1BTWA 1SHYA 1UK4A 1O3AA 3VXEH 2QYIA 2ODPA 2D8WA 5GPIB 4ABJA 3SJ9A 2IOTA 5EGMA 3BIUH 5A8XA 1BT7A 2OXSA 1CA8B 1L1NA 1OX1A 1TPOA 4ABHA 1DXPA 4HI3A 4BOHA 1WQSA 4K5ZA 1LVYA 1KSNA 1VR1H 4NFEA 1PYTD 2ZTZA 1ELFA 1ABIH 1F0SA 1EJAA 5FBIA 4A5TS 3EA9A 2LPRA 3QWCH 2ZDMA 2H9TH 1DUAA 1MZAA 1THRH 2ANKH 1O3KA 3SGBE 3T2NA 3ZV9A 1FN6A 3O8RA 3TGKE 1LPKB 2P59A 3MH5A 3PROA 2ALVA 1CHOG 1AGJA 3AVZA 1O34A 3HATH 2H9HA 4GVUA 4BAHB 3RUOA 2OBQA 3TJNA 3V3MA 1IQJA 3BN9A 2BQWB 2RCEA 3LKWA 1T8MA 2BD9A 4D9QA 3D65E 3A81A 3GCNA 3PTNA 1AIXH 4I8KA 2Q6FA 1T8NA 4Y11E 2H1UA 2Z9IA 4CHAC 1C5YB 1GBHA 1O3FA 3HKJB 5EXNA 3HPTB 1P06A 1XM1A 2A7CA 1C5MD 3I78A 1ARBA 1YYY1 4CRFA 1MD8A 1BB0B 1MU8B 2BVXH 4AB8A 3GYLB 4IMZA 1QR3E 3KQEA 3SBKA 1G30B 1YM0A 4R0IA 4SGBE 1ZSKA 1H4WA 2ODQA 3Q3KA 1THPB 2BTCE 1D6WA 3F9GA 2IPHA 2QC2A 3QZQA 1EJNA 1GI9B 1QIXB 4DJZB 2ZNKH 1S83A 1A2CH 2Y80A 1GI8B 4Y6DA 1GBBA 4GCHG 3BG8A 1NC6A 1BMNH 1QA7A 1A0HB 4FU9A 3H7OA 1AFQC 1GJ4H 3ZZ4A 1O2KA 3E3TA 4F4OC 1SQOA 2ZCKP 4I8GA 4YOJA 7GCHG 2ZDNA 2PW8H 2G5VA 3A7TA 3PWCA 2QXHA 3PWBA 5EPYA 2ZHWH 1A3EH 2FM2A 3V12A 4H6TA 1GJBB 3ZZ3A 2ZFQH 1W7XH 3A82A 3KIDU 4MVNA 2GD4B 1A46H 2BDYA 4LOYH 4ISIH 3ODFA 2BVRH 3M5NA 1KDQA 1N6XA 2YNAA 5C2ZA 4ZXXH 2F9PA 4NGAH 4U30A 5DKMA 3A86A 3U69H 3VFEA 5AFZH 1MUEB 2AS9A 1AO5A 1AI8H 1Z8RA 1NRSH 1S0RA 4YT7H 1DITH 2A1DB 3E8LA 5HM9A 2C3SA 4JYVH 1BTUA 4E05H 1H9HE 1QJ1B 2G55A 1D4PB 3RMNH 3SNEA 1PPHE 1GHXH 2RDLA 2LNCA 4A1VA 2TGAA 3RU4D 1PPCE 2XCFA 1FPHH 4OGYA 1CBWC 2QA9E 3GY3A 2OINA 1LPZB 3NCLA 1H8DH 6LPRA 4CR5A 3V0XA 5T6GA 2ZWLH 4NA8A 3SUGA 4BTIB 5JBAS 1HDTH 4CHAB 1MCVA 1T7CA 1C5QA 1OP2A 4JCNA 1K28D 3LC5A 4B73A 1AU8A 1MH0A 2ZHFH 1C1SA 2GVFA 2BDIA 2PFEA 2H2ZA 1DVAH 1GJ5H 1C2GA 3LC3A 4B71A 2GX4A 1EOJA 4JMYA 2WINI 5JDUB 1EX3A 4KGAA 1QL9A 5C5OA 3TPIZ 1Y5UT 3SJKA 4BTTB 4A6LA 3CENA 3BSQA 1GBTA 1TNHA 3C1KA 3HGNA 2VIDA 3Q3YA 3H7TA 2PTNA 2W7SA 1CU1A 2J2UA 3ZV8A 2J95A 1DE7H 3LGYA 1SBWA 1AKSB 1NROH 2GCHG 3NPSA 4U32A 2NU4E 1SQAA 1JRSA 1CBWB 5K0HA 1C9PA 4RN6A 1ORFA 4UFDH 4ABDA 3AASA 1ELVA 1UCYH 1BRUP 3LGIA 4Z0KA 3RMLH 3EDXB 1GBIA 1ETSH 1O5DH 5EQRA 3RXJA 2G4UA 1BTZA 4ISNA 2XC0A 2OC8A 1A4WH 4NIXA 1ZMNA 3GDSA 1TPAE 3RP2A 1SOZA 2PSYA 1EZSC 5LPEA 1AWHB 1FQ3A 3MNBA 1V6DA 1V2ST 1LVBA 3QK1A 1JXPA 1PQ8A 3NWUA 2A4QA 1W0ZU 2OQUA 3UR6A 3T25A 4X2VA 3L33A 9ESTA 3BEIB 6ESTA 3A7VA 4FUFA 4I8JA 3SNAA 1TQ0B 2PV9B 1EZXC 1AN1E 2BXTH 3T62A 2VU8E 3BTEE 3LPRA 1J9CH 1E37B 4JZIA 1O2ZA 1C4U2 1GBJA 1E36B 1TYNA 3GCHB 1IQGA 4MPWA 4Y76A 2HALA 1PPFE 3PTBA 1AD8H 2CGAA 5EODA 2Z9GA 1SGEE 1YGCH 3O8CA 2BYAX 1D3TB 1ZGVA 1N1LA 3RXHA 1GBDA 3DT0H 1NTPA 5FAHA 1GDQA 1O5BB 1CA0B 1Z8GA 3TH2H 1AE8H 1EZQA 1YKTA 3TH4H 5A8YA 1CT4E 3U9AH 4TWWA 2BD7A 2CMYA 2ZHQH 4H42U 3RXTA 4FUBA 4NA7A 1SLVB 5JYIA 5BPEA 3ZZ7A 7ESTE 3RDZA 1GL1A 4A92A 1CHOF 1UK2A 3QGNB 1Y8TA 1P2KA 4D7GA 4Q7ZA 5I46H 5L6NH 1ESTA 4E7RG 1BITA 2Z3CA 2SFAA 2CN0H 3EAJA 1MTVA 3SNBA 2B0FA 1L0ZA 1QL8A 1Z1IA 2NU3E 1GMDG 1TX8A 3EA7A 1RIWC 1SGIB 5EPNA 1O5AB 3UUZA 3UWIA 1UTOA 4Y7AA 2STAE 4CH2B 2BY8X 2ANYA 5DP6A 1PJPA 1K1PA 3F9HA 3PLKA 1HAXB 4A7IB 1UJ1A 4NWKA 1GBCA 5HYOA 3U1IB 1O5FH 1QY6A 1O3IA 1FZZA 2P95A 3OU0A 2W5EA 1ETRH 5FXLA 3MHWU 1UVOA 1Y5BT 2ZDVH 5G4BA 3PMBB 3TK5A 1VITF 1MKWH 1KXFA 2FMJA 2FOMB 1GCTB 1F92A 1Z7KA 1EQ9A 2FODA 2GZ8A 2VIQA 1G37A 3RXQA 4AG1A 4K2YA 4GSOA 3CS7A 2BQ6B 4MG3A 3LJJA 1UTMA 1O0DH 1J17T 1DWBH 1O33A 2ZKSA 4AOQA 2R0LA 1GHYH 2SGFE 1ESBA 4GCHF 4LXBH 2ZGJA 1QRZA 2BZ6H 1O5GH 2G5NA 5T6DA 2PR3A 1GJ8B 4D7FA 1UCYK 1A1RA 1G3EA 1QHRB 1OKXA 4UFGH 1ZYOA 3TNTA 4DW2U 2EI8A 1JBUH 1MAYA 1NO9H 1O2MA 1GJCB 1MMJN 1T4VH 5HMAA 3LH1A 2J34A 2QXIA 1GBAA 1XUHA 1WV7H 2ZG0H 1IQHA 4I31A 3M7TA 2ZTXA 3P17H 1FONA 3MTYA 5T3HA 4F49A 2ILNA 2UUJB 4X8UH 2VIPA 1F0RA 1JOUB 2ZO3H 4ABBA 2SGQE 3ZZCA 4AGJA 2F91A 5LGOA 1TALA 5E0JA 1SI5H 2BLQA 3URDA 1ELBA 2XNIA 1B0EA 2J92A 1O35A 4K60A 2A31A 3ZVBA 1YPKH 4X0WU 1RJXB 2BD2A 1KDQB 1BMAA 2Y5FA 4FUHA 2B9LA 2OD3B 5F03A 3MU5A 3GY5A 1AB9B 2BMGB 2W3KA 3M5MA 1H1BA 2YOLA 2GT7A 1RIWB 2Q1JA 1EAUA 2JKHA 4BTUB 2CHAC 1KY9A 1DSTA 4ZH8A 1FN8A 1CGHA 1T4UH 1DS2E 4RKJB 1HJ8A 1KXEA 2AIPA 3S9BA 2VGCC 3M37A 4BAMB 1WYKA 1JMOH 3SUDA 1K22H 4ISHH 5CE1A 1A0JA 5DP3A 5EXMA 4NIYA 4NWLA 1GI1A 3OX7U 3LGUA 2FPZA 2BLVA 4K1TA 2Q6DA 2NU0E 1KLIH 1S82A 5TCCA 3FVFB 2AMQA 1AB9C 1TBRH 2C93B 2FYRA 2Y82A 3S9AA 1MTWA 1O3CA 4OS6A 3S7HB 4JZDH 1QBNA 3GY8A 3M35A 2FXRA 1W12U 2BB4A 4FU8A 5F6MA 1DUEA 1Y59T 2FTMA 4XFQA 1ZZZA 5ABWA 4O9VA 1C5OH 3JZ1B 1SGFA 2BM2A 2VWOA 1AY6H 3SU3A 2BVSH 3RXFA 1BBRK 1C5RA 1GMHG 1IQFA 1BOQA 1ETTH 3UOPA 2VVUA 3TJVA 3RXPA 2VINA 1TA6A 2PUXB 2FOHA 1YCPH 1L1JA 1EAXA 1V2TT 1F7ZA 1HAVB 1FXYA 1HNEE 2Z3DA 2VH6A 3F6UH 2PSXA 1QA0A 1CO7E 5C3NA 4KTSA 2VIOA 2P3FH 8ESTE 1YPGH 3FANA 1TNGA 1OWKA 4H4FA 1O3MA 1SQTA 1SHHB 1UVTH 2ZZUH 1EKBB 1QB1A 1ZMLA 3QO6A 4WH8A 4BAOB 2WYJA 5JBTA 3RXRA 2QIQA 1TGCA 3ITIA 1G2LA 4K8YA 4JK5A 2PKSC 3SU0A 4J2YB 3A89A 2CV3A 3SU5A 3SV9A 2ANMH 1F0TA 1TIOA 1BTYA 2RA0A 2Z3EA 4TY6A 1ESAA 4I8HA 3SORA 4CRAA 3BTWE 2BLOA 3SI3H 1L4DA 4Q7YA 4Y71A 2G4TA 4TPYA 4XSKU 1TRYA 1OS8A 1O3LA 4ZAEA 3TITA 1HPGA 1Y3VA 2H5DA 1W8BH 4AGKA 3RC6A 1SMFE 1V2NT 4WXIA 2UWLA 1GWAA 1AZZA 1SOTA 3FP6E 3ODDA 5IDKA 3SUEA 3S9CA 1ZJKA 3BV9B 1ZJDA 3B9FH 1P10A 2KAIA 1WCZA 1SPJA 1HAIH 3RXOA 1O30A 2PKSB 1GJ9B 4JZ1A 2QGRA 1BA8B 3OYPA 1MBMA 1ELCA 1VJAU 1G2MA 4BXWA 4XE4A 1F0UA 1C5SA 1O2QA 8KME2 2BDCA 2WYGA 3QZRA 1FPCH 1UHBA 2VIWA 1Z71A 2BHGA 4FVDA 4KTCA 1DDJA 2B7DH 2P93A 3BIVH 4Y79A 1FY1A 4ABIA 1S81A 2FOBA 3TH3H 1KYNA 1GMCF 4SGAE 4ASHA 1O31A 2ZC9H 1P2JA 7GCHF 2YNBA 5E0GA 4U01A 1FAKH 1PPZA 3P6ZB 3A83A 1HIAB 3RM0H 1HAGE 1Y3UA 2DE8A 1DWDH 2XYAA 1C2EA 2B5TB 3E90B 2GV7A 3VGCB 1P2NA 3KF2A 5EG4A 1YLDA