1NTPA

Use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords BETA-TRYPSIN
publication title Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin
pubmed rcsb
source organism Bos taurus
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA02
2ZDKA 1F2SE 5C1UA 1DT2A 1EZQA 1UK3A 1O2RA 2ZCHP 3FP7E 1O3NA 4CRCA 1GHBG 1W0ZU 2WV4A 4AGKA 1GI6A 1PJPA 1KXBA 4ISLA 2VIVA 1BTUA 1GMDG 2C8XB 3F9GA 3FFGA 1AI8H 5AFYH 1ZSLA 4OGXA 3RXCA 1YLCA 2A7HA 2CGAA 3KQEA 4WVPE 4D7FA 5DP5A 1V3XA 1SGYE 3STJA 1C2GA 3EGKH 1KXAA 1PYTC 1JIMA 1GHYH 5EPYA 2ZHQH 1LPKB 1WQSA 2XWBI 3P8OA 4LXBH 5I46H 4NFFA 4Z0KA 1GMCG 1O38A 2OCVB 2ZEBA 1L0ZA 3SNDA 5T6GA 1YC0A 2Q1JA 1ZR0A 2ANKH 7LPRA 1AUTC 4ZKSU 1YF4A 3TJVA 4WWYA 3SUFA 4X6PA 2D2DA 3LGIA 2BDGA 5ETXA 2F3CE 1A46H 2WPHS 3E0PB 1BBRH 1G37A 4MPXA 2FOMB 6CHAB 1O34A 2QN5T 5DP4A 5C3NA 1EKBB 1GMHG 3E90B 3UR6A 5CE1A 1C2MA 1P2KA 1O35A 4OS2A 1O0DH 4ABGA 3P8FA 1V2ST 1P9UA 2PTNA 1O3MA 3NZIA 1BTZA 2HLCA 1A0LA 1QB9A 3FZZA 1W3CA 1TPOA 2BX3A 1HYLA 1XMNB 1NRRH 5EXLA 4K1EA 5AF9H 1QQUA 1ABIH 2A4RA 1ZTLA 3QUMP 5EW2H 3LGUA 1O3JA 3SV2H 1TA2A 2Y81A 1O3IA 5A0BA 5DGJA 4CRAA 2BQ7B 2QC2A 2ZU1A 3UNQA 5A2MH 3SZNA 1VITH 4BXSA 2BZAA 1C5SA 1V2TT 4CRDA 3HKIB 1CA0B 1BJUA 2BY9X 1BTPA 2BLWA 1UK2A 2JKHA 2ZPSA 3U9AH 3V13A 1T4UH 2JETC 4JZ1A 2GV7A 2FX6A 3GCTG 2TGPZ 1CGJE 2QYIA 3E16B 1G2MA 2BLQA 1XXDA 2V0BA 3P70B 4AB9A 4ABAA 4BTTB 1BTHH 1Z8IB 1O3DA 1C1WH 2BXTH 1O39A 2EC9H 1LKBA 1OSSA 4D76A 3BTHE 1C1NA 1MTNC 4X6NA 2TGTA 3PB1E 3E3TA 1BRAA 1IQKA 1W13U 1TNHA 3M7QA 1SSXA 1SPJA 1KLTA 1XUGA 1L4DA 1F5RA 1NRPH 1MCTA 2SGQE 4OS7A 3SW2B 4ZXYH 2GDEH 2FO9A 1HCGA 2XCNA 1UTPA 3RM2H 1TOCB 3BG4B 3BTME 1G2LA 5GIBA 1Y5UT 3IITA 1E0FD 1GHAG 8GCHF 5FPYA 1S85A 3RXEA 4RSPA 4ZH8A 1YPHE 2BD8A 5J4SA 3MH5A 4KP0A 1J9CH 1W12U 1GI8B 3SV6A 2BD3A 1O2ZA 2VVCA 4IC6A 2NU2E 1ETSH 1FNIA 1HAOH 2FI4E 1CSOE 1SMFE 2UUKB 1F92A 1SLVB 2FP7B 3GY5A 3ESTA 4AN7A 2RA0A 4BAOB 4NSVA 1GBMA 2J4IA 3TJUA 4K60A 4CHAB 2Z3EA 3SI4H 3GCNA 1Q2WA 1F0TA 4NSYA 1GWAA 3HKJB 5IDKA 3BV9B 2HGTH 1Z6EA 1FQ3A 2H9TH 1GJ4H 3IWMA 2QF3A 1QJ1B 1DVAH 2EEKA 3A7YA 3RXQA 1PPGE 4DIIH 2VH6A 2M5TA 2FZZA 3BTTE 1U6QA 5HXFA 4I8LA 1FUJA 1PPEE 1DY8A 3BTGE 1OWEA 3F9EA 3RLYH 1IQNA 5GXPA 5L2ZH 5DKMA 4GPGA 4U01A 1O3EA 2BDAA 5EQSA 2XBVA 3LKWA 4AG2A 3ZV9A 3BTWE 4ZHAA 4JYUH 1BCUH 2C8WB 3Q76A 1B7XB 5CHAB 1RD3B 4Y8XA 1C1VH 1BRUP 2FX4A 3RP2A 5C5NA 1ANCA 1EXFA 1QQ4A 2ZO3H 1TFXA 1GBAA 3OSYA 1T8NA 4B76A 3D62A 5EQQA 4SGAE 3T62A 1KXFA 1NROH 1TGNA 2PW8H 3WY8A 1DSTA 1C5YB 2ZWLH 2G4TA 1EPTB 3SQEE 3SO3A 2CHAC 1IQMA 4NZLA 5FPTA 1LVBA 1RS0A 1S82A 7GCHG 2O8LA 2BY7X 1P11E 4TPYA 1EPTA 2B7DH 4TY6A 3ZVEA 3P8NA 1PPZA 2FESH 4XDEA 1QB6A 1TB6H 1IOEA 1EUFA 2VIWA 1O3KA 1GL0E 3PM3A 2HNTC 1GPZA 2HALA 3KNXA 3UWIA 3M3SA 5LGOA 1QRWA 1MTSA 2RCEA 2VWLA 2ZNKH 1C2KA 1KLIH 1O3BA 4YO9A 1O2NA 1A0HB 3TK9A 4Y11E 4INHA 2R0LA 3K65B 1QJ6B 3T25A 3A87A 1BUIA 1TONA 3S9AA 3I77A 1WV7H 1HAYB 3LDXH 1GBDA 5G4BA 4MNVA 5C1YA 5E2PA 2Z9JA 3DA9B 1SLXB 2PGBB 3BEIB 3GCOA 1W7GH 4JK5A 1LPZB 1LCYA 1P04A 1THSH 2H5DA 2A5IA 1LMWB 1EB1H 1N8OC 3URCA 3D49H 3I78A 4FUFA 4ZKRU 4NA7A 5F8ZA 4O3UA 4BTUB 1K22H 4Y71A 1PPFE 4X2YA 1DITH 1ZHPA 1L1JA 4AX9H 3F1SB 2A7CA 4NIWA 1IQFA 1GBEA 1TLDA 3DFLA 4X0WU 3KIDU 3RXRA 5EQRA 3TVJB 2SGEE 1EB2A 2PSYA 1HBTH 2G51A 3F68H 3HK3B 1HGTH 1S84A 3PMAB 1T8LA 2ZPQA 1LDTT 1C5XB 5FAHA 1MAXA 4BOHA 1MZAA 2ODYB 5FBIA 2Y82A 2FODA 3KQCA 1GJ6A 1FY3A 1TBQH 3PTBA 1ZYOA 3ENSB 6GCHG 1GJ5H 1BHXF 2QGRA 4OS4A 1Z7KA 3BG8A 3SJ9A 3M3TA 3E91A 3TK6A 3MU5A 2FDAA 3RM0H 1F0SA 1CA8B 4A5TS 1LQEA 3RU4T 4LZ1H 1FONA 1C5PA 1XX9A 1BRCE 1M9UA 1ESAA 2UUFB 2HOBA 2VWNA 7ESTE 3RXHA 3GDUA 3TH2H 2PGQB 2Y7ZA 4MTBA 1GJ9B 1SC8U 1NRQH 4B2AA 2ZHEH 1BJVA 2VNTA 2W5EA 2XNIA 1MMJN 4JZDH 3SHAH 3S9BA 1P02A 5FCRA 2RDLA 1ELVA 5A8YA 2YNBA 1W2KH 4X2WA 3SBKA 4WF8A 3ZZBA 1IQHA 8LPRA 1O2MA 3B8JA 2OC8A 3PLBA 4TPIZ 1EJAA 3SNCA 1EZXC 5F03A 1C1UH 4WY3A 3QN7A 4B2BA 2XBWA 1K1IA 1OP8A 5A8XA 5A8ZA 2ODQA 2XBYA 4TYDA 3VB5A 1L1NA 2PKSB 1D4PB 2XYAA 1UMAH 1D6WA 3MU4A 1AQ7A 3W94A 1KSNA 2RA3A 4FVDA 1K9OE 4OS6A 4D9QA 2Z9LA 4A1XA 1EX3A 1V2VT 4DVAU 3C27B 2FYRA 1K1OA 1O5GH 4NCYA 3SNBA 1SLWB 3ZZ3A 3TNTA 1HNEE 5ESBA 3RXIA 4PROA 1QURH 3HGPA 5E8EH 4LOYH 1V2WT 2HWLB 3CENA 2CF9H 1INCA 5JBCS 2PR3A 4ISIH 2B0FA 4YM9A 2EI6A 2DE9A 1S0QA 2P3UB 3QZRA 1P05A 3SU6A 3QX5H 3SGBE 1JRSA 2J92A 2ZGXH 4E06H 3ATLA 1GBJA 1QCPA 1QJ7B 2PKAB 5JB8S 3RXJA 3VB4A 3DFJA 1CBWB 3GY3A 3MU0A 3SOSA 1P2NA 1QR3E 2ZPRA 1YPLH 4I33A 2V3OH 1S5SA 2WYGA 3GCHB 1TRMA 1HLTH 1AY6H 3QTVH 5A09A 2THFB 3KEEA 3EA8A 2J9NA 3RXOA 3EAJA 2WINI 5EODA 5BPEA 1G3EA 2SNWA 2BQ6B 5K0HA 3H7TA 4B75A 1C2HA 1KXEA 1O5AB 2H9EH 3L6PA 1QL8A 3VB6A 5TCCA 1OWKA 1Y3WA 3VGCB 8KME2 2ZECA 1Z8JB 2GTBA 3NWUA 1ORFA 1L2EA 4FUJA 3F9FA 4FU8A 4A6LA 1NFUA 5LPFA 1WYKA 4XSKU 1DY9A 1C1QA 1FY4A 3UREA 1DS2E 5GJ4B 2GZ9A 1JXPA 4CRBA 1O3CA 1MCVA 5BRRE 4K5ZA 1TRNA 2STAE 1H1BA 4ISOA 3A7WA 1C4V2 1VR1H 3GICB 4X1NU 5DP3A 1B0FA 4FUGA 3P17H 1MTWA 2FLBH 3RXUA 4WJG2 3K9XB 3U8RH 4YT6H 1GBFA 1C1SA 1O2JA 2W3IA 2IN2A 4NA8A 4AFZA 1AB9C 2WPMS 2PUXB 2SGDE 1DWCH 5DP9A 1O2SA 1MZDA 2VGCC 2AYWA 1EAUA 5E0HA 1TRYA 1V2OT 1OYTH 2ZU3A 4LZ4B 1K1NA 1SGFG 4K2YA 3UQVA 5DP7A 1UVSH 2ZTXA 2ZHFH 3M61U 1HAGE 1SGTA 2ULLA 1CT4E 2G5NA 5C2ZA 1RJXB 1C9PA 3Q00A 1NT1A 1O31A 3M37A 3M36A 4KTUA 3TU7H 1O33A 2FOBA 5EG4A 4VGCB 1TA6A 2Z3DA 1WU1A 1KTSB 2BVSH 3MI4A 1O3GA 1SHHB 1SOTA 1LPGB 2O8TA 4Y79A 3M3VA 3OX7U 2ZI2H 2QY0B 3GY6A 4D7GA 1SOZA 2A2XH 1C2FA 4MPUA 4YLUA 1AU8A 2XCFA 2A4GA 2BD2A 2ZU4A 2B5TB 3ZZ5A 1ZPBA 1A3BH 1HJ8A 3TK5A 5JDUB 5HYOA 1T8MA 1O3OA 1JMOH 1AVGH 4XBDA 2BVRH 4ISNA 1IHSH 1BA8B 1AO5A 1OWDA 1QBOA 1S0RA 2ZP0H 1HPGA 1CHOF 3E1XB 1AUJA 1P2OA 4FUBA 4FUEA 1GBLA 1AD8H 5DO4H 2PSXA 2O8MA 2GX4A 2FOAA 3PTNA 1O36A 1GBBA 5GPIB 1AFQC 3MU1A 1UTLM 2FXRA 2C3SA 3QGNB 4NIYA 1QBVH 1SGEE 5EU8A 1J17T 2A45B 3MH6A 4B1TA 1TMBH 3ZV8A 1HAXB 3UUZA 2QXIA 3LJOA 1GI9B 1Y5AT 1TQ7B 1MU8B 4ZUHA 5H4IB 1ARBA 3QZQA 1GJBB 4IN1A 2VJ1A 2WPLS 4FU9A 1GI5A 1SGRE 2A7JA 3SGQE 3STIA 1NO9H 1J8AA 3ZZ8A 1O5BB 2OC1A 1F0RA 2GGVB 2ZDVH 1DUAA 1HUTH 4K8BA 1CHGA 1RRKA 3MNXA 3M5MA 4IC5A 2ZGHA 1P10A 2FWWA 3U98H 1O2TA 3K6ZA 3TJNA 1MQ6A 4Q7ZA 3MWIU 4AZ2B 3BTEE 3UR9A 2P59A 4MNXA 4E7NA 1UHBB 2UWPA 4X1SU 2VB0A 3Q3YA 5GDSH 4ZKNU 1HIAB 3GY4A 1FAXA 4A92A 4UONA 1VCPA 1T31A 4GHTA 4NFEA 4H6SB 2IPHA 2BB4A 1CT2E 3RU4D 1FIZA 1EZSC 1UHBA 1G36A 4HTCH 1HIAA 1SFIA 1EJMA 1SI5H 3M7TA 3LU9B 2NU3E 2TIOA 3ZZ7A 2Y6TA 5F8XA 4NG9H 3A89A 2OP9A 4I32A 4AOQA 2BZ6H 3FVFB 1P2QA 5T6FA 1V2QT 1MKXK 1TE0A 6CHAC 1TYNA 2RG3A 4E7RG 1TABE 3EA9A 5ESTE 2AIQA 1QRXA 1AE8H 3OTJE 1A1RA 1RTFB 1MBMA 4KELA 4HI3A 2ALVA 4MQAA 1GVLA 4ASHA 4CRFA 3BF6H 3BTQE 2A1DB 3KN2A 1GBHA 1OYQA 3LGWA 5AVDA 3VB7A 1TPSA 4DURA 1DFPA 1O2HA 1GBTA 3ATIA 4WH8A 1K1MA 1LHFH 3JZ2B 1CHOG 2AFQB 1DICA 4JZFH 2C8YB 3LC5A 5CMXH 3B23B 1EAXA 2VU8E 1A4WH 3DT0H 1Y5BT 1BMMH 2DUCA 2FS9A 1CO7E 4R8TB 1PPHE 5JBTA 2PV9B 2V35A 1YYY1 1TX6A 1O5DH 1CA0C 2FI5E 4IW4E 3ZYEA 3ATWA 1HAHH 2P8OB 1IAUA 2A4QA 4WMEA 1AMHA 5GCHF 4JCNA 2XW9A 1P06A 4K1TA 3OYPA 1NU7B 1TNJA 1RTLA 3ELAH 3MFJA 4X2VA 4IGDA 2H1UA 1ELTA 1GDNA 2JH5D 2SFAA 3KQBA 2FMJA 3NK8A 1HAVB 5SGAE 2Z3CA 1BZXE 4NIVA 1C5OH 2K1QA 2AGEX 2J95A 1ZMLA 1CU1A 3KCGH 2Y80A 1QL7A 5JYIA 4BAHB 1F7ZA 2AS9A 3RXMA 1HAVA 2B9LA 1SQTA 7KMEH 2G52A 2BHGA 2H6MA 5HM9A 1GG6C 3QTOH 4YT7H 6ESTA 2ZHDA 1GJDB 1FPHH 1NS3A 2HNTE 2PTCE 1LTOA 2ZC9H 1HAIH 3PLKA 3ZZCA 4AFQA 2FLRH 4WH6A 3T29A 1QGFA 2P16A 5E0JA 3SJKA 2HRVA 3GDSA 1T32A 4NZQA 1HAPH 5A0AE 2O8UA 1K21H 2P94A 3ODFA 2V6NA 2Z6BD 3BG4C 3A7TA 2STBE 3Q77A 2Y5FA 3U69H 2GVFA 1GBIA 4GCHF 1MH0A 2O9QA 1GHZA 1YPJH 4B71A 1ZTJA 1DOJA 1P2MA 4UD9H 5F6MA 3S7HB 1GJ8B 2VWMA 3M5OA 1SGNE 1O2WA 2BDBA 1GI1A 1IQLA 3KHVA 2XTTB 1VITF 3PLPA 1B0EA 1VJAU 2OUAA 5T3HA 1K1PA 3FP6E 3A7VA 1V2MT 1XKAC 4KTCA 3SV7A 1IQEA 2LNCA 1EQ9A 2W7SA 2OQUA 2ZTYA 1MQ5A 2OC0A 2FEQH 1G30B 1LKAA 1G3CA 2ZIQH 2OC7A 1O2GH 2H9HA 4TWWA 3ZYDA 1FN6A 2BOKA 2ZTZA 1CGHA 2J38A 2A5AA 4MNWA 4A1VA 1P09A 1Z8RA 2WUCA 3AVZA 2F9NA 1QFKH 1IQJA 1N1LA 2AH4X 4Z6AH 3GY7A 2BY8X 1OWHA 2CJIA 3A86A 2ZFTA 5GCHG 4Q7YA 3SN8A 4X6OA 1VGCB 3ATMA 3UWJH 5CHAC 1FLEE 1TPPA 3E8LA 5E2OA 1A0JA 1DUEA 1UCYH 4MVNA 5E0GA 3RXLA 4AG1A 4ESTE 1NRNH 2VIDA 5EOKA 8GCHG 1BBRE 4CH8B 1LHEH 1C2LA 4KKDA 3R0FA 1AHTH 2ZDLA 3QLPH 3DUXH 4A7IB 1SGPE 1PYTD 2GV6A 1WTGH 3CS7A 3HGNA 1GDQA 4AGJA 3EE0B 1GI0A 1Y3UA 4IS5A 5FCKA 2Y5HA 1IHTH 1NFWA 1Y59T 1SQOA 4CREA 4CBNA 2QV1A 1QIXB 2G00A 1PQ5A 4IMQA 4OS5A 1EOLA 1FY1A 1TX8A 4ABHA 1ZMNA 1YCPM 3RU4E 2ZGCA 1BMAA 3MYWA 1C5MD 2SGFE 4MNYA 3VEQB 5JB9S 1KY9A 3VFEA 4CR9A 1TOMH 5B6OA 4GCHG 3UPEA 2O8WA 2KAIA 4M7GA 2GMTB 2ASUB 2WUBA 3RXBA 3F6UH 2ANWA 5T6DA 4BAKB 2CXVA 1GHWH 1PQAA 4H42U 1LO6A 1GI4A 4DG4A 2J2UA 1KDQA 2ZFPH 4DY7B 1V2LT 1LHCH 1RTKA 1ZTKA 1MUEB 1GI2A 2AGIX 1RGQA 1J14A 3AAVA 1BTXA 1QA7A 1W8BH 2LPRA 3MTYA 1HXEH 3PMJA 4XBCA 2FIRH 2ZG0H 1P0SH 1NZQH 3MO9A 4CR5A 2OLGA 1C5UA 3MHWU 3PO1C 4AFUA 1ELBA 1W11U 2XWAA 1V2KT 1JRTA 1DWBH 1TQ0B 1QTFA 2F9OA 4DGJA 1UTKA 2A2QH 3MH7A 5DP8A 1DLEA 3SJIA 4I7YH 2DE8A 2Z7FE 1AKSA 3SU3A 1YCPK 3KF2A 1E38B 3DD2H 1K1JA 1E34B 1NFXA 3KL6A 3BEFB 5PTPA 2B8OH 4OGYA 2FOGA 1O2PA 1C5TA 2VINA 1AFEH 2VVVA 1MTVA 3RXFA 1ABJH 1D3DB 1EOJA 1K28D 2WV5A 1AGJA 1QL9A 1H9LB 4XBBA 3PWCA 4I31A 2YNAA 3NKKA 4X8VH 4B2CA 1ZGVA 1W10U 1H9IE 3AAUA 4X8SH 1ACBE 3TH3H 3GYMA 3LC3A 3A8DA 1MKXH 1NPMA 1FPCH 1AVXA 2P95A 2QAAA 1FAKH 1WOFA 2WPIS 1ANDA 2Y5GA 2ZGJA 3LGTA 5HMAA 5TCAA 3OY5U 1QBNA 1YPEH 3O8CA 1SBWA 3GDVA 3FZDA 3M35A 3N7OA 1TWXB 2CF8H 4HZHA 3UQOA 4KTSA 3A81A 3NXPA 2AIPA 1EASA 3U8OH 1JOUB 3FANA 1QY6A 1THRH 2ZCLP 4U2WA 2HPQH 4WXIA 1GJAB 1O2UA 1C1TA 4RKJB 2QIQA 2AEIH 1P9SA 4X8UH 3UOPA 2BD5A 4MG3A 2BD4A 1ZHMA 1GVZA 4GUXA 2Q6FA 1SFQB 4AFSA 2BY5X 1THPB 3TLOA 1XVOA 2PKSC 3O8BA 1ZRBA 1JIRA 3U1JB 1ID5H 2TRMA 1EATA 3U8TH 2Q6DA 5L2YH 1GCTB 4X1PU 4Q7XA 3SNEA 2R9PA 1PPCE 1PQ7A 3UTUH 3A8AA 4O03A 2ESTE 1HJAB 1NFYA 4YESB 1B5GH 1OXGA 3E6PH 1PQ8A 2H2ZA 1O3LA 2TGAA 3RC5A 5GWZA 1HV7A 4NA9H 5JPMH 5I25A 1G3DA 1OP0A 4FXGH 3H7OA 3ZZ4A 4WXVA 3ATKA 1O2VA 3MOCA 4I8GA 4F4OC 3FP8E 3EYDA 1GI3A 4ZXXH 1OP2A 1H9HE 2GCTB 1CVWH 5HM2A 1HB0B 3BIUH 5EGMA 3RDZA 1WCZA 2FM2A 1ARCA 1RIWB 2F9UA 3QGJA 4JK6A 1D3TB 1QHRB 2GT8A 3ZZ6A 1JBUH 5J4QA 3SU1A 1DXPA 1CBWC 1FY8E 3VXFH 1UTNA 2ZZUH 1O2IA 2C8ZB 2PLXA 2QF0A 4DIHH 2W7UA 1JWTA 3GCHC 1OWIA 1LHGH 1P03A 2VIQA 1X7AC 3KGPA 4AYVB 1VCWA 4DW2U 1Y3VA 1XUHA 1YPGH 3LONA 3LOXA 2XC5A 3VB3A 3TNSA 1TMTH 1O3PB 3VGCC 4YOGA 3T5FH 4ABEA 1TGSZ 2GCHF 1OS8A 1A7SA 1MAYA 2NU4E 4MPVA 1ELFA 2BLVA 2GP9B 1DWEH 2IJOB 1D3PB 1AZ8A 1UO6A 2FPZA 1GBKA 1GHXH 1O2XA 1NM6A 3MNBA 5DG6A 3SNAA 5EW1H 1GMHF 1UCYK 1XVMA 4GVUA 4X8TH 5DPAA 4BAMB 1W7XH 1Y8TA 3U1IB 3L33A 1MTUA 2I6SA 1C5ZB 1C4U2 4I8JA 1WTHD 4H4FA 4ZHMU 3GY8A 2BDCA 5LPEA 3RXVA 1O2KA 5C5OA 3SUEA 4ABJA 1T7CA 4FUCA 1G9IE 3MU8A 1CQQA 3ZVDA 1A5IA 1O30A 4OS1A 2W26A 4H6TA 1P3EA 1O2OA 3ZZ9A 3T27A 1NRSH 3BEUA 2R3UA 5A0CA 1P01A 2G4UA 4DJZB 3TGKE 8ESTE 3LT3A 1C5WB 1AFQB 1ZMJA 1EJNA 4X1QU 1SL3A 2OQ5A 2P3FH 2YOLA 1BDAA 4VGCC 1QRZA 1GBCA 3GCTF 1NESE 1ETTH 2BTCE 2I6QA 4LK4A 4Q2KA 1BTYA 4AORA 3CS0A 3SI3H 1GGDC 3P95A 2OD3B 1EP6A 1MKWK 3VXEH 1TBRH 1SG8B 1TNIA 1AZZA 3H5CB 4UFEH 2UWOA 1WBGB 2ZFFH 3NUMA 1ETRH 1SQAA 4UFGH 3S0NA 1SGFA 1Z1JA 2GZ7A 2G8TA 3SGAE 1LHDH 4BNRA 1ZPCA 2R3YA 1Z6JH 1ZRKA 1J16A 1P57B 4JMYA 3SUDA 1HFDA 1ELCA 2P3TB 3LPRA 4D9RA 4GSOA 1V2PT 2QXJA 1NY22 3BN9A 4XE4A 4B74A 2GCHG 4QT8C 1GHAF 2ALPA 1Q31A 4RKOB 2FTLE 3ZVBA 3SU4A 3RC6A 5C67A 2OTVA 1FI8A 2R2MB 3MMGA 1S81A 5LPRA 2HNTF 3GISB 1SGQE 3QWCH 2UWLA 3SJ8A 2QXGA 5DP6A 3K6YA 1BT7A 2ZQ1A 1H8DH 5ABWA 1V2NT 1PPBH 1LVYA 3ITIA 4K69A 1KTTB 3PWBA 2JETB 5FX5A 4Y8YA 1DPOA 2BLOA 1ANBA 1XM1A 1G3BA 1FIWA 3RXKA 1L1GA 2OINA 1O5CB 3M5LA 2F9PA 1YCPH 4R0IA 5EXNA 2J34A 1DANH 3ZZDA 3PYHA 1RFNA 1MTNB 2C90B 3QO6A 4GLYA 3BIVH 2GT7A 2FOEA 4Y76A 4RN6A 2VIPA 2ZDNA 1O5EH 1K1LA 1MBQA 3AW1A 1XKBC 1YPMH 3ZVFA 3MH4A 2ZQ2A 3TGJE 3T26A 2SNVA 4Q80A 3RLWH 3DHKH 1VZQH 3IG6B 4ABDA 4ABIA 3E0NB 1J15A 3FAOA 4INKA 5HGGA 1D6RA 3A8BA 4WMFA 2BMGB 2ANMH 1FY5A 4FUHA 1NU9A 3OU0A 2ZDMA 2PWXA 2FTMA 3SJOA 4ZROA 1O32A 4D8NA 5JBAS 3TIUA 3RXSA 2NU0E 1BMLA 2R2WU 1Q3XA 3LGYA 4X6MA 1Z8GA 2BD7A 1O3AA 1MD7A 3BTFE 1FZZA 2Z94A 3UIRA 7GCHF 1GG6B 2A5KA 2ZFRH 4X2XA 1UVOA 1WAYB 1GCDA 1NC6A 1AWFH 1D3QB 1P8VC 1DE7H 5DK1A 2QXHA 1TGBA 2G55A 2GZ8A 2HPPH 4SGBE 2FI3E 2EI7A 2ZU2A 4YTAA 3SU0A 1KIGH 1O3FA 2P8OC 2F9VA 4IMZA 3A8CA 1KXCA 3F9HA 2D26C 3W95A 2ZCKP 3PROA 1UK4A 1C1MA 3MNSA 3LGVA 1BRBE 1AVWA 1ZGIA 1P12E 2BX4A 3ZVGA 2AGGX 1O37A 1SGDE 4ISHH 3RMMH 1F5KU 4JYVH 2F9BH 3SU5A 2BD9A 3RXDA 1ZSKA 1FXYA 3T2NA 2XC4A 1SGIB 3P6ZB 4MPWA 1QNJA 3QK1A 3A85A 4XOJA 3I29A 1G32B 1TNKA 4I8HA 2NWNA 1O2YA 2AMQA 1ANEA 2P93A 1EAWA 1DLKB 3BTDE 4CHAC 1C2EA 1C4Y2 3BTKE 2CHAB 2BDIA 5DJ7A 3RXTA 1QB1A 2ANYA 2NU1E 3S7KB 3UNRA 9ESTA 4FU7A 1C5NH 1Y3YA 2ILNA 2QCYA 4ABFA 1MU6B 1UTJA 4K3JA 1NN6A 1T8OA 2A0QB 1BITA 3LJJA 3V7TA 6GCHF 4DT7B 1DDJA 3UOUA 1GJ7B 2FS8A 5F8TA 1C5RA 4U32A 1OKXA 4YOJA 1XXFA 1OWJA 1YBWA 2UUJB 4GHQA 4B73A 2XC0A 1FDPA 3EDXB 1C1OA 1YP9A 3RMNH 3A84A 4Y0YE 1UVTH 1TALA 1P3CA 4JYTA 1TMUH 1FMGA 1YPHC 1S6HA 3NPSA 1ZPZA 1Z71A 3A83A 1DXWA 4ZMAH 3O8RA 2JH6D 4Y8ZA 3RC4A 2ZHWH 3SU2A 1BTWA 4O3TA 2TGDA 1TAWA 1C2JA 3UFAA 3P92A 1WSSH 4CBOA 1EPTC 2FYQA 1HDTH 2ZF0H 2D1JA 1N8OB 4FUDA 4KGAA 3GYLB 1C2IA 2VH0A 1ELDE 2C93B 4Y7AA 3A7XA 2VIOA 1ZOMA 3QDZB 1F5LA 4CRGA 1VGCC 2A31A 2FOHA 1O5FH 9LPRA 2KAIB 2GDDA 1EP5A 4TY7A 3PMBB 5FPSA 3MNCA 1IQIA 1HRTH 3B9FH 5FHTA 1ZJDA 1E35B 1KDQB 1H4WA 2D8WA 1PFXC 2TBSA 1VJ9U 6LPRA 1C9TA 1C1PA 1ELAA 2FOFA 2WPKS 4BXWA 5JBBS 3AASA 1MKWH 1VITG 1ZHRA 2QA9E 1A5GH 2SGAA 1CGIE 1GHVH 1UVPA 1Y3XA 4UDWH 2PUQH 3PO1B 1FV9A 3KQDA 3Q3KA 1TBZH 1BBRK 3ZVCA 3O8DA 4THNH 1YPKH 2ODPA 3MO6A 5L30H 1XUKA 2F83A 3L3TA 5EXMA 4MLFB 1GJCB 3TPIZ 2J94A 2WYJA 3S9CA 2IOTA 2OXSA 1TPAE 1AKSB 1GDUA 1V2JT 4YOIA 2GMTC 1OX1A 5IYTA 2CN0H 3R3GB 1TNGA 1A61H 2ZFSA 1HXFH 3K2UA 5L6NH 4I8KA 3HK6B 1V6DA 3V12A 2HVXA 3BSQA 1GL1A 1UVUH 4AB8A 2TPIZ 2Z9KA 3S69A 2OBOA 3LH1A 1UJ1A 1AWHB 4FUIA 3M7UA 4TWYA 1GI7B 1MD8A 1SVPA 4Y10E 1Z1IA 4NGAH 1DM4B 1C5VA 1O2QA 4FVBA 1XUFA 4XFQA 1AIXH 3T28A 1TGTA 1E36B 3LH3A 4U30A 4Y6DA 4GAWA 2ZGBH 3D23A 4CH2B 1UTQA 1SGCA 1WUNH 2ZKSA 1D9IA 1ELGA 1BB0B 2CV3A 4WMDA 4Y0ZE 2BQWB 1C5QA 2AERH 2ZFQH 3C1KA 1TNLA 2GKVE 1V2UT 4A1TA 2JH0D 2XXLA 2Z9IA 3P8GA 1SLUB 1S83A 1S6FA 1LVOA 5C20A 3ODDA 1N6YA 2BDHA 1ZLRA 3RXAA 1BOQA 1ESTA 1XUJA 3M5NA 2C4FH 1TX7A 1CT0E 1K2I1 2AMDA 4IBLH 3SV8A 3JZ1B 3ZZAA 2SGPE 3GY2A 1YKTA 4UE7H 2GD4B 1DSUA 1BQYA 1TIOA 5FX6A 2W3KA 4K1SA 5TJXA 3VPKA 5AFZH 5C1XA 5LH8A 4ZKOU 1ZSJA 3A80A 4F49A 3UY9A 2ZA5A 4X1RU 1W0YH 2H5CA 2EA3A 1H8IH 2Z9GA 1HAZB 4HGCA 1QA0A 5K7RA 3PV4A 2BDYA 2BVXH 1P2JA 4JZIA 1ESBA 1UTMA 1C2DA 1C1RA 2G81E 1KXDA 3RXPA 3V0XA 3PMHB 1HJ9A 3SORA 1FN8A 2Y7XA 2PKAA 3NCLA 1A5HA 1GHBF 3SUGA 1XUIA 3RMOH 1NTPA 2BY6X 1YM0A 1GMDF 1YLDA 1GCTC 2PHBA 4ZAEA 3A7ZA 3RXGA 2UUYA 2OBQA 1AB9B 2FOCA 3TITA 1C5LH 1HJAC 1UCYE 2VGCB 1EZUC 1UTOA 2EI8A 3HATH 1GVKB 2BYAX 1GMCF 2VVUA 3AW0A 4J2YB 1KYNA 1TGCA 2Q6GA 4J1YA 1O2LA 3EQ0H 1T4VH 2AMPA 1LQDB 1AN1E 1DX5M 1OOKB 3A82A 1SB1H 1VCQA 3EA7A 4AYYB 2BXUH 4BANB 2GCTC 5AHGH 1YGCH 4INLA 2PFEA 3CP7A 3URDA 2ZU5A 3SQHE 1RIWC 5FXLA 4MDSA 4DOQA 4O9VA 3UNSA 4ABBA 4O97A 1EAIA 2ZDAH 1CE5A 3ZVAA 2A4OA 2F91A 1KLJH 4YZUA 3TJOA 1N6XA 1WQVH 4HFPB 1BHXB 3HPTB 3G01A 4BTIB 2V3HH 1P2IA 3Q3XA 1BIOA 4IN2A 3OY6U 1RXPA 3TH4H 1A2CH 1FJSA 4JZEH 4UFDH 1AE5A 4ZHLU 4UEHH 2XBXA 4BAQB 3RMLH 3GOVB 1ZJKA 2BM2A 5EPNA 1SHYA 3SHCH 3RUOA 2A32A 4YLQH 1DWDH 4DCDA 2WPJS 1SR5C 4NWLA 2CMYA 2VWOA 4Y7BA 1F0UA 1V2RT 3D65E 1L4ZA 4K8YA 4E05H 3LIWA 4NIXA 2XRCA 3V3MA 2BOHB 1ZZZA 5FBEA 3A88A 1GGDB 2G5VA 1A3EH 4NWKA 3TGIE 1IQGA 1LVMA 1BMNH 1ELEE 1OPHB 3SV9A 1O3HA 1W14U 3MO3A 4UFFH 1E37B 2R0KA
chains in the Genus database with same CATH superfamily
2ZDKA 1F2SE 5C1UA 1DT2A 1EZQA 2IJD1 1UK3A 1O2RA 2ZCHP 3FP7E 1O3NA 4CRCA 1GHBG 1W0ZU 2WV4A 4AGKA 1GI6A 1PJPA 1KXBA 4ISLA 2VIVA 1BTUA 1GMDG 2C8XB 3F9GA 3FFGA 1AI8H 5AFYH 1ZSLA 2AHME 2LELA 4OGXA 3RXCA 1YLCA 2A7HA 2CGAA 3KQEA 4WVPE 4D7FA 5DP5A 1V3XA 1SGYE 3STJA 1C2GA 3EGKH 1KXAA 1PYTC 1JIMA 1GHYH 1NBMD 5EPYA 2ZHQH 1LPKB 1WQSA 2WHXA 2XWBI 3P8OA 2PP6A 4LXBH 5I46H 4NFFA 4Z0KA 1GMCG 1O38A 2OCVB 2ZEBA 1L0ZA 3SNDA 5T6GA 1YC0A 2Q1JA 1ZR0A 2ANKH 7LPRA 1AUTC 4ZKSU 1YF4A 3TJVA 4WWYA 3SUFA 4X6PA 2D2DA 3LGIA 2BDGA 5ETXA 2F3CE 1A46H 2WPHS 3E0PB 1BBRH 1G37A 4MPXA 2FOMB 6CHAB 1O34A 2QN5T 5DP4A 5C3NA 1EKBB 1GMHG 3E90B 3PRDA 3UR6A 5CE1A 1C2MA 1P2KA 1O35A 4OS2A 1O0DH 4ABGA 3P8FA 1V2ST 1P9UA 2PTNA 1O3MA 3NZIA 5FL7D 1BTZA 2HLCA 4ASUD 1A0LA 1QB9A 3FZZA 1W3CA 1TPOA 2BX3A 1HYLA 1XMNB 1NRRH 5EXLA 4K1EA 5AF9H 1QQUA 1ABIH 2A4RA 1ZTLA 3QUMP 5EW2H 3LGUA 1O3JA 3KYGA 3SV2H 1TA2A 2Y81A 1O3IA 5A0BA 5DGJA 4CRAA 2BQ7B 2QC2A 2ZU1A 3UNQA 5A2MH 3SZNA 1VITH 4BXSA 2BZAA 5EJLA 1C5SA 1V2TT 4CRDA 3HKIB 4P00A 1CA0B 1BJUA 2BY9X 1BTPA 2BLWA 1UK2A 2JKHA 2ZPSA 3U9AH 3V13A 1T4UH 2JETC 2V3MA 4JZ1A 2HLDD 2GV7A 2FX6A 3GCTG 2TGPZ 1CGJE 2QYIA 3E16B 1G2MA 2BLQA 1XXDA 2V0BA 3P70B 4AB9A 4ABAA 4BTTB 1BTHH 1Z8IB 1O3DA 1C1WH 2BXTH 1O39A 1SKYE 1LKBA 2EC9H 1OSSA 2J5UA 4D76A 3BTHE 1C1NA 1MTNC 4X6NA 2TGTA 3PB1E 3E3TA 1BRAA 1IQKA 2KCPA 1W13U 1TNHA 3M7QA 1SSXA 1SPJA 1KLTA 1XUGA 1L4DA 1F5RA 1NRPH 1MCTA 2SGQE 4OS7A 3SW2B 4ZXYH 2GDEH 2FO9A 1HCGA 2XCNA 1UTPA 3RM2H 1TOCB 3BG4B 3BTME 1G2LA 5GIBA 1Y5UT 3IITA 1E0FD 1GHAG 8GCHF 5FPYA 1S85A 3RXEA 1COWD 4RSPA 4ZH8A 1YPHE 2BD8A 5J4SA 3MH5A 4KP0A 1J9CH 1W12U 1GI8B 3SV6A 2BD3A 1O2ZA 2VVCA 4IC6A 2NU2E 1ETSH 1FNIA 1HAOH 2FI4E 1CSOE 4Q4LA 1SMFE 2UUKB 1F92A 1SLVB 2FP7B 3GY5A 3ESTA 4AN7A 2RA0A 4BAOB 4NSVA 1GBMA 2J4IA 3TJUA 4K60A 4CHAB 2Z3EA 3SI4H 3GCNA 1Q2WA 1F0TA 2J97A 4NSYA 1GWAA 3HKJB 5IDKA 3BV9B 2HGTH 1Z6EA 1FQ3A 2H9TH 1GJ4H 3IWMA 2QF3A 1QJ1B 1DVAH 2EEKA 3A7YA 3RXQA 1KMHB 1PPGE 4DIIH 2VH6A 2M5TA 2FZZA 3BTTE 1U6QA 5HXFA 4I8LA 1FUJA 1PPEE 1DY8A 3BTGE 1OWEA 3F9EA 3RLYH 1IQNA 5GXPA 5L2ZH 5DKMA 4GPGA 4U01A 1O3EA 2BDAA 5EQSA 2XBVA 5KEDA 3LKWA 4AG2A 3ZV9A 3BTWE 4ZHAA 4JYUH 1BCUH 2C8WB 3Q76A 1B7XB 4HG6A 5CHAB 1RD3B 2OK5A 4Y8XA 1C1VH 1BRUP 2W6ID 2FX4A 3RP2A 5C5NA 1ANCA 1EXFA 3SYJA 1QQ4A 4RT0A 2ZO3H 1TFXA 1GBAA 3OSYA 1T8NA 4TSFD 4B76A 3D62A 5EQQA 4SGAE 3T62A 1KXFA 1NROH 1TGNA 2PW8H 3WY8A 1DSTA 2K8IA 1C5YB 1H8ED 5CDFE 2ZWLH 2G4TA 1EPTB 3SQEE 3SO3A 1NBME 2CHAC 1IQMA 4NZLA 5FPTA 1LVBA 1RS0A 1S82A 7GCHG 2O8LA 2BY7X 1P11E 4TPYA 1EPTA 2B7DH 4TY6A 3ZVEA 3P8NA 1PPZA 2FESH 4XDEA 1QB6A 1TB6H 1IOEA 1EUFA 2VIWA 1O3KA 1GL0E 3PM3A 2HNTC 1GPZA 2HALA 3KNXA 3UWIA 3M3SA 5LGOA 1QRWA 1MTSA 2RCEA 2VWLA 2ZNKH 1C2KA 1KLIH 1O3BA 4YO9A 1O2NA 1A0HB 3TK9A 4Y11E 4INHA 2R0LA 3K65B 1QJ6B 3T25A 3A87A 1BUIA 1TONA 2KZ4A 3S9AA 1EFRD 3I77A 1WV7H 1HAYB 3LDXH 1GBDA 5G4BA 4MNVA 2YMSC 5C1YA 5E2PA 2Z9JA 3DA9B 1SLXB 2PGBB 3BEIB 3GCOA 1W7GH 4JK5A 1LPZB 1LCYA 1P04A 1THSH 2H5DA 4ACAA 2A5IA 1LMWB 1EB1H 1N8OC 3URCA 3D49H 3I78A 2F4LA 4FUFA 4ZKRU 4NA7A 5F8ZA 4O3UA 4BTUB 1K22H 4Y71A 1PPFE 4X2YA 1DITH 1ZHPA 1L1JA 4AX9H 3F1SB 2A7CA 4NIWA 1IQFA 1GBEA 1TLDA 3DFLA 4X0WU 3KIDU 3RXRA 5EQRA 3TVJB 2SGEE 1EB2A 2PSYA 1HBTH 2G51A 3F68H 3HK3B 1HGTH 3OE7D 1S84A 3PMAB 1T8LA 2ZPQA 1LDTT 1C5XB 5FAHA 1MAXA 4BOHA 1MZAA 2ODYB 5FBIA 2Y82A 2FODA 3KQCA 1GJ6A 1FY3A 1TBQH 3PTBA 1ZYOA 2LP6A 3ENSB 6GCHG 1GJ5H 1BHXF 2QGRA 4OS4A 1Z7KA 3BG8A 3SJ9A 3M3TA 3E91A 3TK6A 3MU5A 2FDAA 3RM0H 1F0SA 1CA8B 4A5TS 4YXWD 1LQEA 3RU4T 2J98A 4LZ1H 1FONA 1C5PA 1XX9A 1BRCE 1M9UA 1ESAA 2UUFB 2HOBA 2VWNA 7ESTE 3RXHA 3GDUA 3TH2H 2PGQB 2Y7ZA 4MTBA 1GJ9B 3F2GA 1SC8U 4Q63A 1NRQH 4B2AA 2ZHEH 2L74A 1BJVA 2VNTA 2W5EA 2XNIA 1MMJN 4JZDH 3SHAH 3S9BA 1P02A 5FCRA 2RDLA 1ELVA 5A8YA 2YNBA 1W2KH 4X2WA 3SBKA 4WF8A 3ZZBA 1IQHA 8LPRA 1O2MA 3B8JA 2OC8A 3PLBA 4TPIZ 1EJAA 3SNCA 1EZXC 5F03A 1C1UH 4WY3A 3QN7A 4B2BA 2XBWA 1K1IA 1OP8A 5A8XA 4P02A 5HKKD 5A8ZA 2ODQA 2XBYA 4TYDA 2XOKD 3VB5A 1L1NA 2HVYB 2PKSB 1D4PB 2XYAA 1UMAH 1D6WA 3MU4A 3UB0A 1AQ7A 3W94A 1KSNA 2RA3A 4FVDA 1K9OE 4OS6A 4D9QA 2Z9LA 4A1XA 1EX3A 1V2VT 4DVAU 3C27B 2FYRA 1K1OA 1O5GH 4NCYA 3SNBA 1SLWB 3ZZ3A 3TNTA 1HNEE 5ESBA 3RXIA 4PROA 1QURH 3HGPA 5E8EH 4LOYH 1V2WT 2HWLB 3CENA 2CF9H 1INCA 5JBCS 2PR3A 4ISIH 2B0FA 4XD7D 4YM9A 2EI6A 2DE9A 1S0QA 2P3UB 2EY4C 1P05A 3QZRA 3SU6A 3QX5H 3SGBE 1JRSA 2J92A 2QF4A 2ZGXH 4E06H 5EJ1A 3ATLA 1GBJA 1QCPA 1QJ7B 2PKAB 3DSGA 5JB8S 3RXJA 3VB4A 3DFJA 1CBWB 3GY3A 3MU0A 3SOSA 1P2NA 1QR3E 2ZPRA 1YPLH 4I33A 2V3OH 1S5SA 2WYGA 3GCHB 1TRMA 1HLTH 2KFWA 1YLNA 1AY6H 3QTVH 5A09A 2THFB 3KEEA 3EA8A 2J9NA 3RXOA 3EAJA 2WINI 5EODA 5BPEA 1G3EA 2SNWA 2BQ6B 5K0HA 3H7TA 4B75A 1C2HA 1KXEA 1O5AB 2H9EH 3L6PA 1QL8A 3VB6A 5TCCA 1OWKA 1Y3WA 3VGCB 8KME2 2ZECA 5T1VA 1H8HD 1Z8JB 2GTBA 3NWUA 1ORFA 1L2EA 4FUJA 3F9FA 4FU8A 4A6LA 1NFUA 4FOUC 5LPFA 1WYKA 4XSKU 1DY9A 1C1QA 1S6LA 1FY4A 3UREA 1DS2E 5GJ4B 2GZ9A 1JXPA 4CRBA 1O3CA 1MCVA 5BRRE 4K5ZA 1TRNA 2STAE 1H1BA 4ISOA 3A7WA 1C4V2 1VR1H 3GICB 4X1NU 5DP3A 1B0FA 4FUGA 3P17H 1MTWA 2FLBH 3RXUA 4WJG2 3K9XB 3U8RH 4YT6H 1GBFA 1C1SA 1O2JA 2W3IA 2IN2A 3PV2A 4NA8A 4AFZA 1AB9C 2WPMS 2PUXB 2SGDE 1DWCH 5DP9A 1O2SA 1MZDA 2VGCC 2AYWA 1W0KD 1EAUA 5E0HA 1TRYA 1V2OT 1OYTH 2ZU3A 4LZ4B 1K1NA 1SGFG 4K2YA 2VBCA 3UQVA 5DP7A 1UVSH 2ZTXA 2ZHFH 3M61U 1HAGE 1SGTA 2ULLA 1CT4E 2G5NA 5C2ZA 1RJXB 1C9PA 3Q00A 3FO8D 1NT1A 1O31A 3M37A 3M36A 4KTUA 3TU7H 3N99A 1O33A 2FOBA 5EG4A 4VGCB 1TA6A 2Z3DA 1WU1A 1KTSB 2BVSH 3MI4A 1O3GA 1SHHB 1SOTA 1LPGB 2O8TA 4Y79A 3M3VA 3OX7U 2ZI2H 2QY0B 3GY6A 4D7GA 1SOZA 2A2XH 1C2FA 4MPUA 4YLUA 1AU8A 2XCFA 2A4GA 2BD2A 2ZU4A 2B5TB 3ZZ5A 1ZPBA 1A3BH 1HJ8A 3TK5A 5JDUB 5HYOA 3ZIAD 1T8MA 1O3OA 1JMOH 1AVGH 4XBDA 2BVRH 4ISNA 1IHSH 1BA8B 1AO5A 1OWDA 1QBOA 1S0RA 2ZP0H 1HPGA 1CHOF 3E1XB 1AUJA 1P2OA 4FUBA 4FUEA 1GBLA 1AD8H 4F55A 5DO4H 2PSXA 2O8MA 2GX4A 2FOAA 3PTNA 1O36A 1GBBA 5GPIB 1AFQC 3MU1A 1UTLM 2FXRA 2C3SA 3QGNB 4NIYA 1QBVH 1SGEE 5EU8A 1J17T 2A45B 3MH6A 4B1TA 1TMBH 3ZV8A 1HAXB 3UUZA 2QXIA 3LJOA 1GI9B 1Y5AT 1TQ7B 1MU8B 4ZUHA 5H4IB 1ARBA 3QZQA 1GJBB 4IN1A 2VJ1A 2WPLS 4FU9A 4RI0A 1GI5A 1SGRE 2A7JA 3SGQE 3STIA 1NO9H 1J8AA 3DSOA 3ZZ8A 1O5BB 2OC1A 1F0RA 2GGVB 2ZDVH 1DUAA 1HUTH 4K8BA 1CHGA 1RRKA 3MNXA 3M5MA 4IC5A 2ZGHA 1P10A 2FWWA 3U98H 1O2TA 3K6ZA 3TJNA 1MQ6A 4Q7ZA 3MWIU 4AZ2B 3BTEE 3UR9A 2P59A 4MNXA 4E7NA 1UHBB 1E79D 1FX0B 2UWPA 4X1SU 2VB0A 3Q3YA 5GDSH 4ZKNU 1HIAB 3GY4A 1FAXA 4A92A 4UONA 1VCPA 1T31A 4GHTA 4NFEA 4H6SB 2IPHA 2BB4A 3FN8A 1CT2E 3RU4D 1FIZA 1EZSC 1UHBA 1G36A 4HTCH 1HIAA 1SFIA 1EJMA 1SI5H 3M7TA 3LU9B 2NU3E 2TIOA 3ZZ7A 2Y6TA 5F8XA 4NG9H 3A89A 2OP9A 4I32A 4AOQA 2BZ6H 3FVFB 1P2QA 5T6FA 1V2QT 1MKXK 1TE0A 6CHAC 1TYNA 2RG3A 1YWUA 4E7RG 1SQRA 1TABE 4AC9A 3EA9A 5ESTE 2AIQA 4DT4A 1QRXA 3OTPA 1AE8H 3OTJE 1A1RA 1RTFB 1MBMA 4KELA 4HI3A 2ALVA 4MQAA 1GVLA 4ASHA 4CRFA 3BF6H 3BTQE 4TT3D 2A1DB 3KN2A 1GBHA 1OYQA 3LGWA 5AVDA 3VB7A 1TPSA 4DURA 1DFPA 1O2HA 1GBTA 3ATIA 4WH8A 1K1MA 1LHFH 3JZ2B 1CHOG 2AFQB 1DICA 4JZFH 2C8YB 3LC5A 5CMXH 3B23B 1EAXA 2VU8E 1A4WH 3DT0H 1Y5BT 1BMMH 2DUCA 2FS9A 1CO7E 4R8TB 1PPHE 5JBTA 2PV9B 2V35A 1YYY1 1E1RD 1TX6A 1O5DH 1CA0C 2FI5E 4IW4E 3ZYEA 3ATWA 1HAHH 2P8OB 3F3BA 3DCLA 1IAUA 2A4QA 4WMEA 1AMHA 5GCHF 2IPQX 4JCNA 2XW9A 1P06A 4K1TA 3OYPA 1NU7B 1TNJA 1RTLA 3ELAH 3MFJA 4X2VA 4IGDA 2H1UA 1ELTA 1GDNA 2JH5D 2SFAA 3KQBA 3WWBA 2FMJA 3NK8A 1HAVB 5SGAE 4M9FA 2Z3CA 1BZXE 4NIVA 1C5OH 2K1QA 2AGEX 2J95A 1ZMLA 1CU1A 3KCGH 2Y80A 1QL7A 5JYIA 4BAHB 1F7ZA 2AS9A 3RXMA 1HAVA 2B9LA 1SQTA 7KMEH 2G52A 2BHGA 2H6MA 5HM9A 1GG6C 3QTOH 4YT7H 6ESTA 2ZHDA 1GJDB 1FPHH 1NS3A 2HNTE 2PTCE 1LTOA 2ZC9H 1HAIH 3F0OA 3PLKA 3ZZCA 4AFQA 2FLRH 4WH6A 3T29A 1QGFA 2P16A 5E0JA 3SJKA 2HRVA 3GDSA 1T32A 4NZQA 1HAPH 5A0AE 2O8UA 2JJ2D 3GS9A 5DN6D 1K21H 2P94A 3ODFA 2V6NA 2Z6BD 3BG4C 3A7TA 2STBE 3Q77A 2Y5FA 3U69H 2GVFA 1GBIA 4GCHF 1MH0A 2O9QA 1GHZA 1YPJH 4B71A 1ZTJA 1DOJA 1P2MA 4UD9H 5F6MA 3S7HB 1GJ8B 2VWMA 3M5OA 1SGNE 1O2WA 2BDBA 1GI1A 1IQLA 3KHVA 2XTTB 1VITF 3PLPA 1B0EA 1VJAU 2OUAA 5T3HA 1K1PA 3FP6E 3A7VA 1V2MT 1XKAC 4KTCA 3SV7A 1IQEA 2LNCA 1EQ9A 2W7SA 2OQUA 2ZTYA 1MQ5A 2OC0A 2FEQH 1G30B 1LKAA 1G3CA 2ZIQH 2OC7A 1O2GH 2K0QA 2H9HA 4TWWA 3ZYDA 1FN6A 2BOKA 2ZTZA 1CGHA 2J38A 2A5AA 4MNWA 4A1VA 1P09A 1Z8RA 2WUCA 3AVZA 2F9NA 1QFKH 1IQJA 1N1LA 2AH4X 4Z6AH 1K0HA 5HIZA 3GY7A 2BY8X 1OWHA 2CJIA 3A86A 2ZFTA 5GCHG 4Q7YA 3SN8A 4X6OA 1VGCB 3ATMA 3UWJH 5CHAC 1FLEE 1TPPA 3E8LA 5E2OA 1A0JA 1DUEA 1UCYH 4MVNA 5E0GA 3RXLA 4AG1A 4ESTE 1NRNH 2VIDA 5EOKA 8GCHG 1BBRE 4CH8B 1LHEH 1C2LA 4KKDA 3R0FA 3VG8A 1AHTH 2ZDLA 3QLPH 3DUXH 4A7IB 1SGPE 1PYTD 2GV6A 1WTGH 3CS7A 3HGNA 1GDQA 5F53A 4AGJA 3EE0B 1GI0A 1Y3UA 4IS5A 5FCKA 2Y5HA 1IHTH 1NFWA 1Y59T 1SQOA 4CREA 4CBNA 2QV1A 1QIXB 2G00A 1PQ5A 4IMQA 4OS5A 1EOLA 1FY1A 1TX8A 4ABHA 3H09A 1ZMNA 1YCPM 3RU4E 2ZGCA 1BMAA 3MYWA 1C5MD 2SGFE 4MNYA 3VEQB 5JB9S 1KY9A 3VFEA 4CR9A 1TOMH 5B6OA 5C17A 4GCHG 3UPEA 2O8WA 3WW7A 2KAIA 4M7GA 2GMTB 2ASUB 2WUBA 5IK2D 3RXBA 2M2AA 3F6UH 2ANWA 5T6DA 4BAKB 2CXVA 1GHWH 1PQAA 4H42U 1LO6A 1GI4A 4DG4A 2J2UA 1KDQA 2ZFPH 4DY7B 1V2LT 1LHCH 1RTKA 1ZTKA 1MUEB 1GI2A 2AGIX 1RGQA 1J14A 3AAVA 2J98B 3SZEA 1BTXA 1QA7A 1W8BH 2LPRA 3MTYA 1HXEH 3PMJA 4XBCA 2QE7D 2FIRH 2ZG0H 3DSPA 1P0SH 1NZQH 3MO9A 3W1EA 4CR5A 2OLGA 1C5UA 3MHWU 3PO1C 4AFUA 1ELBA 1W11U 2XWAA 1V2KT 1JRTA 1DWBH 1TQ0B 1QTFA 2F9OA 4DGJA 1UTKA 3KYFA 2A2QH 3MH7A 5DP8A 1DLEA 3SJIA 4I7YH 3FOAA 2DE8A 2Z7FE 1AKSA 3SU3A 1YCPK 1W0JD 3KF2A 1E38B 3DD2H 1K1JA 1E34B 1NFXA 3KL6A 3BEFB 5PTPA 2B8OH 4OGYA 3UAIC 2FOGA 1O2PA 1C5TA 2VINA 1AFEH 2VVVA 1MTVA 3RXFA 1ABJH 1D3DB 1EOJA 1K28D 2WV5A 1AGJA 1QL9A 1H9LB 4XBBA 3PWCA 4I31A 2YNAA 3NKKA 4X8VH 4B2CA 1ZGVA 3FKSD 1W10U 1H9IE 3AAUA 4X8SH 1ACBE 3TH3H 3GYMA 3LC3A 3A8DA 1MKXH 1NPMA 1FPCH 1AVXA 2P95A 2QAAA 1FAKH 1WOFA 2WPIS 1ANDA 2Y5GA 2ZGJA 3LGTA 5HMAA 5TCAA 3OY5U 1QBNA 1YPEH 5DSFA 3O8CA 1SBWA 1OHHD 3GDVA 3FZDA 3M35A 3N7OA 1TWXB 2CF8H 4HZHA 3UQOA 4KTSA 2V7QD 3A81A 3NXPA 2AIPA 1EASA 3U8OH 1JOUB 3FANA 1QY6A 1THRH 2ZCLP 4U2WA 1VKYA 2HPQH 4WXIA 1GJAB 1O2UA 1C1TA 2GJGA 4RKJB 2QIQA 2AEIH 1P9SA 4X8UH 3UOPA 2BD5A 4MG3A 2BD4A 1ZHMA 1GVZA 4GUXA 4B6EA 2Q6FA 1SFQB 4AFSA 2BY5X 1BMFD 1THPB 3TLOA 1XVOA 2PKSC 3O8BA 1ZRBA 1JIRA 3U1JB 1ID5H 2TRMA 2JJ1D 1EATA 3U8TH 2Q6DA 5L2YH 1GCTB 4X1PU 4Q7XA 3SNEA 2R9PA 1PPCE 1PQ7A 3UTUH 3A8AA 4O03A 2ESTE 1HJAB 1NFYA 4YESB 1B5GH 1OXGA 3E6PH 1PQ8A 2H2ZA 1O3LA 2TGAA 3RC5A 5GWZA 1HV7A 4NA9H 5JPMH 2JIZD 5I25A 1G3DA 1OP0A 4FXGH 3H7OA 3ZZ4A 4WXVA 3ATKA 1O2VA 3MOCA 4I8GA 4F4OC 4XRNA 3FP8E 3EYDA 1GI3A 4ZXXH 1OP2A 3CNRA 1H9HE 2GCTB 1CVWH 5HM2A 2KX4A 1HB0B 3BIUH 5EGMA 3RDZA 1WCZA 2FM2A 1ARCA 1RIWB 2F9UA 3QGJA 4JK6A 1D3TB 1QHRB 2GT8A 3ZZ6A 1JBUH 5J4QA 3SU1A 1DXPA 1CBWC 1FY8E 3VXFH 1UTNA 2ZZUH 1O2IA 2C8ZB 2PLXA 2QF0A 4DIHH 2W7UA 1JWTA 3GCHC 1OWIA 1LHGH 1P03A 2VIQA 1X7AC 3KGPA 4AYVB 1VCWA 4DW2U 1Y3VA 1XUHA 1YPGH 3LONA 3LOXA 2XC5A 3VB3A 3TNSA 1TMTH 1O3PB 3VGCC 4YOGA 3T5FH 4ABEA 1TGSZ 2GCHF 1OS8A 1A7SA 4ZCNA 1MAYA 2NU4E 4MPVA 1ELFA 2BLVA 2GP9B 1DWEH 2IJOB 1D3PB 1AZ8A 1UO6A 2FPZA 1GBKA 1GHXH 1O2XA 1NM6A 3MNBA 5DG6A 3SNAA 5EW1H 1GMHF 1UCYK 1XVMA 4GVUA 4X8TH 5EJZA 1UW7A 5DPAA 1W7XH 1Y8TA 3U1IB 4BAMB 3L33A 2W6JD 1MTUA 2I6SA 2QF5A 1C5ZB 1C4U2 4I8JA 1WTHD 4H4FA 4ZHMU 3GY8A 2BDCA 5LPEA 3RXVA 1O2KA 2YMSD 5C5OA 3SUEA 4ABJA 1T7CA 4FUCA 1G9IE 3MU8A 1CQQA 3ZVDA 1A5IA 4Z1MD 1O30A 4OS1A 2W26A 4H6TA 1P3EA 1O2OA 3ZZ9A 3T27A 1NRSH 3EE7A 3BEUA 2R3UA 5A0CA 1P01A 2G4UA 4DJZB 3TGKE 8ESTE 3LT3A 1C5WB 1AFQB 1ZMJA 1EJNA 4X1QU 1SL3A 2OQ5A 2P3FH 2YOLA 1BDAA 4VGCC 1QRZA 1GBCA 3GCTF 1NESE 1ETTH 2BTCE 2I6QA 4LK4A 4Q2KA 1BTYA 4AORA 3CS0A 3SI3H 5EIYA 1GGDC 3P95A 2OD3B 1EP6A 1MKWK 3VXEH 3WWFA 1TBRH 1SG8B 1TNIA 1AZZA 3H5CB 4UFEH 2UWOA 1WBGB 2ZFFH 3NUMA 1ETRH 1SQAA 4UFGH 3S0NA 1SGFA 1Z1JA 2GZ7A 2G8TA 3SGAE 1LHDH 2XNDD 4BNRA 1ZPCA 2R3YA 1Z6JH 1ZRKA 1J16A 1P57B 4JMYA 3SUDA 1HFDA 1ELCA 2P3TB 3LPRA 4D9RA 4GSOA 1V2PT 2QXJA 1E1QD 1NY22 3BN9A 1QZ8A 4XE4A 4B74A 2GCHG 4QT8C 1GHAF 2ALPA 1Q31A 4RKOB 2FTLE 3ZVBA 3SU4A 3RC6A 5C67A 2OTVA 1FI8A 2R2MB 3MMGA 1S81A 4ACBA 5LPRA 2HNTF 3GISB 1SGQE 3QWCH 2UWLA 3SJ8A 2QXGA 5DP6A 3K6YA 2KR7A 1BT7A 2ZQ1A 1H8DH 5ABWA 1V2NT 1PPBH 1LVYA 3ITIA 4K69A 1KTTB 2KM0A 2JETB 3PWBA 5FX5A 4Y8YA 1DPOA 2BLOA 1ANBA 1XM1A 1G3BA 1FIWA 3RXKA 2RDEA 1L1GA 4FETA 2OINA 1O5CB 3M5LA 2F9PA 1YCPH 2CK3D 4R0IA 5EXNA 2J34A 1DANH 3ZZDA 3PYHA 1RFNA 1MTNB 2C90B 3QO6A 4GLYA 3BIVH 2GT7A 2FOEA 4Y76A 2F43B 4RN6A 2VIPA 2ZDNA 1O5EH 1K1LA 1MBQA 3AW1A 1XKBC 1YPMH 3ZVFA 3MH4A 3PV5A 2ZQ2A 3TGJE 3T26A 2SNVA 4Q80A 3RLWH 3DHKH 5CHBA 1VZQH 3IG6B 4ABDA 4ABIA 5B6LA 3E0NB 1J15A 2WV9A 3FAOA 4INKA 5HGGA 1D6RA 3A8BA 4WMFA 2BMGB 2ANMH 1FY5A 4FUHA 1NU9A 3OU0A 2ZDMA 2PWXA 2FTMA 3SJOA 4ZROA 1O32A 4D8NA 5JBAS 2WSSD 5C0UA 3TIUA 3RXSA 1MABB 2NU0E 1BMLA 2R2WU 2EQNA 1Q3XA 3LGYA 4X6MA 1Z8GA 2BD7A 1O3AA 1MD7A 3BTFE 1FZZA 2Z94A 3OEED 3UIRA 7GCHF 1GG6B 2A5KA 2ZFRH 4X2XA 1UVOA 1WAYB 1GCDA 1NC6A 1AWFH 1D3QB 1P8VC 4B6FA 1DE7H 5DK1A 2QXHA 1TGBA 2G55A 2GZ8A 2HPPH 4SGBE 2FI3E 2EI7A 2ZU2A 4YTAA 3SU0A 1KIGH 1O3FA 2P8OC 2F9VA 4IMZA 3A8CA 1KXCA 3F9HA 2D26C 3W95A 2ZCKP 3PROA 1UK4A 1C1MA 3AK5A 3MNSA 3LGVA 1BRBE 1AVWA 1ZGIA 1P12E 2BX4A 3ZVGA 2AGGX 1O37A 1SGDE 4ISHH 3RMMH 4OM9A 1F5KU 4JYVH 2F9BH 3SU5A 2BD9A 3RXDA 1ZSKA 1FXYA 3T2NA 2XC4A 1SGIB 3P6ZB 4MPWA 1QNJA 3QK1A 3A85A 4XOJA 3I29A 1G32B 1TNKA 4I8HA 2NWNA 1O2YA 2AMQA 1ANEA 2P93A 1EAWA 1DLKB 3BTDE 4CHAC 1C2EA 1C4Y2 3BTKE 2CHAB 2BDIA 5DJ7A 3RXTA 1QB1A 2ANYA 2NU1E 3S7KB 3UNRA 9ESTA 4FU7A 1C5NH 1Y3YA 2ILNA 2QCYA 4ABFA 1MU6B 1UTJA 4K3JA 1NN6A 1T8OA 2A0QB 1BITA 3LJJA 3V7TA 6GCHF 2L6OA 3F0PA 4DT7B 1DDJA 3UOUA 1GJ7B 2FS8A 5F8TA 1C5RA 4U32A 1OKXA 4YOJA 1XXFA 1OWJA 1YBWA 2UUJB 4GHQA 3PRBA 4B73A 2XC0A 3N7DA 1FDPA 2KCAA 3EDXB 1C1OA 1YP9A 3RMNH 3A84A 4Y0YE 1UVTH 1TALA 1P3CA 4JYTA 1TMUH 1FMGA 1YPHC 1S6HA 3NPSA 1ZPZA 2YMSB 1Z71A 3A83A 1DXWA 4ZMAH 3O8RA 2JH6D 4Y8ZA 3RC4A 2ZHWH 3SU2A 1BTWA 4O3TA 2TGDA 1TAWA 1C2JA 3UFAA 3P92A 1WSSH 4CBOA 1EPTC 2FYQA 1HDTH 2ZF0H 2D1JA 1N8OB 4FUDA 4KGAA 3GYLB 1C2IA 2VH0A 1ELDE 3OAAD 2C93B 4Y7AA 3A7XA 3N7EA 2VIOA 1ZOMA 3QDZB 1F5LA 4CRGA 1VGCC 2A31A 2FOHA 1O5FH 9LPRA 2KAIB 2GDDA 2KCOA 1EP5A 4TY7A 3PMBB 5FPSA 3MNCA 1IQIA 1HRTH 3B9FH 1WDIA 5FHTA 1ZJDA 1E35B 1KDQB 1H4WA 2D8WA 1PFXC 2TBSA 1VJ9U 2KCYA 3OFND 6LPRA 1C9TA 1C1PA 1ELAA 2FOFA 2WPKS 4BXWA 5JBBS 3AASA 1MKWH 1VITG 1ZHRA 2QA9E 1A5GH 2SGAA 1CGIE 1GHVH 1UVPA 1Y3XA 4UDWH 2PUQH 3PO1B 1FV9A 4RT1A 3KQDA 3Q3KA 1TBZH 1BBRK 3ZVCA 3O8DA 4THNH 1YPKH 2ODPA 3MO6A 5L30H 1XUKA 2F83A 5HIYA 3L3TA 2WPDD 4MLFB 5EXMA 1GJCB 3TPIZ 2J94A 2WYJA 3S9CA 2IOTA 2OXSA 1TPAE 1AKSB 1GDUA 4I86A 1V2JT 4YOIA 2GMTC 1OX1A 5IYTA 2CN0H 3R3GB 1TNGA 1A61H 5KECA 2ZFSA 1HXFH 5C0TA 3K2UA 5L6NH 4I8KA 3HK6B 1V6DA 3V12A 2HVXA 3BSQA 1GL1A 1UVUH 4AB8A 2TPIZ 2Z9KA 3S69A 2OBOA 3LH1A 2RFKC 1UJ1A 3F2FA 1AWHB 4FUIA 3M7UA 4TWYA 1GI7B 1MD8A 1SVPA 4Y10E 1Z1IA 4NGAH 3F2HA 3NRLA 1DM4B 1C5VA 1O2QA 4FVBA 1XUFA 4XFQA 1AIXH 3T28A 5C94A 1TGTA 1E36B 3LH3A 4U30A 4Y6DA 4GAWA 2ZGBH 3D23A 4CH2B 1UTQA 1SGCA 1WUNH 2ZKSA 1D9IA 1ELGA 1BB0B 2CV3A 4WMDA 4Y0ZE 2BQWB 1C5QA 2AERH 2ZFQH 3C1KA 1TNLA 2GKVE 1V2UT 4A1TA 2JH0D 2XXLA 2Z9IA 3P8GA 1SLUB 1S83A 1S6FA 1LVOA 5C20A 3ODDA 1WXRA 1N6YA 1YY3A 2BDHA 1ZLRA 3RXAA 1BOQA 1ESTA 1XUJA 3M5NA 2C4FH 3MQKC 1TX7A 1CT0E 1K2I1 2AMDA 4IBLH 3SV8A 3KQ5A 3JZ1B 3ZZAA 2SGPE 3GY2A 1YKTA 5GNDA 4UE7H 2GD4B 1DSUA 1BQYA 1TIOA 5FX6A 2W3KA 4K1SA 5TJXA 3VPKA 5AFZH 5C1XA 5LH8A 4ZKOU 1ZSJA 3A80A 4F49A 3UY9A 2ZA5A 4X1RU 1W0YH 2H5CA 2EA3A 1H8IH 2Z9GA 1HAZB 4HGCA 1QA0A 5K7RA 3PV4A 2BDYA 2BVXH 1P2JA 4JZIA 1ESBA 1UTMA 1C2DA 1C1RA 2G81E 1KXDA 3RXPA 3V0XA 3PMHB 1HJ9A 3SORA 1FN8A 2Y7XA 2PKAA 3NCLA 1A5HA 1GHBF 3SUGA 1XUIA 3RMOH 1NTPA 2BY6X 1YM0A 1GMDF 1YLDA 1GCTC 2PHBA 4ZAEA 3A7ZA 3RXGA 2UUYA 2OBQA 1AB9B 2FOCA 3TITA 1C5LH 1HJAC 1UCYE 2VGCB 1EZUC 1UTOA 2EI8A 3HATH 1GVKB 2BYAX 1GMCF 2VVUA 3AW0A 4J2YB 1KYNA 1TGCA 2Q6GA 4J1YA 1O2LA 3EQ0H 1T4VH 2AMPA 1LQDB 3OEHD 1AN1E 1DX5M 1OOKB 3A82A 1SB1H 1VCQA 3EA7A 4AYYB 2BXUH 4BANB 2GCTC 5AHGH 1YGCH 4INLA 2PFEA 3CP7A 3URDA 2ZU5A 3SQHE 1RIWC 5FXLA 4MDSA 4DOQA 4O9VA 3UNSA 4ABBA 4O97A 1EAIA 4F48B 2ZDAH 1CE5A 3ZVAA 2A4OA 2F91A 1KLJH 4YZUA 3TJOA 1N6XA 1WQVH 4HFPB 1BHXB 3HPTB 3G01A 4BTIB 2V3HH 1P2IA 5KGOA 3Q3XA 1BIOA 4IN2A 3OY6U 1RXPA 3TH4H 1A2CH 1FJSA 4JZEH 4UFDH 1AE5A 4ZHLU 4UEHH 2XBXA 4BAQB 2JDID 3RMLH 3GOVB 1ZJKA 2BM2A 5EPNA 1SHYA 3SHCH 3RUOA 2A32A 4YLQH 1DWDH 4DCDA 2WPJS 1SR5C 4NWLA 2CMYA 2VWOA 4Y7BA 1F0UA 1V2RT 3D65E 1L4ZA 4K8YA 4E05H 3LIWA 4NIXA 2XRCA 3V3MA 2BOHB 1ZZZA 5FBEA 3A88A 1GGDB 2G5VA 2WZQA 1A3EH 4NWKA 3TGIE 3U28C 1IQGA 1LVMA 1BMNH 1ELEE 1OPHB 3SV9A 1O3HA 1W14U 3MO3A 4UFFH 1E37B 2R0KA
chains in the Genus database with same CATH topology
2ZDKA 1F2SE 5C1UA 1DT2A 1EZQA 1UK3A 1O2RA 2ZCHP 3FP7E 1O3NA 4CRCA 1GHBG 1W0ZU 2WV4A 4AGKA 1GI6A 1PJPA 1KXBA 4ISLA 2VIVA 1BTUA 1GMDG 2C8XB 3F9GA 3FFGA 1AI8H 5AFYH 1ZSLA 4OGXA 3RXCA 1YLCA 2A7HA 2CGAA 3KQEA 4WVPE 4D7FA 5DP5A 1V3XA 1SGYE 3STJA 1C2GA 3EGKH 1KXAA 1PYTC 1JIMA 1GHYH 5EPYA 2ZHQH 1LPKB 1WQSA 2XWBI 3P8OA 4LXBH 5I46H 4NFFA 4Z0KA 1GMCG 1O38A 2OCVB 2ZEBA 1L0ZA 3SNDA 5T6GA 1YC0A 2Q1JA 1ZR0A 2ANKH 7LPRA 1AUTC 4ZKSU 1YF4A 3TJVA 4WWYA 3SUFA 4X6PA 2D2DA 3LGIA 2BDGA 5ETXA 2F3CE 1A46H 2WPHS 3E0PB 1BBRH 1G37A 4MPXA 2FOMB 6CHAB 1O34A 2QN5T 5DP4A 5C3NA 1EKBB 1GMHG 3E90B 3UR6A 5CE1A 1C2MA 1P2KA 1O35A 4OS2A 1O0DH 4ABGA 3P8FA 1V2ST 1P9UA 2PTNA 1O3MA 3NZIA 1BTZA 2HLCA 1A0LA 1QB9A 3FZZA 1W3CA 1TPOA 2BX3A 1HYLA 1XMNB 1NRRH 5EXLA 4K1EA 5AF9H 1QQUA 1ABIH 2A4RA 1ZTLA 3QUMP 5EW2H 3LGUA 1O3JA 3SV2H 1TA2A 2Y81A 1O3IA 5A0BA 5DGJA 4CRAA 2BQ7B 2QC2A 2ZU1A 3UNQA 5A2MH 3SZNA 1VITH 4BXSA 2BZAA 1C5SA 1V2TT 4CRDA 3HKIB 1CA0B 1BJUA 2BY9X 1BTPA 2BLWA 1UK2A 2JKHA 2ZPSA 3U9AH 3V13A 1T4UH 2JETC 4JZ1A 2GV7A 2FX6A 3GCTG 2TGPZ 1CGJE 2QYIA 3E16B 1G2MA 2BLQA 1XXDA 2V0BA 3P70B 4AB9A 4ABAA 4BTTB 1BTHH 1Z8IB 1O3DA 1C1WH 2BXTH 1O39A 2EC9H 1LKBA 1OSSA 4D76A 3BTHE 1C1NA 1MTNC 4X6NA 2TGTA 3PB1E 3E3TA 1BRAA 1IQKA 1W13U 1TNHA 3M7QA 1SSXA 1SPJA 1KLTA 1XUGA 1L4DA 1F5RA 1NRPH 1MCTA 2SGQE 4OS7A 3SW2B 4ZXYH 2GDEH 2FO9A 1HCGA 2XCNA 1UTPA 3RM2H 1TOCB 3BG4B 3BTME 1G2LA 5GIBA 1Y5UT 3IITA 1E0FD 1GHAG 8GCHF 5FPYA 1S85A 3RXEA 4RSPA 4ZH8A 1YPHE 2BD8A 5J4SA 3MH5A 4KP0A 1J9CH 1W12U 1GI8B 3SV6A 2BD3A 1O2ZA 2VVCA 4IC6A 2NU2E 1ETSH 1FNIA 1HAOH 2FI4E 1CSOE 1SMFE 2UUKB 1F92A 1SLVB 2FP7B 3GY5A 3ESTA 4AN7A 2RA0A 4BAOB 4NSVA 1GBMA 2J4IA 3TJUA 4K60A 4CHAB 2Z3EA 3SI4H 3GCNA 1Q2WA 1F0TA 4NSYA 1GWAA 3HKJB 5IDKA 3BV9B 2HGTH 1Z6EA 1FQ3A 2H9TH 1GJ4H 3IWMA 2QF3A 1QJ1B 1DVAH 2EEKA 3A7YA 3RXQA 1PPGE 4DIIH 2VH6A 2M5TA 2FZZA 3BTTE 1U6QA 5HXFA 4I8LA 1FUJA 1PPEE 1DY8A 3BTGE 1OWEA 3F9EA 3RLYH 1IQNA 5GXPA 5L2ZH 5DKMA 4GPGA 4U01A 1O3EA 2BDAA 5EQSA 2XBVA 3LKWA 4AG2A 3ZV9A 3BTWE 4ZHAA 4JYUH 1BCUH 2C8WB 3Q76A 1B7XB 5CHAB 1RD3B 4Y8XA 1C1VH 1BRUP 2FX4A 3RP2A 5C5NA 1ANCA 1EXFA 1QQ4A 2ZO3H 1TFXA 1GBAA 3OSYA 1T8NA 4B76A 3D62A 5EQQA 4SGAE 3T62A 1KXFA 1NROH 1TGNA 2PW8H 3WY8A 1DSTA 1C5YB 2ZWLH 2G4TA 1EPTB 3SQEE 3SO3A 2CHAC 1IQMA 4NZLA 5FPTA 1LVBA 1RS0A 1S82A 7GCHG 2O8LA 2BY7X 1P11E 4TPYA 1EPTA 2B7DH 4TY6A 3ZVEA 3P8NA 1PPZA 2FESH 4XDEA 1QB6A 1TB6H 1IOEA 1EUFA 2VIWA 1O3KA 1GL0E 3PM3A 2HNTC 1GPZA 2HALA 3KNXA 3UWIA 3M3SA 5LGOA 1QRWA 1MTSA 2RCEA 2VWLA 2ZNKH 1C2KA 1KLIH 1O3BA 4YO9A 1O2NA 1A0HB 3TK9A 4Y11E 4INHA 2R0LA 3K65B 1QJ6B 3T25A 3A87A 1BUIA 1TONA 3S9AA 3I77A 1WV7H 1HAYB 3LDXH 1GBDA 5G4BA 4MNVA 5C1YA 5E2PA 2Z9JA 3DA9B 1SLXB 2PGBB 3BEIB 3GCOA 1W7GH 4JK5A 1LPZB 1LCYA 1P04A 1THSH 2H5DA 2A5IA 1LMWB 1EB1H 1N8OC 3URCA 3D49H 3I78A 4FUFA 4ZKRU 4NA7A 5F8ZA 4O3UA 4BTUB 1K22H 4Y71A 1PPFE 4X2YA 1DITH 1ZHPA 1L1JA 4AX9H 3F1SB 2A7CA 4NIWA 1IQFA 1GBEA 1TLDA 3DFLA 4X0WU 3KIDU 3RXRA 5EQRA 3TVJB 2SGEE 1EB2A 2PSYA 1HBTH 2G51A 3F68H 3HK3B 1HGTH 1S84A 3PMAB 1T8LA 2ZPQA 1LDTT 1C5XB 5FAHA 1MAXA 4BOHA 1MZAA 2ODYB 5FBIA 2Y82A 2FODA 3KQCA 1GJ6A 1FY3A 1TBQH 3PTBA 1ZYOA 3ENSB 6GCHG 1GJ5H 1BHXF 2QGRA 4OS4A 1Z7KA 3BG8A 3SJ9A 3M3TA 3E91A 3TK6A 3MU5A 2FDAA 3RM0H 1F0SA 1CA8B 4A5TS 1LQEA 3RU4T 4LZ1H 1FONA 1C5PA 1XX9A 1BRCE 1M9UA 1ESAA 2UUFB 2HOBA 2VWNA 7ESTE 3RXHA 3GDUA 3TH2H 2PGQB 2Y7ZA 4MTBA 1GJ9B 1SC8U 1NRQH 4B2AA 2ZHEH 1BJVA 2VNTA 2W5EA 2XNIA 1MMJN 4JZDH 3SHAH 3S9BA 1P02A 5FCRA 2RDLA 1ELVA 5A8YA 2YNBA 1W2KH 4X2WA 3SBKA 4WF8A 3ZZBA 1IQHA 8LPRA 1O2MA 3B8JA 2OC8A 3PLBA 4TPIZ 1EJAA 3SNCA 1EZXC 5F03A 1C1UH 4WY3A 3QN7A 4B2BA 2XBWA 1K1IA 1OP8A 5A8XA 5A8ZA 2ODQA 2XBYA 4TYDA 3VB5A 1L1NA 2PKSB 1D4PB 2XYAA 1UMAH 1D6WA 3MU4A 1AQ7A 3W94A 1KSNA 2RA3A 4FVDA 1K9OE 4OS6A 4D9QA 2Z9LA 4A1XA 1EX3A 1V2VT 4DVAU 3C27B 2FYRA 1K1OA 1O5GH 4NCYA 3SNBA 1SLWB 3ZZ3A 3TNTA 1HNEE 5ESBA 3RXIA 4PROA 1QURH 3HGPA 5E8EH 4LOYH 1V2WT 2HWLB 3CENA 2CF9H 1INCA 5JBCS 2PR3A 4ISIH 2B0FA 4YM9A 2EI6A 2DE9A 1S0QA 2P3UB 3QZRA 1P05A 3SU6A 3QX5H 3SGBE 1JRSA 2J92A 2ZGXH 4E06H 3ATLA 1GBJA 1QCPA 1QJ7B 2PKAB 5JB8S 3RXJA 3VB4A 3DFJA 1CBWB 3GY3A 3MU0A 3SOSA 1P2NA 1QR3E 2ZPRA 1YPLH 4I33A 2V3OH 1S5SA 2WYGA 3GCHB 1TRMA 1HLTH 1AY6H 3QTVH 5A09A 2THFB 3KEEA 3EA8A 2J9NA 3RXOA 3EAJA 2WINI 5EODA 5BPEA 1G3EA 2SNWA 2BQ6B 5K0HA 3H7TA 4B75A 1C2HA 1KXEA 1O5AB 2H9EH 3L6PA 1QL8A 3VB6A 5TCCA 1OWKA 1Y3WA 3VGCB 8KME2 2ZECA 1Z8JB 2GTBA 3NWUA 1ORFA 1L2EA 4FUJA 3F9FA 4FU8A 4A6LA 1NFUA 5LPFA 1WYKA 4XSKU 1DY9A 1C1QA 1FY4A 3UREA 1DS2E 5GJ4B 2GZ9A 1JXPA 4CRBA 1O3CA 1MCVA 5BRRE 4K5ZA 1TRNA 2STAE 1H1BA 4ISOA 3A7WA 1C4V2 1VR1H 3GICB 4X1NU 5DP3A 1B0FA 4FUGA 3P17H 1MTWA 2FLBH 3RXUA 4WJG2 3K9XB 3U8RH 4YT6H 1GBFA 1C1SA 1O2JA 2W3IA 2IN2A 4NA8A 4AFZA 1AB9C 2WPMS 2PUXB 2SGDE 1DWCH 5DP9A 1O2SA 1MZDA 2VGCC 2AYWA 1EAUA 5E0HA 1TRYA 1V2OT 1OYTH 2ZU3A 4LZ4B 1K1NA 1SGFG 4K2YA 3UQVA 5DP7A 1UVSH 2ZTXA 2ZHFH 3M61U 1HAGE 1SGTA 2ULLA 1CT4E 2G5NA 5C2ZA 1RJXB 1C9PA 3Q00A 1NT1A 1O31A 3M37A 3M36A 4KTUA 3TU7H 1O33A 2FOBA 5EG4A 4VGCB 1TA6A 2Z3DA 1WU1A 1KTSB 2BVSH 3MI4A 1O3GA 1SHHB 1SOTA 1LPGB 2O8TA 4Y79A 3M3VA 3OX7U 2ZI2H 2QY0B 3GY6A 4D7GA 1SOZA 2A2XH 1C2FA 4MPUA 4YLUA 1AU8A 2XCFA 2A4GA 2BD2A 2ZU4A 2B5TB 3ZZ5A 1ZPBA 1A3BH 1HJ8A 3TK5A 5JDUB 5HYOA 1T8MA 1O3OA 1JMOH 1AVGH 4XBDA 2BVRH 4ISNA 1IHSH 1BA8B 1AO5A 1OWDA 1QBOA 1S0RA 2ZP0H 1HPGA 1CHOF 3E1XB 1AUJA 1P2OA 4FUBA 4FUEA 1GBLA 1AD8H 5DO4H 2PSXA 2O8MA 2GX4A 2FOAA 3PTNA 1O36A 1GBBA 5GPIB 1AFQC 3MU1A 1UTLM 2FXRA 2C3SA 3QGNB 4NIYA 1QBVH 1SGEE 5EU8A 1J17T 2A45B 3MH6A 4B1TA 1TMBH 3ZV8A 1HAXB 3UUZA 2QXIA 3LJOA 1GI9B 1Y5AT 1TQ7B 1MU8B 4ZUHA 5H4IB 1ARBA 3QZQA 1GJBB 4IN1A 2VJ1A 2WPLS 4FU9A 1GI5A 1SGRE 2A7JA 3SGQE 3STIA 1NO9H 1J8AA 3ZZ8A 1O5BB 2OC1A 1F0RA 2GGVB 2ZDVH 1DUAA 1HUTH 4K8BA 1CHGA 1RRKA 3MNXA 3M5MA 4IC5A 2ZGHA 1P10A 2FWWA 3U98H 1O2TA 3K6ZA 3TJNA 1MQ6A 4Q7ZA 3MWIU 4AZ2B 3BTEE 3UR9A 2P59A 4MNXA 4E7NA 1UHBB 2UWPA 4X1SU 2VB0A 3Q3YA 5GDSH 4ZKNU 1HIAB 3GY4A 1FAXA 4A92A 4UONA 1VCPA 1T31A 4GHTA 4NFEA 4H6SB 2IPHA 2BB4A 1CT2E 3RU4D 1FIZA 1EZSC 1UHBA 1G36A 4HTCH 1HIAA 1SFIA 1EJMA 1SI5H 3M7TA 3LU9B 2NU3E 2TIOA 3ZZ7A 2Y6TA 5F8XA 4NG9H 3A89A 2OP9A 4I32A 4AOQA 2BZ6H 3FVFB 1P2QA 5T6FA 1V2QT 1MKXK 1TE0A 6CHAC 1TYNA 2RG3A 4E7RG 1TABE 3EA9A 5ESTE 2AIQA 1QRXA 1AE8H 3OTJE 1A1RA 1RTFB 1MBMA 4KELA 4HI3A 2ALVA 4MQAA 1GVLA 4ASHA 4CRFA 3BF6H 3BTQE 2A1DB 3KN2A 1GBHA 1OYQA 3LGWA 5AVDA 3VB7A 1TPSA 4DURA 1DFPA 1O2HA 1GBTA 3ATIA 4WH8A 1K1MA 1LHFH 3JZ2B 1CHOG 2AFQB 1DICA 4JZFH 2C8YB 3LC5A 5CMXH 3B23B 1EAXA 2VU8E 1A4WH 3DT0H 1Y5BT 1BMMH 2DUCA 2FS9A 1CO7E 4R8TB 1PPHE 5JBTA 2PV9B 2V35A 1YYY1 1TX6A 1O5DH 1CA0C 2FI5E 4IW4E 3ZYEA 3ATWA 1HAHH 2P8OB 1IAUA 2A4QA 4WMEA 1AMHA 5GCHF 4JCNA 2XW9A 1P06A 4K1TA 3OYPA 1NU7B 1TNJA 1RTLA 3ELAH 3MFJA 4X2VA 4IGDA 2H1UA 1ELTA 1GDNA 2JH5D 2SFAA 3KQBA 2FMJA 3NK8A 1HAVB 5SGAE 2Z3CA 1BZXE 4NIVA 1C5OH 2K1QA 2AGEX 2J95A 1ZMLA 1CU1A 3KCGH 2Y80A 1QL7A 5JYIA 4BAHB 1F7ZA 2AS9A 3RXMA 1HAVA 2B9LA 1SQTA 7KMEH 2G52A 2BHGA 2H6MA 5HM9A 1GG6C 3QTOH 4YT7H 6ESTA 2ZHDA 1GJDB 1FPHH 1NS3A 2HNTE 2PTCE 1LTOA 2ZC9H 1HAIH 3PLKA 3ZZCA 4AFQA 2FLRH 4WH6A 3T29A 1QGFA 2P16A 5E0JA 3SJKA 2HRVA 3GDSA 1T32A 4NZQA 1HAPH 5A0AE 2O8UA 1K21H 2P94A 3ODFA 2V6NA 2Z6BD 3BG4C 3A7TA 2STBE 3Q77A 2Y5FA 3U69H 2GVFA 1GBIA 4GCHF 1MH0A 2O9QA 1GHZA 1YPJH 4B71A 1ZTJA 1DOJA 1P2MA 4UD9H 5F6MA 3S7HB 1GJ8B 2VWMA 3M5OA 1SGNE 1O2WA 2BDBA 1GI1A 1IQLA 3KHVA 2XTTB 1VITF 3PLPA 1B0EA 1VJAU 2OUAA 5T3HA 1K1PA 3FP6E 3A7VA 1V2MT 1XKAC 4KTCA 3SV7A 1IQEA 2LNCA 1EQ9A 2W7SA 2OQUA 2ZTYA 1MQ5A 2OC0A 2FEQH 1G30B 1LKAA 1G3CA 2ZIQH 2OC7A 1O2GH 2H9HA 4TWWA 3ZYDA 1FN6A 2BOKA 2ZTZA 1CGHA 2J38A 2A5AA 4MNWA 4A1VA 1P09A 1Z8RA 2WUCA 3AVZA 2F9NA 1QFKH 1IQJA 1N1LA 2AH4X 4Z6AH 3GY7A 2BY8X 1OWHA 2CJIA 3A86A 2ZFTA 5GCHG 4Q7YA 3SN8A 4X6OA 1VGCB 3ATMA 3UWJH 5CHAC 1FLEE 1TPPA 3E8LA 5E2OA 1A0JA 1DUEA 1UCYH 4MVNA 5E0GA 3RXLA 4AG1A 4ESTE