1NTPA

Use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNTLNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ntpA02
1BBRK 2BD7A 4WMEA 1WAYB 4AOQA 1AE5A 2WPHS 3KEEA 3E6PH 1G37A 2J9NA 1UHBA 1O2QA 1YC0A 2P95A 3P92A 3PM3A 4NA8A 2G4TA 1QA0A 2ZDLA 3MWIU 1F5RA 1TX8A 2SGFE 1HUTH 1UVPA 2ZF0H 2XBYA 1G36A 1UMAH 4A5TS 1O3IA 2Z9LA 1P9UA 4GCHG 4TY7A 5DJ7A 5FX5A 1P2KA 2UWOA 1O2WA 1C1UH 1FY5A 4CRAA 2F9BH 3M7TA 3P17H 1LVOA 1O2PA 1ABIH 3OTJE 1P02A 1G2LA 1EASA 1C1NA 3SJOA 4OS2A 1GHBG 1A61H 1DANH 1ELFA 3ODDA 3ZVCA 1K9OE 2BD3A 3BG4C 1YP9A 1GJ7B 2ASUB 1UCYK 4XFQA 3D65E 2BD5A 1SLXB 4WY3A 4BOHA 1B5GH 1MTWA 1OPHB 3RC6A 3OU0A 1E38B 1RS0A 5FCKA 1HAZB 1O3EA 1GMCG 1UK2A 3U1IB 1O2KA 3SI4H 1GI4A 5C67A 1NRPH 1AB9B 3U98H 5CHAB 3VEQB 4ISNA 1KTTB 1Z8IB 1FIWA 1JXPA 1J15A 3U1JB 1T31A 2CJIA 1PQ5A 5DP8A 2F9PA 9LPRA 3RXQA 4BNRA 1O36A 1LKBA 4YT6H 3E3TA 1MKXK 2WPKS 1PFXC 2GCHF 4WH6A 2ILNA 1TX6A 2ZGHA 1O3MA 3EYDA 2DUCA 4U30A 4HZHA 3HPTB 1C2MA 3SHCH 2PWXA 2OLGA 3E1XB 1AWHB 2BYAX 2XWBI 4TPIZ 2GX4A 2ZTZA 4UFDH 5A0AE 4JK6A 5AFYH 1MH0A 1HLTH 1MTUA 3KN2A 1Z6EA 2IN2A 2O8UA 4I8GA 3Q3XA 1YPKH 4U2WA 3S9CA 1OWEA 1CVWH 3QZRA 4B75A 2ZDAH 3RXJA 2FWWA 3M3VA 1L1NA 1L4ZA 5ETXA 4CHAC 3SU5A 3I77A 1Y3UA 1KSNA 1HAIH 2RA3A 5CHAC 1JIRA 1GCTB 3HATH 4Y6DA 4XBDA 2NU3E 1CHOG 1RD3B 1C5PA 1GWAA 1RTLA 1BTWA 4DVAU 4I31A 3UQOA 1S5SA 3UY9A 1ZMJA 1V2WT 1C1SA 1FXYA 1O3JA 4PROA 1PPZA 2HNTC 3SI3H 1W7GH 4E05H 1E35B 2V3OH 2C4FH 1QBVH 2WV5A 3ZVEA 3SV8A 1QR3E 2VNTA 1O2NA 2ZFPH 2Z3DA 1QRZA 2UUYA 4X2YA 4AYVB 1NRSH 1TPPA 3TGIE 1EAUA 4ZHAA 4AORA 4B1TA 4M7GA 1GHWH 3KIDU 4FVDA 3QDZB 1AGJA 1YM0A 4XDEA 3FZDA 1P01A 3SQEE 1OWIA 2QN5T 1MMJN 4F4OC 1ZTKA 2BVXH 3U9AH 1ZPCA 3A82A 2A7HA 1EPTC 1DSTA 3LGVA 2OQUA 2A4QA 4RKJB 5ESTE 1V2QT 3BTGE 3F1SB 3MU0A 3UOPA 2H1UA 1ZLRA 2WYJA 4MG3A 1Y5UT 5EXMA 2F9VA 1GI6A 3O8RA 1RIWB 1FUJA 1QURH 2BOHB 1C9PA 2AH4X 4DY7B 5F03A 2C90B 6CHAC 1EAIA 4X2VA 2GDDA 1SLWB 4NA7A 2V6NA 3E8LA 1FY4A 2BVSH 4CRBA 2PUXB 1FIZA 2BDCA 5IYTA 3GCHB 1C4U2 2OC8A 1FI8A 2BD8A 3A84A 4NWKA 4SGAE 2FOEA 4X0WU 5JBTA 1MQ6A 1O5FH 2WPMS 1IQKA 2ZNKH 1T8OA 4DW2U 1EP5A 1EB2A 3RLWH 1C1WH 4X1SU 5I25A 1AE8H 2VIVA 1TPSA 3I29A 1TMBH 1F2SE 1ZPBA 2Y5FA 2BLOA 3V3MA 4FVBA 1S6FA 2FPZA 1C1QA 4K69A 4BTIB 1DOJA 1W8BH 3PTNA 1TRYA 4FUJA 2VIQA 3RXBA 1O3KA 3P8GA 5EODA 1KDQA 2GZ7A 2CXVA 3T5FH 3B9FH 1CA0B 3NPSA 1V2PT 3UFAA 2AGIX 7GCHG 4O9VA 2BXTH 4NCYA 1TE0A 2VVCA 2ODQA 3ZZCA 1OWJA 1MAXA 2PFEA 1TMTH 1AUTC 2BQ6B 4Y7AA 3L33A 2TPIZ 3QWCH 1CGIE 1ID5H 2PTNA 2Y7XA 1AZ8A 2CF8H 4INLA 4TWWA 4X1NU 1TOMH 2XTTB 3MH6A 1BB0B 4FXGH 2C3SA 2A4GA 1A7SA 1Q3XA 2Z9KA 3GCNA 4BXSA 3BIVH 3FP8E 1O0DH 2CV3A 3F9EA 1ELVA 5PTPA 2ZC9H 3RLYH 3STIA 1INCA 4UEHH 2VIOA 1AQ7A 2B5TB 3Q00A 1OP8A 3MI4A 5JBBS 1OWDA 2FOHA 3QUMP 1BTHH 3KCGH 2ZFQH 3K6ZA 2AERH 1GMHG 1SSXA 2QGRA 5A0BA 4X6MA 1HDTH 3UNSA 2Z94A 3GISB 1CA0C 2JH0D 4BXWA 1BRBE 2XBVA 4GLYA 7KMEH 5IDKA 1QRXA 3UNRA 2UWLA 3SU0A 1IQGA 3VB7A 1V2MT 5B6OA 1ZGVA 2H9HA 1GBAA 3BF6H 5AFZH 1HPGA 1F7ZA 2PUQH 2W7SA 1V6DA 2FOGA 1H1BA 4Q7XA 2QV1A 3KQEA 2QIQA 4AZ2B 1C2LA 1MKWK 1C2HA 2FS9A 4AFQA 2FI4E 2VJ1A 2Y7ZA 2A32A 2B8OH 1HJ9A 4IN2A 5C1UA 1A0HB 1W14U 1P57B 5F8TA 5C20A 1NC6A 2VGCC 3PWCA 1Z71A 1OP0A 5JB8S 1UO6A 2FXRA 2BY7X 2ZCKP 1ANDA 1KLJH 2FIRH 1Y3XA 1AZZA 3SN8A 2Z9JA 3ZVFA 1F0RA 4KTCA 1JMOH 1EKBB 2PW8H 2XCFA 3PV4A 2BDYA 3BEIB 3T27A 4Q7ZA 5GJ4B 1AVWA 3UWJH 2EA3A 4KP0A 2GGVB 1SG8B 2OD3B 4DJZB 2ZGXH 5FHTA 2HRVA 3RXFA 3LC3A 1QB1A 1ZMLA 1BMAA 3MNSA 1J14A 1GJBB 1ELDE 1QGFA 1W0YH 1QRWA 3O8BA 1ZSJA 1VCQA 4CBNA 4CR9A 4FUDA 3FZZA 1XUKA 1C5VA 3DT0H 1IQLA 1XVOA 2RCEA 3FVFB 4CREA 1TNJA 3RP2A 1ARBA 1QA7A 2SGQE 3SOSA 1OOKB 1L0ZA 5FX6A 3NUMA 5TJXA 3SGQE 2AEIH 1HRTH 4IC6A 1SVPA 5I46H 1Z6JH 3TJOA 3HK3B 1L2EA 1NFWA 3E0NB 1MUEB 3SQHE 1WSSH 1XMNB 5C1XA 3UWIA 3ZYDA 1XUFA 2VINA 3JZ1B 5GIBA 2DE8A 5F8ZA 2QC2A 1K1MA 2ANMH 1PYTD 3LKWA 2ALVA 1SGFA 2Y82A 4MVNA 5E0JA 1AD8H 1O2SA 1F5LA 3TNSA 2FS8A 3TU7H 1XVMA 1ZSKA 4YLQH 2Y80A 3UR9A 2ZGJA 1ZRKA 1AI8H 2H5CA 4X6NA 5EPNA 1ETRH 3RXLA 4DT7B 2GD4B 3PROA 3K2UA 4FU7A 4OS1A 3T28A 1Z7KA 2ZI2H 4I8HA 1GHAG 1KTSB 3A7XA 1C2IA 2WUCA 1P9SA 1PYTC 1AO5A 2BQWB 4UE7H 5LPRA 1A2CH 5JPMH 3GY5A 1LPGB 1O5CB 3BTEE 1ELBA 5L30H 1DY9A 7GCHF 3D49H 3RXIA 1MAYA 1FN6A 3TJUA 1GJ9B 1LHGH 3LDXH 3RXKA 1D6RA 2FOCA 3ENSB 1OP2A 1SGTA 3EA9A 5JB9S 1QQUA 4AFZA 1DITH 2FI5E 3HKJB 2SGPE 2Z3CA 1AIXH 3EA7A 1O5GH 1O3LA 1ZHPA 3VGCC 1G2MA 2WPIS 2ZIQH 1HBTH 3H7TA 1GJDB 2GP9B 3AW0A 3LT3A 2G51A 1CQQA 1LMWB 4X8SH 1JIMA 2R0KA 4K1EA 1ZTLA 3EGKH 3RXAA 1D6WA 1G3CA 1FZZA 2PKAA 3BTQE 3I78A 3ATWA 3GDVA 3QN7A 3RMMH 4Y71A 2GMTB 1XXFA 1GG6B 3TK9A 1AFEH 1WBGB 3BTHE 8LPRA 2A2XH 2A4OA 1BIOA 1QB6A 4DIIH 1ESBA 1NT1A 3HGNA 1GDNA 1YPGH 1GBLA 1C2KA 1XM1A 3F6UH 4I8LA 1MZAA 3TNTA 4TY6A 1C2DA 1P2JA 3S9AA 3A8DA 2A45B 2EC9H 2HOBA 4U01A 5CE1A 3V0XA 4A1VA 3FAOA 1UTPA 3JZ2B 2F9UA 2VIPA 3GCTG 3A83A 1A3EH 3LGYA 5LPFA 3DUXH 3KHVA 1BDAA 3KNXA 4OGYA 3VXEH 1C5TA 2HWLB 1BMMH 4ABHA 1T4UH 1TA6A 3U8OH 1ZJDA 3LPRA 3BG8A 1E37B 1C1RA 2FLBH 2EI8A 1T7CA 2BY9X 2JH6D 4TYDA 1V3XA 3ZVAA 2QXJA 1SPJA 3MOCA 1HIAB 3OYPA 4I8KA 1JRTA 4CRCA 2GMTC 3OY5U 3PMAB 4K1TA 1GG6C 1NRNH 3MO6A 5JYIA 1DLKB 2Y81A 1CT2E 2C93B 2A5KA 6GCHG 1TGTA 5EQSA 1EP6A 1KXBA 4I33A 5E2PA 3SJ8A 1GBTA 4AGJA 2ZHDA 4WH8A 5C3NA 3UTUH 3P95A 1QIXB 3RXOA 1S0QA 3PMBB 4X8UH 1TALA 1W10U 3ESTA 3UQVA 5EU8A 2PR3A 1W7XH 1LVMA 3R0FA 3MO3A 1TNKA 3GYLB 4ISIH 3RU4E 3MU8A 5LGOA 1GHYH 4QT8C 2BDIA 2GCTB 3C1KA 3UNQA 4E06H 1GBJA 4MNYA 1IQHA 4IMQA 3GY8A 4AX9H 1O2UA 4JZIA 1NROH 4MTBA 1LVYA 2F9OA 2TBSA 2P3FH 4B2AA 3PMJA 2PLXA 5H4IB 1W0ZU 3KQBA 4Y79A 3SHAH 1PPCE 1K28D 1SGYE 2J34A 1CT0E 2J94A 4BANB 4ZKRU 1A0LA 1G3EA 2GV7A 4LXBH 5C5NA 1YPHC 1HCGA 3S9BA 4Y0YE 2A0QB 3ZV8A 1HAPH 2BZ6H 1C5OH 1WYKA 1S82A 1FY1A 2ZU2A 3F9GA 1TGCA 1XKBC 1Z8GA 2TRMA 1ZGIA 1TOCB 5EXNA 4ZMAH 1T4VH 1Y3WA 2GV6A 3BTWE 3TH2H 2XC5A 3HGPA 4CHAB 4YLUA 5E0GA 2VU8E 3OX7U 2HLCA 3ATKA 4GHQA 3BTTE 1NU9A 3F9FA 4X8VH 5GCHG 2BD2A 2BVRH 1HXEH 2GCTC 2ZPRA 1IQIA 3BIUH 3LGIA 4XBCA 3SGBE 2ZPQA 3SV6A 1A4WH 5EW1H 2BD4A 2GZ9A 1C1OA 1ESAA 3A89A 3OY6U 2QAAA 5A09A 1Y5BT 1KIGH 4GUXA 1MD8A 3QZQA 3SUEA 3UUZA 1SGPE 1CBWC 4OS4A 2O8LA 3B8JA 3N7OA 1GI2A 5T6FA 2XWAA 1P8VC 1BT7A 2HPPH 2XYAA 3RDZA 1MD7A 3Q3KA 2R9PA 1T32A 1JOUB 3SV2H 3G01A 2BTCE 3RXSA 2ZKSA 3D23A 2HNTF 2Q1JA 1TBQH 3S7KB 2FESH 3TJNA 1F5KU 2G8TA 3U69H 2H9EH 1NU7B 1C5SA 1MBQA 1Z1IA 1P06A 4IBLH 1UVUH 2ANWA 3IWMA 4NWLA 3DA9B 1PQ8A 1P10A 3GY4A 5BRRE 1HNEE 1N8OB 4RN6A 1KXAA 4OS6A 3SUDA 1D4PB 1AU8A 1EPTB 2C8ZB 2XC0A 3ODFA 1ZYOA 2Y5GA 3EDXB 1ETTH 3L6PA 4XE4A 1G9IE 4UFEH 1L4DA 1PQ7A 5DP7A 8GCHG 2QXHA 5DP3A 1DWEH 3MYWA 2VH6A 1AN1E 4YO9A 3T2NA 1BTPA 2QF3A 1HB0B 2FEQH 3SBKA 6CHAB 2CF9H 1TBRH 2THFB 4AB9A 1TNIA 3GY7A 2NU2E 3RC4A 2PSXA 3SU6A 5AF9H 3VB5A 5G4BA 1GVKB 1SGFG 2RG3A 4AB8A 2CMYA 1QQ4A 1GBFA 2ZDNA 1GBCA 2Y6TA 5DG6A 3DHKH 2ZU4A 4LOYH 1WCZA 3EAJA 1V2TT 3RC5A 3ZZBA 1LTOA 3CS7A 3M3TA 4UD9H 1N8OC 4OS5A 1ZHMA 2ZU3A 3ITIA 6GCHF 1D3DB 1VCPA 4BTUB 2LNCA 1GBMA 3VB3A 1YPLH 1FY8E 2V3HH 3BTKE 1EZUC 2EI7A 3A7YA 4AYYB 7LPRA 1EJAA 4Z0KA 1PPEE 2ZQ1A 3E91A 1W3CA 3ZZ5A 4E7NA 4KTUA 3AAVA 1BITA 3CP7A 1K2I1 4YTAA 3UREA 1XKAC 4AG2A 3CS0A 1J16A 2PKSB 1HAYB 2BZAA 2FOAA 2O8TA 1E0FD 1P03A 1NN6A 1PPFE 2A4RA 4RSPA 3E16B 4GCHF 2BDAA 1U6QA 2VWMA 1GHZA 3A7TA 1ZJKA 2ZTYA 1FMGA 4B74A 1IQJA 1K1LA 3ZVBA 1PPGE 1BBRE 3T62A 1OXGA 1C5ZB 3SU4A 1LHFH 5EXLA 1GHBF 5GWZA 3RU4D 1DX5M 1BTUA 1SMFE 3MNXA 1NM6A 1O3CA 1RTKA 1O35A 1UVOA 1A1RA 1SGCA 2FX6A 3BSQA 1SGNE 1Z8RA 2XW9A 1BOQA 1Q31A 4WMDA 2TGDA 3K6YA 3TGKE 1THRH 1C5LH 1TGNA 3PMHB 3KQDA 1ACBE 1O3NA 1YGCH 3ZVGA 3M5MA 1TRNA 4HI3A 5A8ZA 4D76A 1GBDA 5ABWA 2JH5D 1O34A 1GMCF 1SQAA 2F9NA 3RM2H 1DY8A 1KLTA 4JYUH 1DXWA 3S7HB 2PKSC 1N6XA 2D2DA 2ZDVH 1TNGA 1KXDA 1UVSH 2BDHA 2G55A 1P0SH 1NS3A 2H2ZA 3F9HA 5J4QA 2AS9A 2GKVE 3NKKA 3K9XB 1UCYE 4GVUA 2F91A 3MH5A 3H7OA 5T3HA 2P94A 1G3BA 3LH1A 1VCWA 2ZDKA 2D26C 2R3UA 1NRRH 5ESBA 3MH4A 4MPVA 3VPKA 2VGCB 3GYMA 1PQAA 3KF2A 1TX7A 1GBBA 1GVLA 5F6MA 1O2ZA 4ZXYH 2Q6DA 1AVGH 2B0FA 5DKMA 1ANEA 3SNCA 1DXPA 1J9CH 4O03A 8KME2 1TGBA 1ZZZA 4K3JA 1NPMA 4H42U 3SORA 5A2MH 2FI3E 1IOEA 1C5UA 1KXEA 3P8NA 1P2IA 3A86A 4WVPE 3AW1A 1S81A 3HK6B 4AFSA 1C5QA 4X6PA 5TCAA 5DK1A 3RM0H 2G5NA 2JETB 3S69A 1DM4B 1HAXB 2KAIA 1DVAH 4MPXA 1CHOF 1UTLM 2ZCHP 3A7VA 1V2VT 1SGQE 1YCPH 2OP9A 3A80A 1LO6A 4O3UA 3GCOA 2J2UA 1BUIA 1OWHA 3LH3A 1NFYA 2C8YB 2OQ5A 3Q77A 2Z6BD 1K1JA 2OUAA 5LH8A 1V2ST 5GXPA 2YNBA 1XUHA 1QHRB 1L1GA 2Z7FE 4LZ4B 1DDJA 4IGDA 2M5TA 3Q3YA 1VITG 2ZHWH 4TPYA 3E0PB 1G3DA 1GBHA 4INKA 2I6SA 3SV9A 1DICA 3LIWA 4D8NA 2WV4A 3GDUA 1MCVA 2FOBA 1RXPA 4NSYA 1QB9A 2EEKA 1AFQC 3ZZ4A 3T25A 4NIWA 2V35A 4BAKB 5JBCS 4H6TA 3MU1A 1DE7H 4NIXA 5E8EH 1SGEE 4K2YA 5E2OA 5BPEA 1HJ8A 4X6OA 1TABE 1YKTA 2JETC 2XCNA 1BTYA 3U8TH 1GMDG 2OBQA 1SFQB 2XBXA 2ZECA 2P3UB 2IPHA 3GY6A 1ZSLA 2IJOB 3A81A 3QLPH 5SGAE 4X2XA 1AY6H 3TIUA 3GY2A 3QX5H 4D7FA 3DFLA 2FODA 1N1LA 1EZSC 3STJA 3NK8A 1EAWA 2D8WA 1O2IA 4ZH8A 4CBOA 1K1PA 1H9LB 4Y7BA 2NU4E 3A8AA 4K1SA 4U32A 1AUJA 2A5IA 4ABIA 1CHGA 2W5EA 5FPSA 1RJXB 1AKSB 3VGCB 1GI8B 1JRSA 3ELAH 3O8DA 3FP7E 4I32A 5CMXH 1G32B 1BJVA 2FX4A 3PLPA 4ABDA 2WYGA 1SQTA 1C4V2 4Y10E 5DP9A 4GHTA 1TONA 4Y76A 2ZZUH 4IW4E 1NO9H 1DS2E 3LU9B 2ODPA 4Z6AH 2R0LA 1LDTT 1VGCC 1B0EA 1QJ7B 3SO3A 1AMHA 2J92A 4Y8ZA 2ZFSA 3PLBA 1TGSZ 1BHXB 1OSSA 2H9TH 4ZKSU 1LQEA 3PYHA 1UVTH 1TNLA 1UTQA 1O3HA 1BRAA 1UTKA 1BRUP 1ANBA 3MNBA 3MTYA 5T6DA 1O33A 1C5NH 3PB1E 1GHVH 2H6MA 4X1QU 1TLDA 4FUGA 1BHXF 6ESTA 1O5DH 4MPUA 1NRQH 2GT7A 5E0HA 3TGJE 2QCYA 3AAUA 4HTCH 4E7RG 3M37A 2ZGCA 1SGDE 3EE0B 2Z3EA 1N6YA 2PTCE 2D1JA 2CN0H 3ZZDA 1XUIA 2OBOA 2FM2A 1QY6A 5K7RA 2HNTE 2GCHG 2I6QA 2BMGB 3GDSA 4YOIA 1D3PB 3PWBA 4NG9H 2BD9A 1NZQH 2VWOA 2A1DB 3E90B 4Q7YA 3RMNH 2BLWA 1GMHF 4ZKNU 1UHBB 1ZOMA 1O3AA 4AGKA 3ZZ9A 3DD2H 1EAXA 5HM2A 1XUGA 4K5ZA 2STAE 3V7TA 1CO7E 3M7QA 1FY3A 1M9UA 3TJVA 1BMNH 1UTNA 1V2UT 1BBRH 1WV7H 3BTDE 4UFGH 1W11U 3NCLA 1GJ4H 4UONA 2O9QA 2AGEX 3A7WA 4CRGA 1S85A 1O2OA 3ATIA 2A31A 4JZ1A 4ASHA 3RXPA 2ZFTA 1YLDA 1VJAU 2PHBA 4J2YB 1OYTH 1CE5A 3A8CA 1YLCA 2BOKA 4NFEA 4JZDH 2C8WB 2OTVA 2ZPSA 3ZZAA 1UTMA 1DWBH 1G30B 1VITF 1TA2A 3K65B 5EQRA 2BY6X 1P09A 2CHAC 4NIYA 4WXIA 1O3BA 4ISHH 4FU9A 3MHWU 1NFXA 4YOJA 1HAVA 1BTZA 1T8LA 3O8CA 1O2GH 1J17T 1MTNC 1E34B 2FTLE 1EOLA 1SHYA 3RUOA 4ISLA 2AIQA 3ZZ8A 1OYQA 4IMZA 3SUGA 1UCYH 1UK3A 1RTFB 1BRCE 5C2ZA 3V13A 3VFEA 1SB1H 1K1OA 2BY5X 1YBWA 2ZG0H 3UR6A 1ELAA 4NZQA 1HFDA 2B9LA 5C1YA 2PSYA 1S6HA 1L1JA 1GDQA 3TVJB 4ZROA 4ZHMU 1MTSA 1KY9A 2ANKH 4WMFA 1O2VA 5JBAS 1CT4E 4ZKOU 3RU4T 1QBOA 2W7UA 3RMOH 1IQMA 3PO1C 5DO4H 3AASA 1GJ6A 1Y3VA 4CRDA 2VIDA 3SNDA 1C1MA 2TGAA 1OWKA 3GY3A 4X1RU 2SGDE 1EATA 1MKXH 1V2OT 1SI5H 1DUEA 1EUFA 1EXFA 5L6NH 1O2TA 4LK4A 2GVFA 5DP4A 3M3SA 1GJ8B 1JBUH 2ZP0H 4DGJA 1YPEH 4J1YA 3VB4A 1GHXH 1VITH 3URDA 2ZDMA 5HGGA 1CBWB 2J95A 4BAQB 4ZUHA 2OXSA 5LPEA 3BV9B 1ABJH 2BX4A 4I8JA 2QYIA 1C5YB 1EQ9A 1KXFA 1C4Y2 1DFPA 1A46H 3M7UA 1HYLA 1QFKH 4CH8B 4MNVA 3ZZ3A 1EJNA 1QL9A 4YT7H 4FU8A 1ARCA 4AFUA 3QGNB 1LKAA 5HM9A 1GHAF 2GZ8A 1YCPM 5FBEA 1GGDB 1D3TB 4K8YA 2VIWA 1GI5A 4GPGA 4OGXA 2ODYB 1P11E 3MH7A 1LHCH 2OCVB 4K60A 4MNXA 4ABFA 2FOFA 2G81E 4R0IA 4TWYA 1HIAA 1YF4A 1S0RA 5FXLA 2SNWA 1H8DH 4Q80A 2G5VA 1C5WB 4X1PU 4NA9H 1SLUB 1C2GA 5JDUB 5HXFA 1P2QA 2R2WU 1MBMA 4B2BA 4KKDA 1FONA 5L2YH 1TQ0B 4LZ1H 4RKOB 1H9HE 1JWTA 1SOTA 3LJOA 2ZFRH 1O2MA 4FUIA 3SU1A 3RXGA 1O2LA 1WTHD 5EQQA 1MTVA 1TFXA 5J4SA 2G00A 5A8YA 1DSUA 2OC1A 5FPYA 1MQ5A 3RMLH 3FANA 3M5LA 3RXMA 4KGAA 3LGWA 2FLRH 1P04A 1C5MD 3BN9A 3DFJA 3VB6A 4JYVH 2UUKB 4K8BA 4UDWH 4GAWA 2A7JA 3SW2B 1GGDC 2P59A 2HPQH 1ZMNA 1ANCA 1PJPA 1C1TA 1UJ1A 1FNIA 1X7AC 1QJ6B 4B76A 1XX9A 4BAHB 2YOLA 1Q2WA 2STBE 1MCTA 2ZWLH 5DP6A 4ISOA 1Z8JB 1WU1A 2VB0A 3A85A 1OX1A 4FUCA 3TK6A 1HJAB 1AHTH 1ELEE 1O39A 2PV9B 2CGAA 1AB9C 1Y5AT 4IS5A 2V0BA 3M5NA 2ZU5A 1C2JA 2TGPZ 4ABAA 1AVXA 2A2QH 4IC5A 4HGCA 3BEFB 1HAHH 6LPRA 1W12U 5EW2H 4A7IB 3VXFH 2ZHFH 3GCTF 3KGPA 3D62A 1K21H 3U8RH 1C1VH 3SJKA 4H6SB 2AIPA 1FN8A 1GL0E 3SZNA 2ZHEH 5A8XA 2ZHQH 1P2OA 2XC4A 2DE9A 2FYRA 3LOXA 4DURA 1KDQB 3LGTA 3MU5A 1J8AA 1THSH 1IQFA 2QXIA 1OKXA 1WOFA 1TRMA 1P12E 3LJJA 2WPLS 1ZRBA 2UUFB 2SNVA 3OSYA 1C1PA 1O3GA 1P2NA 1S83A 4GSOA 1TBZH 1SFIA 1EZQA 1O3DA 3LONA 1DWDH 2BDGA 1IHTH 4Y8XA 3B23B 1F0SA 1MZDA 2B7DH 1CA8B 1HJAC 4Y11E 1ELCA 1TQ7B 1TPAE 1V2LT 2WINI 3QK1A 4HFPB 1ZR0A 3SNAA 1GCTC 1C5RA 4OS7A 2F3CE 3C27B 1CGHA 1GI7B 4JZFH 1LPKB 3MMGA 3LGUA 2BM2A 1NESE 4ABBA 1B7XB 1FQ3A 3QTVH 2Q6FA 2LPRA 1UTJA 5AVDA 1C2EA 4Y8YA 2Z9IA 1UK4A 1O2RA 3M5OA 3W94A 1O2XA 3ZZ7A 2ZU1A 4H4FA 2BLVA 1H8IH 1QJ1B 4ZHLU 3MO9A 2BQ7B 4O3TA 1ELTA 1A5IA 1TNHA 4JZEH 9ESTA 3TITA 4YOGA 1EX3A 1T8MA 3P8OA 1VJ9U 1TAWA 1LVBA 2ESTE 1EPTA 2ANYA 3SNBA 2W26A 1C2FA 1WQSA 1QBNA 1MU6B 3P70B 4B71A 1SL3A 2NU1E 1EZXC 4I7YH 1F0UA 2KAIB 2QY0B 3A87A 1IQNA 1IQEA 1QCPA 3NXPA 1ZHRA 4X8TH 3SU3A 2ZO3H 1O31A 3MNCA 2F83A 1WQVH 4JK5A 3SNEA 5L2ZH 3IITA 1GJAB 2XXLA 2FMJA 1SLVB 5F8XA 1PPHE 2FP7B 4NFFA 4F49A 1LCYA 5GCHF 1BJUA 2QA9E 1O37A 1O32A 1LHDH 1GBIA 4A1XA 1RIWC 5FPTA 1MKWH 4KELA 4NGAH 2P3TB 3T29A 2AMQA 2Q6GA 4ESTE 1TPOA 1O38A 1O3PB 4DIHH 3EA8A 4YESB 1FPCH 1GCDA 2W3IA 1GI3A 5A0CA 3BTME 1TWXB 3IG6B 1GPZA 3BEUA 3F68H 1BA8B 3H5CB 1RGQA 4ABGA 3GCHC 5T6GA 1S84A 1K1IA 1Y3YA 2NWNA 3TH3H 1ZPZA 2Y5HA 4Q2KA 1O2JA 1O5BB 1A0JA 1SC8U 1VZQH 4DG4A 2GT8A 2TIOA 1C9TA 3R3GB 1AFQB 1A5HA 2ZTXA 4YM9A 4A6LA 1WUNH 1V2RT 2HGTH 1OS8A 3SGAE 5EOKA 1T8NA 2AYWA 1TB6H 5EGMA 4BTTB 3L3TA 2VVVA 3SJ9A 2UWPA 1K1NA 1NY22 4FUBA 5DPAA 2G52A 2C8XB 4WF8A 1O3OA 2J38A 2AMPA 1GI0A 3Q76A 8GCHF 1MU8B 4ABEA 4DCDA 2SFAA 1WTGH 4AG1A 1C5XB 2BXUH 4DOQA 2RDLA 2YNAA 2GDEH 3TPIZ 4NIVA 3UIRA 2A7CA 3M35A 1XXDA 3CENA 2FZZA 4A92A 1BMLA 2JKHA 1CSOE 1ORFA 4JMYA 4VGCB 1HV7A 3KQCA 2PGQB 1IAUA 4D9RA 3FFGA 4ZXXH 2FO9A 3TLOA 2WUBA 3M36A 2ZFFH 1BZXE 2VWLA 2EI6A 2ALPA 3P6ZB 1KLIH 1FAXA 4KTSA 1TMUH 2QXGA 1B0FA 4YZUA 1THPB 1ELGA 4XBBA 1CGJE 4CR5A 3A8BA 1HGTH 5TCCA 1O2HA 1BCUH 2VVUA 3MU4A 4CRFA 2BLQA 1VGCB 3RXDA 1KXCA 1SOZA 1RRKA 1A5GH 1EB1H 2XNIA 5EG4A 1DT2A 2QF0A 1LHEH 3TK5A 3UOUA 1YPHE 1O5EH 3M61U 1TIOA 1FLEE 3KL6A 4IN1A 3RXHA 3ZZ6A 3GICB 2G4UA 2TGTA 1D3QB 3QGJA 1LQDB 2R2MB 2FDAA 1YCPK 4VGCC 4ZAEA 2AGGX 3AVZA 5GDSH 3ATMA 1SGIB 3NZIA 4B2CA 2PKAB 1QL8A 2K1QA 1RFNA 3T26A 1VR1H 1K22H 4BAOB 1E36B 1BQYA 3HKIB 2SGEE 4MDSA 1Y8TA 4D9QA 2P93A 4FUHA 1YPJH 2WPJS 2FOMB 2BY8X 4FUEA 4X2WA 3RXVA 3PTBA 4JYTA 2R3YA 4WXVA 1GJ5H 4MLFB 2NU0E 3W95A 2ZA5A 1HAOH 1ZTJA 2OINA 8ESTE 2XRCA 2ZQ2A 4JCNA 2HALA 1W2KH 5GPIB 1XUJA 4FUFA 4THNH 5HYOA 1Z1JA 3WY8A 2VH0A 5HMAA 3BTFE 4BAMB 1GBKA 4MNWA 1FV9A 2FYQA 1H4WA 3MFJA 3RXRA 1GVZA 1O5AB 1O3FA 1V2JT 7ESTE 4MQAA 1HAVB 2P16A 1AWFH 1GDUA 1SBWA 4AN7A 2ZGBH 1V2NT 3ZV9A 4INHA 4CH2B 2OC7A 3QO6A 1P3EA 5C5OA 1PPBH 3A88A 1UTOA 3GOVB 1NFUA 3PLKA 3TH4H 5EPYA 2CHAB 4Y0ZE 1YPMH 3NWUA 4WJG2 4ABJA 3ZVDA 3QTOH 1MTNB 4B73A 2H5DA 1FDPA 5DGJA 1A3BH 1FJSA 1IHSH 1O2YA 3SV7A 2BHGA 2ZCLP 2VWNA 2P8OB 1DLEA 1FAKH 3RXEA 3ATLA 3SUFA 2RA0A 3URCA 2FTMA 3SJIA 1W13U 1EOJA 2AFQB 1GBEA 1H9IE 1F0TA 1EJMA 3UPEA 1AKSA 1ESTA 3SU2A 1QTFA 2BDBA 1DPOA 5FAHA 2O8MA 4MPWA 5FBIA 4A1TA 1DWCH 4D7GA 2GTBA 1KYNA 1ETSH 3FP6E 4NZLA 1QL7A 2UUJB 3PO1B 5K0HA 1SGRE 4UFFH 5DP5A 1DUAA 2J4IA 1P05A 1QNJA 1SR5C 3RXCA 1SQOA 1YYY1 2SGAA 2ZEBA 1GL1A 5AHGH 2BX3A 1LPZB 2ULLA 2W3KA 1GI1A 2IOTA 2OC0A 1F92A 2Z9GA 1CU1A 1SHHB 2P8OC 4R8TB 2HVXA 1Y59T 4XSKU 1HAGE 2AMDA 1NTPA 3A7ZA 2BB4A 1O30A 3ZYEA 4XOJA 5FCRA 2PGBB 4O97A 3RXUA 2A5AA 4WWYA 1GI9B 1P3CA 3V12A 4NSVA 3P8FA 3RXTA 1GMDF 1TYNA 2XBWA 1FPHH 1HXFH 3LC5A 1P2MA 3S0NA 4SGBE 3BG4B 3EQ0H 1BTXA 2O8WA 1D9IA 1V2KT 1GJCB
chains in the Genus database with same CATH superfamily
1BBRK 2BD7A 4WMEA 1WAYB 4AOQA 1AE5A 2WPHS 3KEEA 3E6PH 1G37A 2J9NA 1UHBA 1O2QA 1YC0A 2P95A 3P92A 3PM3A 4NA8A 2G4TA 1QA0A 2ZDLA 3MWIU 1F5RA 1TX8A 2SGFE 1HUTH 1UVPA 2ZF0H 2XBYA 1G36A 1UMAH 4A5TS 1O3IA 2Z9LA 1P9UA 4GCHG 4TY7A 5DJ7A 5FX5A 1P2KA 2UWOA 1O2WA 1W0KD 1C1UH 5DSFA 1FY5A 4CRAA 2F9BH 3M7TA 3P17H 1LVOA 1O2PA 1ABIH 3OTJE 1P02A 1G2LA 1EASA 1C1NA 3SJOA 4OS2A 1GHBG 1A61H 1DANH 1ELFA 3ODDA 3ZVCA 1K9OE 3N7EA 2BD3A 3BG4C 1YP9A 1GJ7B 2ASUB 1UCYK 4XFQA 3D65E 1EFRD 2BD5A 1SLXB 4WY3A 4BOHA 1B5GH 1MTWA 1OPHB 3RC6A 3OU0A 1E38B 1RS0A 5FCKA 2K8IA 1HAZB 1O3EA 1GMCG 1UK2A 3U1IB 1O2KA 3SI4H 1GI4A 5C67A 1NRPH 1AB9B 3U98H 5CHAB 3VEQB 4ISNA 1KTTB 1Z8IB 1FIWA 1JXPA 1E1RD 1J15A 3U1JB 1T31A 2CJIA 3OE7D 1PQ5A 5DP8A 2F9PA 9LPRA 3RXQA 4BNRA 1O36A 1LKBA 4YT6H 3E3TA 1MKXK 2WPKS 1PFXC 2GCHF 4WH6A 2ILNA 1TX6A 2ZGHA 1O3MA 3EYDA 2DUCA 4U30A 4HZHA 2KM0A 3HPTB 1C2MA 3N99A 3SHCH 2PWXA 2OLGA 4TT3D 3E1XB 1AWHB 2BYAX 2XWBI 4TPIZ 2GX4A 2ZTZA 2RDEA 4UFDH 5A0AE 4JK6A 5AFYH 1MH0A 1HLTH 1MTUA 3KN2A 1Z6EA 2IN2A 2O8UA 4I8GA 3Q3XA 1YPKH 4U2WA 3S9CA 1OWEA 1CVWH 3QZRA 4OM9A 4B75A 2ZDAH 3RXJA 2FWWA 3M3VA 1L1NA 1L4ZA 5ETXA 4CHAC 3SU5A 3I77A 1Y3UA 1KSNA 1HAIH 2RA3A 5CHAC 1JIRA 1GCTB 3HATH 4Y6DA 4XBDA 2NU3E 1CHOG 1RD3B 1C5PA 1GWAA 1RTLA 1BTWA 4DVAU 4I31A 5HIYA 3UQOA 1S5SA 3UY9A 1ZMJA 1V2WT 1C1SA 1FXYA 1O3JA 4PROA 1PPZA 2HNTC 3SI3H 1W7GH 2EQNA 4E05H 1E35B 2V3OH 2C4FH 1QBVH 2WV5A 3ZVEA 3SV8A 1QR3E 2VNTA 1O2NA 2ZFPH 2Z3DA 1QRZA 2UUYA 4X2YA 4AYVB 1NRSH 2CK3D 1TPPA 3TGIE 1EAUA 4ZHAA 4AORA 4B1TA 2RFKC 4M7GA 2KR7A 1GHWH 3KIDU 4FVDA 3QDZB 1AGJA 1YM0A 4XDEA 3FZDA 1W0JD 1P01A 3SQEE 1OWIA 2QN5T 1MMJN 4F4OC 1ZTKA 2BVXH 3U9AH 1ZPCA 5IK2D 3A82A 2A7HA 1COWD 1EPTC 2QF5A 2W6ID 1DSTA 3LGVA 2OQUA 2A4QA 4RKJB 5ESTE 1V2QT 3BTGE 3F1SB 3MU0A 3UOPA 2H1UA 1ZLRA 2WYJA 4MG3A 1Y5UT 5EXMA 2F9VA 1GI6A 3O8RA 1RIWB 1FUJA 1QURH 2BOHB 1C9PA 2AH4X 4DY7B 5F03A 2C90B 6CHAC 1EAIA 4X2VA 2GDDA 1SLWB 4NA7A 2V6NA 3E8LA 1FY4A 2BVSH 4CRBA 2PUXB 4I86A 1FIZA 3PRDA 2BDCA 5IYTA 3GCHB 1C4U2 2OC8A 1FI8A 2BD8A 3A84A 4NWKA 4SGAE 2FOEA 4X0WU 5JBTA 1MQ6A 1O5FH 2WPMS 1IQKA 2ZNKH 1T8OA 4DW2U 1EP5A 1EB2A 3RLWH 1C1WH 4X1SU 5I25A 1AE8H 2VIVA 1TPSA 5FL7D 3I29A 1TMBH 1F2SE 1ZPBA 2Y5FA 2BLOA 3V3MA 4FVBA 1S6FA 2FPZA 1C1QA 4K69A 4BTIB 1DOJA 1W8BH 3PTNA 1TRYA 4FUJA 2VIQA 3RXBA 1O3KA 3P8GA 5EODA 1KDQA 2GZ7A 2CXVA 3T5FH 3B9FH 1CA0B 3NPSA 1V2PT 3UFAA 2AGIX 7GCHG 4O9VA 2BXTH 4NCYA 4ACBA 1TE0A 2GJGA 2VVCA 2ODQA 3ZZCA 1OWJA 1MAXA 2PFEA 2QF4A 1TMTH 1AUTC 2BQ6B 4Y7AA 3L33A 2TPIZ 3QWCH 1CGIE 1ID5H 2PTNA 2Y7XA 1AZ8A 2CF8H 4INLA 4TWWA 4X1NU 1TOMH 2XTTB 3DCLA 3MH6A 2KZ4A 1BB0B 4FXGH 2C3SA 2A4GA 1A7SA 1Q3XA 2Z9KA 3GCNA 4BXSA 3BIVH 3FP8E 1O0DH 3PV2A 2CV3A 4B6FA 3F9EA 1ELVA 5PTPA 2ZC9H 3RLYH 3STIA 1INCA 4UEHH 2VIOA 1AQ7A 2B5TB 3NRLA 3Q00A 1OP8A 3MI4A 5JBBS 1OWDA 3U28C 2FOHA 3QUMP 1BTHH 3KCGH 2ZFQH 3K6ZA 2AERH 1GMHG 1SSXA 2QGRA 5A0BA 4X6MA 1WXRA 1HDTH 3UNSA 2PP6A 2Z94A 3GISB 1CA0C 2JH0D 4BXWA 1BRBE 2XBVA 4GLYA 7KMEH 5IDKA 4P02A 1QRXA 3UNRA 2UWLA 3SU0A 1IQGA 3VB7A 1V2MT 5B6OA 1ZGVA 2KCOA 2H9HA 1GBAA 3BF6H 5AFZH 1HPGA 1F7ZA 2PUQH 2W7SA 1V6DA 2FOGA 1H1BA 4Q7XA 2QV1A 3KQEA 2V3MA 2QIQA 4AZ2B 1C2LA 1MKWK 1C2HA 2FS9A 4AFQA 2FI4E 2WSSD 5KEDA 2VJ1A 2Y7ZA 2A32A 3F0OA 2B8OH 1HJ9A 4IN2A 5C1UA 1A0HB 1W14U 1P57B 5F8TA 5C20A 1NC6A 2VGCC 3PWCA 3EE7A 1Z71A 1OP0A 5JB8S 1UO6A 2FXRA 4RT0A 2BY7X 2ZCKP 1ANDA 1KLJH 4F55A 2FIRH 1Y3XA 1AZZA 3SN8A 2Z9JA 3ZVFA 1F0RA 3FO8D 1JMOH 4KTCA 1EKBB 2PW8H 2XCFA 3PV4A 2BDYA 3BEIB 3T27A 4Q7ZA 5GJ4B 1AVWA 3UWJH 3DSOA 2EA3A 4KP0A 2GGVB 1SG8B 2OD3B 4DJZB 3FKSD 4DT4A 2ZGXH 5FHTA 2HRVA 3RXFA 2YMSC 3LC3A 1QB1A 1ZMLA 1BMAA 3MNSA 1J14A 5C94A 1GJBB 1ELDE 1QGFA 1W0YH 1QRWA 3O8BA 1ZSJA 1VCQA 4CBNA 4CR9A 4FUDA 3FZZA 1XUKA 1C5VA 3DT0H 1IQLA 1XVOA 2RCEA 3FVFB 4CREA 1TNJA 3RP2A 1ARBA 1QA7A 2SGQE 3SOSA 1OOKB 1L0ZA 5FX6A 3NUMA 5TJXA 3SGQE 2AEIH 1HRTH 4XD7D 4IC6A 5KECA 1SVPA 2J5UA 3PRBA 5I46H 3CNRA 1Z6JH 5B6LA 3TJOA 3HK3B 1L2EA 1NFWA 3E0NB 1MUEB 3SQHE 1WSSH 1XMNB 5C1XA 3UWIA 3ZYDA 1XUFA 2VINA 3JZ1B 5GIBA 2DE8A 5F8ZA 2QC2A 1K1MA 2ANMH 1PYTD 3LKWA 2ALVA 1SGFA 2Y82A 4MVNA 5E0JA 1AD8H 1O2SA 1F5LA 3TNSA 2OK5A 2FS8A 3TU7H 1XVMA 1ZSKA 4YLQH 2Y80A 3UR9A 2ZGJA 1ZRKA 1AI8H 2H5CA 4X6NA 5EPNA 1ETRH 3RXLA 4DT7B 2GD4B 3PV5A 3PROA 3K2UA 4FU7A 4OS1A 3T28A 1Z7KA 2ZI2H 4I8HA 2XOKD 1GHAG 1KTSB 3A7XA 1C2IA 2WUCA 1P9SA 1PYTC 1AO5A 2BQWB 4UE7H 5LPRA 1A2CH 5JPMH 3GY5A 1LPGB 1O5CB 3BTEE 1ELBA 5L30H 1DY9A 7GCHF 3D49H 3RXIA 1MAYA 1FN6A 3TJUA 1GJ9B 1LHGH 3LDXH 3RXKA 1D6RA 2FOCA 3ENSB 1OP2A 1SGTA 3EA9A 5JB9S 1QQUA 3WWBA 4AFZA 1DITH 2FI5E 3HKJB 2SGPE 2Z3CA 1AIXH 3EA7A 4B6EA 1O5GH 1O3LA 1ZHPA 3VGCC 1G2MA 2WPIS 2ZIQH 1HBTH 3H7TA 1GJDB 2GP9B 3AW0A 3LT3A 2G51A 2L6OA 1CQQA 1LMWB 4X8SH 1JIMA 2R0KA 4K1EA 1ZTLA 3EGKH 3KYFA 3RXAA 1D6WA 1G3CA 1FZZA 1YLNA 2PKAA 3BTQE 3I78A 3ATWA 3GDVA 3QN7A 3H09A 3RMMH 4Y71A 2GMTB 1XXFA 1GG6B 3TK9A 1AFEH 1WBGB 3BTHE 8LPRA 2A2XH 2A4OA 1BIOA 1QB6A 4DIIH 1ESBA 1NT1A 3HGNA 1GDNA 1YPGH 1GBLA 1C2KA 1XM1A 3F6UH 4I8LA 1MZAA 3TNTA 3FOAA 4TY6A 1C2DA 1P2JA 3S9AA 3A8DA 2A45B 2EC9H 2HOBA 4U01A 5CE1A 3V0XA 4A1VA 3FAOA 1UTPA 3JZ2B 2HLDD 2F9UA 2VIPA 3GCTG 4P00A 3A83A 1A3EH 3LGYA 5LPFA 3DUXH 3KHVA 1BDAA 3KNXA 4OGYA 3VXEH 1C5TA 2HWLB 1BMMH 4ABHA 1T4UH 1TA6A 3U8OH 1ZJDA 3LPRA 3BG8A 1E37B 1C1RA 2FLBH 2EI8A 1T7CA 2BY9X 2JH6D 4TYDA 1V3XA 3ZVAA 2QXJA 1SPJA 3MOCA 1HIAB 3OYPA 4I8KA 1JRTA 4CRCA 2GMTC 3OY5U 3PMAB 4K1TA 1GG6C 1NRNH 3MO6A 5JYIA 1DLKB 2Y81A 5HIZA 1CT2E 2C93B 2L74A 2A5KA 6GCHG 1TGTA 5EQSA 1EP6A 1KXBA 4I33A 5E2PA 3SJ8A 1GBTA 4AGJA 2ZHDA 4WH8A 5C3NA 3UTUH 3P95A 1QIXB 3RXOA 1S0QA 3PMBB 4X8UH 1TALA 1W10U 3ESTA 3UQVA 5EU8A 2PR3A 1W7XH 1LVMA 4RT1A 3R0FA 1YWUA 3MO3A 1TNKA 3GYLB 2LP6A 4ISIH 3RU4E 3MU8A 5LGOA 1GHYH 4QT8C 2BDIA 2GCTB 2KX4A 3C1KA 3UNQA 1GBJA 4MNYA 4E06H 1IQHA 4IMQA 3GY8A 4AX9H 1O2UA 4JZIA 1NROH 4MTBA 1LVYA 2F9OA 2TBSA 2P3FH 4B2AA 3PMJA 2PLXA 5H4IB 1W0ZU 3KQBA 4Y79A 4XRNA 1PPCE 3SHAH 1K28D 1SGYE 2J34A 1CT0E 2J94A 4BANB 4ZKRU 1A0LA 1G3EA 2GV7A 4LXBH 5CHBA 5C5NA 1YPHC 1HCGA 3S9BA 4Y0YE 2A0QB 3ZV8A 1HAPH 2BZ6H 1C5OH 1WYKA 1S82A 1FY1A 2ZU2A 3F9GA 1TGCA 1XKBC 1Z8GA 2TRMA 1ZGIA 1TOCB 5EXNA 4ZMAH 1T4VH 1Y3WA 2GV6A 3BTWE 3TH2H 2XC5A 3HGPA 4CHAB 4YLUA 5E0GA 2VU8E 3OX7U 2HLCA 3ATKA 4GHQA 3BTTE 1NU9A 3F9FA 4X8VH 5GCHG 2BD2A 2BVRH 1HXEH 2GCTC 2ZPRA 1IQIA 3BIUH 3LGIA 4XBCA 3SGBE 2ZPQA 3SV6A 1A4WH 5EW1H 2BD4A 2GZ9A 1C1OA 1ESAA 3A89A 3OY6U 2QAAA 5EJZA 5A09A 1Y5BT 1KIGH 3KYGA 2WV9A 4GUXA 2WZQA 1MD8A 3QZQA 3SUEA 3UUZA 1SGPE 1CBWC 4OS4A 2O8LA 3B8JA 3N7OA 1GI2A 5T6FA 2XWAA 1P8VC 1BT7A 2HPPH 2XYAA 3RDZA 1MD7A 3Q3KA 2R9PA 1T32A 1JOUB 3SV2H 3G01A 2BTCE 3RXSA 2ZKSA 3D23A 2HVYB 2HNTF 2Q1JA 1TBQH 3S7KB 2FESH 3TJNA 1F5KU 2G8TA 3U69H 2H9EH 1NU7B 1C5SA 1MBQA 1Z1IA 1P06A 4IBLH 1UVUH 2ANWA 3IWMA 4NWLA 3DA9B 1PQ8A 1P10A 3GY4A 5BRRE 1HNEE 1N8OB 4RN6A 1KXAA 4OS6A 3SUDA 1D4PB 1AU8A 3SYJA 1EPTB 2C8ZB 2XC0A 3ODFA 1ZYOA 2Y5GA 3EDXB 5EIYA 1ETTH 3L6PA 4XE4A 1G9IE 4UFEH 1L4DA 1PQ7A 5DP7A 8GCHG 2QXHA 5DP3A 1DWEH 1KMHB 3MYWA 2VH6A 1AN1E 4YO9A 3F2HA 3T2NA 1BTPA 2QF3A 1HB0B 2FEQH 3SBKA 1WDIA 6CHAB 2CF9H 1TBRH 2THFB 4AB9A 1TNIA 3GY7A 3UB0A 2NU2E 3RC4A 2PSXA 3SU6A 5AF9H 3VB5A 5G4BA 1GVKB 1SGFG 2RG3A 4AB8A 2IJD1 3ZIAD 3DSGA 2CMYA 1QQ4A 1GBFA 2ZDNA 1GBCA 2Y6TA 5DG6A 3DHKH 2ZU4A 5KGOA 4LOYH 1WCZA 3EAJA 1V2TT 3RC5A 3ZZBA 1LTOA 3CS7A 3M3TA 4UD9H 1N8OC 4OS5A 1ZHMA 2ZU3A 3ITIA 6GCHF 1D3DB 1VCPA 4BTUB 2LNCA 1GBMA 3VB3A 1YPLH 1FY8E 2V3HH 3BTKE 1EZUC 2EI7A 3A7YA 4AYYB 7LPRA 1EJAA 4Z0KA 1PPEE 2ZQ1A 3E91A 1W3CA 3ZZ5A 4E7NA 4KTUA 3AAVA 1BITA 3CP7A 1K2I1 4YTAA 3W1EA 3UREA 1XKAC 4AG2A 3CS0A 1J16A 2PKSB 1HAYB 3OFND 2K0QA 2BZAA 2FOAA 2O8TA 1E0FD 1P03A 1NN6A 1PPFE 2A4RA 4RSPA 3E16B 4GCHF 2BDAA 1U6QA 2VWMA 1GHZA 3A7TA 1ZJKA 2ZTYA 1FMGA 4B74A 1IQJA 1K1LA 3ZVBA 1NBME 1PPGE 1BBRE 3T62A 1OXGA 1C5ZB 3SU4A 1LHFH 5EXLA 1GHBF 5GWZA 3RU4D 1DX5M 1BTUA 1SMFE 3MNXA 1NM6A 1O3CA 1RTKA 1O35A 1UVOA 1A1RA 1SGCA 2FX6A 3BSQA 1SGNE 1Z8RA 2XW9A 1BOQA 1Q31A 4WMDA 2TGDA 3K6YA 3TGKE 1THRH 1C5LH 1TGNA 3PMHB 3KQDA 1ACBE 1O3NA 3F0PA 1YGCH 3ZVGA 3M5MA 1TRNA 4HI3A 5A8ZA 4D76A 1GBDA 5ABWA 2JH5D 1O34A 1GMCF 1SQAA 2F9NA 3RM2H 1DY8A 1KLTA 4JYUH 1DXWA 3S7HB 2PKSC 1N6XA 2D2DA 2ZDVH 1TNGA 1KXDA 1UVSH 2BDHA 2G55A 1P0SH 1NS3A 4TSFD 2H2ZA 3F9HA 5J4QA 2AS9A 2GKVE 3NKKA 3K9XB 5EJLA 1UCYE 4GVUA 2F91A 3MH5A 3H7OA 5T3HA 2P94A 1G3BA 3LH1A 1VCWA 2ZDKA 2D26C 2R3UA 1NRRH 5ESBA 3MH4A 4MPVA 3VPKA 2VGCB 3GYMA 1PQAA 3KF2A 1TX7A 1GBBA 1GVLA 5F6MA 1O2ZA 4ZXYH 2Q6DA 1AVGH 2B0FA 5DKMA 1ANEA 3SNCA 1DXPA 1J9CH 4O03A 3WWFA 8KME2 1TGBA 4ZCNA 1ZZZA 4K3JA 1NPMA 2KFWA 4H42U 3SORA 5A2MH 2FI3E 1IOEA 1C5UA 1KXEA 3P8NA 1P2IA 3A86A 4WVPE 3AW1A 1S81A 3HK6B 5GNDA 4AFSA 5C17A 1C5QA 4X6PA 5CDFE 5TCAA 5DK1A 2YMSB 3RM0H 2G5NA 2JETB 3S69A 1DM4B 1HAXB 2KAIA 1DVAH 4MPXA 1CHOF 1UTLM 2ZCHP 3A7VA 1V2VT 1SGQE 1YCPH 2OP9A 3A80A 1LO6A 4O3UA 3GCOA 2J2UA 1BUIA 1OWHA 3LH3A 3UAIC 1NFYA 2C8YB 2OQ5A 3Q77A 2Z6BD 1K1JA 2OUAA 5LH8A 1V2ST 5GXPA 2YNBA 1XUHA 1QHRB 1L1GA 2Z7FE 4LZ4B 1DDJA 4IGDA 2M5TA 3Q3YA 4F48B 1VITG 2ZHWH 3F3BA 4TPYA 3E0PB 1G3DA 3SZEA 1GBHA 4INKA 1SKYE 2I6SA 3SV9A 1DICA 3LIWA 4D8NA 2WV4A 3GDUA 1MCVA 2FOBA 1RXPA 4NSYA 1QB9A 2EEKA 1AFQC 3ZZ4A 3T25A 4NIWA 2V35A 4BAKB 5JBCS 4H6TA 3MU1A 1DE7H 4NIXA 5E8EH 1SGEE 4K2YA 5E2OA 5BPEA 1HJ8A 4X6OA 1TABE 1YKTA 2JETC 2XCNA 1BTYA 3U8TH 1GMDG 2OBQA 1SFQB 2XBXA 2ZECA 4Q63A 2P3UB 2IPHA 3GY6A 1ZSLA 2IJOB 3A81A 3QLPH 5SGAE 4X2XA 1AY6H 3TIUA 3GY2A 3QX5H 4D7FA 3DFLA 1FX0B 2FODA 4FOUC 4FETA 1N1LA 1EZSC 2WPDD 3STJA 3NK8A 1EAWA 2D8WA 1O2IA 4ZH8A 4CBOA 1K1PA 1H9LB 4Y7BA 2NU4E 3A8AA 4K1SA 4U32A 3KQ5A 1AUJA 2A5IA 4ABIA 5DN6D 2J98B 1CHGA 2W5EA 5FPSA 1RJXB 1AKSB 3VGCB 1GI8B 1JRSA 3ELAH 3O8DA 3FP7E 4I32A 5CMXH 1G32B 1BJVA 2FX4A 3PLPA 4ABDA 2WYGA 1SQTA 1C4V2 4Y10E 5DP9A 4GHTA 1TONA 4Y76A 2ZZUH 4IW4E 1NO9H 2IPQX 1DS2E 3LU9B 2ODPA 4Z6AH 2R0LA 1LDTT 1VGCC 1B0EA 1QJ7B 3SO3A 1AMHA 2J92A 4Y8ZA 2ZFSA 3PLBA 1TGSZ 1BHXB 1OSSA 2H9TH 4ZKSU 1LQEA 1NBMD 3PYHA 1UVTH 1TNLA 1UTQA 1O3HA 1BRAA 1UTKA 1BRUP 1ANBA 3MNBA 3MTYA 5T6DA 1O33A 1C5NH 3PB1E 1GHVH 2H6MA 4X1QU 1TLDA 4FUGA 3AK5A 1BHXF 6ESTA 1O5DH 4MPUA 1NRQH 2GT7A 5E0HA 3TGJE 2W6JD 2QCYA 3AAUA 4HTCH 4E7RG 3N7DA 3M37A 2ZGCA 1SGDE 3EE0B 2Z3EA 5EJ1A 1N6YA 2PTCE 2D1JA 2CN0H 3ZZDA 1XUIA 2OBOA 2FM2A 1QY6A 5K7RA 2HNTE 2GCHG 2I6QA 2BMGB 3GDSA 4YOIA 1D3PB 2JJ1D 3PWBA 4NG9H 2BD9A 2VBCA 1NZQH 2VWOA 2A1DB 3E90B 4Q7YA 3RMNH 2BLWA 1GMHF 4ZKNU 1UHBB 1ZOMA 1O3AA 4AGKA 3ZZ9A 3DD2H 1EAXA 5HM2A 1XUGA 4K5ZA 2STAE 3V7TA 1CO7E 3M7QA 1FY3A 1M9UA 3TJVA 1BMNH 1UTNA 1V2UT 1BBRH 1WV7H 3BTDE 4UFGH 1W11U 3NCLA 4M9FA 1GJ4H 4UONA 2O9QA 2AGEX 3A7WA 4CRGA 1S85A 1O2OA 3ATIA 2A31A 4JZ1A 2J97A 4ASHA 3RXPA 2ZFTA 1YLDA 1VJAU 2PHBA 4J2YB 1OYTH 1CE5A 3A8CA 1YLCA 2BOKA 4NFEA 4JZDH 2C8WB 2OTVA 2ZPSA 3ZZAA 1UTMA 1DWBH 1G30B 1VITF 1TA2A 3K65B 5EQRA 2BY6X 1P09A 2CHAC 4NIYA 4WXIA 1O3BA 4ISHH 4FU9A 3MHWU 1NFXA 4YOJA 1HAVA 1BTZA 1T8LA 3O8CA 1O2GH 1J17T 1MTNC 1E34B 4RI0A 2FTLE 1EOLA 1SHYA 3RUOA 4ISLA 2AIQA 3ZZ8A 1OYQA 4IMZA 3SUGA 1UCYH 1UK3A 1RTFB 1BRCE 5C2ZA 3V13A 3VFEA 1SB1H 1K1OA 2JJ2D 2BY5X 1YBWA 2ZG0H 3UR6A 1ELAA 2LELA 4NZQA 1HFDA 2B9LA 2XNDD 5C1YA 2PSYA 1S6HA 1L1JA 1GDQA 3TVJB 4ZROA 4ZHMU 1MTSA 1KY9A 2ANKH 4WMFA 1O2VA 5JBAS 1CT4E 4ZKOU 3RU4T 1QBOA 2W7UA 3GS9A 3RMOH 1IQMA 3PO1C 5DO4H 3AASA 2WHXA 1GJ6A 1Y3VA 4CRDA 2VIDA 3SNDA 1C1MA 2TGAA 1OWKA 3GY3A 4X1RU 2SGDE 1EATA 1MKXH 1V2OT 1SI5H 1DUEA 1EUFA 1EXFA 5L6NH 1O2TA 4LK4A 2GVFA 5DP4A 3M3SA 1GJ8B 1JBUH 2ZP0H 4DGJA 1YPEH 4J1YA 4HG6A 3VB4A 1GHXH 1VITH 3URDA 2ZDMA 5HGGA 1CBWB 2J95A 3VG8A 4BAQB 4ZUHA 2OXSA 5LPEA 3BV9B 1ABJH 2BX4A 4I8JA 2QYIA 1C5YB 1EQ9A 1KXFA 1C4Y2 1DFPA 1A46H 3M7UA 1HYLA 1QFKH 4CH8B 4MNVA 3ZZ3A 1EJNA 1QL9A 4YT7H 2JIZD 4FU8A 1ARCA 4AFUA 3QGNB 1LKAA 2QE7D 5HM9A 1GHAF 3OEHD 2GZ8A 1YCPM 5FBEA 1GGDB 1D3TB 4K8YA 2VIWA 1GI5A 4GPGA 4OGXA 2ODYB 1P11E 3MH7A 1LHCH 2OCVB 4K60A 1UW7A 4MNXA 4ABFA 2FOFA 2G81E 4R0IA 4TWYA 1HIAA 1YF4A 1S0RA 5FXLA 2SNWA 1H8DH 4Q80A 2G5VA 1C5WB 4X1PU 1OHHD 4NA9H 1SLUB 1C2GA 2KCYA 5HXFA 5JDUB 1P2QA 2R2WU 1MBMA 4B2BA 2AHME 3DSPA 4KKDA 1FONA 5L2YH 1TQ0B 4LZ1H 4RKOB 1H9HE 1JWTA 1SOTA 3LJOA 2ZFRH 1O2MA 4FUIA 3SU1A 3RXGA 1O2LA 1WTHD 5EQQA 1MTVA 1TFXA 5J4SA 2G00A 5A8YA 1DSUA 2OC1A 2F4LA 5FPYA 1MQ5A 3RMLH 3FANA 3M5LA 3RXMA 4KGAA 3LGWA 2FLRH 1P04A 1C5MD 3BN9A 3DFJA 3VB6A 4JYVH 2UUKB 4K8BA 4UDWH 4GAWA 2A7JA 3SW2B 1GGDC 2P59A 2HPQH 1ZMNA 1ANCA 1PJPA 1C1TA 1UJ1A 1FNIA 1X7AC 1QJ6B 4B76A 1XX9A 4BAHB 2YOLA 1Q2WA 2STBE 1MCTA 2ZWLH 5DP6A 4ISOA 1Z8JB 1WU1A 2VB0A 1BMFD 3A85A 1OX1A 2F43B 4FUCA 3TK6A 1HJAB 1AHTH 1ELEE 1O39A 2PV9B 2CGAA 1AB9C 1Y5AT 4IS5A 2V0BA 3M5NA 2ZU5A 1C2JA 2TGPZ 1MABB 4ABAA 1AVXA 4AC9A 2A2QH 4IC5A 4HGCA 3BEFB 1HAHH 6LPRA 1W12U 5EW2H 4A7IB 3VXFH 2ZHFH 3GCTF 3KGPA 3D62A 1K21H 3U8RH 1C1VH 3SJKA 4H6SB 2AIPA 1FN8A 1GL0E 3SZNA 2ZHEH 5A8XA 2ZHQH 1P2OA 2XC4A 2DE9A 2FYRA 3LOXA 4DURA 1KDQB 3LGTA 3MU5A 1J8AA 1THSH 1IQFA 2QXIA 1OKXA 1WOFA 3MQKC 1TRMA 1P12E 3LJJA 2WPLS 1ZRBA 2UUFB 2SNVA 3OSYA 1C1PA 5HKKD 1O3GA 1P2NA 1S83A 4GSOA 1TBZH 1SFIA 1EZQA 1O3DA 3LONA 1DWDH 2BDGA 1IHTH 4Y8XA 3B23B 1F0SA 1MZDA 2B7DH 1CA8B 1HJAC 4Y11E 1ELCA 1TQ7B 1TPAE 1V2LT 2WINI 3QK1A 4HFPB 1ZR0A 3SNAA 1GCTC 1C5RA 4OS7A 2F3CE 3C27B 1CGHA 1GI7B 4JZFH 1LPKB 3MMGA 3LGUA 2BM2A 1NESE 4ABBA 1B7XB 1FQ3A 3QTVH 2Q6FA 2LPRA 1UTJA 5AVDA 1C2EA 4Y8YA 2Z9IA 1UK4A 1O2RA 3M5OA 3W94A 1O2XA 3ZZ7A 2ZU1A 4H4FA 2BLVA 1H8IH 1QJ1B 4ZHLU 3MO9A 2BQ7B 4O3TA 1ELTA 1A5IA 1TNHA 4JZEH 9ESTA 3TITA 4YOGA 1EX3A 1T8MA 3P8OA 1VJ9U 1TAWA 1LVBA 2ESTE 1EPTA 2ANYA 3SNBA 2W26A 1C2FA 1WQSA 1QBNA 1MU6B 1QZ8A 3P70B 4B71A 1SL3A 2NU1E 1EZXC 4I7YH 1F0UA 1H8ED 2KAIB 2QY0B 3A87A 1IQNA 1IQEA 1QCPA 3NXPA 1ZHRA 4X8TH 3SU3A 4Q4LA 5F53A 2ZO3H 1O31A 3MNCA 2F83A 1WQVH 4JK5A 3SNEA 5L2ZH 3IITA 1GJAB 2XXLA 2FMJA 1SLVB 5F8XA 1PPHE 2FP7B 4NFFA 4F49A 1LCYA 5GCHF 1BJUA 2QA9E 1O37A 1O32A 1LHDH 1GBIA 4A1XA 1RIWC 2EY4C 5FPTA 1MKWH 4KELA 4NGAH 2P3TB 3T29A 2AMQA 2Q6GA 4ESTE 1TPOA 1VKYA 1O38A 1O3PB 4DIHH 3EA8A 4YESB 1FPCH 1GCDA 2W3IA 1GI3A 5A0CA 3BTME 1TWXB 3IG6B 1GPZA 3BEUA 3F68H 1BA8B 3H5CB 1RGQA 4ABGA 3GCHC 5T6GA 1S84A 1K1IA 1Y3YA 2NWNA 3TH3H 1ZPZA 2Y5HA 4Q2KA 1O2JA 1O5BB 1A0JA 1SC8U 1VZQH 4DG4A 2GT8A 2TIOA 1C9TA 3R3GB 1AFQB 1A5HA 2ZTXA 4YM9A 4A6LA 1YY3A 1WUNH 1V2RT 2HGTH 1OS8A 3SGAE 5EOKA 2JDID 1T8NA 2AYWA 1TB6H 5EGMA 4BTTB 3L3TA 2VVVA 3SJ9A 2UWPA 1K1NA 1NY22 4FUBA 5DPAA 2G52A 2C8XB 4WF8A 4ASUD 1O3OA 2J38A 2AMPA 1GI0A 3Q76A 8GCHF 1MU8B 4ABEA 4DCDA 2SFAA 1WTGH 4AG1A 1C5XB 2BXUH 4DOQA 2RDLA 2YNAA 2GDEH 3TPIZ 4NIVA 3UIRA 2A7CA 3M35A 1XXDA 3CENA 2FZZA 4A92A 1BMLA 2JKHA 1CSOE 1ORFA 4JMYA 4VGCB 1HV7A 3KQCA 2PGQB 1IAUA 4Z1MD 4D9RA 2M2AA 3FFGA 4ZXXH 2FO9A 3TLOA 2WUBA 3M36A 2ZFFH 1BZXE 3OAAD 2VWLA 2EI6A 2ALPA 3P6ZB 1KLIH 1FAXA 4KTSA 2YMSD 1TMUH 2QXGA 1B0FA 4YZUA 1THPB 1ELGA 4XBBA 1K0HA 1CGJE 1S6LA 4CR5A 3A8BA 1HGTH 5TCCA 3WW7A 1O2HA 1BCUH 2VVUA 3MU4A 4CRFA 2BLQA 1VGCB 3RXDA 1KXCA 1SOZA 1RRKA 1A5GH 1EB1H 2XNIA 5EG4A 1DT2A 2QF0A 1LHEH 3TK5A 3UOUA 1YPHE 1O5EH 3M61U 1TIOA 1FLEE 3KL6A 4IN1A 3RXHA 3ZZ6A 3GICB 2G4UA 2TGTA 1D3QB 3QGJA 1LQDB 2R2MB 3OEED 2FDAA 3OTPA 5T1VA 1YCPK 4VGCC 4ZAEA 2AGGX 3AVZA 5GDSH 3ATMA 1SGIB 3NZIA 4B2CA 2PKAB 1QL8A 2K1QA 1RFNA 3T26A 1VR1H 1K22H 1E1QD 4BAOB 1E36B 1BQYA 3HKIB 2SGEE 2V7QD 2KCAA 4MDSA 1Y8TA 4D9QA 2P93A 3FN8A 4FUHA 1YPJH 1E79D 2WPJS 2FOMB 2BY8X 4FUEA 4X2WA 3RXVA 3PTBA 4JYTA 2R3YA 4WXVA 1GJ5H 4MLFB 2NU0E 3W95A 2ZA5A 3F2GA 1HAOH 1ZTJA 2OINA 8ESTE 2XRCA 2ZQ2A 4JCNA 2HALA 1W2KH 5GPIB 1XUJA 4FUFA 5C0UA 4THNH 5HYOA 1Z1JA 3WY8A 2VH0A 5HMAA 3BTFE 4BAMB 1GBKA 4MNWA 1FV9A 2FYQA 1H4WA 2KCPA 3MFJA 3RXRA 1GVZA 1O5AB 1O3FA 1V2JT 7ESTE 4MQAA 1HAVB 2P16A 1AWFH 1GDUA 1SBWA 4AN7A 2ZGBH 1V2NT 3ZV9A 4INHA 4CH2B 2OC7A 3QO6A 1P3EA 5C5OA 1PPBH 3A88A 1UTOA 3GOVB 1NFUA 3PLKA 3TH4H 5EPYA 2CHAB 4Y0ZE 1YPMH 3NWUA 4WJG2 4ABJA 3ZVDA 3QTOH 1MTNB 4B73A 2H5DA 1FDPA 5DGJA 1A3BH 1FJSA 1IHSH 5C0TA 3F2FA 1H8HD 1O2YA 3SV7A 2BHGA 2ZCLP 2VWNA 2P8OB 1DLEA 1FAKH 3RXEA 3ATLA 3SUFA 2RA0A 3URCA 2FTMA 3SJIA 1W13U 1EOJA 2AFQB 1GBEA 2J98A 1H9IE 1F0TA 1EJMA 3UPEA 1AKSA 1ESTA 3SU2A 1QTFA 2BDBA 1DPOA 5FAHA 2O8MA 4MPWA 5FBIA 4A1TA 1DWCH 4D7GA 2GTBA 1KYNA 1ETSH 3FP6E 4NZLA 1QL7A 2UUJB 3PO1B 5K0HA 1SQRA 1SGRE 4UFFH 5DP5A 1DUAA 2J4IA 4YXWD 1P05A 1QNJA 1SR5C 3RXCA 1SQOA 1YYY1 2SGAA 2ZEBA 1GL1A 5AHGH 2BX3A 1LPZB 2ULLA 2W3KA 1GI1A 2IOTA 4ACAA 2OC0A 1F92A 2Z9GA 1CU1A 1SHHB 2P8OC 4R8TB 2HVXA 1Y59T 4XSKU 1HAGE 2AMDA 1NTPA 3A7ZA 2BB4A 1O30A 3ZYEA 4XOJA 5FCRA 2PGBB 4O97A 3RXUA 2A5AA 4WWYA 1GI9B 1P3CA 3V12A 4NSVA 3P8FA 3RXTA 1GMDF 1TYNA 2XBWA 1FPHH 1HXFH 3LC5A 1P2MA 3S0NA 4SGBE 3BG4B 3EQ0H 1BTXA 2O8WA 1D9IA 1V2KT 1GJCB
chains in the Genus database with same CATH topology
1BBRK 2BD7A 4WMEA 1WAYB 4AOQA 1AE5A 2WPHS 3KEEA 3E6PH 1G37A 2J9NA 1UHBA 1O2QA 1YC0A 2P95A 3P92A 3PM3A 4NA8A 2G4TA 1QA0A 2ZDLA 3MWIU 1F5RA 1TX8A 2SGFE 1HUTH 1UVPA 2ZF0H 2XBYA 1G36A 1UMAH 4A5TS 1O3IA 2Z9LA 1P9UA 4GCHG 4TY7A 5DJ7A 5FX5A 1P2KA 2UWOA 1O2WA 1C1UH 1FY5A 4CRAA 2F9BH 3M7TA 3P17H 1LVOA 1O2PA 1ABIH 3OTJE 1P02A 1G2LA 1EASA 1C1NA 3SJOA 4OS2A 1GHBG 1A61H 1DANH 1ELFA 3ODDA 3ZVCA 1K9OE 2BD3A 3BG4C 1YP9A 1GJ7B 2ASUB 1UCYK 4XFQA 3D65E 2BD5A 1SLXB 4WY3A 4BOHA 1B5GH 1MTWA 1OPHB 3RC6A 3OU0A 1E38B 1RS0A 5FCKA 1HAZB 1O3EA 1GMCG 1UK2A 3U1IB 1O2KA 3SI4H 1GI4A 5C67A 1NRPH 1AB9B 3U98H 5CHAB 3VEQB 4ISNA 1KTTB 1Z8IB 1FIWA 1JXPA 1J15A 3U1JB 1T31A 2CJIA 1PQ5A 5DP8A 2F9PA 9LPRA 3RXQA 4BNRA 1O36A 1LKBA 4YT6H 3E3TA 1MKXK 2WPKS 1PFXC 2GCHF 4WH6A 2ILNA 1TX6A 2ZGHA 1O3MA 3EYDA 2DUCA 4U30A 4HZHA 3HPTB 1C2MA 3SHCH 2PWXA 2OLGA 3E1XB 1AWHB 2BYAX 2XWBI 4TPIZ 2GX4A 2ZTZA 4UFDH 5A0AE 4JK6A 5AFYH 1MH0A 1HLTH 1MTUA 3KN2A 1Z6EA 2IN2A 2O8UA 4I8GA 3Q3XA 1YPKH 4U2WA 3S9CA 1OWEA 1CVWH 3QZRA 4B75A 2ZDAH 3RXJA 2FWWA 3M3VA 1L1NA 1L4ZA 5ETXA 4CHAC 3SU5A 3I77A 1Y3UA 1KSNA 1HAIH 2RA3A 5CHAC 1JIRA 1GCTB 3HATH 4Y6DA 4XBDA 2NU3E 1CHOG 1RD3B 1C5PA 1GWAA 1RTLA 1BTWA 4DVAU 4I31A 3UQOA 1S5SA 3UY9A 1ZMJA 1V2WT 1C1SA 1FXYA 1O3JA 4PROA 1PPZA 2HNTC 3SI3H 1W7GH 4E05H 1E35B 2V3OH 2C4FH 1QBVH 2WV5A 3ZVEA 3SV8A 1QR3E 2VNTA 1O2NA 2ZFPH 2Z3DA 1QRZA 2UUYA 4X2YA 4AYVB 1NRSH 1TPPA 3TGIE 1EAUA 4ZHAA 4AORA 4B1TA 4M7GA 1GHWH 3KIDU 4FVDA 3QDZB 1AGJA 1YM0A 4XDEA 3FZDA 1P01A 3SQEE 1OWIA 2QN5T 1MMJN 4F4OC 1ZTKA 2BVXH 3U9AH 1ZPCA 3A82A 2A7HA 1EPTC 1DSTA 3LGVA 2OQUA 2A4QA 4RKJB 5ESTE 1V2QT 3BTGE 3F1SB 3MU0A 3UOPA 2H1UA 1ZLRA 2WYJA 4MG3A 1Y5UT 5EXMA 2F9VA 1GI6A 3O8RA 1RIWB 1FUJA 1QURH 2BOHB 1C9PA 2AH4X 4DY7B 5F03A 2C90B 6CHAC 1EAIA 4X2VA 2GDDA 1SLWB 4NA7A 2V6NA 3E8LA 1FY4A 2BVSH 4CRBA 2PUXB 1FIZA 2BDCA 5IYTA 3GCHB 1C4U2 2OC8A 1FI8A 2BD8A 3A84A 4NWKA 4SGAE 2FOEA 4X0WU 5JBTA 1MQ6A 1O5FH 2WPMS 1IQKA 2ZNKH 1T8OA 4DW2U 1EP5A 1EB2A 3RLWH 1C1WH 4X1SU 5I25A 1AE8H 2VIVA 1TPSA 3I29A 1TMBH 1F2SE 1ZPBA 2Y5FA 2BLOA 3V3MA 4FVBA 1S6FA 2FPZA 1C1QA 4K69A 4BTIB 1DOJA 1W8BH 3PTNA 1TRYA 4FUJA 2VIQA 3RXBA 1O3KA 3P8GA 5EODA 1KDQA 2GZ7A 2CXVA 3T5FH 3B9FH 1CA0B 3NPSA 1V2PT 3UFAA 2AGIX 7GCHG 4O9VA 2BXTH 4NCYA 1TE0A 2VVCA 2ODQA 3ZZCA 1OWJA 1MAXA 2PFEA 1TMTH 1AUTC 2BQ6B 4Y7AA 3L33A 2TPIZ 3QWCH 1CGIE 1ID5H 2PTNA 2Y7XA 1AZ8A 2CF8H 4INLA 4TWWA 4X1NU 1TOMH 2XTTB 3MH6A 1BB0B 4FXGH 2C3SA 2A4GA 1A7SA 1Q3XA 2Z9KA 3GCNA 4BXSA 3BIVH 3FP8E 1O0DH 2CV3A 3F9EA 1ELVA 5PTPA 2ZC9H 3RLYH 3STIA 1INCA 4UEHH 2VIOA 1AQ7A 2B5TB 3Q00A 1OP8A 3MI4A 5JBBS 1OWDA 2FOHA 3QUMP 1BTHH 3KCGH 2ZFQH 3K6ZA 2AERH 1GMHG 1SSXA 2QGRA 5A0BA 4X6MA 1HDTH 3UNSA 2Z94A 3GISB 1CA0C 2JH0D 4BXWA 1BRBE 2XBVA 4GLYA 7KMEH 5IDKA 1QRXA 3UNRA 2UWLA 3SU0A 1IQGA 3VB7A 1V2MT 5B6OA 1ZGVA 2H9HA 1GBAA 3BF6H 5AFZH 1HPGA 1F7ZA 2PUQH 2W7SA 1V6DA 2FOGA 1H1BA 4Q7XA 2QV1A 3KQEA 2QIQA 4AZ2B 1C2LA 1MKWK 1C2HA 2FS9A 4AFQA 2FI4E 2VJ1A 2Y7ZA 2A32A 2B8OH 1HJ9A 4IN2A 5C1UA 1A0HB 1W14U 1P57B 5F8TA 5C20A 1NC6A 2VGCC 3PWCA 1Z71A 1OP0A 5JB8S 1UO6A 2FXRA 2BY7X 2ZCKP 1ANDA 1KLJH 2FIRH 1Y3XA 1AZZA 3SN8A 2Z9JA 3ZVFA 1F0RA 4KTCA 1JMOH 1EKBB 2PW8H 2XCFA 3PV4A 2BDYA 3BEIB 3T27A 4Q7ZA 5GJ4B 1AVWA 3UWJH 2EA3A 4KP0A 2GGVB 1SG8B 2OD3B 4DJZB 2ZGXH 5FHTA 2HRVA 3RXFA 3LC3A 1QB1A 1ZMLA 1BMAA 3MNSA 1J14A 1GJBB 1ELDE 1QGFA 1W0YH 1QRWA 3O8BA 1ZSJA 1VCQA 4CBNA 4CR9A 4FUDA 3FZZA 1XUKA 1C5VA 3DT0H 1IQLA 1XVOA 2RCEA 3FVFB 4CREA 1TNJA 3RP2A 1ARBA 1QA7A 2SGQE 3SOSA 1OOKB 1L0ZA 5FX6A 3NUMA 5TJXA 3SGQE 2AEIH 1HRTH 4IC6A 1SVPA 5I46H 1Z6JH 3TJOA 3HK3B 1L2EA 1NFWA 3E0NB 1MUEB 3SQHE 1WSSH 1XMNB 5C1XA 3UWIA 3ZYDA 1XUFA 2VINA 3JZ1B 5GIBA 2DE8A 5F8ZA 2QC2A 1K1MA 2ANMH 1PYTD 3LKWA 2ALVA 1SGFA 2Y82A 4MVNA 5E0JA 1AD8H 1O2SA 1F5LA 3TNSA 2FS8A 3TU7H 1XVMA 1ZSKA 4YLQH 2Y80A 3UR9A 2ZGJA 1ZRKA 1AI8H 2H5CA 4X6NA 5EPNA 1ETRH 3RXLA 4DT7B 2GD4B 3PROA 3K2UA 4FU7A 4OS1A 3T28A 1Z7KA 2ZI2H 4I8HA 1GHAG 1KTSB 3A7XA 1C2IA 2WUCA 1P9SA 1PYTC 1AO5A 2BQWB 4UE7H 5LPRA 1A2CH 5JPMH 3GY5A 1LPGB 1O5CB 3BTEE 1ELBA 5L30H 1DY9A 7GCHF 3D49H 3RXIA 1MAYA 1FN6A 3TJUA 1GJ9B 1LHGH 3LDXH 3RXKA 1D6RA 2FOCA 3ENSB 1OP2A 1SGTA 3EA9A 5JB9S 1QQUA 4AFZA 1DITH 2FI5E 3HKJB 2SGPE 2Z3CA 1AIXH 3EA7A 1O5GH 1O3LA 1ZHPA 3VGCC 1G2MA 2WPIS 2ZIQH 1HBTH 3H7TA 1GJDB 2GP9B 3AW0A 3LT3A 2G51A 1CQQA 1LMWB 4X8SH 1JIMA 2R0KA 4K1EA 1ZTLA 3EGKH 3RXAA 1D6WA 1G3CA 1FZZA 2PKAA 3BTQE 3I78A 3ATWA 3GDVA 3QN7A 3RMMH 4Y71A 2GMTB 1XXFA 1GG6B 3TK9A 1AFEH 1WBGB 3BTHE 8LPRA 2A2XH 2A4OA 1BIOA 1QB6A 4DIIH 1ESBA 1NT1A 3HGNA 1GDNA 1YPGH 1GBLA 1C2KA 1XM1A 3F6UH 4I8LA 1MZAA 3TNTA 4TY6A 1C2DA 1P2JA 3S9AA 3A8DA 2A45B 2EC9H 2HOBA 4U01A 5CE1A 3V0XA 4A1VA 3FAOA 1UTPA 3JZ2B 2F9UA 2VIPA 3GCTG 3A83A 1A3EH 3LGYA 5LPFA 3DUXH 3KHVA 1BDAA 3KNXA 4OGYA 3VXEH 1C5TA 2HWLB 1BMMH 4ABHA 1T4UH 1TA6A 3U8OH 1ZJDA 3LPRA 3BG8A 1E37B 1C1RA 2FLBH 2EI8A 1T7CA 2BY9X 2JH6D 4TYDA 1V3XA 3ZVAA 2QXJA 1SPJA 3MOCA 1HIAB 3OYPA 4I8KA 1JRTA 4CRCA 2GMTC 3OY5U 3PMAB 4K1TA 1GG6C 1NRNH 3MO6A 5JYIA 1DLKB 2Y81A 1CT2E 2C93B 2A5KA 6GCHG 1TGTA 5EQSA 1EP6A 1KXBA 4I33A 5E2PA 3SJ8A 1GBTA 4AGJA 2ZHDA 4WH8A 5C3NA 3UTUH 3P95A 1QIXB 3RXOA 1S0QA 3PMBB 4X8UH 1TALA 1W10U 3ESTA 3UQVA 5EU8A 2PR3A 1W7XH 1LVMA 3R0FA 3MO3A 1TNKA 3GYLB 4ISIH 3RU4E 3MU8A 5LGOA 1GHYH 4QT8C 2BDIA 2GCTB 3C1KA 3UNQA 4E06H 1GBJA 4MNYA 1IQHA 4IMQA 3GY8A 4AX9H 1O2UA 4JZIA 1NROH 4MTBA 1LVYA 2F9OA 2TBSA 2P3FH 4B2AA 3PMJA 2PLXA 5H4IB 1W0ZU 3KQBA 4Y79A 3SHAH 1PPCE 1K28D 1SGYE 2J34A 1CT0E 2J94A 4BANB 4ZKRU 1A0LA 1G3EA 2GV7A 4LXBH 5C5NA 1YPHC 1HCGA 3S9BA 4Y0YE 2A0QB 3ZV8A 1HAPH 2BZ6H 1C5OH 1WYKA 1S82A 1FY1A 2ZU2A 3F9GA 1TGCA 1XKBC 1Z8GA 2TRMA 1ZGIA 1TOCB 5EXNA 4ZMAH 1T4VH 1Y3WA 2GV6A 3BTWE 3TH2H 2XC5A 3HGPA 4CHAB 4YLUA 5E0GA 2VU8E 3OX7U 2HLCA 3ATKA 4GHQA 3BTTE 1NU9A 3F9FA 4X8VH 5GCHG 2BD2A 2BVRH 1HXEH 2GCTC 2ZPRA 1IQIA 3BIUH 3LGIA 4XBCA 3SGBE 2ZPQA 3SV6A 1A4WH 5EW1H 2BD4A 2GZ9A 1C1OA 1ESAA 3A89A 3OY6U 2QAAA 5A09A 1Y5BT 1KIGH 4GUXA 1MD8A 3QZQA 3SUEA 3UUZA 1SGPE 1CBWC 4OS4A 2O8LA 3B8JA 3N7OA 1GI2A 5T6FA 2XWAA 1P8VC 1BT7A 2HPPH 2XYAA 3RDZA 1MD7A 3Q3KA 2R9PA 1T32A 1JOUB 3SV2H 3G01A 2BTCE 3RXSA 2ZKSA 3D23A 2HNTF 2Q1JA 1TBQH 3S7KB 2FESH 3TJNA 1F5KU 2G8TA 3U69H 2H9EH 1NU7B 1C5SA 1MBQA 1Z1IA 1P06A 4IBLH 1UVUH 2ANWA 3IWMA 4NWLA 3DA9B 1PQ8A 1P10A 3GY4A 5BRRE 1HNEE 1N8OB 4RN6A 1KXAA 4OS6A 3SUDA 1D4PB 1AU8A 1EPTB 2C8ZB 2XC0A 3ODFA 1ZYOA 2Y5GA 3EDXB 1ETTH 3L6PA 4XE4A 1G9IE 4UFEH 1L4DA 1PQ7A 5DP7A 8GCHG 2QXHA 5DP3A 1DWEH 3MYWA 2VH6A 1AN1E 4YO9A 3T2NA 1BTPA 2QF3A 1HB0B 2FEQH 3SBKA 6CHAB 2CF9H 1TBRH 2THFB 4AB9A 1TNIA 3GY7A 2NU2E 3RC4A 2PSXA 3SU6A 5AF9H 3VB5A 5G4BA 1GVKB 1SGFG 2RG3A 4AB8A 2CMYA 1QQ4A 1GBFA 2ZDNA 1GBCA 2Y6TA 5DG6A 3DHKH 2ZU4A 4LOYH 1WCZA 3EAJA 1V2TT 3RC5A 3ZZBA 1LTOA 3CS7A 3M3TA 4UD9H 1N8OC 4OS5A 1ZHMA 2ZU3A 3ITIA 6GCHF 1D3DB 1VCPA 4BTUB 2LNCA 1GBMA 3VB3A 1YPLH 1FY8E 2V3HH 3BTKE 1EZUC 2EI7A 3A7YA 4AYYB 7LPRA 1EJAA 4Z0KA 1PPEE 2ZQ1A 3E91A 1W3CA 3ZZ5A 4E7NA 4KTUA 3AAVA 1BITA 3CP7A 1K2I1 4YTAA 3UREA 1XKAC 4AG2A 3CS0A 1J16A 2PKSB 1HAYB 2BZAA 2FOAA 2O8TA 1E0FD 1P03A 1NN6A 1PPFE 2A4RA 4RSPA 3E16B 4GCHF 2BDAA 1U6QA 2VWMA 1GHZA 3A7TA 1ZJKA 2ZTYA 1FMGA 4B74A 1IQJA 1K1LA 3ZVBA 1PPGE 1BBRE 3T62A 1OXGA 1C5ZB 3SU4A 1LHFH 5EXLA 1GHBF 5GWZA 3RU4D 1DX5M 1BTUA 1SMFE 3MNXA 1NM6A 1O3CA 1RTKA 1O35A 1UVOA 1A1RA 1SGCA 2FX6A 3BSQA 1SGNE 1Z8RA 2XW9A 1BOQA 1Q31A 4WMDA 2TGDA 3K6YA 3TGKE 1THRH 1C5LH 1TGNA 3PMHB 3KQDA 1ACBE 1O3NA 1YGCH 3ZVGA 3M5MA 1TRNA 4HI3A 5A8ZA 4D76A 1GBDA 5ABWA 2JH5D 1O34A 1GMCF 1SQAA 2F9NA 3RM2H 1DY8A 1KLTA 4JYUH 1DXWA 3S7HB 2PKSC 1N6XA 2D2DA 2ZDVH 1TNGA 1KXDA 1UVSH 2BDHA 2G55A 1P0SH 1NS3A 2H2ZA 3F9HA 5J4QA 2AS9A 2GKVE 3NKKA 3K9XB 1UCYE 4GVUA 2F91A 3MH5A 3H7OA 5T3HA 2P94A 1G3BA 3LH1A 1VCWA 2ZDKA 2D26C 2R3UA 1NRRH 5ESBA 3MH4A 4MPVA 3VPKA 2VGCB 3GYMA 1PQAA 3KF2A 1TX7A 1GBBA 1GVLA 5F6MA 1O2ZA 4ZXYH 2Q6DA 1AVGH 2B0FA 5DKMA 1ANEA 3SNCA 1DXPA