3UOUA

Crystal structure of the kunitz-type protease inhibitor shpi-1 lys13leu mutant in complex with pancreatic elastase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Three-dimensional Structure of a Kunitz-type Inhibitor in Complex with an Elastase-like Enzyme.
pubmed doi rcsb
source organism Stichodactyla helianthus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA01
1TNHA 2BYAX 3LGTA 1GJ4H 4I33A 3SJ8A 4BTUB 1C1TA 3M35A 3P8GA 1C1QA 3CENA 1K1NA 1ZPBA 3DFJA 2SNVA 2M5TA 1GMHG 3DD2H 3S9CA 4DVAU 1LPZB 4WWYA 1GHBF 4X1SU 5DGJA 1ELBA 1GBBA 4UONA 2OUAA 1C1SA 1HJ8A 2G55A 1HPGA 1QB6A 1IQHA 4AORA 1ZTLA 3RM2H 2HWLB 1ZZZA 4JYVH 1P8VC 3PWBA 4ASHA 2O8MA 1NC6A 3SU6A 1HNEE 1ANBA 1VJAU 1LVMA 1E38B 1QQ4A 1ARCA 3B23B 1Y5AT 3A87A 4YOJA 4DT7B 1W10U 3K9XB 3KNXA 1QL8A 2JETB 3CS7A 5G4BA 4X6OA 4GUXA 3UR9A 2ZDVH 3PB1E 5EXNA 1CBWC 2VGCB 2ZHEH 2BZ6H 1GHAF 2C4FH 4NZQA 2LPRA 1A1RA 5E0GA 1PFXC 1QHRB 2W7UA 4BAOB 1PPZA 1E37B 1NRSH 2Y82A 1WAYB 1ZRBA 3SV7A 1UTMA 1PQ8A 1PQ5A 4ZMAH 1DSTA 1IQKA 3VB6A 1C4U2 1MKXK 1SMFE 1G2MA 1C2KA 1ZJDA 1HAVB 1QTFA 1K1JA 2ZECA 1J14A 2UUFB 3DHKH 4TPIZ 4XBCA 4CH8B 4F4OC 1H8IH 1OPHB 1Y5BT 1AFQC 1YGCH 1FV9A 3C1KA 2FTMA 4ABAA 1TMTH 3ESTA 4GSOA 4B2CA 2PHBA 3LDXH 3TJVA 1UCYK 5EW1H 1EX3A 1ZHPA 2DE9A 1TRMA 3SHCH 1O2QA 1O3OA 2ZQ2A 2P93A 1DX5M 1BUIA 3D49H 3UIRA 1GI4A 4FUBA 3E0PB 1FQ3A 1O37A 2TPIZ 3RXGA 2FODA 3O8DA 3SORA 2ZDAH 1V3XA 6CHAB 2BZAA 2ZHDA 3CP7A 4FUFA 1DWDH 1AUJA 1Q31A 1DLEA 2FOFA 1CVWH 1SGNE 4BANB 2BX3A 3GY4A 3GY5A 1AU8A 1G3DA 2HVXA 2ZFQH 3MTYA 1C2IA 2ZDMA 1ESTA 4H42U 2ZGJA 4HFPB 1SQAA 2VWLA 5LPFA 2HNTC 1E35B 1EAXA 1MKWH 3QTOH 1C1PA 1Z1JA 2PWXA 3M5MA 4Y0YE 1IQLA 2F9VA 3VB5A 3RU4E 2ALPA 3E1XB 2BTCE 4Y7BA 2XC4A 1DVAH 3FP8E 2ODYB 2G4UA 1KIGH 1V2JT 1NFYA 5HYOA 3HKJB 2ZHFH 1O3NA 4XE4A 4K1SA 2ZDLA 4H4FA 1GBAA 5B6OA 2UUJB 3TGKE 4YZUA 1KXCA 7GCHG 2XBXA 1O3EA 2HLCA 3A8CA 4YM9A 1QBNA 1GHXH 3PMAB 1C5YB 4MVNA 4NG9H 3SOSA 1G32B 4FUGA 3PMHB 4BAMB 1HAYB 1TMBH 1ANDA 1TPPA 3GCHC 2Q6FA 4FUDA 2Y5GA 3GDUA 3RC5A 3ZZ6A 4B71A 3PO1B 3LU9B 2P94A 1C1VH 4GHTA 1GBJA 4LZ1H 2V35A 1WOFA 2EI7A 2A7JA 8GCHF 3S0NA 5A8YA 1AGJA 3SU5A 1MTNB 1PQAA 4B2BA 1THSH 3N7OA 1VCPA 4CBOA 1IQMA 1KTTB 2PTCE 1EPTB 2AMDA 4ZAEA 2V3OH 4A92A 2PSXA 2SGFE 3BSQA 4LK4A 3V0XA 3E8LA 1EB2A 3MNSA 2FOAA 1PQ7A 1GHVH 4XOJA 2BVXH 9ESTA 1SG8B 4ZKRU 3LJJA 5L2YH 3QO6A 2HPQH 2QN5T 1L0ZA 1O3GA 1TOCB 4ISLA 1JIMA 2STBE 4DIIH 1ORFA 4DCDA 3MO3A 1AFQB 2PKAA 1JMOH 3GY6A 3E6PH 3P8OA 4UFFH 4Z0KA 2FX4A 1UHBA 1V2UT 2O8TA 4E7RG 2QXHA 1CU1A 2FEQH 1THPB 1GGDC 1GHZA 1RFNA 1O36A 1TONA 3TK9A 2AS9A 1VITF 3T62A 4FVBA 2VB0A 2PLXA 2BDIA 1P2JA 1D3QB 3UNRA 4X6MA 4CR9A 3LONA 2BXUH 2VNTA 1MKWK 5FX5A 1O5GH 2WPLS 1C2HA 2G81E 1P9SA 3RXTA 2QA9E 2GT8A 3RXOA 5F03A 4Y8YA 3RLWH 4Y11E 1UK2A 5C1XA 4E06H 2F9OA 3GCTG 3M7UA 3E0NB 3GY3A 1GJDB 5GDSH 3AW1A 3HATH 2ZU1A 1C2GA 1A0LA 2BD8A 1FY4A 1BCUH 1P57B 1NY22 1BTPA 3BTKE 1XKAC 1G2LA 1Z8RA 3RXLA 4O97A 2ZP0H 4JK5A 2ZFPH 3HGPA 1ZHRA 3V12A 5ABWA 1GBCA 3U8RH 1PPGE 3ZZ4A 5EQRA 3UR6A 2F9PA 3KCGH 2ZHWH 1HCGA 1HLTH 3ZZ5A 2W7SA 1BHXF 4HZHA 2FOMB 1PPBH 2NU3E 2FYRA 1TNJA 1A5GH 6LPRA 1HJAC 3RMLH 4Y76A 2ZHQH 1RTKA 3GCHB 4R8TB 1H9IE 3Q77A 1FY5A 4X6PA 1GBLA 1SQTA 4BXWA 1RS0A 1FAXA 2A4RA 4BAQB 1UVSH 4WXIA 4QT8C 1F7ZA 2J95A 1DLKB 1GCTB 2GVFA 1O3IA 1GBEA 1QRXA 1JOUB 3Q3KA 2H5DA 1OXGA 2ALVA 2BY7X 1OS8A 3MMGA 5JBTA 2D8WA 1BTWA 2ZPRA 2BQ7B 1P2OA 1C2DA 5TCCA 3BTEE 1P11E 1TNIA 1CO7E 4GHQA 1HAIH 4UFEH 1A5HA 2PKSC 3BTQE 2ODPA 1GVKB 4AX9H 1ELDE 5JBBS 2GCHF 3E90B 3NZIA 4J2YB 1W8BH 5FCKA 5PTPA 4Y71A 1CT2E 1WBGB 3H7TA 1CE5A 4DJZB 1N6YA 1ZGIA 3EA9A 3ATMA 3OSYA 3SU1A 1GGDB 2Y80A 3F6UH 3MI4A 4LXBH 1UVTH 3SHAH 3MYWA 1LPGB 1WU1A 1ZHMA 1O2TA 2C8ZB 1EP6A 1HDTH 3T5FH 1O5CB 1C5LH 4U01A 4OS2A 2ZFRH 3ATLA 1AIXH 1E0FD 1O2NA 2R3UA 4CH2B 2O8WA 1YPEH 1FIZA 5LGOA 4IW4E 1O2RA 1GJAB 3ZZ9A 1LQDB 2OQUA 3BTTE 4BAHB 2FP7B 1O2IA 1TRYA 4MNVA 1F92A 1TBRH 1OWIA 1TMUH 3SI4H 1G3BA 2ZKSA 4NIWA 4RKOB 1UK3A 5DP3A 1MAYA 1DE7H 5EOKA 1J15A 3LC3A 2WUCA 1UTQA 4OS4A 2H9EH 5DG6A 1C5SA 1O3PB 2BD9A 3ZVCA 3ZVGA 2SGDE 3O8BA 3L33A 4YOGA 4NGAH 8LPRA 1V2QT 1IHTH 1AUTC 2SGEE 1QFKH 2J2UA 4JZ1A 4NA9H 1RTFB 4XDEA 2O8LA 1TGTA 2HOBA 1PYTD 1GG6C 1ETSH 2UWOA 2CN0H 4E7NA 1SBWA 2FI5E 1OWEA 1GBHA 1SGTA 1L4DA 2FTLE 1TABE 1C1WH 4WMFA 4AN7A 4KTSA 5K0HA 3TVJB 5HGGA 1D6RA 1A3EH 4KKDA 4K60A 2SNWA 4X1RU 1LCYA 2JKHA 2ZTXA 3AAVA 1SOTA 1EP5A 4CRGA 1P01A 3SU4A 3RLYH 1C5ZB 1EASA 3T29A 4AFQA 1HIAB 2FS8A 3E16B 1WQSA 1TB6H 1F2SE 5FPYA 5T3HA 1GHWH 1CA8B 1DUEA 3A88A 2ZNKH 3HKIB 1C5PA 3LGUA 3RXUA 2ZGBH 3QDZB 4I7YH 6ESTA 3A7VA 3SO3A 3T27A 1NTPA 3BTDE 3P6ZB 3RXRA 2NU0E 4JZEH 4ABGA 1O2LA 1ZLRA 3U1JB 1XM1A 1DANH 1MQ5A 1SLUB 1BMNH 5EW2H 4GCHG 4YT6H 3B8JA 1H1BA 1P0SH 4IS5A 2OTVA 3LC5A 1O3AA 2P16A 3ZZ7A 2CHAC 4MG3A 1H4WA 1UK4A 2GDDA 3ATIA 1KDQA 2A7CA 2F91A 2WV4A 1A3BH 1EJMA 1W2KH 1S5SA 2H2ZA 5TJXA 4ZKNU 1MTVA 1F5RA 2VJ1A 4K5ZA 1TWXB 2G4TA 1EZUC 2WV5A 3SU0A 1AHTH 4X1QU 1W3CA 3OY5U 4CHAB 3LOXA 1C1RA 4I31A 4X6NA 1S84A 2QIQA 1GWAA 1S0RA 4PROA 5GJ4B 4H6TA 1H9LB 1TRNA 3LH1A 3MO9A 3MOCA 2J9NA 2QYIA 4A1TA 4MPVA 1DT2A 2D26C 3SGBE 1G36A 1JIRA 3RXMA 1K9OE 1YC0A 2PTNA 2C8XB 4FVDA 1Z8GA 1HBTH 1HJ9A 3DA9B 2QY0B 3UWJH 1MBQA 1UTOA 3RU4T 4D76A 1B5GH 1CHOG 1VR1H 2SGPE 2TGDA 3UFAA 4JYTA 3MNCA 2KAIA 3D23A 5JB8S 1CT0E 1QB1A 2WUBA 4AFSA 2OC8A 4KTUA 1JRSA 2AMPA 3CS0A 1GBKA 1DITH 1V2PT 1Y59T 3SNBA 1Y3UA 2F9NA 2F9UA 4ISOA 4K8YA 2FI3E 1GMCF 3TIUA 1GJ7B 4OS1A 2I6QA 2VU8E 3A7WA 3RC4A 3NUMA 4MPUA 3PWCA 4B75A 1FY3A 1HAOH 1HB0B 1TX6A 1LTOA 1DOJA 2XBYA 1YYY1 1CA0B 1LPKB 1ELVA 4A5TS 3IG6B 1KLIH 1O2GH 1IOEA 1V2RT 2P59A 2A2QH 3M61U 1PPFE 1XUIA 2VWNA 5F8TA 2NU4E 3GOVB 4ABBA 1ELEE 4ESTE 4ABHA 1W14U 1DM4B 3A85A 1C5QA 1VJ9U 4TY6A 3A89A 3VGCC 1V2TT 2FOGA 1YPKH 5GCHG 1YLCA 4OGYA 2R2MB 1BTZA 5FXLA 1MD7A 1IAUA 7KMEH 2CJIA 4NA7A 4ABJA 2A5IA 1FY8E 1GMDG 2C93B 2TGPZ 2Y7XA 5EXMA 2J94A 3JZ2B 1K2I1 4ZHLU 1O2SA 2BD5A 2QXGA 1AWHB 4F49A 1TGCA 1XUJA 1EUFA 2C90B 4WXVA 4X8SH 1HGTH 2Z3CA 5ESTE 3ZZ3A 3F9FA 1C1UH 5F8ZA 4CRCA 4Y8XA 3SU2A 1C5UA 3BV9B 3TGIE 3BTGE 2A4QA 2ZDNA 3FFGA 1FLEE 1ABIH 5ESBA 1T32A 1TAWA 5BRRE 1FY1A 3ZVAA 1D3DB 1QIXB 4BTIB 3QZRA 2YNAA 2OP9A 1OKXA 1GBDA 2BVSH 2A45B 2ZU5A 3A83A 1C2EA 5EQQA 2VWOA 3RU4D 4DGJA 2CF9H 1O0DH 1MZDA 4AG1A 1HV7A 3O8CA 1AFEH 2VIVA 4X1NU 3KQCA 4AYYB 2XW9A 3BG4C 2W3IA 1G9IE 1SLVB 4YO9A 1K1PA 1F0TA 4INKA 5E8EH 3U98H 2VIWA 1NM6A 3M7QA 1D3TB 1SHYA 3S9AA 3IITA 5HMAA 5C1UA 1W0ZU 4NSVA 1CQQA 2NWNA 3SQEE 1BRCE 1YPJH 4ABEA 2PKAB 1AKSA 2B5TB 4D9RA 1ZTJA 2F3CE 2Z9LA 1HAPH 1UHBB 3EYDA 2IPHA 1O3BA 2O9QA 4A7IB 1EZXC 2XWAA 1QB9A 1K1LA 1UMAH 2UWLA 1NRRH 3Q00A 1KXAA 1TGBA 1LKAA 1SHHB 1HXFH 1TQ0B 8KME2 1GJCB 1O2UA 1BJUA 2V6NA 2NU1E 5A2MH 4YOIA 4BXSA 1O2OA 3ELAH 4DG4A 4ISNA 3SGAE 1QR3E 3VB3A 1LHFH 2AFQB 1WTHD 3BIUH 1J17T 4XBBA 4Y0ZE 1BJVA 1XVOA 5EG4A 1THRH 3RMMH 4BTTB 3T28A 1O39A 4FUHA 1N6XA 1BZXE 2I6SA 1O5FH 5L6NH 1OP8A 1P2QA 3AVZA 5J4QA 2Z9IA 1UTKA 1C2LA 3NXPA 3SNEA 3ZZCA 2Y81A 2AIQA 1O38A 3M3TA 1C5OH 1B0FA 1D9IA 3A82A 3BEUA 2BDCA 4XSKU 3SUDA 1ZPZA 4K8BA 4FU7A 5AVDA 4CRDA 1TLDA 1ELCA 1S85A 4Y8ZA 1WUNH 2GKVE 4JZDH 1CBWB 1TNGA 1GJ5H 4H6SB 1KXDA 2QC2A 1NN6A 2DE8A 1XUHA 1LDTT 1B0EA 1TBZH 3TLOA 1YPHC 1D4PB 4NFFA 1C9TA 1KXBA 4O3TA 5C67A 3SNAA 1VITH 2G51A 3R3GB 3SI3H 3FVFB 6GCHG 2F9BH 2EC9H 3GDVA 1GJ8B 3VFEA 1ZGVA 4K1TA 1O31A 3V7TA 5E2PA 1AVGH 4TY7A 3KIDU 2FXRA 3D65E 2ZTYA 2GTBA 3BG4B 2GV7A 2OC7A 3F9EA 1LHDH 1O30A 2BDBA 4RN6A 2A4GA 1XMNB 2FOBA 1O5AB 2CV3A 2Z9KA 3TJNA 1UVUH 2HGTH 4YESB 3SUFA 2EI6A 1P09A 3K65B 1TNKA 4JK6A 2WYJA 3QWCH 3PMBB 1GMHF 2OQ5A 1UVOA 2IN2A 1O3MA 1VCWA 1XUFA 3BTWE 4D7FA 2A2XH 4Q7YA 1YPGH 1TOMH 2GDEH 4A6LA 2TIOA 1CHGA 1MH0A 1GI7B 1T31A 3GY7A 1P12E 2HNTE 3SBKA 1GI8B 1E34B 2Z94A 1PPEE 1BTHH 2B0FA 2BY6X 1RGQA 3F9HA 3ENSB 5F8XA 2H1UA 3UNQA 4AFUA 3PMJA 4ZHAA 2TRMA 3MH7A 1G3CA 1SL3A 3NWUA 2G8TA 3FAOA 1NU9A 1BTUA 1EXFA 1YF4A 1F0SA 3PLKA 2BD4A 1FUJA 1EAIA 2ANMH 1ZPCA 2OC1A 1A2CH 3I77A 2FMJA 1K22H 2Y5FA 3RC6A 2G5NA 3TU7H 4AB8A 2QF0A 4DW2U 1NPMA 2XXLA 4X2WA 3RUOA 5C3NA 3SV8A 1GJBB 1UVPA 5ETXA 1AB9C 1L1NA 3BTHE 3UTUH 1DXWA 3RXPA 1K1IA 3QZQA 2RA0A 3SV2H 4UE7H 1GDNA 1P9UA 1T8MA 2P3UB 5HM9A 3UQVA 1AY6H 2WPKS 2K1QA 1ZSKA 2A5KA 3M36A 3V13A 2VH0A 2ZFTA 5AFZH 3W95A 1FN6A 1GVLA 1GHYH 4JZFH 2XC0A 3KN2A 2AGIX 3UREA 2R0LA 3TH4H 2BDHA 4MTBA 1SGQE 2OC0A 1QJ6B 1IQJA 4KELA 3LIWA 1GBTA 1GDUA 1T8LA 3TNSA 1V2OT 5JBCS 5C2ZA 2A32A 3F1SB 2PGBB 1AVWA 1ANEA 1NRNH 1GI2A 1RIWC 5JB9S 3V3MA 2WYGA 3AASA 1A7SA 3TH3H 7ESTE 3PTNA 5LH8A 1INCA 1QCPA 2IOTA 3VB4A 4IBLH 4NWLA 1GVZA 2GX4A 2XCFA 3QN7A 5K7RA 1ELFA 1T4UH 5DP6A 5CHAC 1C1MA 1O5BB 1Z71A 2F83A 1Y3YA 4X1PU 4OS5A 5FX6A 3TPIZ 2ANYA 4DOQA 1BBRE 1O2KA 5CE1A 1O32A 2XBWA 2BQ6B 2G5VA 4TWWA 1FNIA 1OX1A 1S83A 2BHGA 7GCHF 4CRFA 1SLXB 5C20A 3MH4A 3ZVFA 1EZSC 3T2NA 2HALA 1PYTC 4YLUA 4LZ4B 1OP2A 1KDQB 1P03A 2OBOA 1PPHE 4AYVB 1SPJA 3BEIB 1BMAA 2HPPH 2PUQH 5T6FA 1O3FA 2BX4A 3MH6A 2WPHS 1GHBG 1N8OC 3DFLA 1ARBA 1W12U 1EATA 3SUGA 5IYTA 5EQSA 4MQAA 4XBDA 1Y3VA 1LHGH 1CT4E 1FXYA 1ESAA 1NO9H 4MNWA 1HRTH 1TIOA 3KHVA 2C8WB 1MTSA 4YT7H 2VIDA 1L4ZA 3FZZA 1L1GA 1HAZB 1TGSZ 1SGPE 1KTSB 1E36B 1YPMH 2LNCA 1HJAB 1UTPA 1AB9B 4KP0A 3LGWA 2Q6DA 3URDA 5AFYH 3QUMP 2BLVA 3UNSA 2ZA5A 5A09A 4GVUA 1LHEH 3ZVDA 1GHAG 3GYLB 3EA7A 1FPHH 2JH6D 3A84A 3M5OA 4CRAA 1O3KA 2KAIB 4SGAE 1DPOA 2SFAA 3OY6U 4WH8A 1Z8IB 2ZWLH 4Y7AA 1EB1H 4ZHMU 3F9GA 1O2YA 1ZTKA 3S69A 2B8OH 2ZIQH 3VXEH 2PSYA 3MU4A 1VGCC 2JH5D 2QGRA 3MU5A 1C1NA 3BG8A 1MAXA 3UOPA 1BDAA 3OX7U 5I25A 2PKSB 1O2ZA 1AE5A 1V2LT 4U2WA 3BN9A 1Q2WA 4AB9A 4VGCC 1BRBE 1RIWB 4I8KA 3M7TA 1FJSA 4X8UH 3GCTF 1SGYE 1BMMH 1RD3B 3RXJA 3F68H 1GJ6A 1MCVA 4I8LA 1FMGA 1TE0A 1ELAA 3QTVH 2FS9A 5EGMA 3TNTA 5FHTA 3TK6A 1GI0A 4THNH 3LT3A 3DUXH 1K21H 1HUTH 1OP0A 2QCYA 1QJ1B 1SFQB 1SR5C 1XVMA 3EQ0H 3NKKA 2IJOB 4A1VA 5DP8A 1GBMA 2AIPA 4B73A 1W13U 2ZCKP 1YM0A 1SSXA 1YP9A 3A8BA 2D2DA 4JCNA 1WCZA 3UY9A 1A0HB 8ESTE 2PGQB 5H4IB 4AG2A 3EAJA 2R0KA 1SGFG 2JETC 3RM0H 5A8ZA 1BT7A 1SGEE 4I8JA 1HAHH 2FZZA 2Y7ZA 3STJA 2XC5A 2BB4A 2THFB 1AD8H 1SGRE 1C4Y2 3ZVBA 1NESE 1GPZA 2OD3B 4O9VA 1OYTH 1FPCH 2BMGB 2W26A 2J4IA 3MNXA 1P2MA 2PFEA 4CR5A 1GCDA 3MNBA 3ATKA 1QGFA 5DP9A 1W0YH 3RMOH 2BD2A 2ESTE 3A81A 1G3EA 1DUAA 1XUGA 1SC8U 5DP5A 2CMYA 1O2JA 4X8VH 1BA8B 1DY9A 1H9HE 1LHCH 1MCTA 1AQ7A 4WJG2 1KLTA 2FWWA 3A8AA 1KY9A 3QGNB 1PJPA 2GT7A 2Z9GA 3E3TA 1GG6B 1UO6A 2OBQA 4FUJA 5C1YA 8GCHG 1ELGA 3RXHA 2CGAA 3VXFH 4RKJB 5BPEA 1IQFA 4FU9A 3GY2A 2VH6A 4O3UA 2Z7FE 4WH6A 5JBAS 5FBIA 1GJ9B 1XXDA 3SJIA 4ZKSU 1C9PA 2OINA 1AN1E 1BBRH 2QXIA 1VGCB 5T6DA 2ZU2A 3RDZA 1C5WB 1AO5A 2TGAA 3KQBA 4NCYA 4ISHH 1GDQA 1A4WH 1D6WA 1TYNA 3ITIA 2VVUA 1F0RA 3RP2A 2J92A 1C4V2 4VGCB 5A0CA 2J34A 2QF3A 1OYQA 2XBVA 2ZTZA 4WF8A 4LOYH 3RXQA 4Q7ZA 5JDUB 1TA6A 1DWBH 1NRQH 1NS3A 5T6GA 4O03A 1F5LA 3ATWA 1VITG 2ANKH 2Y5HA 2W5EA 3MHWU 2TGTA 4K1EA 4GAWA 4GPGA 1AVXA 4X2XA 1C5TA 4TYDA 2CHAB 4Y10E 1F5KU 2BY8X 1ZSLA 3FP7E 1P04A 3ZV8A 1GBIA 5E2OA 1C5VA 9LPRA 1FONA 5GWZA 1AZZA 1BHXB 3BEFB 4NIYA 1O3HA 3T26A 5DP4A 1N1LA 2UUYA 3SQHE 2ANWA 3UOUA 3K2UA 4E05H 2A31A 5I46H 2ZDKA 3ZZ8A 3STIA 5JYIA 2ZGHA 2WPMS 1EJNA 2BD7A 5EU8A 5DK1A 2Z9JA 3PO1C 4NA8A 3P95A 2ZI2H 1K1MA 1C5XB 1ACBE 1SVPA 4ZROA 1MTNC 1S0QA 2ZGXH 2FLBH 2J38A 2BLWA 2OLGA 5HM2A 5IDKA 2FOEA 3M3VA 1EPTC 2B9LA 3UQOA 1GBFA 1RRKA 3I29A 4BNRA 5DO4H 4Q7XA 4WY3A 2QXJA 1V2WT 2PV9B 5DPAA 5GXPA 4AGKA 1HAGE 2FX6A 2P8OC 3A7TA 2A5AA 2GP9B 1VCQA 1P3CA 3P8FA 3NPSA 1YKTA 2YOLA 1C5RA 1OWKA 1WSSH 1QBOA 2AYWA 2BLQA 3NCLA 1QRZA 2DUCA 1ZR0A 1AZ8A 4B74A 1QL7A 4FUCA 5A0BA 3S9BA 1V2VT 1BBRK 2PUXB 4CRBA 2ZGCA 1MZAA 3S7HB 2VWMA 1CSOE 1W7XH 4JZIA 3A7ZA 4GCHF 2QV1A 3HK3B 3VEQB 5FCRA 3GICB 2P3FH 1Y3XA 3U1IB 1WYKA 1P02A 3UUZA 1ESBA 1YCPH 1TX8A 2CXVA 2GMTC 1JWTA 4BOHA 4D7GA 1EOLA 4Z6AH 3HPTB 1W11U 2ZPQA 5GIBA 1SGIB 3GCOA 1Y8TA 3QX5H 3BIVH 2GZ8A 1SGCA 2GCHG 2P3TB 1KLJH 2FIRH 1KYNA 3EE0B 3ZVEA 1WTGH 5EXLA 3VGCB 1AMHA 2Q1JA 2JH0D 3TK5A 1FIWA 2GZ7A 4D9QA 1UJ1A 1Y3WA 2WPIS 3LGYA 1T7CA 3GY8A 1D3PB 2UWPA 3ZZDA 3RXCA 1ELTA 1EAUA 1HAXB 3GCNA 5AHGH 3ZZAA 1RXPA 3LGVA 1O33A 1HFDA 1MU8B 3AAUA 4X8TH 3KQDA 3SGQE 1FAKH 3QK1A 3A80A 1AWFH 1LVYA 3MH5A 1NROH 1DDJA 3MU8A 1WQVH 3RXFA 5C5NA 3RXEA 1CHOF 2BDAA 4A1XA 1Z7KA 5J4SA 4U32A 2ZC9H 3U8OH 3I78A 1P10A 1ZMJA 3WY8A 2H9HA 1K1OA 2BY5X 1O2VA 2GD4B 1M9UA 3H7OA 1TX7A 1TBQH 2FOHA 4I32A 4YTAA 1IQEA 2WINI 4WVPE 4NIVA 3IWMA 4HI3A 1GCTC 1C5NH 1NRPH 2RG3A 3S7KB 2ODQA 3RXDA 3RXVA 4WMEA 4Y6DA 1HAVA 1MBMA 2AERH 2SGQE 1LVBA 2A4OA 3VB7A 4CBNA 5L30H 4ZKOU 1ZMNA 2V3HH 4OGXA 2BXTH 2WPJS 4DY7B 1LKBA 5CMXH 1LO6A 1P2IA 1F0UA 3NK8A 2P8OB 2BM2A 2PR3A 1MTUA 1O2MA 3U69H 1DSUA 3BTME 2YNBA 1HYLA 1GI6A 2VIPA 1BRUP 1DY8A 1J8AA 5EPNA 3KL6A 1Z6JH 1W7GH 2C3SA 1YCPK 4IMZA 3PLPA 5GCHF 4FUEA 1O3CA 2XWBI 4AOQA 1DWEH 2A1DB 4UD9H 2AGGX 2NU2E 1P06A 5DJ7A 1GMDF 1V2ST 2H9TH 2SGAA 2R3YA 1OWJA 3FZDA 2GZ9A 1ZSJA 5DKMA 4Q80A 3ZV9A 2GMTB 1QBVH 2AGEX 1UTLM 1IQIA 4FU8A 3RXSA 3M5NA 1LVOA 4WMDA 3SJKA 4K2YA 3U9AH 1GI1A 4IMQA 4NSYA 3TGJE 3P17H 2UUKB 1MD8A 2ULLA 3MU0A 2XCNA 5F6MA 2ZCLP 1EAWA 1TPOA 3PTBA 3KEEA 5LPRA 1BMLA 1OSSA 5L2ZH 1XXFA 3PM3A 3TJOA 5EPYA 3O8RA 5GPIB 4MNYA 4DURA 2FM2A 3FANA 2BY9X 4AZ2B 1NFXA 3LPRA 2OXSA 5FAHA 4RSPA 3G01A 2V0BA 5E0JA 5A8XA 1NFWA 1EQ9A 1J9CH 2STAE 1OWHA 1YCPM 2XTTB 1YPHE 3MFJA 1Z8JB 1MMJN 2AH4X 1DXPA 1T8OA 1TGNA 3HGNA 3MO6A 1EPTA 1ABJH 2A0QB 3PYHA 2RA3A 1ZOMA 1JBUH 3KQEA 2ZF0H 2GV6A 1V6DA 3A7YA 4NZLA 1O3LA 1P3EA 1SB1H 4IC5A 1QA7A 4HGCA 5EODA 4ZXYH 1Z1IA 2VINA 1SLWB 1TPSA 1X7AC 2R2WU 2XYAA 5SGAE 4INLA 4IC6A 2BDGA 4XFQA 3KF2A 1BITA 1T8NA 4AFZA 1GI9B 4MLFB 4UFGH 3UWIA 5A0AE 1O34A 4ZUHA 4D8NA 1DICA 1ANCA 4NIXA 4B76A 1GL0E 3R0FA 1C5MD 4GLYA 5FPTA 2ASUB 1UTNA 3C27B 4R0IA 3ODDA 1UCYE 4ISIH 1CGIE 3M37A 3ODFA 1GMCG 1EZQA 2ZPSA 1NT1A 2ZG0H 1QNJA 4J1YA 1DWCH 2FO9A 2ZFSA 1ZMLA 2B7DH 2Z3EA 1WV7H 3RMNH 3RXKA 5AF9H 1G30B 1TALA 1L1JA 4NFEA 1C2FA 1BTYA 3QGJA 3LJOA 3Q3XA 1BQYA 1J16A 1GI5A 1JRTA 3BF6H 1UTJA 3JZ1B 1QRWA 2BLOA 3K6YA 3U8TH 1CGJE 4SGBE 1HXEH 5JPMH 4CHAC 4K3JA 1Q3XA 4Q2KA 1P2KA 2XRCA 1A61H 3GISB 1C1OA 2Q6GA 3SJ9A 1O2HA 2BVRH 1YLDA 2ZFFH 1H8DH 1NFUA 3Q3YA 1DS2E 1O2PA 3TH2H 1S6FA 3Q76A 5LPEA 2W3KA 3KGPA 2TBSA 1V2NT 1IQNA 4B2AA 1IQGA 3A86A 4CREA 5C5OA 2VIOA 4Y79A 3SW2B 6GCHF 4ABDA 4OS7A 1OWDA 3M3SA 1AI8H 1BRAA 2FLRH 2FPZA 4I8GA 1P05A 4IN2A 2GCTC 1A0JA 2XNIA 3SNDA 3EDXB 2Y6TA 2EI8A 3EA8A 1YPLH 3LGIA 4UFDH 3DT0H 2R9PA 1ETRH 1FZZA 3D62A 2H6MA 3ZYEA 3H5CB 1C2MA 3E91A 1LQEA 4AGJA 2O8UA 2Z3DA 1MU6B 4TWYA 1S82A 2C8YB 1U6QA 1JXPA 3OTJE 4IN1A 3BTFE 2VVCA 1O2XA 1QJ7B 2HRVA 2QAAA 3M5LA 3SU3A 3A7XA 3URCA 4BAKB 2BDYA 1FDPA 2FOCA 4TPYA 3SN8A 3P70B 1BIOA 2FI4E 1LMWB 2P95A 4NWKA 3FP6E 2AEIH 2EEKA 1O35A 5FPSA 3PV4A 2ZU4A 3PROA 3RXBA 1MUEB 1O3JA 1RTLA 3OYPA 1BTXA 1TNLA 3GDSA 1ZJKA 3SUEA 5FBEA 4FXGH 4B1TA 2GGVB 1EKBB 1KXEA 1YBWA 2ZQ1A 3EGKH 1CA0C 1EJAA 1O5DH 1QY6A 1RJXB 1G37A 1Z6EA 1MQ6A 3TITA 2H5CA 3RXIA 1A5IA 1ZYOA 4X0WU 1GI3A 2BOKA 3VPKA 4ZXXH 1KSNA 4M7GA 5E0HA 5HXFA 2ZZUH 4UDWH 1XX9A 5CHAB 1O2WA 4IGDA 3RXAA 3HK6B 1GL1A 1BOQA 1NU7B 1TQ7B 1QURH 1S81A 1FN8A 4KGAA 3SZNA 2ZO3H 1KXFA 2VVVA 1TPAE 1TA2A 3L3TA 2BD3A 3MU1A 1P2NA 1SGDE 1MTWA 3OU0A 4FUIA 1Y5UT 5TCAA 1BB0B 4U30A 4K69A 3ZZBA 2HNTF 1EOJA 4DIHH 4ABFA 1XKBC 4I8HA 4MPWA 2VGCC 3ZYDA 1O5EH 4ABIA 3GYMA 1AE8H 1TFXA 2FYQA 1V2KT 1N8OB 1SOZA 2CF8H 3P8NA 4MPXA 2RCEA 1K28D 3L6PA 4INHA 4HTCH 4OS6A 1B7XB 1T4VH 1DFPA 3SV9A 2ZCHP 2OCVB 3P92A 1SFIA 1O3DA 2FDAA 1ID5H 1ZRKA 1PPCE 2G00A 2ZEBA 3AW0A 4KTCA 2BOHB 1QA0A 3LH3A 1A46H 4UEHH 2VIQA 1ETTH 3QLPH 4MNXA 5DP7A 2GCTB 2BQWB 2EA3A 2D1JA 4X2YA 1QL9A 2PW8H 1MKXH 3UPEA 1XUKA 3LKWA 1V2MT 2ILNA 4MDSA 1C2JA 1IHSH 3W94A 2RDLA 2ZU3A 1L2EA 3TJUA 2A7HA 2G52A 1FI8A 6CHAC 1AKSB 3SNCA 1UCYH 3SV6A 1QQUA 4X2VA 4JYUH 2FESH 3K6ZA 4YLQH 4ZH8A 7LPRA 4JMYA 3B9FH 1HIAA 1CGHA 3PLBA 1NZQH 1S6HA 3T25A 3MWIU 1SQOA 3A8DA 2AMQA 1OOKB 1VZQH 1SI5H 3SJOA 2Z6BD 1SGFA
chains in the Genus database with same CATH superfamily
1TNHA 2BYAX 3LGTA 1GJ4H 4I33A 3SJ8A 4BTUB 1C1TA 3M35A 3P8GA 1C1QA 3CENA 1K1NA 1ZPBA 3DFJA 3F3BA 2SNVA 3N7DA 2M5TA 1GMHG 2WSSD 3DD2H 3S9CA 4DVAU 1LPZB 4WWYA 1GHBF 4X1SU 5DGJA 1ELBA 1GBBA 4UONA 2OUAA 1C1SA 1HJ8A 3VG8A 2G55A 1HPGA 1QB6A 1IQHA 4AORA 1ZTLA 3RM2H 2AHME 2HWLB 1ZZZA 4JYVH 1P8VC 3PWBA 4ASHA 2O8MA 1NC6A 5F53A 3SU6A 1HNEE 1ANBA 1VJAU 1LVMA 1E38B 1QQ4A 1ARCA 3B23B 1Y5AT 3A87A 4YOJA 4DT7B 1W10U 3K9XB 3KNXA 1QL8A 2JETB 3CS7A 2WZQA 5G4BA 4X6OA 4GUXA 3UR9A 2ZDVH 3PB1E 5EXNA 1CBWC 2VGCB 2HLDD 2ZHEH 2BZ6H 1GHAF 2C4FH 4NZQA 2LPRA 1A1RA 5E0GA 1PFXC 1QHRB 2W7UA 4BAOB 1PPZA 1E37B 1NRSH 2Y82A 1WAYB 1ZRBA 3SV7A 1UTMA 1PQ8A 1PQ5A 4ZMAH 1DSTA 1IQKA 3VB6A 1C4U2 1MKXK 1SMFE 1G2MA 1C2KA 1ZJDA 1HAVB 1QTFA 1K1JA 2ZECA 1J14A 2UUFB 3DHKH 4TPIZ 4XBCA 4CH8B 4F4OC 1H8IH 1OPHB 1Y5BT 1AFQC 1YGCH 1FV9A 3C1KA 2FTMA 4ABAA 1TMTH 3ESTA 4GSOA 4B2CA 2PHBA 3DSGA 3LDXH 3TJVA 1W0JD 1UCYK 5EW1H 1EX3A 1ZHPA 2DE9A 1TRMA 3SHCH 1O2QA 1O3OA 2ZQ2A 2P93A 1DX5M 1BUIA 3D49H 2OK5A 3N7EA 3UIRA 1GI4A 4FUBA 3E0PB 1FQ3A 1O37A 2TPIZ 3RXGA 2FODA 4FETA 3O8DA 3SORA 2ZDAH 1V3XA 6CHAB 2BZAA 2ZHDA 3CP7A 4FUFA 1DWDH 1AUJA 1Q31A 1DLEA 2FOFA 1CVWH 1SGNE 4BANB 1KMHB 2BX3A 3GY4A 3GY5A 1AU8A 1G3DA 2HVXA 2ZFQH 3MTYA 1C2IA 2ZDMA 1ESTA 4H42U 4Q63A 2ZGJA 4HFPB 1SQAA 2VWLA 4Z1MD 5LPFA 2HNTC 1E35B 1EAXA 1MKWH 3QTOH 5C0TA 1C1PA 1Z1JA 2PWXA 3M5MA 4Y0YE 1IQLA 2F9VA 3VB5A 3RU4E 2ALPA 3E1XB 2BTCE 4Y7BA 2XC4A 1DVAH 3FP8E 2ODYB 2G4UA 1KIGH 1V2JT 1NFYA 5HYOA 3HKJB 2ZHFH 1WDIA 1O3NA 4XE4A 4K1SA 1E1RD 2ZDLA 4H4FA 1GBAA 5B6OA 3EE7A 3UB0A 2UUJB 3TGKE 4YZUA 1KXCA 7GCHG 2XBXA 1O3EA 2HLCA 3A8CA 4YM9A 1QBNA 1GHXH 3PMAB 1C5YB 4MVNA 4NG9H 3SOSA 1G32B 4FUGA 3PMHB 4BAMB 1HAYB 3F2HA 1TMBH 1ANDA 1TPPA 3GCHC 2Q6FA 4FUDA 3PRDA 2Y5GA 3GDUA 3RC5A 3ZZ6A 4B71A 5EJZA 3PO1B 3LU9B 2P94A 1C1VH 4GHTA 1GBJA 4LZ1H 2V35A 1WOFA 2EI7A 2KCPA 2A7JA 8GCHF 3S0NA 5A8YA 1AGJA 3SU5A 1MTNB 2KR7A 1PQAA 4B2BA 1THSH 3N7OA 1VCPA 4CBOA 1IQMA 1KTTB 2PTCE 1EPTB 2AMDA 4ZAEA 2V3OH 4A92A 2PSXA 2SGFE 3BSQA 4LK4A 3V0XA 3E8LA 1EB2A 3MNSA 2FOAA 1PQ7A 1GHVH 4XOJA 2BVXH 9ESTA 1SG8B 4ZKRU 3LJJA 5L2YH 3QO6A 2HPQH 2QN5T 3KYGA 1L0ZA 1O3GA 1TOCB 3F2FA 4ISLA 1JIMA 2STBE 4P02A 1ORFA 4DCDA 3MO3A 4DIIH 1AFQB 2PKAA 1JMOH 3GY6A 3E6PH 3P8OA 4UFFH 4Z0KA 2FX4A 1UHBA 1V2UT 2O8TA 4E7RG 2QXHA 1CU1A 2FEQH 1THPB 1GGDC 1GHZA 1RFNA 1O36A 1TONA 3TK9A 2AS9A 1VITF 2K8IA 4FVBA 3T62A 2VB0A 2PLXA 2BDIA 1P2JA 1D3QB 3FKSD 3UNRA 4X6MA 4CR9A 3LONA 2BXUH 2VNTA 1MKWK 5FX5A 2RDEA 2KZ4A 1O5GH 2WPLS 1C2HA 2G81E 1P9SA 3RXTA 2QA9E 2GT8A 3RXOA 5F03A 4Y8YA 3RLWH 4Y11E 1UK2A 5C1XA 4E06H 2F9OA 3GCTG 3M7UA 3E0NB 3GY3A 1GJDB 5GDSH 3AW1A 3HATH 2ZU1A 1C2GA 1A0LA 2BD8A 1FY4A 1BCUH 1P57B 1NY22 1BTPA 3BTKE 1XKAC 1G2LA 1Z8RA 3RXLA 4O97A 2ZP0H 4JK5A 2ZFPH 3HGPA 1ZHRA 3V12A 5ABWA 1GBCA 3U8RH 1PPGE 3ZZ4A 5EQRA 3UR6A 2F9PA 3KCGH 2ZHWH 1HCGA 1HLTH 3ZZ5A 2W7SA 1BHXF 4HZHA 2FOMB 2JDID 1PPBH 2NU3E 1WXRA 2FYRA 1TNJA 1A5GH 6LPRA 1HJAC 3RMLH 4Y76A 2ZHQH 1RTKA 3GCHB 4R8TB 1H9IE 3Q77A 1FY5A 4X6PA 1GBLA 4RT1A 1W0KD 1SQTA 4BXWA 1RS0A 1FAXA 2A4RA 4BAQB 1UVSH 2JJ1D 4WXIA 2J98B 4QT8C 1F7ZA 2J95A 1DLKB 1GCTB 2GVFA 1O3IA 1GBEA 1QRXA 1JOUB 3Q3KA 5T1VA 2H5DA 1OXGA 2ALVA 2BY7X 1OS8A 3MMGA 5JBTA 2D8WA 1BTWA 2ZPRA 2BQ7B 1P2OA 1C2DA 5TCCA 3BTEE 1P11E 1TNIA 1CO7E 4GHQA 1HAIH 4UFEH 1A5HA 2PKSC 3BTQE 2ODPA 1GVKB 4AX9H 1ELDE 5JBBS 2GCHF 3E90B 3NZIA 4J2YB 1W8BH 5FCKA 5PTPA 4Y71A 1CT2E 1WBGB 3H7TA 1CE5A 4DJZB 3OE7D 1N6YA 2JIZD 1ZGIA 3EA9A 3ATMA 3OSYA 3SU1A 1GGDB 2Y80A 3F6UH 3MI4A 4LXBH 1UVTH 3SHAH 3MYWA 1LPGB 1WU1A 1ZHMA 1O2TA 2C8ZB 1EP6A 3DSOA 1HDTH 3T5FH 1O5CB 1C5LH 4U01A 4OS2A 2ZFRH 3ATLA 1AIXH 4ZCNA 1E0FD 1O2NA 3PV2A 2R3UA 4CH2B 2O8WA 1YPEH 1FIZA 5LGOA 4IW4E 1O2RA 1GJAB 3ZZ9A 1LQDB 2OQUA 3BTTE 4BAHB 2FP7B 1O2IA 1TRYA 4MNVA 1F92A 1TBRH 1OWIA 1TMUH 3SI4H 1G3BA 2ZKSA 4NIWA 4RKOB 1UK3A 5DP3A 1MAYA 1UW7A 1DE7H 5EOKA 1J15A 3LC3A 2WUCA 1UTQA 4OS4A 2H9EH 5DG6A 1C5SA 1O3PB 2BD9A 3ZVCA 2W6ID 3ZVGA 2SGDE 3O8BA 3L33A 4YOGA 4FOUC 1NBME 4NGAH 8LPRA 1V2QT 1IHTH 1AUTC 2SGEE 1QFKH 2J2UA 4JZ1A 4NA9H 1RTFB 4XDEA 2O8LA 1TGTA 2HOBA 1PYTD 1GG6C 1ETSH 2UWOA 2CN0H 4E7NA 1SBWA 2FI5E 1OWEA 1GBHA 1SGTA 1L4DA 2FTLE 5FL7D 1TABE 1C1WH 4WMFA 4AN7A 4KTSA 5K0HA 3TVJB 5HGGA 1D6RA 1A3EH 4KKDA 4K60A 2SNWA 4X1RU 1LCYA 2JKHA 2ZTXA 3AAVA 1SOTA 1EP5A 4CRGA 1P01A 3SU4A 3RLYH 1C5ZB 1EASA 2KFWA 3T29A 4AFQA 3FO8D 1HIAB 3KQ5A 2FS8A 3E16B 1WQSA 1TB6H 1F2SE 5FPYA 5T3HA 1GHWH 1CA8B 1DUEA 3A88A 2ZNKH 3HKIB 1C5PA 3LGUA 3RXUA 2ZGBH 3QDZB 4I7YH 6ESTA 3A7VA 3SO3A 2KM0A 3T27A 1NTPA 3BTDE 3P6ZB 3RXRA 2NU0E 4JZEH 1OHHD 4ABGA 1O2LA 1ZLRA 3U1JB 1XM1A 1DANH 1MQ5A 2WHXA 1SLUB 1BMNH 5EW2H 4GCHG 4YT6H 3B8JA 1H1BA 1P0SH 4IS5A 2OTVA 3LC5A 1O3AA 2P16A 3ZZ7A 2CHAC 4MG3A 1H4WA 1UK4A 2GDDA 3ATIA 1KDQA 2A7CA 2F91A 2WV4A 1A3BH 1EJMA 1W2KH 1S5SA 2H2ZA 5TJXA 4ZKNU 1MTVA 1F5RA 2VJ1A 4K5ZA 1TWXB 2G4TA 1EZUC 2WV5A 3SU0A 1AHTH 4X1QU 1W3CA 3OY5U 4CHAB 3LOXA 1C1RA 3F2GA 4I31A 4X6NA 1FX0B 1S84A 2QIQA 1GWAA 1S0RA 4PROA 5GJ4B 4H6TA 1H9LB 1TRNA 3LH1A 3MO9A 3MOCA 2J9NA 2QYIA 4A1TA 4MPVA 1DT2A 2D26C 3SGBE 1G36A 1JIRA 3RXMA 1K9OE 1YC0A 2PTNA 2C8XB 2QF4A 3PRBA 4FVDA 1Z8GA 2KCOA 1HBTH 1HJ9A 3DA9B 2QY0B 3UWJH 1MBQA 1UTOA 3RU4T 2XNDD 1B5GH 4D76A 2EY4C 1CHOG 5GNDA 1E79D 1VR1H 2SGPE 2TGDA 3UFAA 4JYTA 3MNCA 2KAIA 3F0PA 2K0QA 3D23A 5JB8S 1CT0E 1QB1A 2WUBA 4AFSA 2VBCA 2OC8A 4KTUA 1JRSA 2AMPA 3CS0A 1GBKA 1DITH 1V2PT 1Y59T 3SNBA 1Y3UA 2PP6A 2F9NA 2F9UA 4ISOA 4K8YA 2FI3E 1GMCF 3TIUA 1GJ7B 4OS1A 2I6QA 2VU8E 3A7WA 3RC4A 3NUMA 4MPUA 3PWCA 4B75A 1FY3A 1HAOH 1HB0B 1TX6A 1LTOA 1DOJA 2XBYA 1YYY1 1CA0B 1LPKB 1ELVA 4A5TS 3IG6B 1KLIH 1O2GH 1IOEA 1V2RT 2P59A 2A2QH 3M61U 1PPFE 1XUIA 2VWNA 5F8TA 2NU4E 3GOVB 4ABBA 1ELEE 4ESTE 4ABHA 1W14U 1DM4B 3A85A 1C5QA 1VJ9U 4TY6A 3A89A 3VGCC 4XRNA 1V2TT 2FOGA 1YPKH 2CK3D 5GCHG 1YLCA 4OGYA 5DN6D 2R2MB 1BTZA 5FXLA 1MD7A 1IAUA 7KMEH 2CJIA 4NA7A 4ABJA 2A5IA 1FY8E 1GMDG 2C93B 2TGPZ 2Y7XA 5EXMA 2J94A 3JZ2B 1K2I1 2KCAA 4ZHLU 3ZIAD 1O2SA 2BD5A 2QXGA 1AWHB 4F49A 1TGCA 1XUJA 1EUFA 2C90B 4WXVA 4X8SH 1HGTH 2Z3CA 5ESTE 3ZZ3A 3F9FA 1C1UH 5F8ZA 4CRCA 4Y8XA 3SU2A 1C5UA 3BV9B 3TGIE 3BTGE 2A4QA 2ZDNA 3FFGA 1FLEE 1ABIH 5ESBA 4ACAA 1T32A 1TAWA 5BRRE 1FY1A 3ZVAA 1D3DB 1QIXB 4BTIB 3QZRA 2YNAA 2OP9A 1OKXA 3OEHD 1GBDA 2BVSH 2A45B 2ZU5A 3A83A 1C2EA 5EQQA 2VWOA 3RU4D 4DGJA 2CF9H 1O0DH 1MZDA 4AG1A 1HV7A 3O8CA 1AFEH 2VIVA 4X1NU 3KQCA 4AYYB 2XW9A 3BG4C 2W3IA 1G9IE 1SLVB 4YO9A 1K1PA 1F0TA 4INKA 5E8EH 3U98H 2VIWA 1NM6A 3M7QA 1D3TB 1SHYA 3S9AA 3IITA 5HMAA 5C1UA 1W0ZU 4NSVA 1CQQA 2NWNA 3SQEE 1BRCE 1YPJH 4ABEA 2PKAB 1AKSA 2B5TB 4D9RA 1ZTJA 2F3CE 2Z9LA 1HAPH 1UHBB 3EYDA 2IPHA 1O3BA 4DT4A 2O9QA 4A7IB 1EZXC 3FOAA 2XWAA 1QB9A 1K1LA 1UMAH 2UWLA 1NRRH 3Q00A 1KXAA 1TGBA 1LKAA 1SHHB 1QZ8A 1HXFH 1TQ0B 8KME2 1GJCB 1O2UA 1BJUA 2V6NA 2NU1E 5A2MH 4AC9A 4YOIA 4BXSA 1O2OA 3ELAH 4DG4A 4ISNA 5CDFE 3SGAE 1QR3E 3VB3A 1LHFH 2AFQB 1WTHD 3BIUH 1J17T 4XBBA 4OM9A 1BJVA 4Y0ZE 1XVOA 5EG4A 1THRH 3RMMH 4BTTB 3T28A 1H8ED 1O39A 4FUHA 5KECA 1N6XA 1BZXE 2I6SA 3WWBA 1O5FH 5L6NH 1OP8A 3DCLA 1P2QA 3AVZA 5J4QA 2Z9IA 1UTKA 1C2LA 2QF5A 3NXPA 3SNEA 3ZZCA 2Y81A 2AIQA 1O38A 3M3TA 1C5OH 1B0FA 1D9IA 3A82A 3BEUA 2BDCA 4XSKU 3SUDA 1ZPZA 4K8BA 4FU7A 5AVDA 4CRDA 1TLDA 1ELCA 1S85A 4Y8ZA 1WUNH 2GKVE 4JZDH 1CBWB 1TNGA 1GJ5H 4H6SB 1KXDA 2QC2A 1NN6A 2DE8A 1XUHA 1LDTT 1B0EA 1TBZH 3TLOA 1YPHC 1D4PB 3OFND 4NFFA 1C9TA 1KXBA 4O3TA 5C67A 3SNAA 1VITH 2G51A 2F43B 3R3GB 3SI3H 3FVFB 6GCHG 5C17A 2F9BH 2EC9H 3GDVA 1GJ8B 3KYFA 3VFEA 1ZGVA 4K1TA 1O31A 3F0OA 3V7TA 5E2PA 1AVGH 4TY7A 3KIDU 2FXRA 3D65E 2ZTYA 2GTBA 3BG4B 5HIYA 2GV7A 2OC7A 3F9EA 1LHDH 1O30A 2BDBA 4RN6A 2A4GA 1XMNB 2FOBA 1O5AB 2CV3A 2Z9KA 3TJNA 1UVUH 2HGTH 4M9FA 4YESB 3SUFA 2EI6A 1P09A 3K65B 1TNKA 4JK6A 2WYJA 3QWCH 3PMBB 1GMHF 2OQ5A 1UVOA 2IN2A 1O3MA 1VCWA 1XUFA 3BTWE 4D7FA 2A2XH 4Q7YA 1YPGH 1TOMH 5IK2D 2GDEH 4A6LA 2TIOA 1CHGA 1MH0A 1GI7B 1T31A 3GY7A 1P12E 2HNTE 3SBKA 1GI8B 3SYJA 1E34B 2Z94A 1PPEE 1BTHH 4B6FA 2B0FA 2BY6X 1RGQA 3F9HA 3ENSB 5F8XA 3PV5A 2H1UA 3UNQA 4AFUA 3PMJA 2L6OA 4ZHAA 2TRMA 3MH7A 1G3CA 1SL3A 2M2AA 3NWUA 2G8TA 3FAOA 1NU9A 1BTUA 1EXFA 1YF4A 1F0SA 3PLKA 2BD4A 1FUJA 1EAIA 2ANMH 1ZPCA 2OC1A 1A2CH 3I77A 2FMJA 1K22H 2Y5FA 3RC6A 2G5NA 3TU7H 4AB8A 2QF0A 4DW2U 1NPMA 2XXLA 4X2WA 3RUOA 5C3NA 3SV8A 1GJBB 1MABB 1UVPA 5ETXA 1AB9C 1L1NA 4ASUD 3BTHE 3UTUH 1DXWA 3RXPA 1K1IA 3QZQA 2RA0A 3SV2H 4UE7H 1GDNA 1P9UA 1T8MA 2P3UB 5HM9A 3UQVA 1AY6H 2WPKS 2K1QA 1ZSKA 2A5KA 3M36A 3V13A 2VH0A 2ZFTA 5AFZH 3W95A 1FN6A 1GVLA 1GHYH 4JZFH 2XC0A 4HG6A 3KN2A 2AGIX 3UREA 2R0LA 3TH4H 2BDHA 4MTBA 1SGQE 2OC0A 1QJ6B 1IQJA 4KELA 3FN8A 3LIWA 1GBTA 1GDUA 1T8LA 3TNSA 1V2OT 5JBCS 5B6LA 2A32A 3F1SB 5C2ZA 2PGBB 1AVWA 1ANEA 1NRNH 1GI2A 3GS9A 1RIWC 5JB9S 3V3MA 2WYGA 3AASA 1A7SA 3TH3H 7ESTE 3PTNA 5LH8A 1INCA 1QCPA 2IOTA 3VB4A 4IBLH 4NWLA 1GVZA 2GX4A 2XCFA 3QN7A 5K7RA 1ELFA 1NBMD 3WWFA 1T4UH 5DP6A 5CHAC 1C1MA 1O5BB 1Z71A 2F83A 1Y3YA 4X1PU 4OS5A 5FX6A 3TPIZ 2YMSC 5HKKD 2ANYA 4DOQA 1BBRE 1O2KA 5CE1A 1O32A 2XBWA 2BQ6B 2G5VA 4TWWA 1FNIA 1OX1A 1S83A 2BHGA 2JJ2D 7GCHF 4CRFA 1SLXB 5C20A 3MH4A 3ZVFA 1EZSC 3T2NA 2HALA 1PYTC 4YLUA 4LZ4B 1OP2A 1KDQB 1P03A 2OBOA 1PPHE 4AYVB 1SPJA 3BEIB 1BMAA 2HPPH 2PUQH 5T6FA 1O3FA 2BX4A 3MH6A 2WPHS 1GHBG 1N8OC 3DFLA 1ARBA 1W12U 1EATA 3SUGA 5IYTA 5EQSA 4MQAA 5DSFA 4XBDA 1Y3VA 1LHGH 1CT4E 1FXYA 1ESAA 1NO9H 4MNWA 1HRTH 1TIOA 3KHVA 2C8WB 1MTSA 4YT7H 2VIDA 1L4ZA 3FZZA 1L1GA 1VKYA 1HAZB 1TGSZ 1SGPE 1KTSB 1E36B 1YPMH 2LNCA 1HJAB 1UTPA 1AB9B 4KP0A 3LGWA 2Q6DA 3URDA 5AFYH 3QUMP 2BLVA 3UNSA 2ZA5A 3NRLA 5A09A 4GVUA 1LHEH 3ZVDA 1GHAG 3GYLB 3EA7A 1FPHH 2JH6D 3A84A 3M5OA 4CRAA 1O3KA 2KAIB 4SGAE 1DPOA 2SFAA 3OY6U 4WH8A 1Z8IB 2ZWLH 4Y7AA 1EB1H 4ZHMU 3F9GA 1O2YA 1ZTKA 3S69A 2B8OH 2ZIQH 3VXEH 2PSYA 3MU4A 1VGCC 2JH5D 2QGRA 3MU5A 1C1NA 3BG8A 1MAXA 3UOPA 1BDAA 3OX7U 5I25A 2PKSB 1O2ZA 1AE5A 1V2LT 4U2WA 3BN9A 1Q2WA 4AB9A 4VGCC 1BRBE 1RIWB 4I8KA 3M7TA 1FJSA 4X8UH 3GCTF 1SGYE 1BMMH 1RD3B 3RXJA 3F68H 1GJ6A 1MCVA 4I8LA 1FMGA 1TE0A 1ELAA 3QTVH 2FS9A 5EGMA 3TNTA 5FHTA 3TK6A 1GI0A 4THNH 3LT3A 3DUXH 1K21H 1HUTH 1OP0A 5CHBA 2QCYA 3MQKC 1QJ1B 1SFQB 1SR5C 1XVMA 3EQ0H 3NKKA 2IJOB 4A1VA 5DP8A 1GBMA 1E1QD 2AIPA 4B73A 1W13U 2ZCKP 1YM0A 2YMSB 1SSXA 1YP9A 3A8BA 2D2DA 4JCNA 1WCZA 3UY9A 1A0HB 8ESTE 2PGQB 5H4IB 4AG2A 3EAJA 2R0KA 1SGFG 2JETC 3RM0H 5A8ZA 1BT7A 1SGEE 4I8JA 1HAHH 2FZZA 2Y7ZA 3STJA 2XC5A 2BB4A 2THFB 1AD8H 1SGRE 1C4Y2 4Q4LA 3ZVBA 1NESE 1GPZA 2OD3B 4O9VA 4P00A 1OYTH 2KCYA 3W1EA 1FPCH 2BMGB 2W26A 4RI0A 2J4IA 3MNXA 1P2MA 2V3MA 2PFEA 4CR5A 1GCDA 3MNBA 3ATKA 1QGFA 5DP9A 1W0YH 3RMOH 2BD2A 2ESTE 3A81A 1G3EA 1DUAA 1XUGA 1SC8U 5DP5A 2CMYA 1O2JA 4X8VH 1BA8B 1DY9A 1H9HE 1LHCH 1MCTA 1AQ7A 4WJG2 1KLTA 2FWWA 3A8AA 1KY9A 3QGNB 1PJPA 2GT7A 2Z9GA 3E3TA 1GG6B 1UO6A 2OBQA 4FUJA 5C1YA 8GCHG 1ELGA 1K0HA 3RXHA 2CGAA 3VXFH 4RKJB 5BPEA 1IQFA 4FU9A 3GY2A 2VH6A 4O3UA 2Z7FE 3H09A 4WH6A 5JBAS 5FBIA 1GJ9B 1XXDA 3SJIA 4ZKSU 1C9PA 2OINA 1AN1E 1BBRH 2QXIA 1VGCB 5T6DA 2ZU2A 3RDZA 1C5WB 1AO5A 2TGAA 3KQBA 4NCYA 4ISHH 1GDQA 1A4WH 1D6WA 1TYNA 3ITIA 2VVUA 1F0RA 3RP2A 2J92A 1C4V2 4VGCB 5A0CA 2J34A 2QF3A 1OYQA 2XBVA 2ZTZA 4WF8A 4LOYH 3RXQA 4Q7ZA 5JDUB 1TA6A 1DWBH 1NRQH 1NS3A 5T6GA 4O03A 1F5LA 3ATWA 5KEDA 1VITG 2ANKH 2Y5HA 2W5EA 3MHWU 2TGTA 4K1EA 4GAWA 4GPGA 1AVXA 4X2XA 1C5TA 4TYDA 2CHAB 4Y10E 1F5KU 2BY8X 1ZSLA 3FP7E 1P04A 3ZV8A 1GBIA 5E2OA 1C5VA 9LPRA 1FONA 5GWZA 1AZZA 1BHXB 3BEFB 4NIYA 1O3HA 3T26A 5DP4A 1N1LA 2UUYA 3SQHE 2ANWA 3UOUA 3K2UA 4E05H 2A31A 5I46H 2ZDKA 3ZZ8A 3STIA 4B6EA 5JYIA 2ZGHA 2RFKC 2WPMS 1EJNA 2BD7A 5EU8A 5DK1A 1YLNA 2Z9JA 3PO1C 4NA8A 3P95A 2ZI2H 1K1MA 1C5XB 1ACBE 1SVPA 4ZROA 1MTNC 1S0QA 2ZGXH 2FLBH 2J38A 2BLWA 2OLGA 5HM2A 5IDKA 2FOEA 3M3VA 4F55A 1EPTC 2B9LA 3U28C 3UQOA 1GBFA 1RRKA 3I29A 4BNRA 5DO4H 4Q7XA 4WY3A 2QXJA 1V2WT 2PV9B 5DPAA 5GXPA 4AGKA 1HAGE 2FX6A 2P8OC 3A7TA 2A5AA 2GP9B 1VCQA 1P3CA 3P8FA 3NPSA 1YKTA 2YOLA 1C5RA 1OWKA 1WSSH 1QBOA 2AYWA 1SQRA 2BLQA 3NCLA 1QRZA 2DUCA 1ZR0A 1AZ8A 4B74A 1QL7A 4FUCA 5A0BA 3S9BA 1V2VT 1BBRK 2PUXB 4RT0A 4CRBA 2ZGCA 1MZAA 3S7HB 2VWMA 1CSOE 1W7XH 4JZIA 3A7ZA 4GCHF 2QV1A 3HK3B 3VEQB 5FCRA 3GICB 2P3FH 1Y3XA 3U1IB 1WYKA 1P02A 3UUZA 1ESBA 1YCPH 1TX8A 2CXVA 2GMTC 1JWTA 4BOHA 4D7GA 1EOLA 4Z6AH 3HPTB 1W11U 2ZPQA 5GIBA 1SGIB 3GCOA 1Y8TA 3QX5H 3BIVH 2GZ8A 1SGCA 2GCHG 2P3TB 1KLJH 5EJLA 2FIRH 2XOKD 1KYNA 3EE0B 3ZVEA 1WTGH 5EXLA 3VGCB 2W6JD 1AMHA 2Q1JA 2JH0D 3UAIC 3TK5A 1FIWA 2GZ7A 4D9QA 1UJ1A 1Y3WA 2WPIS 3LGYA 1T7CA 3GY8A 2WV9A 1D3PB 2UWPA 3ZZDA 3RXCA 1ELTA 1EAUA 1HAXB 3GCNA 5AHGH 3ZZAA 1RXPA 3LGVA 1O33A 3CNRA 1HFDA 1MU8B 3AAUA 4X8TH 3KQDA 3SGQE 1FAKH 3QK1A 3A80A 1AWFH 1LVYA 3MH5A 1NROH 1DDJA 3MU8A 1WQVH 3RXFA 5C5NA 3RXEA 1CHOF 2BDAA 4A1XA 1Z7KA 5J4SA 4U32A 2ZC9H 3U8OH 3I78A 1P10A 1ZMJA 3WY8A 2H9HA 1K1OA 2BY5X 1O2VA 1S6LA 2GD4B 1M9UA 3H7OA 1TX7A 1TBQH 2FOHA 4I32A 4YTAA 1IQEA 2WINI 4WVPE 4NIVA 3IWMA 4HI3A 1GCTC 1C5NH 1NRPH 2RG3A 3S7KB 2ODQA 3RXDA 3RXVA 4WMEA 4Y6DA 1HAVA 1MBMA 2AERH 2SGQE 1LVBA 2A4OA 3VB7A 4CBNA 5L30H 4ZKOU 1ZMNA 2V3HH 4OGXA 2BXTH 2WPJS 4DY7B 1LKBA 5CMXH 1LO6A 1P2IA 1F0UA 3NK8A 2P8OB 2BM2A 2PR3A 1MTUA 1O2MA 3U69H 1DSUA 3BTME 2YNBA 1HYLA 1GI6A 2VIPA 1BRUP 1DY8A 1J8AA 5EPNA 3KL6A 1Z6JH 1W7GH 2J97A 5C0UA 2C3SA 1YCPK 2V7QD 4IMZA 3PLPA 5GCHF 4FUEA 1O3CA 3AK5A 2XWBI 1H8HD 4AOQA 1DWEH 4ACBA 2A1DB 4UD9H 2AGGX 2NU2E 1P06A 5DJ7A 1GMDF 1V2ST 2H9TH 2SGAA 2R3YA 1OWJA 3FZDA 2GZ9A 1ZSJA 5DKMA 4Q80A 3ZV9A 2GMTB 1QBVH 2AGEX 1UTLM 1IQIA 4FU8A 3RXSA 5C94A 3M5NA 1LVOA 4WMDA 3SJKA 4K2YA 3U9AH 1GI1A 4IMQA 4NSYA 3TGJE 3P17H 2UUKB 1MD8A 2ULLA 3MU0A 2XCNA 5F6MA 2ZCLP 1EAWA 1TPOA 3PTBA 3KEEA 5LPRA 1BMLA 1OSSA 5L2ZH 1XXFA 3PM3A 3TJOA 5EPYA 3O8RA 5GPIB 4MNYA 4DURA 2FM2A 3FANA 2BY9X 4AZ2B 1NFXA 3LPRA 2OXSA 5FAHA 5KGOA 4RSPA 2EQNA 3G01A 2V0BA 5E0JA 5A8XA 1NFWA 1EQ9A 2HVYB 1J9CH 1BMFD 2STAE 1OWHA 1YCPM 2XTTB 2L74A 1YPHE 3MFJA 1Z8JB 1MMJN 2AH4X 1DXPA 1T8OA 1TGNA 3HGNA 3MO6A 1EPTA 1ABJH 2A0QB 3PYHA 2RA3A 1ZOMA 2LELA 1JBUH 3KQEA 2WPDD 2ZF0H 2GV6A 1V6DA 3A7YA 4NZLA 1O3LA 1P3EA 1SB1H 4IC5A 1QA7A 4HGCA 5EODA 4ZXYH 1Z1IA 2VINA 1COWD 1SLWB 1TPSA 1X7AC 2R2WU 2XYAA 5SGAE 4INLA 4IC6A 4TSFD 2BDGA 4XFQA 3KF2A 1BITA 1T8NA 4AFZA 1GI9B 4MLFB 4UFGH 3UWIA 5A0AE 1O34A 4ZUHA 4D8NA 1DICA 1ANCA 4NIXA 4I86A 4B76A 1GL0E 3R0FA 3N99A 1C5MD 4GLYA 5FPTA 2ASUB 1UTNA 3C27B 4R0IA 3DSPA 3ODDA 1UCYE 4ISIH 1CGIE 3M37A 3ODFA 1GMCG 1EZQA 2ZPSA 1NT1A 2ZG0H 1QNJA 4J1YA 1DWCH 5EIYA 2FO9A 2ZFSA 4XD7D 1ZMLA 2B7DH 2Z3EA 1WV7H 3RMNH 3RXKA 5AF9H 1G30B 1TALA 2J5UA 1L1JA 1C2FA 1BTYA 3QGJA 4NFEA 3LJOA 3Q3XA 1BQYA 1J16A 1GI5A 1JRTA 3BF6H 1UTJA 3JZ1B 1QRWA 2BLOA 3K6YA 3U8TH 1CGJE 4SGBE 1HXEH 5JPMH 4CHAC 4K3JA 1Q3XA 4Q2KA 1P2KA 2XRCA 1A61H 3GISB 1C1OA 2Q6GA 3SJ9A 1O2HA 2BVRH 5EJ1A 1YLDA 2ZFFH 1H8DH 1NFUA 3Q3YA 1DS2E 1O2PA 3TH2H 1S6FA 3Q76A 5LPEA 2W3KA 3KGPA 2TBSA 1V2NT 1IQNA 4B2AA 1IQGA 3A86A 4CREA 5C5OA 2VIOA 4Y79A 1YY3A 3SW2B 6GCHF 4ABDA 4OS7A 1OWDA 3M3SA 1AI8H 1BRAA 2FLRH 2FPZA 4I8GA 1P05A 4IN2A 2GCTC 4YXWD 1A0JA 2XNIA 3SNDA 3EDXB 2Y6TA 2EI8A 3EA8A 1YPLH 3LGIA 4UFDH 3DT0H 2R9PA 1ETRH 1FZZA 2LP6A 2H6MA 3D62A 3H5CB 3ZYEA 1C2MA 2J98A 2KX4A 3E91A 1LQEA 4AGJA 2YMSD 2O8UA 2Z3DA 1MU6B 4TWYA 2QE7D 1S82A 2C8YB 1U6QA 1JXPA 3OTJE 4IN1A 3BTFE 2VVCA 1O2XA 1QJ7B 2HRVA 2QAAA 3M5LA 3SU3A 3A7XA 3URCA 4BAKB 2BDYA 1FDPA 2FOCA 4TPYA 3SN8A 3P70B 1BIOA 2FI4E 1LMWB 2P95A 4NWKA 3FP6E 2AEIH 2EEKA 1O35A 5FPSA 3PV4A 2ZU4A 3PROA 3RXBA 1MUEB 1O3JA 1RTLA 3OYPA 2IJD1 1BTXA 1TNLA 3GDSA 1ZJKA 3SUEA 5FBEA 4FXGH 4B1TA 2GGVB 1EKBB 1KXEA 1YBWA 2ZQ1A 3EGKH 1CA0C 1EJAA 1O5DH 1QY6A 1RJXB 1G37A 1Z6EA 1MQ6A 3TITA 2H5CA 3RXIA 1A5IA 1ZYOA 4X0WU 1EFRD 1GI3A 2BOKA 3VPKA 4ZXXH 1KSNA 4M7GA 5E0HA 5HXFA 2ZZUH 4UDWH 2IPQX 1XX9A 5CHAB 1O2WA 4IGDA 3RXAA 3HK6B 3OEED 1GL1A 1BOQA 1NU7B 1TQ7B 1QURH 1S81A 1FN8A 4KGAA 3SZNA 2ZO3H 1KXFA 2VVVA 1TPAE 1TA2A 3L3TA 2BD3A 3MU1A 1P2NA 1SGDE 1MTWA 3OU0A 4FUIA 1Y5UT 5TCAA 1BB0B 4U30A 4K69A 3SZEA 2HNTF 3ZZBA 1EOJA 4DIHH 4ABFA 1XKBC 4I8HA 4MPWA 2VGCC 3ZYDA 1O5EH 4ABIA 3GYMA 1AE8H 1TFXA 2FYQA 1V2KT 1N8OB 1SOZA 2CF8H 3OTPA 3P8NA 4MPXA 2RCEA 1K28D 3L6PA 4INHA 4HTCH 4OS6A 1B7XB 1T4VH 1DFPA 3SV9A 2ZCHP 4F48B 2OCVB 3P92A 1SFIA 1O3DA 2FDAA 1ID5H 1ZRKA 1PPCE 2G00A 2ZEBA 3AW0A 4KTCA 2BOHB 1QA0A 3LH3A 1A46H 4UEHH 2VIQA 1ETTH 3QLPH 4MNXA 5DP7A 2GCTB 2BQWB 2EA3A 4TT3D 2D1JA 4X2YA 1QL9A 2PW8H 1MKXH 3UPEA 1XUKA 3LKWA 1V2MT 5HIZA 2ILNA 4MDSA 1C2JA 1IHSH 3W94A 2RDLA 2ZU3A 1L2EA 3TJUA 2A7HA 2G52A 1FI8A 6CHAC 1YWUA 1AKSB 3SNCA 1UCYH 3SV6A 1QQUA 1SKYE 4X2VA 4JYUH 2FESH 3K6ZA 4YLQH 4ZH8A 3OAAD 7LPRA 4JMYA 2GJGA 3B9FH 1HIAA 1CGHA 3WW7A 3PLBA 1NZQH 1S6HA 3T25A 3MWIU 1SQOA 3A8DA 2AMQA 1OOKB 1VZQH 1SI5H 3SJOA 2Z6BD 1SGFA 2F4LA
chains in the Genus database with same CATH topology
1TNHA 2BYAX 3LGTA 1GJ4H 4I33A 3SJ8A 4BTUB 1C1TA 3M35A 3P8GA 1C1QA 3CENA 1K1NA 1ZPBA 3DFJA 2SNVA 2M5TA 1GMHG 3DD2H 3S9CA 4DVAU 1LPZB 4WWYA 1GHBF 4X1SU 5DGJA 1ELBA 1GBBA 4UONA 2OUAA 1C1SA 1HJ8A 2G55A 1HPGA 1QB6A 1IQHA 4AORA 1ZTLA 3RM2H 2HWLB 1ZZZA 4JYVH 1P8VC 3PWBA 4ASHA 2O8MA 1NC6A 3SU6A 1HNEE 1ANBA 1VJAU 1LVMA 1E38B 1QQ4A 1ARCA 3B23B 1Y5AT 3A87A 4YOJA 4DT7B 1W10U 3K9XB 3KNXA 1QL8A 2JETB 3CS7A 5G4BA 4X6OA 4GUXA 3UR9A 2ZDVH 3PB1E 5EXNA 1CBWC 2VGCB 2ZHEH 2BZ6H 1GHAF 2C4FH 4NZQA 2LPRA 1A1RA 5E0GA 1PFXC 1QHRB 2W7UA 4BAOB 1PPZA 1E37B 1NRSH 2Y82A 1WAYB 1ZRBA 3SV7A 1UTMA 1PQ8A 1PQ5A 4ZMAH 1DSTA 1IQKA 3VB6A 1C4U2 1MKXK 1SMFE 1G2MA 1C2KA 1ZJDA 1HAVB 1QTFA 1K1JA 2ZECA 1J14A 2UUFB 3DHKH 4TPIZ 4XBCA 4CH8B 4F4OC 1H8IH 1OPHB 1Y5BT 1AFQC 1YGCH 1FV9A 3C1KA 2FTMA 4ABAA 1TMTH 3ESTA 4GSOA 4B2CA 2PHBA 3LDXH 3TJVA 1UCYK 5EW1H 1EX3A 1ZHPA 2DE9A 1TRMA 3SHCH 1O2QA 1O3OA 2ZQ2A 2P93A 1DX5M 1BUIA 3D49H 3UIRA 1GI4A 4FUBA 3E0PB 1FQ3A 1O37A 2TPIZ 3RXGA 2FODA 3O8DA 3SORA 2ZDAH 1V3XA 6CHAB 2BZAA 2ZHDA 3CP7A 4FUFA 1DWDH 1AUJA 1Q31A 1DLEA 2FOFA 1CVWH 1SGNE 4BANB 2BX3A 3GY4A 3GY5A 1AU8A 1G3DA 2HVXA 2ZFQH 3MTYA 1C2IA 2ZDMA 1ESTA 4H42U 2ZGJA 4HFPB 1SQAA 2VWLA 5LPFA 2HNTC 1E35B 1EAXA 1MKWH 3QTOH 1C1PA 1Z1JA 2PWXA 3M5MA 4Y0YE 1IQLA 2F9VA 3VB5A 3RU4E 2ALPA 3E1XB 2BTCE 4Y7BA 2XC4A 1DVAH 3FP8E 2ODYB 2G4UA 1KIGH 1V2JT 1NFYA 5HYOA 3HKJB 2ZHFH 1O3NA 4XE4A 4K1SA 2ZDLA 4H4FA 1GBAA 5B6OA 2UUJB 3TGKE 4YZUA 1KXCA 7GCHG 2XBXA 1O3EA 2HLCA 3A8CA 4YM9A 1QBNA 1GHXH 3PMAB 1C5YB 4MVNA 4NG9H 3SOSA 1G32B 4FUGA 3PMHB 4BAMB 1HAYB 1TMBH 1ANDA 1TPPA 3GCHC 2Q6FA 4FUDA 2Y5GA 3GDUA 3RC5A 3ZZ6A 4B71A 3PO1B 3LU9B 2P94A 1C1VH 4GHTA 1GBJA 4LZ1H 2V35A 1WOFA 2EI7A 2A7JA 8GCHF 3S0NA 5A8YA 1AGJA 3SU5A 1MTNB 1PQAA 4B2BA 1THSH 3N7OA 1VCPA 4CBOA 1IQMA 1KTTB 2PTCE 1EPTB 2AMDA 4ZAEA 2V3OH 4A92A 2PSXA 2SGFE 3BSQA 4LK4A 3V0XA 3E8LA 1EB2A 3MNSA 2FOAA 1PQ7A 1GHVH 4XOJA 2BVXH 9ESTA 1SG8B 4ZKRU 3LJJA 5L2YH 3QO6A 2HPQH 2QN5T 1L0ZA 1O3GA 1TOCB 4ISLA 1JIMA 2STBE 4DIIH 1ORFA 4DCDA 3MO3A 1AFQB 2PKAA 1JMOH 3GY6A 3E6PH 3P8OA 4UFFH 4Z0KA 2FX4A 1UHBA 1V2UT 2O8TA 4E7RG 2QXHA 1CU1A 2FEQH 1THPB 1GGDC 1GHZA 1RFNA 1O36A 1TONA 3TK9A 2AS9A 1VITF 3T62A 4FVBA 2VB0A 2PLXA 2BDIA 1P2JA 1D3QB 3UNRA 4X6MA 4CR9A 3LONA 2BXUH 2VNTA 1MKWK 5FX5A 1O5GH 2WPLS 1C2HA 2G81E 1P9SA 3RXTA 2QA9E 2GT8A 3RXOA 5F03A 4Y8YA 3RLWH 4Y11E 1UK2A 5C1XA 4E06H 2F9OA 3GCTG 3M7UA 3E0NB 3GY3A 1GJDB 5GDSH 3AW1A 3HATH 2ZU1A 1C2GA 1A0LA 2BD8A 1FY4A 1BCUH 1P57B 1NY22 1BTPA 3BTKE 1XKAC 1G2LA 1Z8RA 3RXLA 4O97A 2ZP0H 4JK5A 2ZFPH 3HGPA 1ZHRA 3V12A 5ABWA 1GBCA 3U8RH 1PPGE 3ZZ4A 5EQRA 3UR6A 2F9PA 3KCGH 2ZHWH 1HCGA 1HLTH 3ZZ5A 2W7SA 1BHXF 4HZHA 2FOMB 1PPBH 2NU3E 2FYRA 1TNJA 1A5GH 6LPRA 1HJAC 3RMLH 4Y76A 2ZHQH 1RTKA 3GCHB 4R8TB 1H9IE 3Q77A 1FY5A 4X6PA 1GBLA 1SQTA 4BXWA 1RS0A 1FAXA 2A4RA 4BAQB 1UVSH 4WXIA 4QT8C 1F7ZA 2J95A 1DLKB 1GCTB 2GVFA 1O3IA 1GBEA 1QRXA 1JOUB 3Q3KA 2H5DA 1OXGA 2ALVA 2BY7X 1OS8A 3MMGA 5JBTA 2D8WA 1BTWA 2ZPRA 2BQ7B 1P2OA 1C2DA 5TCCA 3BTEE 1P11E 1TNIA 1CO7E 4GHQA 1HAIH 4UFEH 1A5HA 2PKSC 3BTQE 2ODPA 1GVKB 4AX9H 1ELDE 5JBBS 2GCHF 3E90B 3NZIA 4J2YB 1W8BH 5FCKA 5PTPA 4Y71A 1CT2E 1WBGB 3H7TA 1CE5A 4DJZB 1N6YA 1ZGIA 3EA9A 3ATMA 3OSYA 3SU1A 1GGDB 2Y80A 3F6UH 3MI4A 4LXBH 1UVTH 3SHAH 3MYWA 1LPGB 1WU1A 1ZHMA 1O2TA 2C8ZB 1EP6A 1HDTH 3T5FH 1O5CB 1C5LH 4U01A 4OS2A 2ZFRH 3ATLA 1AIXH 1E0FD 1O2NA 2R3UA 4CH2B 2O8WA 1YPEH 1FIZA 5LGOA 4IW4E 1O2RA 1GJAB 3ZZ9A 1LQDB 2OQUA 3BTTE 4BAHB 2FP7B 1O2IA 1TRYA 4MNVA 1F92A 1TBRH 1OWIA 1TMUH 3SI4H 1G3BA 2ZKSA 4NIWA 4RKOB 1UK3A 5DP3A 1MAYA 1DE7H 5EOKA 1J15A 3LC3A 2WUCA 1UTQA 4OS4A 2H9EH 5DG6A 1C5SA 1O3PB 2BD9A 3ZVCA 3ZVGA 2SGDE 3O8BA 3L33A 4YOGA 4NGAH 8LPRA 1V2QT 1IHTH 1AUTC 2SGEE 1QFKH 2J2UA 4JZ1A 4NA9H 1RTFB 4XDEA 2O8LA 1TGTA 2HOBA 1PYTD 1GG6C 1ETSH 2UWOA 2CN0H 4E7NA 1SBWA 2FI5E 1OWEA 1GBHA 1SGTA 1L4DA 2FTLE 1TABE 1C1WH 4WMFA 4AN7A 4KTSA 5K0HA 3TVJB 5HGGA 1D6RA 1A3EH 4KKDA 4K60A 2SNWA 4X1RU 1LCYA 2JKHA 2ZTXA 3AAVA 1SOTA 1EP5A 4CRGA 1P01A 3SU4A 3RLYH 1C5ZB 1EASA 3T29A 4AFQA 1HIAB 2FS8A 3E16B 1WQSA 1TB6H 1F2SE 5FPYA 5T3HA 1GHWH 1CA8B 1DUEA 3A88A 2ZNKH 3HKIB 1C5PA 3LGUA 3RXUA 2ZGBH 3QDZB 4I7YH 6ESTA 3A7VA 3SO3A 3T27A 1NTPA 3BTDE 3P6ZB 3RXRA 2NU0E 4JZEH 4ABGA 1O2LA 1ZLRA 3U1JB 1XM1A 1DANH 1MQ5A 1SLUB 1BMNH 5EW2H 4GCHG 4YT6H 3B8JA 1H1BA 1P0SH 4IS5A 2OTVA 3LC5A 1O3AA 2P16A 3ZZ7A 2CHAC 4MG3A 1H4WA 1UK4A 2GDDA 3ATIA 1KDQA 2A7CA 2F91A 2WV4A 1A3BH 1EJMA 1W2KH 1S5SA 2H2ZA 5TJXA 4ZKNU 1MTVA 1F5RA 2VJ1A 4K5ZA 1TWXB 2G4TA 1EZUC 2WV5A 3SU0A 1AHTH 4X1QU 1W3CA 3OY5U 4CHAB 3LOXA 1C1RA 4I31A 4X6NA 1S84A 2QIQA 1GWAA 1S0RA 4PROA 5GJ4B 4H6TA 1H9LB 1TRNA 3LH1A 3MO9A 3MOCA 2J9NA 2QYIA 4A1TA 4MPVA 1DT2A 2D26C 3SGBE 1G36A 1JIRA 3RXMA 1K9OE 1YC0A 2PTNA 2C8XB 4FVDA 1Z8GA 1HBTH 1HJ9A 3DA9B 2QY0B 3UWJH 1MBQA 1UTOA 3RU4T 4D76A 1B5GH 1CHOG 1VR1H 2SGPE 2TGDA 3UFAA 4JYTA 3MNCA 2KAIA 3D23A 5JB8S 1CT0E 1QB1A 2WUBA 4AFSA 2OC8A 4KTUA 1JRSA 2AMPA 3CS0A 1GBKA 1DITH 1V2PT 1Y59T 3SNBA 1Y3UA 2F9NA 2F9UA 4ISOA 4K8YA 2FI3E 1GMCF 3TIUA 1GJ7B 4OS1A 2I6QA 2VU8E 3A7WA 3RC4A 3NUMA 4MPUA 3PWCA 4B75A 1FY3A 1HAOH 1HB0B 1TX6A 1LTOA 1DOJA 2XBYA 1YYY1 1CA0B 1LPKB 1ELVA 4A5TS 3IG6B 1KLIH 1O2GH 1IOEA 1V2RT 2P59A 2A2QH 3M61U 1PPFE 1XUIA 2VWNA 5F8TA 2NU4E 3GOVB 4ABBA 1ELEE 4ESTE 4ABHA 1W14U 1DM4B 3A85A 1C5QA 1VJ9U 4TY6A 3A89A 3VGCC 1V2TT 2FOGA 1YPKH 5GCHG 1YLCA 4OGYA 2R2MB 1BTZA 5FXLA 1MD7A 1IAUA 7KMEH 2CJIA 4NA7A 4ABJA 2A5IA 1FY8E 1GMDG 2C93B 2TGPZ 2Y7XA 5EXMA 2J94A 3JZ2B 1K2I1 4ZHLU 1O2SA 2BD5A 2QXGA 1AWHB 4F49A 1TGCA 1XUJA 1EUFA 2C90B 4WXVA 4X8SH 1HGTH 2Z3CA 5ESTE 3ZZ3A 3F9FA 1C1UH 5F8ZA 4CRCA 4Y8XA 3SU2A 1C5UA 3BV9B 3TGIE 3BTGE 2A4QA 2ZDNA 3FFGA 1FLEE 1ABIH 5ESBA 1T32A 1TAWA 5BRRE 1FY1A 3ZVAA 1D3DB 1QIXB 4BTIB 3QZRA 2YNAA 2OP9A 1OKXA 1GBDA 2BVSH 2A45B 2ZU5A 3A83A 1C2EA 5EQQA 2VWOA 3RU4D 4DGJA 2CF9H 1O0DH 1MZDA 4AG1A 1HV7A 3O8CA 1AFEH 2VIVA 4X1NU 3KQCA 4AYYB 2XW9A 3BG4C 2W3IA 1G9IE 1SLVB 4YO9A 1K1PA 1F0TA 4INKA 5E8EH 3U98H 2VIWA 1NM6A 3M7QA 1D3TB 1SHYA 3S9AA 3IITA 5HMAA 5C1UA 1W0ZU 4NSVA 1CQQA 2NWNA 3SQEE 1BRCE 1YPJH 4ABEA 2PKAB 1AKSA 2B5TB 4D9RA 1ZTJA 2F3CE 2Z9LA 1HAPH 1UHBB 3EYDA 2IPHA 1O3BA 2O9QA 4A7IB 1EZXC 2XWAA 1QB9A 1K1LA 1UMAH 2UWLA 1NRRH 3Q00A 1KXAA 1TGBA 1LKAA 1SHHB 1HXFH 1TQ0B 8KME2 1GJCB 1O2UA 1BJUA 2V6NA 2NU1E 5A2MH 4YOIA 4BXSA 1O2OA 3ELAH 4DG4A 4ISNA 3SGAE 1QR3E 3VB3A 1LHFH 2AFQB 1WTHD 3BIUH 1J17T 4XBBA 4Y0ZE 1BJVA 1XVOA 5EG4A 1THRH 3RMMH 4BTTB 3T28A 1O39A 4FUHA 1N6XA 1BZXE 2I6SA 1O5FH 5L6NH 1OP8A 1P2QA 3AVZA 5J4QA 2Z9IA 1UTKA 1C2LA 3NXPA 3SNEA 3ZZCA 2Y81A 2AIQA 1O38A 3M3TA 1C5OH 1B0FA 1D9IA 3A82A 3BEUA 2BDCA 4XSKU 3SUDA 1ZPZA 4K8BA 4FU7A 5AVDA 4CRDA 1TLDA 1ELCA 1S85A 4Y8ZA 1WUNH 2GKVE 4JZDH 1CBWB 1TNGA 1GJ5H 4H6SB 1KXDA 2QC2A 1NN6A 2DE8A 1XUHA 1LDTT 1B0EA 1TBZH 3TLOA 1YPHC 1D4PB 4NFFA 1C9TA 1KXBA 4O3TA 5C67A 3SNAA 1VITH 2G51A 3R3GB 3SI3H 3FVFB 6GCHG 2F9BH 2EC9H 3GDVA 1GJ8B 3VFEA 1ZGVA 4K1TA 1O31A 3V7TA 5E2PA 1AVGH 4TY7A 3KIDU 2FXRA 3D65E 2ZTYA 2GTBA 3BG4B 2GV7A 2OC7A 3F9EA 1LHDH 1O30A 2BDBA 4RN6A 2A4GA 1XMNB 2FOBA 1O5AB 2CV3A 2Z9KA 3TJNA 1UVUH 2HGTH 4YESB 3SUFA 2EI6A 1P09A 3K65B 1TNKA 4JK6A 2WYJA 3QWCH 3PMBB 1GMHF 2OQ5A 1UVOA 2IN2A 1O3MA 1VCWA 1XUFA 3BTWE 4D7FA 2A2XH 4Q7YA 1YPGH 1TOMH 2GDEH 4A6LA 2TIOA 1CHGA 1MH0A 1GI7B 1T31A 3GY7A 1P12E 2HNTE 3SBKA 1GI8B 1E34B 2Z94A 1PPEE 1BTHH 2B0FA 2BY6X 1RGQA 3F9HA 3ENSB 5F8XA 2H1UA 3UNQA 4AFUA 3PMJA 4ZHAA 2TRMA 3MH7A 1G3CA 1SL3A 3NWUA 2G8TA 3FAOA 1NU9A 1BTUA 1EXFA 1YF4A 1F0SA 3PLKA 2BD4A 1FUJA 1EAIA 2ANMH 1ZPCA 2OC1A 1A2CH 3I77A 2FMJA 1K22H 2Y5FA 3RC6A 2G5NA 3TU7H 4AB8A 2QF0A 4DW2U 1NPMA 2XXLA 4X2WA 3RUOA 5C3NA 3SV8A 1GJBB 1UVPA 5ETXA 1AB9C 1L1NA 3BTHE 3UTUH 1DXWA 3RXPA 1K1IA 3QZQA 2RA0A 3SV2H 4UE7H 1GDNA 1P9UA 1T8MA 2P3UB 5HM9A 3UQVA 1AY6H 2WPKS 2K1QA 1ZSKA 2A5KA 3M36A 3V13A 2VH0A 2ZFTA 5AFZH 3W95A 1FN6A 1GVLA 1GHYH 4JZFH 2XC0A 3KN2A 2AGIX 3UREA 2R0LA 3TH4H