3UOUA

Crystal structure of the kunitz-type protease inhibitor shpi-1 lys13leu mutant in complex with pancreatic elastase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Three-dimensional Structure of a Kunitz-type Inhibitor in Complex with an Elastase-like Enzyme.
pubmed doi rcsb
source organism Stichodactyla helianthus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA01
3ZZAA 4ZH8A 1TRMA 1VITG 1GBBA 5FPSA 4NCYA 1P11E 2BQ6B 1EZUC 3MNBA 4ASHA 2NU2E 1GHAG 1QL8A 1FY8E 2FX6A 2VVUA 2D8WA 2GT8A 2ALPA 3BTKE 1EPTA 3RXRA 5HXFA 1LKAA 3TGJE 1IHSH 4OS5A 4H4FA 3LH1A 1DY8A 1TONA 1SQAA 2BX3A 1WOFA 3OU0A 1A3EH 3TNSA 5JBCS 1O3DA 1V2RT 1CU1A 2XWAA 5C1YA 2DE8A 4XFQA 1EOLA 1MKWK 1O3EA 3KF2A 4INHA 1UVSH 1L4ZA 3DA9B 2FX4A 3RMLH 1TWXB 1NRQH 3A83A 5EXNA 5EXLA 4ISLA 3ZZCA 3T29A 4YTAA 4A1XA 2W26A 1G2LA 1TIOA 2VNTA 1VITF 3EQ0H 3SUGA 1K1PA 2QXJA 1AVXA 2ZU5A 3UOPA 1GJAB 3FFGA 5EODA 3I29A 5AF9H 4A92A 3I77A 3PV4A 4UEHH 3NZIA 3MTYA 9LPRA 1YPJH 4X2WA 3RU4D 3ZZ6A 1DS2E 2OTVA 1E36B 1XKBC 3NWUA 2H9TH 1MTUA 5BRRE 4DURA 1OP8A 1PQ5A 2R0KA 1HXFH 2XBXA 1OP2A 2Q1JA 1W11U 4DGJA 2FMJA 3HK6B 4BAMB 1SGFG 1TA2A 2RA0A 2UUYA 4I8KA 4D76A 1F5LA 1E0FD 3SUFA 2BDBA 3MU1A 1NZQH 2TIOA 4ISIH 4IMZA 4UFEH 3VB3A 3LOXA 3KL6A 3A7VA 4INLA 2C8XB 4Y7AA 3PMAB 3FANA 5HYOA 3O8DA 4UFGH 1BQYA 3RXQA 2R9PA 1IQHA 1JXPA 1CGHA 1MQ5A 1ZSJA 2Z3EA 3LT3A 3LGTA 5GWZA 1SC8U 2J92A 1C2EA 1W13U 1BBRK 3AAVA 3UR6A 3SQEE 1XXDA 3M3SA 1NFUA 1S81A 3ENSB 4WJG2 1FMGA 1O30A 3IITA 3LJOA 1Y3WA 1C5WB 1QR3E 1IQFA 3F68H 2ZU4A 4XSKU 2SNWA 3P70B 2G4UA 4QT8C 3JZ2B 1FV9A 1O3IA 2W7UA 1IHTH 3E0NB 3SOSA 3UR9A 1V2TT 1GI4A 1C9PA 1VZQH 3BIVH 1HB0B 2GV6A 4JYTA 3MU8A 4UFFH 3E91A 1O35A 3EA7A 1O2VA 1GVKB 1THRH 1SFQB 2BLVA 1XMNB 4KP0A 1AD8H 1C5NH 3LKWA 4WF8A 5T6DA 1O2PA 1NFWA 3SN8A 1GMHF 1PQAA 2FESH 3P8FA 1O2ZA 3JZ1B 1D9IA 4NA9H 4Q7YA 2GZ9A 1GBAA 1JIMA 3STIA 3HATH 2JETC 4TWYA 1GMCF 4Y10E 1P2OA 1JRTA 2W7SA 2Z6BD 1QRZA 1P12E 2GMTC 4ZKRU 1OPHB 1C9TA 6GCHG 3RC4A 1O3PB 1P2IA 1N6XA 1ANDA 1T31A 8KME2 3RXGA 1W7GH 1AB9B 4H42U 3BN9A 5ABWA 5FCRA 1G36A 1SGYE 2YNAA 4UE7H 3M7QA 1Y8TA 1ELAA 2WPKS 2GDEH 1NRSH 2F9BH 4MDSA 4U30A 3QX5H 2OINA 4NZLA 1DWEH 1TLDA 1ELTA 5C67A 2ZIQH 3GY3A 4VGCB 4DY7B 1QFKH 1H4WA 4I8HA 4JK5A 4UDWH 1HBTH 2G51A 4CRBA 2SNVA 1IQJA 2B8OH 3MMGA 3N7OA 2KAIA 2FM2A 3SU6A 1Z8GA 3MH6A 5IDKA 1HPGA 6GCHF 2Z94A 5A8YA 1A1RA 2FZZA 3SO3A 1SGNE 1C1RA 3L6PA 2TRMA 3BTME 1C1QA 1O3MA 1WAYB 1GGDC 2ZFPH 4KTUA 4B1TA 1CBWB 1V2PT 1FAKH 2DUCA 3GY7A 4CH2B 2ZHDA 1HAHH 1DOJA 1QB1A 3M3TA 3S9CA 5CHAC 4FUDA 3RUOA 1MAYA 4MQAA 3LDXH 1AI8H 1ZSLA 2R0LA 2GKVE 1OS8A 3MH5A 3ZYDA 5L6NH 4NSVA 3GCHB 3B9FH 1K1OA 1SQTA 3RC5A 3TJNA 2BZAA 2QXHA 1ZHMA 3RXPA 1YKTA 1L4DA 1H1BA 2OQ5A 5C1XA 3KEEA 2ZU2A 2HNTF 1GBHA 5DK1A 2Q6FA 1S0RA 4ABIA 1ELEE 4ZROA 1K1NA 2ZQ1A 1QNJA 1TQ0B 1QTFA 5A2MH 1GBEA 1SHYA 1O3KA 2ODYB 1C5ZB 2LPRA 1MU6B 4DJZB 5DG6A 1SMFE 2V6NA 2P8OB 1O2HA 1AVWA 1V2QT 3VGCB 1BHXF 3RXHA 1Y3UA 3PO1B 1NROH 2WV5A 1ZRKA 1YPHE 1UTPA 3SU5A 1LKBA 4A1TA 3M36A 1FN6A 1ZMJA 2QN5T 2ZKSA 4ABHA 3ZVAA 4MG3A 1BMLA 1ETSH 1VCQA 5F6MA 1DWBH 2VWNA 6ESTA 1HRTH 3U8RH 1EUFA 4JZEH 1ETRH 5JB9S 2BQWB 2P3UB 2QV1A 2RDLA 3HKJB 4RSPA 3DUXH 5E0GA 1IQLA 1SGCA 2AYWA 2CHAB 3PMHB 1YBWA 5JBTA 4AFQA 1W2KH 2AFQB 2C4FH 1CA8B 4RKOB 2A7HA 4MPUA 1OP0A 3A8DA 3B8JA 2SGFE 3SHAH 4X8UH 4AG2A 1EAUA 2P59A 5EQSA 4JYUH 5A0AE 4I7YH 3QGNB 4BAOB 1MAXA 1YPKH 1D6RA 1P09A 2XBVA 3URCA 5C2ZA 1C2LA 2FP7B 2Z7FE 1FI8A 2BX4A 1BTPA 1J17T 2THFB 4ABBA 3O8RA 1BUIA 1ANBA 4JMYA 1FIZA 4NA7A 1J9CH 1BTZA 3QTOH 6CHAC 1UTJA 1KXEA 1UK3A 1QA7A 3TPIZ 4F49A 1GI8B 4CHAB 3L33A 4FUGA 1BHXB 2BVRH 2PFEA 2BOKA 1C1TA 3GCOA 2DE9A 2G4TA 1DICA 1AIXH 1EP5A 4TPIZ 2JKHA 3M3VA 4ISHH 2OC0A 5DP7A 3SBKA 3ODFA 1SI5H 3SUEA 1H9HE 4A5TS 3PTNA 3RLWH 4X1RU 4U01A 1GG6B 1N1LA 2SFAA 2AS9A 1E35B 4Q7ZA 3F6UH 1UVTH 2H9HA 1GHVH 1NU9A 5EGMA 3VEQB 3RXFA 2A4OA 3SNDA 3UNSA 3DT0H 2EI7A 3ZV9A 2JH6D 1WTHD 2C93B 5E0HA 5CMXH 1HJAB 4OGXA 2H5CA 1JRSA 1GVLA 2H2ZA 4XE4A 5GDSH 4NWKA 4U2WA 1KLIH 3NCLA 1ELFA 3Q77A 5FPTA 3R0FA 4KTSA 3FZDA 3V12A 1JBUH 1DANH 3U8OH 2OBQA 1XVMA 1ZPCA 1ZJDA 4MPXA 1SR5C 2C8ZB 1GCTB 2Y7ZA 3DHKH 1UK2A 2H6MA 1P03A 3H5CB 5ESTE 2VIDA 1KXFA 1Y3XA 3QTVH 1HIAB 4GVUA 3IG6B 5FX5A 1RJXB 1HFDA 1BITA 4K8BA 4K1TA 2OP9A 2BVXH 2P3FH 4CREA 1BTYA 3QGJA 1HAZB 3E16B 1WV7H 1RRKA 2IPHA 1TX8A 2WPIS 3ITIA 3UIRA 1FJSA 1O3GA 2XBWA 5ETXA 3K6YA 3ESTA 1TB6H 4K69A 1H8DH 4CRAA 1V2JT 2P3TB 3T2NA 1YCPH 2PKAA 1NU7B 2QF0A 1O2IA 1A4WH 2NU1E 1W7XH 1J16A 1BBRE 3E90B 5AFYH 1BJVA 3U69H 4FU9A 1YPGH 1C5YB 5C1UA 4THNH 2C8WB 4IC5A 1C1MA 2EC9H 2PUQH 4LOYH 1BOQA 1PPHE 5GCHG 1D6WA 1L0ZA 1PQ8A 1T8MA 1AU8A 4CBOA 1W10U 3S0NA 2ANYA 4YM9A 3O8BA 4WMFA 3GDUA 1DXWA 4CR9A 2XXLA 1QA0A 3PYHA 3D62A 5C20A 5HMAA 4E06H 2BY7X 1NC6A 1SGDE 2A5IA 2ODQA 3QZQA 4CRDA 2ZA5A 1T8NA 1TBRH 1HIAA 2BQ7B 4I33A 3UTUH 9ESTA 1NT1A 1GMDF 1HYLA 1MH0A 2PSXA 1GBFA 1SVPA 3GCTG 3M7TA 1SGEE 1TGNA 1Z6EA 3RC6A 3SU1A 7ESTE 1BB0B 2GTBA 4FVBA 3MH7A 4YOIA 2GV7A 2GP9B 2WYJA 3A88A 1H8IH 2RG3A 1AUJA 2A4QA 2VGCB 3A7ZA 1XUKA 1Y5UT 3OTJE 3M37A 1LHEH 2ULLA 1AVGH 3A84A 4ESTE 3SU0A 3D23A 2BDIA 2P95A 1BRAA 2PLXA 3UOUA 4FXGH 3BG4B 1XVOA 3GY8A 1V6DA 1C2JA 3GDSA 5A8XA 4AFZA 1C4V2 4HTCH 2WUBA 1L1NA 4I8LA 3A8AA 2QA9E 1A0HB 3ZV8A 2ZHQH 5K7RA 1LMWB 2G81E 2R3UA 4WH6A 2H9EH 3D49H 3SV7A 2G5NA 1K2I1 1LTOA 1BDAA 5TCAA 1EZQA 1DLEA 1WCZA 3TU7H 4MLFB 1EJMA 1VGCB 2XNIA 2OUAA 2Z9JA 1GI1A 1AKSB 1EXFA 3D65E 5GPIB 1TNIA 1LPGB 2SGEE 3CS0A 1ELBA 4ZHLU 5DP8A 2A0QB 1IQNA 1NO9H 3SJOA 2XTTB 3S7HB 2HPQH 4MTBA 1ARBA 1FONA 1GBLA 1AFQB 1F7ZA 4LK4A 1O34A 1Y3YA 1OSSA 1P0SH 2QYIA 2ZF0H 3VB5A 1GI7B 3VGCC 1OKXA 5DO4H 3PO1C 3F9FA 2EI6A 4NFEA 1VCPA 4YT7H 1LCYA 1XUHA 4Q7XA 2ANMH 2CF8H 3V7TA 2V35A 1C2MA 1PYTD 4Y79A 1RFNA 3SU2A 1GJ6A 1D3DB 1P9SA 4AYVB 5B6OA 4XBDA 1GHBF 2BDYA 4GCHF 3K65B 1O2TA 2VB0A 1RTKA 3M61U 3TLOA 2GVFA 4YO9A 2BMGB 2Z3DA 3TK9A 4UFDH 1E34B 1QQ4A 1GHAF 2CHAC 1O3BA 4B2AA 2TPIZ 1GJ7B 1PPZA 1SLVB 3C27B 2CXVA 1TAWA 1AKSA 3SORA 1K1IA 1ESBA 5DP3A 2VVCA 1QHRB 2ZDVH 1KXAA 2CN0H 5JPMH 3LGWA 4JCNA 1DITH 2HNTC 1ANCA 1NFXA 4K60A 5DP6A 1P06A 2ODPA 4NG9H 3GY6A 1O2RA 1MTNB 3UNQA 5JBBS 3KCGH 1V2ST 1MMJN 3SNEA 1GI6A 4GLYA 1RD3B 5JB8S 2ASUB 1XKAC 1HJ9A 1O5BB 3M35A 2ZTYA 3V3MA 1C2IA 1EZSC 1G3DA 3RXBA 1GBCA 1C5LH 1QRWA 3A89A 3SV8A 2F9OA 1TX6A 4J1YA 4Y71A 2Y82A 4OS2A 2FYRA 1H9IE 4X2VA 3K6ZA 4XBCA 1P04A 1FPCH 3OYPA 2XYAA 7GCHG 1GG6C 1S85A 3HGPA 1P2MA 1B0FA 1Q3XA 1THSH 4R0IA 1UCYH 3RMNH 1C1VH 1O3AA 2R2WU 4KGAA 3SI3H 7LPRA 2A5AA 1VCWA 2BOHB 3LU9B 4WXIA 3RXDA 2NU0E 2J94A 4OS6A 1NFYA 3TH2H 2CMYA 1K28D 3AVZA 3RU4T 1HLTH 2BY8X 1HJAC 3KN2A 1QBVH 4WMDA 3NK8A 3P95A 1K21H 3TITA 3MU0A 1TFXA 3BTTE 1JIRA 5F8XA 1C5SA 1EP6A 1O5FH 3HKIB 2BY5X 2NU3E 2BYAX 2KAIB 1YP9A 5AFZH 1C5VA 2BD4A 1O2GH 3MOCA 1UTMA 1B5GH 3A7TA 1GBIA 5F8TA 4UD9H 3DFJA 1IQMA 4DCDA 3ATMA 5F8ZA 4SGBE 1GCTC 4BAHB 3E0PB 1FY4A 2PUXB 1GJBB 4X8VH 1O2KA 1IQGA 3SUDA 1C2GA 5E2OA 3RXLA 3BG8A 1DPOA 4BAKB 2BZ6H 4OS4A 3OY5U 1WSSH 1RIWC 4CRFA 2ZPQA 4ABJA 1F0SA 1YCPM 2ESTE 1K1LA 3T27A 3BTFE 1DLKB 2STBE 6LPRA 3U9AH 2FODA 4ZXYH 2AERH 4ZKNU 4BXWA 2W3IA 2ZI2H 5BPEA 1PYTC 1P2JA 1T4UH 3ZVCA 1SOTA 5J4SA 2UUFB 3LGVA 2VIVA 1C1NA 1O0DH 1BMMH 4FUJA 3W95A 1PPCE 1SHHB 2BHGA 2O8MA 4KELA 5AHGH 5DP5A 1SLUB 1YPHC 1NRPH 1WQVH 2FOEA 5GXPA 4X6OA 1CVWH 1W12U 1P2NA 4O97A 1HAGE 3VXEH 2J38A 1BTXA 4NIVA 3V13A 5FBIA 1FPHH 1ZPBA 1HAVA 2C8YB 1MUEB 1S6FA 2P93A 1FY1A 5DPAA 3MI4A 2GCHG 2BY9X 2BXUH 1WQSA 2FDAA 2I6SA 4K1SA 1Z7KA 1G32B 2ZFQH 2J9NA 4AFUA 1G37A 3KNXA 1ZTJA 1S84A 5CE1A 4I8JA 1BMNH 1NRRH 1D3QB 1TE0A 3KQEA 4X1PU 3EAJA 3FP8E 1V2KT 2VWMA 2A45B 4YT6H 2J95A 2D1JA 1YPLH 4ZHMU 1O2NA 3BTEE 3GYMA 4BXSA 2GCTB 1ARCA 4BOHA 1Z8RA 1O2LA 1EPTC 3BTDE 3T62A 1P8VC 1BRUP 1XM1A 1O3OA 3ATLA 1N8OC 3MFJA 3BTHE 2SGPE 4SGAE 3SV6A 1ELCA 2ZEBA 3RXVA 5DP9A 3MNXA 3BG4C 2UUJB 5PTPA 2RA3A 5K0HA 3SJ9A 2C3SA 4X6MA 4OGYA 3MNSA 2HLCA 3AW1A 4HFPB 1ZTLA 1BT7A 1O3HA 3A7WA 1TRNA 5LPEA 3SNCA 3A8CA 1WBGB 2STAE 3RXJA 4JYVH 4YOGA 1DE7H 1PQ7A 3DD2H 2IN2A 3NPSA 1FY5A 1EB2A 1ZHPA 1OXGA 1YYY1 5FHTA 2VIOA 1TQ7B 2FI5E 1W0ZU 5EQQA 2ZWLH 3ZVFA 1T32A 1TPPA 1QJ1B 1S82A 2ZGXH 2IOTA 1V2VT 1KTTB 2Y5FA 1GBMA 3RXMA 2AMQA 4B2CA 1C1OA 1BRCE 1VITH 3CS7A 4TYDA 1CA0B 1O3JA 1S6HA 1S83A 4PROA 4BANB 1MTSA 3RM2H 1WUNH 3FZZA 3LH3A 4B2BA 1Z71A 3TGIE 2BB4A 4H6SB 1JMOH 1LHGH 2BD2A 1V2OT 8ESTE 2CJIA 1EAXA 1UO6A 1CGIE 2VU8E 2PHBA 1YCPK 2R2MB 1MQ6A 1AQ7A 3QUMP 1DVAH 3AW0A 2XCNA 1Z8IB 3BV9B 2WPJS 3P8OA 1OWEA 1ZR0A 1O33A 1AE8H 4K3JA 3ODDA 2JH5D 2V3HH 4CRGA 1LDTT 2A2XH 1O3FA 1ZZZA 3QO6A 1SLXB 4LZ4B 1SL3A 2GD4B 3RXTA 1O38A 1OWHA 3EA9A 1W0YH 3M7UA 4M7GA 1AUTC 1AY6H 3WY8A 1O2SA 1YLDA 2BDCA 2VH6A 2ZDNA 1P01A 2Y5HA 3EGKH 1RXPA 4Y0YE 1THPB 1IAUA 2O8UA 1TNHA 5L2YH 1GHYH 1F92A 3KGPA 1EX3A 1LPZB 1VJAU 2PTCE 1RGQA 4BTIB 2TGDA 3GY4A 3A8BA 1P3EA 2ZC9H 2NWNA 3TK6A 2G52A 1UMAH 1TNLA 1F5KU 4DG4A 1GL0E 1SPJA 3M5LA 3MNCA 2BD7A 5JDUB 3GY2A 2AGEX 4DT7B 2PKAB 1CO7E 1CT4E 4YLQH 2FOAA 4AGKA 1GHZA 2Z9KA 1BCUH 5DJ7A 1X7AC 2ILNA 1SGRE 4O03A 1HV7A 3SGQE 1V2UT 2VJ1A 3QDZB 2XC0A 2AIPA 3RXEA 1NS3A 1TRYA 1P2QA 2BLQA 4ABAA 5T3HA 4D7GA 1TMBH 4D8NA 1FXYA 1J8AA 4MNVA 1O32A 5EPNA 3E6PH 4RKJB 2NU4E 2GT7A 2A7CA 3KQDA 4E05H 4K8YA 1LVMA 4O3TA 1EOJA 2ZQ2A 1PFXC 1G3EA 1O5GH 2ALVA 2H5DA 3E8LA 2B5TB 2ZPSA 2F3CE 1ZGIA 1LQDB 2HGTH 1Q2WA 1TYNA 1DFPA 4BTTB 2WPHS 1C5QA 4NWLA 5TCCA 1C5PA 5FX6A 2OC8A 4Y8XA 2BVSH 1INCA 1K22H 3A82A 3ZVEA 1GI3A 2FOCA 2JETB 4Y8YA 5LGOA 2HVXA 1HJ8A 2GMTB 4NA8A 3U98H 3MH4A 5J4QA 1YPMH 1C2KA 1HAXB 3HGNA 3KQCA 3P8NA 3Q3XA 1MCTA 3RXSA 1C1UH 1P57B 1MKXH 2FEQH 2BY6X 3UQVA 2K1QA 3GOVB 3ZVBA 5DKMA 1EASA 4Y76A 3PWCA 3MO3A 2BD5A 4B74A 4IN1A 1Y5AT 4MPVA 4KKDA 3MU5A 1HDTH 1OYTH 3A7XA 1KSNA 5HM2A 1GBDA 1Z6JH 4Y8ZA 5EU8A 1PJPA 2VIPA 1U6QA 1GWAA 4O9VA 1RTFB 1F5RA 1XUGA 1AB9C 1TBZH 1ETTH 3BEFB 1F0RA 3G01A 3SV9A 1MD7A 2A32A 3T28A 1SGPE 2SGQE 1G3CA 1GVZA 1GJ5H 3BSQA 5L2ZH 8LPRA 1V2NT 4VGCC 4B76A 2J34A 3E1XB 4B75A 1UHBA 4JK6A 2F9VA 4DIHH 3QN7A 4XOJA 5EOKA 5GCHF 1D3TB 1SOZA 3K9XB 1O3LA 2G5VA 1QJ6B 4DW2U 2ZTZA 5EW2H 1TPSA 1HAPH 1ZLRA 2WUCA 5CHAB 4A6LA 5EG4A 4BTUB 4JZ1A 1MD8A 3UPEA 1C1WH 2WV4A 2HOBA 4GHQA 4YZUA 1CBWC 2Y80A 4JZIA 1HAOH 5HGGA 3BTQE 1FN8A 3NUMA 2VIQA 1OWKA 1O2JA 3GCTF 3UWJH 4AFSA 1TGCA 2WPMS 2QIQA 3RM0H 1LHDH 3RXAA 3TH3H 4D7FA 1ELGA 4AOQA 1TOMH 2OD3B 1QIXB 1JOUB 3SGAE 1OWIA 3GCHC 2GCTC 4O3UA 1UCYK 4FUBA 1TBQH 1KTSB 3M5OA 1PPGE 4ISNA 1GJ9B 1YLCA 2ZFTA 2FIRH 1O5AB 1ZMNA 1Y5BT 2ZHWH 4CR5A 4IMQA 3ZZ9A 2JH0D 3FVFB 1OX1A 2PR3A 2WYGA 1TALA 2FOMB 3GISB 1DWCH 3KHVA 2O9QA 2ZFRH 1W14U 2BD8A 2VWOA 2GDDA 3SJ8A 4AORA 3NXPA 2P8OC 2QCYA 3ATWA 2TGAA 4I8GA 1BTHH 3BEIB 1KY9A 1YPEH 1K9OE 2UWOA 1EB1H 2FI3E 3A85A 3PWBA 4X1QU 2A5KA 4GPGA 4AG1A 2OXSA 4MVNA 1GI5A 4NIXA 4MNYA 3UNRA 1CT2E 2J4IA 2BM2A 4FVDA 2A2QH 1TOCB 1AZZA 1GHXH 1NPMA 5FPYA 1NY22 4X8TH 2CGAA 1C5OH 1BMAA 3BIUH 1CA0C 2BLWA 2PWXA 3Q3KA 4AGJA 3RMOH 1A0JA 2ZGJA 3LGUA 3TJUA 4A1VA 1LPKB 4BAQB 2VINA 1SLWB 2VWLA 2QXIA 1NN6A 1F0TA 1TGSZ 4WMEA 2PGQB 3B23B 4WXVA 2FPZA 2ZNKH 5EXMA 6CHAB 3VB6A 3TK5A 1ESTA 1IQIA 4ZXXH 4B71A 5A8ZA 1MTWA 2TGTA 1G9IE 5IYTA 4TWWA 2OC1A 3BF6H 5F03A 3E3TA 1O2XA 3A81A 3SJIA 5LPFA 2WINI 3KQBA 1A61H 1HNEE 1SGIB 1UVOA 1KDQB 3HK3B 1UVUH 1DDJA 2LNCA 5AVDA 2PKSB 2H1UA 3FP7E 3TH4H 4CHAC 3UQOA 2Y7XA 3GCNA 1ZJKA 3RMMH 3RXKA 1O31A 3ZZDA 3UFAA 2D26C 5TJXA 2HALA 2ZHFH 1AWHB 1A3BH 4INKA 4X6PA 2AEIH 3W94A 2Z9GA 3IWMA 1FAXA 4X2YA 4HZHA 2QC2A 1IQKA 1LVOA 2ZO3H 3RXUA 3EDXB 3A7YA 4ZMAH 1E38B 2FS9A 4FU7A 1C5XB 1T4VH 3RXIA 2AH4X 1DT2A 3M5NA 3LGIA 4GSOA 1GBJA 3P92A 1ZTKA 1SG8B 4XDEA 1F2SE 3SHCH 3P8GA 1QJ7B 4K1EA 1QBOA 2YNBA 3PLKA 4HI3A 1GMHG 1UK4A 1F0UA 3PTBA 4CRCA 3UWIA 1TMTH 1DUEA 2TGPZ 1TPAE 1S0QA 1EKBB 1GMCG 1HAVB 2FTLE 1VJ9U 4IBLH 1EJNA 2PW8H 1N6YA 5GJ4B 2CV3A 1KDQA 4FU8A 1C4U2 1ELVA 2ZFSA 4YOJA 7GCHF 2ZZUH 1NESE 2Z9LA 3AAUA 1QQUA 1V2LT 2ZFFH 5T6FA 2EEKA 2QXGA 3OSYA 1HCGA 2OQUA 3EYDA 1A7SA 4FUFA 4DIIH 1DM4B 1GI0A 2Z9IA 2C90B 1AN1E 4B73A 2FWWA 2B0FA 2ZDAH 1D3PB 1P05A 1O2QA 4Z0KA 3ELAH 4Q80A 3GY5A 4AZ2B 2W3KA 4ABEA 2V0BA 3LC5A 4ZKOU 3H7TA 1C1PA 1C5UA 1MKWH 2XWBI 3MYWA 1O3NA 2HNTE 3K2UA 4FUEA 4NSYA 3S69A 5L30H 1ESAA 3EE0B 3TJVA 1MTVA 2VH0A 4ABDA 1LHFH 3MWIU 4F4OC 1FZZA 2FO9A 2BDHA 1CE5A 3UY9A 4GHTA 1KIGH 1DY9A 1EQ9A 1WTGH 4JZDH 2ZU1A 1AO5A 1KYNA 5H4IB 3T26A 5JBAS 2FOHA 4E7RG 2B7DH 2PTNA 4KTCA 1C5RA 1DWDH 2Q6GA 3A87A 4ZKSU 1QURH 1AGJA 3TJOA 2EI8A 1A5GH 3AASA 1TNJA 4GAWA 3L3TA 5LPRA 2FTMA 1TNKA 5C5OA 1S5SA 1BA8B 2ZGCA 1GI2A 3SI4H 3T5FH 2ZDLA 2OLGA 3ZZ5A 1AE5A 2A7JA 1OWJA 3BTWE 5LH8A 2XRCA 2ZG0H 1TNGA 2BLOA 1G2MA 1UTKA 1UTQA 4MPWA 1J14A 4I32A 1A46H 1KXCA 1L1JA 2HWLB 5A0BA 2VGCC 1FNIA 2AIQA 3LJJA 4Y11E 1KXDA 4X8SH 3VPKA 2QY0B 1QB6A 1BBRH 2PGBB 4E7NA 1W3CA 3LC3A 2QF3A 3ZZ4A 1ABJH 1ZOMA 1LVYA 3EA8A 1O5DH 1MBMA 1EAWA 2GCHF 1C5MD 3VFEA 2TBSA 3PB1E 1SGQE 2VIWA 2D2DA 2XCFA 4U32A 4IW4E 1CGJE 1DXPA 1A0LA 1XXFA 1SGFA 4HGCA 4J2YB 4FUCA 4IC6A 1D4PB 4AX9H 2P94A 5SGAE 1YC0A 1BRBE 3SU4A 2BDAA 2F9PA 5I25A 1G3BA 2ZPRA 1BJUA 4Y7BA 2ZU3A 1CT0E 5E8EH 1VGCC 1H9LB 4AYYB 8GCHG 1T8OA 1FQ3A 2B9LA 4AN7A 1ZGVA 4NIYA 4A7IB 2FOGA 4BNRA 3O8CA 2F91A 1A5IA 2GZ8A 1O2OA 2BTCE 1GJCB 1C2FA 4X1NU 2FOBA 2OBOA 4MNWA 5C3NA 1LQEA 4JZFH 1ZRBA 1L1GA 4DOQA 1CHOG 2RCEA 2M5TA 1C1SA 1SGTA 4YESB 3PLBA 4Y6DA 5C5NA 3ZZ7A 3FP6E 4AB9A 4K2YA 3RDZA 2XBYA 1AFQC 1KXBA 1QGFA 2O8WA 1IQEA 2A4GA 3PMJA 1OYQA 4LZ1H 3RU4E 2ZGHA 2QGRA 3SW2B 3VB4A 1L2EA 1ID5H 3MO6A 2PV9B 3ATIA 1QY6A 1MKXK 2F9UA 1ELDE 4NFFA 2A1DB 1UCYE 3URDA 1XUJA 2BDGA 8GCHF 1T8LA 1ZHRA 2FLBH 4YLUA 2AGGX 5E0JA 1UTOA 1P02A 1ABIH 3A80A 3LONA 2XW9A 3S9AA 1P9UA 1PPFE 3U8TH 2ZHEH 7KMEH 3ZZ3A 1FLEE 2ZECA 3GICB 1TA6A 2ANKH 1GL1A 1PPBH 1CHOF 2QAAA 3V0XA 5GIBA 3U1JB 3F9HA 1KLTA 2EA3A 2F9NA 1MCVA 2PSYA 1DUAA 1YGCH 4XBBA 1E37B 1GPZA 2XC4A 2ZP0H 1RTLA 1LHCH 2WPLS 4WWYA 4MNXA 1OOKB 2ZCKP 3Q00A 3ATKA 3PM3A 2SGAA 1Z8JB 3F1SB 1O37A 1AFEH 1EATA 1WYKA 1P10A 2Q6DA 1BTWA 3KIDU 4Z6AH 3BEUA 2I6QA 1OWDA 1TMUH 2A31A 3FAOA 1MTNC 1G30B 1ZYOA 1A2CH 4GUXA 4ZHAA 2V3OH 3F9GA 1O2MA 2FXRA 1K1JA 4K5ZA 4TY7A 5E2PA 1B7XB 4D9RA 2PKSC 3SNBA 1ZMLA 1GDUA 1O5CB 4RN6A 1UTLM 2FLRH 4NZQA 5EPYA 4X1SU 3OX7U 2ZCHP 4ABGA 1Z1IA 1UJ1A 1HXEH 2HRVA 4ZUHA 2CF9H 5ESBA 2IJOB 3A86A 4Q2KA 2ZDMA 3PROA 1NRNH 3PLPA 3SQHE 2UWPA 3R3GB 5A0CA 1SBWA 1AZ8A 1BTUA 1V2MT 2J2UA 2O8LA 3C1KA 2FS8A 1HUTH 3ZZ8A 1CHGA 4X2XA 1VR1H 1DSTA 3LPRA 1AWFH 2G00A 2FOFA 2OCVB 2FI4E 3QK1A 1O3CA 3GYLB 1MZDA 1EJAA 2GZ7A 4LXBH 1WU1A 3Q76A 1Y3VA 3DFLA 5DP4A 3CP7A 3SV2H 1TGTA 3RLYH 1UHBB 1GJ4H 4FUHA 2ZGBH 2SGDE 1TX7A 4Y0ZE 1YF4A 3TNTA 2UWLA 5A09A 1UVPA 2AMDA 5G4BA 1GJDB 5FAHA 3S7KB 1TGBA 1ZPZA 4AB8A 1MU8B 1C4Y2 1RIWB 5FBEA 1EAIA 3F9EA 3SZNA 1J15A 2AMPA 1C5TA 5T6GA 2AGIX 3ZVDA 1FIWA 2HPPH 2R3YA 1SQOA 4ISOA 1Q31A 1MBQA 4D9QA 1RS0A 4WVPE 4I31A 1T7CA 2Y6TA 1MZAA 3TGKE 3MHWU 1B0EA 2P16A 1XX9A 1XUFA 1QB9A 1GMDG 1O5EH 2UUKB 1GJ8B 4TY6A 3ZYEA 1GBKA 1TPOA 3H7OA 1GCDA 4OS1A 4UONA 3S9BA 3P6ZB 4CH8B 2ZDKA 3Q3YA 3QZRA 1GDNA 1XUIA 3U1IB 1A5HA 4H6TA 3MU4A 3TIUA 3VXFH 5I46H 4DVAU 1LO6A 4X0WU 5FXLA 3STJA 1GDQA 3RP2A 1QL7A 3MO9A 4ZAEA 2A4RA 5JYIA 2G55A 1V2WT 1QRXA 2VVVA 1FDPA 1AHTH 1HAIH 2OC7A 2ZCLP 3T25A 3LIWA 1GGDB 1ANEA 1SFIA 4WY3A 2Y5GA 3BTGE 1IOEA 1P2KA 4IS5A 1GHWH 4OS7A 4R8TB 1YM0A 1NTPA 1Y59T 4CBNA 5EW1H 1W8BH 1JWTA 3QWCH 1UTNA 1M9UA 4TPYA 3ZVGA 5DGJA 1LVBA 3I78A 3HPTB 3ZZBA 1O2UA 1EPTB 1TABE 4X6NA 1SSXA 2Z3CA 4IGDA 1N8OB 2BXTH 1DX5M 5EQRA 3SGBE 1KLJH 1ORFA 1HGTH 1QL9A 3M5MA 1GI9B 2Y81A 2XC5A 4IN2A 2F83A 1K1MA 2GX4A 3RXOA 3LGYA 3SNAA 1DSUA 2W5EA 1Z1JA 4ABFA 1ZSKA 1O2YA 3QLPH 1HAYB 2O8TA 3SU3A 3UUZA 1V3XA 4FUIA 1O36A 3SJKA 1QCPA 5FCKA 1ACBE 3GDVA 2BD9A 4WH8A 1CQQA 1CSOE 1NM6A 1O2WA 1QBNA 2ANWA 3VB7A 1SB1H 1O39A 3P17H 1C2HA 3OY6U 1BZXE 3NKKA 1PPEE 4NIWA 1AMHA 2ZTXA 2FYQA 3TVJB 5HM9A 2GGVB 1P3CA 1BIOA 2BD3A 1C2DA 1EZXC 1FY3A 4NGAH 2YOLA 3RXCA 1GHBG 1GBTA 3PMBB 4GCHG 3CENA 1FUJA 2G8TA 3UREA
chains in the Genus database with same CATH superfamily
3ZZAA 4ZH8A 1TRMA 1VITG 3KYFA 1GBBA 5FPSA 4NCYA 1P11E 2BQ6B 1EZUC 3MNBA 4ASHA 2NU2E 1GHAG 1QL8A 1FY8E 2FX6A 2VVUA 2D8WA 5EJZA 2GT8A 2ALPA 3BTKE 1EPTA 3RXRA 5HXFA 1LKAA 3TGJE 1IHSH 4OS5A 4H4FA 3LH1A 3PV5A 4HG6A 1DY8A 1TONA 1SQAA 2BX3A 1WOFA 3OU0A 1A3EH 3TNSA 5JBCS 1O3DA 1V2RT 1CU1A 2XWAA 5C1YA 2DE8A 4XFQA 1EOLA 1MKWK 1O3EA 3KF2A 4INHA 1UVSH 1L4ZA 3DA9B 2FX4A 3RMLH 1TWXB 1NRQH 3A83A 5EXNA 5EXLA 4ISLA 3ZZCA 3T29A 4YTAA 4A1XA 2W26A 1G2LA 1TIOA 2VNTA 1VITF 3EQ0H 3SUGA 1K1PA 2QXJA 1AVXA 2ZU5A 3UOPA 1GJAB 3FFGA 5EODA 5FL7D 5T1VA 3I29A 5AF9H 4A92A 3I77A 3PV4A 4UEHH 3NZIA 3MTYA 9LPRA 1YPJH 4X2WA 3RU4D 3ZZ6A 5KECA 1DS2E 2OTVA 1E36B 1XKBC 3NWUA 2H9TH 1MTUA 5BRRE 4DURA 1OP8A 1PQ5A 2R0KA 1HXFH 2XBXA 1OP2A 2Q1JA 1W11U 3OEED 4DGJA 2FMJA 3HK6B 4BAMB 1SGFG 1TA2A 2RA0A 2UUYA 4I8KA 4D76A 1F5LA 1BMFD 1E0FD 3SUFA 2BDBA 3MU1A 1NZQH 2TIOA 1EFRD 4ISIH 4IMZA 3PV2A 2JDID 4UFEH 3VB3A 3LOXA 3KL6A 3A7VA 4INLA 2C8XB 4Y7AA 3PMAB 3FANA 4B6FA 5HYOA 3O8DA 3F2HA 4UFGH 1BQYA 3RXQA 2R9PA 1IQHA 1JXPA 1CGHA 1MQ5A 1ZSJA 2Z3EA 3LT3A 4DT4A 3LGTA 5GWZA 1SC8U 2J92A 1C2EA 1W13U 1BBRK 3AAVA 3UR6A 3SQEE 1XXDA 3M3SA 1NFUA 1S81A 3ENSB 4WJG2 1FMGA 1O30A 3IITA 3LJOA 1Y3WA 1C5WB 1QR3E 1IQFA 3F68H 2ZU4A 4XSKU 2SNWA 4ZCNA 3P70B 2G4UA 4QT8C 3JZ2B 1FV9A 1O3IA 2W7UA 1IHTH 3E0NB 3SOSA 3UR9A 1V2TT 1GI4A 1C9PA 1VZQH 5EJ1A 3BIVH 1HB0B 2GV6A 4JYTA 3MU8A 4UFFH 3E91A 1O35A 3EA7A 1O2VA 1GVKB 1THRH 1SFQB 3F0OA 2BLVA 2V3MA 1XMNB 4KP0A 1AD8H 1C5NH 3LKWA 4WF8A 3F0PA 5T6DA 1O2PA 1NFWA 3SN8A 1GMHF 1PQAA 2FESH 3P8FA 1O2ZA 3JZ1B 1D9IA 4NA9H 4Q7YA 2J97A 2GZ9A 1GBAA 1JIMA 3STIA 1OHHD 3HATH 2JETC 4TWYA 1GMCF 3MQKC 4Y10E 1P2OA 1JRTA 2W7SA 2Z6BD 1QRZA 1P12E 2GMTC 4ZKRU 1OPHB 1C9TA 6GCHG 3RC4A 1O3PB 1P2IA 1N6XA 1ANDA 1T31A 8KME2 3RXGA 1W7GH 1AB9B 4H42U 3BN9A 5ABWA 5FCRA 1G36A 1SGYE 2YNAA 4UE7H 3M7QA 1Y8TA 1ELAA 2WPKS 2GDEH 1NRSH 2F9BH 4MDSA 4U30A 5EIYA 3QX5H 2OINA 2M2AA 4NZLA 1DWEH 1TLDA 1ELTA 5C67A 2ZIQH 3GY3A 4VGCB 4DY7B 1QFKH 1H4WA 4I8HA 4JK5A 4UDWH 1HBTH 2G51A 4CRBA 2SNVA 1IQJA 2B8OH 3MMGA 3N7OA 2KAIA 2FM2A 3SU6A 1Z8GA 3MH6A 5IDKA 1HPGA 6GCHF 2Z94A 5A8YA 1A1RA 2FZZA 3SO3A 1SGNE 1C1RA 3L6PA 2TRMA 3BTME 1C1QA 1O3MA 1WAYB 2JJ1D 1GGDC 2ZFPH 4KTUA 4B1TA 1CBWB 1V2PT 3DSGA 1FAKH 2DUCA 3GY7A 4CH2B 2ZHDA 1HAHH 1DOJA 1QB1A 3M3TA 3S9CA 5CHAC 4FUDA 3RUOA 1MAYA 4MQAA 3LDXH 1AI8H 1ZSLA 2R0LA 2GKVE 1OS8A 3MH5A 3ZYDA 5L6NH 4NSVA 3GCHB 3B9FH 1K1OA 1SQTA 3RC5A 3TJNA 2BZAA 2QXHA 1ZHMA 3RXPA 1YKTA 1L4DA 1H1BA 2OQ5A 5C1XA 3KEEA 2ZU2A 2HNTF 1GBHA 4TSFD 5DK1A 2Q6FA 1S0RA 4ABIA 1ELEE 4ZROA 1K1NA 1W0JD 2ZQ1A 1QNJA 2IPQX 1TQ0B 1QTFA 5A2MH 1GBEA 1SHYA 1O3KA 2ODYB 1C5ZB 3PRDA 2LPRA 1MU6B 4DJZB 5DG6A 1SMFE 2V6NA 2P8OB 1O2HA 1AVWA 1V2QT 3VGCB 1BHXF 5KEDA 3RXHA 1Y3UA 3PO1B 1NROH 5CDFE 2WV5A 1ZRKA 1YPHE 1UTPA 3SU5A 1LKBA 4A1TA 3M36A 1FN6A 1ZMJA 2J98A 2QN5T 2ZKSA 4ABHA 3ZVAA 4MG3A 1BMLA 4OM9A 1ETSH 1VCQA 5F6MA 1DWBH 2VWNA 6ESTA 1HRTH 3U8RH 1EUFA 4JZEH 1ETRH 5JB9S 2BQWB 2P3UB 2QV1A 2RDLA 3HKJB 4RSPA 3DUXH 5E0GA 1IQLA 1SGCA 2AYWA 2CHAB 3PMHB 1YBWA 5JBTA 4AFQA 1W2KH 2AFQB 2C4FH 1CA8B 4RKOB 2A7HA 4MPUA 1OP0A 3A8DA 3B8JA 2SGFE 3SHAH 4X8UH 4AG2A 1EAUA 2P59A 5EQSA 4JYUH 5A0AE 4I7YH 3QGNB 4BAOB 1MAXA 1YPKH 1D6RA 1P09A 2XBVA 3URCA 5C2ZA 1C2LA 2FP7B 2Z7FE 1FI8A 2BX4A 1BTPA 1J17T 2THFB 4ABBA 3O8RA 1BUIA 1ANBA 4JMYA 1FIZA 5KGOA 4NA7A 1J9CH 1BTZA 3QTOH 6CHAC 1UTJA 1KXEA 1UK3A 1QA7A 3TPIZ 1K0HA 4F49A 1GI8B 4CHAB 3L33A 4FUGA 1BHXB 2BVRH 2PFEA 1KMHB 2OK5A 2BOKA 1C1TA 1E1QD 3GCOA 2DE9A 3UB0A 2G4TA 1DICA 1AIXH 3N99A 1EP5A 4TPIZ 2JKHA 3M3VA 4ISHH 2OC0A 5DP7A 3CNRA 3SBKA 3ODFA 1SI5H 3SUEA 1H9HE 4A5TS 3PTNA 3RLWH 4X1RU 4U01A 1GG6B 1N1LA 2SFAA 2AS9A 1E35B 4Q7ZA 3F6UH 1UVTH 2H9HA 1GHVH 1NU9A 5EGMA 3VEQB 3RXFA 2A4OA 3SNDA 3UNSA 3OFND 1FX0B 3DT0H 2EI7A 3ZV9A 4RI0A 2JH6D 1WTHD 2C93B 5E0HA 5CMXH 1HJAB 4OGXA 2H5CA 1JRSA 1GVLA 2H2ZA 4Q63A 4XE4A 1WDIA 5GDSH 4NWKA 4U2WA 1KLIH 3NCLA 1ELFA 3Q77A 5FPTA 3R0FA 4KTSA 3FZDA 3V12A 1JBUH 1DANH 3U8OH 2OBQA 1XVMA 1ZPCA 1ZJDA 4MPXA 1SR5C 2C8ZB 1GCTB 2Y7ZA 3DHKH 1UK2A 3KYGA 2H6MA 1P03A 3H5CB 2YMSD 5ESTE 2VIDA 1KXFA 1Y3XA 3QTVH 1HIAB 4GVUA 3WWBA 3IG6B 3H09A 5FX5A 1RJXB 3N7EA 1HFDA 1BITA 4K8BA 4P00A 4K1TA 2OP9A 4XRNA 2BVXH 2P3FH 4CREA 1BTYA 3QGJA 1HAZB 3E16B 1WV7H 1RRKA 2IPHA 1TX8A 2WPIS 3ITIA 3UIRA 1FJSA 1O3GA 2XBWA 5ETXA 3K6YA 3ESTA 1TB6H 5F53A 4K69A 1H8DH 4CRAA 1V2JT 2P3TB 3T2NA 1YCPH 2PKAA 1NU7B 2QF0A 1O2IA 1A4WH 2NU1E 1W7XH 1J16A 1BBRE 3E90B 5AFYH 1BJVA 3U69H 4FU9A 1YPGH 1C5YB 5C1UA 4THNH 2C8WB 4IC5A 1C1MA 2EC9H 2PUQH 4LOYH 1BOQA 1PPHE 5GCHG 1D6WA 1L0ZA 1PQ8A 1T8MA 1AU8A 4CBOA 1W10U 3S0NA 2ANYA 4YM9A 3O8BA 4WMFA 3GDUA 1DXWA 4CR9A 2XXLA 1QA0A 3PYHA 3D62A 5C20A 5HMAA 2KCAA 4E06H 5DSFA 2BY7X 1NC6A 1SGDE 2A5IA 2ODQA 3QZQA 4CRDA 2ZA5A 1T8NA 1TBRH 1HIAA 2BQ7B 4I33A 3UTUH 9ESTA 1NT1A 1GMDF 1HYLA 1MH0A 2PSXA 1GBFA 1SVPA 3GCTG 3M7TA 1SGEE 1TGNA 1Z6EA 3RC6A 3SU1A 7ESTE 1BB0B 2GTBA 4FVBA 3MH7A 4YOIA 2GV7A 2GP9B 2WYJA 1YWUA 1W0KD 3A88A 1H8IH 2RG3A 1AUJA 2A4QA 2VGCB 3A7ZA 1XUKA 1Y5UT 3OTJE 3M37A 1LHEH 2ULLA 1AVGH 3A84A 4ESTE 3SU0A 3D23A 2BDIA 2P95A 1BRAA 2PLXA 3UOUA 1VKYA 4FXGH 3BG4B 1XVOA 2LELA 3GY8A 1V6DA 1C2JA 1H8ED 3GDSA 5A8XA 4AFZA 1C4V2 4HTCH 2WUBA 1L1NA 4I8LA 3A8AA 3U28C 2QA9E 1A0HB 3ZV8A 2ZHQH 5K7RA 1LMWB 2G81E 2R3UA 4WH6A 2H9EH 3D49H 3SV7A 2G5NA 3F2GA 1K2I1 1LTOA 1BDAA 5TCAA 1EZQA 1DLEA 1WCZA 3TU7H 4MLFB 1EJMA 1VGCB 2XNIA 4ACAA 2OUAA 2Z9JA 1GI1A 1AKSB 1EXFA 3PRBA 2WHXA 3D65E 5GPIB 5C0TA 1TNIA 1LPGB 2SGEE 3CS0A 1ELBA 4ZHLU 5DP8A 2A0QB 1IQNA 1NO9H 2YMSC 3SJOA 2XTTB 3S7HB 2HPQH 3WWFA 4MTBA 1ARBA 1FONA 1GBLA 1AFQB 1F7ZA 4LK4A 1O34A 1Y3YA 1OSSA 1P0SH 2QYIA 2ZF0H 3VB5A 1GI7B 4RT1A 3VGCC 3FO8D 1OKXA 5DO4H 3PO1C 3F9FA 2EI6A 4NFEA 1VCPA 4YT7H 1LCYA 3N7DA 1XUHA 4Q7XA 2ANMH 2CF8H 3V7TA 2V35A 1C2MA 1PYTD 4Y79A 1RFNA 3SU2A 1GJ6A 1D3DB 1P9SA 4AYVB 5B6OA 4XBDA 1GHBF 2RFKC 2BDYA 4GCHF 3K65B 1O2TA 2VB0A 1RTKA 3M61U 3TLOA 2GVFA 4YO9A 2BMGB 2Z3DA 3TK9A 4UFDH 1E34B 1QQ4A 1GHAF 2CHAC 1O3BA 4B2AA 2TPIZ 1GJ7B 1PPZA 1SLVB 3C27B 2W6JD 2CXVA 1TAWA 1AKSA 3SORA 1K1IA 1ESBA 5DP3A 2VVCA 2RDEA 1QHRB 2ZDVH 1KXAA 2XOKD 2CN0H 5JPMH 3LGWA 4JCNA 1DITH 2HNTC 1ANCA 1NFXA 4K60A 5DP6A 2KX4A 1P06A 2ODPA 4NG9H 3GY6A 1O2RA 1MTNB 3UNQA 5JBBS 3KCGH 1V2ST 1MMJN 3SNEA 1GI6A 4GLYA 1RD3B 5JB8S 2ASUB 1XKAC 1HJ9A 1O5BB 3M35A 2ZTYA 3V3MA 1C2IA 1EZSC 1G3DA 3RXBA 1GBCA 1C5LH 1QRWA 3A89A 3SV8A 2F9OA 1TX6A 2W6ID 4J1YA 4Y71A 2Y82A 4OS2A 2FYRA 1H9IE 4X2VA 3K6ZA 4XBCA 2K8IA 1P04A 1FPCH 3OYPA 2XYAA 7GCHG 1GG6C 1S85A 3HGPA 1P2MA 1B0FA 1Q3XA 1THSH 4R0IA 1UCYH 3RMNH 1C1VH 1O3AA 2R2WU 4KGAA 3SI3H 7LPRA 2A5AA 1VCWA 3UAIC 2BOHB 3LU9B 1YY3A 4WXIA 3RXDA 2NU0E 2J94A 4OS6A 1NFYA 3TH2H 2CMYA 1K28D 2KM0A 2WV9A 3AVZA 3RU4T 1HLTH 2BY8X 2KR7A 1HJAC 3KN2A 1QBVH 4WMDA 3NK8A 3P95A 1K21H 3TITA 3MU0A 1TFXA 3BTTE 1JIRA 5F8XA 1C5SA 1EP6A 1O5FH 3HKIB 2BY5X 2BYAX 2NU3E 2KAIB 1YP9A 5AFZH 1C5VA 2BD4A 1O2GH 3MOCA 1UTMA 3FKSD 1B5GH 3A7TA 1GBIA 5F8TA 4UD9H 3DFJA 1IQMA 4DCDA 3ATMA 5F8ZA 4SGBE 1GCTC 4BAHB 3VG8A 3E0PB 1FY4A 2PUXB 1GJBB 4X8VH 1O2KA 1IQGA 3SUDA 1C2GA 5E2OA 3RXLA 3BG8A 1DPOA 3NRLA 4BAKB 2BZ6H 4OS4A 3OY5U 1WSSH 1RIWC 4CRFA 2ZPQA 4ABJA 1F0SA 1YCPM 2V7QD 2ESTE 1K1LA 3T27A 3BTFE 1DLKB 2STBE 6LPRA 3U9AH 2FODA 4ZXYH 2AERH 4ZKNU 4BXWA 2W3IA 2PP6A 2ZI2H 5BPEA 1PYTC 1P2JA 1T4UH 3ZVCA 1SOTA 3ZIAD 5J4SA 2UUFB 3LGVA 2VIVA 1C1NA 1O0DH 1BMMH 4FUJA 3W95A 1PPCE 1SHHB 2BHGA 2O8MA 4KELA 5AHGH 5DP5A 1SLUB 1YPHC 1NRPH 1WQVH 2FOEA 5GXPA 4X6OA 1CVWH 1W12U 1P2NA 4O97A 1HAGE 3VXEH 2J38A 1BTXA 4NIVA 3V13A 5FBIA 1FPHH 1ZPBA 1HAVA 2C8YB 1MUEB 1S6FA 2P93A 1FY1A 5DPAA 3MI4A 2GCHG 2BY9X 2BXUH 3FN8A 1WQSA 2FDAA 2I6SA 3OE7D 4K1SA 5HIZA 1Z7KA 1G32B 2ZFQH 2J9NA 4AFUA 1G37A 2J98B 2LP6A 3KNXA 1ZTJA 1S84A 5CE1A 4I8JA 1BMNH 1NRRH 1D3QB 1TE0A 3KQEA 4X1PU 3EAJA 3FP8E 1V2KT 2VWMA 2EQNA 2A45B 4YT6H 2J95A 2D1JA 1YPLH 4ZHMU 1O2NA 3BTEE 3GYMA 4BXSA 2GCTB 1ARCA 4BOHA 1Z8RA 4Z1MD 1O2LA 1EPTC 3BTDE 3T62A 1P8VC 1BRUP 1XM1A 1O3OA 3ATLA 1N8OC 3MFJA 3BTHE 2SGPE 4SGAE 4FETA 3SV6A 1ELCA 2ZEBA 3RXVA 5DP9A 3DSPA 3MNXA 3BG4C 2UUJB 5PTPA 2RA3A 5K0HA 3SJ9A 2C3SA 4X6MA 4OGYA 3MNSA 2HLCA 3AW1A 4HFPB 1ZTLA 1BT7A 1O3HA 3A7WA 3GS9A 3EE7A 1TRNA 5LPEA 3SNCA 3A8CA 1WBGB 2STAE 3RXJA 3AK5A 4JYVH 4YOGA 1DE7H 1PQ7A 3DD2H 2IN2A 3NPSA 1FY5A 1EB2A 1ZHPA 1OXGA 1YYY1 5FHTA 2VIOA 1TQ7B 2FI5E 1W0ZU 5EQQA 2ZWLH 3ZVFA 1T32A 3OAAD 2WZQA 1TPPA 1QJ1B 1S82A 3FOAA 2ZGXH 2IOTA 1V2VT 1KTTB 2Y5FA 1GBMA 3RXMA 2AMQA 4B2CA 1C1OA 1BRCE 1VITH 3CS7A 4TYDA 1CA0B 1O3JA 1S6HA 1S83A 4PROA 4BANB 1MTSA 3RM2H 1WUNH 3FZZA 3LH3A 4B2BA 1Z71A 3TGIE 2BB4A 4H6SB 1JMOH 1LHGH 2BD2A 1V2OT 8ESTE 2CJIA 1EAXA 1UO6A 1CGIE 2VU8E 2PHBA 1YCPK 2R2MB 1MQ6A 1AQ7A 3QUMP 1DVAH 3AW0A 3DCLA 2XCNA 1Z8IB 3BV9B 2WPJS 3P8OA 1OWEA 1ZR0A 1O33A 4ACBA 1AE8H 4K3JA 3ODDA 2JH5D 2V3HH 4CRGA 1LDTT 2A2XH 4FOUC 1O3FA 1ZZZA 3QO6A 1SLXB 4LZ4B 1SL3A 2GD4B 3RXTA 1O38A 1OWHA 3EA9A 1W0YH 3M7UA 2CK3D 4M7GA 1AUTC 1AY6H 3WY8A 1O2SA 1YLDA 2BDCA 2VH6A 2ZDNA 1P01A 2Y5HA 3EGKH 1RXPA 4Y0YE 1E1RD 1THPB 1IAUA 2O8UA 1TNHA 5L2YH 1GHYH 1F92A 3KGPA 2HVYB 1EX3A 1LPZB 1VJAU 2PTCE 1RGQA 5GNDA 4BTIB 2TGDA 3GY4A 3A8BA 1P3EA 2ZC9H 2NWNA 2L6OA 2G52A 3TK6A 1UMAH 1TNLA 1F5KU 4DG4A 1GL0E 1SPJA 3M5LA 3MNCA 2BD7A 5JDUB 3GY2A 5C17A 2AGEX 4DT7B 2PKAB 1CO7E 1CT4E 4YLQH 2FOAA 4AGKA 1GHZA 2Z9KA 1BCUH 5DJ7A 5DN6D 1X7AC 2ILNA 1SGRE 4O03A 1HV7A 3SGQE 1V2UT 2VJ1A 3QDZB 2XC0A 2AIPA 3RXEA 1NS3A 1TRYA 1P2QA 2BLQA 4ABAA 5T3HA 4D7GA 1TMBH 4D8NA 1FXYA 1J8AA 4MNVA 1O32A 5EPNA 3E6PH 4RKJB 2NU4E 2GT7A 2A7CA 3KQDA 4E05H 4K8YA 1LVMA 4O3TA 1EOJA 2ZQ2A 1PFXC 1G3EA 1O5GH 2ALVA 2H5DA 3E8LA 2B5TB 2ZPSA 5C0UA 2F3CE 1ZGIA 1LQDB 2HGTH 1Q2WA 1TYNA 1DFPA 2JIZD 4BTTB 2WPHS 1C5QA 4NWLA 5TCCA 1C5PA 3OEHD 5FX6A 4P02A 2OC8A 4Y8XA 2BVSH 1INCA 1K22H 3A82A 3ZVEA 1GI3A 2FOCA 2JETB 4Y8YA 5LGOA 2HVXA 1HJ8A 2GMTB 4NA8A 3U98H 3MH4A 5J4QA 1YPMH 1C2KA 1HAXB 3HGNA 3KQCA 3P8NA 3Q3XA 1MCTA 3RXSA 1C1UH 1P57B 1MKXH 2FEQH 2BY6X 3UQVA 2K1QA 3GOVB 2AHME 3ZVBA 5DKMA 1EASA 4Y76A 3PWCA 3MO3A 2BD5A 4B74A 4IN1A 1Y5AT 4MPVA 4KKDA 1WXRA 3MU5A 1HDTH 1OYTH 3A7XA 1KSNA 5HM2A 1GBDA 1Z6JH 4Y8ZA 5EU8A 1PJPA 2VIPA 1U6QA 5CHBA 1GWAA 4O9VA 1RTFB 1F5RA 1XUGA 1AB9C 1TBZH 1ETTH 3BEFB 1F0RA 3G01A 3SV9A 4ASUD 1MD7A 2A32A 3T28A 1SGPE 2SGQE 1G3CA 1GVZA 1GJ5H 3BSQA 5L2ZH 8LPRA 1V2NT 4VGCC 4B76A 2J34A 3E1XB 4B75A 1UHBA 4JK6A 2F9VA 3F3BA 4DIHH 3QN7A 4XOJA 5EOKA 5GCHF 1D3TB 1SOZA 3K9XB 1O3LA 2G5VA 1QJ6B 4DW2U 2ZTZA 5EW2H 1TPSA 1HAPH 1ZLRA 2WUCA 5CHAB 4A6LA 5EG4A 4BTUB 4JZ1A 1MD8A 3UPEA 1C1WH 2WV4A 2HOBA 4GHQA 4YZUA 1CBWC 2Y80A 4JZIA 1HAOH 5HGGA 3BTQE 1FN8A 3NUMA 2VIQA 1OWKA 1O2JA 3GCTF 3UWJH 4AFSA 5C94A 1TGCA 2WPMS 2QIQA 3RM0H 1LHDH 3RXAA 3TH3H 4D7FA 1ELGA 4AOQA 1TOMH 2OD3B 1QIXB 1JOUB 3SGAE 1OWIA 3GCHC 2GCTC 4O3UA 1UCYK 4FUBA 1TBQH 1KTSB 3M5OA 1PPGE 4ISNA 1GJ9B 1YLCA 2ZFTA 2FIRH 1O5AB 4Q4LA 1ZMNA 1Y5BT 2ZHWH 4CR5A 4IMQA 3ZZ9A 2JH0D 3FVFB 1OX1A 2PR3A 2WYGA 4F55A 1TALA 2FOMB 3GISB 1DWCH 3KHVA 2O9QA 2ZFRH 1W14U 2BD8A 2VWOA 3F2FA 2GDDA 3SJ8A 4AORA 3NXPA 2P8OC 2QCYA 3ATWA 2TGAA 4I8GA 1BTHH 3BEIB 1KY9A 1YPEH 1K9OE 2UWOA 1EB1H 2FI3E 3A85A 3PWBA 4X1QU 3OTPA 2A5KA 4GPGA 4AG1A 2OXSA 5HKKD 4MVNA 1GI5A 4NIXA 4MNYA 3UNRA 1CT2E 2J4IA 2BM2A 4FVDA 2A2QH 1TOCB 1AZZA 1GHXH 1NPMA 5FPYA 1NY22 2VBCA 4X8TH 2CGAA 1C5OH 1BMAA 3BIUH 1CA0C 2BLWA 2PWXA 3Q3KA 4AGJA 3RMOH 1A0JA 2ZGJA 3LGUA 3TJUA 4A1VA 1LPKB 4BAQB 2VINA 1SLWB 2VWLA 2QXIA 1NN6A 1F0TA 1TGSZ 4I86A 4WMEA 2PGQB 3B23B 4WXVA 2FPZA 2ZNKH 5EXMA 6CHAB 3VB6A 3TK5A 1ESTA 1IQIA 4ZXXH 4B71A 5A8ZA 1MTWA 2TGTA 1G9IE 5IYTA 4TWWA 2OC1A 3BF6H 5F03A 3E3TA 1O2XA 3A81A 3SJIA 5LPFA 2WINI 3KQBA 1A61H 1HNEE 1SGIB 1UVOA 1KDQB 3HK3B 1UVUH 1DDJA 2LNCA 5AVDA 2PKSB 2H1UA 3FP7E 3TH4H 4CHAC 3UQOA 2Y7XA 3GCNA 1ZJKA 3RMMH 3RXKA 1O31A 1S6LA 3ZZDA 3UFAA 2D26C 5TJXA 2HALA 2ZHFH 1AWHB 1A3BH 4INKA 4X6PA 2AEIH 3W94A 2Z9GA 3IWMA 1FAXA 4X2YA 4HZHA 2QC2A 5B6LA 1IQKA 1LVOA 2ZO3H 3RXUA 3EDXB 3A7YA 3DSOA 4ZMAH 1E38B 2FS9A 4FU7A 1C5XB 1T4VH 3RXIA 2EY4C 2AH4X 1DT2A 3M5NA 3LGIA 4GSOA 1GBJA 3P92A 1ZTKA 1SG8B 4XDEA 1F2SE 3SHCH 3P8GA 1QJ7B 4K1EA 1QBOA 2YNBA 3PLKA 4HI3A 1GMHG 1UK4A 1F0UA 3PTBA 4CRCA 3UWIA 1TMTH 2QF4A 1DUEA 2TGPZ 1TPAE 1S0QA 1EKBB 1GMCG 1HAVB 2FTLE 1VJ9U 4IBLH 1EJNA 2L74A 2PW8H 1N6YA 5GJ4B 2CV3A 1KDQA 4FU8A 1C4U2 1ELVA 2ZFSA 4YOJA 7GCHF 2ZZUH 1NESE 2Z9LA 3AAUA 2KFWA 1QQUA 1V2LT 2ZFFH 5T6FA 2EEKA 2QXGA 3OSYA 1HCGA 2OQUA 3EYDA 1A7SA 4FUFA 4DIIH 1DM4B 1GI0A 2Z9IA 2C90B 1AN1E 4B73A 2FWWA 2B0FA 2ZDAH 1D3PB 1P05A 1H8HD 1O2QA 4Z0KA 3ELAH 4Q80A 3GY5A 4AZ2B 2W3KA 4ABEA 2V0BA 3LC5A 4ZKOU 3H7TA 5EJLA 4TT3D 1C1PA 1C5UA 1MKWH 2XWBI 3MYWA 1O3NA 2HNTE 3K2UA 4FUEA 4NSYA 3S69A 5L30H 1ESAA 3EE0B 3TJVA 1MTVA 2VH0A 1SQRA 4ABDA 1LHFH 3MWIU 4F4OC 1FZZA 2FO9A 1YLNA 2BDHA 1CE5A 3UY9A 4GHTA 1KIGH 1DY9A 1EQ9A 1WTGH 4JZDH 2ZU1A 1AO5A 1KYNA 5H4IB 3T26A 3KQ5A 5JBAS 4B6EA 2FOHA 4E7RG 2B7DH 2PTNA 4KTCA 1C5RA 1DWDH 2Q6GA 3A87A 4ZKSU 1QURH 1E79D 1AGJA 3TJOA 2EI8A 3W1EA 1A5GH 3AASA 1TNJA 4GAWA 3L3TA 5LPRA 4AC9A 2FTMA 1TNKA 5C5OA 1S5SA 1BA8B 2ZGCA 1GI2A 3SI4H 3T5FH 2ZDLA 2OLGA 3ZZ5A 1AE5A 2A7JA 1OWJA 3BTWE 5LH8A 2JJ2D 2XRCA 2ZG0H 1TNGA 2BLOA 1G2MA 1UTKA 1UTQA 4MPWA 1J14A 1COWD 1A46H 1SKYE 4I32A 3WW7A 1NBME 1KXCA 1L1JA 2HWLB 5A0BA 2VGCC 1FNIA 2AIQA 3LJJA 4Y11E 1KXDA 4X8SH 3VPKA 2QY0B 1QB6A 4RT0A 1BBRH 2PGBB 4E7NA 1W3CA 3LC3A 2QF3A 3ZZ4A 2F4LA 1ABJH 1ZOMA 1LVYA 3EA8A 1O5DH 1MBMA 1EAWA 2GCHF 1C5MD 3VFEA 2QE7D 2TBSA 3PB1E 1SGQE 2VIWA 2D2DA 2XCFA 4U32A 4IW4E 1CGJE 1DXPA 1A0LA 1XXFA 1SGFA 2GJGA 4HGCA 4J2YB 4FUCA 4IC6A 1D4PB 4AX9H 2P94A 5SGAE 4XD7D 1YC0A 1BRBE 2IJD1 3SYJA 3SU4A 2BDAA 2F9PA 5I25A 1G3BA 5HIYA 2YMSB 2ZPRA 1BJUA 4Y7BA 2ZU3A 1CT0E 5E8EH 1VGCC 1H9LB 4AYYB 8GCHG 1T8OA 1FQ3A 2B9LA 4AN7A 1ZGVA 4NIYA 4A7IB 2FOGA 4BNRA 3O8CA 2F91A 1A5IA 2GZ8A 1O2OA 2BTCE 1GJCB 1C2FA 4X1NU 2FOBA 2OBOA 4MNWA 5C3NA 1LQEA 4JZFH 1ZRBA 1L1GA 4DOQA 1CHOG 2RCEA 2M5TA 1C1SA 1SGTA 4YESB 3PLBA 4Y6DA 5C5NA 3ZZ7A 3FP6E 4AB9A 4K2YA 3RDZA 2XBYA 1AFQC 1KXBA 1QGFA 2O8WA 1IQEA 2A4GA 3PMJA 1OYQA 4LZ1H 3RU4E 2ZGHA 2QGRA 3SW2B 3VB4A 1L2EA 1ID5H 2WSSD 2PV9B 3ATIA 3MO6A 1QY6A 1MKXK 2F9UA 1ELDE 4NFFA 2A1DB 1UCYE 3URDA 1XUJA 2BDGA 8GCHF 1T8LA 1ZHRA 2FLBH 4YLUA 2AGGX 5E0JA 1UTOA 1P02A 1ABIH 3A80A 3LONA 2XW9A 3S9AA 1P9UA 1PPFE 3U8TH 2ZHEH 7KMEH 2KCYA 1FLEE 3ZZ3A 2ZECA 3GICB 1TA6A 2ANKH 1GL1A 1PPBH 1CHOF 2QAAA 3V0XA 5GIBA 3U1JB 3F9HA 1KLTA 2EA3A 2F9NA 1MCVA 2PSYA 1DUAA 1YGCH 4XBBA 1E37B 1GPZA 2XC4A 2ZP0H 1RTLA 2KCOA 1LHCH 2WPLS 4WWYA 4MNXA 1OOKB 2HLDD 2ZCKP 3Q00A 3ATKA 3PM3A 2SGAA 1Z8JB 3F1SB 5IK2D 1O37A 1AFEH 2KCPA 1EATA 1WYKA 1P10A 2Q6DA 1BTWA 3KIDU 4Z6AH 3BEUA 2I6QA 1OWDA 1TMUH 2A31A 3FAOA 1MTNC 1G30B 1ZYOA 1A2CH 4GUXA 4ZHAA 2V3OH 3F9GA 1O2MA 2FXRA 1K1JA 4K5ZA 4M9FA 4TY7A 5E2PA 1B7XB 4D9RA 2PKSC 3SNBA 1ZMLA 1GDUA 1O5CB 4RN6A 4F48B 1UTLM 2FLRH 4NZQA 5EPYA 4X1SU 3OX7U 2ZCHP 4ABGA 1Z1IA 1UJ1A 1HXEH 2WPDD 2HRVA 4ZUHA 2CF9H 5ESBA 2IJOB 3A86A 4Q2KA 2ZDMA 3PROA 1NRNH 3PLPA 3SQHE 2UWPA 3R3GB 5A0CA 1SBWA 1AZ8A 1BTUA 1V2MT 2F43B 2J2UA 2O8LA 3C1KA 2FS8A 1HUTH 2QF5A 3ZZ8A 1CHGA 4X2XA 1VR1H 1DSTA 3LPRA 1AWFH 2G00A 2FOFA 2OCVB 2FI4E 3QK1A 1O3CA 2K0QA 3GYLB 1MZDA 3SZEA 1EJAA 2GZ7A 2KZ4A 4LXBH 1WU1A 3Q76A 1Y3VA 3DFLA 5DP4A 2J5UA 3CP7A 3SV2H 1TGTA 3RLYH 1UHBB 1GJ4H 4FUHA 2ZGBH 2SGDE 1TX7A 4Y0ZE 1YF4A 3TNTA 2UWLA 5A09A 1UVPA 2AMDA 5G4BA 1GJDB 5FAHA 3S7KB 1TGBA 1ZPZA 4AB8A 1MU8B 1C4Y2 1RIWB 5FBEA 1EAIA 3F9EA 3SZNA 1J15A 2AMPA 1C5TA 5T6GA 2AGIX 3ZVDA 1FIWA 2HPPH 2R3YA 1SQOA 4ISOA 1Q31A 2XNDD 1MBQA 4D9QA 1RS0A 4WVPE 4I31A 1T7CA 2Y6TA 1MZAA 3TGKE 3MHWU 1B0EA 2P16A 1XX9A 1XUFA 1QB9A 1GMDG 1O5EH 2UUKB 1GJ8B 4TY6A 3ZYEA 1GBKA 1TPOA 3H7OA 1GCDA 4OS1A 4UONA 3S9BA 3P6ZB 4CH8B 2ZDKA 3Q3YA 3QZRA 1GDNA 1XUIA 3U1IB 1A5HA 4H6TA 3MU4A 3TIUA 3VXFH 5I46H 4DVAU 1LO6A 4X0WU 5FXLA 3STJA 1GDQA 3RP2A 1QL7A 3MO9A 4ZAEA 2A4RA 5JYIA 2G55A 1V2WT 1QRXA 2VVVA 1FDPA 1AHTH 1HAIH 2OC7A 2ZCLP 3T25A 3LIWA 1MABB 1GGDB 1ANEA 1SFIA 4WY3A 2Y5GA 3BTGE 1IOEA 1P2KA 4IS5A 1GHWH 4OS7A 4R8TB 1YM0A 1NTPA 1Y59T 4CBNA 5EW1H 1W8BH 1JWTA 3QWCH 1UTNA 1M9UA 4TPYA 3ZVGA 5DGJA 1LVBA 3I78A 3HPTB 3ZZBA 1O2UA 1EPTB 1TABE 4X6NA 1QZ8A 1SSXA 2Z3CA 4IGDA 1N8OB 2BXTH 1DX5M 5EQRA 3SGBE 1KLJH 1ORFA 1HGTH 1QL9A 3M5MA 1GI9B 2Y81A 2XC5A 4IN2A 2F83A 4YXWD 1K1MA 2GX4A 3RXOA 3LGYA 3SNAA 1DSUA 2W5EA 1Z1JA 4ABFA 1ZSKA 1O2YA 3QLPH 1HAYB 2O8TA 3SU3A 3UUZA 1V3XA 4FUIA 1O36A 3SJKA 1QCPA 5FCKA 1ACBE 3GDVA 2BD9A 4WH8A 1CQQA 1CSOE 1NBMD 1NM6A 1O2WA 1QBNA 2ANWA 3VB7A 1SB1H 1O39A 3P17H 1C2HA 3OY6U 1BZXE 3NKKA 1PPEE 4NIWA 1UW7A 1AMHA 2ZTXA 2FYQA 3TVJB 5HM9A 2GGVB 1P3CA 1BIOA 2BD3A 1C2DA 1EZXC 1FY3A 4NGAH 2YOLA 3RXCA 1GHBG 1GBTA 3PMBB 4GCHG 3CENA 1FUJA 2G8TA 3UREA
chains in the Genus database with same CATH topology
3ZZAA 4ZH8A 1TRMA 1VITG 1GBBA 5FPSA 4NCYA 1P11E 2BQ6B 1EZUC 3MNBA 4ASHA 2NU2E 1GHAG 1QL8A 1FY8E 2FX6A 2VVUA 2D8WA 2GT8A 2ALPA 3BTKE 1EPTA 3RXRA 5HXFA 1LKAA 3TGJE 1IHSH 4OS5A 4H4FA 3LH1A 1DY8A 1TONA 1SQAA 2BX3A 1WOFA 3OU0A 1A3EH 3TNSA 5JBCS 1O3DA 1V2RT 1CU1A 2XWAA 5C1YA 2DE8A 4XFQA 1EOLA 1MKWK 1O3EA 3KF2A 4INHA 1UVSH 1L4ZA 3DA9B 2FX4A 3RMLH 1TWXB 1NRQH 3A83A 5EXNA 5EXLA 4ISLA 3ZZCA 3T29A 4YTAA 4A1XA 2W26A 1G2LA 1TIOA 2VNTA 1VITF 3EQ0H 3SUGA 1K1PA 2QXJA 1AVXA 2ZU5A 3UOPA 1GJAB 3FFGA 5EODA 3I29A 5AF9H 4A92A 3I77A 3PV4A 4UEHH 3NZIA 3MTYA 9LPRA 1YPJH 4X2WA 3RU4D 3ZZ6A 1DS2E 2OTVA 1E36B 1XKBC 3NWUA 2H9TH 1MTUA 5BRRE 4DURA 1OP8A 1PQ5A 2R0KA 1HXFH 2XBXA 1OP2A 2Q1JA 1W11U 4DGJA 2FMJA 3HK6B 4BAMB 1SGFG 1TA2A 2RA0A 2UUYA 4I8KA 4D76A 1F5LA 1E0FD 3SUFA 2BDBA 3MU1A 1NZQH 2TIOA 4ISIH 4IMZA 4UFEH 3VB3A 3LOXA 3KL6A 3A7VA 4INLA 2C8XB 4Y7AA 3PMAB 3FANA 5HYOA 3O8DA 4UFGH 1BQYA 3RXQA 2R9PA 1IQHA 1JXPA 1CGHA 1MQ5A 1ZSJA 2Z3EA 3LT3A 3LGTA 5GWZA 1SC8U 2J92A 1C2EA 1W13U 1BBRK 3AAVA 3UR6A 3SQEE 1XXDA 3M3SA 1NFUA 1S81A 3ENSB 4WJG2 1FMGA 1O30A 3IITA 3LJOA 1Y3WA 1C5WB 1QR3E 1IQFA 3F68H 2ZU4A 4XSKU 2SNWA 3P70B 2G4UA 4QT8C 3JZ2B 1FV9A 1O3IA 2W7UA 1IHTH 3E0NB 3SOSA 3UR9A 1V2TT 1GI4A 1C9PA 1VZQH 3BIVH 1HB0B 2GV6A 4JYTA 3MU8A 4UFFH 3E91A 1O35A 3EA7A 1O2VA 1GVKB 1THRH 1SFQB 2BLVA 1XMNB 4KP0A 1AD8H 1C5NH 3LKWA 4WF8A 5T6DA 1O2PA 1NFWA 3SN8A 1GMHF 1PQAA 2FESH 3P8FA 1O2ZA 3JZ1B 1D9IA 4NA9H 4Q7YA 2GZ9A 1GBAA 1JIMA 3STIA 3HATH 2JETC 4TWYA 1GMCF 4Y10E 1P2OA 1JRTA 2W7SA 2Z6BD 1QRZA 1P12E 2GMTC 4ZKRU 1OPHB 1C9TA 6GCHG 3RC4A 1O3PB 1P2IA 1N6XA 1ANDA 1T31A 8KME2 3RXGA 1W7GH 1AB9B 4H42U 3BN9A 5ABWA 5FCRA 1G36A 1SGYE 2YNAA 4UE7H 3M7QA 1Y8TA 1ELAA 2WPKS 2GDEH 1NRSH 2F9BH 4MDSA 4U30A 3QX5H 2OINA 4NZLA 1DWEH 1TLDA 1ELTA 5C67A 2ZIQH 3GY3A 4VGCB 4DY7B 1QFKH 1H4WA 4I8HA 4JK5A 4UDWH 1HBTH 2G51A 4CRBA 2SNVA 1IQJA 2B8OH 3MMGA 3N7OA 2KAIA 2FM2A 3SU6A 1Z8GA 3MH6A 5IDKA 1HPGA 6GCHF 2Z94A 5A8YA 1A1RA 2FZZA 3SO3A 1SGNE 1C1RA 3L6PA 2TRMA 3BTME 1C1QA 1O3MA 1WAYB 1GGDC 2ZFPH 4KTUA 4B1TA 1CBWB 1V2PT 1FAKH 2DUCA 3GY7A 4CH2B 2ZHDA 1HAHH 1DOJA 1QB1A 3M3TA 3S9CA 5CHAC 4FUDA 3RUOA 1MAYA 4MQAA 3LDXH 1AI8H 1ZSLA 2R0LA 2GKVE 1OS8A 3MH5A 3ZYDA 5L6NH 4NSVA 3GCHB 3B9FH 1K1OA 1SQTA 3RC5A 3TJNA 2BZAA 2QXHA 1ZHMA 3RXPA 1YKTA 1L4DA 1H1BA 2OQ5A 5C1XA 3KEEA 2ZU2A 2HNTF 1GBHA 5DK1A 2Q6FA 1S0RA 4ABIA 1ELEE 4ZROA 1K1NA 2ZQ1A 1QNJA 1TQ0B 1QTFA 5A2MH 1GBEA 1SHYA 1O3KA 2ODYB 1C5ZB 2LPRA 1MU6B 4DJZB 5DG6A 1SMFE 2V6NA 2P8OB 1O2HA 1AVWA 1V2QT 3VGCB 1BHXF 3RXHA 1Y3UA 3PO1B 1NROH 2WV5A 1ZRKA 1YPHE 1UTPA 3SU5A 1LKBA 4A1TA 3M36A 1FN6A 1ZMJA 2QN5T 2ZKSA 4ABHA 3ZVAA 4MG3A 1BMLA 1ETSH 1VCQA 5F6MA 1DWBH 2VWNA 6ESTA 1HRTH 3U8RH 1EUFA 4JZEH 1ETRH 5JB9S 2BQWB 2P3UB 2QV1A 2RDLA 3HKJB 4RSPA 3DUXH 5E0GA 1IQLA 1SGCA 2AYWA 2CHAB 3PMHB 1YBWA 5JBTA 4AFQA 1W2KH 2AFQB 2C4FH 1CA8B 4RKOB 2A7HA 4MPUA 1OP0A 3A8DA 3B8JA 2SGFE 3SHAH 4X8UH 4AG2A 1EAUA 2P59A 5EQSA 4JYUH 5A0AE 4I7YH 3QGNB 4BAOB 1MAXA 1YPKH 1D6RA 1P09A 2XBVA 3URCA 5C2ZA 1C2LA 2FP7B 2Z7FE 1FI8A 2BX4A 1BTPA 1J17T 2THFB 4ABBA 3O8RA 1BUIA 1ANBA 4JMYA 1FIZA 4NA7A 1J9CH 1BTZA 3QTOH 6CHAC 1UTJA 1KXEA 1UK3A 1QA7A 3TPIZ 4F49A 1GI8B 4CHAB 3L33A 4FUGA 1BHXB 2BVRH 2PFEA 2BOKA 1C1TA 3GCOA 2DE9A 2G4TA 1DICA 1AIXH 1EP5A 4TPIZ 2JKHA 3M3VA 4ISHH 2OC0A 5DP7A 3SBKA 3ODFA 1SI5H 3SUEA 1H9HE 4A5TS 3PTNA 3RLWH 4X1RU 4U01A 1GG6B 1N1LA 2SFAA 2AS9A 1E35B 4Q7ZA 3F6UH 1UVTH 2H9HA 1GHVH 1NU9A 5EGMA 3VEQB 3RXFA 2A4OA 3SNDA 3UNSA 3DT0H 2EI7A 3ZV9A 2JH6D 1WTHD 2C93B 5E0HA 5CMXH 1HJAB 4OGXA 2H5CA 1JRSA 1GVLA 2H2ZA 4XE4A 5GDSH 4NWKA 4U2WA 1KLIH 3NCLA 1ELFA 3Q77A 5FPTA 3R0FA 4KTSA 3FZDA 3V12A 1JBUH 1DANH 3U8OH 2OBQA 1XVMA 1ZPCA 1ZJDA 4MPXA 1SR5C 2C8ZB 1GCTB 2Y7ZA 3DHKH 1UK2A 2H6MA 1P03A 3H5CB 5ESTE 2VIDA 1KXFA 1Y3XA 3QTVH 1HIAB 4GVUA 3IG6B 5FX5A 1RJXB 1HFDA 1BITA 4K8BA 4K1TA 2OP9A 2BVXH 2P3FH 4CREA 1BTYA 3QGJA 1HAZB 3E16B 1WV7H 1RRKA 2IPHA 1TX8A 2WPIS 3ITIA 3UIRA 1FJSA 1O3GA 2XBWA 5ETXA 3K6YA 3ESTA 1TB6H 4K69A 1H8DH 4CRAA 1V2JT 2P3TB 3T2NA 1YCPH 2PKAA 1NU7B 2QF0A 1O2IA 1A4WH 2NU1E 1W7XH 1J16A 1BBRE 3E90B 5AFYH 1BJVA 3U69H 4FU9A 1YPGH 1C5YB 5C1UA 4THNH 2C8WB 4IC5A 1C1MA 2EC9H 2PUQH 4LOYH 1BOQA 1PPHE 5GCHG 1D6WA 1L0ZA 1PQ8A 1T8MA 1AU8A 4CBOA 1W10U 3S0NA 2ANYA 4YM9A 3O8BA 4WMFA 3GDUA 1DXWA 4CR9A 2XXLA 1QA0A 3PYHA 3D62A 5C20A 5HMAA 4E06H 2BY7X 1NC6A 1SGDE 2A5IA 2ODQA 3QZQA 4CRDA 2ZA5A 1T8NA 1TBRH 1HIAA 2BQ7B 4I33A 3UTUH 9ESTA 1NT1A 1GMDF 1HYLA 1MH0A 2PSXA 1GBFA 1SVPA 3GCTG 3M7TA 1SGEE 1TGNA 1Z6EA 3RC6A 3SU1A 7ESTE 1BB0B 2GTBA 4FVBA 3MH7A 4YOIA 2GV7A 2GP9B 2WYJA 3A88A 1H8IH 2RG3A 1AUJA 2A4QA 2VGCB 3A7ZA 1XUKA 1Y5UT 3OTJE 3M37A 1LHEH 2ULLA 1AVGH 3A84A 4ESTE 3SU0A 3D23A 2BDIA 2P95A 1BRAA 2PLXA 3UOUA 4FXGH 3BG4B 1XVOA 3GY8A 1V6DA 1C2JA 3GDSA 5A8XA 4AFZA 1C4V2 4HTCH 2WUBA 1L1NA 4I8LA 3A8AA 2QA9E 1A0HB 3ZV8A 2ZHQH 5K7RA 1LMWB 2G81E 2R3UA 4WH6A 2H9EH 3D49H 3SV7A 2G5NA 1K2I1 1LTOA 1BDAA 5TCAA 1EZQA 1DLEA 1WCZA 3TU7H 4MLFB 1EJMA 1VGCB 2XNIA 2OUAA 2Z9JA 1GI1A 1AKSB 1EXFA 3D65E 5GPIB 1TNIA 1LPGB 2SGEE 3CS0A 1ELBA 4ZHLU 5DP8A 2A0QB 1IQNA 1NO9H 3SJOA 2XTTB 3S7HB 2HPQH 4MTBA 1ARBA 1FONA 1GBLA 1AFQB 1F7ZA 4LK4A 1O34A 1Y3YA 1OSSA 1P0SH 2QYIA 2ZF0H 3VB5A 1GI7B 3VGCC 1OKXA 5DO4H 3PO1C 3F9FA 2EI6A 4NFEA 1VCPA 4YT7H 1LCYA 1XUHA 4Q7XA 2ANMH 2CF8H 3V7TA 2V35A 1C2MA 1PYTD 4Y79A 1RFNA 3SU2A 1GJ6A 1D3DB 1P9SA 4AYVB 5B6OA 4XBDA 1GHBF 2BDYA 4GCHF 3K65B 1O2TA 2VB0A 1RTKA 3M61U 3TLOA 2GVFA 4YO9A 2BMGB 2Z3DA 3TK9A 4UFDH 1E34B 1QQ4A 1GHAF 2CHAC 1O3BA 4B2AA 2TPIZ 1GJ7B 1PPZA 1SLVB 3C27B 2CXVA 1TAWA 1AKSA 3SORA 1K1IA 1ESBA 5DP3A 2VVCA 1QHRB 2ZDVH 1KXAA 2CN0H 5JPMH 3LGWA 4JCNA 1DITH 2HNTC 1ANCA 1NFXA 4K60A 5DP6A 1P06A 2ODPA 4NG9H 3GY6A 1O2RA 1MTNB 3UNQA 5JBBS 3KCGH 1V2ST 1MMJN 3SNEA 1GI6A 4GLYA 1RD3B 5JB8S 2ASUB 1XKAC 1HJ9A 1O5BB 3M35A 2ZTYA 3V3MA 1C2IA 1EZSC 1G3DA 3RXBA 1GBCA 1C5LH 1QRWA 3A89A 3SV8A 2F9OA 1TX6A 4J1YA 4Y71A 2Y82A 4OS2A 2FYRA 1H9IE 4X2VA 3K6ZA 4XBCA 1P04A 1FPCH 3OYPA 2XYAA 7GCHG 1GG6C 1S85A 3HGPA 1P2MA 1B0FA 1Q3XA 1THSH 4R0IA 1UCYH 3RMNH 1C1VH 1O3AA 2R2WU 4KGAA 3SI3H 7LPRA 2A5AA 1VCWA 2BOHB 3LU9B 4WXIA 3RXDA 2NU0E 2J94A 4OS6A 1NFYA 3TH2H 2CMYA 1K28D 3AVZA 3RU4T 1HLTH 2BY8X 1HJAC 3KN2A 1QBVH 4WMDA 3NK8A 3P95A 1K21H 3TITA 3MU0A 1TFXA 3BTTE 1JIRA 5F8XA 1C5SA 1EP6A 1O5FH 3HKIB 2BY5X 2NU3E 2BYAX 2KAIB 1YP9A 5AFZH 1C5VA 2BD4A 1O2GH 3MOCA 1UTMA 1B5GH 3A7TA 1GBIA 5F8TA 4UD9H 3DFJA 1IQMA 4DCDA 3ATMA 5F8ZA 4SGBE 1GCTC 4BAHB 3E0PB 1FY4A 2PUXB 1GJBB 4X8VH 1O2KA 1IQGA 3SUDA 1C2GA 5E2OA 3RXLA 3BG8A 1DPOA 4BAKB 2BZ6H 4OS4A 3OY5U 1WSSH 1RIWC 4CRFA 2ZPQA 4ABJA 1F0SA 1YCPM 2ESTE 1K1LA 3T27A 3BTFE 1DLKB 2STBE 6LPRA 3U9AH 2FODA 4ZXYH 2AERH 4ZKNU 4BXWA 2W3IA 2ZI2H 5BPEA 1PYTC 1P2JA 1T4UH 3ZVCA 1SOTA 5J4SA 2UUFB 3LGVA 2VIVA 1C1NA 1O0DH 1BMMH 4FUJA 3W95A 1PPCE 1SHHB 2BHGA 2O8MA 4KELA 5AHGH 5DP5A 1SLUB 1YPHC 1NRPH 1WQVH 2FOEA 5GXPA 4X6OA 1CVWH 1W12U 1P2NA 4O97A 1HAGE 3VXEH 2J38A 1BTXA 4NIVA 3V13A 5FBIA 1FPHH 1ZPBA 1HAVA 2C8YB 1MUEB 1S6FA 2P93A 1FY1A 5DPAA 3MI4A 2GCHG 2BY9X 2BXUH 1WQSA 2FDAA 2I6SA 4K1SA 1Z7KA 1G32B 2ZFQH 2J9NA 4AFUA 1G37A 3KNXA 1ZTJA 1S84A 5CE1A 4I8JA 1BMNH 1NRRH 1D3QB 1TE0A 3KQEA 4X1PU 3EAJA 3FP8E 1V2KT 2VWMA 2A45B 4YT6H 2J95A 2D1JA 1YPLH 4ZHMU 1O2NA 3BTEE 3GYMA 4BXSA 2GCTB 1ARCA 4BOHA 1Z8RA 1O2LA 1EPTC 3BTDE 3T62A 1P8VC 1BRUP 1XM1A 1O3OA 3ATLA 1N8OC 3MFJA 3BTHE 2SGPE 4SGAE 3SV6A 1ELCA 2ZEBA 3RXVA 5DP9A 3MNXA 3BG4C 2UUJB 5PTPA 2RA3A 5K0HA 3SJ9A 2C3SA 4X6MA 4OGYA 3MNSA 2HLCA 3AW1A 4HFPB 1ZTLA 1BT7A 1O3HA 3A7WA 1TRNA 5LPEA 3SNCA 3A8CA 1WBGB 2STAE 3RXJA 4JYVH 4YOGA 1DE7H 1PQ7A 3DD2H 2IN2A 3NPSA 1FY5A 1EB2A 1ZHPA 1OXGA 1YYY1 5FHTA 2VIOA 1TQ7B 2FI5E 1W0ZU 5EQQA 2ZWLH 3ZVFA 1T32A 1TPPA 1QJ1B 1S82A 2ZGXH 2IOTA 1V2VT 1KTTB 2Y5FA 1GBMA 3RXMA 2AMQA 4B2CA 1C1OA 1BRCE 1VITH 3CS7A 4TYDA 1CA0B 1O3JA 1S6HA 1S83A 4PROA 4BANB 1MTSA 3RM2H 1WUNH 3FZZA 3LH3A 4B2BA 1Z71A 3TGIE 2BB4A