3UOUA

Crystal structure of the kunitz-type protease inhibitor shpi-1 lys13leu mutant in complex with pancreatic elastase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chymotrypsin-like elastase family member 1
publication title Three-dimensional Structure of a Kunitz-type Inhibitor in Complex with an Elastase-like Enzyme.
pubmed doi rcsb
source organism Stichodactyla helianthus
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uouA01
1ZRBA 2CJIA 2O8TA 1JWTA 2R3YA 1GMDG 2Z9LA 2FOEA 1TONA 4CBOA 3L3TA 2BVRH 2F9BH 1ZGVA 2ZDNA 4LOYH 3GCHB 2ASUB 4B73A 5C2ZA 3M35A 4Y7BA 3U8TH 1LHCH 2BOHB 1C5MD 1CT4E 4ISIH 5HGGA 2H9TH 3E90B 1NESE 1MU6B 3A8AA 2D1JA 3A81A 4ZKSU 3RXLA 2FYRA 4NIWA 1DWEH 3SW2B 1GI4A 1ELCA 5JBCS 2ZCKP 2SGEE 4THNH 1P9SA 1TNHA 3PWCA 1TPPA 3D23A 2V35A 2YNAA 1BTWA 3OYPA 4H42U 5HYOA 3PLKA 6LPRA 2FP7B 3RMLH 4KKDA 2PKAB 1PPBH 1P04A 1SHHB 4CHAC 1G37A 4SGAE 3SU3A 2H9EH 3FAOA 1ZMJA 1SGYE 1V2JT 2RDLA 5A0AE 3RXMA 1LVYA 2W26A 1BRBE 2Z7FE 3ATIA 5AFYH 4HI3A 3BEIB 1FONA 4ABFA 1TE0A 1BQYA 2A7JA 3DHKH 3T2NA 3B8JA 5AVDA 4YESB 3LT3A 4XBDA 2VH6A 1Z8GA 2FOCA 2ZCLP 1H9LB 3AW1A 1TPAE 3GDUA 4NFEA 2GP9B 3RXHA 2J2UA 1GJDB 3A8BA 4IGDA 3HKJB 4KTUA 3SI3H 1HJAB 1PPCE 4CRBA 1NRSH 1S6FA 3NPSA 4CR5A 1AIXH 2VIVA 1BTHH 1KY9A 3BTHE 3KQDA 4Y79A 1WYKA 1FI8A 2GMTC 4I7YH 1GMDF 1C1QA 1Y5UT 1BMNH 1L1NA 3CP7A 2RA0A 1FIWA 3PLBA 1TQ0B 1Y3YA 1ABJH 4SGBE 3DA9B 4MLFB 1P2NA 1Z7KA 4A7IB 1O3KA 1P2IA 2AS9A 1O3LA 1C5ZB 3EQ0H 1EASA 5IYTA 1QFKH 3A7ZA 1A7SA 1FY8E 1N6YA 1AI8H 1XUFA 5DG6A 1J16A 2BHGA 1OPHB 3TITA 4CRGA 1C5QA 2G81E 2Z6BD 4AB9A 5JBAS 1VGCC 4K2YA 3QGJA 1T8LA 1OYTH 2BVSH 2ZDAH 1THSH 3TIUA 4ABGA 1MKWK 3MFJA 1FPHH 1LHDH 1ZSKA 2Z3DA 3BTEE 2FOMB 1SQTA 1UTJA 2R3UA 3MO6A 7LPRA 5FX6A 4GSOA 3GCHC 4FU7A 2UUJB 1MD7A 4FU8A 3ZVEA 1YP9A 1S83A 2AIPA 1LPZB 1QRZA 1F0SA 1BCUH 1V2LT 3GISB 2ZQ1A 1LVMA 1QB1A 1SFQB 1OYQA 4AORA 1BITA 1EUFA 1XVOA 1EPTA 1O37A 1INCA 3SU5A 1SLUB 2WYGA 4BOHA 4HFPB 3KGPA 4FUDA 1K2I1 4RN6A 1SVPA 2BQ7B 3R0FA 1MD8A 1IOEA 1O2GH 1A3BH 4H6SB 1JIRA 4JZEH 1O2RA 3M61U 4GCHG 3SQEE 2HVXA 1TNJA 4GPGA 1ZMNA 1C4V2 2HLCA 4IMZA 4FXGH 2J4IA 5F03A 1D3QB 4A6LA 1U6QA 5A0CA 1AN1E 1AGJA 4E05H 1CA8B 3M5MA 3TK6A 3TK5A 2Y5GA 3NXPA 2G4TA 4TWWA 4U2WA 2ZI2H 1CSOE 1WU1A 1A4WH 2GKVE 1C5WB 1GDUA 2PW8H 4BAQB 1XVMA 1YKTA 2EA3A 1AZ8A 2G52A 1WQSA 1HAGE 3Q3XA 3S0NA 2CGAA 3PMJA 1BT7A 1HJAC 3ZZBA 1T7CA 1KXCA 1TWXB 5FPSA 1GBHA 2ZTZA 1HYLA 3A7TA 1EB1H 4JMYA 1AVGH 3D62A 4K60A 5EU8A 3RXSA 5TCAA 3KHVA 1PQ7A 3S9BA 4FUIA 3S9CA 1ZR0A 1G32B 3SU0A 3PTBA 2ZGHA 1D6WA 3LONA 2FPZA 1ELTA 2ZU2A 3PMAB 1D4PB 1BOQA 4NIVA 1C4Y2 1QGFA 2QYIA 4NA8A 1ELDE 4FUEA 1MTNB 2GD4B 1JIMA 1AO5A 3BN9A 1NU7B 5FPYA 3HGPA 1IQKA 4CR9A 1BTYA 1EP6A 1UTPA 2ZFQH 2XBWA 3BG4B 1ESAA 1Y5BT 3SQHE 3UQVA 3UY9A 3VXEH 5ESTE 3A85A 4DJZB 2ODQA 2VWLA 1MKXH 2F3CE 1GDNA 2FI4E 5C1XA 4I33A 1HPGA 3TNSA 1K1NA 4GCHF 1GJAB 2C8WB 5H4IB 4LZ4B 2BD9A 1CT2E 3FP8E 1O2VA 1AB9B 5AFZH 3ZVAA 3RP2A 2IOTA 1K1LA 1TGBA 1TFXA 5FPTA 4RKOB 3ZZ4A 1DX5M 1BTPA 3FP6E 4X1QU 3KQCA 2SGAA 3LGUA 4ISNA 3RXAA 1Y59T 1CBWC 3IITA 1HV7A 4K8YA 3TH4H 1PQAA 1BUIA 1QA7A 4BAHB 1SPJA 3AW0A 3SJKA 1O3FA 5DP3A 3KEEA 1K28D 4CRCA 2FDAA 3V12A 1UTKA 1ETSH 4HGCA 2GV7A 1X7AC 1FN6A 4ZHAA 4X2XA 2PUQH 2OCVB 1S85A 3LJOA 1V2QT 5E8EH 4X6PA 1C5LH 1W8BH 1GVZA 4X0WU 3TH2H 3T26A 1HDTH 3L33A 1MU8B 3RXBA 1EPTB 1VCPA 1YPGH 1O31A 2I6SA 2CV3A 4NCYA 1RFNA 2Y5HA 4B2BA 3ZYEA 2ZHQH 4AX9H 1AVXA 2H2ZA 1P11E 1KIGH 1DSTA 3QGNB 1ZYOA 1HAPH 2ZDKA 4AGKA 2BOKA 3RC5A 1ZRKA 1VR1H 2BVXH 2XBXA 1WQVH 2PV9B 1V2WT 1BDAA 2SNWA 3LGTA 4MPWA 2D26C 2QF0A 2W7SA 1O2MA 4XFQA 2VB0A 4WJG2 3ATLA 3UOPA 2QXGA 3P17H 1BMMH 2B0FA 5F6MA 4XOJA 5C67A 2FX6A 3DFLA 3RM2H 5EPNA 1EOLA 3PV4A 3RU4E 2ZP0H 1GI6A 1BHXB 1QJ7B 2PSYA 1ETTH 1HUTH 2Z9IA 4DIHH 1YLDA 1O5DH 5E2OA 1DUAA 3Q76A 4AFQA 2C8ZB 1GJ5H 1W13U 2O8WA 3QZQA 5EPYA 1P03A 2R2WU 3AAUA 2FTMA 1BMAA 1DANH 1LHGH 1QBVH 2QXHA 3Q3YA 4D7FA 2SFAA 1SLVB 1GMCG 3E3TA 1DM4B 1MTNC 1IQIA 1FJSA 2STBE 4UEHH 3ZZCA 4MDSA 2C4FH 2WUCA 1OS8A 1HGTH 4JZ1A 4WMFA 1ZGIA 1YCPH 1GVKB 2EI7A 1IHSH 2A31A 3BG4C 3T28A 4MVNA 8GCHF 2FZZA 1T4VH 2G5VA 1WUNH 8ESTE 2CMYA 4ABHA 2FOGA 1HAYB 1AE8H 1W7XH 1LHEH 1OWJA 3ZZ7A 3SV2H 1UVOA 4MPUA 2ANYA 4ABJA 1UMAH 1MBMA 3EGKH 1T8MA 1C1RA 1QL7A 1OWKA 1PQ5A 4YO9A 1Z1JA 2ZFTA 1AY6H 1K1PA 4U30A 4FVDA 1PYTD 2O8UA 1A0JA 1LPKB 1WTGH 4Y10E 5L6NH 2V0BA 3A87A 3T29A 3TJUA 3TLOA 1H9HE 3GY4A 1GHAG 2FS9A 3P95A 2ZGCA 3AAVA 2FOHA 1Z8JB 1F0RA 2JH6D 4DVAU 1ZTKA 3W94A 2F9UA 6GCHG 3UNSA 5A8ZA 1BMLA 3F68H 1AFQB 5DJ7A 2Z3CA 1UTLM 4XSKU 1HCGA 2JH0D 2BMGB 1OP0A 2ZGJA 3UIRA 1KXEA 1CGIE 2ZHDA 4B1TA 1OSSA 1PJPA 3WY8A 4DOQA 4XDEA 3RXEA 4AFSA 1KXAA 1O2SA 1EPTC 5EXMA 2XRCA 3N7OA 1S5SA 2OQUA 1D9IA 1ABIH 3VEQB 3SNBA 1KLJH 1TGNA 5C20A 3Q3KA 5CHAB 1GMCF 1HNEE 4DIIH 1A3EH 2CXVA 4RSPA 1GBBA 1TLDA 4JK5A 1SBWA 1A0LA 3Q00A 1OX1A 4R8TB 3ZVFA 3KQBA 4X6NA 3TPIZ 1IQFA 1O3DA 3MH7A 3A89A 4B75A 2XNIA 2P93A 1T4UH 1BB0B 4FVBA 2H1UA 1TOCB 3KQEA 5IDKA 1TX8A 1GBMA 1KXDA 5F8ZA 3TVJB 1T8OA 2BDIA 1AZZA 2FS8A 4ESTE 1KXBA 1WSSH 1TPSA 1N8OB 1UK3A 4UFEH 2ALPA 1O39A 1UTOA 2C8XB 3F9GA 1DLEA 1RTKA 3VB7A 1GJ6A 9ESTA 2ZGXH 1K21H 1C5YB 4X1RU 5JDUB 1GHAF 1ZZZA 3TJVA 2IN2A 1FNIA 3L6PA 2C90B 1O2YA 5E0GA 2F83A 3BTFE 3LPRA 4E7RG 1P2OA 1F2SE 3EE0B 1LO6A 6GCHF 7ESTE 2ZO3H 3VGCC 2GVFA 3UQOA 3G01A 4CH2B 1SI5H 5J4SA 1EJAA 3MHWU 2YOLA 4GHTA 2AH4X 1D3DB 4INKA 3CENA 4GLYA 1BBRK 2ZDLA 3SZNA 4E7NA 1MUEB 2QY0B 2XBVA 2GDEH 2UUYA 2HGTH 2PR3A 4WWYA 1HLTH 1Q2WA 2ZPRA 2WPLS 2AGIX 1BBRE 4YT6H 4ZROA 1P02A 3NCLA 3RXJA 1T31A 1C2JA 4Y0ZE 1AD8H 4TY7A 1O3BA 1ESTA 1GI7B 2BD3A 3UUZA 1NN6A 1FY4A 1FXYA 1O3HA 1GHBG 4AG2A 1B0EA 4BAOB 1V2NT 1GCTB 4JCNA 5FCKA 3HPTB 4DW2U 2CHAB 4Q2KA 1SGFA 5A09A 1KTSB 2TRMA 2ZWLH 4MNXA 1TIOA 2WV4A 1H9IE 3MH5A 3PWBA 5EW1H 3GYLB 5DP4A 4BANB 2BX3A 2OC1A 3UOUA 1OP8A 3LH1A 3UR6A 1ZSJA 5A8XA 2UWLA 1NT1A 1CVWH 1RIWC 4UFDH 1ELVA 3ZZ9A 3MNSA 1SGTA 1ZHPA 5CE1A 1ETRH 4Y76A 1IHTH 2P3FH 4FUBA 4DY7B 3SI4H 1HJ9A 5CHAC 2C8YB 3C27B 3RXQA 1CA0B 2ULLA 3T27A 1QRWA 1A46H 1DXWA 2W7UA 3A7XA 1MBQA 2A4GA 2BXUH 3F9FA 1XUIA 2AMDA 1G2MA 3MU4A 1XUKA 2ZC9H 3EA7A 1C2KA 1HIAA 1SFIA 4UE7H 1DOJA 2AEIH 1KLTA 2Q6DA 3K6ZA 4VGCB 1G36A 1MKXK 2J38A 2QC2A 2D2DA 2QXIA 4IC5A 2KAIB 1SHYA 2ANWA 2JH5D 5F8XA 4I8HA 6CHAB 1GJ7B 1V2OT 4DCDA 1N8OC 1QB6A 5L30H 2ODPA 3ZVDA 1MZAA 4Y8ZA 2F9NA 1GGDB 1P2QA 1W0ZU 1YF4A 4D9RA 3LIWA 2VIDA 1YYY1 3MNXA 4NFFA 1C5SA 2UWOA 2QN5T 3C1KA 1QBOA 3M5OA 3KIDU 1SSXA 4XE4A 3M5LA 1D3PB 2FI3E 1MQ5A 1O2NA 2ZG0H 1YPHC 4Q7ZA 5FBEA 3H5CB 4YM9A 4WMEA 1GBJA 4ISOA 3RXRA 2YNBA 3U98H 1XKBC 1CU1A 2FX4A 1TNKA 2BDHA 3HGNA 2A32A 3LC5A 3I77A 1GI3A 1O2ZA 5T6GA 2Q6FA 3RXTA 2PWXA 5DK1A 1GHBF 3ESTA 3RXCA 3SN8A 1O2LA 5AF9H 2OLGA 1BTZA 2ZTXA 1Z8RA 4BTTB 2B9LA 2BM2A 4NZLA 1EAXA 2GZ7A 3MH6A 5L2ZH 1QL9A 2J34A 2EI6A 2J95A 3PTNA 3M3VA 3RXKA 3V3MA 4GUXA 2ZFFH 3STIA 3VPKA 4K69A 1TQ7B 1DICA 3A7YA 1C2FA 4K8BA 1GDQA 4Z0KA 4ZKRU 2RA3A 2FESH 3URCA 5A0BA 4I8KA 1L4ZA 2WPJS 2H5CA 2J9NA 2OD3B 5EQSA 3H7OA 1F5RA 1GBIA 1GL1A 1XUHA 4F49A 1ESBA 4X1PU 4CREA 4DT7B 3SV8A 1F0TA 3EA9A 4UFGH 2FLBH 1O2XA 1W14U 4YOGA 1GJ8B 2VWOA 1ARCA 3D49H 4ZAEA 1D3TB 1GI8B 1GWAA 3RXGA 2G51A 2OQ5A 3K2UA 1NROH 5FCRA 3A86A 2Z9KA 1YBWA 1ANBA 1TYNA 1UVTH 1O2WA 5ETXA 1A5GH 1DLKB 1NFWA 1SOTA 3MO3A 3QO6A 1YPJH 1TOMH 1OKXA 1W3CA 2BDBA 1QHRB 2B5TB 3U9AH 1S0RA 1EB2A 1QURH 3DUXH 1O38A 3MWIU 3R3GB 1DSUA 1K1MA 3A8DA 2TGDA 1YCPK 4K5ZA 1K1OA 5K0HA 5FX5A 1TBRH 4OS1A 1V2VT 3UPEA 4X8UH 1C2HA 3QLPH 2RG3A 1TA2A 2ZU4A 1BBRH 2VH0A 4ABDA 1NRPH 1OXGA 3ZZAA 1ZJDA 1C1UH 1EQ9A 1TX6A 2O8MA 4FUCA 5C3NA 1TMUH 3SNAA 1SGEE 4NZQA 3RC4A 3E16B 1HAOH 1PQ8A 3M36A 3TH3H 6CHAC 2XC0A 1YPLH 3NK8A 1GG6B 1GJ9B 2TGPZ 2AIQA 1VZQH 1QQ4A 4UDWH 1O30A 1UO6A 2ZTYA 3F6UH 4IBLH 3T25A 2BDAA 2OBQA 1NFYA 2BD7A 2DE9A 5DP8A 4GVUA 1HIAB 2BY8X 1ARBA 3SUEA 5EGMA 2ANKH 3JZ1B 3U8RH 4X2WA 3GDVA 2JETB 1ID5H 4NWKA 2VIQA 1CQQA 3MTYA 3E0PB 1WOFA 1DT2A 1NM6A 4WXVA 1FUJA 1NO9H 1O2PA 2FXRA 2Y5FA 1JBUH 3RM0H 1OWDA 3RXDA 1HFDA 2XWAA 1Y3WA 1A1RA 1P01A 1O2JA 4B71A 1BRAA 1EZXC 2OXSA 3BTTE 1HBTH 3ZZ5A 5B6OA 2HOBA 1SGQE 3HK3B 3SU1A 3LGVA 1K1JA 3LU9B 4ZXXH 4FUHA 1TX7A 2Q6GA 4OS6A 3GOVB 1Y5AT 1NZQH 2FO9A 3GCOA 4FUFA 3I29A 3SHCH 2A2QH 1V3XA 2R0LA 3SNCA 1BHXF 4I32A 5K7RA 4BXWA 3T5FH 2VVUA 3GY3A 2BQWB 1OWIA 4H6TA 2PKSB 2NU0E 2ZU3A 1E38B 3GDSA 1QR3E 1PFXC 1AUTC 4AYVB 1C2GA 5GIBA 2G55A 1LPGB 2F9VA 3M7TA 3MO9A 1Y8TA 2VWNA 2W3KA 1WAYB 2QCYA 3EAJA 5LPEA 1FZZA 3F9HA 3VB5A 3OTJE 1PPFE 1FY1A 3MI4A 4GAWA 1NRNH 1GI2A 1P2JA 2BD2A 4BAMB 1A2CH 1JRTA 5GXPA 3GCNA 4X1NU 2XC5A 8GCHG 1AFEH 3MU0A 1LQEA 2FOBA 2VIPA 3SV9A 3UREA 5DP7A 1DPOA 4RKJB 2PFEA 3SOSA 3RC6A 2XYAA 3FP7E 4A1TA 4TYDA 2XCNA 1L1GA 4MNWA 5EQRA 2BY6X 1C2MA 3RXUA 5BPEA 1CHGA 1C1NA 1DXPA 3VXFH 3BTME 5C1UA 8KME2 3GY6A 4ZH8A 3BIUH 2BQ6B 1W7GH 2CF8H 1GHXH 1YGCH 5DPAA 1Y3XA 2BTCE 3TGJE 1C1VH 1J8AA 1ZTJA 2WPMS 4R0IA 1C1OA 2FI5E 4MQAA 2ZIQH 2FYQA 5JBTA 1GG6C 2ZFPH 3BG8A 1AUJA 1CHOG 1LVOA 2ZU1A 1QIXB 2BB4A 2PTCE 2BDYA 4ZMAH 3S7KB 2FWWA 1NFUA 1AQ7A 4CRDA 1VJ9U 4YLUA 1QY6A 3BTWE 4I8JA 1W12U 2BY5X 2JETC 5T3HA 3VB6A 3LGWA 1O3JA 2ZHWH 3SV7A 1KXFA 2A7CA 5HMAA 1FY3A 1C1SA 3F9EA 4JYVH 4JYTA 2GDDA 4NIXA 4AZ2B 2GTBA 1P9UA 5CMXH 5BRRE 1DE7H 1DUEA 1ZPZA 3E6PH 5FAHA 1GHZA 4KELA 1W10U 1EJNA 1MTWA 1TGSZ 1N6XA 1Z71A 2BZAA 1J9CH 2P3TB 2ESTE 2VNTA 1SQOA 3KF2A 1GHYH 1TBZH 1TA6A 1LHFH 1LTOA 1EAIA 1ZTLA 3OY5U 4WF8A 1FMGA 3URDA 4AFZA 1NRQH 2BD5A 3BTGE 3SUFA 1S81A 1MQ6A 3IG6B 4WH8A 2AGGX 3STJA 2BY9X 4CRFA 1UK4A 2C93B 3CS0A 5EXLA 5DP5A 2OC7A 1AB9C 1MTSA 3A80A 3EYDA 2NU4E 1GBDA 1K9OE 5C5OA 4NGAH 2R2MB 1SGNE 1UK2A 1TNLA 1YLCA 1VCWA 3NUMA 4INLA 1SR5C 4AYYB 1ELFA 1G30B 1GI5A 2WPIS 1OWEA 2Y7ZA 4CBNA 3ZVGA 3A84A 1CHOF 1YM0A 1F7ZA 2K1QA 3MH4A 2UUFB 1VITG 5E0HA 2QV1A 3ENSB 4AFUA 2O9QA 2EI8A 3M7UA 2LNCA 1SGRE 1GPZA 2STAE 2WUBA 4ISHH 1ZHRA 4YZUA 5JB8S 1M9UA 1AU8A 3P8OA 3U8OH 3ODFA 4X8SH 3UWIA 3SGQE 2A2XH 2ZPQA 3SGBE 1AWHB 5FXLA 4ABIA 1GL0E 3NZIA 1PYTC 1Q31A 3K6YA 2IPHA 1DVAH 2WINI 2Y82A 4QT8C 5T6FA 1RTFB 5J4QA 1AE5A 3MU5A 4ABAA 3SU4A 4OGYA 2HNTF 1G2LA 1O36A 1JOUB 5T6DA 1UJ1A 1QQUA 5EOKA 4BNRA 1AKSA 3ZVCA 5DP9A 1E36B 4NA7A 4MNVA 3MMGA 1P06A 3SJ9A 3S7HB 1C1TA 3ZZ3A 1NY22 1EZSC 1XXFA 3SGAE 1PPHE 4K1SA 1P05A 3FVFB 1BA8B 2TBSA 3U1IB 4E06H 4AGJA 2EC9H 2FOFA 2ODYB 3P8FA 1C9PA 3KL6A 3A88A 3V13A 1W0YH 3RLWH 4CHAB 1QTFA 4WXIA 1O2HA 1J15A 1MAYA 4F4OC 1IQEA 1FIZA 1IQGA 1EAUA 1AMHA 2Y7XA 5LPRA 2CF9H 5GCHG 2GT7A 1CT0E 3PM3A 3A83A 2SNVA 2P59A 2AGEX 1MCTA 1CO7E 3FANA 3LOXA 3EA8A 1HXEH 5LPFA 3P6ZB 1VITF 1P3EA 1KLIH 2WPKS 2FTLE 2BX4A 3OX7U 1GBTA 3SORA 5EG4A 4ZHLU 4ISLA 4HZHA 4AG1A 3PB1E 3MNCA 1HJ8A 4X6OA 3UR9A 4ZKNU 4Y71A 4DURA 3U1JB 1C9TA 1TRYA 1SGFG 1V6DA 2AYWA 2CN0H 1DWCH 4KP0A 1W11U 4I8LA 4X2YA 3M5NA 5FBIA 4D7GA 2VIOA 1V2RT 2BLVA 2ZHEH 2XWBI 3UTUH 4A1VA 4JYUH 4MTBA 1XM1A 1AFQC 2G5NA 2O8LA 2A5AA 1C2EA 3TGKE 1PPZA 4OGXA 1VGCB 4Y7AA 2P3UB 1YCPM 2GCHF 4DG4A 3E8LA 1TNGA 3QDZB 2VU8E 3ODDA 1GJCB 4ZHMU 4MPVA 2ZU5A 1BZXE 2A1DB 1P0SH 1IQHA 2SGDE 1GCDA 3M7QA 1Z6EA 3BSQA 4INHA 4B2CA 1T8NA 2PGQB 1V2PT 2TGTA 1EZQA 1TBQH 7GCHG 1ANDA 5HXFA 2AERH 3OSYA 3GYMA 1LCYA 3UFAA 1O34A 1THRH 4WMDA 2XC4A 2UUKB 4FUJA 5GCHF 1UVUH 4GHQA 1C1PA 4WH6A 4OS5A 1DDJA 3LGIA 1YPHE 3S69A 4TY6A 1G3CA 9LPRA 1GJ4H 4I8GA 2HPQH 5FHTA 1XUJA 1G3DA 1KSNA 1NRRH 4X8TH 2M5TA 1ELGA 2BD4A 3RXPA 4ABEA 1WCZA 3KN2A 4Y0YE 2D8WA 1ZSLA 4WY3A 3BV9B 3LJJA 3QTVH 4MG3A 1TNIA 1C5PA 1AKSB 3MU1A 1A5IA 1NPMA 1SQAA 4KTCA 1OP2A 1FN8A 1FLEE 3BIVH 2FM2A 3RLYH 1BJUA 2Y80A 3EDXB 3RXIA 1OOKB 1HAVA 1GBEA 1O3OA 1RS0A 3O8BA 4O9VA 1BIOA 4Y6DA 4IW4E 3UNRA 3MNBA 4LK4A 2PLXA 1O3NA 1F5LA 1EX3A 2R0KA 3RMMH 1TGCA 2FODA 4B76A 5I46H 1C2IA 1J17T 3E0NB 2HALA 2H9HA 5C1YA 5TJXA 1O3GA 3HK6B 4D8NA 1QJ6B 3HATH 2HNTE 4J2YB 2VJ1A 3RUOA 3RU4T 2ZNKH 1FQ3A 4X1SU 1Z8IB 2A4QA 2ZHFH 3QX5H 5EXNA 5PTPA 3ZZDA 1LMWB 1FAXA 1RRKA 3AASA 2A5IA 1MTVA 1IQLA 1P10A 3ZYDA 3TJNA 2GT8A 2VGCB 3D65E 3DFJA 7GCHF 3TGIE 1UHBA 3B9FH 1LKBA 1OWHA 4JZFH 1H1BA 1LKAA 2QGRA 3GY8A 4K3JA 2BLWA 2PTNA 1TMTH 1CGJE 4K1TA 2F9PA 5EW2H 1XX9A 2HNTC 2H5DA 8LPRA 1SGPE 3QUMP 4YLQH 1HB0B 1O5GH 3QN7A 2OC8A 2BDCA 1O3PB 4I31A 1GCTC 1O0DH 3OU0A 2FEQH 2CHAC 2C3SA 1HAZB 1TABE 1EATA 1C2DA 2Y6TA 2OP9A 1YPMH 3DT0H 1KTTB 1A5HA 2ZDMA 3PMBB 2BD8A 3QZRA 1PPEE 3MYWA 3QTOH 3VB4A 2ZA5A 1RXPA 1FPCH 3K65B 2BDGA 3CS7A 4HTCH 2GX4A 1UVPA 1CA0C 1GHWH 4H4FA 1CBWB 3ZZ8A 2P94A 4Y8YA 2PSXA 1UTQA 1CE5A 1SC8U 3U69H 2I6QA 1GVLA 1UVSH 1MMJN 1HRTH 2ZGBH 1VJAU 2LPRA 4VGCC 1P2KA 3RMNH 2VWMA 4O97A 5GJ4B 1DY9A 3UNQA 4A5TS 3SU6A 2OBOA 1UTMA 3DD2H 4NSVA 1BTUA 1VCQA 1GGDC 3P92A 1SMFE 5JBBS 1DS2E 5AHGH 1O3AA 1ACBE 2TIOA 1F5KU 3NKKA 1UCYK 4NIYA 3O8RA 4Y11E 3SJIA 1NS3A 3GY2A 3SV6A 1ELAA 2UWPA 1O5EH 3LC3A 2NU1E 4BXSA 1UCYE 5HM2A 4A1XA 4YT7H 3MU8A 2BXTH 1GMHG 2P95A 3BTDE 1V2MT 3GY5A 5E2PA 3RXVA 1QB9A 1QBNA 3O8CA 1TAWA 5DGJA 1GHVH 1Z6JH 1O3MA 1THPB 2V6NA 1TGTA 3KNXA 1E35B 2PUXB 3ZVBA 1ZOMA 4BTIB 2BZ6H 1AVWA 1FV9A 2Z94A 3SUGA 5JB9S 4BAKB 3FFGA 3GY7A 1HAVB 3RDZA 2XTTB 4WVPE 5A2MH 1ORFA 2Z3EA 4NSYA 3LDXH 1C5UA 1C1MA 1GI0A 2P8OB 1H4WA 3RXFA 1IQJA 4YOIA 3QK1A 2VINA 1BJVA 1W2KH 2TPIZ 2VGCC 1EAWA 1SLWB 2WYJA 1P3CA 1O2QA 2AMPA 2PGBB 2A45B 4M7GA 4Z6AH 5JPMH 1B7XB 3E1XB 1O5FH 4A92A 2ZF0H 1ZMLA 2SGFE 2HWLB 3NWUA 1TPOA 1DWBH 3IWMA 1HAIH 2A0QB 2A5KA 1TMBH 4TWYA 3SHAH 1WTHD 3V0XA 3ATWA 5TCCA 3ZZ6A 1Q3XA 5L2YH 1P12E 2ILNA 4O3TA 1NC6A 2WPHS 5GDSH 1O35A 5C5NA 2XCFA 1UHBB 4MPXA 4PROA 2GV6A 2GCTB 1GBCA 5DP6A 2SGPE 1TB6H 3LGYA 1P8VC 4D9QA 1H8IH 3V7TA 1V2UT 3HKIB 3M3TA 3M37A 2OC0A 1C4U2 1SL3A 1N1LA 3PO1B 2JKHA 3LKWA 2SGQE 1RTLA 2V3OH 3TU7H 1ELEE 1AWFH 4FUGA 7KMEH 5E0JA 1C5TA 1P09A 2G00A 2ZECA 1EP5A 2ZFSA 1GI9B 5JYIA 4UFFH 1S0QA 1Y3VA 1L4DA 2GZ8A 3UWJH 1QJ1B 1GMHF 5SGAE 1QNJA 3A7VA 1ZPCA 5G4BA 1SB1H 1L2EA 3FZZA 2Y81A 2ZEBA 2TGAA 1IAUA 2G4UA 5GPIB 1EOJA 2V3HH 1O3IA 2B8OH 2NU3E 3BTKE 3P8GA 1NU9A 1IQNA 4ZUHA 4AOQA 1HAHH 1UTNA 3BEUA 3SBKA 1K22H 1MTUA 1XKAC 1FAKH 1TALA 4ABBA 3PROA 3E91A 2DE8A 1TRNA 1S84A 1L1JA 3SNEA 4B74A 4ASHA 1YPKH 1ANEA 4CH8B 1A0HB 4D76A 2NU2E 2ZFRH 1KYNA 1VITH 1MKWH 2WV5A 1TRMA 2QA9E 1G3BA 4MNYA 3MOCA 1B5GH 1G9IE 1CGHA 4X6MA 1YPEH 3PLPA 4KGAA 4KTSA 2ANMH 2HPPH 3RU4D 1A61H 1MAXA 2A4RA 2QIQA 2BLOA 1LVBA 1JMOH 4YTAA 4IMQA 2P16A 1ELBA 1GI1A 1S6HA 1GJBB 3ATKA 1H8DH 1O3CA 3RMOH 1DITH 2A7HA 1SGIB 3SUDA 1P57B 2P8OC 4J1YA 4X8VH 1S82A 1G3EA 1WV7H 2ZQ2A 3O8DA 4ZXYH 5LH8A 3ELAH 1ANCA 3TJOA 2BY7X 4UONA 2ZZUH 4IS5A 1V2ST 2GZ9A 5DKMA 3GCTG 2PKSC 3OY6U 3QWCH 3VFEA 3GICB 1O5CB 1QL8A 2RCEA 1BRCE 1EZUC 3VGCB 5F8TA 1QA0A 1B0FA 4AB8A 4Q7YA 1YC0A 1KDQA 4JZIA 2QXJA 1D6RA 2EEKA 1UCYH 4JK6A 2GCTC 1DWDH 3Q77A 2R9PA 3H7TA 4BTUB 1O2IA 1DY8A 1O5AB 2IJOB 2FIRH 4CRAA 1XUGA 4FU9A 1F92A 1Z1IA 1MCVA 1J14A 1C5OH 2NWNA 1XXDA 2XBYA 3A8CA 3PO1C 1AHTH 1DFPA 1WBGB 2ALVA 2W5EA 1GBKA 3FZDA 1SLXB 3SNDA 2J92A 4XBCA 2PHBA 1C5VA 1HXFH 1SG8B 3BTQE 2QF3A 4Y8XA 4UD9H 2VIWA 2H6MA 4LXBH 3ZV8A 1V2TT 1RJXB 4OS7A 2GGVB 3P70B 2AMQA 4TPIZ 3RXOA 2ZCHP 1EJMA 3BF6H 3SJ8A 2Z9JA 4LZ1H 4XBBA 1C5NH 2QAAA 4DGJA 4JZDH 1IQMA 1C5RA 3B23B 3A7WA 3SJOA 1GBFA 1PPGE 5A8YA 3T62A 1O2TA 3ATMA 4NWLA 4O03A 4OS4A 3VB3A 2W3IA 2XXLA 2PKAA 3SU2A 2OINA 2DUCA 4IN2A 1SGCA 1ZHMA 4U32A 1RIWB 2Z9GA 2GCHG 5ABWA 1O3EA 2KAIA 1QRXA 4Q7XA 6ESTA 2Q1JA 1O2OA 4NG9H 4O3UA 3W95A 1HAXB 3GCTF 2B7DH 1GBAA 1NFXA 1O5BB 1RGQA 4AN7A 3F1SB 4NA9H 3LH3A 3PYHA 1BRUP 4K1EA 2HRVA 2G8TA 1FY5A 1C2LA 4IC6A 3K9XB 1ZLRA 5DO4H 5GWZA 2F91A 2FLRH 1QCPA 4Q80A 4X2VA 5HM9A 2XW9A 2THFB 1LDTT 5LGOA 3JZ2B 3TK9A 1K1IA 1GBLA 1C5XB 2ZPSA 1MH0A 2J94A 1BTXA 3P8NA 1O33A 3BEFB 3ZV9A 2BLQA 3M3SA 3A82A 1Y3UA 3KCGH 1JXPA 1MZDA 1XMNB 1E37B 1EKBB 4TPYA 1E34B 1O2UA 2ZDVH 5EODA 1EXFA 1O32A 1F0UA 2BYAX 4YOJA 1V2KT 2GMTB 1L0ZA 1P2MA 3S9AA 3PMHB 5EQQA 2FOAA 1JRSA 1O2KA 1ZPBA 2OTVA 1SGDE 4ZKOU 1SOZA 5I25A 1LQDB 4U01A 4IN1A 4OS2A 2A4OA 5ESBA 3TNTA 1ZJKA 2FMJA 2F9OA 3AVZA 4B2AA 3ITIA 1T32A 2ZKSA 2VVVA 1FDPA 2OUAA 1C1WH 1RD3B 1NTPA 1E0FD 3SO3A 2AFQB 3I78A 1KDQB 2VVCA
chains in the Genus database with same CATH superfamily
1ZRBA 2CJIA 2O8TA 1JWTA 2R3YA 1GMDG 2Z9LA 2FOEA 1TONA 4CBOA 3L3TA 2BVRH 2F9BH 1ZGVA 2ZDNA 4LOYH 3GCHB 2ASUB 4B73A 5C2ZA 3M35A 4Y7BA 4P00A 3U8TH 1LHCH 2BOHB 4F55A 1C5MD 1VKYA 1CT4E 4ISIH 5HGGA 2H9TH 3E90B 1NESE 1MU6B 3A8AA 2D1JA 3A81A 4ZKSU 3RXLA 2FYRA 4NIWA 1DWEH 3SW2B 1GI4A 1ELCA 5JBCS 2ZCKP 2SGEE 4THNH 1P9SA 1TNHA 3PWCA 1TPPA 3D23A 2V35A 2YNAA 1BTWA 3OYPA 4H42U 1COWD 5HYOA 3PLKA 6LPRA 2FP7B 3RMLH 4KKDA 2PKAB 1PPBH 1P04A 1SHHB 4CHAC 1G37A 4SGAE 3SU3A 2H9EH 3F2HA 3FAOA 1ZMJA 1SGYE 1V2JT 2RDLA 2YMSD 5A0AE 3RXMA 1LVYA 2W26A 1BRBE 2Z7FE 3ATIA 5AFYH 4HI3A 3BEIB 1FONA 4ABFA 1TE0A 1BQYA 2A7JA 3DHKH 3T2NA 3B8JA 5AVDA 4YESB 2WZQA 3LT3A 4XBDA 2VH6A 1Z8GA 2FOCA 2ZCLP 1H9LB 3AW1A 1TPAE 3GDUA 4NFEA 2GP9B 3RXHA 2J2UA 1GJDB 3A8BA 4IGDA 3HKJB 4KTUA 3SI3H 1HJAB 1PPCE 2IJD1 4CRBA 1NRSH 1S6FA 2WHXA 3NPSA 4CR5A 1AIXH 2VIVA 1BTHH 1KY9A 3BTHE 3KQDA 4Y79A 5EJZA 1WYKA 1FI8A 2GMTC 4I7YH 1GMDF 1C1QA 1Y5UT 1BMNH 1L1NA 3CP7A 2RA0A 1FIWA 3PLBA 1TQ0B 1Y3YA 1ABJH 4SGBE 3DA9B 4MLFB 2J97A 1P2NA 1Z7KA 4A7IB 1O3KA 1P2IA 2AS9A 1O3LA 1C5ZB 3EQ0H 1EASA 5IYTA 1QFKH 3A7ZA 1A7SA 1FY8E 1N6YA 1AI8H 1XUFA 5DG6A 1J16A 2BHGA 1OPHB 3TITA 4CRGA 1C5QA 2WPDD 2G81E 3AK5A 2Z6BD 4AB9A 5B6LA 5JBAS 1VGCC 4K2YA 3QGJA 1T8LA 1OYTH 2BVSH 2ZDAH 1THSH 3TIUA 4ABGA 3UAIC 1MKWK 3MFJA 1FPHH 1LHDH 1ZSKA 2HVYB 3F2GA 2Z3DA 3BTEE 2FOMB 1SQTA 1UTJA 2R3UA 3MO6A 7LPRA 5FX6A 4GSOA 3GCHC 4FU7A 2UUJB 1MD7A 4FU8A 3ZVEA 1YP9A 1S83A 2AIPA 1LPZB 1QRZA 3ZIAD 3UB0A 1F0SA 1BCUH 1V2LT 3GISB 2ZQ1A 1LVMA 1QB1A 1SFQB 1W0JD 1OYQA 4AORA 1BITA 1EUFA 1XVOA 1EPTA 1O37A 1INCA 3SU5A 1SLUB 2WYGA 4BOHA 4HFPB 3KGPA 4FUDA 1K2I1 4RN6A 1SVPA 2BQ7B 3R0FA 1MD8A 1IOEA 2GJGA 1O2GH 1A3BH 4H6SB 1JIRA 4JZEH 1O2RA 3M61U 4GCHG 3SQEE 2HVXA 1TNJA 4GPGA 1ZMNA 1C4V2 2HLCA 4IMZA 4FXGH 2J4IA 3N99A 5F03A 1D3QB 4Q4LA 4A6LA 1U6QA 5A0CA 1AN1E 1AGJA 4E05H 1CA8B 3M5MA 3TK6A 3TK5A 2Y5GA 3NXPA 2G4TA 4TWWA 4U2WA 2ZI2H 1CSOE 1WU1A 1A4WH 2GKVE 1C5WB 1GDUA 2PW8H 4ACBA 4BAQB 1XVMA 1YKTA 2EA3A 1AZ8A 2L74A 2G52A 1WQSA 1HAGE 3Q3XA 3S0NA 2CGAA 3PMJA 1BT7A 1HJAC 3ZZBA 1T7CA 1KXCA 1TWXB 5FPSA 1GBHA 2ZTZA 1HYLA 3A7TA 4YXWD 1EB1H 4JMYA 1AVGH 3D62A 4K60A 5EU8A 3RXSA 5TCAA 3KHVA 1PQ7A 3S9BA 4FUIA 3S9CA 1ZR0A 1G32B 3SU0A 3PTBA 2ZGHA 1D6WA 3LONA 2FPZA 1ELTA 2ZU2A 3PMAB 1D4PB 1BOQA 4NIVA 1C4Y2 1QGFA 2QYIA 4NA8A 1ELDE 2F4LA 4FUEA 1MTNB 2GD4B 1JIMA 1AO5A 3BN9A 1NU7B 5FPYA 2K8IA 3HGPA 2M2AA 1IQKA 4CR9A 1BTYA 1EP6A 1UTPA 2ZFQH 2W6JD 2XBWA 3BG4B 1ESAA 1Y5BT 3SQHE 3UQVA 3UY9A 3VXEH 5ESTE 3FOAA 3A85A 1KMHB 4DJZB 2ODQA 2VWLA 1MKXH 2F3CE 1GDNA 2FI4E 5C1XA 4I33A 1HPGA 3TNSA 1K1NA 4GCHF 1GJAB 2L6OA 2C8WB 5H4IB 3KYFA 4LZ4B 2BD9A 1CT2E 3FP8E 1O2VA 1AB9B 5AFZH 3ZVAA 3RP2A 2IOTA 1K1LA 1TGBA 1TFXA 5FPTA 4RKOB 3ZZ4A 1DX5M 1BTPA 3FP6E 4X1QU 3KQCA 2SGAA 3LGUA 4ISNA 3RXAA 4FETA 1Y59T 1CBWC 3IITA 1HV7A 4K8YA 3TH4H 1PQAA 1BUIA 1QA7A 4BAHB 1SPJA 3AW0A 2V7QD 1MABB 3SJKA 1O3FA 5DP3A 3KEEA 1K28D 4CRCA 2FDAA 3V12A 1UTKA 1ETSH 4HGCA 2GV7A 1X7AC 1FN6A 4ZHAA 4X2XA 2PUQH 2OCVB 3NRLA 1S85A 3LJOA 1V2QT 5E8EH 4X6PA 1C5LH 1W8BH 1GVZA 4X0WU 3TH2H 3T26A 1HDTH 3L33A 1MU8B 3RXBA 1EPTB 1VCPA 1YPGH 1O31A 2I6SA 2CV3A 4NCYA 1RFNA 2Y5HA 4B2BA 3ZYEA 2ZHQH 4AX9H 1AVXA 2H2ZA 1P11E 1KIGH 1DSTA 3QGNB 1ZYOA 2IPQX 1HAPH 3PV5A 2ZDKA 4AGKA 2BOKA 3RC5A 1ZRKA 1VR1H 2BVXH 2XBXA 1WQVH 2PV9B 1V2WT 3F3BA 1BDAA 2SNWA 3LGTA 4MPWA 2D26C 2QF0A 2W7SA 1O2MA 4XFQA 2VB0A 4WJG2 3ATLA 3UOPA 2QXGA 3P17H 1BMMH 2B0FA 5F6MA 4XOJA 5DSFA 5C67A 2FX6A 3DFLA 3RM2H 5EPNA 1EOLA 3PV4A 3RU4E 2ZP0H 1GI6A 1BHXB 1QJ7B 2PSYA 1ETTH 1HUTH 2Z9IA 4DIHH 1YLDA 1O5DH 3DSGA 5E2OA 1DUAA 3Q76A 4AFQA 2C8ZB 1GJ5H 1W13U 2O8WA 3QZQA 5EPYA 1P03A 2R2WU 3AAUA 2FTMA 1BMAA 1DANH 1LHGH 1QBVH 2QXHA 3Q3YA 4D7FA 2SFAA 1SLVB 1GMCG 3E3TA 1YY3A 1DM4B 1MTNC 1IQIA 1FJSA 2STBE 4UEHH 3ZZCA 4MDSA 2C4FH 2WUCA 1OS8A 1HGTH 4JZ1A 4WMFA 1ZGIA 1YCPH 1GVKB 2EI7A 1IHSH 2A31A 3BG4C 3T28A 4MVNA 8GCHF 2FZZA 3KQ5A 1T4VH 2G5VA 1WUNH 8ESTE 2CMYA 4ABHA 2FOGA 1HAYB 1AE8H 1W7XH 1LHEH 1OWJA 3ZZ7A 1QZ8A 3SV2H 1UVOA 4MPUA 5CHBA 2ANYA 4ABJA 1UMAH 1MBMA 3EGKH 1T8MA 1C1RA 1QL7A 1OWKA 1PQ5A 4YO9A 1Z1JA 2ZFTA 1AY6H 1K1PA 4U30A 4FVDA 1PYTD 2O8UA 1A0JA 1LPKB 1WTGH 4Y10E 5L6NH 2V0BA 3A87A 3T29A 3TJUA 3TLOA 1H9HE 3GY4A 1GHAG 2FS9A 3P95A 2ZGCA 3AAVA 2FOHA 1SKYE 1Z8JB 1F0RA 2JH6D 4DVAU 1ZTKA 3W94A 2F9UA 6GCHG 3UNSA 5A8ZA 1BMLA 3F68H 1AFQB 5DJ7A 2Z3CA 1UTLM 4XSKU 1HCGA 2JH0D 2BMGB 1OP0A 2ZGJA 3UIRA 1KXEA 1CGIE 1E79D 2ZHDA 4B1TA 1OSSA 1PJPA 3WY8A 4DOQA 4XDEA 3RXEA 4AFSA 3OTPA 1KXAA 1O2SA 1EPTC 5EXMA 2XRCA 3N7OA 3DSOA 1S5SA 2OQUA 1D9IA 1ABIH 3VEQB 3SNBA 1KLJH 1TGNA 3H09A 3Q3KA 5C20A 5CHAB 1GMCF 1HNEE 3N7DA 4DIIH 1A3EH 2CXVA 4RSPA 3U28C 1GBBA 2KX4A 1TLDA 4JK5A 1SBWA 1A0LA 3Q00A 1OX1A 4R8TB 3ZVFA 3KQBA 1YWUA 4X6NA 3TPIZ 1IQFA 1O3DA 3MH7A 3A89A 4B75A 2XNIA 2P93A 1T4UH 1BB0B 4FVBA 2H1UA 1TOCB 3KQEA 5IDKA 1TX8A 1GBMA 1KXDA 5F8ZA 3TVJB 1T8OA 2BDIA 1AZZA 2FS8A 4ESTE 1KXBA 1WSSH 1TPSA 1N8OB 1UK3A 4UFEH 2ALPA 1O39A 1UTOA 2C8XB 3F9GA 1DLEA 1RTKA 3VB7A 1GJ6A 9ESTA 2ZGXH 1K21H 1C5YB 4X1RU 5JDUB 1GHAF 1ZZZA 3TJVA 2IN2A 1FNIA 3L6PA 2C90B 1O2YA 5E0GA 2F83A 3BTFE 3LPRA 4E7RG 1P2OA 1F2SE 3EE0B 1LO6A 6GCHF 7ESTE 2ZO3H 3VGCC 5KEDA 2GVFA 3UQOA 3G01A 4CH2B 1SI5H 3N7EA 1EJAA 5J4SA 3MHWU 2YOLA 2YMSB 5C0TA 3OE7D 4GHTA 2AH4X 1D3DB 4INKA 3CENA 4GLYA 1BBRK 2ZDLA 3SZNA 4E7NA 1MUEB 2QY0B 2XBVA 2GDEH 2UUYA 2HGTH 2PR3A 4WWYA 1HLTH 1Q2WA 2ZPRA 2WPLS 2AGIX 1BBRE 4YT6H 4XD7D 4ZROA 1P02A 4P02A 3NCLA 3RXJA 1T31A 1C2JA 4Y0ZE 1AD8H 4TY7A 1O3BA 1ESTA 1GI7B 2BD3A 3F2FA 3UUZA 1NN6A 1FY4A 1FXYA 1O3HA 1GHBG 4AG2A 1B0EA 4BAOB 1V2NT 1GCTB 4JCNA 5FCKA 2XOKD 3HPTB 4DW2U 2CHAB 4Q2KA 1SGFA 5A09A 1KTSB 2TRMA 2ZWLH 4MNXA 1TIOA 2WV4A 1H9IE 3MH5A 3PWBA 5EW1H 3GYLB 5DP4A 4BANB 2BX3A 2OC1A 3UOUA 1OP8A 3LH1A 3UR6A 1ZSJA 5A8XA 2UWLA 1NT1A 1CVWH 1RIWC 4UFDH 1ELVA 3ZZ9A 3MNSA 1SGTA 1ZHPA 5CE1A 1ETRH 4Y76A 1IHTH 2P3FH 4FUBA 4DY7B 3SI4H 1HJ9A 5CHAC 2C8YB 3C27B 3RXQA 1CA0B 2ULLA 3T27A 1QRWA 1A46H 1DXWA 2W7UA 3A7XA 1MBQA 2A4GA 2BXUH 3F9FA 1XUIA 2AMDA 1G2MA 3MU4A 5KECA 1XUKA 2ZC9H 3EA7A 1C2KA 1HIAA 1SFIA 3WWFA 4UE7H 1DOJA 2AEIH 1KLTA 2Q6DA 3K6ZA 4VGCB 1G36A 1MKXK 2J38A 4XRNA 2QC2A 2D2DA 2QXIA 4IC5A 2KAIB 1SHYA 2ANWA 2JH5D 5F8XA 4I8HA 6CHAB 1GJ7B 1V2OT 4DCDA 1N8OC 1QB6A 5L30H 2ODPA 3ZVDA 1MZAA 4Y8ZA 2F9NA 1GGDB 1P2QA 1W0ZU 1YF4A 4D9RA 3LIWA 2VIDA 1YYY1 2JJ2D 3MNXA 4F48B 4NFFA 1C5SA 1BMFD 2UWOA 2QN5T 3C1KA 1QBOA 3M5OA 3KIDU 1SSXA 4XE4A 3M5LA 1D3PB 5FL7D 2FI3E 1MQ5A 1O2NA 2ZG0H 1YPHC 4Q7ZA 5FBEA 3H5CB 2JIZD 4YM9A 4WMEA 1GBJA 4ISOA 3RXRA 2YNBA 3U98H 1XKBC 1CU1A 2FX4A 1TNKA 2BDHA 3HGNA 2A32A 3LC5A 3I77A 1GI3A 1O2ZA 5T6GA 2Q6FA 3RXTA 2PWXA 5DK1A 1GHBF 3ESTA 3RXCA 3SN8A 1O2LA 5AF9H 2OLGA 1BTZA 2ZTXA 1Z8RA 5C17A 2YMSC 4BTTB 2B9LA 2BM2A 4NZLA 1EAXA 2GZ7A 3MH6A 5L2ZH 1QL9A 2J34A 2EI6A 2J95A 3PTNA 3M3VA 3RXKA 1E1QD 2K0QA 4GUXA 1W0KD 2ZFFH 3STIA 3V3MA 3VPKA 4K69A 1TQ7B 1DICA 2KZ4A 3A7YA 1C2FA 4K8BA 1GDQA 4Z0KA 4ZKRU 2RA3A 2FESH 3URCA 5A0BA 4I8KA 1L4ZA 2WPJS 2H5CA 2J9NA 5GNDA 3OFND 2OD3B 5EQSA 3H7OA 1F5RA 1GBIA 1GL1A 1YLNA 1XUHA 4F49A 1ESBA 4X1PU 4CREA 4DT7B 3SV8A 1F0TA 3DSPA 3EA9A 4UFGH 2FLBH 1O2XA 1W14U 2W6ID 4YOGA 1GJ8B 2VWOA 1ARCA 3D49H 4ZAEA 1D3TB 3SZEA 1GI8B 1GWAA 5C94A 3RXGA 2G51A 2OQ5A 3K2UA 1NROH 5FCRA 3A86A 2Z9KA 1YBWA 1ANBA 1TYNA 1UVTH 1O2WA 5ETXA 1A5GH 1DLKB 1NFWA 1SOTA 3MO3A 3QO6A 1YPJH 2J5UA 1K0HA 1TOMH 1OKXA 1W3CA 2BDBA 1QHRB 2B5TB 3U9AH 1S0RA 1EB2A 1QURH 3DUXH 1O38A 3MWIU 3R3GB 1DSUA 5EJ1A 1K1MA 3A8DA 2TGDA 1YCPK 4K5ZA 1K1OA 5K0HA 5FX5A 1TBRH 4OS1A 1V2VT 3UPEA 4X8UH 3SYJA 1C2HA 3QLPH 2RG3A 1TA2A 2ZU4A 1BBRH 2VH0A 4ABDA 1NRPH 1OXGA 3ZZAA 1ZJDA 1C1UH 1EQ9A 5KGOA 1TX6A 2O8MA 4FUCA 5C3NA 1TMUH 3SNAA 1SGEE 4NZQA 2KCPA 3RC4A 3E16B 1HAOH 1PQ8A 3M36A 3TH3H 4AC9A 6CHAC 3W1EA 2XC0A 1YPLH 3NK8A 1GG6B 1GJ9B 2TGPZ 2AIQA 1VZQH 1QQ4A 4UDWH 1O30A 1UO6A 2ZTYA 3F6UH 4IBLH 3T25A 2BDAA 2OBQA 1SQRA 1NFYA 2BD7A 2DE9A 5DP8A 4GVUA 1HIAB 2BY8X 1ARBA 3SUEA 5EGMA 2ANKH 3JZ1B 3U8RH 4X2WA 3GDVA 2JETB 1ID5H 4NWKA 2VIQA 1CQQA 3MTYA 3E0PB 2KM0A 1WOFA 1DT2A 1NM6A 4WXVA 1FUJA 1NO9H 1O2PA 2FXRA 2Y5FA 1JBUH 3RM0H 1OWDA 3RXDA 1HFDA 2XWAA 1Y3WA 1A1RA 1P01A 1O2JA 4B71A 1BRAA 1EZXC 2KCOA 2OXSA 3BTTE 1HBTH 3ZZ5A 5B6OA 2HOBA 2V3MA 1SGQE 3HK3B 3SU1A 3LGVA 1K1JA 3LU9B 4ZXXH 4FUHA 1TX7A 2Q6GA 4OS6A 3GOVB 1Y5AT 1NZQH 2FO9A 3GCOA 4FUFA 3I29A 3SHCH 2A2QH 1V3XA 2R0LA 3SNCA 1BHXF 4I32A 5K7RA 4BXWA 3T5FH 2VVUA 3GY3A 2BQWB 1OWIA 4H6TA 2PKSB 2NU0E 2ZU3A 1E38B 3GDSA 1QR3E 1PFXC 1AUTC 4AYVB 1C2GA 5GIBA 2G55A 1LPGB 2F9VA 3M7TA 3MO9A 1Y8TA 2VWNA 2W3KA 1WAYB 2QCYA 3EAJA 5LPEA 1FZZA 3F9HA 3VB5A 1NBME 3OTJE 1PPFE 1FY1A 3MI4A 4GAWA 1NRNH 1GI2A 1P2JA 2BD2A 4BAMB 1A2CH 1JRTA 5GXPA 3GCNA 4X1NU 2XC5A 8GCHG 1AFEH 3MU0A 1LQEA 2FOBA 2VIPA 3SV9A 3UREA 5DP7A 1DPOA 4RKJB 2PFEA 3SOSA 3RC6A 5HIZA 5HIYA 2XYAA 3FP7E 4A1TA 4TYDA 2XCNA 1L1GA 4MNWA 5EQRA 2BY6X 1C2MA 3RXUA 5BPEA 1CHGA 2LP6A 1C1NA 1DXPA 3VG8A 3VXFH 3BTME 5C1UA 8KME2 3GY6A 4ZH8A 3BIUH 2BQ6B 1W7GH 1OHHD 2CF8H 1GHXH 1YGCH 5DPAA 1Y3XA 2BTCE 3TGJE 1C1VH 1J8AA 1ZTJA 2WPMS 4R0IA 1C1OA 2FI5E 4MQAA 2ZIQH 2FYQA 5JBTA 1GG6C 2ZFPH 3BG8A 1AUJA 1CHOG 1LVOA 2JDID 2ZU1A 3PV2A 5HKKD 1QIXB 2BB4A 2PTCE 2BDYA 4ZMAH 3S7KB 2FWWA 1NFUA 2RFKC 1AQ7A 4CRDA 1VJ9U 5EIYA 4YLUA 1QY6A 3BTWE 4I8JA 1W12U 2BY5X 2JETC 5T3HA 1H8ED 3VB6A 3LGWA 1O3JA 2ZHWH 3F0OA 3SV7A 1KXFA 2A7CA 5HMAA 1FY3A 1C1SA 3F9EA 4JYVH 4JYTA 2GDDA 4NIXA 4AZ2B 2GTBA 1E1RD 1P9UA 5CMXH 5BRRE 3WWBA 1DE7H 1DUEA 1ZPZA 3E6PH 5FAHA 1GHZA 4KELA 1W10U 1EJNA 1MTWA 1TGSZ 1N6XA 1Z71A 2BZAA 1J9CH 2P3TB 2ESTE 2VNTA 1SQOA 3KF2A 1GHYH 1TBZH 1TA6A 1LHFH 1LTOA 1EAIA 1ZTLA 3OY5U 4WF8A 1FMGA 3URDA 2KR7A 4AFZA 1NRQH 2BD5A 3BTGE 3SUFA 1S81A 1MQ6A 3IG6B 4TT3D 4WH8A 3EE7A 2AGGX 3STJA 2BY9X 4CRFA 1UK4A 2C93B 3CS0A 5EXLA 5DP5A 4B6EA 2OC7A 1AB9C 1MTSA 3A80A 3EYDA 2NU4E 1GBDA 1K9OE 5C5OA 4ACAA 4NGAH 2R2MB 1SGNE 1UK2A 1TNLA 1YLCA 1VCWA 3NUMA 4INLA 1SR5C 4AYYB 1ELFA 1G30B 1GI5A 2WPIS 1OWEA 2Y7ZA 4CBNA 3ZVGA 3A84A 1CHOF 1YM0A 1F7ZA 2K1QA 3MH4A 2UUFB 1VITG 5E0HA 2QV1A 3ENSB 4AFUA 2O9QA 2EI8A 3M7UA 2LNCA 1SGRE 1GPZA 2STAE 2WUBA 2XNDD 4ISHH 1ZHRA 4YZUA 5JB8S 1M9UA 1AU8A 3P8OA 3U8OH 3ODFA 1S6LA 4X8SH 3UWIA 3SGQE 1WDIA 2A2XH 2ZPQA 3SGBE 1AWHB 5FXLA 4ABIA 1GL0E 3NZIA 1PYTC 1Q31A 3K6YA 2IPHA 1DVAH 2WINI 3CNRA 2Y82A 4QT8C 5T6FA 1RTFB 5J4QA 1AE5A 3MU5A 4ABAA 1H8HD 3SU4A 4OGYA 2HNTF 1G2LA 1O36A 1JOUB 5T6DA 1UJ1A 2KFWA 1QQUA 5EOKA 4BNRA 1AKSA 1FX0B 3ZVCA 5DP9A 1E36B 4NA7A 4MNVA 3MMGA 1P06A 3SJ9A 3S7HB 1C1TA 3ZZ3A 1NY22 1EZSC 1XXFA 3SGAE 1PPHE 4K1SA 1P05A 3FVFB 3WW7A 1BA8B 2TBSA 3U1IB 4E06H 4AGJA 2EC9H 2FOFA 2ODYB 3P8FA 1C9PA 3KL6A 3A88A 3V13A 1W0YH 3RLWH 4CHAB 1QTFA 4WXIA 1O2HA 3KYGA 1J15A 1MAYA 4F4OC 1IQEA 1FIZA 1IQGA 1EAUA 1AMHA 2Y7XA 4FOUC 2CF9H 5GCHG 5LPRA 2GT7A 1CT0E 3PM3A 3A83A 2SNVA 4RI0A 2P59A 2AGEX 1MCTA 1CO7E 3FANA 3LOXA 3EA8A 1HXEH 5LPFA 3P6ZB 1VITF 1P3EA 1KLIH 2WPKS 2FTLE 2BX4A 3OX7U 1GBTA 3SORA 5EG4A 4ZHLU 4ISLA 4HZHA 4AG1A 3PB1E 3MNCA 1HJ8A 3OEHD 4X6OA 3UR9A 4ZKNU 4Y71A 4DURA 3U1JB 1C9TA 1TRYA 1SGFG 1V6DA 2AYWA 2CN0H 1DWCH 4KP0A 1W11U 4I8LA 4X2YA 3M5NA 5FBIA 4D7GA 2VIOA 1V2RT 2BLVA 2ZHEH 2XWBI 3UTUH 4A1VA 2QE7D 4JYUH 4MTBA 1XM1A 1AFQC 2G5NA 2O8LA 2A5AA 1C2EA 3TGKE 1PPZA 4OGXA 1VGCB 4Y7AA 2P3UB 1YCPM 2GCHF 4DG4A 3E8LA 1TNGA 3QDZB 2VU8E 3ODDA 1GJCB 4ZHMU 4MPVA 2ZU5A 1BZXE 2A1DB 1P0SH 1IQHA 2SGDE 1GCDA 3M7QA 1Z6EA 3BSQA 4INHA 4B2CA 3FKSD 1T8NA 2PGQB 1V2PT 2TGTA 2RDEA 1EZQA 1TBQH 7GCHG 1ANDA 5HXFA 2AERH 3OSYA 3GYMA 1LCYA 4Z1MD 3UFAA 1O34A 1THRH 4WMDA 2XC4A 2UUKB 4FUJA 5GCHF 1UVUH 4GHQA 1C1PA 4WH6A 4OS5A 1DDJA 3LGIA 1YPHE 3S69A 3PRBA 4TY6A 1G3CA 9LPRA 1GJ4H 4I8GA 2HPQH 5FHTA 1XUJA 1G3DA 1KSNA 1NRRH 4X8TH 2M5TA 1ELGA 2BD4A 3RXPA 4ABEA 1WCZA 3KN2A 4Y0YE 2D8WA 1ZSLA 4WY3A 3BV9B 3LJJA 3QTVH 4MG3A 1TNIA 1C5PA 1AKSB 3MU1A 1A5IA 2LELA 1NPMA 1SQAA 4KTCA 1OP2A 1FN8A 1FLEE 3BIVH 2FM2A 3RLYH 4ASUD 1BJUA 2Y80A 3EDXB 3RXIA 1OOKB 1HAVA 1GBEA 4Q63A 1O3OA 1RS0A 3O8BA 4O9VA 1BIOA 4Y6DA 4IW4E 3UNRA 3MNBA 4LK4A 2PLXA 1O3NA 1F5LA 1EX3A 2R0KA 3RMMH 1TGCA 2FODA 4B76A 5I46H 1C2IA 1J17T 3E0NB 2HALA 2H9HA 5C1YA 5TJXA 1O3GA 3HK6B 4D8NA 1QJ6B 3HATH 2HNTE 4J2YB 2VJ1A 3RUOA 3RU4T 2ZNKH 1FQ3A 4X1SU 1Z8IB 2A4QA 2ZHFH 2QF5A 3QX5H 5EXNA 5PTPA 3ZZDA 1LMWB 4B6FA 1FAXA 1RRKA 3AASA 2A5IA 1MTVA 1IQLA 1P10A 3ZYDA 3TJNA 2AHME 2GT8A 2VGCB 3D65E 3DFJA 7GCHF 4OM9A 3TGIE 1UHBA 3B9FH 1LKBA 1OWHA 4JZFH 5IK2D 1H1BA 1LKAA 2QGRA 3GY8A 4K3JA 2BLWA 2PTNA 1TMTH 1CGJE 4K1TA 2F9PA 5EW2H 1XX9A 2HNTC 4I86A 2H5DA 8LPRA 1SGPE 3QUMP 4YLQH 1HB0B 1O5GH 3QN7A 2OC8A 2BDCA 1O3PB 4I31A 1GCTC 1O0DH 3OU0A 2FEQH 2CHAC 2C3SA 4RT0A 1HAZB 1TABE 1EATA 1C2DA 2Y6TA 2OP9A 1YPMH 3DT0H 1KTTB 2EY4C 1A5HA 2ZDMA 3PMBB 2BD8A 3QZRA 1PPEE 3MYWA 3QTOH 3VB4A 2ZA5A 1RXPA 1FPCH 3K65B 2BDGA 3CS7A 4HTCH 2GX4A 2PP6A 1UVPA 1CA0C 2J98A 1GHWH 4H4FA 1CBWB 3ZZ8A 2P94A 4Y8YA 2PSXA 1UTQA 1CE5A 1SC8U 3U69H 2I6QA 1GVLA 1UVSH 1MMJN 3F0PA 1HRTH 2ZGBH 1VJAU 2LPRA 4VGCC 1P2KA 3RMNH 2VWMA 4O97A 5GJ4B 1DY9A 3UNQA 4A5TS 3SU6A 2OBOA 1UTMA 3DD2H 4NSVA 1BTUA 1VCQA 1GGDC 3P92A 1SMFE 5JBBS 1DS2E 5AHGH 1O3AA 1ACBE 2TIOA 1F5KU 3NKKA 1UCYK 4NIYA 3O8RA 4Y11E 2EQNA 3SJIA 1NS3A 3GY2A 3SV6A 1ELAA 2UWPA 1O5EH 3LC3A 2NU1E 4BXSA 1UCYE 5T1VA 5HM2A 4A1XA 4YT7H 3MU8A 2BXTH 1GMHG 2P95A 2WV9A 1V2MT 3BTDE 3GY5A 5E2PA 3RXVA 1QB9A 1QBNA 3O8CA 1TAWA 5DGJA 1GHVH 1Z6JH 1O3MA 1THPB 2V6NA 1TGTA 3KNXA 1E35B 2PUXB 3ZVBA 1ZOMA 4BTIB 2BZ6H 1AVWA 1FV9A 2Z94A 3SUGA 5JB9S 4BAKB 3FFGA 3GY7A 1HAVB 3RDZA 2XTTB 4WVPE 5A2MH 1ORFA 2Z3EA 4NSYA 3LDXH 1C5UA 1C1MA 1GI0A 1UW7A 2P8OB 1H4WA 3RXFA 1IQJA 4YOIA 3QK1A 2VINA 1BJVA 1W2KH 2TPIZ 2VGCC 1EAWA 1SLWB 2QF4A 2WYJA 1P3CA 1O2QA 2AMPA 2PGBB 2A45B 4M7GA 4Z6AH 5JPMH 1B7XB 3E1XB 1O5FH 4A92A 2ZF0H 1ZMLA 2SGFE 2HWLB 3NWUA 1TPOA 1DWBH 3IWMA 1HAIH 2A0QB 2A5KA 1TMBH 4TWYA 3SHAH 1WTHD 3V0XA 3ATWA 3DCLA 4M9FA 5TCCA 3ZZ6A 1Q3XA 5L2YH 2HLDD 1P12E 2ILNA 4O3TA 1NC6A 2WPHS 5GDSH 1O35A 5C5NA 2XCFA 1UHBB 4MPXA 4PROA 2GV6A 2GCTB 1GBCA 5DP6A 2SGPE 1TB6H 3LGYA 1P8VC 4D9QA 1H8IH 3V7TA 1V2UT 3HKIB 3M3TA 3M37A 2OC0A 1C4U2 1SL3A 1N1LA 3PO1B 1NBMD 2JKHA 3LKWA 2SGQE 1RTLA 2WSSD 2V3OH 3TU7H 1ELEE 1AWFH 4FUGA 7KMEH 5E0JA 1C5TA 1P09A 2G00A 2ZECA 1EP5A 4TSFD 2ZFSA 1GI9B 5JYIA 4UFFH 1S0QA 1Y3VA 1L4DA 2GZ8A 4RT1A 3UWJH 1QJ1B 1GMHF 5SGAE 1QNJA 3A7VA 1ZPCA 5G4BA 1SB1H 1L2EA 3FZZA 2Y81A 2ZEBA 2TGAA 1IAUA 2G4UA 5GPIB 1EOJA 2V3HH 1O3IA 2J98B 2B8OH 2NU3E 3BTKE 3P8GA 1NU9A 1IQNA 4ZUHA 4AOQA 1HAHH 1UTNA 3BEUA 3SBKA 1K22H 1MTUA 1XKAC 1FAKH 1TALA 4ABBA 3PROA 3E91A 4ZCNA 2DE8A 1TRNA 1S84A 1L1JA 3SNEA 4B74A 4ASHA 1YPKH 1ANEA 4CH8B 1A0HB 4D76A 2NU2E 2ZFRH 1KYNA 1VITH 1MKWH 3FO8D 2WV5A 1TRMA 2QA9E 1G3BA 4MNYA 3MOCA 1B5GH 1G9IE 1CGHA 4X6MA 1YPEH 3PLPA 4KGAA 4KTSA 2ANMH 2HPPH 3OEED 1A61H 3RU4D 1MAXA 2A4RA 2QIQA 2BLOA 1LVBA 1JMOH 5EJLA 4YTAA 4IMQA 2P16A 1ELBA 1GI1A 1S6HA 1GJBB 3ATKA 1H8DH 1O3CA 3RMOH 1DITH 2A7HA 1SGIB 3SUDA 1P57B 2P8OC 4J1YA 4X8VH 1S82A 1G3EA 1WV7H 2ZQ2A 3O8DA 4ZXYH 5LH8A 3ELAH 1ANCA 3TJOA 2BY7X 4UONA 2ZZUH 4IS5A 1V2ST 2GZ9A 5DKMA 3GCTG 5F53A 2OK5A 2PKSC 3OY6U 3QWCH 3VFEA 3GICB 1O5CB 1QL8A 2RCEA 1BRCE 1EZUC 3VGCB 5F8TA 1QA0A 1B0FA 4AB8A 1WXRA 4Q7YA 1YC0A 1KDQA 4JZIA 2QXJA 1D6RA 2EEKA 1UCYH 4JK6A 2GCTC 1DWDH 3Q77A 2R9PA 3H7TA 4BTUB 1O2IA 1DY8A 1O5AB 2IJOB 2FIRH 4CRAA 1XUGA 4FU9A 1F92A 1Z1IA 1EFRD 1MCVA 1J14A 1C5OH 2NWNA 1XXDA 2XBYA 3A8CA 3PO1C 1AHTH 1DFPA 1WBGB 2ALVA 2W5EA 5DN6D 3OAAD 1GBKA 3FZDA 1SLXB 3SNDA 2KCAA 2J92A 4XBCA 2PHBA 1C5VA 1HXFH 1SG8B 2CK3D 3BTQE 2QF3A 4Y8XA 4UD9H 2VIWA 2H6MA 4LXBH 3ZV8A 1V2TT 1RJXB 4OS7A 2GGVB 3P70B 2AMQA 4TPIZ 5C0UA 3RXOA 2ZCHP 1EJMA 3BF6H 3SJ8A 2Z9JA 4LZ1H 3PRDA 4XBBA 1C5NH 2QAAA 4DGJA 4JZDH 1IQMA 1C5RA 3B23B 3A7WA 3SJOA 1GBFA 1PPGE 5A8YA 3T62A 1O2TA 3ATMA 4NWLA 4O03A 4OS4A 3VB3A 2W3IA 2XXLA 2PKAA 3SU2A 2OINA 2KCYA 2DUCA 4IN2A 1SGCA 1ZHMA 4U32A 1RIWB 2Z9GA 2GCHG 5ABWA 1O3EA 2KAIA 1QRXA 4Q7XA 6ESTA 2Q1JA 3GS9A 1O2OA 4NG9H 4O3UA 3W95A 1HAXB 3GCTF 2B7DH 1GBAA 1NFXA 1O5BB 1RGQA 4HG6A 4AN7A 3F1SB 4NA9H 3LH3A 3PYHA 1BRUP 4K1EA 2HRVA 2G8TA 1FY5A 1C2LA 4IC6A 3K9XB 1ZLRA 5DO4H 5GWZA 2F91A 2FLRH 1QCPA 4Q80A 4X2VA 5HM9A 2XW9A 2THFB 1LDTT 5LGOA 3JZ2B 3TK9A 1K1IA 1GBLA 2F43B 1C5XB 2ZPSA 1MH0A 2J94A 1BTXA 3P8NA 1O33A 3BEFB 3ZV9A 2BLQA 3M3SA 3A82A 1Y3UA 3KCGH 1JXPA 5CDFE 1MZDA 1XMNB 1E37B 1EKBB 4TPYA 1E34B 1O2UA 2ZDVH 5EODA 1EXFA 1O32A 1F0UA 2BYAX 4YOJA 1V2KT 2GMTB 1L0ZA 1P2MA 3S9AA 3PMHB 5EQQA 2FOAA 1JRSA 1O2KA 1ZPBA 2OTVA 1SGDE 4ZKOU 1SOZA 5I25A 1LQDB 4U01A 3MQKC 4IN1A 4OS2A 2A4OA 5ESBA 3TNTA 1ZJKA 2FMJA 2F9OA 3FN8A 3AVZA 4B2AA 3ITIA 1T32A 2ZKSA 2VVVA 1FDPA 2OUAA 2VBCA 1C1WH 1RD3B 1NTPA 1E0FD 3SO3A 4DT4A 2AFQB 3I78A 2JJ1D 1KDQB 2VVCA
chains in the Genus database with same CATH topology
1ZRBA 2CJIA 2O8TA 1JWTA 2R3YA 1GMDG 2Z9LA 2FOEA 1TONA 4CBOA 3L3TA 2BVRH 2F9BH 1ZGVA 2ZDNA 4LOYH 3GCHB 2ASUB 4B73A 5C2ZA 3M35A 4Y7BA 3U8TH 1LHCH 2BOHB 1C5MD 1CT4E 4ISIH 5HGGA 2H9TH 3E90B 1NESE 1MU6B 3A8AA 2D1JA 3A81A 4ZKSU 3RXLA 2FYRA 4NIWA 1DWEH 3SW2B 1GI4A 1ELCA 5JBCS 2ZCKP 2SGEE 4THNH 1P9SA 1TNHA 3PWCA 1TPPA 3D23A 2V35A 2YNAA 1BTWA 3OYPA 4H42U 5HYOA 3PLKA 6LPRA 2FP7B 3RMLH 4KKDA 2PKAB 1PPBH 1P04A 1SHHB 4CHAC 1G37A 4SGAE 3SU3A 2H9EH 3FAOA 1ZMJA 1SGYE 1V2JT 2RDLA 5A0AE 3RXMA 1LVYA 2W26A 1BRBE 2Z7FE 3ATIA 5AFYH 4HI3A 3BEIB 1FONA 4ABFA 1TE0A 1BQYA 2A7JA 3DHKH 3T2NA 3B8JA 5AVDA 4YESB 3LT3A 4XBDA 2VH6A 1Z8GA 2FOCA 2ZCLP 1H9LB 3AW1A 1TPAE 3GDUA 4NFEA 2GP9B 3RXHA 2J2UA 1GJDB 3A8BA 4IGDA 3HKJB 4KTUA 3SI3H 1HJAB 1PPCE 4CRBA 1NRSH 1S6FA 3NPSA 4CR5A 1AIXH 2VIVA 1BTHH 1KY9A 3BTHE 3KQDA 4Y79A 1WYKA 1FI8A 2GMTC 4I7YH 1GMDF 1C1QA 1Y5UT 1BMNH 1L1NA 3CP7A 2RA0A 1FIWA 3PLBA 1TQ0B 1Y3YA 1ABJH 4SGBE 3DA9B 4MLFB 1P2NA 1Z7KA 4A7IB 1O3KA 1P2IA 2AS9A 1O3LA 1C5ZB 3EQ0H 1EASA 5IYTA 1QFKH 3A7ZA 1A7SA 1FY8E 1N6YA 1AI8H 1XUFA 5DG6A 1J16A 2BHGA 1OPHB 3TITA 4CRGA 1C5QA 2G81E 2Z6BD 4AB9A 5JBAS 1VGCC 4K2YA 3QGJA 1T8LA 1OYTH 2BVSH 2ZDAH 1THSH 3TIUA 4ABGA 1MKWK 3MFJA 1FPHH 1LHDH 1ZSKA 2Z3DA 3BTEE 2FOMB 1SQTA 1UTJA 2R3UA 3MO6A 7LPRA 5FX6A 4GSOA 3GCHC 4FU7A 2UUJB 1MD7A 4FU8A 3ZVEA 1YP9A 1S83A 2AIPA 1LPZB 1QRZA 1F0SA 1BCUH 1V2LT 3GISB 2ZQ1A 1LVMA 1QB1A 1SFQB 1OYQA 4AORA 1BITA 1EUFA 1XVOA 1EPTA 1O37A 1INCA 3SU5A 1SLUB 2WYGA 4BOHA 4HFPB 3KGPA 4FUDA 1K2I1 4RN6A 1SVPA 2BQ7B 3R0FA 1MD8A 1IOEA 1O2GH 1A3BH 4H6SB 1JIRA 4JZEH 1O2RA 3M61U 4GCHG 3SQEE 2HVXA 1TNJA 4GPGA 1ZMNA 1C4V2 2HLCA 4IMZA 4FXGH 2J4IA 5F03A 1D3QB 4A6LA 1U6QA 5A0CA 1AN1E 1AGJA 4E05H 1CA8B 3M5MA 3TK6A 3TK5A 2Y5GA 3NXPA 2G4TA 4TWWA 4U2WA 2ZI2H 1CSOE 1WU1A 1A4WH 2GKVE 1C5WB 1GDUA 2PW8H 4BAQB 1XVMA 1YKTA 2EA3A 1AZ8A 2G52A 1WQSA 1HAGE 3Q3XA 3S0NA 2CGAA 3PMJA 1BT7A 1HJAC 3ZZBA 1T7CA 1KXCA 1TWXB 5FPSA 1GBHA 2ZTZA 1HYLA 3A7TA 1EB1H 4JMYA 1AVGH 3D62A 4K60A 5EU8A 3RXSA 5TCAA 3KHVA 1PQ7A 3S9BA 4FUIA 3S9CA 1ZR0A 1G32B 3SU0A 3PTBA 2ZGHA 1D6WA 3LONA 2FPZA 1ELTA 2ZU2A 3PMAB 1D4PB 1BOQA 4NIVA 1C4Y2 1QGFA 2QYIA 4NA8A 1ELDE 4FUEA 1MTNB 2GD4B 1JIMA 1AO5A 3BN9A 1NU7B 5FPYA 3HGPA 1IQKA 4CR9A 1BTYA 1EP6A 1UTPA 2ZFQH 2XBWA 3BG4B 1ESAA 1Y5BT 3SQHE 3UQVA 3UY9A 3VXEH 5ESTE 3A85A 4DJZB 2ODQA 2VWLA 1MKXH 2F3CE 1GDNA 2FI4E 5C1XA 4I33A 1HPGA 3TNSA 1K1NA 4GCHF 1GJAB 2C8WB 5H4IB 4LZ4B 2BD9A 1CT2E 3FP8E 1O2VA 1AB9B 5AFZH 3ZVAA 3RP2A 2IOTA 1K1LA 1TGBA 1TFXA 5FPTA 4RKOB 3ZZ4A 1DX5M 1BTPA 3FP6E 4X1QU 3KQCA 2SGAA 3LGUA 4ISNA 3RXAA 1Y59T 1CBWC 3IITA 1HV7A 4K8YA 3TH4H 1PQAA 1BUIA 1QA7A 4BAHB 1SPJA 3AW0A 3SJKA 1O3FA 5DP3A 3KEEA 1K28D 4CRCA 2FDAA 3V12A 1UTKA 1ETSH 4HGCA 2GV7A 1X7AC 1FN6A 4ZHAA 4X2XA 2PUQH 2OCVB 1S85A 3LJOA 1V2QT 5E8EH 4X6PA 1C5LH 1W8BH 1GVZA 4X0WU 3TH2H 3T26A 1HDTH 3L33A 1MU8B 3RXBA 1EPTB 1VCPA 1YPGH 1O31A 2I6SA 2CV3A 4NCYA 1RFNA 2Y5HA 4B2BA 3ZYEA 2ZHQH 4AX9H 1AVXA 2H2ZA 1P11E 1KIGH 1DSTA 3QGNB 1ZYOA 1HAPH 2ZDKA 4AGKA 2BOKA 3RC5A 1ZRKA 1VR1H 2BVXH 2XBXA 1WQVH 2PV9B 1V2WT 1BDAA 2SNWA 3LGTA 4MPWA 2D26C 2QF0A 2W7SA 1O2MA 4XFQA 2VB0A 4WJG2 3ATLA 3UOPA 2QXGA 3P17H 1BMMH 2B0FA 5F6MA 4XOJA 5C67A 2FX6A 3DFLA 3RM2H 5EPNA 1EOLA 3PV4A 3RU4E 2ZP0H 1GI6A 1BHXB 1QJ7B 2PSYA 1ETTH 1HUTH 2Z9IA 4DIHH 1YLDA 1O5DH 5E2OA 1DUAA 3Q76A 4AFQA 2C8ZB 1GJ5H 1W13U 2O8WA 3QZQA 5EPYA 1P03A 2R2WU 3AAUA 2FTMA 1BMAA 1DANH 1LHGH 1QBVH 2QXHA 3Q3YA 4D7FA 2SFAA 1SLVB 1GMCG 3E3TA 1DM4B 1MTNC 1IQIA 1FJSA 2STBE 4UEHH 3ZZCA 4MDSA 2C4FH 2WUCA 1OS8A 1HGTH 4JZ1A 4WMFA 1ZGIA 1YCPH 1GVKB 2EI7A 1IHSH 2A31A 3BG4C 3T28A 4MVNA 8GCHF 2FZZA 1T4VH 2G5VA 1WUNH 8ESTE 2CMYA 4ABHA 2FOGA 1HAYB 1AE8H 1W7XH 1LHEH 1OWJA 3ZZ7A 3SV2H 1UVOA 4MPUA 2ANYA 4ABJA 1UMAH 1MBMA 3EGKH 1T8MA 1C1RA 1QL7A 1OWKA 1PQ5A 4YO9A 1Z1JA 2ZFTA 1AY6H 1K1PA 4U30A 4FVDA 1PYTD 2O8UA 1A0JA 1LPKB 1WTGH 4Y10E 5L6NH 2V0BA 3A87A 3T29A 3TJUA 3TLOA 1H9HE 3GY4A 1GHAG 2FS9A 3P95A 2ZGCA 3AAVA 2FOHA 1Z8JB 1F0RA 2JH6D 4DVAU 1ZTKA 3W94A 2F9UA 6GCHG 3UNSA 5A8ZA 1BMLA 3F68H 1AFQB 5DJ7A 2Z3CA 1UTLM 4XSKU 1HCGA 2JH0D 2BMGB 1OP0A 2ZGJA 3UIRA 1KXEA 1CGIE 2ZHDA 4B1TA 1OSSA 1PJPA 3WY8A 4DOQA 4XDEA 3RXEA 4AFSA 1KXAA 1O2SA 1EPTC 5EXMA 2XRCA 3N7OA 1S5SA 2OQUA 1D9IA 1ABIH 3VEQB 3SNBA 1KLJH 1TGNA 5C20A 3Q3KA 5CHAB 1GMCF 1HNEE 4DIIH 1A3EH 2CXVA 4RSPA 1GBBA 1TLDA 4JK5A 1SBWA 1A0LA 3Q00A 1OX1A 4R8TB 3ZVFA 3KQBA 4X6NA 3TPIZ 1IQFA 1O3DA 3MH7A 3A89A 4B75A 2XNIA 2P93A 1T4UH 1BB0B 4FVBA 2H1UA 1TOCB 3KQEA 5IDKA 1TX8A 1GBMA 1KXDA 5F8ZA 3TVJB 1T8OA 2BDIA 1AZZA 2FS8A 4ESTE 1KXBA 1WSSH 1TPSA 1N8OB 1UK3A 4UFEH 2ALPA 1O39A 1UTOA 2C8XB 3F9GA 1DLEA 1RTKA 3VB7A 1GJ6A 9ESTA 2ZGXH 1K21H 1C5YB 4X1RU 5JDUB 1GHAF 1ZZZA 3TJVA 2IN2A 1FNIA 3L6PA 2C90B 1O2YA 5E0GA 2F83A 3BTFE 3LPRA 4E7RG 1P2OA 1F2SE 3EE0B 1LO6A 6GCHF 7ESTE 2ZO3H 3VGCC 2GVFA 3UQOA 3G01A 4CH2B 1SI5H 5J4SA 1EJAA 3MHWU 2YOLA 4GHTA 2AH4X 1D3DB 4INKA 3CENA 4GLYA 1BBRK 2ZDLA 3SZNA 4E7NA 1MUEB 2QY0B 2XBVA 2GDEH 2UUYA 2HGTH 2PR3A 4WWYA 1HLTH 1Q2WA 2ZPRA 2WPLS 2AGIX 1BBRE 4YT6H 4ZROA 1P02A 3NCLA 3RXJA 1T31A 1C2JA 4Y0ZE 1AD8H 4TY7A 1O3BA 1ESTA 1GI7B 2BD3A 3UUZA 1NN6A 1FY4A 1FXYA 1O3HA 1GHBG 4AG2A 1B0EA 4BAOB 1V2NT 1GCTB 4JCNA 5FCKA 3HPTB 4DW2U 2CHAB 4Q2KA 1SGFA 5A09A 1KTSB 2TRMA 2ZWLH 4MNXA 1TIOA 2WV4A 1H9IE 3MH5A 3PWBA 5EW1H 3GYLB 5DP4A 4BANB 2BX3A 2OC1A 3UOUA 1OP8A 3LH1A 3UR6A 1ZSJA 5A8XA 2UWLA 1NT1A 1CVWH 1RIWC 4UFDH 1ELVA 3ZZ9A 3MNSA 1SGTA 1ZHPA 5CE1A 1ETRH 4Y76A 1IHTH 2P3FH 4FUBA 4DY7B 3SI4H 1HJ9A 5CHAC 2C8YB 3C27B 3RXQA 1CA0B 2ULLA 3T27A 1QRWA 1A46H 1DXWA 2W7UA 3A7XA 1MBQA 2A4GA 2BXUH 3F9FA 1XUIA 2AMDA 1G2MA 3MU4A 1XUKA 2ZC9H 3EA7A 1C2KA 1HIAA 1SFIA 4UE7H 1DOJA 2AEIH 1KLTA 2Q6DA 3K6ZA 4VGCB 1G36A 1MKXK 2J38A 2QC2A 2D2DA 2QXIA 4IC5A 2KAIB 1SHYA 2ANWA 2JH5D 5F8XA 4I8HA 6CHAB 1GJ7B 1V2OT 4DCDA 1N8OC 1QB6A 5L30H 2ODPA 3ZVDA 1MZAA 4Y8ZA 2F9NA 1GGDB 1P2QA 1W0ZU 1YF4A 4D9RA 3LIWA 2VIDA 1YYY1 3MNXA 4NFFA 1C5SA 2UWOA 2QN5T 3C1KA 1QBOA 3M5OA 3KIDU 1SSXA 4XE4A 3M5LA 1D3PB 2FI3E 1MQ5A 1O2NA 2ZG0H 1YPHC 4Q7ZA 5FBEA 3H5CB 4YM9A 4WMEA 1GBJA 4ISOA 3RXRA 2YNBA 3U98H 1XKBC 1CU1A 2FX4A 1TNKA 2BDHA 3HGNA 2A32A 3LC5A 3I77A 1GI3A 1O2ZA 5T6GA 2Q6FA 3RXTA 2PWXA 5DK1A 1GHBF 3ESTA 3RXCA 3SN8A 1O2LA 5AF9H 2OLGA 1BTZA 2ZTXA 1Z8RA 4BTTB 2B9LA 2BM2A 4NZLA 1EAXA 2GZ7A 3MH6A 5L2ZH 1QL9A 2J34A 2EI6A 2J95A 3PTNA 3M3VA 3RXKA 3V3MA 4GUXA 2ZFFH 3STIA 3VPKA 4K69A 1TQ7B 1DICA 3A7YA 1C2FA 4K8BA 1GDQA 4Z0KA 4ZKRU 2RA3A 2FESH 3URCA 5A0BA 4I8KA 1L4ZA 2WPJS 2H5CA 2J9NA 2OD3B 5EQSA 3H7OA 1F5RA 1GBIA 1GL1A 1XUHA 4F49A 1ESBA 4X1PU 4CREA 4DT7B 3SV8A 1F0TA 3EA9A 4UFGH 2FLBH 1O2XA 1W14U 4YOGA 1GJ8B 2VWOA 1ARCA 3D49H 4ZAEA 1D3TB 1GI8B 1GWAA 3RXGA 2G51A 2OQ5A 3K2UA 1NROH 5FCRA 3A86A 2Z9KA 1YBWA 1ANBA 1TYNA 1UVTH 1O2WA 5ETXA 1A5GH 1DLKB 1NFWA 1SOTA 3MO3A 3QO6A 1YPJH 1TOMH 1OKXA 1W3CA 2BDBA 1QHRB 2B5TB 3U9AH 1S0RA 1EB2A 1QURH 3DUXH 1O38A 3MWIU 3R3GB 1DSUA 1K1MA 3A8DA 2TGDA 1YCPK 4K5ZA 1K1OA 5K0HA 5FX5A 1TBRH 4OS1A 1V2VT 3UPEA 4X8UH 1C2HA 3QLPH 2RG3A 1TA2A 2ZU4A 1BBRH 2VH0A 4ABDA 1NRPH 1OXGA 3ZZAA 1ZJDA 1C1UH 1EQ9A 1TX6A 2O8MA 4FUCA 5C3NA 1TMUH 3SNAA 1SGEE 4NZQA 3RC4A 3E16B 1HAOH 1PQ8A 3M36A 3TH3H 6CHAC 2XC0A 1YPLH 3NK8A 1GG6B 1GJ9B 2TGPZ 2AIQA 1VZQH 1QQ4A 4UDWH 1O30A 1UO6A 2ZTYA 3F6UH 4IBLH 3T25A 2BDAA 2OBQA 1NFYA 2BD7A 2DE9A 5DP8A 4GVUA 1HIAB 2BY8X 1ARBA 3SUEA 5EGMA 2ANKH 3JZ1B 3U8RH 4X2WA 3GDVA 2JETB 1ID5H 4NWKA 2VIQA 1CQQA 3MTYA 3E0PB 1WOFA 1DT2A 1NM6A 4WXVA 1FUJA 1NO9H 1O2PA 2FXRA 2Y5FA 1JBUH 3RM0H 1OWDA 3RXDA 1HFDA 2XWAA 1Y3WA 1A1RA 1P01A 1O2JA 4B71A 1BRAA 1EZXC 2OXSA 3BTTE 1HBTH 3ZZ5A 5B6OA 2HOBA 1SGQE 3HK3B 3SU1A 3LGVA 1K1JA 3LU9B 4ZXXH 4FUHA 1TX7A 2Q6GA 4OS6A 3GOVB 1Y5AT 1NZQH 2FO9A 3GCOA 4FUFA 3I29A 3SHCH 2A2QH 1V3XA 2R0LA 3SNCA 1BHXF 4I32A 5K7RA 4BXWA 3T5FH 2VVUA 3GY3A 2BQWB 1OWIA 4H6TA 2PKSB 2NU0E 2ZU3A 1E38B 3GDSA 1QR3E 1PFXC 1AUTC 4AYVB 1C2GA 5GIBA 2G55A 1LPGB 2F9VA