3T29A

Tmao-grown trigonal trypsin (bovine)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t29A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t29A02
1H9HE 1TNLA 2OCVB 1H4WA 4ZMAH 4D7FA 2ZFTA 1L2EA 3HKJB 3S0NA 1F5KU 5DG6A 1Z8RA 4UD9H 2ODQA 1BHXB 1O2MA 1OP0A 1SPJA 5CE1A 3HATH 1TAWA 3LGUA 4MPXA 1C5QA 2PFEA 1KXEA 3RXOA 1YCPH 2OBOA 1OS8A 4X2WA 2OTVA 4CHAC 1HJ8A 2Q6FA 1ELTA 1PPEE 4KKDA 2PKAB 3ZVCA 5DP6A 1ELAA 1MD8A 1O2LA 1P06A 5FAHA 1ZGIA 4ZROA 3G01A 1EAXA 1C2GA 3RMNH 4PROA 4UDWH 1A2CH 1JRTA 1QJ6B 1U6QA 3B9FH 1Z1JA 4ASHA 3V0XA 3RXGA 3KQBA 4TYDA 3S9AA 4A7IB 4CREA 6LPRA 6GCHG 4KTCA 1GI6A 3AW1A 1EOLA 4I8JA 5EU8A 4WH6A 1NFXA 5E2PA 1EJMA 1GPZA 3RC6A 1K1PA 3HKIB 4YLUA 4BXWA 2WPJS 4NIXA 1FONA 1GJ8B 4B2AA 1BRAA 3W95A 1MMJN 3Q3XA 1YLDA 1FZZA 1C2JA 2NU0E 3H7OA 1YYY1 2HGTH 1Y5AT 4ZAEA 2SNVA 1ZSLA 3P92A 3KGPA 2TPIZ 5DO4H 1NY22 3AW0A 1QA7A 1LPGB 1NU9A 1XUGA 2BVXH 1GMHF 1JRSA 1O2RA 2C8YB 1W3CA 3M3SA 1MTUA 3UNSA 3EE0B 3FFGA 1AE8H 4I8LA 1O2IA 1A0HB 4DIHH 4B73A 2Z6BD 1AU8A 1OOKB 2VWLA 3A7ZA 3STIA 1C5VA 4XFQA 4CRGA 1KXDA 3PMHB 3JZ1B 3VB6A 1RTFB 4TWYA 1O5AB 3LGWA 1F0TA 4I33A 1EB1H 5C67A 2VH6A 1P3EA 1FPHH 4JYTA 2HWLB 1B7XB 2Y5HA 7LPRA 1HBTH 2P95A 3VEQB 2VGCC 1O2OA 2WUBA 3M35A 4NZQA 3U8OH 4ESTE 3MNXA 3MYWA 4DGJA 3GCOA 2WPMS 1O3MA 3KCGH 5EQQA 1C1MA 3HK6B 2AS9A 1SLXB 3RMLH 2OBQA 1QTFA 2RCEA 1N6YA 2XCNA 4X0WU 3UR6A 3QWCH 4GSOA 2A7JA 1QGFA 1O39A 1HYLA 1SR5C 2BLQA 4Y8XA 3U69H 2GZ9A 1ZMNA 3KNXA 4GAWA 4MVNA 5TCAA 1VJAU 5EPNA 1SLVB 4MNXA 2FYQA 5EG4A 3CP7A 2ANMH 1GL1A 4OS1A 1O2WA 4ZKOU 1GBJA 4K3JA 1MTWA 3QN7A 1SGIB 4DURA 1V2PT 1LHDH 3QZQA 1GHAF 4OS2A 1V2TT 3Q3YA 1MKXH 3GY8A 5J4QA 1G3CA 3P95A 1TA6A 3TVJB 1EUFA 2SGFE 1ABJH 1BRBE 3A85A 2AIQA 1NFUA 1O2UA 1C5XB 1GJDB 5JBAS 2H5CA 3DA9B 1YPGH 3ZVEA 1LKAA 3AAVA 1ZJDA 1O2XA 2F9UA 1OWEA 2EA3A 2O9QA 1UJ1A 2ZECA 4K1TA 1O33A 1DUEA 1O30A 2BDGA 1LVMA 2RDLA 3GCHB 2VNTA 1SGFG 2GCHF 1E38B 4H6SB 2PGBB 4B74A 2PUXB 3RXTA 4DVAU 1VR1H 5A2MH 1GHZA 1HGTH 3P8OA 4BNRA 5E8EH 1QR3E 2VU8E 1L4DA 3TIUA 1JIRA 1QA0A 4NCYA 4MG3A 1TMTH 1K1MA 4XBDA 1O34A 1CT4E 5LGOA 4H42U 1A0LA 4LZ4B 2A4QA 1O2PA 1O5FH 3NUMA 2PUQH 1JBUH 1LVOA 2G5NA 2KAIA 1G2LA 2ODYB 2ZFFH 3I29A 1C5MD 1P2JA 2A4RA 1C1VH 3TPIZ 4INKA 2ZHQH 2ESTE 1PQ7A 2D1JA 2O8TA 3MI4A 1TALA 1BMLA 5A8ZA 1SC8U 1YF4A 3A7TA 1BA8B 2EEKA 1GDUA 2BD8A 3ZYEA 4BAQB 1MKWK 1WV7H 1UVTH 5A0AE 4ZKNU 3T29A 1DPOA 1YPJH 2JETC 2IPHA 3BTWE 2ALPA 2TBSA 1BMNH 2WPHS 1A0JA 5GJ4B 3L33A 2XBXA 1RFNA 1YPHE 2QN5T 1P2QA 3ATIA 2G55A 1C1SA 1EZUC 3FZDA 2ZFPH 1KXAA 1ETTH 2ZTZA 3RXRA 2HPQH 3MNSA 4ZXXH 3ZVGA 2H1UA 1IQIA 4X1SU 2BY5X 3A82A 2J92A 4NA9H 4Q7YA 2Y7ZA 2PKSB 2ZHWH 1ZHMA 1SBWA 2KAIB 1MTSA 2XBYA 3MH4A 1OKXA 2TGDA 2XXLA 2QXGA 3SU3A 4OS4A 2AEIH 3M7TA 2BDHA 3PYHA 1MH0A 3ATMA 3E0PB 1HXEH 2HPPH 5EOKA 3TLOA 3ZZ3A 1AFQC 1D4PB 2PSYA 5HM9A 1L4ZA 3UUZA 2FO9A 1ZPZA 1GCTC 1DM4B 1ZSKA 1KDQA 2OP9A 5K0HA 4JZDH 1C5RA 1QJ1B 1UK2A 4JZFH 5HGGA 3M5NA 1MTNB 1EZSC 2C8ZB 2W3IA 5F6MA 2VB0A 3E91A 3SHAH 1TPSA 4LOYH 1DWDH 1UO6A 4YO9A 3RP2A 1DWCH 2PR3A 1P02A 4AFQA 1RXPA 2Y5GA 2R0KA 1RJXB 3GDSA 4NGAH 1WYKA 3BEUA 3OX7U 3RXMA 1LQDB 1HLTH 2ZGXH 2XBVA 1SGFA 1XUHA 3WY8A 2AFQB 2PWXA 3RM2H 4A1TA 5GDSH 4AYYB 3PMBB 3TK5A 8LPRA 2FS8A 5EGMA 1HAPH 1AN1E 4E7RG 1HCGA 1T8OA 4Q7XA 1A4WH 3UNQA 1ELCA 2ZFQH 2W7UA 1FN8A 1GDNA 5JB8S 1WBGB 1UHBA 1SGDE 4JYVH 5K7RA 1WCZA 2GP9B 4JZ1A 1TGTA 1J14A 1KDQB 1E36B 5FCKA 1KXCA 3F9HA 1XVOA 1AKSA 2HRVA 1S0RA 2F9OA 4MNYA 1QURH 1XUKA 1ZTLA 2Z9GA 1TX8A 1WTGH 5TJXA 1NFWA 1IQHA 2F83A 4Z0KA 2BD9A 1GHAG 1AO5A 1A3EH 3PB1E 4Q2KA 2FIRH 4AB8A 1NC6A 1BDAA 1Z8JB 3LU9B 4NFEA 1L1JA 3B23B 8GCHF 1Z6JH 5EPYA 1C1TA 5EXMA 1HRTH 5ESBA 2XC0A 3U9AH 3SO3A 2VWNA 1EOJA 1DANH 1WSSH 3GCTG 1YBWA 4R8TB 3SU1A 1O5DH 3TNTA 1O3JA 1GBAA 1V2QT 4B76A 1O3DA 1TIOA 3PWCA 1BIOA 1ZR0A 1E35B 2QYIA 4FUCA 1HJAC 1UHBB 1NO9H 1ZTJA 2QAAA 3MU5A 1CA0C 9LPRA 1EPTA 3ZYDA 2OC0A 1W0ZU 3MOCA 4NG9H 1P3CA 1RTLA 1AKSB 1DWBH 4CRAA 2ZCKP 1MBQA 2ZF0H 3MTYA 5DK1A 3RXSA 3KIDU 2BDAA 3O8CA 2FX4A 1P2IA 3P8FA 1TX6A 1H9LB 1J17T 1VCPA 2HOBA 2Q6GA 4TY6A 1K1OA 1LTOA 3P8NA 2SGEE 4Y0ZE 1V3XA 4I8GA 2BY9X 2CV3A 2WINI 1OWDA 2PLXA 4DJZB 3KQDA 4WMDA 1XUJA 1G3DA 1N8OC 3GYMA 1B5GH 1IQKA 2BZAA 1F5RA 1GHWH 1GI8B 4NWKA 3M3VA 3QZRA 1TNHA 3TJNA 4GHQA 5AF9H 1RD3B 2FOAA 1C2FA 1DE7H 2FOEA 5FPTA 3SGAE 1SGQE 1P01A 1AUJA 2OC8A 2AMPA 1EPTB 2ALVA 1P57B 1KTTB 3GY5A 1DT2A 5L30H 2H9EH 1WQVH 1A5GH 5HYOA 2ZP0H 3UTUH 2GGVB 2ZPQA 4WMFA 2J95A 4LZ1H 3FP8E 3LGTA 1LHEH 2O8MA 1SGEE 1ZHRA 4HFPB 3GCNA 2D2DA 4Q7ZA 1DX5M 1P9UA 1FY5A 4Q80A 1P9SA 1EATA 2P16A 2PSXA 1L1NA 2FI4E 2BD4A 2P59A 1ZGVA 1GJ5H 3A84A 4FUHA 5DKMA 1S83A 4A92A 4X6OA 1AUTC 1XKBC 4Y10E 1AHTH 1W13U 2BY8X 3MH5A 1GWAA 3QO6A 1A7SA 4MPVA 4ABEA 5L2YH 3V3MA 4XSKU 4DG4A 1ANEA 4THNH 3A7YA 1M9UA 4BXSA 1H8IH 1UK4A 5A8XA 3O8RA 3RXHA 1ELEE 2A4GA 4IC6A 5EXNA 2CGAA 2FOFA 2AGGX 1GGDB 1DUAA 1HJ9A 3TJUA 3BG4B 1YCPM 1BTYA 4ABDA 1DXPA 1GVKB 2GDDA 1PYTC 2A32A 1B0FA 2ANKH 1ZMJA 3A89A 2O8LA 3PO1B 3A87A 3GISB 1ETSH 1HPGA 4F4OC 1VITF 2XW9A 4DW2U 5BRRE 2ZFRH 1OWJA 2B5TB 1SHYA 3LH1A 1CT2E 1TNKA 4E7NA 1GCDA 4B1TA 4XBBA 1TWXB 3EDXB 3RLYH 1G2MA 3S7KB 2C8WB 1O5BB 1GG6C 2FEQH 3SN8A 1ESAA 3HK3B 4Y8YA 3GY2A 4X6PA 1QRZA 1T8NA 3TH3H 1S82A 4FUGA 4CRFA 1ZTKA 4ISLA 1GI9B 2A7CA 1OP2A 1TX7A 2QGRA 2TGAA 1LHCH 2JH5D 2FXRA 2W5EA 4YTAA 3FP6E 1OXGA 4JCNA 1OYQA 1C9PA 2EI6A 5I25A 3NCLA 3BEFB 2ZDAH 4CBNA 8GCHG 1FY1A 4TPIZ 1SG8B 4K2YA 4X6NA 1PFXC 1UMAH 1BTUA 1DY8A 1SGNE 2UWLA 3QGNB 5GIBA 1HAGE 1DLKB 2GZ7A 1BT7A 1QNJA 2CF8H 1NZQH 1VCWA 2RG3A 1AVGH 1D9IA 1EZXC 1MZDA 2ZGJA 3M5OA 4NIVA 2YOLA 1A5IA 1RIWB 1T8LA 5BPEA 1XKAC 1KLJH 4D76A 2G5VA 2P93A 2XCFA 3BF6H 1TPAE 4Y79A 5A09A 1OP8A 1WU1A 3QDZB 3O8DA 2ZU2A 2A1DB 1AVWA 1LHFH 1H8DH 2A5AA 1EASA 2FP7B 2J38A 2NU4E 2HNTC 1XX9A 4K1EA 1BTPA 1GJ6A 1BTZA 2PW8H 4B75A 5EQRA 1EP5A 2ZI2H 1P03A 4J2YB 4X8VH 4TWWA 2H9HA 3RXKA 1NTPA 1NRNH 4MNVA 4CR9A 2ZA5A 2K1QA 3RU4T 3LKWA 4H4FA 1KLIH 1TMUH 2QF3A 5CHAB 1OSSA 4CRBA 4INLA 4WWYA 2QXHA 1FY4A 2SGDE 1QJ7B 3PTBA 3UR9A 3MNCA 2F9VA 1JMOH 1SSXA 1UCYH 1DOJA 3ELAH 1BB0B 1PPGE 1BJVA 4K60A 1C2LA 1HIAA 3P70B 1LQEA 1Y3VA 1TBRH 5L6NH 2XC5A 2A2XH 3KEEA 2C90B 1UK3A 1CGHA 4FUJA 4ISHH 4U30A 1O3OA 2ZC9H 4AX9H 4X1PU 3I78A 2FOBA 3S9BA 2OXSA 1CGJE 5TCCA 2ZFSA 3QGJA 1EJNA 1GHBG 2ANYA 3LPRA 3HPTB 4KELA 4WXIA 3LC5A 1GJ4H 1QB6A 1TFXA 1BTXA 6ESTA 2P8OB 1GI3A 3DFLA 1GVLA 3SJ8A 1C2DA 1TB6H 2GV7A 4BAHB 1VGCB 1MAXA 1V2KT 2ZU4A 8ESTE 1O2GH 1Y3WA 1W11U 4E06H 3AVZA 4CBOA 1VZQH 5FCRA 3V12A 1HIAB 1Y5BT 4X2VA 1BBRH 3UY9A 2TGTA 3GY4A 4DY7B 1VCQA 3RMMH 3K6YA 3VPKA 1OYTH 2FX6A 3A88A 4BOHA 4UONA 1HAHH 1C5PA 3NZIA 3TNSA 3E16B 1OX1A 1BITA 1GJBB 1YP9A 2D26C 3GY7A 2WV4A 1F7ZA 4AGKA 1VITG 2Z3DA 3LT3A 1BJUA 1O5EH 2OC7A 3EAJA 6CHAB 2GKVE 1SB1H 2UUJB 3GCTF 2FOCA 4JK5A 4ABHA 3LONA 2BVSH 1O2SA 1O3CA 1WQSA 1XUFA 3GCHC 1C5TA 2OC1A 3SJKA 4K5ZA 2Q6DA 2PV9B 1CGIE 5T3HA 3TK6A 1W2KH 3U1JB 4NA8A 3BTGE 3TGJE 4UFEH 1SI5H 3ATLA 1W12U 3SU2A 1O2ZA 1Y3YA 2B0FA 3T26A 2VWMA 3U1IB 4LXBH 3RM0H 3SUDA 3DUXH 4IS5A 1GBDA 4NIYA 5EXLA 3VB7A 1TBZH 3F6UH 1UVPA 2ZU5A 1ZPBA 2UUYA 2FLBH 5LPFA 2ZNKH 4IN1A 1ZRKA 4X1QU 1D3QB 3MO6A 2VVVA 4NFFA 3UREA 2XBWA 1K9OE 1YCPK 3TGKE 3OSYA 1NU7B 1P12E 1TA2A 4B2CA 1TGCA 2FZZA 1MZAA 1T31A 1THPB 2G81E 2VH0A 2C93B 3RC5A 1Q31A 1DSTA 1C5WB 3P17H 2BD7A 3T25A 1SFIA 1CBWB 1OWHA 3UIRA 5JB9S 2GMTB 4WH8A 1ZHPA 1E0FD 1KIGH 4WMEA 1ACBE 1TRYA 4XE4A 1P8VC 4X8SH 1C2HA 1IQJA 4OS5A 4MNWA 2D8WA 4HZHA 1ARCA 1IQFA 4UFFH 3DHKH 1C1PA 1C1RA 5GCHG 1UVOA 2FODA 1ZOMA 1O2VA 1SHHB 1HUTH 1Z8GA 1FDPA 4AB9A 3M7UA 4HTCH 4IBLH 5F8TA 3MU1A 3ODDA 3RU4D 1CU1A 4AORA 4U32A 4ZKSU 1V2JT 1O31A 3K2UA 1O37A 1O2TA 1O2QA 1JOUB 1V2ST 3L6PA 1PPCE 2PKSC 4O3UA 2ZHEH 1XMNB 2EI8A 1ELDE 1PQ5A 1Q2WA 1SLWB 3ZZ8A 1ZZZA 2SGPE 2XWAA 5AFYH 4CH2B 2O8WA 2SNWA 1AMHA 3UNRA 2GVFA 1P2KA 2QXIA 1CHGA 2R2MB 2G52A 3DD2H 3OTJE 2FDAA 4X8UH 1BCUH 4OS7A 3L3TA 3M7QA 4ABBA 5HXFA 2HLCA 3T5FH 1LPZB 1MTNC 3ZZ7A 3ZVDA 1AI8H 1UTLM 1KYNA 1HFDA 4MQAA 4WVPE 1EX3A 3BTFE 1LPKB 2CF9H 1J8AA 4AYVB 1BRCE 3IG6B 4B71A 3BTEE 4Y7BA 2OD3B 1NT1A 4AG2A 1P10A 4ZKRU 2B8OH 4Z6AH 2BOKA 1BTHH 1SL3A 1HB0B 2TRMA 2ZHFH 2VIWA 1ZYOA 4BTTB 1L1GA 1THSH 1OPHB 2Y82A 1KTSB 3GICB 1T4VH 2A7HA 2ZDNA 1O2NA 1UTPA 2ZPRA 5LH8A 1AZ8A 1CA8B 3FVFB 3RXPA 1KXFA 3PROA 4I32A 1QRWA 2SGAA 1YPMH 4FUEA 2Y81A 2Z94A 4R0IA 2AIPA 2ZDLA 1DWEH 4MLFB 1YPHC 3N7OA 4U01A 3SNCA 1O3KA 4CR5A 1Q3XA 1Z6EA 3SNEA 1QIXB 4IW4E 3MNBA 1QBNA 2W3KA 3T2NA 3SHCH 3TU7H 3PMAB 3ITIA 1NFYA 1IAUA 3MU8A 1DITH 1GBIA 2ZWLH 4X8TH 5HMAA 3MMGA 4AFZA 2ZDVH 4ABIA 2O8UA 4K69A 1D3TB 2BDCA 2ZEBA 5A0CA 1YC0A 4JYUH 1GI4A 3UPEA 4CH8B 3IITA 4LK4A 1K1JA 5AVDA 5DPAA 5B6OA 4FUBA 4VGCB 1C1WH 4O3TA 1L0ZA 3ZV8A 2OINA 3KL6A 1KLTA 1PJPA 2VIDA 1G3BA 2BHGA 1LO6A 1K1LA 1T8MA 2J2UA 1IQGA 1G30B 3EA7A 2BXUH 1C5UA 2QC2A 1AWFH 1FXYA 1S5SA 4DOQA 1A3BH 5JBCS 4TY7A 5C1YA 3UOUA 3OY6U 1NRPH 2P94A 3D65E 2VIQA 2AH4X 1DXWA 1F92A 3VFEA 1B0EA 1BTWA 4D8NA 2CHAB 1AB9B 1N6XA 7GCHG 4RKOB 5PTPA 3SGBE 2AYWA 2TIOA 3Q76A 1LHGH 4Y76A 3TH2H 3TJOA 3CENA 4BAMB 1HAVA 3LH3A 4NSYA 1OWKA 5JPMH 2R3UA 2V35A 3MH7A 7KMEH 2BD5A 3HGPA 1UCYE 1HDTH 3SQHE 1C2IA 1P11E 2F9PA 3ZV9A 2ZDMA 3BN9A 2G8TA 2ZZUH 4X2XA 1S0QA 4DCDA 4B2BA 1GBMA 1E37B 2Z9JA 5E0HA 1QBOA 3RXLA 3F9EA 1ELVA 3RXAA 1DVAH 5T6FA 3SU0A 1C5YB 4OGXA 1XVMA 2BLVA 1TRNA 5E2OA 1HAZB 1UTMA 2ZTXA 1BRUP 3O8BA 4GHTA 3F1SB 1EPTC 3SV2H 2Y80A 1PQAA 1YPKH 3SI4H 1C2MA 4A1XA 1G3EA 5DP7A 1C1QA 1FI8A 4ABJA 1SGYE 1TQ0B 2FTMA 3A83A 2BD2A 4WY3A 1O36A 4GUXA 1CHOG 1FJSA 2FESH 1ELBA 3SU4A 1HXFH 5FX6A 1O5CB 4D9RA 3A8AA 1LVYA 1QB9A 4RN6A 3EGKH 1HAVB 3RXVA 1IOEA 1FN6A 2BY7X 2YNBA 2Z7FE 1A5HA 1FAKH 1MAYA 2BZ6H 3E90B 2V6NA 4SGAE 5FBEA 4NA7A 1ZMLA 1O3EA 4KTSA 1SQOA 2ZGCA 1TOMH 2FI5E 1BBRE 1GHBF 1FY3A 4YT7H 1XUIA 4A5TS 3LOXA 2C8XB 2V3OH 4AFSA 2ZGBH 1NM6A 2QV1A 4Y11E 1C5ZB 2BLWA 1BUIA 2CJIA 2OQUA 5C20A 4CRCA 2JH6D 4Y6DA 2Z3EA 4O03A 3SU6A 3A7XA 1TABE 3BTHE 1EAWA 4HI3A 1O35A 4Y0YE 2DE8A 1UTNA 3A8DA 1NN6A 2ULLA 4K8BA 1WTHD 5J4SA 3UQVA 1QL7A 1GGDC 3K9XB 1AVXA 1V2MT 5EODA 3SV9A 3BG4C 3SQEE 2HALA 1S6FA 2PHBA 3P8GA 4ISOA 3FP7E 3ZZ5A 2UUKB 2R0LA 3F68H 4UE7H 2AGIX 1MCTA 2GD4B 4BAKB 5C2ZA 4IC5A 5ESTE 4GVUA 3Q3KA 4ABAA 5E0GA 5IYTA 3S7HB 3EA9A 4ABGA 1GBEA 2M5TA 3PLPA 1SGCA 3TITA 1K22H 1TGNA 1FIZA 1BOQA 1WOFA 2FTLE 5AFZH 1FAXA 5H4IB 1DY9A 1D3DB 5GXPA 2CN0H 1P2MA 4UFGH 3VGCB 1GI1A 1NRQH 2ZQ2A 3QTVH 3URCA 1MU8B 5FHTA 2R9PA 2H9TH 1S84A 2WYJA 3GYLB 1O3HA 1ORFA 1GBBA 2VINA 1UTQA 4DT7B 3MO3A 2V0BA 1AQ7A 2HNTE 4AOQA 3DT0H 5DP4A 1MTVA 4IN2A 1AIXH 1GJAB 3KHVA 1TNJA 1ID5H 1PPBH 2VIVA 1GG6B 3PMJA 3Q00A 1C1NA 1GMDG 1TGBA 2GCTB 1TMBH 1AE5A 2NU2E 1O3BA 3BEIB 3V13A 1TE0A 4GCHG 1ABIH 1EJAA 3UWIA 1V2WT 1QFKH 1JIMA 1O3LA 2ZGHA 4M7GA 1SGRE 3ATKA 5ETXA 3SJ9A 3F9GA 1RTKA 1RIWC 3A81A 2A5KA 2H5DA 2J4IA 1C2EA 3RC4A 1QL8A 3TH4H 2FI3E 4FVDA 3E8LA 2XYAA 4FUIA 5FX5A 4CHAB 1GMCG 2C4FH 3ENSB 2G51A 1SOTA 3R0FA 5DP8A 5GCHF 1V2OT 1EZQA 1TGSZ 1V2UT 2W26A 4BAOB 3PM3A 3SORA 1KY9A 3IWMA 4ZHLU 5JBBS 2ZPSA 3OYPA 4RKJB 1DFPA 1GBCA 2GZ8A 1SLUB 1QQ4A 1C4Y2 1ESTA 2ZDKA 1HV7A 3SU5A 1MKWH 1K2I1 2Z9LA 1O2KA 3V7TA 1BMMH 4D9QA 5CHAC 3UQOA 3M36A 3H7TA 1Y5UT 1C4U2 1H1BA 2G00A 2QF0A 2WPIS 3JZ2B 1T32A 3A80A 1DDJA 1FQ3A 1V6DA 3SUEA 1CSOE 5C5NA 1ZJKA 1MU6B 3C27B 4JZIA 4AFUA 4JZEH 3NKKA 1EP6A 1ANDA 1S85A 1TPPA 4AN7A 4QT8C 3PTNA 4F49A 3EQ0H 2UWOA 1LKBA 3QX5H 3KQCA 1ELFA 3BIVH 1FMGA 1RS0A 3DFJA 1QL9A 2BYAX 9ESTA 2Z9KA 3LGVA 2G4UA 4E05H 1EXFA 1O0DH 3U8RH 2Q1JA 4BTIB 3RXUA 3LGIA 1S81A 2GV6A 5EW2H 2ZKSA 2IOTA 1MBMA 1CT0E 1S6HA 1C2KA 2BDYA 2GT8A 2Y5FA 1CQQA 4BANB 2R2WU 3ZZBA 2B9LA 1JWTA 1GI5A 1O3FA 3A8BA 2FOGA 3RXJA 1TPOA 1O2HA 2P8OC 1H9IE 1O3IA 2OLGA 5FBIA 1IQNA 1VGCC 1HAOH 2G4TA 5F03A 3SUFA 7ESTE 1HAXB 3RMOH 1QB1A 2XC4A 2HVXA 2ZG0H 2VVCA 2JH0D 3ATWA 1XXDA 4K1SA 1KSNA 1A1RA 5LPEA 1FV9A 2VGCB 1NS3A 1GHVH 4MTBA 2EC9H 2RA0A 3M3TA 2A0QB 1EAIA 1XM1A 2FOMB 1ANBA 3RXQA 2PGQB 3ZZ4A 5I46H 1RRKA 5JYIA 3M37A 3PLKA 2A5IA 2DE9A 1YPEH 1SGPE 2QXJA 1BZXE 3VXFH 1NRRH 3E3TA 2PTCE 4J1YA 3OY5U 4Y8ZA 4YOJA 1MQ6A 1W7GH 1SQAA 2P3FH 1HNEE 1UVUH 6CHAC 2FLRH 2FS9A 5T6DA 4I8KA 4NWLA 4YOGA 1ELGA 1K1NA 4YT6H 3SV8A 4HGCA 3S69A 1O32A 3SW2B 1ZSJA 2ZU3A 1F5LA 3P6ZB 1PPHE 4OS6A 2FMJA 2BXTH 4WF8A 4YOIA 5DP9A 1DLEA 3E6PH 1IQMA 2PTNA 1IQLA 3BV9B 1Y59T 4D7GA 3BTDE 3F9FA 3M5MA 7GCHF 1Z7KA 4ABFA 1BHXF 3KN2A 1F0RA 2STAE 4XDEA 1O3NA 1TNGA 1EKBB 5GPIB 4JMYA 4NIWA 1O2YA 2A45B 1P04A 3K65B 3MO9A 1LDTT 2IJOB 4GLYA 3U98H 3T62A 1C4V2 3GDUA 3BTQE 3PV4A 4YM9A 1CBWC 2P3UB 3SNAA 4WXVA 3LDXH 2GMTC 3A7WA 1EAUA 1W7XH 3ZZCA 2BY6X 5HM2A 2LPRA 3SZNA 1C5SA 3FAOA 2AMDA 1AD8H 1FLEE 1MD7A 1O38A 4IMZA 1C5NH 1P2NA 2A2QH 2UWPA 2VIOA 3UWJH 2BQWB 2ZQ1A 2FYRA 1YLCA 3RXDA 5ABWA 2AGEX 4UEHH 1W10U 3RLWH 3ZZ6A 1BMAA 3U8TH 3E1XB 5DP5A 1TONA 1G32B 5LPRA 1GBKA 1C1OA 3SNDA 3MU0A 2F3CE 4AZ2B 2NU1E 3RXBA 4FU7A 2EI7A 1YGCH 4H6TA 1O3AA 1CHOF 1T4UH 3RUOA 1P09A 2Z9IA 4I31A 2HNTF 3M5LA 4ISIH 1AGJA 4X2YA 3VB5A 3GY3A 2VIPA 4IGDA 2BD3A 4SGBE 1GBHA 4AG1A 2JETB 3ZZ9A 4K8YA 2VJ1A 1UVSH 2H6MA 1V2NT 1AWHB 3TJVA 3LIWA 2ANWA 3QK1A 2BQ7B 3PLBA 4MPWA 1HAIH 3R3GB 1UCYK 4Y71A 1QQUA 2BM2A 1F2SE 1UTKA 2IN2A 1UTJA 2FPZA 1P0SH 4TPYA 1GJ9B 3VXEH 1IHTH 3NPSA 1FY8E 1GHYH 1YKTA 2CMYA 2DUCA 5EW1H 2FOHA 3BG8A 4NSVA 2XNIA 4FXGH 4JK6A 1QHRB 2THFB 3ZVBA 2F91A 1W8BH 1GMHG 1D6WA 3SNBA 4FU9A 3RXIA 1GL0E 1IHSH 5A8YA 1HAYB 1AFQB 2BQ6B 5C3NA 1DS2E 1GCTB 3D23A 3GDVA 4INHA 2Y7XA 4XBCA 1X7AC 4NZLA 1XXFA 1EQ9A 2STBE 3QTOH 2XRCA 3SUGA 1LVBA 1FPCH 2GTBA 3MU4A 2GX4A 1O2JA 3RXCA 3VB4A 3EA8A 3RU4E 3AASA 3MH6A 2UUFB 1FIWA 3KF2A 4O9VA 2YNAA 1TRMA 1T7CA 1DICA 4CRDA 1CVWH 1YPLH 2BLOA 2ILNA 1GI7B 1UTOA 1BBRK 1ETRH 3LJOA 3LJJA 1MQ5A 2F9BH 2XWBI 3A8CA 3VB3A 5EQSA 2I6QA 1Y3XA 1TQ7B 4YESB 1SVPA 1G9IE 2ZTYA 1NESE 1V2LT 3MWIU 3KQEA 5F8ZA 4FUFA 5F8XA 1NRSH 5IDKA 4BTUB 1IQEA 1MKXK 2QIQA 1GBFA 1O3GA 1W14U 3MFJA 2SGQE 1SQTA 1NROH 4UFDH 3NWUA 1FUJA 1GMDF 4VGCC 1SOZA 1OWIA 4ISNA 3H5CB 1G36A 4GCHF 2ZCHP 4ZHAA 2BOHB 2VWOA 3RDZA 2OUAA 3HGNA 1GBTA 1SGTA 2OQ5A 1C9TA 4YZUA 2BVRH 3NK8A 3LGYA 5DJ7A 5JDUB 2J9NA 3SGQE 2CHAC 1AB9C 3C1KA 1AY6H 3SV6A 5CMXH 1PQ8A 1GMCF 1Z71A 1Y8TA 1J15A 1W0YH 4MPUA 2ZHDA 2ZU1A 4Y7AA 1O5GH 1A61H 1PYTD 1TYNA 3D49H 2R3YA 3TK9A 4KTUA 2NWNA 4OGYA 5DP3A 2TGPZ 2WPLS 2GCHG 1QBVH 4X6MA 4O97A 1HJAB 3QUMP 4YLQH 1ARBA 1GJ7B 3ZVFA 1FNIA 1DSUA 1NPMA 1CA0B 4ZUHA 3CS0A 2LNCA 3SOSA 3ZZDA 1GVZA 5C5OA 2B7DH 1THRH 2QA9E 2V3HH 3T28A 4A6LA 1SMFE 1GBLA 2BDIA 2CXVA 6GCHF 1VJ9U 2C3SA 3URDA 5C1UA 1LCYA 2ODPA 4GPGA 4KP0A 5SGAE 4FU8A 2XTTB 1WUNH 3SV7A 3ESTA 2QY0B 3D62A 1PPFE 3RXEA 3T27A 1ESBA 2ZO3H 1D6RA 3ZVAA 2J34A 2WV5A 5T6GA 3RXFA 5JBTA 5DGJA 3E0NB 1J16A 1N1LA 2AERH 3I77A 2QCYA 3BSQA 1GI2A 2Z3CA 4X1NU 1J9CH 1N8OB 1Z1IA 4X1RU 1GDQA 1PPZA 1MCVA 2A4OA 3MHWU 3PWBA 3LC3A 2BX3A 1GHXH 1C1UH 1ZLRA 3SI3H 1TNIA 1C5OH 1V2RT 1AZZA 1K21H 3A86A 1LMWB 5GWZA 3AAUA 1O3PB 3UFAA 1TOCB 1ZRBA 2I6SA 3M61U 1G37A 4I8HA 2SFAA 4KGAA 1CO7E 1INCA 8KME2 1Z8IB 3BTTE 1K28D 2ZIQH 3CS7A 2P3TB 1KXBA 3BTME 1RGQA 3STJA 1TBQH 3SBKA 3SJOA 3NXPA 1K1IA 4RSPA 1SFQB 3TGIE 3BTKE 3Q77A 2RA3A 3BIUH 3OU0A 1GJCB 1A46H 2FM2A 2ZCLP 1ZPCA 1CE5A 2AMQA 2JKHA 1F0SA 3EYDA 3FANA 4MDSA 1V2VT 5A0BA 3ZZAA 3S9CA 1F0UA 4ZH8A 1VITH 1YM0A 2WPKS 4DIIH 5FPYA 2H2ZA 3FZZA 3PO1C 5E0JA 1JXPA 2ASUB 5FXLA 2F9NA 3QLPH 3K6ZA 5C1XA 2BTCE 4FVBA 3UOPA 2NU3E 1D3PB 3A7VA 4FUDA 2BDBA 3ODFA 4ZXYH 1TLDA 1WAYB 4U2WA 4WJG2 4AGJA 3W94A 5L2ZH 2Y6TA 3VGCC 2BB4A 3GY6A 1QRXA 2VVUA 1GI0A 4ZHMU 1Y3UA 4XOJA 1MUEB 1EB2A 3SJIA 2WUCA 2PKAA 2GT7A 2BMGB 1P05A 4I7YH 2GDEH 1C5LH 2W7SA 1QY6A 2WYGA 3GOVB 1BQYA 4IMQA 5FPSA 1AFEH 3B8JA 2FWWA 5AHGH 2BX4A 2A31A 1P2OA 5G4BA 1E34B 2GCTC 1QCPA 2J94A 1ANCA 4A1VA
chains in the Genus database with same CATH superfamily
1YY3A 1H9HE 1TNLA 2OCVB 1H4WA 4ZMAH 4D7FA 2ZFTA 1L2EA 3HKJB 2RFKC 3S0NA 1F5KU 5DG6A 1Z8RA 4UD9H 2ODQA 3FOAA 1BHXB 1O2MA 1OP0A 1SPJA 5CE1A 1WDIA 3SYJA 3HATH 1TAWA 3LGUA 4MPXA 4P02A 1C5QA 2PFEA 1KXEA 3RXOA 1YCPH 2OBOA 1OS8A 4X2WA 2OTVA 4XRNA 4CHAC 1HJ8A 2Q6FA 1ELTA 1PPEE 4KKDA 2PKAB 3ZVCA 5DP6A 1ELAA 1MD8A 1O2LA 1P06A 5FAHA 1ZGIA 4ZROA 3G01A 1EAXA 1C2GA 3RMNH 4PROA 4UDWH 1A2CH 1JRTA 1QJ6B 1U6QA 3B9FH 1Z1JA 4ASHA 3V0XA 3RXGA 3KQBA 4TYDA 3S9AA 4A7IB 4CREA 6LPRA 5EJ1A 6GCHG 4KTCA 1GI6A 3AW1A 1EOLA 3F0PA 4I8JA 5EU8A 4WH6A 3KYGA 1NFXA 5E2PA 1EJMA 1GPZA 3RC6A 1K1PA 3HKIB 4YLUA 4BXWA 2WPJS 4NIXA 1FONA 1GJ8B 4B2AA 1BRAA 3W95A 1MMJN 3Q3XA 1YLDA 1FZZA 1C2JA 3EE7A 2NU0E 3H7OA 1YYY1 2HGTH 1Y5AT 3OAAD 4ZAEA 2SNVA 3FN8A 1H8HD 1ZSLA 3P92A 4F48B 3KGPA 2TPIZ 5DO4H 1NY22 3AW0A 1QA7A 1LPGB 1NU9A 1XUGA 2BVXH 1GMHF 1JRSA 1O2RA 2C8YB 1W3CA 3M3SA 1MTUA 3UNSA 3EE0B 3FFGA 1AE8H 4I8LA 2PP6A 1O2IA 1A0HB 4TT3D 4DIHH 4B73A 2Z6BD 1AU8A 1OOKB 2VWLA 3A7ZA 3STIA 1C5VA 3KYFA 4XFQA 4CRGA 1KXDA 5T1VA 3PMHB 3JZ1B 3VB6A 1RTFB 4TWYA 1O5AB 3LGWA 1F0TA 4I33A 1EB1H 5C67A 2VH6A 1P3EA 3F2HA 1FPHH 4JYTA 1EFRD 2HWLB 1B7XB 2Y5HA 7LPRA 1HBTH 2P95A 2WPDD 1FX0B 3VEQB 2VGCC 1O2OA 2WUBA 3M35A 4NZQA 3U8OH 4ESTE 3MNXA 3MYWA 4DGJA 3GCOA 2WPMS 1O3MA 3KCGH 5EQQA 1C1MA 3HK6B 2AS9A 1SLXB 3RMLH 2OBQA 3CNRA 1QTFA 2RCEA 1N6YA 2XCNA 4X0WU 1OHHD 3UR6A 3QWCH 4GSOA 2A7JA 1QGFA 1O39A 1HYLA 1SR5C 2BLQA 4Y8XA 3U69H 2GZ9A 3F0OA 1ZMNA 3KNXA 4GAWA 4MVNA 5TCAA 1VJAU 5EPNA 1SLVB 4MNXA 2FYQA 5EG4A 3CP7A 2ANMH 1GL1A 4OS1A 1O2WA 4ZKOU 1GBJA 3AK5A 4K3JA 1MTWA 3QN7A 1SGIB 4DURA 1V2PT 1LHDH 3QZQA 1GHAF 4OS2A 1V2TT 3Q3YA 1MKXH 1MABB 3GY8A 5J4QA 1G3CA 3P95A 1TA6A 3TVJB 1EUFA 2SGFE 1ABJH 1BRBE 3A85A 2AIQA 1NFUA 1O2UA 1C5XB 2KCOA 1GJDB 5JBAS 2H5CA 3DA9B 1YPGH 3ZVEA 1LKAA 3AAVA 1ZJDA 1O2XA 2JJ2D 2F9UA 1OWEA 2EA3A 2O9QA 1UJ1A 2ZECA 4K1TA 1O33A 1DUEA 1O30A 2BDGA 1LVMA 2RDLA 2VBCA 3GCHB 2VNTA 1SGFG 2GCHF 1E38B 4H6SB 2PGBB 4B74A 2PUXB 3RXTA 4DVAU 1VR1H 5A2MH 1GHZA 1HGTH 3P8OA 4BNRA 5KGOA 5E8EH 1QR3E 2VU8E 1L4DA 3TIUA 1JIRA 1QA0A 4NCYA 4MG3A 1TMTH 1K1MA 2QF5A 4XBDA 1O34A 1CT4E 5LGOA 4H42U 1A0LA 4LZ4B 2A4QA 1O2PA 1O5FH 3NUMA 2PUQH 1JBUH 1LVOA 2G5NA 2KAIA 1G2LA 2ODYB 2ZFFH 3U28C 3I29A 1C5MD 1E79D 1P2JA 2A4RA 1C1VH 3TPIZ 4INKA 2ZHQH 2ESTE 1PQ7A 2D1JA 2O8TA 3MI4A 1TALA 1BMLA 5A8ZA 1SC8U 1YF4A 1E1RD 3A7TA 1BA8B 2EEKA 1GDUA 2BD8A 3ZYEA 4BAQB 1MKWK 1WV7H 1UVTH 5A0AE 4ZKNU 3T29A 1DPOA 1YPJH 2JETC 2IPHA 3BTWE 2ALPA 2TBSA 1BMNH 2WPHS 1A0JA 5GJ4B 3L33A 2XBXA 1RFNA 1YPHE 2QN5T 1P2QA 3ATIA 2G55A 1C1SA 1EZUC 3FZDA 2ZFPH 1KXAA 1ETTH 2ZTZA 3RXRA 2HPQH 3MNSA 4ZXXH 3ZVGA 2H1UA 1IQIA 4X1SU 2BY5X 3A82A 2J92A 4NA9H 4Q7YA 2Y7ZA 2PKSB 2ZHWH 1ZHMA 1SBWA 2KAIB 1MTSA 2XBYA 3MH4A 5DSFA 1OKXA 2TGDA 2XXLA 2QXGA 3SU3A 4OS4A 2AEIH 3M7TA 2BDHA 3PYHA 1MH0A 2EY4C 3ATMA 3E0PB 1HXEH 2HPPH 5EOKA 3TLOA 3ZZ3A 1AFQC 1D4PB 2PSYA 5HM9A 1L4ZA 3UUZA 2FO9A 1ZPZA 1GCTC 1DM4B 1ZSKA 1KDQA 2OP9A 5K0HA 4JZDH 1C5RA 1QJ1B 1UK2A 4HG6A 4JZFH 5HGGA 3M5NA 1MTNB 1EZSC 2C8ZB 2W3IA 5F6MA 2VB0A 3E91A 3H09A 3SHAH 1TPSA 4LOYH 1DWDH 1UO6A 4YO9A 3RP2A 1DWCH 2PR3A 1P02A 4AFQA 1RXPA 2Y5GA 2R0KA 1RJXB 3GDSA 4NGAH 1WYKA 3BEUA 3OX7U 3RXMA 1LQDB 3GS9A 4RT0A 3MQKC 1HLTH 2ZGXH 1KMHB 2XBVA 1SGFA 3DSGA 1XUHA 3WY8A 2AFQB 2PWXA 3RM2H 4A1TA 5GDSH 3SZEA 4AYYB 3PMBB 3TK5A 8LPRA 2FS8A 5EGMA 1HAPH 1AN1E 4E7RG 2LP6A 1HCGA 1T8OA 4Q7XA 1A4WH 3UNQA 1ELCA 2ZFQH 2W7UA 1FN8A 1GDNA 5JB8S 1WBGB 1UHBA 1SGDE 4JYVH 5K7RA 1WCZA 2GP9B 4JZ1A 1TGTA 1J14A 1KDQB 1E36B 5FCKA 1KXCA 3PRBA 3F9HA 1XVOA 1AKSA 2HRVA 1S0RA 4ACBA 2F9OA 4MNYA 1QURH 1XUKA 1ZTLA 2Z9GA 1TX8A 1WTGH 5TJXA 1NFWA 1IQHA 2F83A 4Z0KA 2BD9A 1GHAG 1AO5A 1A3EH 5EIYA 3PB1E 4Q2KA 2FIRH 4AB8A 1NC6A 1BDAA 1Z8JB 3LU9B 4NFEA 1L1JA 3B23B 3OEHD 8GCHF 1Z6JH 5EPYA 1C1TA 5EXMA 1HRTH 5ESBA 2XC0A 3U9AH 3SO3A 2VWNA 1EOJA 1DANH 1WSSH 3GCTG 1YBWA 4R8TB 2AHME 3SU1A 1O5DH 3TNTA 2QE7D 1O3JA 1GBAA 1V2QT 4B76A 1O3DA 1TIOA 3PWCA 2WV9A 1BIOA 1ZR0A 1E35B 2QYIA 4FUCA 1HJAC 1UHBB 1NO9H 1ZTJA 2QAAA 3MU5A 1CA0C 9LPRA 1EPTA 3ZYDA 2OC0A 1W0ZU 3MOCA 4NG9H 1P3CA 1RTLA 1AKSB 1DWBH 4CRAA 2ZCKP 1MBQA 2ZF0H 3MTYA 5DK1A 3RXSA 3F3BA 3KIDU 2BDAA 3O8CA 2FX4A 1P2IA 3P8FA 1TX6A 1H9LB 1J17T 1VCPA 2HOBA 2WZQA 2Q6GA 4TY6A 1K1OA 1LTOA 3P8NA 3NRLA 2SGEE 4Y0ZE 1V3XA 4I8GA 2BY9X 2CV3A 2WINI 1OWDA 2PLXA 2M2AA 4DJZB 3KQDA 4WMDA 1XUJA 1G3DA 1N8OC 3GYMA 1B5GH 1IQKA 2BZAA 1F5RA 1GHWH 1GI8B 4NWKA 4ZCNA 3M3VA 3QZRA 1TNHA 3TJNA 4GHQA 5AF9H 1RD3B 2FOAA 1C2FA 1DE7H 2FOEA 5FPTA 3SGAE 1SGQE 1P01A 1AUJA 2OC8A 2AMPA 3OTPA 1EPTB 2ALVA 1P57B 1KTTB 3GY5A 1DT2A 5L30H 2H9EH 1WQVH 1A5GH 5HYOA 4RT1A 2ZP0H 3UTUH 2GGVB 2ZPQA 4WMFA 2J95A 3ZIAD 5IK2D 4LZ1H 3FP8E 3LGTA 1LHEH 2O8MA 1SGEE 1ZHRA 4HFPB 3GCNA 2D2DA 4Q7ZA 1DX5M 1P9UA 1FY5A 4Q80A 1P9SA 2K8IA 3F2GA 3FO8D 1EATA 2P16A 2PSXA 1L1NA 2FI4E 2BD4A 2P59A 1ZGVA 1GJ5H 3A84A 4FUHA 5DKMA 1S83A 4A92A 4X6OA 1AUTC 1XKBC 4Y10E 1AHTH 1W13U 2BY8X 3MH5A 4I86A 1GWAA 3QO6A 1A7SA 4MPVA 4ABEA 5L2YH 3V3MA 4XSKU 2CK3D 4DG4A 1ANEA 4THNH 3A7YA 1M9UA 4BXSA 1H8IH 1UK4A 5A8XA 3O8RA 3RXHA 1ELEE 2A4GA 4IC6A 5EXNA 2CGAA 2FOFA 4Q63A 2AGGX 1GGDB 1DUAA 1HJ9A 3TJUA 3WWBA 3BG4B 1YCPM 1BTYA 4ABDA 1DXPA 1GVKB 2GDDA 1PYTC 2A32A 1B0FA 2ANKH 1ZMJA 3A89A 2O8LA 3PO1B 3A87A 3GISB 1ETSH 1HPGA 4F4OC 1VITF 2XW9A 4DW2U 5BRRE 1UW7A 1OWJA 2B5TB 2ZFRH 1SHYA 3LH1A 1CT2E 1TNKA 4E7NA 1GCDA 4B1TA 4XBBA 1TWXB 3EDXB 3RLYH 1G2MA 3S7KB 2C8WB 1O5BB 1GG6C 2FEQH 3SN8A 1ESAA 3HK3B 4Y8YA 3GY2A 4X6PA 1QRZA 1T8NA 3TH3H 1S82A 4FUGA 4CRFA 1ZTKA 4ISLA 1WXRA 1GI9B 2A7CA 1OP2A 3FKSD 1TX7A 2QGRA 2TGAA 1LHCH 2JH5D 2FXRA 2W5EA 4YTAA 3FP6E 2WSSD 1OXGA 4JCNA 1OYQA 1C9PA 2EI6A 5I25A 3NCLA 3BEFB 2ZDAH 4CBNA 8GCHG 1FY1A 4TPIZ 1SG8B 4K2YA 4X6NA 1PFXC 1UMAH 1BTUA 1DY8A 1SGNE 2UWLA 3QGNB 5GIBA 1HAGE 1DLKB 2GZ7A 1BT7A 1QNJA 2CF8H 1NZQH 1VCWA 2RG3A 1AVGH 1D9IA 3OE7D 1EZXC 1MZDA 2ZGJA 3M5OA 4NIVA 2YOLA 1A5IA 1RIWB 1T8LA 5BPEA 1XKAC 1KLJH 4D76A 2G5VA 2P93A 2J97A 2XCFA 3BF6H 1COWD 1TPAE 4Y79A 5A09A 1OP8A 1WU1A 3QDZB 3O8DA 2ZU2A 2A1DB 1AVWA 1LHFH 1H8DH 2A5AA 1EASA 2FP7B 2J38A 2NU4E 2HNTC 1XX9A 4K1EA 1BTPA 1GJ6A 1BTZA 2PW8H 4B75A 5EQRA 1EP5A 2ZI2H 1P03A 4J2YB 4X8VH 4TWWA 2H9HA 3RXKA 1NTPA 1NRNH 4MNVA 4CR9A 2ZA5A 2K1QA 2L6OA 2RDEA 5HIYA 3RU4T 3LKWA 4H4FA 1KLIH 1TMUH 2QF3A 5CHAB 1NBME 1OSSA 4CRBA 4INLA 4WWYA 2QXHA 1FY4A 1YLNA 2SGDE 1QJ7B 3PTBA 3UR9A 3MNCA 2F9VA 2KR7A 1JMOH 1SSXA 1UCYH 1DOJA 3ELAH 5C94A 1BB0B 1PPGE 1BJVA 3OFND 4K60A 1C2LA 1HIAA 3P70B 1LQEA 1Y3VA 1TBRH 5L6NH 2XC5A 2A2XH 2JDID 3KEEA 2C90B 1UK3A 1K0HA 1CGHA 4FUJA 4ISHH 4F55A 4U30A 1O3OA 2ZC9H 2KCYA 4AX9H 4X1PU 3I78A 2FOBA 3S9BA 2OXSA 1CGJE 5TCCA 2ZFSA 3QGJA 1EJNA 1GHBG 5B6LA 2ANYA 3LPRA 3HPTB 4KELA 4WXIA 3LC5A 1GJ4H 1QB6A 1TFXA 1BTXA 6ESTA 2P8OB 1GI3A 3DFLA 1GVLA 3SJ8A 1C2DA 1TB6H 2GV7A 4BAHB 1VGCB 1MAXA 1V2KT 2ZU4A 8ESTE 1O2GH 3VG8A 1Y3WA 2KZ4A 1W11U 4E06H 3AVZA 4CBOA 1VZQH 5FCRA 3V12A 1HIAB 1Y5BT 4X2VA 1BBRH 3UY9A 2TGTA 3GY4A 4DY7B 1VCQA 3RMMH 3K6YA 2KM0A 3VPKA 1OYTH 2FX6A 3A88A 4BOHA 4UONA 1HAHH 1C5PA 3NZIA 3TNSA 3E16B 1OX1A 3PV5A 1BITA 1GJBB 2GJGA 1YP9A 2D26C 3GY7A 2WV4A 1F7ZA 4AGKA 1VITG 2Z3DA 3LT3A 1BJUA 1O5EH 2OC7A 3OEED 3EAJA 6CHAB 2GKVE 1SB1H 2UUJB 3GCTF 2FOCA 2EQNA 4RI0A 4JK5A 4ABHA 3LONA 2BVSH 1O2SA 1O3CA 1WQSA 1XUFA 3GCHC 1C5TA 2OC1A 3SJKA 4K5ZA 2Q6DA 2PV9B 1CGIE 5T3HA 3TK6A 1W2KH 3U1JB 4NA8A 3BTGE 3TGJE 4UFEH 2V3MA 1SI5H 4OM9A 3ATLA 1W12U 3SU2A 1O2ZA 1Y3YA 2B0FA 5FL7D 2VWMA 3T26A 3U1IB 4LXBH 3RM0H 3SUDA 3DUXH 4IS5A 1GBDA 4NIYA 5EXLA 3VB7A 1TBZH 3F6UH 1UVPA 2ZU5A 1ZPBA 2UUYA 2FLBH 5LPFA 2ZNKH 4IN1A 1ZRKA 4X1QU 1D3QB 3MO6A 2VVVA 4NFFA 3UREA 2XBWA 1K9OE 1YCPK 3TGKE 3OSYA 1NU7B 1P12E 1TA2A 4B2CA 1TGCA 2FZZA 3DSPA 1MZAA 1T31A 1THPB 2G81E 2VH0A 2C93B 3RC5A 1Q31A 2J98A 1DSTA 1C5WB 3P17H 2BD7A 3T25A 1SFIA 1CBWB 1OWHA 3UIRA 5JB9S 2GMTB 4WH8A 1ZHPA 4B6FA 1E0FD 1KIGH 4WMEA 1ACBE 1TRYA 4XE4A 1P8VC 4X8SH 1C2HA 1IQJA 4OS5A 4MNWA 2D8WA 4HZHA 1ARCA 1IQFA 4UFFH 3DHKH 1C1PA 1C1RA 5GCHG 1UVOA 2FODA 1ZOMA 1O2VA 5CHBA 1SHHB 1HUTH 1Z8GA 1FDPA 4AB9A 3M7UA 4HTCH 4IBLH 5F8TA 3MU1A 3ODDA 3RU4D 1CU1A 4AORA 4U32A 4ZKSU 1V2JT 1O31A 3K2UA 1O37A 1O2TA 1O2QA 1JOUB 1V2ST 3L6PA 1PPCE 2PKSC 4O3UA 2ZHEH 1XMNB 2EI8A 1ELDE 1PQ5A 1Q2WA 1SLWB 3ZZ8A 1ZZZA 2J98B 2SGPE 2XWAA 5AFYH 2YMSB 4CH2B 2O8WA 2SNWA 1AMHA 3UNRA 2GVFA 1P2KA 2QXIA 1CHGA 2R2MB 2G52A 3DD2H 3OTJE 2FDAA 4X8UH 1BCUH 4OS7A 3L3TA 3M7QA 4ABBA 5HXFA 2HLCA 3T5FH 1LPZB 1MTNC 3ZZ7A 1SKYE 3ZVDA 1AI8H 1UTLM 1KYNA 1HFDA 4MQAA 4WVPE 1EX3A 3BTFE 1LPKB 2CF9H 1J8AA 4AYVB 1BRCE 3IG6B 4B71A 3BTEE 4Y7BA 2OD3B 1NT1A 4AG2A 1P10A 4ZKRU 2B8OH 4Z6AH 2BOKA 1BTHH 1SL3A 1HB0B 2TRMA 2ZHFH 2VIWA 1ZYOA 4BTTB 5C17A 1L1GA 1THSH 1OPHB 2Y82A 1KTSB 3GICB 1T4VH 2A7HA 2ZDNA 1O2NA 1UTPA 2ZPRA 5LH8A 1AZ8A 2F43B 1CA8B 3FVFB 3RXPA 1KXFA 3PROA 4I32A 3N99A 1QRWA 2SGAA 1YPMH 4FUEA 2Y81A 2Z94A 4R0IA 2AIPA 2ZDLA 1DWEH 4MLFB 5EJLA 1YPHC 3N7OA 4U01A 3SNCA 1O3KA 4CR5A 1Q3XA 1Z6EA 3SNEA 1QIXB 4IW4E 2JJ1D 3MNBA 1QBNA 2W3KA 3T2NA 3SHCH 3TU7H 3PMAB 3ITIA 1NFYA 1IAUA 3MU8A 1DITH 1GBIA 2ZWLH 4X8TH 5HMAA 3MMGA 4AFZA 2ZDVH 4ABIA 2F4LA 2O8UA 4K69A 1D3TB 2BDCA 2ZEBA 5A0CA 1YC0A 4JYUH 1GI4A 3UPEA 4CH8B 3IITA 4LK4A 1K1JA 5AVDA 5DPAA 5B6OA 4FUBA 4VGCB 1C1WH 4O3TA 1L0ZA 3ZV8A 2OINA 3KL6A 1KLTA 1PJPA 2VIDA 1G3BA 2BHGA 1LO6A 1K1LA 1T8MA 2J2UA 1IQGA 1G30B 3EA7A 2BXUH 1C5UA 2QC2A 1AWFH 1FXYA 1S5SA 4DOQA 1A3BH 5JBCS 4TY7A 5C1YA 3UOUA 3OY6U 4Q4LA 1NRPH 2P94A 3D65E 2VIQA 2AH4X 1DXWA 1F92A 3VFEA 1B0EA 1BTWA 4D8NA 2CHAB 1AB9B 2KFWA 1N6XA 7GCHG 4P00A 4RKOB 5PTPA 3SGBE 2AYWA 2TIOA 3Q76A 1LHGH 1H8ED 4Y76A 3TH2H 3TJOA 3CENA 4BAMB 1HAVA 2WHXA 3LH3A 4NSYA 3PV2A 1OWKA 5JPMH 2R3UA 2V35A 3MH7A 7KMEH 2BD5A 3HGPA 1UCYE 1HDTH 3SQHE 1C2IA 1YWUA 1P11E 2F9PA 3ZV9A 2ZDMA 3BN9A 2G8TA 2ZZUH 4X2XA 1S0QA 4DCDA 4B2BA 1GBMA 1E37B 2Z9JA 5E0HA 1QBOA 3RXLA 1S6LA 3F9EA 1ELVA 3RXAA 1DVAH 5T6FA 3DSOA 3SU0A 1C5YB 4OGXA 1XVMA 2BLVA 1TRNA 5E2OA 1HAZB 1UTMA 2ZTXA 1BRUP 3O8BA 4GHTA 3F1SB 1EPTC 3SV2H 2Y80A 1PQAA 1YPKH 3SI4H 1C2MA 4A1XA 1G3EA 3PRDA 5DP7A 1C1QA 1FI8A 4ABJA 1SGYE 1TQ0B 2FTMA 3A83A 2BD2A 4WY3A 1O36A 4GUXA 1CHOG 1FJSA 2FESH 1ELBA 3SU4A 1HXFH 5FX6A 1O5CB 4D9RA 3A8AA 1LVYA 1QB9A 4RN6A 3EGKH 1HAVB 3RXVA 1IOEA 1FN6A 2KCPA 2BY7X 2YNBA 2Z7FE 1A5HA 1FAKH 1MAYA 2BZ6H 3E90B 2V6NA 4SGAE 5FBEA 4NA7A 1ZMLA 1O3EA 4KTSA 1SQOA 2ZGCA 1TOMH 2FI5E 1BBRE 1GHBF 1FY3A 4YT7H 1XUIA 4A5TS 3LOXA 2C8XB 2V3OH 4AFSA 2ZGBH 1NM6A 2QV1A 4Y11E 1C5ZB 2BLWA 1BUIA 2CJIA 2OQUA 5CDFE 5C20A 4CRCA 2JH6D 2L74A 4Y6DA 2Z3EA 4O03A 2QF4A 3SU6A 3A7XA 1TABE 3BTHE 3F2FA 1EAWA 4HI3A 1O35A 4Y0YE 2DE8A 1UTNA 3A8DA 1NN6A 2ULLA 4K8BA 1WTHD 5F53A 5J4SA 3UQVA 1QL7A 1GGDC 3K9XB 1AVXA 1V2MT 5EODA 3SV9A 3BG4C 3SQEE 2HALA 1S6FA 2PHBA 4M9FA 3P8GA 3DCLA 4ISOA 3FP7E 3ZZ5A 2UUKB 2R0LA 3F68H 4UE7H 4ASUD 2AGIX 2KCAA 1MCTA 2GD4B 4BAKB 5C2ZA 5KEDA 4IC5A 5ESTE 2IJD1 4GVUA 5C0TA 3Q3KA 4ABAA 5E0GA 5IYTA 3S7HB 3EA9A 4XD7D 4ABGA 1GBEA 2M5TA 3PLPA 1SGCA 2K0QA 3TITA 1K22H 1TGNA 4TSFD 1FIZA 1BOQA 1WOFA 2FTLE 5AFZH 1FAXA 5H4IB 1DY9A 1D3DB 5GXPA 2CN0H 1P2MA 4UFGH 3VGCB 1GI1A 1NRQH 2ZQ2A 3QTVH 3URCA 1MU8B 5FHTA 2R9PA 4YXWD 2H9TH 3N7DA 1S84A 2WYJA 3GYLB 1O3HA 1ORFA 1GBBA 2VINA 1UTQA 4DT7B 3MO3A 2V0BA 1AQ7A 2HNTE 4AOQA 1W0JD 3DT0H 5DP4A 1MTVA 4IN2A 1AIXH 1GJAB 3KHVA 1TNJA 1ID5H 1PPBH 2VIVA 1GG6B 3PMJA 3Q00A 1C1NA 1GMDG 1TGBA 2GCTB 1TMBH 1AE5A 2NU2E 5KECA 1O3BA 3BEIB 3V13A 1TE0A 1VKYA 4GCHG 1ABIH 1EJAA 3UWIA 1V2WT 1QFKH 1JIMA 1NBMD 1O3LA 2ZGHA 4M7GA 1SGRE 3ATKA 5ETXA 3SJ9A 3F9GA 1RTKA 1RIWC 3A81A 2A5KA 2H5DA 3UAIC 2J4IA 1C2EA 3RC4A 1QL8A 3TH4H 2FI3E 4FVDA 3E8LA 2XYAA 4FUIA 5FX5A 4CHAB 1GMCG 2C4FH 3ENSB 2G51A 1SOTA 3R0FA 5DP8A 5GCHF 1V2OT 1EZQA 1TGSZ 1V2UT 2W26A 4BAOB 3PM3A 3SORA 1KY9A 3IWMA 4ZHLU 2JIZD 5JBBS 2ZPSA 3OYPA 4RKJB 1DFPA 1GBCA 2GZ8A 2HLDD 1SLUB 1QQ4A 1C4Y2 1ESTA 2ZDKA 1HV7A 3WWFA 3SU5A 1MKWH 1K2I1 2Z9LA 1O2KA 3V7TA 1BMMH 4D9QA 5CHAC 3UQOA 3M36A 3H7TA 1Y5UT 1C4U2 1H1BA 2G00A 2QF0A 2WPIS 3JZ2B 1T32A 3A80A 1DDJA 1FQ3A 1V6DA 3SUEA 1CSOE 5C5NA 1ZJKA 3W1EA 1MU6B 3C27B 4JZIA 4AFUA 4JZEH 3NKKA 1EP6A 1ANDA 1S85A 1TPPA 4AN7A 4QT8C 3PTNA 4F49A 3EQ0H 2UWOA 1LKBA 3QX5H 3KQCA 1ELFA 3BIVH 1FMGA 1RS0A 3DFJA 5HKKD 3N7EA 1QL9A 2BYAX 9ESTA 2Z9KA 3LGVA 2G4UA 4E05H 1EXFA 1O0DH 3U8RH 2Q1JA 2XOKD 4BTIB 3RXUA 3LGIA 1S81A 2GV6A 5EW2H 2ZKSA 2IOTA 1MBMA 1CT0E 1S6HA 1C2KA 2BDYA 2GT8A 2Y5FA 1CQQA 4BANB 2R2WU 3ZZBA 2B9LA 1JWTA 1GI5A 1O3FA 3A8BA 2FOGA 3RXJA 1TPOA 1O2HA 2P8OC 1H9IE 1O3IA 2OLGA 5FBIA 1IQNA 1VGCC 1HAOH 2G4TA 5F03A 3SUFA 7ESTE 1HAXB 3RMOH 1QB1A 2XC4A 2HVXA 2ZG0H 2VVCA 2JH0D 3ATWA 1XXDA 4ACAA 4K1SA 1KSNA 2YMSD 1A1RA 5LPEA 1FV9A 2VGCB 1NS3A 1GHVH 4MTBA 2EC9H 2RA0A 3M3TA 2A0QB 1EAIA 1XM1A 2FOMB 1ANBA 3RXQA 2PGQB 3ZZ4A 5I46H 1RRKA 2KX4A 5JYIA 3M37A 3PLKA 2A5IA 2DE9A 1SQRA 1YPEH 1SGPE 2QXJA 1BZXE 3VXFH 1NRRH 3E3TA 2PTCE 4J1YA 3OY5U 4Y8ZA 4YOJA 1MQ6A 1W7GH 1SQAA 2P3FH 1HNEE 1UVUH 6CHAC 2FLRH 2FS9A 5T6DA 4I8KA 4NWLA 2W6ID 4YOGA 1ELGA 1K1NA 4YT6H 3SV8A 4HGCA 3S69A 1O32A 3SW2B 1ZSJA 2ZU3A 1F5LA 3P6ZB 1PPHE 4OS6A 2FMJA 2BXTH 4WF8A 4YOIA 5DP9A 1DLEA 5HIZA 3E6PH 1IQMA 2PTNA 1IQLA 3BV9B 1Y59T 4D7GA 3BTDE 3F9FA 3M5MA 7GCHF 1W0KD 1Z7KA 4ABFA 1BHXF 3KN2A 1F0RA 2STAE 4XDEA 1O3NA 1TNGA 1EKBB 5GPIB 4JMYA 4NIWA 1O2YA 2A45B 1P04A 3K65B 3MO9A 1LDTT 2IJOB 4GLYA 3U98H 3T62A 1C4V2 3GDUA 3BTQE 3PV4A 4YM9A 1CBWC 2P3UB 3SNAA 4WXVA 3LDXH 2GMTC 3A7WA 1EAUA 1W7XH 3ZZCA 2BY6X 5HM2A 2LPRA 3SZNA 1C5SA 3FAOA 2AMDA 1AD8H 1FLEE 1MD7A 1O38A 4IMZA 1C5NH 1P2NA 2A2QH 2UWPA 2VIOA 3UWJH 2BQWB 2ZQ1A 2FYRA 1YLCA 3RXDA 5ABWA 2AGEX 4UEHH 1W10U 3RLWH 3ZZ6A 1BMAA 3U8TH 3E1XB 5DP5A 1TONA 1G32B 5LPRA 1GBKA 1C1OA 3SNDA 3MU0A 2F3CE 4AZ2B 2NU1E 3RXBA 4FU7A 2EI7A 1YGCH 4H6TA 1O3AA 1CHOF 1T4UH 3RUOA 1BMFD 1P09A 2Z9IA 4I31A 2HNTF 3M5LA 4ISIH 1AGJA 4X2YA 3VB5A 3GY3A 5DN6D 2VIPA 4IGDA 2BD3A 4SGBE 1GBHA 4AG1A 5EJZA 2JETB 2YMSC 3ZZ9A 4K8YA 2VJ1A 1UVSH 2H6MA 1V2NT 1AWHB 3TJVA 3LIWA 2ANWA 3QK1A 2BQ7B 3PLBA 4MPWA 1HAIH 3R3GB 1UCYK 4Y71A 1QQUA 2BM2A 1F2SE 1UTKA 2IN2A 1UTJA 2J5UA 2FPZA 1P0SH 4TPYA 1GJ9B 3VXEH 1IHTH 3NPSA 1FY8E 1GHYH 1YKTA 2CMYA 2DUCA 5EW1H 2FOHA 3BG8A 4NSVA 2XNIA 4FXGH 4JK6A 1QHRB 2THFB 3ZVBA 2F91A 1W8BH 1GMHG 1D6WA 3SNBA 4FU9A 3RXIA 1GL0E 1E1QD 1IHSH 4AC9A 5A8YA 1HAYB 1AFQB 2BQ6B 5C3NA 1DS2E 1GCTB 3D23A 3GDVA 4INHA 2Y7XA 4XBCA 1X7AC 4NZLA 1XXFA 1EQ9A 2STBE 3QTOH 2XRCA 3SUGA 1LVBA 1FPCH 2GTBA 3MU4A 2GX4A 1O2JA 3RXCA 3VB4A 3EA8A 3RU4E 3AASA 3MH6A 2UUFB 1FIWA 3KF2A 4O9VA 2YNAA 1TRMA 1T7CA 1DICA 4CRDA 1CVWH 1YPLH 2BLOA 2ILNA 1GI7B 1UTOA 1BBRK 1ETRH 3LJOA 3LJJA 1MQ5A 2F9BH 2XWBI 3A8CA 3UB0A 3VB3A 5EQSA 2I6QA 1Y3XA 1TQ7B 4YESB 1SVPA 1G9IE 2ZTYA 1NESE 1V2LT 3MWIU 3KQEA 5F8ZA 4FUFA 5F8XA 1NRSH 5IDKA 4BTUB 1IQEA 1MKXK 2QIQA 1GBFA 1O3GA 1W14U 3MFJA 2SGQE 1SQTA 1NROH 4UFDH 3NWUA 1FUJA 1GMDF 4VGCC 1SOZA 1OWIA 5GNDA 4ISNA 3H5CB 1G36A 4GCHF 2ZCHP 4ZHAA 2BOHB 2VWOA 3RDZA 2OUAA 3HGNA 1GBTA 1SGTA 2OQ5A 1C9TA 4YZUA 2BVRH 3NK8A 3LGYA 5DJ7A 2HVYB 5JDUB 2J9NA 3SGQE 2CHAC 1AB9C 2IPQX 3C1KA 4B6EA 1AY6H 3SV6A 5CMXH 3KQ5A 1PQ8A 1GMCF 1Z71A 4FOUC 1Y8TA 1J15A 1W0YH 4MPUA 2ZHDA 2ZU1A 4Y7AA 1O5GH 1A61H 1PYTD 1TYNA 3D49H 2R3YA 3TK9A 4KTUA 2NWNA 4OGYA 5DP3A 2TGPZ 2WPLS 2GCHG 1QBVH 4X6MA 4O97A 1HJAB 3QUMP 4YLQH 1ARBA 1GJ7B 3ZVFA 1FNIA 1DSUA 1NPMA 1CA0B 4ZUHA 3CS0A 1QZ8A 2LNCA 3SOSA 1GVZA 5C5OA 2B7DH 1THRH 3ZZDA 2QA9E 2V3HH 3T28A 4A6LA 1SMFE 1GBLA 2BDIA 2CXVA 6GCHF 1VJ9U 2C3SA 3URDA 5C1UA 1LCYA 2ODPA 2V7QD 4GPGA 4KP0A 5SGAE 4FU8A 4FETA 2XTTB 1WUNH 3SV7A 3ESTA 2QY0B 3D62A 1PPFE 3RXEA 3T27A 1ESBA 2ZO3H 1D6RA 3ZVAA 2J34A 2WV5A 5T6GA 3RXFA 5JBTA 5DGJA 3E0NB 1J16A 1N1LA 2AERH 3I77A 2QCYA 4DT4A 3BSQA 1GI2A 2Z3CA 4X1NU 1J9CH 1N8OB 1Z1IA 4X1RU 1GDQA 1PPZA 1MCVA 2A4OA 3MHWU 3PWBA 3LC3A 2BX3A 1GHXH 1C1UH 1ZLRA 3SI3H 1TNIA 1C5OH 1V2RT 1AZZA 1K21H 3A86A 1LMWB 5GWZA 3AAUA 1O3PB 3UFAA 1TOCB 1ZRBA 2I6SA 3M61U 2XNDD 1G37A 4I8HA 2SFAA 4KGAA 1CO7E 1INCA 8KME2 1Z8IB 3BTTE 1K28D 2ZIQH 3CS7A 2P3TB 1KXBA 3BTME 1RGQA 3STJA 1TBQH 3SBKA 3SJOA 3NXPA 1K1IA 4RSPA 1SFQB 3TGIE 3BTKE 3Q77A 2RA3A 3BIUH 3OU0A 1GJCB 1A46H 2FM2A 2ZCLP 1ZPCA 1CE5A 2AMQA 2JKHA 1F0SA 3EYDA 3FANA 4MDSA 1V2VT 5A0BA 3ZZAA 3S9CA 1F0UA 4ZH8A 2OK5A 1VITH 1YM0A 2WPKS 4DIIH 5FPYA 2H2ZA 3FZZA 3PO1C 5E0JA 1JXPA 2ASUB 5FXLA 2F9NA 3QLPH 3K6ZA 5C1XA 2BTCE 4FVBA 3UOPA 2NU3E 1D3PB 3A7VA 4FUDA 2BDBA 3ODFA 4ZXYH 1TLDA 1WAYB 4U2WA 4WJG2 4AGJA 3W94A 5L2ZH 2Y6TA 3VGCC 2BB4A 3GY6A 1QRXA 2VVUA 1GI0A 3WW7A 4ZHMU 1Y3UA 4XOJA 1MUEB 4Z1MD 1EB2A 3SJIA 2WUCA 2PKAA 2GT7A 2BMGB 1P05A 4I7YH 2GDEH 1C5LH 2LELA 2W7SA 5C0UA 1QY6A 2WYGA 2W6JD 3GOVB 1BQYA 4IMQA 5FPSA 1AFEH 3B8JA 2FWWA 5AHGH 2BX4A 2A31A 1P2OA 5G4BA 1E34B 2GCTC 1QCPA 2J94A 1ANCA 4A1VA
chains in the Genus database with same CATH topology
1H9HE 1TNLA 2OCVB 1H4WA 4ZMAH 4D7FA 2ZFTA 1L2EA 3HKJB 3S0NA 1F5KU 5DG6A 1Z8RA 4UD9H 2ODQA 1BHXB 1O2MA 1OP0A 1SPJA 5CE1A 3HATH 1TAWA 3LGUA 4MPXA 1C5QA 2PFEA 1KXEA 3RXOA 1YCPH 2OBOA 1OS8A 4X2WA 2OTVA 4CHAC 1HJ8A 2Q6FA 1ELTA 1PPEE 4KKDA 2PKAB 3ZVCA 5DP6A 1ELAA 1MD8A 1O2LA 1P06A 5FAHA 1ZGIA 4ZROA 3G01A 1EAXA 1C2GA 3RMNH 4PROA 4UDWH 1A2CH 1JRTA 1QJ6B 1U6QA 3B9FH 1Z1JA 4ASHA 3V0XA 3RXGA 3KQBA 4TYDA 3S9AA 4A7IB 4CREA 6LPRA 6GCHG 4KTCA 1GI6A 3AW1A 1EOLA 4I8JA 5EU8A 4WH6A 1NFXA 5E2PA 1EJMA 1GPZA 3RC6A 1K1PA 3HKIB 4YLUA 4BXWA 2WPJS 4NIXA 1FONA 1GJ8B 4B2AA 1BRAA 3W95A 1MMJN 3Q3XA 1YLDA 1FZZA 1C2JA 2NU0E 3H7OA 1YYY1 2HGTH 1Y5AT 4ZAEA 2SNVA 1ZSLA 3P92A 3KGPA 2TPIZ 5DO4H 1NY22 3AW0A 1QA7A 1LPGB 1NU9A 1XUGA 2BVXH 1GMHF 1JRSA 1O2RA 2C8YB 1W3CA 3M3SA 1MTUA 3UNSA 3EE0B 3FFGA 1AE8H 4I8LA 1O2IA 1A0HB 4DIHH 4B73A 2Z6BD 1AU8A 1OOKB 2VWLA 3A7ZA 3STIA 1C5VA 4XFQA 4CRGA 1KXDA 3PMHB 3JZ1B 3VB6A 1RTFB 4TWYA 1O5AB 3LGWA 1F0TA 4I33A 1EB1H 5C67A 2VH6A 1P3EA 1FPHH 4JYTA 2HWLB 1B7XB 2Y5HA 7LPRA 1HBTH 2P95A 3VEQB 2VGCC 1O2OA 2WUBA 3M35A 4NZQA 3U8OH 4ESTE 3MNXA 3MYWA 4DGJA 3GCOA 2WPMS 1O3MA 3KCGH 5EQQA 1C1MA 3HK6B 2AS9A 1SLXB 3RMLH 2OBQA 1QTFA 2RCEA 1N6YA 2XCNA 4X0WU 3UR6A 3QWCH 4GSOA 2A7JA 1QGFA 1O39A 1HYLA 1SR5C 2BLQA 4Y8XA 3U69H 2GZ9A 1ZMNA 3KNXA 4GAWA 4MVNA 5TCAA 1VJAU 5EPNA 1SLVB 4MNXA 2FYQA 5EG4A 3CP7A 2ANMH 1GL1A 4OS1A 1O2WA 4ZKOU 1GBJA 4K3JA 1MTWA 3QN7A 1SGIB 4DURA 1V2PT 1LHDH 3QZQA 1GHAF 4OS2A 1V2TT 3Q3YA 1MKXH 3GY8A 5J4QA 1G3CA 3P95A 1TA6A 3TVJB 1EUFA 2SGFE 1ABJH 1BRBE 3A85A 2AIQA 1NFUA 1O2UA 1C5XB 1GJDB 5JBAS 2H5CA 3DA9B 1YPGH 3ZVEA 1LKAA 3AAVA 1ZJDA 1O2XA 2F9UA 1OWEA 2EA3A 2O9QA 1UJ1A 2ZECA 4K1TA 1O33A 1DUEA 1O30A 2BDGA 1LVMA 2RDLA 3GCHB 2VNTA 1SGFG 2GCHF 1E38B 4H6SB 2PGBB 4B74A 2PUXB 3RXTA 4DVAU 1VR1H 5A2MH 1GHZA 1HGTH 3P8OA 4BNRA 5E8EH 1QR3E 2VU8E 1L4DA 3TIUA 1JIRA 1QA0A 4NCYA 4MG3A 1TMTH 1K1MA 4XBDA 1O34A 1CT4E 5LGOA 4H42U 1A0LA 4LZ4B 2A4QA 1O2PA 1O5FH 3NUMA 2PUQH 1JBUH 1LVOA 2G5NA 2KAIA 1G2LA 2ODYB 2ZFFH 3I29A 1C5MD 1P2JA 2A4RA 1C1VH 3TPIZ 4INKA 2ZHQH 2ESTE 1PQ7A 2D1JA 2O8TA 3MI4A 1TALA 1BMLA 5A8ZA 1SC8U 1YF4A 3A7TA 1BA8B 2EEKA 1GDUA 2BD8A 3ZYEA 4BAQB 1MKWK 1WV7H 1UVTH 5A0AE 4ZKNU 3T29A 1DPOA 1YPJH 2JETC 2IPHA 3BTWE 2ALPA 2TBSA 1BMNH 2WPHS 1A0JA 5GJ4B 3L33A 2XBXA 1RFNA 1YPHE 2QN5T 1P2QA 3ATIA 2G55A 1C1SA 1EZUC 3FZDA 2ZFPH 1KXAA 1ETTH 2ZTZA 3RXRA 2HPQH 3MNSA 4ZXXH 3ZVGA 2H1UA 1IQIA 4X1SU 2BY5X 3A82A 2J92A 4NA9H 4Q7YA 2Y7ZA 2PKSB 2ZHWH 1ZHMA 1SBWA 2KAIB 1MTSA 2XBYA 3MH4A 1OKXA 2TGDA 2XXLA 2QXGA 3SU3A 4OS4A 2AEIH 3M7TA 2BDHA 3PYHA 1MH0A 3ATMA 3E0PB 1HXEH 2HPPH 5EOKA 3TLOA 3ZZ3A 1AFQC 1D4PB 2PSYA 5HM9A 1L4ZA 3UUZA 2FO9A 1ZPZA 1GCTC 1DM4B 1ZSKA 1KDQA 2OP9A 5K0HA 4JZDH 1C5RA 1QJ1B 1UK2A 4JZFH 5HGGA 3M5NA 1MTNB 1EZSC 2C8ZB 2W3IA 5F6MA 2VB0A 3E91A 3SHAH 1TPSA 4LOYH 1DWDH 1UO6A 4YO9A 3RP2A 1DWCH 2PR3A 1P02A 4AFQA 1RXPA 2Y5GA 2R0KA 1RJXB 3GDSA 4NGAH 1WYKA 3BEUA 3OX7U 3RXMA 1LQDB 1HLTH 2ZGXH 2XBVA 1SGFA 1XUHA 3WY8A 2AFQB 2PWXA 3RM2H 4A1TA 5GDSH 4AYYB 3PMBB 3TK5A 8LPRA 2FS8A 5EGMA 1HAPH 1AN1E 4E7RG 1HCGA 1T8OA 4Q7XA 1A4WH 3UNQA 1ELCA 2ZFQH 2W7UA 1FN8A 1GDNA 5JB8S 1WBGB 1UHBA 1SGDE 4JYVH 5K7RA 1WCZA 2GP9B 4JZ1A 1TGTA 1J14A 1KDQB 1E36B 5FCKA 1KXCA 3F9HA 1XVOA 1AKSA 2HRVA 1S0RA 2F9OA 4MNYA 1QURH 1XUKA 1ZTLA 2Z9GA 1TX8A 1WTGH 5TJXA 1NFWA 1IQHA 2F83A 4Z0KA 2BD9A 1GHAG 1AO5A 1A3EH 3PB1E 4Q2KA 2FIRH 4AB8A 1NC6A 1BDAA 1Z8JB 3LU9B 4NFEA 1L1JA 3B23B 8GCHF 1Z6JH 5EPYA 1C1TA 5EXMA 1HRTH 5ESBA 2XC0A 3U9AH 3SO3A 2VWNA 1EOJA 1DANH 1WSSH 3GCTG 1YBWA 4R8TB 3SU1A 1O5DH 3TNTA 1O3JA 1GBAA 1V2QT 4B76A 1O3DA 1TIOA 3PWCA 1BIOA 1ZR0A 1E35B 2QYIA 4FUCA 1HJAC 1UHBB 1NO9H 1ZTJA 2QAAA 3MU5A 1CA0C 9LPRA 1EPTA 3ZYDA 2OC0A 1W0ZU 3MOCA 4NG9H 1P3CA 1RTLA 1AKSB 1DWBH 4CRAA 2ZCKP 1MBQA 2ZF0H 3MTYA 5DK1A 3RXSA 3KIDU 2BDAA 3O8CA 2FX4A 1P2IA 3P8FA 1TX6A 1H9LB 1J17T 1VCPA 2HOBA 2Q6GA 4TY6A 1K1OA 1LTOA 3P8NA 2SGEE 4Y0ZE 1V3XA 4I8GA 2BY9X 2CV3A 2WINI 1OWDA 2PLXA 4DJZB 3KQDA 4WMDA 1XUJA 1G3DA 1N8OC 3GYMA 1B5GH 1IQKA 2BZAA 1F5RA 1GHWH 1GI8B 4NWKA 3M3VA 3QZRA 1TNHA 3TJNA 4GHQA 5AF9H 1RD3B 2FOAA 1C2FA 1DE7H 2FOEA 5FPTA 3SGAE 1SGQE 1P01A 1AUJA 2OC8A 2AMPA 1EPTB 2ALVA 1P57B 1KTTB 3GY5A 1DT2A 5L30H 2H9EH 1WQVH 1A5GH 5HYOA 2ZP0H 3UTUH 2GGVB 2ZPQA 4WMFA 2J95A 4LZ1H 3FP8E 3LGTA 1LHEH 2O8MA 1SGEE 1ZHRA 4HFPB 3GCNA 2D2DA 4Q7ZA 1DX5M 1P9UA 1FY5A 4Q80A 1P9SA 1EATA 2P16A 2PSXA 1L1NA 2FI4E 2BD4A 2P59A 1ZGVA 1GJ5H 3A84A 4FUHA 5DKMA 1S83A 4A92A 4X6OA 1AUTC 1XKBC 4Y10E 1AHTH 1W13U 2BY8X 3MH5A 1GWAA 3QO6A 1A7SA 4MPVA 4ABEA 5L2YH 3V3MA 4XSKU 4DG4A 1ANEA 4THNH 3A7YA 1M9UA 4BXSA 1H8IH 1UK4A 5A8XA 3O8RA 3RXHA 1ELEE 2A4GA 4IC6A 5EXNA 2CGAA 2FOFA 2AGGX 1GGDB 1DUAA 1HJ9A 3TJUA 3BG4B 1YCPM 1BTYA 4ABDA 1DXPA 1GVKB 2GDDA 1PYTC 2A32A 1B0FA 2ANKH 1ZMJA 3A89A 2O8LA 3PO1B 3A87A 3GISB 1ETSH 1HPGA 4F4OC 1VITF 2XW9A 4DW2U 5BRRE 2ZFRH 1OWJA 2B5TB 1SHYA 3LH1A 1CT2E 1TNKA 4E7NA 1GCDA 4B1TA 4XBBA 1TWXB 3EDXB 3RLYH 1G2MA 3S7KB 2C8WB 1O5BB 1GG6C 2FEQH 3SN8A 1ESAA 3HK3B 4Y8YA 3GY2A 4X6PA 1QRZA 1T8NA 3TH3H 1S82A 4FUGA 4CRFA 1ZTKA 4ISLA 1GI9B 2A7CA 1OP2A 1TX7A 2QGRA 2TGAA 1LHCH 2JH5D 2FXRA 2W5EA 4YTAA 3FP6E 1OXGA 4JCNA 1OYQA 1C9PA 2EI6A 5I25A 3NCLA 3BEFB 2ZDAH 4CBNA 8GCHG 1FY1A 4TPIZ 1SG8B 4K2YA 4X6NA 1PFXC 1UMAH 1BTUA 1DY8A 1SGNE 2UWLA 3QGNB 5GIBA 1HAGE 1DLKB 2GZ7A 1BT7A 1QNJA 2CF8H 1NZQH 1VCWA 2RG3A 1AVGH 1D9IA 1EZXC 1MZDA 2ZGJA 3M5OA 4NIVA 2YOLA 1A5IA 1RIWB 1T8LA 5BPEA 1XKAC 1KLJH 4D76A 2G5VA 2P93A 2XCFA 3BF6H 1TPAE 4Y79A 5A09A 1OP8A 1WU1A 3QDZB 3O8DA 2ZU2A 2A1DB 1AVWA 1LHFH 1H8DH 2A5AA 1EASA 2FP7B 2J38A 2NU4E 2HNTC 1XX9A 4K1EA 1BTPA 1GJ6A 1BTZA 2PW8H 4B75A 5EQRA 1EP5A 2ZI2H 1P03A 4J2YB 4X8VH 4TWWA 2H9HA 3RXKA 1NTPA 1NRNH 4MNVA 4CR9A 2ZA5A 2K1QA 3RU4T 3LKWA 4H4FA 1KLIH 1TMUH 2QF3A 5CHAB 1OSSA 4CRBA 4INLA 4WWYA 2QXHA 1FY4A 2SGDE 1QJ7B 3PTBA 3UR9A 3MNCA 2F9VA 1JMOH 1SSXA 1UCYH 1DOJA 3ELAH 1BB0B 1PPGE 1BJVA 4K60A 1C2LA 1HIAA 3P70B 1LQEA 1Y3VA 1TBRH 5L6NH 2XC5A 2A2XH 3KEEA 2C90B 1UK3A 1CGHA 4FUJA 4ISHH 4U30A 1O3OA 2ZC9H 4AX9H 4X1PU 3I78A 2FOBA 3S9BA 2OXSA 1CGJE 5TCCA 2ZFSA 3QGJA 1EJNA 1GHBG 2ANYA 3LPRA 3HPTB 4KELA 4WXIA 3LC5A 1GJ4H 1QB6A 1TFXA 1BTXA 6ESTA 2P8OB 1GI3A 3DFLA 1GVLA 3SJ8A 1C2DA 1TB6H 2GV7A 4BAHB 1VGCB 1MAXA 1V2KT 2ZU4A 8ESTE 1O2GH 1Y3WA 1W11U 4E06H 3AVZA 4CBOA 1VZQH 5FCRA 3V12A 1HIAB 1Y5BT 4X2VA 1BBRH 3UY9A 2TGTA 3GY4A 4DY7B 1VCQA 3RMMH 3K6YA 3VPKA 1OYTH 2FX6A 3A88A 4BOHA 4UONA 1HAHH 1C5PA 3NZIA 3TNSA 3E16B 1OX1A 1BITA 1GJBB 1YP9A 2D26C 3GY7A 2WV4A 1F7ZA 4AGKA 1VITG 2Z3DA 3LT3A 1BJUA 1O5EH 2OC7A 3EAJA 6CHAB 2GKVE 1SB1H 2UUJB 3GCTF 2FOCA 4JK5A 4ABHA 3LONA 2BVSH 1O2SA 1O3CA 1WQSA 1XUFA 3GCHC 1C5TA 2OC1A 3SJKA 4K5ZA 2Q6DA 2PV9B 1CGIE 5T3HA 3TK6A 1W2KH 3U1JB 4NA8A 3BTGE 3TGJE 4UFEH 1SI5H 3ATLA 1W12U 3SU2A 1O2ZA 1Y3YA 2B0FA 3T26A 2VWMA 3U1IB 4LXBH 3RM0H 3SUDA 3DUXH 4IS5A 1GBDA 4NIYA 5EXLA 3VB7A 1TBZH 3F6UH 1UVPA 2ZU5A 1ZPBA 2UUYA 2FLBH 5LPFA 2ZNKH 4IN1A 1ZRKA 4X1QU 1D3QB 3MO6A 2VVVA 4NFFA 3UREA 2XBWA 1K9OE 1YCPK 3TGKE 3OSYA 1NU7B 1P12E 1TA2A 4B2CA 1TGCA 2FZZA 1MZAA 1T31A 1THPB 2G81E 2VH0A 2C93B 3RC5A 1Q31A 1DSTA 1C5WB 3P17H 2BD7A 3T25A 1SFIA 1CBWB 1OWHA 3UIRA 5JB9S 2GMTB 4WH8A 1ZHPA 1E0FD 1KIGH 4WMEA 1ACBE 1TRYA 4XE4A 1P8VC 4X8SH 1C2HA 1IQJA 4OS5A 4MNWA 2D8WA 4HZHA 1ARCA 1IQFA 4UFFH 3DHKH 1C1PA 1C1RA 5GCHG 1UVOA 2FODA 1ZOMA 1O2VA 1SHHB 1HUTH 1Z8GA 1FDPA 4AB9A 3M7UA 4HTCH 4IBLH 5F8TA 3MU1A 3ODDA 3RU4D 1CU1A 4AORA 4U32A 4ZKSU 1V2JT 1O31A 3K2UA 1O37A 1O2TA 1O2QA 1JOUB 1V2ST 3L6PA 1PPCE 2PKSC 4O3UA 2ZHEH 1XMNB 2EI8A 1ELDE 1PQ5A 1Q2WA 1SLWB 3ZZ8A 1ZZZA 2SGPE 2XWAA 5AFYH 4CH2B 2O8WA 2SNWA 1AMHA 3UNRA 2GVFA 1P2KA 2QXIA 1CHGA 2R2MB 2G52A 3DD2H 3OTJE 2FDAA 4X8UH 1BCUH 4OS7A 3L3TA 3M7QA 4ABBA 5HXFA 2HLCA 3T5FH 1LPZB 1MTNC 3ZZ7A 3ZVDA 1AI8H 1UTLM 1KYNA 1HFDA 4MQAA 4WVPE 1EX3A 3BTFE 1LPKB 2CF9H 1J8AA 4AYVB 1BRCE 3IG6B 4B71A 3BTEE 4Y7BA 2OD3B 1NT1A 4AG2A 1P10A 4ZKRU 2B8OH 4Z6AH 2BOKA