3T29A

Tmao-grown trigonal trypsin (bovine)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t29A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t29A02
2ULLA 4YOIA 2FOGA 2H2ZA 4X6PA 2ALVA 2FOAA 2F91A 1P2OA 3P6ZB 2ZPSA 1ZR0A 1Q31A 2CHAB 1O2ZA 2QC2A 1GMDF 1D9IA 2O8TA 4SGAE 3ZZDA 3RU4E 2HNTF 3AW1A 3A7TA 1MU8B 1T4UH 1NROH 2VH6A 2BDIA 1V2TT 2FXRA 2P93A 2Z9KA 3U1JB 9ESTA 4FUFA 4B2AA 1QBNA 3WY8A 3KEEA 2OBQA 1Z8RA 2ODQA 1ANDA 2FDAA 5JBAS 3DHKH 5GWZA 5EPYA 3SJ8A 1DY9A 1GI9B 3TJVA 3Q77A 3RXEA 3F9EA 3SUEA 3MO3A 1TPPA 3ZVGA 1VR1H 2BMGB 4I8LA 2VIWA 1TMTH 1SGDE 3FVFB 3AW0A 1TABE 1BUIA 1KDQA 1P2QA 2NWNA 3A7WA 1O34A 1AFQB 1AE8H 2D1JA 1UHBA 1AGJA 3TH4H 1SMFE 4JK6A 1S0RA 1OWDA 1UVTH 2WUBA 5DGJA 3HPTB 4U32A 4TPIZ 1THRH 3E91A 3W94A 1Y3UA 3QX5H 1L0ZA 3OY6U 1OWIA 1O32A 1P05A 1ELEE 5FPSA 4FU8A 1BMMH 1W0YH 1GJBB 1EUFA 5LPFA 1AIXH 3GDSA 4X2YA 4ABAA 1ZHRA 4RKJB 2G4TA 2VIOA 3SU5A 4JYVH 3VFEA 1BIOA 1BQYA 1FJSA 3K9XB 3GCOA 1DANH 5CHAB 2KAIB 1IQHA 2Y5HA 1OS8A 1BA8B 2A7HA 1NU9A 1NRPH 4Y71A 1BRAA 3MU4A 2C3SA 3JZ2B 1TONA 1V2NT 1GBLA 4IN1A 4OS6A 1Z7KA 2Y5GA 1HJ9A 3TU7H 2JH6D 1F7ZA 3GY3A 1O3KA 1NO9H 5ETXA 3LKWA 2TGDA 1C5XB 1AZ8A 3Q3YA 4YT6H 5DP5A 3RU4T 1AO5A 4MNWA 3MU5A 5GDSH 2ASUB 5E2OA 3SHAH 3H7TA 1MZDA 3QLPH 1YF4A 4ABEA 2RA0A 3ZZCA 1C5QA 3F6UH 5TCCA 1ZJKA 2F9VA 5FPYA 4INLA 2XYAA 3SUFA 3GCNA 4O03A 2Y82A 2SFAA 1D3PB 4ZH8A 1SI5H 2FS8A 1ZLRA 1P11E 1DXWA 4ISLA 1WQSA 1DUAA 4BXSA 1AI8H 1AUJA 1WTGH 1XMNB 2AIQA 1T8MA 3SU4A 2FOBA 1G2LA 8GCHF 4D9RA 2JKHA 1ABJH 1LO6A 3MO6A 3V13A 3UY9A 1P12E 4AFQA 2BDAA 1O2GH 1UVUH 2ZHDA 1VJAU 5CHAC 3R0FA 1GBBA 1FY8E 1GVLA 1QB1A 3TK5A 3PYHA 1O5DH 3RXJA 2KAIA 3HKJB 1T8LA 3E90B 3ELAH 1W0ZU 5LH8A 1NU7B 1EJNA 3E16B 3GY6A 1CVWH 1SHHB 2FOCA 2ZCLP 4OS1A 1AB9B 1ELBA 2XC0A 1GBAA 1A0LA 1WQVH 4FXGH 2Z9IA 1HV7A 1FDPA 2WPLS 5AFZH 2WPMS 2V3HH 4MLFB 3NK8A 1TA6A 1C1VH 1Y3WA 1G3DA 4WY3A 2ZFPH 3E3TA 2FZZA 4DY7B 2ZTXA 2ZZUH 2BB4A 1UTMA 1O39A 1MBQA 1YGCH 5BRRE 1G3CA 2A5AA 1RGQA 4O3TA 2IPHA 4WF8A 1NTPA 5J4QA 2P3TB 4NA7A 2SGDE 1GHAG 2FTMA 2FYQA 3RXMA 1P09A 1CGJE 2G8TA 3EA9A 3GOVB 3KN2A 2QXGA 2FP7B 3ZZ8A 4FUHA 1WAYB 1W8BH 1MQ5A 5LGOA 1TX7A 4CBNA 2XC5A 1F5RA 1RD3B 1CGHA 1YCPM 1AFEH 3QN7A 1D6RA 1SGIB 1H9IE 2CMYA 2OC7A 2O8WA 3I29A 4BTUB 3S0NA 2GVFA 2AS9A 2WYGA 3SJOA 4THNH 1BRUP 2FX4A 3MOCA 1V2WT 2Y6TA 1GBMA 4NG9H 1HAZB 5EW2H 1TNHA 1GJCB 3SU6A 4WMDA 1O2OA 1O30A 1GG6C 1O2XA 1RJXB 2VWLA 2GTBA 1ZTJA 1ESAA 1UK4A 3UIRA 1INCA 3MO9A 2Z9JA 4JZ1A 4E06H 4CRAA 4I8GA 4ABHA 1HAOH 1V2MT 2IN2A 4KGAA 1FY4A 4ZROA 1V2KT 2HNTE 3RXFA 2UWLA 1Z1IA 3PTBA 1C4Y2 3Q00A 1EJMA 1V2LT 1O3LA 1SC8U 4D7GA 1V2PT 1C5SA 2GT7A 1B0EA 1G9IE 3BTEE 3K6YA 1QCPA 1KIGH 1BTWA 2FOMB 5DPAA 3S9CA 3KIDU 1W7GH 1G3BA 1ZMLA 1LMWB 6GCHF 3BTTE 1O2IA 1VITG 2GD4B 4INKA 2PTNA 5FCRA 3TIUA 2BDHA 4CR9A 5FX6A 1Q2WA 4Q7XA 1UCYK 3DFJA 1GGDC 2Y80A 3E0NB 4ABFA 1O3PB 4NIWA 1OXGA 1S81A 1S83A 2AERH 1BCUH 2ZHQH 2GCHG 3SV2H 1IQEA 2P94A 1LPZB 2Q1JA 3RMMH 4D76A 3P8FA 1P03A 1BBRH 2BLWA 5DJ7A 3MHWU 1YPMH 3BSQA 3SQHE 1TOCB 2P3UB 2B9LA 2VINA 1HAGE 1C1SA 4K69A 4A1XA 1GHXH 1ELAA 4RKOB 1MKXH 1T4VH 1O5EH 3RC4A 1LQDB 4YM9A 1O35A 5C1UA 3UR6A 2BX3A 3M5OA 1GHYH 2NU4E 1JIMA 1MCVA 1DOJA 3SV8A 4ZHLU 1J15A 2ZC9H 2CGAA 1NRSH 1QJ7B 4YOJA 3PWCA 1QL8A 1EAUA 5DP3A 1GI8B 2AEIH 2OC1A 4ZXYH 4CREA 5EU8A 1DT2A 1NRRH 1HJAB 2Z3EA 1LPKB 4MG3A 1S5SA 3MH5A 4AG2A 3A8BA 4FUGA 1NC6A 3GY5A 4AB8A 4Y8YA 4JCNA 2HWLB 2A2XH 4K1TA 4UD9H 1Y5BT 3ZZ7A 4SGBE 1CA8B 4JYTA 1C2HA 1HNEE 2SNVA 1C5TA 1QRXA 4K60A 1ACBE 3SBKA 1YC0A 1HCGA 1L4ZA 1K9OE 2PR3A 4TY7A 1DY8A 1MTWA 2GV7A 2YOLA 3RXIA 1GI6A 2XWBI 1A2CH 2IOTA 4KKDA 1LKBA 4M7GA 1DWCH 3SU1A 2FI5E 1FAKH 1Z8JB 1ZGVA 1IQKA 1BMNH 1O36A 1FNIA 1V2ST 1IQMA 1W11U 2GP9B 2VNTA 1K1MA 1C5YB 1P2NA 1FIWA 1QHRB 3RP2A 3S69A 5LPEA 2SGQE 4K1SA 1EJAA 1BRBE 1YLCA 1F2SE 2FOEA 2NU0E 2XNIA 4NFFA 3LJOA 5C5OA 3O8BA 1NESE 1U6QA 1D3DB 4AZ2B 3DFLA 3RXSA 1O3AA 2PW8H 2CN0H 1QQ4A 1TGBA 5JPMH 3PO1B 4KTUA 1IAUA 4KTCA 2BVSH 3FP7E 3ATLA 5FX5A 3ZZBA 4NFEA 1EZSC 1F0TA 3O8RA 3A81A 3F9FA 1VCWA 1EX3A 2FOFA 1X7AC 1AHTH 3TJOA 1ZMNA 1Q3XA 1IQFA 3GISB 2QXHA 4MDSA 4BAKB 3CS0A 1DITH 1O2PA 1B5GH 2NU3E 3MYWA 1A5IA 2QXIA 3BN9A 4MPWA 3RXQA 3EA7A 3C1KA 1OWHA 3KL6A 1NFYA 1S6FA 2HPPH 3PMAB 3VB6A 4XFQA 1JXPA 1YYY1 2STAE 3OY5U 3U98H 4TYDA 5T6DA 4KELA 1MQ6A 1GI5A 1ARCA 1CBWB 1V2RT 4RN6A 1ELTA 3RXKA 1WU1A 1SGNE 3ATMA 3ZV9A 1HAXB 3I78A 4NIVA 4X6OA 1SR5C 1KXDA 4Y7BA 3QDZB 3TGJE 1O2NA 1HAVB 3L33A 5C67A 2BDBA 3A85A 1YPEH 1ETSH 6CHAB 2Z3CA 1DWBH 5DO4H 1LDTT 1O2YA 2JETB 1IOEA 3ZZ3A 1BJUA 1GI2A 1O2MA 1QY6A 4NA9H 1PPEE 1C2JA 4MNYA 2ZTYA 1K1JA 4HGCA 2ZA5A 1IQNA 1C9PA 2J95A 1QBVH 1WCZA 1GMHF 2QF3A 3TGKE 2ZQ2A 1CHGA 1TQ7B 1SFIA 4CRGA 1CO7E 2G55A 4MPVA 3RXAA 1CE5A 1MUEB 2XCNA 1XKAC 5F8XA 2BXUH 2XWAA 1CT2E 4B74A 1EAIA 2H9TH 3ATKA 3SU2A 1O2QA 4Y10E 1BBRE 1ANEA 3A88A 1IQIA 1Z8GA 1ZMJA 2OQUA 4NGAH 4I31A 2ZHWH 1FI8A 3RXLA 2ZECA 4GHTA 4GCHG 5C5NA 3RUOA 3EGKH 3IG6B 3P8GA 4K1EA 1ELVA 2WINI 4MNVA 1D3TB 1HB0B 1MAYA 4Z6AH 1QQUA 1W2KH 3A84A 4IN2A 3ZVFA 1FQ3A 3FANA 3RMNH 1F0RA 5DK1A 1KLIH 3M7TA 2TRMA 5BPEA 1HAVA 1OX1A 4KTSA 2ZGBH 1SGCA 4DIIH 1GJ6A 3SU3A 2FTLE 2QIQA 3OX7U 3BG8A 4MTBA 1FZZA 3SV7A 1O2KA 3SI3H 3ZVEA 5C3NA 4GAWA 5L6NH 3M5MA 2ZDAH 2PTCE 5HXFA 3PMJA 4H42U 4BTTB 2VGCC 1ZGIA 1FPHH 1HRTH 3RXCA 1QL7A 3MI4A 2YNBA 5E2PA 1N6YA 4AGJA 3DUXH 5FCKA 2ZU4A 1GBEA 5HGGA 8ESTE 3FFGA 1C2KA 2Y7XA 2AGGX 2ZU5A 1TRNA 1HUTH 1P01A 5A8YA 1QJ1B 1C5ZB 3LU9B 1C5NH 1GDQA 1BT7A 1BHXF 2WUCA 2AMDA 4MNXA 3VB4A 2XC4A 1W10U 1V2UT 4DCDA 1CT0E 1GJ9B 3GYMA 2FI3E 1FPCH 2Z94A 4DT7B 3UNQA 1PYTC 1O3IA 3F68H 3RXBA 3RXOA 4DJZB 3GCTF 3W95A 3BG4B 3LONA 1WTHD 1DSUA 4NSYA 1PFXC 3M35A 6LPRA 1AVWA 1BOQA 3A82A 2OCVB 1UTJA 1GPZA 4IMZA 4K3JA 2OINA 1AD8H 1ETRH 3DA9B 5C1XA 2GMTB 1GMCG 3BTDE 4X2VA 3S9AA 1YKTA 2HGTH 2VIDA 2BQ7B 3V0XA 1QTFA 2C4FH 2O8LA 1NT1A 2LPRA 2SGEE 2C8YB 5A0BA 3NXPA 2BOHB 1GI1A 4X1QU 1Y5UT 2BY5X 2AGIX 1PYTD 2BM2A 2CHAC 1LHEH 5JBBS 1MD7A 1O3OA 2PSYA 3LDXH 2J34A 3SO3A 1A1RA 4CR5A 3ZVCA 4AFSA 4K5ZA 3Q76A 3U8OH 2W7UA 3SV6A 1SLUB 4BAMB 1MD8A 5DP9A 1HIAB 5FBIA 4JYUH 2GCTB 3A7YA 4OS2A 3SOSA 3T25A 5FAHA 1TBQH 3EAJA 1A61H 1SOZA 5AHGH 2EA3A 1N1LA 2ZWLH 2ILNA 3B9FH 1LVMA 4ISHH 3RU4D 1KXAA 1ORFA 5DP6A 1P9SA 1O2UA 4YLUA 3TJUA 5CMXH 1V2JT 2ZGHA 1HDTH 1AFQC 2ZFSA 4BNRA 3SU0A 4Z0KA 1BTXA 5GCHG 1W13U 2ODYB 3VB3A 5J4SA 1C2MA 1L4DA 1C2EA 3MMGA 3BV9B 1PPCE 4UEHH 1WV7H 1UCYH 2TIOA 1B0FA 2QV1A 5EXMA 1GBKA 1O3JA 1Z1JA 3KQDA 3HGPA 1QJ6B 4BAQB 1SLXB 1TPAE 3A7XA 3SUGA 4JMYA 1TGCA 3BEIB 3A83A 5DP8A 2W3IA 4NSVA 3MWIU 3PB1E 4CRBA 1XXFA 1GHWH 3M3TA 1ZRBA 2P95A 2F9OA 1TIOA 4B2CA 1EAXA 5AF9H 1O3CA 2B5TB 4O9VA 1HYLA 1SGFA 2XXLA 2ZI2H 5A09A 1F5LA 4GLYA 3V3MA 3VB7A 1SQTA 1W3CA 1AQ7A 1QB9A 2A4OA 4X8VH 2HALA 1TPSA 1F0SA 3U1IB 2A7JA 1OOKB 1ZHPA 1MCTA 4J1YA 3VGCB 5A0AE 3L6PA 2GZ8A 5JBTA 1O2WA 3SNAA 2WPKS 3MH4A 3RMLH 1NY22 2HPQH 3EQ0H 2G00A 1GBJA 1C5UA 3SJKA 3M7QA 4LOYH 2FLBH 1ZOMA 1QL9A 1DWDH 2BZAA 5EXNA 1XVMA 4Q2KA 2V3OH 3CP7A 4XBCA 5FHTA 1VCPA 4JK5A 1ZJDA 4ASHA 1P04A 3NZIA 2PWXA 1TWXB 1KXCA 3OTJE 4VGCB 3QK1A 4Y0ZE 1P10A 7GCHG 4OS5A 3QTOH 4WMFA 1TX6A 1DUEA 3ZV8A 4I8KA 1EOLA 4IGDA 2ZHEH 3LJJA 1ELGA 2Q6DA 1LVYA 1SGTA 2EC9H 5E0HA 4CHAB 4OGYA 1B7XB 3QGJA 4WXVA 1DFPA 1F92A 3NUMA 2V0BA 1O2TA 1YPKH 1GVZA 2F9UA 1AVGH 1IHSH 1SB1H 2B8OH 2CJIA 2ANYA 1SFQB 2ALPA 2PSXA 5F8TA 1CGIE 1YPHE 3M7UA 1SGPE 1TBRH 3TNTA 2D26C 2ZIQH 1BTHH 1AB9C 1P9UA 9LPRA 3BTGE 1G36A 4Y76A 5GPIB 4WJG2 1DSTA 1CT4E 3VGCC 1EPTB 1EZQA 5TJXA 5JBCS 1MTUA 4GHQA 3BEFB 1HAYB 2EI8A 1TX8A 1MTVA 1ZSJA 2F9NA 1Z6EA 3UOUA 1RIWB 2BHGA 1EXFA 1TYNA 1ZPBA 2OD3B 2O8MA 1WYKA 1F0UA 1O3FA 1OKXA 1JRSA 4ZHAA 2H9EH 4BANB 4MVNA 1AKSB 4A1TA 1SGRE 3PLPA 1O5FH 1VGCB 2I6QA 5K7RA 1TE0A 1TNJA 1OYQA 2ZPQA 3ZZ9A 3N7OA 1TNKA 1NRQH 1JRTA 1J14A 1DX5M 4X1SU 4B71A 1TRMA 1BHXB 5AFYH 2GKVE 2ZNKH 3LIWA 1WBGB 2Y7ZA 4CHAC 1LTOA 1GHAF 1N6XA 3ZZAA 1TQ0B 1XVOA 1UVSH 1PJPA 3A8AA 1D3QB 1UMAH 1LCYA 3HK3B 3H5CB 2TBSA 3M5LA 1O2JA 3D49H 1K2I1 3H7OA 1GHBG 2FYRA 1P3CA 1V2VT 1E37B 3ITIA 2G51A 3T26A 1NPMA 1GDNA 3M37A 1IQGA 1N8OB 1RTLA 2XRCA 1PPFE 3NPSA 1AN1E 1J16A 5I46H 2A4GA 2XBXA 5EXLA 4ZKRU 1QIXB 1SSXA 3GDVA 1LHDH 1SGFG 3JZ1B 1EPTC 3QZQA 4PROA 1W14U 1G3EA 5DG6A 2H5DA 2CF8H 1E35B 3RXUA 3MTYA 3FP8E 1EPTA 1A0JA 1UCYE 4AYYB 2V35A 1C1QA 2OTVA 3ODFA 2HNTC 2FMJA 4FUEA 5GJ4B 3PLBA 2CF9H 3RDZA 3ZYDA 1TPOA 1O5AB 3VXFH 4LXBH 2BY7X 1FY3A 3LGVA 3P70B 1GCTB 1O5CB 1C4U2 1A7SA 1BB0B 3LC3A 4ABGA 1AWFH 1ELCA 3Q3XA 4TWWA 2FM2A 2ESTE 5ESBA 1CU1A 5JB9S 2ZPRA 1THSH 2PLXA 1VJ9U 1ID5H 1ZPZA 1OYTH 4MPUA 4I33A 5ABWA 2BQ6B 3HKIB 3HGNA 1ETTH 1SPJA 3URCA 1SOTA 1LVOA 1W7XH 1C2FA 3KNXA 1H9HE 1GDUA 3MFJA 4A7IB 1VITF 3MH6A 2LNCA 1D4PB 3KQCA 4H6SB 5DP4A 5JYIA 3MU0A 4BOHA 4BAOB 3EA8A 1RXPA 2A5IA 2BOKA 1GWAA 1H1BA 2HRVA 3QWCH 4FUDA 4DVAU 3U69H 5EQRA 2Z9GA 3MH7A 2Q6GA 2GCHF 3ZVDA 2ANWA 2QAAA 1QRZA 5FBEA 1C5OH 2FLRH 2F83A 2RA3A 2TGPZ 4HZHA 2OLGA 1QURH 3E1XB 2J9NA 1DWEH 8LPRA 1K1LA 4K2YA 2HOBA 1MKWK 1C1UH 1UVPA 1VCQA 4YTAA 2FWWA 3TITA 3STIA 2A0QB 1YM0A 4UDWH 3RLYH 3NKKA 2WV4A 1CQQA 2VJ1A 2AFQB 2VWOA 1SHYA 1EAWA 2DE8A 4FUCA 1MAXA 2ZQ1A 5HMAA 4DGJA 1HAIH 1P2KA 3EDXB 4IS5A 5EPNA 4YLQH 3SQEE 1DVAH 1RTKA 1GBDA 1NZQH 1LVBA 1HJAC 3RC6A 2A1DB 3G01A 3T28A 1FN8A 5HYOA 4A5TS 3BTQE 3E0PB 1P57B 1V2QT 1JBUH 1OPHB 1A5GH 5PTPA 1C2LA 1VZQH 1UTQA 5B6OA 3A8DA 3ZVAA 4AYVB 4J2YB 3QUMP 2UUFB 1BRCE 1TNGA 1TOMH 1V3XA 4E05H 3PTNA 3U8RH 1V6DA 1GCDA 3URDA 3RC5A 3DD2H 3OU0A 4ZHMU 2R3UA 2O8UA 4BXWA 3RMOH 2K1QA 4BAHB 2W7SA 2VU8E 4A6LA 3FZDA 1QA0A 4MQAA 3NCLA 2GDEH 2J2UA 4IC5A 3HATH 1AU8A 4UFDH 4YZUA 4B2BA 4I32A 3SNBA 3GICB 3UNSA 4F4OC 1S0QA 4HFPB 4D9QA 1JWTA 1FY1A 2VB0A 3SNEA 3P92A 4LZ4B 3RXPA 5ESTE 1PPGE 1YCPK 1KLTA 1CHOG 1SLVB 3CENA 3PO1C 3RXTA 1KXEA 1Z71A 3T5FH 4ABBA 4AFUA 4B76A 2VVCA 2ZGCA 5C20A 3BIUH 2ZFRH 2J4IA 2Q6FA 1PPZA 1ZTKA 1IQJA 1AVXA 1O31A 1F5KU 1WOFA 3GY4A 5GIBA 2THFB 3O8DA 1QBOA 2C90B 1A4WH 2B7DH 1OSSA 2PKAB 1GJAB 1GMDG 2ZO3H 1GBIA 4XE4A 1SL3A 1WSSH 2GZ7A 2QN5T 4ZKSU 4IW4E 1GL1A 1BMAA 1CA0B 4KP0A 3UOPA 2GDDA 1RS0A 1O2RA 2H6MA 2ANMH 2CXVA 1K1OA 3BTWE 3PV4A 2FO9A 2D8WA 4I8JA 1UTKA 2H5CA 3B23B 3T29A 4FU9A 4XDEA 3SV9A 5EG4A 1CBWC 3GY7A 1OWKA 4DW2U 2AIPA 2M5TA 2BDYA 3P17H 4X1NU 4Y8XA 3A89A 3M5NA 3PLKA 4F49A 1H8DH 1PQ5A 2OQ5A 1UTLM 5E0GA 1C2IA 1O3NA 3SGBE 3SHCH 4Y11E 1E0FD 3QTVH 5GXPA 3AAVA 2EI6A 3PM3A 1SLWB 1K28D 3L3TA 1UHBB 1C5VA 2ZGXH 6CHAC 1GHVH 5JB8S 2R3YA 3LGYA 2JETC 5A8ZA 1C2DA 1C2GA 1MH0A 1SG8B 2AGEX 4JZEH 4Y6DA 3BTKE 4B1TA 3UQVA 1FY5A 1UK2A 2G5NA 3ZZ4A 4ISNA 1T8NA 1GI3A 3GY2A 3VPKA 2PUQH 4UFGH 4WWYA 4UFEH 5L30H 3D65E 3GCHB 1K1NA 3ZYEA 2RCEA 1O2HA 3STJA 2ZDVH 8KME2 2PKAA 1P8VC 3LOXA 4E7NA 5E0JA 4UFFH 2Z6BD 1CA0C 1RTFB 2VH0A 1QA7A 1PQ8A 3HK6B 3M3VA 2PFEA 2F3CE 1ELDE 1P02A 2P16A 5F6MA 1NFUA 1TNLA 1A5HA 2A4RA 3UR9A 1FV9A 2AYWA 4YT7H 3UNRA 3LT3A 2ZG0H 2W3KA 4X0WU 3LH3A 1KTSB 4YESB 3MNSA 2OUAA 3AASA 2VWNA 2ZU1A 1YBWA 5JDUB 2UUKB 2ZTZA 1L1NA 2BD9A 3AVZA 4X1RU 3QZRA 4E7RG 3RM2H 1T31A 2ZCKP 2R2MB 1C5MD 2ZKSA 4ABJA 3OYPA 1TAWA 4GCHF 2BY8X 3LGUA 2BD2A 1O3EA 4A1VA 1SGYE 4A92A 3C27B 2VWMA 4OGXA 4K8BA 5FPTA 2BVRH 4CH8B 3QGNB 1L1GA 4FUJA 4I8HA 1ANCA 1KYNA 2G81E 2SNWA 3V7TA 1PQAA 4MPXA 4BTIB 2NU2E 4CBOA 5TCAA 1OWJA 3TH2H 4GSOA 2Z9LA 1ZPCA 8GCHG 1FN6A 3ZVBA 4AGKA 3ZZ6A 2AH4X 3SW2B 2ZHFH 1HXEH 1GVKB 1EB2A 3GCHC 1LHCH 4ESTE 1P3EA 3KQEA 3BIVH 4CRCA 1TMUH 1K21H 1K1IA 2BD4A 2FPZA 2WPHS 3UFAA 1TRYA 2PHBA 1J8AA 2WV5A 3A80A 1RFNA 4OS7A 2VIPA 1ZSKA 3K65B 3ATWA 3MNCA 2TGAA 3MNXA 2F9BH 1H9LB 4HI3A 5F03A 5IDKA 4U2WA 3FAOA 1C4V2 2W26A 3D23A 3GYLB 1K1PA 1GI0A 2G4UA 3BG4C 4UE7H 1MU6B 4AFZA 5F8ZA 1LQEA 1XUIA 3MNBA 2A31A 3KCGH 2FX6A 4X2XA 1SQAA 2BY6X 3M3SA 2GGVB 3KF2A 2GMTC 3P95A 1XXDA 1S6HA 2ANKH 2J92A 1SQOA 3EE0B 4X6NA 3RXRA 5DP7A 1TGNA 1GMCF 2W5EA 3FZZA 1V2OT 1KTTB 3SGQE 3TH3H 2A5KA 2ZP0H 4FVBA 1JMOH 4X8SH 3LPRA 1YPLH 7KMEH 1AMHA 1P2IA 1QGFA 2FI4E 2ODPA 2BVXH 1UO6A 1EKBB 1O3GA 2PGQB 2BX4A 2OC8A 1HBTH 3LGWA 1TB6H 2HVXA 3V12A 3SZNA 1UVOA 2C8ZB 2P8OB 3A86A 4JZIA 4ZKOU 2P59A 1AE5A 3M61U 1NFXA 1GI7B 2GCTC 2ZFFH 2WYJA 3ODDA 3CS7A 1Y8TA 1HIAA 1YP9A 1OP2A 1QRWA 3RLWH 4O3UA 2QA9E 1C5LH 3UREA 1C9TA 1MTSA 1RRKA 4AB9A 1A46H 1TMBH 3SN8A 3ESTA 3S9BA 4H4FA 1GG6B 3RXGA 1GJ4H 4H6TA 1TFXA 1ZTLA 3NWUA 4NIXA 1WUNH 3BTME 4ZXXH 2TPIZ 1BJVA 4RSPA 3E6PH 4JZFH 5GCHF 1XUJA 1ZZZA 4X8UH 4ZAEA 5IYTA 2ZFTA 1MBMA 3GDUA 3BTFE 1TLDA 4D7FA 3MU8A 4QT8C 3RXHA 1FMGA 1Y3XA 3BF6H 3K6ZA 4YO9A 3TLOA 3U8TH 1C5RA 1P0SH 2VIVA 1H4WA 4X6MA 2FOHA 1S82A 4CRDA 4X2WA 1O3MA 1C5PA 2FEQH 2SGFE 3SNCA 1THPB 2VIQA 5EGMA 1Y5AT 1G2MA 1G32B 6GCHG 1DLEA 1EQ9A 2VVUA 2GZ9A 4NIYA 3P8OA 1O38A 2XW9A 1MKWH 1C1WH 2P8OC 1NRNH 2P3FH 1A3BH 2ZU2A 1S84A 2G5VA 4NZLA 2EEKA 1ABIH 3SJ9A 1GGDB 5CE1A 5EQSA 1IHTH 5DKMA 4Y7AA 1HGTH 4IMQA 2ZU3A 4FVDA 1GBFA 1O3HA 1TGSZ 1GBCA 1MZAA 3KGPA 1C1OA 1GL0E 2NU1E 2RDLA 2XBVA 3A8CA 2BLQA 1DXPA 4D8NA 1XUFA 1TA2A 1O3DA 1SVPA 2FODA 1JOUB 2O9QA 3LGTA 1P2JA 4R8TB 4WMEA 4XBBA 1GBHA 2D2DA 2ZDNA 4VGCC 3R3GB 1BTPA 2BLOA 2QY0B 1E36B 1GJDB 3I77A 2CV3A 1ZHMA 7GCHF 5A0CA 1L2EA 1H8IH 2IJOB 1AUTC 1ARBA 5LPRA 2PKSB 1DE7H 3E8LA 1M9UA 3K2UA 1O33A 2BLVA 3PROA 4U30A 1SBWA 2ZF0H 1HFDA 4ZUHA 3LH1A 2XTTB 1HXFH 2Y81A 1C5WB 5HM2A 2ZEBA 3OSYA 2BD3A 3UUZA 3UWJH 2ZDMA 1XM1A 5EODA 1YPHC 2J94A 4NCYA 3RM0H 1TBZH 1ZRKA 2GT8A 1SGEE 1YCPH 2YNAA 2ZDLA 4FUBA 3RXVA 2QCYA 4IBLH 3TNSA 4WXIA 2A45B 4ISOA 2I6SA 4LK4A 1IQLA 4Q7ZA 1FIZA 2C8XB 1Z6JH 4XBDA 4I7YH 2BYAX 1ESTA 1HPGA 1RIWC 1MTNB 1O37A 2A2QH 1AZZA 4ABDA 5EW1H 2R0LA 3PMHB 3A87A 1QB6A 1G37A 3FP6E 4AORA 3S7HB 4LZ1H 1YPGH 1VGCC 4IC6A 4AN7A 1AKSA 2RG3A 4K8YA 1QFKH 2UUYA 5A8XA 2BDGA 2SGPE 2BXTH 2BD5A 2BDCA 2XBWA 3D62A 3T62A 3IITA 2OXSA 2PKSC 1EP6A 2Z3DA 1DICA 1FONA 5HM9A 3SGAE 2XCFA 4NA8A 3M36A 2FIRH 4YOGA 5T3HA 2A32A 2DE9A 4TY6A 1O2SA 1GHZA 2B0FA 3ZZ5A 2G52A 3T2NA 1LPGB 4WVPE 1UTNA 2JH0D 4TPYA 1GHBF 2DUCA 1N8OC 1UTOA 1T32A 1BITA 4DOQA 2BY9X 1A3EH 1BTYA 2ZFQH 2F9PA 3KQBA 3BEUA 1OWEA 3SUDA 3SNDA 1S85A 1GI4A 3TK9A 1DLKB 1OP8A 2PV9B 1UTPA 5L2YH 4XSKU 4ZMAH 7LPRA 4GVUA 7ESTE 3VB5A 2EI7A 3TGIE 1KXFA 1T8OA 1Y3VA 4X8TH 5H4IB 3F9HA 1MTNC 2C93B 1E34B 2FS9A 1KLJH 1EB1H 1ESBA 3RXDA 1AY6H 3UQOA 1PPBH 4NWKA 4AX9H 2UWPA 3TPIZ 4TWYA 1C1MA 4XOJA 1O2LA 1GJ8B 4R0IA 1Y59T 4B75A 2SGAA 1XUKA 1GCTC 1HLTH 1O0DH 2QF0A 2WPIS 2TGTA 1QR3E 1O5BB 1FUJA 1W12U 1UK3A 4UONA 5L2ZH 2R9PA 2OC0A 3BTHE 4Y79A 1GMHG 1VITH 4CH2B 1P2MA 1AWHB 2J38A 3VEQB 3ENSB 1DDJA 5I25A 1TNIA 4FUIA 2ZGJA 2ZCHP 3PWBA 2QGRA 2BQWB 3UTUH 1C1PA 1EOJA 4FU7A 2QXJA 1OP0A 2H1UA 1JIRA 1UJ1A 3TK6A 4ABIA 1DPOA 1EATA 1EZXC 1QNJA 2V6NA 4WH6A 1BMLA 2BD7A 5C2ZA 3AAUA 1PPHE 1EP5A 2XBYA 4O97A 2PGBB 5C1YA 1ZSLA 1GJ7B 1XUHA 5T6FA 2A4QA 1BTZA 1BDAA 1J17T 1DS2E 2OP9A 2Y5FA 1HJ8A 3P8NA 4X1PU 2H9HA 3O8CA 4NWLA 1YLDA 1HAPH 3B8JA 1A0HB 3LC5A 3Q3KA 1NM6A 4INHA 1J9CH 5EQQA 3F1SB 3PMBB 1BZXE 4B73A 4WH8A 1SGQE 3TJNA 3UWIA 3A7VA 1Z8IB 1HAHH 3F9GA 3S7KB 1GBTA 1KSNA 2JH5D 2QYIA 3IWMA 2Z7FE 1C1RA 2UUJB 4DG4A 1LHFH 1BTUA 2OBOA 2A7CA 2VVVA 3UPEA 1O2VA 2GX4A 3QO6A 4CRFA 1O3BA 2AMPA 5T6GA 1XX9A 2ZDKA 3T27A 2BTCE 1PQ7A 1KY9A 1MMJN 4AOQA 3ATIA 1FXYA 1Y3YA 1BBRK 3MU1A 5EOKA 3A7ZA 1YPJH 2R2WU 4HTCH 3U9AH 5K0HA 4ZKNU 4OS4A 1KXBA 2C8WB 1FAXA 5SGAE 2VGCB 3GY8A 4NZQA 1NS3A 2WPJS 1CSOE 4Q80A 1EZUC 2UWOA 6ESTA 3KHVA 1MKXK 3VXEH 1XUGA 2BD8A 3EYDA 1L1JA 4Y8ZA 1LKAA 4ISIH 1ZYOA 4Q7YA 2R0KA 5AVDA 1O5GH 5A2MH 1E38B 4AG1A 4Y0YE 4DIHH 1ELFA 4JZDH 1FLEE 1XKBC 1G30B 2AMQA 1KDQB 3LGIA 1K22H 3GCTG 5E8EH 2PUXB 3SJIA 1C1TA 1GJ5H 1TALA 3DT0H 1P06A 3SI4H 5FXLA 1ANBA 3SORA 2GV6A 2FESH 4GUXA 1NN6A 1C1NA 1EASA 1LHGH 1NFWA 1TGTA 4DURA 1D6WA 4GPGA 2BZ6H 3TVJB 1DM4B 1T7CA 5G4BA 1CHOF 2HLCA 4U01A 2STBE
chains in the Genus database with same CATH superfamily
2ULLA 4YOIA 2FOGA 2H2ZA 4X6PA 2ALVA 2FOAA 2F91A 1P2OA 3P6ZB 2ZPSA 1ZR0A 1Q31A 2CHAB 1O2ZA 2QC2A 1GMDF 1D9IA 2O8TA 4SGAE 3ZZDA 3RU4E 2HNTF 3AW1A 3A7TA 1MU8B 1T4UH 1NROH 2VH6A 2BDIA 1V2TT 1SKYE 2FXRA 2P93A 2Z9KA 3U1JB 9ESTA 4FUFA 4B2AA 1QBNA 3WY8A 3KEEA 2OBQA 1Z8RA 3DSGA 2ODQA 1ANDA 2FDAA 4TT3D 3ZIAD 5JBAS 3DHKH 4B6FA 5GWZA 5EPYA 3SJ8A 1DY9A 1GI9B 3TJVA 3Q77A 3RXEA 3F9EA 3SUEA 3MO3A 1TPPA 3ZVGA 1VR1H 2BMGB 4I8LA 2VIWA 1TMTH 1SGDE 3FVFB 3AW0A 1TABE 1BUIA 1KDQA 1P2QA 2NWNA 3FKSD 3A7WA 1O34A 1AFQB 1AE8H 1NBME 2D1JA 1UHBA 1WDIA 1AGJA 3TH4H 1SMFE 4JK6A 1S0RA 1OWDA 1UVTH 2WUBA 5DGJA 3HPTB 4U32A 4TPIZ 1THRH 3E91A 3W94A 1Y3UA 3QX5H 1L0ZA 3OY6U 1OWIA 1O32A 1P05A 1ELEE 5FPSA 4FU8A 1BMMH 1W0YH 1GJBB 1EUFA 5LPFA 1AIXH 3GDSA 4X2YA 4ABAA 1ZHRA 4RKJB 2G4TA 2VIOA 3SU5A 4JYVH 3VFEA 1BIOA 1BQYA 1FJSA 3K9XB 3GCOA 1DANH 5CHAB 2KAIB 1IQHA 2Y5HA 1OS8A 1BA8B 2A7HA 1NU9A 1NRPH 4Y71A 1BRAA 3MU4A 2C3SA 2JIZD 3JZ2B 1TONA 1V2NT 1GBLA 4IN1A 4OS6A 1Z7KA 2Y5GA 1HJ9A 3TU7H 2JH6D 1F7ZA 3GY3A 1O3KA 1NO9H 4RI0A 5ETXA 3LKWA 2TGDA 1C5XB 1AZ8A 3Q3YA 4YT6H 5DP5A 3RU4T 5EJ1A 2WHXA 1AO5A 4MNWA 3MU5A 5GDSH 2ASUB 5E2OA 3SHAH 3H7TA 1MZDA 3QLPH 1YF4A 4ABEA 2RA0A 3ZZCA 1C5QA 4Q63A 3F6UH 5TCCA 1ZJKA 2F9VA 5FPYA 2XOKD 4INLA 2XYAA 3SUFA 3GCNA 4O03A 2Y82A 2SFAA 1D3PB 4ZH8A 1SI5H 2FS8A 1ZLRA 1P11E 1DXWA 4ISLA 1WQSA 1DUAA 4BXSA 1AI8H 1AUJA 1WTGH 1XMNB 2AIQA 2KCYA 1T8MA 3SU4A 2FOBA 1G2LA 8GCHF 4FETA 4D9RA 2JKHA 1ABJH 3F3BA 1LO6A 3MO6A 3V13A 3F0PA 5KEDA 3UY9A 1P12E 4AFQA 2BDAA 1O2GH 1UVUH 2ZHDA 1VJAU 5CHAC 3R0FA 1GBBA 1FY8E 1GVLA 1QB1A 3TK5A 3PYHA 1O5DH 3RXJA 2KAIA 3HKJB 1T8LA 3E90B 3ELAH 1W0ZU 5LH8A 1NU7B 1EJNA 3E16B 3F2GA 3GY6A 2YMSB 1CVWH 1SHHB 2FOCA 2ZCLP 3NRLA 2KX4A 4OS1A 1AB9B 1ELBA 2XC0A 1GBAA 1A0LA 3U28C 1WQVH 4FXGH 2Z9IA 1HV7A 1FDPA 2WPLS 5AFZH 2WPMS 2V3HH 4MLFB 3NK8A 1TA6A 1C1VH 1Y3WA 1G3DA 4WY3A 2ZFPH 3E3TA 2FZZA 4DY7B 2ZTXA 4TSFD 2ZZUH 2BB4A 1UTMA 1O39A 1MBQA 1YGCH 5BRRE 1G3CA 2A5AA 1RGQA 4O3TA 2IPHA 2J98B 4WF8A 1NTPA 5J4QA 2P3TB 4NA7A 2SGDE 1GHAG 2FTMA 2FYQA 3RXMA 1P09A 1CGJE 2G8TA 3EA9A 3GOVB 3KN2A 2QXGA 2FP7B 3ZZ8A 4FUHA 1WAYB 1W8BH 1MQ5A 2F43B 5LGOA 1TX7A 4CBNA 2XC5A 1F5RA 1RD3B 1CGHA 1YCPM 1AFEH 3QN7A 1D6RA 1SGIB 1H9IE 2CMYA 2OC7A 2O8WA 3I29A 4BTUB 5IK2D 1W0JD 3S0NA 2GVFA 2AS9A 2WYGA 3SJOA 4THNH 1BRUP 2FX4A 3MOCA 1V2WT 2Y6TA 3VG8A 1GBMA 2YMSC 4NG9H 1HAZB 5EW2H 1TNHA 1GJCB 3SU6A 4WMDA 2HLDD 1O2OA 1O30A 1GG6C 1O2XA 1RJXB 2VWLA 2GTBA 1ZTJA 1ESAA 1UK4A 3UIRA 1INCA 3MO9A 2Z9JA 4JZ1A 4E06H 4CRAA 4I8GA 4ABHA 1HAOH 1V2MT 2IN2A 4KGAA 1FY4A 4ZROA 1V2KT 2HNTE 3RXFA 2UWLA 1Z1IA 3PTBA 1C4Y2 3Q00A 1EJMA 1V2LT 1O3LA 1SC8U 4D7GA 2WZQA 1V2PT 1C5SA 1S6LA 2GT7A 1B0EA 1G9IE 3BTEE 3K6YA 1QCPA 1KIGH 1BTWA 2J98A 2FOMB 5DPAA 3S9CA 3KIDU 1W7GH 3AK5A 1G3BA 1ZMLA 3KYFA 1LMWB 6GCHF 3BTTE 1O2IA 1VITG 2GD4B 4INKA 2PTNA 5FCRA 3TIUA 2BDHA 4CR9A 5FX6A 1Q2WA 4Q7XA 1UCYK 3DFJA 1GGDC 2Y80A 3E0NB 4ABFA 1O3PB 4NIWA 1OXGA 1S81A 1S83A 2AERH 1BCUH 2ZHQH 2GCHG 3DCLA 3SV2H 1IQEA 2P94A 1LPZB 2Q1JA 3RMMH 4D76A 3P8FA 1P03A 1BBRH 2BLWA 5DJ7A 3MHWU 1YPMH 3BSQA 3SQHE 1TOCB 2P3UB 2B9LA 2VINA 1HAGE 1C1SA 4K69A 4A1XA 1GHXH 1ELAA 4RKOB 1MKXH 1T4VH 1O5EH 3RC4A 1LQDB 4YM9A 1O35A 5C1UA 3UR6A 2BX3A 3M5OA 1GHYH 2NU4E 1JIMA 1MCVA 1DOJA 3SV8A 5F53A 2KM0A 2JJ2D 4ZHLU 1J15A 2ZC9H 2CGAA 1NRSH 1QJ7B 4YOJA 3PWCA 1QL8A 1EAUA 5DP3A 1GI8B 2AEIH 2OC1A 4ZXYH 4CREA 5EU8A 1DT2A 1NRRH 1HJAB 2Z3EA 1LPKB 4MG3A 1S5SA 3MH5A 4AG2A 3A8BA 4FUGA 1NC6A 3GY5A 4AB8A 4Y8YA 4JCNA 2HWLB 2A2XH 4K1TA 4UD9H 1Y5BT 3ZZ7A 4SGBE 1CA8B 4JYTA 1C2HA 1HNEE 2SNVA 1C5TA 1QRXA 4K60A 1ACBE 3OEHD 3SBKA 1YC0A 1HCGA 1L4ZA 1K9OE 2PR3A 4TY7A 1DY8A 1MTWA 2GV7A 2YOLA 3RXIA 1GI6A 2XWBI 1A2CH 2IOTA 4KKDA 1LKBA 4M7GA 1DWCH 3SU1A 2FI5E 1FAKH 1Z8JB 1ZGVA 1IQKA 1BMNH 1O36A 1FNIA 1V2ST 1IQMA 1W11U 2GP9B 2VNTA 1K1MA 1C5YB 1P2NA 1FIWA 1QHRB 3RP2A 3S69A 5LPEA 2SGQE 4K1SA 1EJAA 1BRBE 1YLCA 1F2SE 2FOEA 2NU0E 2XNIA 4NFFA 3LJOA 5C5OA 3O8BA 1NESE 1U6QA 1D3DB 4AZ2B 1K0HA 3DFLA 3RXSA 1O3AA 2PW8H 2CN0H 1QQ4A 1TGBA 5JPMH 3PO1B 4KTUA 1IAUA 4KTCA 2BVSH 3FP7E 3ATLA 5FX5A 3ZZBA 4NFEA 1EZSC 1F0TA 3O8RA 3A81A 3F9FA 1VCWA 1EX3A 2FOFA 1X7AC 1AHTH 3TJOA 1ZMNA 1Q3XA 1IQFA 3GISB 2QXHA 4MDSA 4BAKB 3CS0A 1DITH 1O2PA 1B5GH 2NU3E 3MYWA 1A5IA 2QXIA 3BN9A 4MPWA 3RXQA 3EA7A 3C1KA 1OWHA 2QE7D 3KL6A 1NFYA 1S6FA 2HPPH 3PMAB 3VB6A 4XFQA 1JXPA 1YYY1 2STAE 3OY5U 3U98H 4TYDA 5T6DA 4KELA 1MQ6A 1GI5A 1ARCA 1CBWB 4F48B 1V2RT 4RN6A 1ELTA 3RXKA 1WU1A 1SGNE 3ATMA 3ZV9A 1HAXB 3I78A 4NIVA 4X6OA 1SR5C 1KXDA 4Y7BA 3QDZB 3TGJE 1O2NA 1HAVB 3L33A 5C67A 2BDBA 3A85A 1YPEH 1ETSH 6CHAB 2Z3CA 1DWBH 5DO4H 1LDTT 1O2YA 2IJD1 1IOEA 2JETB 3ZZ3A 1BJUA 1GI2A 1O2MA 1QY6A 4NA9H 1PPEE 1C2JA 2IPQX 4MNYA 2ZTYA 1K1JA 4HGCA 2ZA5A 4P02A 1IQNA 4ACAA 1C9PA 2J95A 1QBVH 1WCZA 1GMHF 2QF3A 3FOAA 3TGKE 2ZQ2A 1CHGA 1TQ7B 1SFIA 4CRGA 1CO7E 2G55A 4MPVA 3RXAA 1CE5A 1MUEB 2XCNA 1XKAC 4XRNA 5F8XA 2BXUH 2XWAA 3EE7A 1CT2E 4B74A 1EAIA 2H9TH 3ATKA 3SU2A 3OTPA 1O2QA 4Y10E 1BBRE 1ANEA 2L6OA 3A88A 1IQIA 1Z8GA 1ZMJA 2OQUA 3N7DA 4NGAH 5T1VA 4I31A 2ZHWH 1FI8A 3RXLA 2ZECA 4GHTA 5B6LA 4GCHG 5C5NA 3RUOA 3PRBA 3EGKH 3IG6B 3P8GA 4K1EA 1ELVA 4XD7D 2WINI 4MNVA 1D3TB 1HB0B 1MAYA 4Z6AH 1QQUA 1W2KH 3A84A 4IN2A 3ZVFA 1FQ3A 3FANA 3RMNH 1F0RA 5DK1A 1KLIH 3M7TA 2TRMA 5BPEA 1HAVA 1OX1A 4KTSA 2ZGBH 1SGCA 4DIIH 1GJ6A 3SU3A 2FTLE 2QIQA 3OX7U 3BG8A 4MTBA 1FZZA 3SV7A 1O2KA 3SI3H 3ZVEA 5C3NA 4GAWA 5L6NH 3M5MA 2ZDAH 2PTCE 5HXFA 3PMJA 4H42U 4BTTB 2VGCC 1ZGIA 1FPHH 1HRTH 2EY4C 3RXCA 1QL7A 3MI4A 2YNBA 4Q4LA 5E2PA 1N6YA 4AGJA 3DUXH 5EIYA 5FCKA 2ZU4A 1GBEA 5HGGA 8ESTE 3FFGA 1C2KA 2Y7XA 2AGGX 2ZU5A 1TRNA 1HUTH 1P01A 5A8YA 1QJ1B 1C5ZB 3LU9B 1C5NH 2HVYB 1GDQA 1BT7A 1BHXF 2WUCA 2AMDA 4MNXA 3VB4A 2XC4A 1W10U 1V2UT 4DCDA 1CT0E 1GJ9B 3GYMA 5KGOA 2FI3E 1FPCH 2Z94A 4DT7B 3UNQA 1PYTC 1O3IA 3F68H 3RXBA 3RXOA 4DJZB 3GCTF 3W95A 3BG4B 3LONA 1WTHD 1DSUA 4NSYA 1PFXC 3M35A 6LPRA 1AVWA 1BOQA 3A82A 2OCVB 1UTJA 1GPZA 4IMZA 4K3JA 2OINA 1AD8H 1ETRH 3DA9B 5C1XA 2GMTB 1GMCG 3BTDE 4X2VA 3S9AA 1YKTA 2HGTH 2VIDA 2BQ7B 3V0XA 5GNDA 1QTFA 2C4FH 2O8LA 1NT1A 1FX0B 2LPRA 2SGEE 2C8YB 5A0BA 3NXPA 2BOHB 1GI1A 4X1QU 1Y5UT 2BY5X 2AGIX 1PYTD 2BM2A 2CHAC 1LHEH 5JBBS 1MD7A 1O3OA 2PSYA 3LDXH 2J34A 3SO3A 1A1RA 4CR5A 2KFWA 3ZVCA 4AFSA 4K5ZA 3OFND 3Q76A 3U8OH 2W7UA 3SV6A 1SLUB 4BAMB 1MD8A 4HG6A 5DP9A 1HIAB 5FBIA 4JYUH 2GCTB 3A7YA 4OS2A 3SOSA 3T25A 5FAHA 1TBQH 3EAJA 1A61H 1SOZA 3CNRA 5AHGH 2EA3A 1N1LA 2ZWLH 3OAAD 2ILNA 3B9FH 1LVMA 4ISHH 3RU4D 1KXAA 1ORFA 5DP6A 1P9SA 1O2UA 4YLUA 1YY3A 3TJUA 5CMXH 1V2JT 2ZGHA 1HDTH 1AFQC 2ZFSA 4BNRA 3SU0A 4Z0KA 1BTXA 5GCHG 1W13U 2ODYB 3VB3A 5J4SA 1C2MA 1L4DA 1C2EA 3MMGA 3BV9B 1PPCE 4UEHH 1WV7H 1UCYH 2TIOA 1B0FA 2QV1A 5EXMA 1GBKA 1O3JA 1Z1JA 3KQDA 3HGPA 1QJ6B 4BAQB 1SLXB 1TPAE 3A7XA 3SUGA 4JMYA 1TGCA 3BEIB 3A83A 5DP8A 2W3IA 4NSVA 3MWIU 3PB1E 4CRBA 1XXFA 1GHWH 3M3TA 1ZRBA 2P95A 1NBMD 2F9OA 1TIOA 4B2CA 1EAXA 5AF9H 3F2FA 1O3CA 2B5TB 5FL7D 4O9VA 1HYLA 1SGFA 2XXLA 2ZI2H 5A09A 1F5LA 4GLYA 3V3MA 3VB7A 1SQTA 1W3CA 1AQ7A 1QB9A 2A4OA 4X8VH 2HALA 1TPSA 1F0SA 3U1IB 2AHME 2A7JA 1OOKB 1ZHPA 1MCTA 4J1YA 3VGCB 5A0AE 3L6PA 2GZ8A 5JBTA 1O2WA 3SNAA 2WPKS 3MH4A 3RMLH 1NY22 2HPQH 3EQ0H 2G00A 1GBJA 1C5UA 3SJKA 3M7QA 4LOYH 2FLBH 1ZOMA 3DSOA 1QL9A 1DWDH 2BZAA 5KECA 5EXNA 1XVMA 4Q2KA 5HIYA 2V3OH 3CP7A 4XBCA 5FHTA 1VCPA 4JK5A 1ZJDA 4ASHA 1P04A 3NZIA 2PWXA 1TWXB 1KXCA 3OTJE 4VGCB 3QK1A 4Y0ZE 1P10A 7GCHG 4OS5A 3QTOH 4WMFA 1TX6A 1DUEA 3ZV8A 4I8KA 1EOLA 4IGDA 5C0UA 2ZHEH 3LJJA 1ELGA 2Q6DA 1LVYA 1SGTA 2EC9H 5E0HA 4CHAB 4OGYA 2CK3D 1B7XB 3QGJA 4WXVA 1DFPA 1F92A 3NUMA 2V0BA 1O2TA 1YPKH 1GVZA 2F9UA 1AVGH 1IHSH 1SB1H 2B8OH 2CJIA 2ANYA 1SFQB 2ALPA 2PSXA 5F8TA 1CGIE 1YPHE 3M7UA 1SGPE 1TBRH 3TNTA 2D26C 2ZIQH 3SYJA 1BTHH 1AB9C 1P9UA 9LPRA 3BTGE 1G36A 4Y76A 5GPIB 4WJG2 1DSTA 1CT4E 3VGCC 1EPTB 1EZQA 5TJXA 5JBCS 1MTUA 4GHQA 3BEFB 1HAYB 2EI8A 1TX8A 1MTVA 1ZSJA 2F9NA 1Z6EA 3UOUA 1RIWB 2BHGA 1EXFA 1TYNA 1ZPBA 2OD3B 2O8MA 1WYKA 1F0UA 1O3FA 1OKXA 1JRSA 4ZHAA 2H9EH 4BANB 4MVNA 1AKSB 4A1TA 1SGRE 3PLPA 1O5FH 1VGCB 2I6QA 5K7RA 1BMFD 1TE0A 1TNJA 2YMSD 1OYQA 2ZPQA 1E79D 3N7OA 1TNKA 3ZZ9A 1NRQH 1JRTA 1J14A 1DX5M 4X1SU 4B71A 1TRMA 1BHXB 5AFYH 2GKVE 2ZNKH 3LIWA 1WBGB 2Y7ZA 4CHAC 3F0OA 1LTOA 1GHAF 1N6XA 3ZZAA 1TQ0B 1XVOA 1UVSH 1PJPA 3A8AA 1D3QB 1UMAH 1LCYA 3HK3B 3H5CB 2TBSA 3M5LA 1O2JA 3D49H 1K2I1 3H7OA 1GHBG 2FYRA 1P3CA 1V2VT 1E37B 3ITIA 2G51A 3T26A 1NPMA 1GDNA 3M37A 1IQGA 1N8OB 1RTLA 2XRCA 1PPFE 3NPSA 1AN1E 1J16A 5I46H 2A4GA 2XBXA 3GS9A 1EFRD 5EXLA 4ZKRU 1QIXB 1SSXA 3GDVA 1LHDH 1SGFG 3JZ1B 1EPTC 3QZQA 4PROA 1W14U 1G3EA 5DG6A 2H5DA 2KZ4A 2CF8H 1E35B 4RT1A 3RXUA 3MQKC 3MTYA 3FP8E 1EPTA 1A0JA 1UCYE 1YLNA 4AYYB 2V35A 1C1QA 2OTVA 3ODFA 2HNTC 2FMJA 4FUEA 5GJ4B 3PLBA 2CF9H 3RDZA 3ZYDA 1TPOA 2XNDD 1O5AB 3VXFH 4LXBH 2BY7X 1FY3A 3LGVA 3P70B 1GCTB 1O5CB 1C4U2 1A7SA 4ASUD 1BB0B 3LC3A 4ABGA 1AWFH 1ELCA 3Q3XA 4TWWA 2FM2A 2ESTE 5ESBA 1CU1A 5JB9S 2ZPRA 3FN8A 1THSH 2PLXA 1VJ9U 1ID5H 1ZPZA 1OYTH 4MPUA 4I33A 5ABWA 2BQ6B 3HKIB 3HGNA 1ETTH 5EJZA 1SPJA 3URCA 1SOTA 1LVOA 1W7XH 1C2FA 3KNXA 1H9HE 1GDUA 3MFJA 4A7IB 4FOUC 1VITF 3MH6A 2LNCA 1D4PB 3KQCA 4H6SB 5DP4A 5JYIA 3MU0A 4BOHA 4BAOB 3EA8A 1RXPA 2A5IA 2BOKA 1GWAA 1H1BA 2HRVA 3QWCH 4FUDA 4DVAU 3U69H 5EQRA 2Z9GA 3MH7A 2Q6GA 2GCHF 3ZVDA 2ANWA 2QAAA 1QRZA 5FBEA 1C5OH 2FLRH 2F83A 2RA3A 2TGPZ 4HZHA 2OLGA 1QURH 3E1XB 2J9NA 1DWEH 8LPRA 1K1LA 4K2YA 2HOBA 1MKWK 1C1UH 1UVPA 1VCQA 4YTAA 2FWWA 3TITA 3STIA 2A0QB 1YM0A 4UDWH 3RLYH 3NKKA 2WV4A 1CQQA 2VJ1A 2AFQB 2VWOA 1SHYA 1EAWA 2DE8A 4FUCA 5C0TA 1MAXA 2ZQ1A 5HMAA 4DGJA 1HAIH 1P2KA 3EDXB 4IS5A 5EPNA 4YLQH 3SQEE 1DVAH 1RTKA 1GBDA 1NZQH 4F55A 1LVBA 1HJAC 3RC6A 4B6EA 2A1DB 3G01A 2GJGA 3T28A 1FN8A 5HYOA 4A5TS 3BTQE 3E0PB 1P57B 1V2QT 1JBUH 1OPHB 1A5GH 5PTPA 1C2LA 1VZQH 1UTQA 5B6OA 3A8DA 3ZVAA 4AYVB 4J2YB 2J97A 3QUMP 2UUFB 1BRCE 1TNGA 3H09A 2EQNA 1TOMH 1V3XA 4E05H 3PTNA 3U8RH 1V6DA 1GCDA 3URDA 3RC5A 3DD2H 3OU0A 4ZHMU 2R3UA 2O8UA 4RT0A 4BXWA 3RMOH 2K1QA 4BAHB 2W7SA 2JJ1D 2VU8E 4A6LA 3FZDA 1QA0A 4MQAA 3NCLA 2GDEH 2J2UA 4IC5A 3HATH 1AU8A 4UFDH 4YZUA 4B2BA 4I32A 3SNBA 3GICB 3UNSA 4F4OC 1S0QA 2W6ID 4HFPB 4D9QA 1JWTA 1FY1A 2VB0A 5C94A 3SNEA 3P92A 4LZ4B 3RXPA 5ESTE 1PPGE 1YCPK 1KLTA 1CHOG 1SLVB 3CENA 3PO1C 3RXTA 1KXEA 1Z71A 3T5FH 4ABBA 4AFUA 4B76A 2VVCA 2ZGCA 5C20A 3BIUH 2ZFRH 2J4IA 2Q6FA 1PPZA 1ZTKA 1IQJA 1AVXA 1O31A 1F5KU 1WOFA 3GY4A 3PV5A 5GIBA 1E1QD 2THFB 3O8DA 1QBOA 2C90B 1A4WH 2B7DH 1OSSA 2PKAB 1GJAB 1GMDG 2ZO3H 1GBIA 4XE4A 1SL3A 1WSSH 2GZ7A 2QN5T 4ZKSU 4IW4E 1GL1A 1BMAA 1CA0B 4KP0A 3UOPA 2GDDA 1RS0A 1O2RA 2H6MA 2ANMH 2CXVA 1K1OA 3BTWE 3PV4A 2FO9A 2D8WA 4I8JA 1UTKA 2H5CA 3B23B 3T29A 4FU9A 4XDEA 3SV9A 5EG4A 1CBWC 3GY7A 1OWKA 4DW2U 3WW7A 2AIPA 2M5TA 2BDYA 3P17H 4X1NU 4Y8XA 3A89A 3M5NA 3PLKA 4F49A 1H8DH 1PQ5A 2OQ5A 1UTLM 5E0GA 1C2IA 1O3NA 2M2AA 3SGBE 1W0KD 3SHCH 2W6JD 4Y11E 1E0FD 3QTVH 5GXPA 3AAVA 2EI6A 3PM3A 1SLWB 1K28D 3L3TA 1UHBB 1C5VA 2ZGXH 6CHAC 1GHVH 5JB8S 2R3YA 3LGYA 2JETC 5A8ZA 1C2DA 1C2GA 1MH0A 1SG8B 2AGEX 4JZEH 4Y6DA 3BTKE 4B1TA 3UQVA 1FY5A 1UK2A 2G5NA 3ZZ4A 4ISNA 1T8NA 1GI3A 3GY2A 3VPKA 2PUQH 4DT4A 4UFGH 4WWYA 4UFEH 5L30H 3D65E 3GCHB 1K1NA 3ZYEA 2RCEA 1O2HA 3STJA 2ZDVH 8KME2 2PKAA 1P8VC 3LOXA 4E7NA 5E0JA 4UFFH 2Z6BD 1CA0C 1RTFB 2VH0A 1QA7A 1PQ8A 3HK6B 3M3VA 2F3CE 2P16A 1ELDE 1P02A 2PFEA 5F6MA 1NFUA 1TNLA 1A5HA 2A4RA 3UR9A 1FV9A 2AYWA 4YT7H 3UNRA 3LT3A 2ZG0H 2W3KA 4X0WU 3LH3A 1KTSB 4YESB 3MNSA 2OUAA 3AASA 2VWNA 2ZU1A 1YBWA 5JDUB 2UUKB 2ZTZA 1L1NA 2BD9A 3AVZA 4X1RU 3QZRA 4E7RG 3RM2H 1T31A 2ZCKP 2R2MB 1C5MD 2ZKSA 4ABJA 3OYPA 1TAWA 4GCHF 2BY8X 3LGUA 4P00A 2BD2A 1O3EA 4A1VA 1SGYE 4A92A 2QF5A 3C27B 2VWMA 4OGXA 4K8BA 5FPTA 2BVRH 4CH8B 3QGNB 1L1GA 4FUJA 4I8HA 1ANCA 1KYNA 2G81E 2SNWA 3V7TA 1PQAA 4MPXA 4BTIB 2NU2E 4CBOA 5TCAA 1OWJA 3TH2H 4GSOA 2Z9LA 1ZPCA 8GCHG 1FN6A 3ZVBA 4AGKA 3ZZ6A 2AH4X 3SW2B 2ZHFH 1HXEH 1GVKB 1EB2A 3GCHC 1LHCH 3N99A 4ESTE 1P3EA 3KQEA 3BIVH 4CRCA 1TMUH 2KR7A 1K21H 1K1IA 2BD4A 2FPZA 2WPHS 3UFAA 1TRYA 2PHBA 1J8AA 2WV5A 3A80A 1RFNA 4OS7A 2VIPA 1WXRA 1ZSKA 3K65B 3ATWA 3MNCA 2TGAA 3MNXA 2F9BH 1H9LB 4HI3A 5F03A 5IDKA 4U2WA 3FAOA 1C4V2 2W26A 3D23A 2RFKC 3GYLB 1K1PA 1GI0A 2G4UA 3BG4C 4UE7H 1MU6B 4AFZA 5F8ZA 3PRDA 3OEED 1LQEA 1XUIA 3MNBA 2A31A 3KCGH 2FX6A 4X2XA 1SQAA 2BY6X 3FO8D 3M3SA 2GGVB 3KF2A 2GMTC 3OE7D 3P95A 1XXDA 1S6HA 2ANKH 2J92A 1SQOA 3EE0B 4X6NA 3RXRA 5DP7A 1TGNA 1GMCF 2W5EA 3FZZA 1V2OT 1KTTB 3SGQE 3TH3H 2A5KA 2K0QA 2ZP0H 4FVBA 4ACBA 1JMOH 4X8SH 3LPRA 1YPLH 7KMEH 1AMHA 1P2IA 1QGFA 1KMHB 2FI4E 2ODPA 2WSSD 2BVXH 1UO6A 1EKBB 1O3GA 2PGQB 2BX4A 2OC8A 1HBTH 3LGWA 1TB6H 2HVXA 3V12A 1SQRA 3SZNA 1UVOA 2C8ZB 2P8OB 3A86A 5DN6D 4JZIA 4ZKOU 1VKYA 2P59A 1AE5A 3M61U 1NFXA 1GI7B 2GCTC 2ZFFH 2WYJA 3ODDA 3CS7A 1Y8TA 1HIAA 1YP9A 1OP2A 1QRWA 3RLWH 4O3UA 2QA9E 1C5LH 3UREA 4AC9A 1C9TA 1MTSA 1RRKA 4AB9A 1A46H 2LP6A 4YXWD 1TMBH 4I86A 3SN8A 3KQ5A 3ESTA 3S9BA 4H4FA 1GG6B 3RXGA 1GJ4H 4H6TA 1TFXA 1ZTLA 3NWUA 4NIXA 2WV9A 1WUNH 3BTME 4ZXXH 2TPIZ 1BJVA 3N7EA 3E6PH 4RSPA 4JZFH 5GCHF 1XUJA 1ZZZA 4X8UH 4ZAEA 5IYTA 2ZFTA 1MBMA 3GDUA 3BTFE 1TLDA 4D7FA 3MU8A 4QT8C 3RXHA 1FMGA 1Y3XA 3BF6H 3K6ZA 4YO9A 3TLOA 3U8TH 1C5RA 1P0SH 2VIVA 1H4WA 4X6MA 2FOHA 1S82A 4CRDA 4X2WA 1O3MA 1C5PA 2FEQH 2SGFE 1YWUA 3SNCA 1THPB 2VIQA 5EGMA 1Y5AT 1G2MA 3DSPA 1G32B 6GCHG 1DLEA 1EQ9A 2VVUA 2GZ9A 4NIYA 3P8OA 1O38A 2XW9A 1MKWH 1C1WH 2P8OC 2KCPA 1NRNH 2P3FH 1A3BH 2ZU2A 1S84A 2G5VA 4NZLA 2EEKA 1ABIH 3SJ9A 1GGDB 5CE1A 5EQSA 1IHTH 5DKMA 4Y7AA 1HGTH 4IMQA 2ZU3A 4FVDA 5CHBA 1GBFA 1O3HA 1TGSZ 1GBCA 1MZAA 3KGPA 1C1OA 1GL0E 2NU1E 2RDLA 2XBVA 3A8CA 2BLQA 3KYGA 1DXPA 4D8NA 1XUFA 1TA2A 1O3DA 1SVPA 2FODA 1JOUB 2K8IA 2O9QA 3LGTA 1P2JA 4R8TB 4WMEA 4XBBA 1GBHA 2D2DA 2ZDNA 4VGCC 3R3GB 1BTPA 2BLOA 2QY0B 1E36B 1GJDB 3I77A 2CV3A 1ZHMA 7GCHF 5A0CA 1L2EA 1H8IH 1COWD 2IJOB 1AUTC 1ARBA 3UAIC 5LPRA 2PKSB 1DE7H 3E8LA 1M9UA 3K2UA 1O33A 2BLVA 3PROA 4U30A 1SBWA 2ZF0H 1HFDA 4ZUHA 3WWBA 3LH1A 2XTTB 1HXFH 2Y81A 1C5WB 5HM2A 2ZEBA 3OSYA 2BD3A 3UUZA 3UWJH 2ZDMA 1XM1A 5EODA 1YPHC 2J94A 4NCYA 3RM0H 1TBZH 1ZRKA 2GT8A 2V7QD 1SGEE 5HIZA 4M9FA 1YCPH 2YNAA 2ZDLA 4FUBA 3RXVA 2QCYA 4IBLH 3TNSA 4WXIA 2A45B 4ISOA 2I6SA 4LK4A 1IQLA 4Q7ZA 1FIZA 2C8XB 1Z6JH 4XBDA 4I7YH 2BYAX 1ESTA 1HPGA 1RIWC 1MTNB 1O37A 2RDEA 2L74A 2A2QH 1AZZA 4ABDA 5EW1H 2R0LA 3PMHB 3A87A 1QB6A 1G37A 1H8HD 3FP6E 4AORA 3S7HB 4LZ1H 1YPGH 1VGCC 4IC6A 4AN7A 1AKSA 2RG3A 4K8YA 1QFKH 2UUYA 5A8XA 5EJLA 2BDGA 2SGPE 2KCAA 2BXTH 2BD5A 2BDCA 2XBWA 3D62A 4ZCNA 3T62A 3IITA 2OXSA 1EP6A 2PKSC 2Z3DA 1DICA 1FONA 5HM9A 3SGAE 2J5UA 2XCFA 4NA8A 3M36A 2FIRH 4YOGA 5T3HA 5CDFE 2A32A 2DE9A 2QF4A 4TY6A 1O2SA 1GHZA 2B0FA 2JDID 3ZZ5A 2G52A 3T2NA 1LPGB 4WVPE 1UTNA 2JH0D 4TPYA 3W1EA 1GHBF 2DUCA 1N8OC 1UW7A 1UTOA 1T32A 1BITA 4DOQA 2BY9X 1A3EH 1BTYA 2ZFQH 2F9PA 3KQBA 3BEUA 1OWEA 3SUDA 3SNDA 1S85A 1GI4A 3TK9A 1DLKB 1OP8A 2PV9B 1UTPA 5L2YH 4XSKU 4ZMAH 7LPRA 4GVUA 7ESTE 3VB5A 2EI7A 3TGIE 1KXFA 1T8OA 1Y3VA 4X8TH 5H4IB 1E1RD 3F9HA 1MTNC 2C93B 1E34B 2FS9A 1KLJH 1EB1H 1ESBA 3RXDA 1AY6H 3UQOA 1PPBH 4NWKA 4AX9H 2UWPA 3TPIZ 4TWYA 1C1MA 4XOJA 1O2LA 1GJ8B 4R0IA 1Y59T 1MABB 4B75A 2SGAA 2VBCA 1XUKA 1GCTC 1HLTH 1O0DH 2QF0A 2WPIS 2TGTA 1QR3E 1O5BB 1FUJA 1W12U 3F2HA 1UK3A 4UONA 5L2ZH 2R9PA 2OC0A 3BTHE 4Y79A 1GMHG 1VITH 4CH2B 1P2MA 1AWHB 2J38A 3WWFA 3VEQB 3ENSB 1DDJA 5I25A 1TNIA 4FUIA 3SZEA 2ZGJA 2F4LA 2ZCHP 3PWBA 2QGRA 2BQWB 3UTUH 1C1PA 1EOJA 4FU7A 2QXJA 1OP0A 2OK5A 2H1UA 1JIRA 1UJ1A 3TK6A 4ABIA 1DPOA 1EATA 1EZXC 1QNJA 2V6NA 4WH6A 1BMLA 2BD7A 5C2ZA 3AAUA 1PPHE 1EP5A 2XBYA 4O97A 2PGBB 5C1YA 1ZSLA 1GJ7B 1XUHA 5T6FA 2A4QA 1BTZA 1BDAA 1J17T 1DS2E 2OP9A 2Y5FA 1HJ8A 3P8NA 4X1PU 2H9HA 5HKKD 3O8CA 4NWLA 3PV2A 1YLDA 1HAPH 3B8JA 1A0HB 3LC5A 3Q3KA 1NM6A 4INHA 4OM9A 1J9CH 5EQQA 3F1SB 3PMBB 5C17A 1BZXE 4B73A 4WH8A 1SGQE 3TJNA 3UWIA 3A7VA 1Z8IB 1HAHH 3F9GA 3S7KB 1GBTA 1KSNA 2JH5D 2LELA 2QYIA 3IWMA 2Z7FE 1C1RA 2UUJB 2V3MA 4DG4A 1LHFH 1BTUA 2OBOA 2A7CA 2VVVA 3UPEA 1O2VA 2GX4A 3QO6A 4CRFA 1O3BA 2AMPA 5T6GA 1XX9A 2ZDKA 3T27A 2BTCE 3UB0A 1PQ7A 1KY9A 1MMJN 2WPDD 4AOQA 3ATIA 1FXYA 1Y3YA 1BBRK 1QZ8A 3MU1A 5EOKA 3A7ZA 1YPJH 2R2WU 4HTCH 4Z1MD 3U9AH 5K0HA 4ZKNU 4OS4A 1KXBA 2C8WB 1FAXA 5SGAE 2VGCB 3GY8A 4NZQA 1NS3A 2WPJS 1CSOE 4Q80A 1EZUC 2UWOA 6ESTA 3KHVA 1MKXK 3VXEH 1XUGA 2BD8A 3EYDA 1L1JA 4Y8ZA 1LKAA 4ISIH 1ZYOA 4Q7YA 2KCOA 2R0KA 5AVDA 1O5GH 5A2MH 1E38B 4AG1A 4Y0YE 4DIHH 1ELFA 2PP6A 4JZDH 1FLEE 1XKBC 1G30B 2AMQA 1KDQB 3LGIA 1K22H 3GCTG 5E8EH 2PUXB 3SJIA 1C1TA 1GJ5H 1TALA 3DT0H 1P06A 3SI4H 5FXLA 1ANBA 3SORA 2GV6A 2FESH 4GUXA 1NN6A 1H8ED 1C1NA 1EASA 1LHGH 1NFWA 1TGTA 1OHHD 1D6WA 4GPGA 5DSFA 2BZ6H 4DURA 3TVJB 1DM4B 1T7CA 5G4BA 1CHOF 2HLCA 4U01A 2STBE
chains in the Genus database with same CATH topology
2ULLA 4YOIA 2FOGA 2H2ZA 4X6PA 2ALVA 2FOAA 2F91A 1P2OA 3P6ZB 2ZPSA 1ZR0A 1Q31A 2CHAB 1O2ZA 2QC2A 1GMDF 1D9IA 2O8TA 4SGAE 3ZZDA 3RU4E 2HNTF 3AW1A 3A7TA 1MU8B 1T4UH 1NROH 2VH6A 2BDIA 1V2TT 2FXRA 2P93A 2Z9KA 3U1JB 9ESTA 4FUFA 4B2AA 1QBNA 3WY8A 3KEEA 2OBQA 1Z8RA 2ODQA 1ANDA 2FDAA 5JBAS 3DHKH 5GWZA 5EPYA 3SJ8A 1DY9A 1GI9B 3TJVA 3Q77A 3RXEA 3F9EA 3SUEA 3MO3A 1TPPA 3ZVGA 1VR1H 2BMGB 4I8LA 2VIWA 1TMTH 1SGDE 3FVFB 3AW0A 1TABE 1BUIA 1KDQA 1P2QA 2NWNA 3A7WA 1O34A 1AFQB 1AE8H 2D1JA 1UHBA 1AGJA 3TH4H 1SMFE 4JK6A 1S0RA 1OWDA 1UVTH 2WUBA 5DGJA 3HPTB 4U32A 4TPIZ 1THRH 3E91A 3W94A 1Y3UA 3QX5H 1L0ZA 3OY6U 1OWIA 1O32A 1P05A 1ELEE 5FPSA 4FU8A 1BMMH 1W0YH 1GJBB 1EUFA 5LPFA 1AIXH 3GDSA 4X2YA 4ABAA 1ZHRA 4RKJB 2G4TA 2VIOA 3SU5A 4JYVH 3VFEA 1BIOA 1BQYA 1FJSA 3K9XB 3GCOA 1DANH 5CHAB 2KAIB 1IQHA 2Y5HA 1OS8A 1BA8B 2A7HA 1NU9A 1NRPH 4Y71A 1BRAA 3MU4A 2C3SA 3JZ2B 1TONA 1V2NT 1GBLA 4IN1A 4OS6A 1Z7KA 2Y5GA 1HJ9A 3TU7H 2JH6D 1F7ZA 3GY3A 1O3KA 1NO9H 5ETXA 3LKWA 2TGDA 1C5XB 1AZ8A 3Q3YA 4YT6H 5DP5A 3RU4T 1AO5A 4MNWA 3MU5A 5GDSH 2ASUB 5E2OA 3SHAH 3H7TA 1MZDA 3QLPH 1YF4A 4ABEA 2RA0A 3ZZCA 1C5QA 3F6UH 5TCCA 1ZJKA 2F9VA 5FPYA 4INLA 2XYAA 3SUFA 3GCNA 4O03A 2Y82A 2SFAA 1D3PB 4ZH8A 1SI5H 2FS8A 1ZLRA 1P11E 1DXWA 4ISLA 1WQSA 1DUAA 4BXSA 1AI8H 1AUJA 1WTGH 1XMNB 2AIQA 1T8MA 3SU4A 2FOBA 1G2LA 8GCHF 4D9RA 2JKHA 1ABJH 1LO6A 3MO6A 3V13A 3UY9A 1P12E 4AFQA 2BDAA 1O2GH 1UVUH 2ZHDA 1VJAU 5CHAC 3R0FA 1GBBA 1FY8E 1GVLA 1QB1A 3TK5A 3PYHA 1O5DH 3RXJA 2KAIA 3HKJB 1T8LA 3E90B 3ELAH 1W0ZU 5LH8A 1NU7B 1EJNA 3E16B 3GY6A 1CVWH 1SHHB 2FOCA 2ZCLP 4OS1A 1AB9B 1ELBA 2XC0A 1GBAA 1A0LA 1WQVH 4FXGH 2Z9IA 1HV7A 1FDPA 2WPLS 5AFZH 2WPMS 2V3HH 4MLFB 3NK8A 1TA6A 1C1VH 1Y3WA 1G3DA 4WY3A 2ZFPH 3E3TA 2FZZA 4DY7B 2ZTXA 2ZZUH 2BB4A 1UTMA 1O39A 1MBQA 1YGCH 5BRRE 1G3CA 2A5AA 1RGQA 4O3TA 2IPHA 4WF8A 1NTPA 5J4QA 2P3TB 4NA7A 2SGDE 1GHAG 2FTMA 2FYQA 3RXMA 1P09A 1CGJE 2G8TA 3EA9A 3GOVB 3KN2A 2QXGA 2FP7B 3ZZ8A 4FUHA 1WAYB 1W8BH 1MQ5A 5LGOA 1TX7A 4CBNA 2XC5A 1F5RA 1RD3B 1CGHA 1YCPM 1AFEH 3QN7A 1D6RA 1SGIB 1H9IE 2CMYA 2OC7A 2O8WA 3I29A 4BTUB 3S0NA 2GVFA 2AS9A 2WYGA 3SJOA 4THNH 1BRUP 2FX4A 3MOCA 1V2WT 2Y6TA 1GBMA 4NG9H 1HAZB 5EW2H 1TNHA 1GJCB 3SU6A 4WMDA 1O2OA 1O30A 1GG6C 1O2XA 1RJXB 2VWLA 2GTBA 1ZTJA 1ESAA 1UK4A 3UIRA 1INCA 3MO9A 2Z9JA 4JZ1A 4E06H 4CRAA 4I8GA 4ABHA 1HAOH 1V2MT 2IN2A 4KGAA 1FY4A 4ZROA 1V2KT 2HNTE 3RXFA 2UWLA 1Z1IA 3PTBA 1C4Y2 3Q00A 1EJMA 1V2LT 1O3LA 1SC8U 4D7GA 1V2PT 1C5SA 2GT7A 1B0EA 1G9IE 3BTEE 3K6YA 1QCPA 1KIGH 1BTWA 2FOMB 5DPAA 3S9CA 3KIDU 1W7GH 1G3BA 1ZMLA 1LMWB 6GCHF 3BTTE 1O2IA 1VITG 2GD4B 4INKA 2PTNA 5FCRA 3TIUA 2BDHA 4CR9A 5FX6A 1Q2WA 4Q7XA 1UCYK 3DFJA 1GGDC 2Y80A 3E0NB 4ABFA 1O3PB 4NIWA 1OXGA 1S81A 1S83A 2AERH 1BCUH 2ZHQH 2GCHG 3SV2H 1IQEA 2P94A 1LPZB 2Q1JA 3RMMH 4D76A 3P8FA 1P03A 1BBRH 2BLWA 5DJ7A 3MHWU 1YPMH 3BSQA 3SQHE 1TOCB 2P3UB 2B9LA 2VINA 1HAGE 1C1SA 4K69A 4A1XA 1GHXH 1ELAA 4RKOB 1MKXH 1T4VH 1O5EH 3RC4A 1LQDB 4YM9A 1O35A 5C1UA 3UR6A 2BX3A 3M5OA 1GHYH 2NU4E 1JIMA 1MCVA 1DOJA 3SV8A 4ZHLU 1J15A 2ZC9H 2CGAA 1NRSH 1QJ7B 4YOJA 3PWCA 1QL8A 1EAUA 5DP3A 1GI8B 2AEIH 2OC1A 4ZXYH 4CREA 5EU8A 1DT2A 1NRRH 1HJAB 2Z3EA 1LPKB 4MG3A 1S5SA 3MH5A 4AG2A 3A8BA 4FUGA 1NC6A 3GY5A 4AB8A 4Y8YA 4JCNA 2HWLB 2A2XH 4K1TA 4UD9H 1Y5BT 3ZZ7A 4SGBE 1CA8B 4JYTA 1C2HA 1HNEE 2SNVA 1C5TA 1QRXA 4K60A 1ACBE 3SBKA 1YC0A 1HCGA 1L4ZA 1K9OE 2PR3A 4TY7A 1DY8A 1MTWA 2GV7A 2YOLA 3RXIA 1GI6A 2XWBI 1A2CH 2IOTA 4KKDA 1LKBA 4M7GA 1DWCH 3SU1A 2FI5E 1FAKH 1Z8JB 1ZGVA 1IQKA 1BMNH 1O36A 1FNIA 1V2ST 1IQMA 1W11U 2GP9B 2VNTA 1K1MA 1C5YB 1P2NA 1FIWA 1QHRB 3RP2A 3S69A 5LPEA 2SGQE 4K1SA 1EJAA 1BRBE 1YLCA 1F2SE 2FOEA 2NU0E 2XNIA 4NFFA 3LJOA 5C5OA 3O8BA 1NESE 1U6QA 1D3DB 4AZ2B 3DFLA 3RXSA 1O3AA 2PW8H 2CN0H 1QQ4A 1TGBA 5JPMH 3PO1B 4KTUA 1IAUA 4KTCA 2BVSH 3FP7E 3ATLA 5FX5A 3ZZBA 4NFEA 1EZSC 1F0TA 3O8RA 3A81A 3F9FA 1VCWA 1EX3A 2FOFA 1X7AC 1AHTH 3TJOA 1ZMNA 1Q3XA 1IQFA 3GISB 2QXHA 4MDSA 4BAKB 3CS0A 1DITH 1O2PA 1B5GH 2NU3E 3MYWA 1A5IA 2QXIA 3BN9A 4MPWA 3RXQA 3EA7A 3C1KA 1OWHA 3KL6A 1NFYA 1S6FA 2HPPH 3PMAB 3VB6A 4XFQA 1JXPA 1YYY1 2STAE 3OY5U 3U98H 4TYDA 5T6DA 4KELA 1MQ6A 1GI5A 1ARCA 1CBWB 1V2RT 4RN6A 1ELTA 3RXKA 1WU1A 1SGNE 3ATMA 3ZV9A 1HAXB 3I78A 4NIVA 4X6OA 1SR5C 1KXDA 4Y7BA 3QDZB 3TGJE 1O2NA 1HAVB 3L33A 5C67A 2BDBA 3A85A 1YPEH 1ETSH 6CHAB 2Z3CA 1DWBH 5DO4H 1LDTT 1O2YA 2JETB 1IOEA 3ZZ3A 1BJUA 1GI2A 1O2MA 1QY6A 4NA9H 1PPEE 1C2JA 4MNYA 2ZTYA 1K1JA 4HGCA 2ZA5A 1IQNA 1C9PA 2J95A 1QBVH 1WCZA 1GMHF 2QF3A 3TGKE 2ZQ2A 1CHGA 1TQ7B 1SFIA 4CRGA 1CO7E 2G55A 4MPVA 3RXAA 1CE5A 1MUEB 2XCNA 1XKAC 5F8XA 2BXUH 2XWAA 1CT2E 4B74A 1EAIA 2H9TH 3ATKA 3SU2A 1O2QA 4Y10E 1BBRE 1ANEA 3A88A 1IQIA 1Z8GA 1ZMJA 2OQUA 4NGAH 4I31A 2ZHWH 1FI8A 3RXLA 2ZECA 4GHTA 4GCHG 5C5NA 3RUOA 3EGKH 3IG6B 3P8GA 4K1EA 1ELVA 2WINI 4MNVA 1D3TB 1HB0B 1MAYA 4Z6AH 1QQUA 1W2KH 3A84A 4IN2A 3ZVFA 1FQ3A 3FANA 3RMNH 1F0RA 5DK1A 1KLIH 3M7TA 2TRMA 5BPEA 1HAVA 1OX1A 4KTSA 2ZGBH 1SGCA 4DIIH 1GJ6A 3SU3A 2FTLE 2QIQA 3OX7U 3BG8A 4MTBA 1FZZA 3SV7A 1O2KA 3SI3H 3ZVEA 5C3NA 4GAWA 5L6NH 3M5MA 2ZDAH 2PTCE 5HXFA 3PMJA 4H42U 4BTTB 2VGCC 1ZGIA 1FPHH 1HRTH 3RXCA 1QL7A 3MI4A 2YNBA 5E2PA 1N6YA 4AGJA 3DUXH 5FCKA 2ZU4A 1GBEA 5HGGA 8ESTE 3FFGA 1C2KA 2Y7XA 2AGGX 2ZU5A 1TRNA 1HUTH 1P01A 5A8YA 1QJ1B 1C5ZB 3LU9B 1C5NH 1GDQA 1BT7A 1BHXF 2WUCA 2AMDA 4MNXA 3VB4A 2XC4A 1W10U 1V2UT 4DCDA 1CT0E 1GJ9B 3GYMA 2FI3E 1FPCH 2Z94A 4DT7B 3UNQA 1PYTC 1O3IA 3F68H 3RXBA 3RXOA 4DJZB 3GCTF 3W95A 3BG4B 3LONA 1WTHD 1DSUA 4NSYA 1PFXC 3M35A 6LPRA 1AVWA 1BOQA 3A82A 2OCVB 1UTJA 1GPZA 4IMZA 4K3JA 2OINA 1AD8H 1ETRH 3DA9B 5C1XA 2GMTB 1GMCG 3BTDE 4X2VA 3S9AA 1YKTA 2HGTH 2VIDA 2BQ7B 3V0XA 1QTFA 2C4FH 2O8LA 1NT1A 2LPRA 2SGEE 2C8YB 5A0BA 3NXPA 2BOHB 1GI1A 4X1QU 1Y5UT 2BY5X 2AGIX 1PYTD 2BM2A 2CHAC 1LHEH 5JBBS 1MD7A 1O3OA 2PSYA 3LDXH 2J34A 3SO3A 1A1RA 4CR5A 3ZVCA 4AFSA 4K5ZA 3Q76A 3U8OH 2W7UA 3SV6A 1SLUB 4BAMB 1MD8A 5DP9A 1HIAB 5FBIA 4JYUH 2GCTB 3A7YA 4OS2A 3SOSA 3T25A 5FAHA 1TBQH 3EAJA 1A61H 1SOZA 5AHGH 2EA3A 1N1LA 2ZWLH 2ILNA 3B9FH 1LVMA 4ISHH 3RU4D 1KXAA 1ORFA 5DP6A 1P9SA 1O2UA 4YLUA 3TJUA 5CMXH 1V2JT 2ZGHA 1HDTH 1AFQC 2ZFSA 4BNRA 3SU0A 4Z0KA 1BTXA 5GCHG 1W13U 2ODYB 3VB3A 5J4SA 1C2MA 1L4DA 1C2EA 3MMGA 3BV9B 1PPCE 4UEHH 1WV7H 1UCYH 2TIOA 1B0FA 2QV1A 5EXMA 1GBKA 1O3JA 1Z1JA 3KQDA 3HGPA 1QJ6B 4BAQB 1SLXB 1TPAE 3A7XA 3SUGA 4JMYA 1TGCA 3BEIB 3A83A 5DP8A 2W3IA 4NSVA 3MWIU 3PB1E 4CRBA 1XXFA 1GHWH 3M3TA 1ZRBA 2P95A 2F9OA 1TIOA 4B2CA 1EAXA 5AF9H 1O3CA 2B5TB 4O9VA 1HYLA 1SGFA 2XXLA 2ZI2H 5A09A 1F5LA 4GLYA 3V3MA 3VB7A 1SQTA 1W3CA 1AQ7A 1QB9A 2A4OA 4X8VH 2HALA 1TPSA 1F0SA 3U1IB 2A7JA 1OOKB 1ZHPA 1MCTA 4J1YA 3VGCB 5A0AE 3L6PA 2GZ8A 5JBTA 1O2WA 3SNAA 2WPKS 3MH4A 3RMLH 1NY22 2HPQH 3EQ0H 2G00A 1GBJA 1C5UA 3SJKA 3M7QA 4LOYH 2FLBH 1ZOMA 1QL9A 1DWDH 2BZAA 5EXNA 1XVMA 4Q2KA 2V3OH 3CP7A 4XBCA 5FHTA 1VCPA 4JK5A 1ZJDA 4ASHA 1P04A 3NZIA 2PWXA 1TWXB 1KXCA 3OTJE 4VGCB 3QK1A 4Y0ZE 1P10A 7GCHG 4OS5A 3QTOH 4WMFA 1TX6A 1DUEA 3ZV8A 4I8KA 1EOLA 4IGDA 2ZHEH 3LJJA 1ELGA 2Q6DA 1LVYA 1SGTA 2EC9H 5E0HA 4CHAB 4OGYA 1B7XB 3QGJA 4WXVA 1DFPA 1F92A 3NUMA 2V0BA 1O2TA 1YPKH 1GVZA 2F9UA 1AVGH 1IHSH 1SB1H 2B8OH 2CJIA 2ANYA 1SFQB 2ALPA 2PSXA 5F8TA 1CGIE 1YPHE 3M7UA 1SGPE 1TBRH 3TNTA 2D26C 2ZIQH 1BTHH 1AB9C 1P9UA 9LPRA 3BTGE 1G36A 4Y76A 5GPIB 4WJG2 1DSTA 1CT4E 3VGCC 1EPTB 1EZQA 5TJXA 5JBCS 1MTUA 4GHQA 3BEFB 1HAYB 2EI8A 1TX8A 1MTVA 1ZSJA 2F9NA 1Z6EA 3UOUA 1RIWB 2BHGA 1EXFA 1TYNA 1ZPBA 2OD3B 2O8MA 1WYKA 1F0UA 1O3FA 1OKXA 1JRSA 4ZHAA 2H9EH 4BANB 4MVNA 1AKSB 4A1TA 1SGRE 3PLPA 1O5FH 1VGCB 2I6QA 5K7RA 1TE0A 1TNJA 1OYQA 2ZPQA 3ZZ9A 3N7OA 1TNKA 1NRQH 1JRTA 1J14A 1DX5M 4X1SU 4B71A 1TRMA 1BHXB 5AFYH 2GKVE 2ZNKH 3LIWA 1WBGB 2Y7ZA 4CHAC 1LTOA 1GHAF 1N6XA 3ZZAA 1TQ0B 1XVOA 1UVSH 1PJPA 3A8AA 1D3QB 1UMAH 1LCYA 3HK3B 3H5CB 2TBSA 3M5LA 1O2JA 3D49H 1K2I1 3H7OA 1GHBG 2FYRA 1P3CA 1V2VT 1E37B 3ITIA 2G51A 3T26A 1NPMA 1GDNA 3M37A 1IQGA 1N8OB 1RTLA 2XRCA 1PPFE 3NPSA 1AN1E