1P2KA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsinogen, cationic
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA02
4FUDA 1YP9A 2AFQB 5L2ZH 1RGQA 2ANMH 4IW4E 1NC6A 1Z8GA 3V0XA 3UNSA 1BBRH 2B0FA 4A7IB 1S83A 1HAPH 1C4Y2 4YOJA 4RKOB 2BDIA 2D1JA 7GCHF 4Y8ZA 1VCPA 4DVAU 3SQEE 1H9HE 3RUOA 2AMPA 2Z3CA 4JK6A 2R9PA 5GPIB 3SUDA 4ASHA 4WY3A 3E3TA 1PPBH 1K1LA 3M7QA 1EAWA 1BT7A 5AF9H 1SGPE 1HJAB 2GMTC 2ZGCA 4ISOA 2C8ZB 1L2EA 4K2YA 1ELDE 2KAIB 5EPYA 1IAUA 4FUCA 3M3SA 1ZYOA 2GZ8A 2OQUA 2ZGXH 3JZ1B 3GY4A 5EPNA 2ZHWH 3LH3A 3ZV8A 2R0KA 4CBNA 1DY8A 3LJJA 1PPGE 1YLCA 1ELVA 2TPIZ 3NPSA 1ZRKA 1GMHF 1QA0A 1OWHA 8GCHG 4O3UA 5EW2H 1OXGA 1QJ7B 3K2UA 3MU8A 1S6HA 1TQ0B 2VWNA 1DLKB 2Z9IA 5LH8A 2JETC 1LO6A 8ESTE 2Z94A 2NU3E 3U1JB 1PPHE 4JZIA 3H5CB 4X2XA 4D9RA 3M36A 4NFFA 1KXFA 4INHA 1W0YH 1MZDA 3GDVA 1N1LA 1TALA 1RIWC 2ILNA 1PQ5A 4BAOB 1NM6A 4YT6H 2BDBA 3A81A 3BTHE 1AY6H 2H9EH 1IQEA 2XYAA 3QTOH 1DM4B 1GHXH 3HK6B 1BRAA 2O9QA 1GI0A 2JH5D 1FY4A 1YM0A 4DJZB 2ZTYA 1O3BA 3SOSA 3ODDA 3I29A 3TNTA 4Q2KA 1KTSB 1HV7A 1EZUC 2ZI2H 1GBHA 3E90B 3SU0A 1WUNH 3BTME 1OX1A 1T4UH 1T32A 2NU4E 1CHOF 2FLRH 4MQAA 1UCYH 4INLA 3GCOA 1NFXA 3DFLA 1O5AB 4ZMAH 2IJOB 4DIHH 4ZXXH 1ARCA 3SN8A 3P70B 1N6YA 4MNYA 1BHXB 3T28A 3T29A 2ZZUH 1SGTA 1BITA 2F9BH 3VXFH 4ZHAA 2BD3A 4AG1A 1AUJA 4OS2A 3ZYDA 3LU9B 1MZAA 1A61H 1TMBH 3W95A 1IOEA 1P0SH 2OTVA 3STJA 3UREA 2PW8H 2Z3EA 1SVPA 2FZZA 3BEUA 2P8OB 1WBGB 4MLFB 3UWJH 1MKXK 1DLEA 3NCLA 4FUEA 1S0QA 4ABIA 3P8FA 2A4QA 4YESB 4OGXA 1ESAA 2G55A 2AERH 1T8NA 1ZHRA 1AB9C 2H1UA 1UVPA 1K9OE 2V3HH 3SU2A 1GMCF 4MNVA 2A7HA 1C1TA 2H9TH 1HYLA 1SHYA 2PSXA 3JZ2B 3SO3A 2QCYA 2CJIA 3SNCA 1SGQE 1NZQH 1TIOA 1W8BH 3ZZ5A 3E1XB 1FY3A 2Y5FA 1GL0E 1WCZA 3A83A 1O5BB 4O03A 2AYWA 4I8JA 4A92A 3UY9A 5GWZA 1XVOA 3F68H 9LPRA 1HB0B 3LGWA 1D3PB 5SGAE 1W2KH 4XBDA 2D26C 3SGQE 1D9IA 1NU9A 1INCA 3CS7A 3RXRA 4OS5A 2GGVB 1OYTH 3U69H 2J94A 1ZSKA 1EAIA 1C5LH 2GZ7A 1FY1A 3PM3A 1HLTH 1C2GA 5FX5A 1DXWA 4U01A 6GCHG 2A4OA 1ZTJA 4UEHH 2BY7X 1ELEE 1B7XB 1TPPA 4HGCA 1ARBA 3ZV9A 1RTKA 2BB4A 1OPHB 1GBCA 1V2LT 1IQNA 1WYKA 3S0NA 3UFAA 4TPYA 4UFEH 1XMNB 1O3OA 2H5DA 2PKSC 2UUJB 1LPZB 1PQAA 3RMNH 2KAIA 1MBMA 4Q7YA 3NKKA 1O37A 2JH0D 2SGEE 2FI5E 4ISIH 2XTTB 4AFZA 1O2YA 1EP6A 6CHAC 1O3EA 2F9NA 1DX5M 1K21H 1OWJA 3A85A 3RXEA 1KDQB 1XXDA 3A88A 2J9NA 1CGJE 3VXEH 1C2HA 1ZGVA 5DKMA 3P8OA 5J4QA 1ZHPA 1VITG 1NRNH 2Z3DA 4Y6DA 1HIAB 3PTBA 1RIWB 1SGIB 1GBAA 1E38B 1EXFA 2FS8A 2PR3A 5F8TA 5PTPA 1GHAG 1SBWA 8LPRA 1YCPM 2BQ7B 1H8DH 3LIWA 4JYTA 1ANDA 1AZZA 1D3QB 1Z6JH 1GHYH 3F9GA 1A1RA 4ABBA 1CGHA 4NIWA 2FODA 3TIUA 3MU1A 2C90B 1HXEH 1LQEA 3UIRA 1IHSH 1ZGIA 1YPHC 3VB4A 3LGYA 4DURA 1BBRE 3KF2A 1K1OA 4WVPE 2NU2E 2CHAC 3UWIA 1EPTB 4UD9H 2BMGB 2HLCA 3NXPA 3RXAA 1TX7A 2F83A 3CS0A 1BTHH 2J95A 1L1GA 1EPTC 3LPRA 3RXMA 1XX9A 3PWBA 3GCTG 1W0ZU 1UTNA 1QQUA 1GGDB 1TRYA 4A1VA 2BX4A 1TX8A 2BD4A 5LPEA 1EUFA 2NWNA 3S7HB 1W10U 4KTSA 1MCVA 4Q80A 4AG2A 2HVXA 2ZFFH 1C5YB 1AB9B 3QUMP 4CR5A 1WSSH 3V13A 4ABFA 1ZMLA 5CMXH 3QWCH 1MH0A 1GG6C 1LDTT 4U30A 1N8OC 1LQDB 1UVOA 3RXKA 1DVAH 1HAZB 1VITF 1DXPA 2F9OA 3GY7A 5A0CA 2A1DB 4YZUA 3SU1A 1O3LA 1TGBA 4CH2B 1THRH 3AVZA 4ZXYH 1SI5H 2A0QB 4I32A 4LZ4B 1IQMA 3A8DA 4RN6A 4UDWH 3SNDA 2OC8A 1GI6A 3ODFA 4FUHA 3ZVDA 4K3JA 1IHTH 1VITH 4X1PU 2J4IA 4AB8A 5EQSA 3K9XB 1C5XB 3BTKE 1XUFA 3MH6A 4A1TA 1BB0B 1WV7H 1TLDA 2ZFQH 3RMOH 2WV5A 2VGCC 1O34A 4F4OC 3MYWA 5K0HA 2P94A 2ZECA 2HGTH 1O2VA 4F49A 1LPKB 3ZZ8A 5AVDA 4X2VA 1C2FA 2C4FH 1P3EA 1XM1A 5FPSA 4OS1A 1O3CA 5T6DA 3M5OA 3A7XA 1C1QA 4INKA 2FOAA 4I7YH 2ZGBH 2V3OH 1A5GH 5JYIA 1MMJN 3SUGA 8GCHF 2BZ6H 3B23B 1V3XA 1VCWA 1FQ3A 4AFSA 1EAUA 1O2PA 4JYVH 2THFB 3BTFE 4Z0KA 4D9QA 3ZZ6A 1RTLA 4Y0ZE 1C9TA 5LPRA 1DANH 2DUCA 5EODA 1OS8A 1SPJA 3A7YA 1O3AA 5DP6A 1K1IA 2FI4E 3QTVH 4IC6A 1ABIH 1AHTH 1QTFA 3LJOA 3O8DA 3M61U 3RXJA 1O2TA 3LGVA 2CMYA 1AUTC 1C2LA 3STIA 3VB5A 1UTJA 1MKWH 4FU7A 1GG6B 2GV7A 3L33A 2NU1E 4KELA 4BTTB 3KL6A 1HFDA 3R3GB 4X6NA 1O5DH 2JH6D 1CVWH 4LZ1H 4ZAEA 1YC0A 3OTJE 1EB2A 1P8VC 3IG6B 2EC9H 1QBOA 1AFEH 2ZGJA 1NS3A 4MPWA 2BD5A 3SJIA 1C2KA 1O0DH 3K6YA 1C1OA 1BA8B 2TGTA 1GDNA 3KHVA 3SORA 2Z9JA 1C5ZB 1GGDC 5JB8S 2VVUA 3NUMA 2J2UA 4NGAH 5GDSH 2CGAA 1B5GH 4NA9H 5J4SA 4GHTA 7LPRA 3BTWE 3UUZA 2XCNA 4CHAB 1PPFE 3S7KB 1EATA 1O2KA 1AN1E 5ESTE 1HAOH 3A80A 4Q7XA 2VIQA 1BRCE 3VB3A 2PV9B 2P95A 3LH1A 3P8NA 4OS7A 5EXMA 3A89A 1FDPA 1FY5A 4FUFA 4D76A 4DG4A 1V2NT 5C20A 2ZPRA 5EW1H 1FPHH 1TABE 3KQCA 3SNBA 5HGGA 1TRMA 2WV4A 5LPFA 2BLOA 1X7AC 3GCTF 2UWLA 2ZC9H 4ABEA 1G2LA 1V2MT 5EG4A 1GMDF 1TOCB 1J16A 1NESE 2A7CA 4MPXA 2BDCA 2QYIA 2ZU1A 4UFGH 1O3NA 1IQFA 1O39A 2H6MA 2P16A 1CQQA 5IDKA 1W12U 1BMAA 1HNEE 2ZWLH 3QGNB 1TPAE 1YCPH 2FOEA 3BTTE 1RS0A 3TU7H 2GDEH 1BUIA 3LOXA 1AU8A 2QA9E 1Y8TA 1IQHA 3L3TA 6LPRA 2YNAA 3FANA 1F2SE 3RXCA 1AZ8A 1A3BH 3UR6A 4WJG2 2BQ6B 1DSTA 1IQIA 2BM2A 3KGPA 1C2IA 1P9SA 1EQ9A 3W94A 1Y5UT 1XUKA 1LHDH 1LHGH 3KN2A 2PUXB 3ZYEA 2AEIH 2FWWA 1P2KA 4KTUA 1G9IE 3PMAB 1CSOE 5FHTA 5FAHA 1Y3VA 2BLVA 5L2YH 5HM2A 1BRBE 3S69A 4XBCA 3ZZ9A 2BTCE 4FXGH 4Y7BA 4B76A 2RDLA 1L4ZA 4B2AA 1SLWB 1P2QA 2FIRH 1EOJA 3UPEA 2B5TB 3D49H 3GY3A 2OUAA 1GCTB 2A5IA 3ENSB 4KP0A 1Z71A 1LHCH 5JBBS 3ATWA 5I25A 1BTYA 1D4PB 3I77A 4CHAC 1C5SA 4ZH8A 3OU0A 2W5EA 3SUFA 3PMHB 3MOCA 3M5LA 1GBDA 1P06A 3TVJB 3GOVB 3TLOA 2XBWA 2H9HA 4Y7AA 2GCHF 3PWCA 4X6MA 3BTGE 3SU3A 4JK5A 3MH7A 4TPIZ 4TY7A 4GAWA 1O2NA 4X1SU 3TNSA 3SU6A 1UK3A 1D3TB 2P59A 1ELFA 1B0EA 4CRBA 1S81A 2O8TA 4B2BA 1C1MA 3RU4T 1C1WH 3MU4A 1MQ6A 1EJNA 1NPMA 4CRFA 3EGKH 3LGIA 1IQKA 1QNJA 2V0BA 4CREA 2WUBA 1SGEE 4AYYB 1H9LB 2HNTC 1GDUA 2XBXA 5DP9A 2FS9A 1T31A 1WOFA 2W3KA 3RLYH 1G2MA 3PMJA 1AE8H 3LONA 2DE8A 1BMLA 1T4VH 4B71A 2FI3E 1NRRH 1AKSA 1QIXB 2XC5A 1MTNB 1WQVH 2VIDA 3DHKH 1QJ1B 1JOUB 3E16B 1GL1A 1Y3YA 2Y80A 3SU5A 2UWOA 2HALA 1PJPA 4IGDA 7GCHG 2VIPA 2AGGX 1UTPA 4K1TA 1FJSA 5I46H 2VB0A 3CP7A 4B73A 2BD2A 1GBIA 2I6SA 1F0RA 4UE7H 2WPHS 2FYQA 3OY5U 2BVRH 4X1NU 2D8WA 2QN5T 3MO9A 1Z6EA 1DWDH 1OKXA 4Y8XA 4I8KA 4GCHF 4NIXA 4UONA 2WINI 1MCTA 3TJVA 3MU0A 1SR5C 2VGCB 1XXFA 2BY8X 2WPJS 1SSXA 1MD8A 1UTLM 3NWUA 3ZZ7A 5E0JA 3SV6A 1NRSH 4BANB 5CE1A 2RA0A 5EU8A 3T25A 1RJXB 1S0RA 3A7TA 4SGBE 3MU5A 3Q00A 1VJAU 4MNWA 1GMHG 1QHRB 1ETTH 1PPEE 1GVZA 1TPSA 1KIGH 2B9LA 2BY9X 2P3TB 2CN0H 1L0ZA 2Y7XA 2A4GA 2XC4A 3T27A 4IN1A 1YBWA 2BOHB 2BD9A 1CT0E 1YPLH 1UO6A 1A2CH 1UCYK 4I33A 2A7JA 1N8OB 2ZTZA 1KLIH 1TA2A 1G32B 1RTFB 2FX4A 4NSVA 1TOMH 1GHBF 2ZKSA 2SGQE 1OWKA 2OC1A 4K69A 4JZ1A 1GWAA 5JPMH 4B74A 4K1EA 1D3DB 2ZU2A 3TITA 3UNRA 3RC6A 1AI8H 1UCYE 2Z7FE 1LVOA 2BOKA 5ESBA 4GCHG 4CH8B 1AGJA 1LVMA 3SUEA 1LHEH 1A4WH 3QZQA 3MTYA 2ZCHP 4AGJA 3PYHA 5A8ZA 3AASA 4SGAE 4GUXA 1C5VA 1AWFH 1Y3UA 2XBVA 2F9UA 1ELTA 1C9PA 2OBQA 3AW0A 3OX7U 3B9FH 3T2NA 1ESTA 1PPZA 1IQJA 5C5NA 2ZU3A 1AWHB 3GYMA 2XC0A 7KMEH 1C5MD 2ZFSA 2HWLB 2CHAB 1W11U 1O2UA 1A0JA 1DFPA 4ZHMU 1C1UH 1NY22 4YLQH 1NTPA 4RSPA 2ANWA 2R3YA 3RC5A 2RCEA 1MTWA 1QL9A 1AO5A 3LC3A 1HJ9A 1V2KT 1THPB 3TGKE 3P95A 2BYAX 1CU1A 3SU4A 1HAGE 3ZZ4A 5HMAA 2BVSH 3A86A 2FOBA 4DW2U 1WAYB 1JMOH 1E35B 2ZFTA 3AAVA 1TBRH 4FU9A 3URDA 4ABGA 1GJBB 1EASA 5GJ4B 1LPGB 1P2MA 5F8XA 4Z6AH 4D7FA 2ZCLP 1ETRH 2EI8A 1GJ9B 1SOTA 2ESTE 1NO9H 3VEQB 1F0TA 1PQ8A 1GI1A 1A0HB 2A2QH 1C1VH 4I8LA 4LK4A 2W26A 5DPAA 1KYNA 1HAVB 2Z9KA 3MO6A 1O5FH 3KQBA 1ANEA 1C1SA 1H9IE 1W7XH 1BTXA 3F9EA 4GLYA 1AKSB 2GP9B 3BIVH 4OGYA 1KLTA 1O2QA 2G4TA 1QBNA 1YF4A 1V2VT 5TCCA 2HRVA 1Q31A 1O5GH 4QT8C 1M9UA 1HGTH 1GBBA 2VWLA 2HOBA 3RM0H 1GCTC 2BLQA 1G3DA 1FN6A 4ISHH 2GCTB 1GBFA 2ZCKP 1A5HA 1O3PB 3TJOA 1ABJH 1P04A 1JRTA 2RA3A 2VWMA 3BIUH 2ODQA 5AHGH 2ZP0H 1EPTA 1AFQC 3TGJE 2G4UA 2QV1A 3RMLH 1O3DA 2BQWB 4E7NA 1V6DA 2SNVA 1TNKA 5DP3A 1F0SA 3GY2A 2VINA 4VGCC 3BG8A 3A7WA 3L6PA 1G36A 1GI5A 4WMFA 2BX3A 4ZHLU 1HAVA 1C5RA 4ABJA 2QGRA 4M7GA 3B8JA 2BXUH 1O3IA 3HK3B 1LMWB 1P02A 1C4U2 1UHBA 3G01A 3EA9A 1EX3A 4DT7B 1OWEA 1J15A 2G51A 5DG6A 1QR3E 1GJ6A 2G81E 4IMQA 1BTWA 2FTLE 1FONA 2FOCA 4AGKA 1SQOA 1K28D 4YT7H 2J38A 3N7OA 2XRCA 1DOJA 3E91A 2AMDA 1KDQA 4RKJB 3ITIA 2Q1JA 3GY6A 1Y5BT 1CO7E 1SQAA 1SGDE 2A4RA 1TNHA 1ANCA 3ZVBA 3TK6A 3MMGA 1RD3B 3SHCH 2I6QA 1UK2A 1G37A 3SV2H 1G30B 2ZQ2A 1ANBA 1QL8A 5T3HA 1V2RT 2A5AA 1YPHE 3SBKA 3SJKA 1DUAA 4GSOA 1C5PA 1QQ4A 2QXGA 3EA8A 1SG8B 1TMUH 3AAUA 1P01A 1EP5A 5F6MA 3T62A 4D8NA 1O32A 2ANYA 1TBQH 2ZPSA 4U2WA 1ELAA 1MU6B 4K1SA 1C2DA 3KIDU 2Z9GA 2IPHA 1MTUA 2Z9LA 4YLUA 8KME2 1O3HA 1GJ7B 3M35A 1A5IA 2Q6FA 1KXAA 5C1UA 1OP0A 1HJ8A 1V2PT 1VGCB 1ZMJA 1UTQA 3GDSA 3A8BA 2FP7B 1BOQA 1QY6A 3LGTA 3V12A 4E06H 4BAKB 1HXFH 4CR9A 1XKAC 1UMAH 5EQRA 4YOGA 3E8LA 1MTVA 5FCRA 3TK5A 3RXLA 1TA6A 1TQ7B 3H7OA 5JBCS 3UTUH 2FOMB 4MTBA 1ZJKA 4U32A 2IOTA 3VPKA 3WY8A 1QURH 1SMFE 3U1IB 2ZGHA 2ZDVH 3SI4H 4CBOA 4ISLA 2P8OC 4ZKNU 1FMGA 1BTPA 1QCPA 3PROA 1MD7A 1SGFG 3RXUA 1TGTA 2J34A 3ZVEA 1XUGA 1L1NA 3FFGA 1E36B 2ZEBA 4IBLH 1NFYA 1O33A 2BY6X 4VGCB 1KLJH 2AH4X 3BF6H 1EJMA 1SGRE 2HPQH 3BTEE 4YM9A 2FDAA 1O3MA 3HPTB 4X8VH 4D7GA 1AFQB 3SNAA 3PB1E 1EJAA 3Q76A 3UR9A 3T26A 3KQEA 1FIWA 1OP8A 1UK4A 3MO3A 3RXSA 5TCAA 4MNXA 1GJAB 5DJ7A 1YPEH 3FP8E 2QF0A 2WPKS 2BD7A 3RXPA 1BMNH 1QJ6B 3EAJA 1ZTKA 1HDTH 1XUIA 2TBSA 1GHBG 2YNBA 1SQTA 1GMCG 5G4BA 1OYQA 3SJ9A 2BDGA 2TRMA 1SGFA 5JB9S 1V2WT 4R8TB 2AIPA 3HGPA 1YPJH 1P2NA 5DP4A 3IWMA 1HAIH 1GI8B 1DE7H 1GPZA 3TPIZ 2ZQ1A 2ZU5A 2ZHDA 2ZHQH 3MNBA 1P10A 2IN2A 3TJNA 3VB7A 1BJUA 2XBYA 3OYPA 2BXTH 2GT7A 1ZPCA 4J1YA 3ESTA 2Q6DA 2QXHA 1ZMNA 5E8EH 1OOKB 2PKSB 1C5OH 2BY5X 1F5KU 2UWPA 4H4FA 4WXVA 2PTNA 3M7TA 4E05H 1BIOA 2EA3A 2GX4A 4ABAA 4Y0YE 2ZO3H 3EE0B 2F91A 2Q6GA 1K1PA 3GYLB 3DUXH 1KXCA 1RRKA 1GHVH 4O3TA 2GMTB 3D62A 3ZVFA 3O8BA 1EB1H 2ZG0H 1O2JA 3E6PH 3NZIA 1BZXE 1EKBB 2ASUB 1H4WA 1BRUP 3RP2A 2NU0E 3UOUA 3PLPA 3ZVCA 3LKWA 1QRXA 2BDHA 4Y79A 2PGBB 2SFAA 3PO1B 4X0WU 1SLUB 2ODYB 1SLXB 2AGIX 1ZTLA 1S85A 3HKIB 4FU8A 3DFJA 2FEQH 4YO9A 1BJVA 4X2YA 3PLBA 1VR1H 3P92A 3PO1C 1CHOG 3BG4B 5FBEA 4FUJA 2LNCA 1DICA 4ZKSU 2Y81A 5JBTA 4WMEA 1AE5A 4XBBA 3ATMA 5IYTA 5HYOA 2VH0A 3SV7A 1LHFH 4BAQB 1GDQA 4ABDA 4JMYA 4NSYA 1O5EH 3BTQE 4UFFH 4AFUA 1CBWB 3PLKA 1KXEA 3SW2B 3GY8A 1FAXA 2P93A 5DP7A 2VJ1A 3KCGH 1ZSLA 1BMMH 4KTCA 1K1NA 1WTGH 3RLWH 3M5MA 2WYGA 2CF8H 1S5SA 1UJ1A 5F8ZA 3SNEA 1K1JA 3QK1A 1O2ZA 1ORFA 2O8MA 1EZSC 2FM2A 4ZROA 1HBTH 5EXLA 1AQ7A 1W7GH 4AX9H 1AMHA 3FZZA 5FXLA 1BCUH 1O2SA 1DSUA 5E0HA 1W3CA 1F0UA 5A09A 4YOIA 5GCHG 2EI6A 2QAAA 2GD4B 1LTOA 1MKXH 1UVSH 2R0LA 2GT8A 2XWAA 5AFYH 1O2IA 3M3VA 5AFZH 3RXQA 5A0BA 1TGSZ 3GCHB 2XWBI 1KTTB 1MKWK 4AOQA 4UFDH 1Z7KA 3K65B 1O3JA 1IQGA 1HAHH 2QXJA 1YKTA 1GCDA 4HI3A 1NN6A 1O2LA 2WUCA 1UTOA 4WXIA 1ZOMA 1MBQA 1NFUA 3U8RH 2FXRA 1YGCH 4H6SB 1T8LA 3MH4A 2V35A 2GZ9A 2SGAA 1E34B 1TONA 1YCPK 4CRAA 2PHBA 2C93B 1XUHA 1YYY1 2YOLA 1ZZZA 2AGEX 3BV9B 3URCA 1HAXB 2G5VA 1SFQB 1GJCB 4NIVA 1S84A 1GHWH 4FUGA 1JBUH 3BTDE 3P6ZB 1XUJA 2FMJA 1EOLA 1Y5AT 3M5NA 4JZFH 1IQLA 1C4V2 2H2ZA 2PTCE 2VIWA 1T7CA 1ESBA 2ZDNA 4X8SH 3DD2H 1UHBB 1ZHMA 1OSSA 3M3TA 1Q2WA 3RXDA 1Z8RA 3PV4A 3LT3A 4ISNA 1FUJA 2ZFRH 3R0FA 2XNIA 2JKHA 1LKBA 2ZHEH 1E0FD 1ZLRA 4K60A 3SI3H 4MPVA 4ZKRU 3EYDA 4BTIB 2ANKH 1GJ5H 1FIZA 2OCVB 1BBRK 2FLBH 5CHAB 1SL3A 4K8BA 2B8OH 1T8MA 4MG3A 1Q3XA 1V2UT 2ZU4A 1P3CA 2STBE 5F03A 4BAMB 2ZHFH 2A5KA 1O2OA 2Y5GA 2Y5HA 2TGAA 1GHZA 4ZUHA 2VNTA 5C1YA 3A87A 5E2OA 1BHXF 5FPYA 3NK8A 5DGJA 1SGYE 1O30A 1VGCC 5FCKA 1HPGA 4AYVB 4DOQA 3S9BA 1Y3WA 3C27B 3OSYA 1KSNA 3SV9A 1NFWA 1J17T 4WF8A 3V7TA 3FP6E 2VIVA 2ALPA 3UQOA 2FOHA 1YPMH 2OBOA 4PROA 5JBAS 1GJ4H 1G3CA 2ULLA 2Y7ZA 3ELAH 1W14U 1ELBA 3DA9B 4X6PA 1RXPA 3QX5H 4H6TA 1P2IA 3TK9A 4Y8YA 1XKBC 3CENA 5DO4H 1QFKH 3U8OH 1O2HA 4IMZA 1C1NA 4BAHB 1QBVH 2A31A 1P11E 3KEEA 1FZZA 2HNTE 3MFJA 5A8XA 2C8XB 1TX6A 2A2XH 4XE4A 4AZ2B 3VFEA 1TNGA 1NROH 1DPOA 4O9VA 2UUKB 2GKVE 2VH6A 3T5FH 1NU7B 1O35A 4FVBA 4KGAA 2ZDMA 5FBIA 1GVKB 1ZSJA 1QL7A 2PGQB 1DUEA 3ZZ3A 2XW9A 3I78A 1FLEE 1O2GH 3SJ8A 1A7SA 4JZDH 3QO6A 3ZZDA 5DK1A 1JRSA 3GY5A 1P12E 2OP9A 1YPKH 1Z1JA 2J92A 3S9CA 4X2WA 1DWEH 1GBJA 1UVUH 2XXLA 3F1SB 4X1QU 5C2ZA 1BTUA 3RXBA 1A46H 3U98H 1QGFA 1QRZA 2PWXA 2VWOA 2OXSA 4HZHA 1GI3A 4KKDA 4DGJA 2ZDAH 6GCHF 1SGCA 4MVNA 2UUYA 2EEKA 2O8UA 2LPRA 3MI4A 1Z8JB 2AS9A 1NRQH 1CBWC 1CA0C 5GCHF 3Q3YA 1K22H 3ATKA 4YTAA 4Y76A 5C3NA 1B0FA 1DWCH 3BSQA 1K1MA 2CF9H 1TB6H 3ZZBA 2SGPE 3MWIU 3F9FA 1ELCA 1QB9A 1GJ8B 5A2MH 1SLVB 1KXBA 1TPOA 2EI7A 1W13U 4Y11E 2QXIA 2QC2A 4B75A 3BG4C 2UUFB 4K8YA 1SFIA 2BLWA 4WWYA 2Z6BD 1SGNE 1O5CB 2R2MB 3LDXH 1OWDA 2ZPQA 1F5RA 4CRDA 3C1KA 4FVDA 3SJOA 2G52A 5B6OA 1O31A 1OWIA 1HAYB 3QZRA 4DY7B 2FX6A 5EGMA 3FP7E 3FVFB 3VGCC 7ESTE 3GDUA 4A1XA 1SB1H 2FOGA 1C2EA 2FO9A 3ATLA 4NZQA 4BOHA 4HTCH 4THNH 1P57B 1DWBH 2TGPZ 4NWLA 1YPGH 4ZKOU 4E7RG 4HFPB 1P9UA 2BHGA 1DY9A 1PYTC 3ATIA 1EZQA 4IN2A 1GI4A 1SC8U 2CXVA 4MPUA 2G5NA 2GTBA 2V6NA 2ZDLA 1MU8B 1LCYA 2Y82A 5JDUB 2R3UA 4AB9A 1G3BA 2GVFA 1DITH 1TE0A 2PKAB 9ESTA 2ZDKA 4FUIA 1GVLA 3DT0H 5EQQA 3U9AH 3UQVA 4ABHA 3RXVA 1P2OA 2C8YB 3MH5A 6ESTA 1GBTA 1TNIA 1FPCH 3RM2H 3M37A 3PMBB 4TWWA 1P05A 1WTHD 2WPMS 1VJ9U 1JIRA 1C5WB 4TYDA 3Q77A 3MNXA 2JETB 4I8GA 4AFQA 1HRTH 1O2XA 1MQ5A 3FZDA 1TNLA 4GVUA 3VGCB 3RC4A 5LGOA 4X8TH 1AVGH 3QDZB 1P03A 5HM9A 3Q3KA 2QY0B 5A8YA 3TJUA 3BN9A 4BXSA 3BEIB 4NWKA 1D6WA 3SGAE 1FY8E 3FAOA 1MAXA 3PTNA 3QN7A 2BVXH 3RXHA 2P3UB 4WH6A 4TY6A 1CGIE 2G8TA 2RG3A 1C5NH 2ZFPH 4AORA 2STAE 3SGBE 3SZNA 4NFEA 4FUBA 4NIYA 2XCFA 4Q7ZA 1L1JA 1Y59T 5FPTA 1F92A 3TH2H 1C2JA 1AVWA 5C67A 1H8IH 2PFEA 1THSH 1O2MA 3A7VA 1HCGA 4IC5A 1TYNA 1CT2E 2CV3A 1TRNA 2B7DH 1TGCA 5BPEA 1AD8H 1BTZA 2WPLS 3SHAH 5T6GA 2F9VA 1D6RA 5EXNA 4JZEH 1TBZH 4Y10E 3HKJB 1GI2A 1GI7B 3M7UA 3GCNA 2DE9A 1FI8A 4GPGA 3QLPH 2BD8A 2QIQA 2R2WU 1O3FA 1CT4E 4O97A 3HATH 4DIIH 1FV9A 3MHWU 4K5ZA 1RFNA 2VU8E 2GDDA 2WPIS 2GV6A 1SHHB 1FN8A 1N6XA 2ZTXA 3D65E 1LVBA 4J2YB 2HPPH 2W7UA 1U6QA 1GBMA 2ZIQH 1DDJA 1ELGA 4B2CA 4CRGA 1P09A 3RXGA 1PFXC 1VCQA 1C5QA 2SGDE 3EQ0H 2O8LA 1ZPBA 2OD3B 3A7ZA 4XFQA 2BZAA 2PSYA 3MNSA 2G00A 1C5UA 1AVXA 1QRWA 5HXFA 1H1BA 2ZA5A 5C1XA 4Y71A 1OP2A 3TH4H 4NA8A 2M5TA 1FAKH 1ID5H 5GXPA 5EOKA 5H4IB 5L6NH 1C1PA 3ZZCA 1O36A 1GJDB 3IITA 4OS4A 1V2ST 4LXBH 4X6OA 4CRCA 2TGDA 1GBLA 2W7SA 1GI9B 3KNXA 3RXFA 1O2RA 5FX6A 5T6FA 2ZNKH 3GCHC 1BQYA 4A6LA 1FNIA 1WQSA 1O38A 3A84A 2FTMA 1JXPA 1F5LA 1MUEB 1G3EA 1SOZA 1Y3XA 2PLXA 1QB6A 1MTSA 4LOYH 2K1QA 3AW1A 2VVCA 4BTUB 5ETXA 1HIAA 6CHAB 1DT2A 1WU1A 4TWYA 1E37B 4B1TA 1PPCE 3TH3H 3F9HA 3D23A 1PYTD 4WMDA 1GMDG 1CHGA 1UTMA 3OY6U 1V2TT 2A45B 2SNWA 3SV8A 4BXWA 3QGJA 4WH8A 3LGUA 5TJXA 3GISB 3Q3XA 1GBEA 1MAYA 1HUTH 3UOPA 2WYJA 4JCNA 3V3MA 5K7RA 2D2DA 2PKAA 1DS2E 4NCYA 1C1RA 3S9AA 2OLGA 1ZPZA 1TWXB 2Y6TA 3EA7A 2VVVA 4XDEA 3K6ZA 1BDAA 4GHQA 3E0NB 2A32A 1HJAC 1CE5A 4X1RU 4NG9H 4A5TS 2ZF0H 1ZR0A 3VB6A 3A82A 4DCDA 1AIXH 1GBKA 2C8WB 5DP8A 4IS5A 1KXDA 3MNCA 1EZXC 4XOJA 1S82A 4OS6A 3ZVGA 4I31A 5GIBA 1TAWA 4H42U 1NRPH 1O3KA 3ZVAA 1KY9A 5ABWA 4R0IA 1CA0B 3O8RA 3A8AA 4NA7A 3SQHE 2GCTC 1LVYA 4I8HA 3U8TH 1GHAF 1QB1A 3RXOA 5A0AE 1TNJA 3E0PB 2OC0A 1Z1IA 2O8WA 1UTKA 2F3CE 2FYRA 2VIOA 3ZZAA 3O8CA 1ZJDA 3HGNA 2FPZA 2OQ5A 1V2OT 2OINA 1F7ZA 4X8UH 2SGFE 1FXYA 1MTNC 1PQ7A 2FESH 1TGNA 3RXIA 2GCHG 2OC7A 1NT1A 2HNTF 3H7TA 3P8GA 1Z8IB 2QF3A 3RXTA 1UVTH 2ALVA 2AMQA 3LC5A 3P17H 4BNRA 1V2JT 2C3SA 1L4DA 1J9CH 1C2MA 3A8CA 1ACBE 1T8OA 1ZRBA 2BDAA 4ESTE 5DP5A 1QA7A 3RMMH 1K2I1 3BEFB 1TMTH 2PUQH 2FOFA 3GICB 3UNQA 4MDSA 4JYUH 2W3IA 1XVMA 2AIQA 1V2QT 5E2PA 1LKAA 3RU4D 1O3GA 1A3EH 5L30H 1YLDA 1VZQH 2BDYA 1P2JA 4XSKU 1JIMA 3F6UH 5BRRE 1S6FA 2ODPA 2P3FH 1TFXA 5E0GA 4NZLA 3EDXB 1JWTA 2TIOA 3KQDA 2H5CA 3RDZA 3RU4E 5CHAC 1A0LA 2F9PA 3TGIE 1C5TA 5C5OA 4AN7A 1J14A 1CA8B 1O2WA 1J8AA 1ETSH 1EAXA
chains in the Genus database with same CATH superfamily
4FUDA 1YP9A 2AFQB 5L2ZH 1RGQA 2ANMH 4IW4E 1NC6A 1Z8GA 3V0XA 3UNSA 1BBRH 2B0FA 4A7IB 1S83A 1HAPH 1C4Y2 5IK2D 4YOJA 4RKOB 2BDIA 2D1JA 7GCHF 4Y8ZA 1VCPA 4DVAU 3SQEE 1H9HE 3RUOA 2AMPA 2Z3CA 4JK6A 2R9PA 5GPIB 3SUDA 4ASHA 4WY3A 3E3TA 1PPBH 1K1LA 3M7QA 1EAWA 1BT7A 5AF9H 1SGPE 1HJAB 2GMTC 2ZGCA 4ISOA 2C8ZB 1L2EA 4K2YA 1ELDE 2KAIB 5EPYA 1IAUA 4FUCA 3M3SA 1ZYOA 2GZ8A 2OQUA 2ZGXH 3JZ1B 1W0KD 3GY4A 5EPNA 2ZHWH 3LH3A 3ZV8A 2R0KA 4CBNA 1DY8A 3LJJA 1PPGE 1YLCA 1ELVA 2TPIZ 3NPSA 1ZRKA 1GMHF 1QA0A 1OWHA 8GCHG 4Q4LA 4O3UA 5EW2H 1OXGA 1QJ7B 2V3MA 3K2UA 3MU8A 1S6HA 1TQ0B 3N7DA 2VWNA 1DLKB 2Z9IA 5LH8A 2JETC 1LO6A 8ESTE 2Z94A 2NU3E 3U1JB 1PPHE 4JZIA 3H5CB 4X2XA 4D9RA 3M36A 4NFFA 1KXFA 4INHA 1W0YH 1MZDA 3WW7A 3GDVA 1N1LA 1TALA 2W6JD 1H8ED 1RIWC 2ILNA 1PQ5A 4BAOB 1NM6A 4YT6H 2BDBA 3A81A 3BTHE 1AY6H 2H9EH 1IQEA 2XYAA 2V7QD 3QTOH 1DM4B 1GHXH 3HK6B 1BRAA 2O9QA 2KX4A 1GI0A 2JH5D 1FY4A 1YM0A 4DJZB 2ZTYA 1O3BA 3SOSA 3ODDA 3I29A 3TNTA 4Q2KA 1KTSB 1HV7A 1EZUC 2ZI2H 1GBHA 3E90B 3SU0A 2L74A 1WUNH 3BTME 1OX1A 1T4UH 1T32A 2NU4E 4I86A 1CHOF 2FLRH 4MQAA 1UCYH 4INLA 3GCOA 1NFXA 3DFLA 1O5AB 4ZMAH 2IJOB 4DIHH 4ZXXH 1ARCA 3SN8A 3P70B 4F55A 1N6YA 4MNYA 1BHXB 3T28A 3T29A 2M2AA 2ZZUH 1SGTA 1BITA 2F9BH 3VXFH 4ZHAA 2BD3A 4AG1A 1AUJA 4OS2A 3ZYDA 3LU9B 1MZAA 1A61H 1TMBH 3W95A 1IOEA 1P0SH 2OTVA 3STJA 3UREA 2PW8H 2Z3EA 5C0UA 1SVPA 2FZZA 3BEUA 1S6LA 2P8OB 3F2FA 1WBGB 4MLFB 3UWJH 1MKXK 1DLEA 3NCLA 4FUEA 1S0QA 4ABIA 3P8FA 2A4QA 4YESB 4OGXA 1ESAA 2G55A 2AERH 1T8NA 1ZHRA 1AB9C 2H1UA 1UVPA 1K9OE 2V3HH 3SU2A 1GMCF 4MNVA 3DSOA 2A7HA 1C1TA 2H9TH 1HYLA 1SHYA 2PSXA 3JZ2B 3SO3A 2QCYA 2CJIA 3SNCA 1SGQE 1NZQH 1TIOA 1W8BH 3ZZ5A 3E1XB 1FY3A 2Y5FA 1GL0E 1WCZA 3A83A 1O5BB 4O03A 2AYWA 4I8JA 4A92A 3UY9A 5GWZA 1XVOA 3F68H 9LPRA 3F2GA 1HB0B 3LGWA 1D3PB 5SGAE 1W2KH 4XBDA 2D26C 3SGQE 1D9IA 1NU9A 1INCA 3CS7A 3RXRA 4OS5A 2GGVB 1OYTH 3U69H 2J94A 1ZSKA 1EAIA 1C5LH 2GZ7A 1FY1A 3PM3A 1HLTH 1C2GA 5FX5A 1DXWA 4U01A 6GCHG 2A4OA 1ZTJA 4UEHH 2BY7X 1ELEE 1B7XB 1TPPA 4HGCA 2RDEA 1ARBA 3ZV9A 1RTKA 2BB4A 1OPHB 1GBCA 1V2LT 1IQNA 1WYKA 3S0NA 3UFAA 4TPYA 4UFEH 1XMNB 1O3OA 2H5DA 2PKSC 2UUJB 1LPZB 1PQAA 3RMNH 2KAIA 1MBMA 4Q7YA 3NKKA 1O37A 2JH0D 2SGEE 2FI5E 4ISIH 2XTTB 4AFZA 3MQKC 1O2YA 3EE7A 1EP6A 6CHAC 1O3EA 2F9NA 1DX5M 5C17A 1K21H 1OWJA 3A85A 3RXEA 1KDQB 1XXDA 3A88A 2J9NA 1CGJE 3VXEH 1C2HA 1ZGVA 5DKMA 3P8OA 5J4QA 1ZHPA 1VITG 1NRNH 2Z3DA 4Y6DA 1HIAB 3PTBA 1RIWB 1SGIB 1GBAA 1E38B 1EXFA 2FS8A 2PR3A 5F8TA 5PTPA 1GHAG 1SBWA 8LPRA 1YCPM 3NRLA 2BQ7B 1H8DH 3LIWA 4JYTA 1ANDA 1AZZA 1D3QB 1Z6JH 1GHYH 3F9GA 1A1RA 4ABBA 1CGHA 4NIWA 2FODA 3TIUA 3MU1A 2C90B 1HXEH 1LQEA 3UIRA 1IHSH 1ZGIA 1YPHC 3VB4A 3LGYA 4DURA 1BBRE 3KF2A 1K1OA 4WVPE 2NU2E 4F48B 2CHAC 3UWIA 1EPTB 4UD9H 2BMGB 2HLCA 3NXPA 3RXAA 1TX7A 2F83A 3CS0A 1BTHH 2J95A 1L1GA 1EPTC 3LPRA 3RXMA 1XX9A 3PWBA 2QF4A 1W0ZU 3GCTG 1UTNA 1QQUA 1GGDB 5KECA 1TRYA 4A1VA 2BX4A 1TX8A 2BD4A 5LPEA 1EUFA 2NWNA 3S7HB 1W10U 4KTSA 1MCVA 2HLDD 5HIYA 4Q80A 4AG2A 2HVXA 2F4LA 2ZFFH 1C5YB 1AB9B 3QUMP 2CK3D 4CR5A 1WSSH 3V13A 3WWFA 4ABFA 1ZMLA 5CMXH 3QWCH 1MH0A 1GG6C 1LDTT 4U30A 1N8OC 1LQDB 1UVOA 3OTPA 3RXKA 1DVAH 1HAZB 1VITF 1DXPA 2F9OA 3GY7A 5A0CA 2A1DB 4YZUA 3SU1A 1O3LA 1TGBA 4CH2B 1THRH 3AVZA 4ZXYH 1SI5H 2A0QB 4I32A 4LZ4B 1IQMA 3A8DA 4RN6A 4UDWH 3SNDA 2OC8A 1GI6A 3ODFA 4FUHA 3ZVDA 4K3JA 1IHTH 4XRNA 1VITH 4X1PU 2J4IA 4AB8A 5EQSA 3K9XB 1C5XB 3BTKE 1XUFA 3MH6A 4A1TA 1BB0B 1YY3A 1WV7H 1TLDA 2ZFQH 3RMOH 2WV5A 2VGCC 1O34A 4F4OC 3MYWA 5K0HA 2P94A 2ZECA 2HGTH 1O2VA 4F49A 1LPKB 3ZZ8A 5AVDA 3SZEA 4X2VA 1C2FA 2J5UA 2C4FH 1P3EA 1XM1A 5FPSA 4OS1A 1O3CA 5T6DA 3M5OA 3A7XA 1C1QA 4INKA 2FOAA 4I7YH 2ZGBH 2V3OH 1A5GH 5JYIA 1MMJN 3SUGA 8GCHF 2BZ6H 3B23B 1V3XA 1VCWA 1FQ3A 4AFSA 1EAUA 1O2PA 4JYVH 2THFB 3BTFE 4Z0KA 4D9QA 3ZZ6A 1RTLA 4Y0ZE 1C9TA 5LPRA 1DANH 2DUCA 5EODA 1OS8A 1SPJA 3A7YA 1O3AA 5DP6A 1K1IA 2FI4E 3QTVH 4HG6A 4IC6A 1ABIH 1AHTH 1QTFA 3LJOA 3O8DA 3M61U 3RXJA 1O2TA 3LGVA 2CMYA 1AUTC 1C2LA 3STIA 3VB5A 1FX0B 1MKWH 1UTJA 4FU7A 1GG6B 2GV7A 3L33A 2JJ2D 2NU1E 4KELA 4BTTB 3KL6A 1HFDA 3R3GB 3F0OA 4X6NA 1O5DH 2JH6D 1CVWH 4LZ1H 4ZAEA 1YC0A 3OTJE 1EB2A 1P8VC 1NBME 3IG6B 2EC9H 1QBOA 1AFEH 2ZGJA 4P00A 1NS3A 4MPWA 2BD5A 3SJIA 1C2KA 1O0DH 3K6YA 1C1OA 1BA8B 2TGTA 1GDNA 3KHVA 3SORA 2Z9JA 1C5ZB 1GGDC 5JB8S 2VVUA 3NUMA 2J2UA 4NGAH 5GDSH 2CGAA 1B5GH 4NA9H 5J4SA 4GHTA 7LPRA 3BTWE 3UUZA 2XCNA 4CHAB 1SKYE 1PPFE 3S7KB 1EATA 1O2KA 1AN1E 5ESTE 1HAOH 3A80A 4Q7XA 2VIQA 5FL7D 1BRCE 3VB3A 2PV9B 2P95A 3LH1A 3P8NA 4OS7A 5EXMA 4FOUC 3A89A 1FDPA 1FY5A 4FUFA 4D76A 4DG4A 1V2NT 5C20A 2ZPRA 5EW1H 1FPHH 3PRDA 1TABE 3KQCA 3SNBA 5HGGA 1TRMA 2WV4A 5LPFA 2BLOA 1X7AC 3GCTF 2UWLA 2ZC9H 4ABEA 1G2LA 1V2MT 5EG4A 2L6OA 1GMDF 1TOCB 1J16A 1NESE 2A7CA 4MPXA 2LP6A 2BDCA 2QYIA 2ZU1A 4UFGH 1O3NA 1IQFA 1O39A 2H6MA 2P16A 1CQQA 5IDKA 1W12U 1BMAA 1HNEE 2ZWLH 3QGNB 1TPAE 1YCPH 2FOEA 3BTTE 1RS0A 3TU7H 2GDEH 1BUIA 3LOXA 1AU8A 2QA9E 1Y8TA 1IQHA 2JJ1D 3L3TA 1E79D 6LPRA 2YNAA 3FANA 1F2SE 3RXCA 1AZ8A 1A3BH 3UR6A 4WJG2 2BQ6B 1DSTA 1IQIA 2BM2A 3KGPA 1C2IA 1P9SA 1EQ9A 3W94A 1Y5UT 1XUKA 1LHDH 1LHGH 3KN2A 2PUXB 3ZYEA 2AEIH 2FWWA 1P2KA 4KTUA 3KQ5A 1G9IE 3PMAB 1CSOE 5FHTA 5FAHA 1Y3VA 2BLVA 2KM0A 5L2YH 5HM2A 1BRBE 3S69A 4XBCA 3ZZ9A 2BTCE 4FXGH 4Y7BA 4B76A 2RDLA 1L4ZA 4B2AA 4TSFD 1SLWB 1P2QA 2FIRH 1EOJA 3UPEA 2B5TB 3D49H 3GY3A 2OUAA 1GCTB 2A5IA 3ENSB 4KP0A 1Z71A 1LHCH 5JBBS 3ATWA 5I25A 1BTYA 1D4PB 3I77A 4CHAC 1C5SA 4ZH8A 3OU0A 2W5EA 3SUFA 4XD7D 3PMHB 3MOCA 2J98B 3M5LA 1GBDA 1P06A 3TVJB 3GOVB 3TLOA 2XBWA 2H9HA 4Y7AA 2GCHF 2LELA 3F2HA 3PWCA 4X6MA 3BTGE 3SU3A 4JK5A 3MH7A 4TPIZ 2IPQX 4TY7A 3PRBA 4GAWA 1O2NA 4X1SU 3TNSA 3SU6A 1UK3A 1D3TB 2P59A 1ELFA 1B0EA 4CRBA 1S81A 2O8TA 2OK5A 1C1MA 4B2BA 3RU4T 1C1WH 3MU4A 1MQ6A 1EJNA 1NPMA 2VBCA 4CRFA 3EGKH 3LGIA 4ACAA 1IQKA 1QNJA 2V0BA 4CREA 2WUBA 1SGEE 4AYYB 1H9LB 2HNTC 1GDUA 2XBXA 5DP9A 2FS9A 1T31A 1WOFA 2W3KA 3RLYH 1G2MA 3PMJA 1AE8H 3LONA 2DE8A 1BMLA 1T4VH 4B71A 2FI3E 3FOAA 1NRRH 1AKSA 1QIXB 2XC5A 1MTNB 1WQVH 2VIDA 3DHKH 1QJ1B 1JOUB 3E16B 1E1QD 3ZIAD 2AHME 1GL1A 1Y3YA 2Y80A 3SU5A 2UWOA 2HALA 1PJPA 2WV9A 4IGDA 7GCHG 2VIPA 5EJLA 2AGGX 1UTPA 4K1TA 1FJSA 5I46H 2VB0A 3CP7A 4B73A 2BD2A 4M9FA 5GNDA 1GBIA 2I6SA 1F0RA 4UE7H 2WPHS 3F0PA 2FYQA 3OY5U 2BVRH 2KCAA 2D8WA 4X1NU 2QN5T 3MO9A 1Z6EA 1DWDH 1OKXA 4Y8XA 4I8KA 2WZQA 4GCHF 4NIXA 4UONA 5CDFE 2WINI 1MCTA 3TJVA 3MU0A 1SR5C 2VGCB 1XXFA 2BY8X 2WPJS 1SSXA 1MD8A 1UTLM 3NWUA 3ZZ7A 5E0JA 3SV6A 1NRSH 4BANB 5CE1A 2RA0A 5EU8A 3T25A 1RJXB 1S0RA 3A7TA 4SGBE 3MU5A 3Q00A 1VJAU 4MNWA 1GMHG 1QHRB 1ETTH 1PPEE 1GVZA 2XOKD 1TPSA 1KIGH 2B9LA 2RFKC 1COWD 2BY9X 2P3TB 2CN0H 2KR7A 3UB0A 1L0ZA 2Y7XA 2A4GA 2XC4A 3T27A 4IN1A 2K0QA 1YBWA 2BOHB 2BD9A 1CT0E 1YPLH 1UO6A 1A2CH 1UCYK 4I33A 2A7JA 1N8OB 2ZTZA 1KLIH 5HIZA 1TA2A 1G32B 1RTFB 2FX4A 4NSVA 1TOMH 1GHBF 2ZKSA 2SGQE 1OWKA 2OC1A 4K69A 4JZ1A 1GWAA 5JPMH 2KCOA 4B74A 4K1EA 1D3DB 3DCLA 2ZU2A 3TITA 3UNRA 3FKSD 3RC6A 1QZ8A 1AI8H 1UCYE 2Z7FE 1LVOA 2BOKA 5ESBA 4GCHG 3WWBA 1AGJA 4CH8B 1LVMA 3SUEA 1LHEH 1A4WH 3QZQA 3MTYA 2ZCHP 4AGJA 3PYHA 5A8ZA 3AASA 2XNDD 4SGAE 4GUXA 1C5VA 1AWFH 1Y3UA 2XBVA 2F9UA 1ELTA 1C9PA 2OBQA 3AW0A 3OX7U 3B9FH 3T2NA 1ESTA 1PPZA 1IQJA 3H09A 5F53A 5C5NA 2ZU3A 1AWHB 3GYMA 2XC0A 4P02A 7KMEH 1C5MD 2ZFSA 2HWLB 2CHAB 1W11U 1O2UA 1A0JA 1DFPA 4ZHMU 1C1UH 1NY22 4YLQH 1NTPA 4RSPA 2ANWA 2R3YA 3RC5A 2KZ4A 2RCEA 3F3BA 1MTWA 1QL9A 1AO5A 3OAAD 3LC3A 1HJ9A 1V2KT 1THPB 3TGKE 3P95A 2BYAX 1CU1A 3SU4A 1HAGE 3ZZ4A 5HMAA 2BVSH 3A86A 2FOBA 4DW2U 1WAYB 1JMOH 1E35B 2ZFTA 3AAVA 1TBRH 4FU9A 3URDA 4ABGA 1GJBB 1SQRA 1EASA 5GJ4B 1LPGB 1P2MA 5F8XA 4Z6AH 4D7FA 2ZCLP 1ETRH 2EI8A 1GJ9B 1SOTA 2ESTE 1NO9H 3VEQB 1F0TA 1PQ8A 3FO8D 1GI1A 1A0HB 2A2QH 1C1VH 4I8LA 4LK4A 2W26A 5DPAA 1KYNA 1HAVB 2Z9KA 3MO6A 1O5FH 3KQBA 1ANEA 1C1SA 1H9IE 1W7XH 1BTXA 3F9EA 4GLYA 1AKSB 2GP9B 3BIVH 4OGYA 5C94A 1KLTA 1O2QA 2G4TA 1QBNA 1YF4A 1V2VT 5TCCA 2HRVA 1Q31A 1O5GH 4QT8C 1M9UA 5KGOA 1HGTH 1GBBA 2VWLA 2HOBA 3RM0H 1GCTC 2BLQA 1KMHB 1G3DA 1FN6A 4ISHH 2GCTB 1GBFA 2ZCKP 1K0HA 1A5HA 1O3PB 3TJOA 1ABJH 1P04A 1JRTA 2RA3A 2VWMA 3BIUH 2ODQA 5AHGH 2ZP0H 4ASUD 1EPTA 1AFQC 3TGJE 2G4UA 2QV1A 3RMLH 1O3DA 2BQWB 4E7NA 1V6DA 2SNVA 1TNKA 5DP3A 1F0SA 3GY2A 5EJZA 2VINA 4VGCC 3BG8A 3A7WA 3L6PA 1G36A 1GI5A 4WMFA 2BX3A 4ZHLU 1HAVA 1C5RA 4ABJA 2QGRA 4M7GA 1YLNA 3B8JA 2BXUH 1O3IA 3HK3B 1LMWB 1P02A 1C4U2 1UHBA 3G01A 3EA9A 1EX3A 2KCPA 1OWEA 4DT7B 1J15A 2G51A 5DG6A 1QR3E 1GJ6A 2G81E 2QF5A 4IMQA 1BTWA 2FTLE 1FONA 2FOCA 4AGKA 1SQOA 1K28D 4YT7H 2J38A 3N7OA 2XRCA 1DOJA 3E91A 2AMDA 1KDQA 4RKJB 3ITIA 2Q1JA 3GY6A 1Y5BT 1CO7E 1SQAA 1SGDE 1VKYA 1TNHA 2A4RA 1ANCA 3DSPA 3ZVBA 3TK6A 3KYGA 3MMGA 1RD3B 3SHCH 1H8HD 3CNRA 2I6QA 1UK2A 1G37A 3SV2H 1G30B 2ZQ2A 2W6ID 1ANBA 1QL8A 5T3HA 1V2RT 2A5AA 1YPHE 3SBKA 3SJKA 1DUAA 4GSOA 1C5PA 1QQ4A 2QXGA 4DT4A 3EA8A 1SG8B 1TMUH 3AAUA 1P01A 1EP5A 5F6MA 3T62A 4D8NA 1O32A 2ANYA 1TBQH 2ZPSA 4U2WA 1ELAA 1MU6B 4K1SA 1C2DA 3KIDU 2Z9GA 2IPHA 1MTUA 2Z9LA 4YLUA 8KME2 1O3HA 1GJ7B 3M35A 1A5IA 2Q6FA 1YWUA 1KXAA 5C1UA 1OP0A 1HJ8A 1V2PT 1VGCB 1ZMJA 1UTQA 3GDSA 3A8BA 2FP7B 1BOQA 1QY6A 3LGTA 3V12A 4E06H 4BAKB 5EIYA 1HXFH 4RI0A 4CR9A 1XKAC 1UMAH 5EQRA 4YOGA 3E8LA 1MTVA 5FCRA 3TK5A 3RXLA 1TA6A 1TQ7B 3H7OA 5JBCS 3UTUH 2FOMB 4MTBA 1ZJKA 4U32A 2IOTA 3VPKA 3WY8A 1QURH 1SMFE 3U1IB 2ZGHA 2ZDVH 3SI4H 4CBOA 4ISLA 2P8OC 4ZKNU 1FMGA 1BTPA 1QCPA 3PROA 1MD7A 1SGFG 3RXUA 1TGTA 2J34A 3ZVEA 1XUGA 1L1NA 3FFGA 1E36B 2ZEBA 2IJD1 1NFYA 4IBLH 1O33A 2BY6X 4VGCB 1KLJH 2AH4X 3BF6H 1EJMA 1SGRE 2HPQH 3BTEE 4YM9A 2FDAA 1O3MA 3HPTB 4X8VH 4D7GA 1AFQB 3SNAA 1OHHD 3PB1E 1EJAA 3Q76A 3UR9A 3T26A 3KQEA 1FIWA 1OP8A 1UK4A 3MO3A 3RXSA 5TCAA 4MNXA 1GJAB 5DJ7A 1YPEH 3FP8E 2QF0A 2WPKS 2BD7A 3RXPA 1BMNH 1QJ6B 3EAJA 1ZTKA 1HDTH 1XUIA 2TBSA 1GHBG 2YNBA 1SQTA 1GMCG 5G4BA 1OYQA 1UW7A 3SJ9A 2BDGA 2TRMA 1SGFA 5JB9S 2WHXA 1V2WT 4B6EA 4R8TB 2AIPA 3HGPA 1YPJH 1P2NA 5DP4A 3IWMA 1HAIH 1GI8B 1DE7H 1GPZA 3VG8A 3TPIZ 2ZQ1A 2ZU5A 2ZHDA 2ZHQH 3MNBA 1P10A 2IN2A 3TJNA 3VB7A 1BJUA 2XBYA 3OYPA 2BXTH 2GT7A 1ZPCA 4J1YA 3ESTA 2Q6DA 2QXHA 1ZMNA 5E8EH 1OOKB 2PKSB 1C5OH 2BY5X 4TT3D 1F5KU 2UWPA 4H4FA 4WXVA 2PTNA 3M7TA 4E05H 1BIOA 2EA3A 2GX4A 3PV5A 4ABAA 4Y0YE 2ZO3H 3EE0B 2F91A 2Q6GA 1K1PA 3GYLB 3DUXH 1KXCA 1RRKA 1GHVH 4O3TA 2F43B 2GMTB 3D62A 3ZVFA 3O8BA 1EB1H 2ZG0H 1O2JA 3E6PH 3NZIA 1BZXE 1EKBB 2ASUB 1H4WA 1BRUP 3RP2A 2NU0E 3UOUA 3PLPA 3ZVCA 3LKWA 1QRXA 2BDHA 4Y79A 2PGBB 2SFAA 3PO1B 4X0WU 1SLUB 2ODYB 1SLXB 2AGIX 1ZTLA 1S85A 3HKIB 4FU8A 4Q63A 3DFJA 2FEQH 4YO9A 1BJVA 4X2YA 3PLBA 1VR1H 3P92A 3PO1C 1CHOG 3BG4B 5FBEA 4FUJA 2LNCA 1DICA 4ZKSU 2Y81A 5JBTA 4WMEA 1AE5A 4XBBA 3ATMA 5IYTA 5HYOA 2VH0A 3SV7A 1LHFH 4BAQB 1GDQA 4ABDA 4JMYA 4NSYA 1O5EH 3BTQE 4UFFH 4AFUA 1CBWB 3PLKA 1KXEA 3SW2B 3GY8A 1FAXA 2P93A 5DP7A 2VJ1A 3KCGH 1ZSLA 1BMMH 4KTCA 1K1NA 1WTGH 3RLWH 3M5MA 2WYGA 2CF8H 1S5SA 1UJ1A 5F8ZA 3SNEA 1K1JA 3QK1A 1O2ZA 1ORFA 2O8MA 1EZSC 1W0JD 2FM2A 4ZROA 1HBTH 5EXLA 1AQ7A 1W7GH 4AX9H 1AMHA 3FZZA 5FXLA 1BCUH 1O2SA 1DSUA 5E0HA 1W3CA 1F0UA 5A09A 4YOIA 5GCHG 2EI6A 2QAAA 2GD4B 1LTOA 1MKXH 1UVSH 2R0LA 2GT8A 2XWAA 5AFYH 1O2IA 3M3VA 5AFZH 3RXQA 3W1EA 5A0BA 1TGSZ 3GCHB 2XWBI 1KTTB 1MKWK 4AOQA 4UFDH 1Z7KA 3K65B 1O3JA 1IQGA 1HAHH 2QXJA 1YKTA 1GCDA 4HI3A 1NN6A 1O2LA 2WUCA 1UTOA 4WXIA 1ZOMA 1MBQA 1NFUA 3U8RH 2FXRA 1YGCH 4H6SB 1T8LA 3MH4A 2V35A 2GZ9A 2SGAA 1E34B 1TONA 1YCPK 4CRAA 2PHBA 2C93B 1XUHA 1YYY1 2YOLA 1ZZZA 2AGEX 3BV9B 3URCA 1HAXB 2G5VA 1SFQB 1GJCB 4NIVA 1S84A 1GHWH 4FUGA 1JBUH 3BTDE 3U28C 3P6ZB 1XUJA 2FMJA 1EOLA 1Y5AT 3M5NA 4JZFH 1IQLA 1C4V2 2H2ZA 2PTCE 3OE7D 2VIWA 1T7CA 1ESBA 2ZDNA 4X8SH 3DD2H 1UHBB 1ZHMA 1OSSA 3M3TA 5T1VA 1Q2WA 3RXDA 1Z8RA 3PV4A 3LT3A 4ISNA 1FUJA 2ZFRH 3R0FA 2XNIA 5C0TA 2JKHA 1LKBA 2ZHEH 1E0FD 1ZLRA 4K60A 3SI3H 4MPVA 4ZKRU 3EYDA 4BTIB 2ANKH 1GJ5H 1FIZA 2OCVB 1BBRK 2FLBH 5CHAB 1SL3A 4K8BA 2B8OH 1T8MA 4MG3A 1Q3XA 1V2UT 2ZU4A 1P3CA 2STBE 5F03A 4BAMB 2ZHFH 2A5KA 1O2OA 2Y5GA 2Y5HA 2TGAA 1GHZA 4ZUHA 2VNTA 5C1YA 3A87A 5E2OA 1BHXF 5FPYA 3NK8A 5DGJA 1SGYE 1O30A 1VGCC 5FCKA 1HPGA 4AYVB 4DOQA 2GJGA 3S9BA 3SYJA 1Y3WA 3C27B 3OSYA 1KSNA 3SV9A 1NFWA 1J17T 4WF8A 3V7TA 3FP6E 2ALPA 2VIVA 3UQOA 2FOHA 1YPMH 2OBOA 4PROA 5JBAS 1GJ4H 1G3CA 2ULLA 2Y7ZA 3ELAH 1W14U 5B6LA 1ELBA 3DA9B 4X6PA 1RXPA 3QX5H 4H6TA 1P2IA 3TK9A 2PP6A 3N99A 4Y8YA 1XKBC 3CENA 5DO4H 1E1RD 1QFKH 3U8OH 2KCYA 1O2HA 4IMZA 1C1NA 4BAHB 1QBVH 2A31A 3N7EA 1P11E 3KEEA 1FZZA 2HNTE 3MFJA 5A8XA 2C8XB 1TX6A 2A2XH 4XE4A 4AZ2B 3VFEA 1TNGA 1NROH 1DPOA 4O9VA 2UUKB 2GKVE 2VH6A 2J97A 3T5FH 1NU7B 1O35A 4FVBA 4KGAA 2ZDMA 5FBIA 1GVKB 1ZSJA 1QL7A 2PGQB 1DUEA 3ZZ3A 2XW9A 3I78A 1FLEE 1O2GH 3SJ8A 1A7SA 4JZDH 3QO6A 3ZZDA 5DK1A 1JRSA 3GY5A 1P12E 2OP9A 1YPKH 1Z1JA 2J92A 3S9CA 4X2WA 1DWEH 1GBJA 1UVUH 2XXLA 5KEDA 3F1SB 4X1QU 5C2ZA 1BTUA 3RXBA 1A46H 3U98H 1QGFA 1QRZA 2PWXA 2VWOA 2OXSA 4HZHA 1GI3A 4KKDA 4DGJA 3AK5A 2ZDAH 2J98A 6GCHF 1SGCA 4MVNA 2UUYA 2EEKA 2O8UA 2LPRA 3MI4A 1Z8JB 2AS9A 1NRQH 3FN8A 4OM9A 1CBWC 1CA0C 2QE7D 2YMSD 1K22H 3Q3YA 5GCHF 3ATKA 4YTAA 4Y76A 5C3NA 1B0FA 1DWCH 3BSQA 1K1MA 2CF9H 1TB6H 3ZZBA 2SGPE 3MWIU 3F9FA 1ELCA 1QB9A 1GJ8B 5A2MH 1SLVB 1KXBA 1TPOA 2EI7A 1W13U 4Y11E 2KFWA 2QXIA 2QC2A 4B75A 3BG4C 2UUFB 4K8YA 1SFIA 2BLWA 4WWYA 2Z6BD 1SGNE 1O5CB 2R2MB 5CHBA 3LDXH 1OWDA 2ZPQA 1F5RA 4CRDA 3C1KA 4FVDA 3SJOA 2G52A 5B6OA 1O31A 1OWIA 3KYFA 1HAYB 3QZRA 4DY7B 2FX6A 5EGMA 3FP7E 3FVFB 3VGCC 7ESTE 3GDUA 4A1XA 1SB1H 2FOGA 1C2EA 2FO9A 2YMSC 3ATLA 4NZQA 4BOHA 4HTCH 4THNH 1NBMD 1P57B 1DWBH 2TGPZ 4NWLA 1YPGH 4ZKOU 4E7RG 4HFPB 1P9UA 2BHGA 4RT1A 1DY9A 1PYTC 3ATIA 1EZQA 4IN2A 1GI4A 1SC8U 2CXVA 4MPUA 2G5NA 2GTBA 2V6NA 2ZDLA 1MU8B 1BMFD 1LCYA 2Y82A 5JDUB 2R3UA 4AB9A 1G3BA 2GVFA 1DITH 1TE0A 2PKAB 9ESTA 2ZDKA 4FUIA 1GVLA 3DT0H 5EQQA 3U9AH 3UQVA 4ABHA 3RXVA 1P2OA 2C8YB 3MH5A 6ESTA 1GBTA 1TNIA 1FPCH 1MABB 3RM2H 3M37A 3PMBB 4TWWA 1P05A 1WTHD 2WPMS 1VJ9U 1JIRA 1WXRA 1C5WB 4TYDA 3Q77A 3MNXA 2JETB 4I8GA 4AFQA 1HRTH 1O2XA 1MQ5A 3FZDA 1TNLA 4GVUA 3VGCB 3RC4A 5LGOA 4X8TH 1AVGH 3QDZB 1P03A 5HM9A 3Q3KA 2QY0B 5A8YA 3TJUA 3BN9A 4BXSA 3BEIB 4NWKA 1D6WA 3SGAE 1FY8E 3FAOA 1MAXA 3PTNA 3QN7A 2BVXH 3RXHA 2P3UB 4WH6A 4TY6A 1CGIE 2G8TA 2RG3A 1C5NH 2ZFPH 4AORA 2STAE 3SGBE 3SZNA 4NFEA 2HVYB 4FUBA 4NIYA 2XCFA 4Q7ZA 1L1JA 1Y59T 5FPTA 1F92A 3TH2H 1C2JA 1AVWA 5C67A 1H8IH 2PFEA 1THSH 1O2MA 3A7VA 1HCGA 4IC5A 4Z1MD 1TYNA 1CT2E 2CV3A 1TRNA 2B7DH 1TGCA 5BPEA 1AD8H 1BTZA 2WPLS 3SHAH 5T6GA 2F9VA 1D6RA 5EXNA 4JZEH 1TBZH 4Y10E 3HKJB 1GI2A 1GI7B 3M7UA 3GCNA 2DE9A 1FI8A 4GPGA 3QLPH 2BD8A 2QIQA 1EFRD 2R2WU 1O3FA 1CT4E 4O97A 3HATH 4DIIH 1FV9A 3MHWU 4K5ZA 1RFNA 2VU8E 2GDDA 2WPIS 2GV6A 1SHHB 1FN8A 1N6XA 2ZTXA 3D65E 1LVBA 4J2YB 2HPPH 2W7UA 1U6QA 1GBMA 2ZIQH 1DDJA 1ELGA 4B2CA 4CRGA 1P09A 3RXGA 1PFXC 1VCQA 1C5QA 2SGDE 3EQ0H 2O8LA 1ZPBA 2OD3B 3A7ZA 3DSGA 4XFQA 2BZAA 2PSYA 3MNSA 2G00A 1C5UA 3OEHD 1AVXA 1QRWA 5HXFA 1H1BA 2ZA5A 5C1XA 4Y71A 1OP2A 3TH4H 4NA8A 2M5TA 1FAKH 5DSFA 1ID5H 5GXPA 5EOKA 5H4IB 5L6NH 2YMSB 1C1PA 3ZZCA 1O36A 1GJDB 3IITA 4OS4A 1V2ST 4LXBH 4X6OA 4CRCA 2TGDA 1GBLA 5EJ1A 2W7SA 1GI9B 3KNXA 3RXFA 1O2RA 4RT0A 5FX6A 5T6FA 2ZNKH 3GCHC 1BQYA 4A6LA 1FNIA 1WQSA 1O38A 3A84A 2FTMA 1JXPA 3OEED 1F5LA 1MUEB 1G3EA 1SOZA 1Y3XA 2PLXA 1QB6A 1MTSA 4LOYH 2K1QA 3AW1A 2VVCA 4BTUB 5ETXA 1HIAA 6CHAB 1DT2A 1WU1A 4TWYA 1E37B 4B1TA 1PPCE 3TH3H 3F9HA 3D23A 1PYTD 2EY4C 4WMDA 1GMDG 1CHGA 1UTMA 3OY6U 1V2TT 2A45B 2SNWA 3SV8A 4BXWA 3QGJA 4WH8A 3LGUA 5TJXA 3GISB 3Q3XA 1GBEA 1MAYA 1HUTH 3UOPA 2WYJA 4JCNA 2WPDD 3V3MA 5K7RA 2D2DA 2PKAA 1DS2E 4NCYA 4FETA 1C1RA 3S9AA 2OLGA 1ZPZA 1TWXB 2Y6TA 3EA7A 2VVVA 4XDEA 3K6ZA 1BDAA 4GHQA 3E0NB 3OFND 2A32A 1HJAC 4AC9A 1CE5A 4X1RU 4NG9H 5DN6D 4ZCNA 4A5TS 2ZF0H 1ZR0A 3VB6A 3A82A 4DCDA 1AIXH 1GBKA 2C8WB 5DP8A 4IS5A 1KXDA 3MNCA 1EZXC 4XOJA 1S82A 4OS6A 3ZVGA 4I31A 5GIBA 1TAWA 4H42U 1NRPH 1O3KA 3ZVAA 1KY9A 5ABWA 4R0IA 1CA0B 3O8RA 3A8AA 4NA7A 3SQHE 2GCTC 2K8IA 1LVYA 4I8HA 1WDIA 3U8TH 1GHAF 4YXWD 1QB1A 3RXOA 5A0AE 1TNJA 3E0PB 2OC0A 1Z1IA 2O8WA 1UTKA 4ACBA 2F3CE 2FYRA 3GS9A 2VIOA 3ZZAA 3O8CA 1ZJDA 3HGNA 2FPZA 2OQ5A 1V2OT 2OINA 1F7ZA 4X8UH 2SGFE 1FXYA 1MTNC 1PQ7A 2FESH 1TGNA 3RXIA 2GCHG 2OC7A 1NT1A 2HNTF 3H7TA 3P8GA 1Z8IB 2QF3A 5HKKD 3RXTA 1UVTH 2ALVA 2AMQA 3LC5A 3P17H 4BNRA 3UAIC 1V2JT 2C3SA 1L4DA 1J9CH 1C2MA 3A8CA 2JIZD 1ACBE 1T8OA 1ZRBA 2BDAA 4ESTE 5DP5A 1QA7A 3RMMH 1K2I1 2EQNA 3BEFB 1TMTH 2PUQH 2FOFA 3GICB 3UNQA 4MDSA 4JYUH 2W3IA 1XVMA 2AIQA 1V2QT 5E2PA 1LKAA 3RU4D 1O3GA 1A3EH 5L30H 4B6FA 1YLDA 1VZQH 2BDYA 1P2JA 4XSKU 1JIMA 3PV2A 3F6UH 5BRRE 1S6FA 2ODPA 2P3FH 1TFXA 5E0GA 4NZLA 3EDXB 2JDID 1JWTA 2TIOA 3KQDA 2H5CA 2WSSD 3RDZA 3RU4E 5CHAC 1A0LA 2F9PA 3TGIE 1C5TA 5C5OA 4AN7A 1J14A 1CA8B 1O2WA 1J8AA 1ETSH 1EAXA
chains in the Genus database with same CATH topology
4FUDA 1YP9A 2AFQB 5L2ZH 1RGQA 2ANMH 4IW4E 1NC6A 1Z8GA 3V0XA 3UNSA 1BBRH 2B0FA 4A7IB 1S83A 1HAPH 1C4Y2 4YOJA 4RKOB 2BDIA 2D1JA 7GCHF 4Y8ZA 1VCPA 4DVAU 3SQEE 1H9HE 3RUOA 2AMPA 2Z3CA 4JK6A 2R9PA 5GPIB 3SUDA 4ASHA 4WY3A 3E3TA 1PPBH 1K1LA 3M7QA 1EAWA 1BT7A 5AF9H 1SGPE 1HJAB 2GMTC 2ZGCA 4ISOA 2C8ZB 1L2EA 4K2YA 1ELDE 2KAIB 5EPYA 1IAUA 4FUCA 3M3SA 1ZYOA 2GZ8A 2OQUA 2ZGXH 3JZ1B 3GY4A 5EPNA 2ZHWH 3LH3A 3ZV8A 2R0KA 4CBNA 1DY8A 3LJJA 1PPGE 1YLCA 1ELVA 2TPIZ 3NPSA 1ZRKA 1GMHF 1QA0A 1OWHA 8GCHG 4O3UA 5EW2H 1OXGA 1QJ7B 3K2UA 3MU8A 1S6HA 1TQ0B 2VWNA 1DLKB 2Z9IA 5LH8A 2JETC 1LO6A 8ESTE 2Z94A 2NU3E 3U1JB 1PPHE 4JZIA 3H5CB 4X2XA 4D9RA 3M36A 4NFFA 1KXFA 4INHA 1W0YH 1MZDA 3GDVA 1N1LA 1TALA 1RIWC 2ILNA 1PQ5A 4BAOB 1NM6A 4YT6H 2BDBA 3A81A 3BTHE 1AY6H 2H9EH 1IQEA 2XYAA 3QTOH 1DM4B 1GHXH 3HK6B 1BRAA 2O9QA 1GI0A 2JH5D 1FY4A 1YM0A 4DJZB 2ZTYA 1O3BA 3SOSA 3ODDA 3I29A 3TNTA 4Q2KA 1KTSB 1HV7A 1EZUC 2ZI2H 1GBHA 3E90B 3SU0A 1WUNH 3BTME 1OX1A 1T4UH 1T32A 2NU4E 1CHOF 2FLRH 4MQAA 1UCYH 4INLA 3GCOA 1NFXA 3DFLA 1O5AB 4ZMAH 2IJOB 4DIHH 4ZXXH 1ARCA 3SN8A 3P70B 1N6YA 4MNYA 1BHXB 3T28A 3T29A 2ZZUH 1SGTA 1BITA 2F9BH 3VXFH 4ZHAA 2BD3A 4AG1A 1AUJA 4OS2A 3ZYDA 3LU9B 1MZAA 1A61H 1TMBH 3W95A 1IOEA 1P0SH 2OTVA 3STJA 3UREA 2PW8H 2Z3EA 1SVPA 2FZZA 3BEUA 2P8OB 1WBGB 4MLFB 3UWJH 1MKXK 1DLEA 3NCLA 4FUEA 1S0QA 4ABIA 3P8FA 2A4QA 4YESB 4OGXA 1ESAA 2G55A 2AERH 1T8NA 1ZHRA 1AB9C 2H1UA 1UVPA 1K9OE 2V3HH 3SU2A 1GMCF 4MNVA 2A7HA 1C1TA 2H9TH 1HYLA 1SHYA 2PSXA 3JZ2B 3SO3A 2QCYA 2CJIA 3SNCA 1SGQE 1NZQH 1TIOA 1W8BH 3ZZ5A 3E1XB 1FY3A 2Y5FA 1GL0E 1WCZA 3A83A 1O5BB 4O03A 2AYWA 4I8JA 4A92A 3UY9A 5GWZA 1XVOA 3F68H 9LPRA 1HB0B 3LGWA 1D3PB 5SGAE 1W2KH 4XBDA 2D26C 3SGQE 1D9IA 1NU9A 1INCA 3CS7A 3RXRA 4OS5A 2GGVB 1OYTH 3U69H 2J94A 1ZSKA 1EAIA 1C5LH 2GZ7A 1FY1A 3PM3A 1HLTH 1C2GA 5FX5A 1DXWA 4U01A 6GCHG 2A4OA 1ZTJA 4UEHH 2BY7X 1ELEE 1B7XB 1TPPA 4HGCA 1ARBA 3ZV9A 1RTKA 2BB4A 1OPHB 1GBCA 1V2LT 1IQNA 1WYKA 3S0NA 3UFAA 4TPYA 4UFEH 1XMNB 1O3OA 2H5DA 2PKSC 2UUJB 1LPZB 1PQAA 3RMNH 2KAIA 1MBMA 4Q7YA 3NKKA 1O37A 2JH0D 2SGEE 2FI5E 4ISIH 2XTTB 4AFZA 1O2YA 1EP6A 6CHAC 1O3EA 2F9NA 1DX5M 1K21H 1OWJA 3A85A 3RXEA 1KDQB 1XXDA 3A88A 2J9NA 1CGJE 3VXEH 1C2HA 1ZGVA 5DKMA 3P8OA 5J4QA 1ZHPA 1VITG 1NRNH 2Z3DA 4Y6DA 1HIAB 3PTBA 1RIWB 1SGIB 1GBAA 1E38B 1EXFA 2FS8A 2PR3A 5F8TA 5PTPA 1GHAG 1SBWA 8LPRA 1YCPM 2BQ7B 1H8DH 3LIWA 4JYTA 1ANDA 1AZZA 1D3QB 1Z6JH 1GHYH 3F9GA 1A1RA 4ABBA 1CGHA 4NIWA 2FODA 3TIUA 3MU1A 2C90B 1HXEH 1LQEA 3UIRA 1IHSH 1ZGIA 1YPHC 3VB4A 3LGYA 4DURA 1BBRE 3KF2A 1K1OA 4WVPE 2NU2E 2CHAC 3UWIA 1EPTB 4UD9H 2BMGB 2HLCA 3NXPA 3RXAA 1TX7A 2F83A 3CS0A 1BTHH 2J95A 1L1GA 1EPTC 3LPRA 3RXMA 1XX9A 3PWBA 3GCTG 1W0ZU 1UTNA 1QQUA 1GGDB 1TRYA 4A1VA 2BX4A 1TX8A 2BD4A 5LPEA 1EUFA 2NWNA 3S7HB 1W10U 4KTSA 1MCVA 4Q80A 4AG2A 2HVXA 2ZFFH 1C5YB 1AB9B 3QUMP 4CR5A 1WSSH 3V13A 4ABFA 1ZMLA 5CMXH 3QWCH 1MH0A 1GG6C 1LDTT 4U30A 1N8OC 1LQDB 1UVOA 3RXKA 1DVAH 1HAZB 1VITF 1DXPA 2F9OA 3GY7A 5A0CA 2A1DB 4YZUA 3SU1A 1O3LA 1TGBA 4CH2B 1THRH 3AVZA 4ZXYH 1SI5H 2A0QB 4I32A 4LZ4B 1IQMA 3A8DA 4RN6A 4UDWH 3SNDA 2OC8A 1GI6A 3ODFA 4FUHA 3ZVDA 4K3JA 1IHTH 1VITH 4X1PU 2J4IA 4AB8A 5EQSA 3K9XB 1C5XB 3BTKE 1XUFA 3MH6A 4A1TA 1BB0B 1WV7H 1TLDA 2ZFQH 3RMOH 2WV5A 2VGCC 1O34A 4F4OC 3MYWA 5K0HA 2P94A 2ZECA 2HGTH 1O2VA 4F49A 1LPKB 3ZZ8A 5AVDA 4X2VA 1C2FA 2C4FH 1P3EA 1XM1A 5FPSA 4OS1A 1O3CA 5T6DA 3M5OA 3A7XA 1C1QA 4INKA 2FOAA 4I7YH 2ZGBH 2V3OH 1A5GH 5JYIA 1MMJN 3SUGA 8GCHF 2BZ6H 3B23B 1V3XA 1VCWA 1FQ3A 4AFSA 1EAUA 1O2PA 4JYVH 2THFB 3BTFE 4Z0KA 4D9QA 3ZZ6A 1RTLA 4Y0ZE 1C9TA 5LPRA 1DANH 2DUCA 5EODA 1OS8A 1SPJA 3A7YA 1O3AA 5DP6A 1K1IA 2FI4E 3QTVH 4IC6A 1ABIH 1AHTH 1QTFA 3LJOA 3O8DA 3M61U 3RXJA 1O2TA 3LGVA 2CMYA 1AUTC 1C2LA 3STIA 3VB5A 1UTJA 1MKWH 4FU7A 1GG6B 2GV7A 3L33A 2NU1E 4KELA 4BTTB 3KL6A 1HFDA 3R3GB 4X6NA 1O5DH 2JH6D 1CVWH 4LZ1H 4ZAEA 1YC0A 3OTJE 1EB2A 1P8VC 3IG6B 2EC9H 1QBOA 1AFEH 2ZGJA 1NS3A 4MPWA 2BD5A 3SJIA 1C2KA 1O0DH 3K6YA 1C1OA 1BA8B 2TGTA 1GDNA 3KHVA 3SORA 2Z9JA 1C5ZB 1GGDC 5JB8S 2VVUA 3NUMA 2J2UA 4NGAH 5GDSH 2CGAA 1B5GH 4NA9H 5J4SA 4GHTA 7LPRA 3BTWE 3UUZA 2XCNA 4CHAB 1PPFE 3S7KB 1EATA 1O2KA 1AN1E 5ESTE 1HAOH 3A80A 4Q7XA 2VIQA 1BRCE 3VB3A 2PV9B 2P95A 3LH1A 3P8NA 4OS7A 5EXMA 3A89A 1FDPA 1FY5A 4FUFA 4D76A 4DG4A 1V2NT 5C20A 2ZPRA 5EW1H 1FPHH 1TABE 3KQCA 3SNBA 5HGGA 1TRMA 2WV4A 5LPFA 2BLOA 1X7AC 3GCTF 2UWLA 2ZC9H 4ABEA 1G2LA 1V2MT 5EG4A 1GMDF 1TOCB 1J16A 1NESE 2A7CA 4MPXA 2BDCA 2QYIA 2ZU1A 4UFGH 1O3NA 1IQFA 1O39A 2H6MA 2P16A 1CQQA 5IDKA 1W12U 1BMAA 1HNEE 2ZWLH 3QGNB 1TPAE 1YCPH 2FOEA 3BTTE 1RS0A 3TU7H 2GDEH 1BUIA 3LOXA 1AU8A 2QA9E 1Y8TA 1IQHA 3L3TA 6LPRA 2YNAA 3FANA 1F2SE 3RXCA 1AZ8A 1A3BH 3UR6A 4WJG2 2BQ6B 1DSTA 1IQIA 2BM2A 3KGPA 1C2IA 1P9SA 1EQ9A 3W94A 1Y5UT 1XUKA 1LHDH 1LHGH 3KN2A 2PUXB 3ZYEA 2AEIH 2FWWA 1P2KA 4KTUA 1G9IE 3PMAB 1CSOE 5FHTA 5FAHA 1Y3VA 2BLVA 5L2YH 5HM2A 1BRBE 3S69A 4XBCA 3ZZ9A 2BTCE 4FXGH 4Y7BA 4B76A 2RDLA 1L4ZA 4B2AA 1SLWB 1P2QA 2FIRH 1EOJA 3UPEA 2B5TB 3D49H 3GY3A 2OUAA 1GCTB 2A5IA 3ENSB 4KP0A 1Z71A 1LHCH 5JBBS 3ATWA 5I25A 1BTYA 1D4PB 3I77A 4CHAC 1C5SA 4ZH8A 3OU0A 2W5EA 3SUFA 3PMHB 3MOCA 3M5LA 1GBDA 1P06A 3TVJB 3GOVB 3TLOA 2XBWA 2H9HA 4Y7AA 2GCHF 3PWCA 4X6MA 3BTGE 3SU3A 4JK5A 3MH7A 4TPIZ 4TY7A 4GAWA 1O2NA 4X1SU 3TNSA 3SU6A 1UK3A 1D3TB 2P59A 1ELFA 1B0EA 4CRBA 1S81A 2O8TA 4B2BA 1C1MA 3RU4T 1C1WH 3MU4A 1MQ6A 1EJNA 1NPMA 4CRFA 3EGKH 3LGIA 1IQKA 1QNJA 2V0BA 4CREA 2WUBA 1SGEE 4AYYB 1H9LB 2HNTC 1GDUA 2XBXA 5DP9A 2FS9A 1T31A 1WOFA 2W3KA 3RLYH 1G2MA 3PMJA 1AE8H 3LONA 2DE8A 1BMLA 1T4VH 4B71A 2FI3E 1NRRH 1AKSA 1QIXB 2XC5A 1MTNB 1WQVH 2VIDA 3DHKH 1QJ1B 1JOUB 3E16B 1GL1A 1Y3YA 2Y80A 3SU5A 2UWOA 2HALA 1PJPA 4IGDA 7GCHG 2VIPA 2AGGX 1UTPA 4K1TA 1FJSA 5I46H 2VB0A 3CP7A 4B73A 2BD2A 1GBIA 2I6SA 1F0RA 4UE7H 2WPHS 2FYQA 3OY5U 2BVRH 4X1NU 2D8WA 2QN5T 3MO9A 1Z6EA 1DWDH 1OKXA 4Y8XA 4I8KA 4GCHF 4NIXA 4UONA 2WINI 1MCTA 3TJVA 3MU0A 1SR5C 2VGCB 1XXFA 2BY8X 2WPJS 1SSXA 1MD8A 1UTLM 3NWUA 3ZZ7A 5E0JA 3SV6A 1NRSH 4BANB 5CE1A 2RA0A 5EU8A 3T25A 1RJXB 1S0RA 3A7TA 4SGBE 3MU5A 3Q00A 1VJAU 4MNWA 1GMHG 1QHRB 1ETTH 1PPEE 1GVZA 1TPSA 1KIGH 2B9LA 2BY9X 2P3TB 2CN0H 1L0ZA 2Y7XA 2A4GA 2XC4A 3T27A 4IN1A 1YBWA 2BOHB 2BD9A 1CT0E 1YPLH 1UO6A 1A2CH 1UCYK 4I33A 2A7JA 1N8OB 2ZTZA 1KLIH 1TA2A 1G32B 1RTFB 2FX4A 4NSVA 1TOMH 1GHBF 2ZKSA 2SGQE 1OWKA 2OC1A 4K69A 4JZ1A 1GWAA 5JPMH 4B74A 4K1EA 1D3DB 2ZU2A 3TITA 3UNRA 3RC6A 1AI8H 1UCYE 2Z7FE 1LVOA 2BOKA 5ESBA 4GCHG 4CH8B 1AGJA 1LVMA 3SUEA 1LHEH 1A4WH 3QZQA 3MTYA 2ZCHP 4AGJA 3PYHA 5A8ZA 3AASA 4SGAE 4GUXA 1C5VA 1AWFH 1Y3UA 2XBVA 2F9UA 1ELTA 1C9PA 2OBQA 3AW0A 3OX7U 3B9FH 3T2NA 1ESTA 1PPZA 1IQJA 5C5NA 2ZU3A 1AWHB 3GYMA 2XC0A 7KMEH 1C5MD 2ZFSA 2HWLB 2CHAB 1W11U 1O2UA 1A0JA 1DFPA 4ZHMU 1C1UH 1NY22 4YLQH 1NTPA 4RSPA 2ANWA 2R3YA 3RC5A 2RCEA 1MTWA 1QL9A 1AO5A 3LC3A 1HJ9A 1V2KT 1THPB 3TGKE 3P95A 2BYAX 1CU1A 3SU4A 1HAGE 3ZZ4A 5HMAA 2BVSH 3A86A 2FOBA 4DW2U 1WAYB 1JMOH 1E35B 2ZFTA 3AAVA 1TBRH 4FU9A 3URDA 4ABGA 1GJBB 1EASA 5GJ4B 1LPGB 1P2MA 5F8XA 4Z6AH 4D7FA 2ZCLP 1ETRH 2EI8A 1GJ9B 1SOTA 2ESTE 1NO9H 3VEQB 1F0TA 1PQ8A 1GI1A 1A0HB 2A2QH 1C1VH 4I8LA 4LK4A 2W26A 5DPAA 1KYNA 1HAVB 2Z9KA 3MO6A 1O5FH 3KQBA 1ANEA 1C1SA 1H9IE 1W7XH 1BTXA 3F9EA 4GLYA 1AKSB 2GP9B 3BIVH 4OGYA 1KLTA 1O2QA 2G4TA 1QBNA 1YF4A 1V2VT 5TCCA 2HRVA 1Q31A 1O5GH 4QT8C 1M9UA 1HGTH 1GBBA 2VWLA 2HOBA 3RM0H 1GCTC 2BLQA 1G3DA 1FN6A 4ISHH 2GCTB 1GBFA 2ZCKP 1A5HA 1O3PB 3TJOA 1ABJH 1P04A 1JRTA 2RA3A 2VWMA 3BIUH 2ODQA 5AHGH 2ZP0H 1EPTA 1AFQC 3TGJE 2G4UA 2QV1A 3RMLH 1O3DA 2BQWB 4E7NA 1V6DA 2SNVA 1TNKA 5DP3A 1F0SA 3GY2A 2VINA 4VGCC 3BG8A 3A7WA 3L6PA 1G36A 1GI5A 4WMFA 2BX3A 4ZHLU 1HAVA 1C5RA 4ABJA 2QGRA 4M7GA 3B8JA 2BXUH 1O3IA 3HK3B 1LMWB 1P02A 1C4U2 1UHBA 3G01A 3EA9A 1EX3A 4DT7B 1OWEA 1J15A 2G51A 5DG6A 1QR3E 1GJ6A 2G81E 4IMQA 1BTWA 2FTLE 1FONA 2FOCA 4AGKA 1SQOA 1K28D 4YT7H 2J38A 3N7OA 2XRCA 1DOJA 3E91A 2AMDA 1KDQA 4RKJB 3ITIA 2Q1JA 3GY6A