1P2KA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsinogen, cationic
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA02
3O8BA 2LNCA 2G55A 1HAIH 4A5TS 3AAVA 3SU0A 5TCCA 2W3IA 5E2PA 3OY5U 4GPGA 3SORA 3VB3A 1O37A 3LJJA 3RXVA 1HPGA 1GI2A 4RKJB 1CGHA 2JETC 4WVPE 1A4WH 1F5LA 4ZKNU 4NCYA 4ABGA 3LGVA 1O2YA 4FUIA 1E35B 3GYLB 4TWYA 1TGSZ 3A7YA 2ILNA 2ZP0H 4UONA 2H9TH 1AKSA 1DICA 1GI4A 2ANYA 1AVXA 2ZQ1A 1Y5AT 3ZZ6A 1SBWA 1ETSH 1DY9A 2Z3EA 2GCTC 3SJOA 4ZMAH 5JBBS 2BZ6H 3SGQE 1TNHA 3TK5A 1QURH 3K65B 1O3KA 1ESBA 3BSQA 1O2VA 1Z7KA 1P2NA 4FUJA 4AYVB 5GCHG 1T8LA 2GCHG 2J38A 2QGRA 1VCWA 1BTYA 3E91A 1ANBA 3P17H 8GCHG 4CREA 4WJG2 3I29A 3ZYEA 1UK4A 2UUYA 4FU9A 1EUFA 3SV2H 1QJ6B 1T32A 1V2PT 1P06A 1SLWB 2H5DA 2O9QA 2ASUB 2DE8A 1HJ9A 3DA9B 5FCKA 5LGOA 1FNIA 1G37A 3S7KB 5GDSH 2VIPA 2TGPZ 2C90B 4B2CA 5SGAE 3R3GB 2XBXA 3SUGA 3S69A 2PKSC 3SNAA 1MKXH 2SNVA 3F68H 1C1PA 2ZU3A 2Z6BD 4J1YA 2XW9A 1IQFA 1C2DA 1S81A 1TRYA 4MPVA 1LQEA 1O5CB 2W7UA 4MNWA 4AN7A 1NO9H 4IMQA 3LDXH 2YOLA 5G4BA 4HGCA 1UTMA 3SHAH 4H42U 1GJ7B 1HXFH 4F49A 2TGDA 2OLGA 2NU0E 3K2UA 3ZZ3A 3M35A 1H8IH 2ZCKP 3A87A 2F9UA 4O3TA 1W7GH 1CSOE 4JK6A 1BJVA 4X8UH 1CO7E 1S0RA 1T8OA 2ZGBH 6LPRA 2J34A 3LIWA 1AUJA 3NXPA 1F5KU 1QBVH 5F8XA 1TX7A 3MYWA 4MNVA 4KELA 3URDA 1BT7A 1P2MA 1TE0A 2BX3A 1SOTA 2TGAA 1EATA 2BD5A 1C2HA 5J4QA 3OU0A 1FDPA 3Q77A 4WMDA 3MH6A 1FAKH 1L2EA 1T7CA 3D23A 1SFQB 4B71A 2FIRH 4D76A 1GMDG 2BXUH 1OWJA 1ZZZA 3PROA 3EGKH 3M37A 1SVPA 1LCYA 1C1OA 1NFWA 3HK3B 1FUJA 1RTKA 1NRNH 3PTNA 4A1TA 3CP7A 5EXLA 5FCRA 2B5TB 2QV1A 4FU8A 4AGKA 4CRBA 2ZGHA 1T4VH 2G81E 1NT1A 3LGTA 2GZ8A 1S5SA 4NIVA 1O2HA 2SGDE 1W8BH 4NFEA 2F9VA 1GHZA 3B9FH 1O2RA 1L4DA 1SI5H 3K9XB 3KNXA 1TMBH 3Q3KA 4NZLA 2ZFPH 5LPEA 3RXGA 1TA6A 4LOYH 3I77A 2QXJA 4Y10E 2QXGA 2FOBA 1DM4B 1HFDA 5GXPA 1TIOA 4AX9H 1F0TA 2CXVA 1DDJA 2A7JA 2CJIA 1TMUH 3A7ZA 5JDUB 1D3PB 5C5NA 3RXLA 1TLDA 2ZNKH 3LKWA 1CA0C 1HUTH 1OWHA 1FY1A 4X1SU 2STBE 1ORFA 1O36A 4FXGH 4X6MA 5I25A 1V2UT 1O39A 2XYAA 1OWKA 2ZWLH 4AYYB 2ZU5A 5TCAA 5EGMA 1HDTH 2WUCA 3E0NB 1VCPA 4ZHAA 2Z9KA 4B2BA 2IN2A 1C2KA 3UR9A 3VGCC 2CF8H 3ZZAA 1HAHH 1TMTH 1HB0B 1EOJA 1NU7B 2B8OH 3HKJB 1DXWA 1CA8B 2OQUA 3BTKE 3P8GA 4YOGA 3RXHA 2QYIA 3BG4C 1GL0E 1G3CA 4ISIH 1BTPA 2XCNA 2P94A 3VB5A 2BM2A 3TH2H 3GCHB 1PFXC 2Y5GA 2GDEH 3RM2H 1V2NT 1C2JA 2TGTA 3K6ZA 1FN6A 1DWCH 4Z0KA 1RTFB 1AIXH 1YKTA 2LPRA 2XCFA 1LDTT 2IJOB 5A8YA 3UQVA 1DY8A 2AS9A 1C2EA 1G2LA 1QA7A 1WYKA 1O2QA 3SU3A 3PLKA 4A6LA 1CA0B 4RSPA 1GHVH 1ZMNA 2FEQH 2AGGX 1EAWA 3AASA 5HM2A 4B73A 1QL9A 1Y8TA 1LVYA 1BTHH 2NU2E 1FMGA 1PPFE 1Z6EA 4UDWH 2GVFA 1UTNA 3LJOA 3HATH 3M7QA 5FX6A 4OS6A 4YOJA 2GZ7A 2D26C 3VGCB 3RU4D 4JYUH 3ZZ8A 3S9BA 1QRZA 2V3HH 1TGCA 4H6SB 1A3BH 3H7OA 2R9PA 1QNJA 3UQOA 2V0BA 4ZH8A 2NU3E 3BN9A 1Y59T 5JBAS 4FVBA 1W13U 3MFJA 3BTHE 1KYNA 2FLBH 1P11E 1HAVA 2PUXB 3TGKE 3HGNA 1FI8A 1A0JA 3UNQA 1Y3VA 2Z9GA 3BTGE 1J15A 5GWZA 1SB1H 3PWCA 1FQ3A 2ZHEH 3O8DA 1B0EA 2SGPE 4DW2U 1XXFA 2Y82A 2P3FH 3MU1A 1G2MA 1XUKA 2UUKB 4MNYA 3MO6A 4K8BA 1EXFA 2A31A 1Z8RA 2IPHA 1ZSLA 1K1IA 3W94A 1S6FA 3SU5A 1X7AC 1Z71A 4Y76A 2AMPA 2G4UA 4FUCA 4ISLA 1Y5BT 1GI1A 2PTNA 1ACBE 1VR1H 3U1JB 3ZVFA 3SOSA 3RXKA 3SV6A 1GBMA 3SN8A 3ODDA 3BIUH 4K60A 4XE4A 1O0DH 2ZDNA 4MTBA 2A4RA 5K7RA 2OC8A 1DSUA 5AFZH 2CF9H 3P70B 4Y6DA 4ESTE 1O3PB 2ZG0H 4B75A 2EA3A 2HGTH 2J2UA 3FAOA 1BRBE 1HXEH 2XRCA 5CHAC 3MU4A 4OS7A 2BDCA 1E0FD 2GZ9A 3JZ2B 1ZMLA 4JZIA 3U9AH 4CBNA 2D8WA 1IHSH 3QK1A 5C1UA 2G00A 2A4QA 2ZFTA 1J17T 2P16A 2AMDA 2WPHS 3P8NA 4XBCA 1EOLA 4E05H 2BOHB 1ZTJA 3D49H 2OTVA 2PUQH 2D2DA 3NKKA 1NS3A 1TNIA 4LZ1H 2GT8A 4UFFH 1AGJA 1SPJA 1NRQH 3QWCH 4CRDA 3SNCA 1SGDE 1NTPA 4Y7BA 1VGCB 4NFFA 1AFEH 3TU7H 1AFQB 2HOBA 1FPCH 1FY3A 5TJXA 1O3AA 3RMLH 1SFIA 2JETB 2H1UA 3B23B 3RU4E 3MHWU 3HK6B 3SNBA 3OX7U 1FIWA 1A5HA 2QAAA 2BLQA 3TLOA 1D6WA 3URCA 1J14A 3Q3YA 2M5TA 4FU7A 4J2YB 4MG3A 4NG9H 1FY8E 2XC0A 3MNSA 4K2YA 1GJ8B 4X1RU 4E7RG 2BDBA 1UK2A 1RIWC 3ZV8A 1QR3E 4CHAB 4ABHA 1CQQA 2A5AA 3SJIA 1UCYK 2PGQB 5CHAB 2RDLA 1P9SA 4WWYA 4XOJA 3A8CA 4YT6H 1S85A 1YLCA 3U8TH 2EI7A 2CN0H 4YZUA 5EQRA 1TOMH 1MMJN 2J95A 4ABIA 2HLCA 2H9HA 4DJZB 1F0SA 1LPKB 1YPHE 1OWDA 7GCHF 1W12U 1K9OE 1PPZA 4OS1A 1SMFE 2GMTC 4MNXA 2F9NA 1QA0A 1LVMA 2BD4A 1GBEA 1O30A 3Q3XA 2Q6FA 2OBOA 1GBIA 1HAPH 4B76A 5FBEA 1A5IA 1AQ7A 5CMXH 1B0FA 1C5NH 1TA2A 1GBDA 3SNDA 4JZFH 5DP4A 1KTTB 3F9FA 3SGBE 3O8CA 1GDNA 3ZV9A 1NRRH 5DKMA 1YPKH 1KIGH 2O8LA 3SO3A 2FWWA 3M61U 1P09A 2UUFB 1GJAB 5EQQA 2FTLE 2ZPRA 3PMBB 4TWWA 1TNGA 2VWMA 4DY7B 1HAOH 2R0KA 1H9LB 2B0FA 2G52A 4JYVH 4DOQA 2DUCA 1FPHH 3P6ZB 5I46H 1CT0E 3EA8A 4O03A 2XC5A 3SUDA 4AFZA 2A45B 2AH4X 4CH8B 3SV9A 2A2XH 2ZFFH 1WQVH 2NU4E 1P9UA 4Y0ZE 3M7TA 3A7XA 1A3EH 1DUAA 5EU8A 1EPTA 1UMAH 3LONA 1DT2A 5JPMH 5GJ4B 2BDHA 3P8FA 3EDXB 1BTXA 4NWLA 5EOKA 1C5XB 1Y5UT 2BDAA 3FVFB 1H1BA 2VB0A 3RLYH 3ITIA 2BYAX 4INHA 4B2AA 4JZEH 4CRAA 1EPTC 1BZXE 3VB6A 1N8OB 4KP0A 2ZGJA 1JIRA 5F8TA 3M36A 1Z8JB 3FP6E 1HGTH 1O3LA 4AZ2B 1C2FA 3ZVAA 2ZEBA 1Z6JH 1K21H 1P57B 1C4V2 1UTKA 4I8HA 2TIOA 3MO3A 2QA9E 1WTHD 4OS2A 2FI4E 2BB4A 2C3SA 5H4IB 2PV9B 3GDSA 3T26A 1GHYH 3M5LA 1RXPA 1WU1A 2ANWA 1HJ8A 3H7TA 3UOUA 2HPPH 1P8VC 3GY2A 1V2OT 5E2OA 1AMHA 1HAYB 9ESTA 1TB6H 4ZXYH 1C4U2 2ZU2A 2Z94A 1WAYB 4AGJA 4GCHG 1GJCB 5J4SA 1AWFH 2H9EH 3ZVCA 4H6TA 1EPTB 1AD8H 6ESTA 5JBTA 1KLJH 2A2QH 2OUAA 3V12A 2VH6A 1C5TA 2KAIA 4JMYA 1UHBA 5A0BA 2FYRA 2P95A 5AVDA 1FIZA 2ODPA 1C1SA 1WSSH 1KXFA 5T6DA 3MOCA 3SJ9A 1NN6A 2GV6A 1U6QA 1DITH 4D7GA 1O34A 1OP8A 5DP3A 2BXTH 1IQGA 3SW2B 4X2VA 1DANH 1CGIE 3IWMA 2HALA 3E8LA 4A1VA 1DWBH 2NWNA 1V2LT 2D1JA 2Y7XA 4Y79A 2QF0A 3RXAA 2BMGB 2C8YB 1UVSH 1TBZH 3SU4A 3UWIA 5ESBA 4ZKOU 2BTCE 3UTUH 4BANB 5A0AE 1C1RA 2R3YA 3SHCH 4FUBA 1UVPA 1QFKH 3MU0A 1MTUA 1V2JT 5JYIA 1XKAC 2CGAA 1NY22 2OQ5A 4X2XA 1IQHA 5HMAA 1GHAF 4Q7ZA 3NWUA 4MPWA 2EEKA 4NA8A 2OXSA 4GAWA 4XSKU 1MCVA 5GIBA 4NIWA 5IYTA 4ZUHA 5HXFA 2ANMH 4HI3A 1C2MA 2PSXA 4ASHA 1BDAA 1K22H 2AGEX 2VNTA 1O38A 1EP5A 4IN1A 4KTCA 1OX1A 1O3GA 4AFUA 1LHEH 1ARBA 1SLVB 2FXRA 1V2MT 4YTAA 3RC4A 3RXCA 3NK8A 3LH3A 1GHBF 3F9EA 1A61H 3SJ8A 4ISOA 2FI3E 2ALVA 4IGDA 1AVWA 5C5OA 1A2CH 3M5MA 1C9PA 1A5GH 3GY3A 1NROH 1SHYA 4U30A 1RFNA 1W11U 1AB9C 1NFUA 2ANKH 4OS5A 2EI6A 1H9HE 1RS0A 1INCA 1VGCC 3GCTF 2GDDA 1VITF 4YO9A 2VIQA 1MUEB 3DFJA 1A0HB 2ZGXH 2PKSB 4M7GA 4UD9H 1QHRB 1QCPA 1SGIB 3TJUA 1NC6A 1ETTH 2XXLA 2SGEE 2B9LA 3RU4T 1K1JA 4GHTA 1UCYH 1HCGA 3LGYA 4D8NA 1P2QA 1GBBA 4X6PA 1GMCF 3FZDA 2XBWA 3TPIZ 2F9OA 4YESB 4Y11E 3E16B 4IS5A 3PB1E 3NUMA 3RMOH 2FI5E 1W3CA 5LH8A 1C5MD 3AAUA 1C1TA 1KSNA 1W7XH 1ANCA 1GCTB 4SGAE 1QBNA 1BQYA 2BX4A 2G4TA 2FTMA 4BXWA 2EC9H 4X1NU 2FODA 1PYTC 4ISNA 2HNTC 4A92A 1VJ9U 2C8ZB 2GD4B 5DP9A 3FP7E 4WXIA 1TPOA 1ARCA 4Q2KA 2QN5T 1F2SE 2TPIZ 5E0GA 1GI8B 1O2OA 4MQAA 4DGJA 7GCHG 1ZHMA 2ZDAH 5L30H 3KQBA 1ELGA 1GMDF 3SU6A 1PJPA 2B7DH 2Z7FE 2VGCC 3HKIB 1CGJE 2ZI2H 2ZZUH 3U8OH 3W95A 4H4FA 1B7XB 3UUZA 1GBFA 1KLTA 1GHXH 1MTSA 1BMMH 1AE8H 1RD3B 3BTME 1NZQH 2VIVA 1TPAE 2QF3A 4CR9A 1JXPA 2SGFE 3GY4A 1L4ZA 1MD7A 3A80A 1DLEA 2Q6GA 5C67A 1BBRK 3DD2H 1V3XA 4DG4A 3VEQB 1VJAU 2W26A 1NFXA 1EZUC 4K1SA 5C2ZA 3EAJA 1DVAH 1F0RA 1WV7H 2BHGA 2PFEA 1EAIA 3I78A 5L2ZH 1LKBA 3S9CA 2ZHFH 3SI3H 2AFQB 4NSVA 4D9QA 1O2GH 3MMGA 4HFPB 1OYTH 4Y71A 4MLFB 2Y7ZA 4ABEA 1P2OA 1GBAA 1HYLA 2FX6A 3U69H 4Y0YE 2RG3A 3ZYDA 1WCZA 1J16A 3A89A 1F0UA 2IOTA 1P05A 1C2GA 2AIPA 4I7YH 3BTWE 3QDZB 3RXFA 2GP9B 3RXSA 3O8RA 4X8TH 2VIOA 4OS4A 3N7OA 2ZFSA 4KKDA 3TGJE 3V7TA 1LHCH 1TAWA 4I8JA 2C8XB 3VB7A 2RA0A 3UY9A 1ELAA 1MTNC 3AVZA 1HJAC 3U1IB 1L0ZA 4Z6AH 7LPRA 2QC2A 1KTSB 3SGAE 5GCHF 1Z8GA 1FY4A 2GCHF 1TPSA 3QTVH 3RLWH 5FPYA 2AMQA 4VGCB 1OOKB 2ZTXA 1OKXA 1N8OC 2VIDA 1DOJA 1EP6A 2OD3B 4WH8A 2VVVA 1LVOA 5PTPA 5ETXA 2FOFA 4HZHA 2Z9IA 4RN6A 1BJUA 1YCPH 4Y8ZA 1THPB 2O8WA 2FX4A 1TOCB 4SGBE 4INKA 1NFYA 2G51A 1GI6A 1SC8U 1ANEA 1AY6H 1SOZA 5AF9H 1BTWA 1BCUH 1UO6A 5FXLA 1BIOA 1MH0A 1RIWB 2Y5HA 4DIIH 1YCPM 1ZOMA 1ELTA 4KTSA 1YP9A 1C5VA 2PW8H 2OC0A 4BAQB 3OYPA 1LHFH 3ATWA 4AG2A 2W5EA 1IQLA 3SBKA 1NU9A 1O2JA 2DE9A 1O2SA 4NA9H 1TFXA 1C5YB 3RMMH 2BD8A 5FBIA 1V2TT 5HM9A 1NPMA 1SGPE 3UOPA 1AUTC 2BD3A 2FM2A 3RM0H 2F9BH 1GJDB 1TX8A 2K1QA 3MNBA 3UWJH 2OC7A 1C5UA 2ZHDA 5DP5A 1A7SA 4TYDA 1UTQA 2FS9A 3SQEE 2J9NA 3L33A 1ZPCA 3EYDA 1ID5H 2BLOA 1GJ6A 1XUFA 1P04A 3SV8A 1MTWA 3T27A 3SV7A 1PQ7A 4INLA 1OYQA 3BTEE 1GDUA 4I8GA 1HV7A 1KXDA 1IQMA 2OC1A 1OWIA 3A83A 5EXMA 1V2RT 2PWXA 1MKXK 1TBQH 4MDSA 2WV5A 2Q6DA 1FY5A 5AHGH 1L1JA 1W0YH 2ZPQA 3SU2A 4IC6A 2A32A 1DLKB 1QB9A 1NM6A 2P59A 3TNSA 1QB6A 1O3EA 2WPJS 3BG8A 3C27B 4X1PU 1O2LA 1V2WT 3VB4A 1F92A 1K1MA 2Z3CA 3S9AA 3E3TA 3SUEA 1LVBA 1FV9A 1GMHF 1EJNA 1QQUA 1C5PA 4NGAH 1GHBG 3V0XA 3K6YA 1UTOA 1XUGA 3MH4A 5E8EH 3ATIA 1E34B 5EQSA 1G30B 1V6DA 1Y3WA 1C5LH 1T31A 1DPOA 3GY7A 3TH4H 2ZA5A 2C93B 3SI4H 4ABBA 4XDEA 2A4GA 2BOKA 1B5GH 2BVXH 3GCTG 1O2TA 3HGPA 1C9TA 5C3NA 4JZDH 1VITG 1P2KA 1O2ZA 2XNIA 2UUJB 2W3KA 3M5OA 5E0JA 3VFEA 1G32B 1EZXC 3KEEA 3HPTB 1S0QA 1E36B 1GMCG 1V2KT 1EKBB 2THFB 1TONA 1J8AA 3M7UA 4FUDA 1O3IA 2FO9A 3OTJE 1P3CA 1A0LA 2YNBA 4WF8A 1CE5A 4I8KA 2BQ6B 1HAGE 1YF4A 3QUMP 1TBRH 2HNTF 3KF2A 2GTBA 2FYQA 1IOEA 2RCEA 3DHKH 1UCYE 1BB0B 3UNSA 1SHHB 3V3MA 1T4UH 1ZTLA 3A7WA 4AORA 3ZZ9A 1QRWA 3QZRA 1SGFG 3F6UH 3MU8A 6GCHF 4BNRA 1K1PA 1BTUA 3CENA 4GCHF 3A88A 1NRSH 3RXUA 2FMJA 2GX4A 2HWLB 4FUGA 4WMFA 4YLQH 1CHGA 1BBRH 1G9IE 3EA7A 3EA9A 1ELVA 1EX3A 3IITA 3A8BA 5FPSA 1ZPBA 2JH0D 1SG8B 1EB2A 2VWNA 3PMHB 3P92A 2H6MA 1Q2WA 6CHAC 4CHAC 1QGFA 4FUEA 1UHBB 1ELFA 2CMYA 1BHXF 1CT4E 4IN2A 1BHXB 3SZNA 1MD8A 5EPNA 3BV9B 3KGPA 3H5CB 2WYJA 1THRH 2PHBA 5F6MA 2Z3DA 3PLBA 1MBQA 4ISHH 2ZFRH 3KN2A 1VZQH 1AO5A 1VCQA 3TK9A 4BTIB 2BY6X 1ELEE 1ZYOA 3GCOA 4A1XA 1TABE 4X2YA 3ATLA 1UJ1A 4FVDA 1C4Y2 2F83A 3RXRA 5DP6A 4IW4E 5LPFA 1XVMA 2PKAB 1P12E 1Y3YA 3OSYA 1AKSB 1GVLA 2AEIH 2ODQA 1A46H 2F91A 1QQ4A 2C4FH 3LGWA 1JBUH 4CRFA 9LPRA 4WH6A 1SGEE 1BRUP 1UVTH 1GHAG 1HIAA 3D62A 3RC6A 2PKAA 4K5ZA 1H8DH 2O8UA 2ZHWH 1EJMA 5ABWA 2EI8A 5ESTE 2HVXA 1AWHB 3LC3A 1O32A 1ABJH 3S7HB 2Z9JA 1JIMA 1DX5M 3T2NA 1C2LA 5C1XA 1O31A 1DWEH 3PO1C 1N1LA 3TJVA 5A0CA 2ZDVH 2ZQ2A 1ZHRA 1XUIA 1BMAA 4K8YA 2ZC9H 1PYTD 4X6OA 4JK5A 3DFLA 4X0WU 5A09A 1C1VH 1LHDH 1D3QB 3T28A 1G36A 1C5OH 4JCNA 5DPAA 4DCDA 1DWDH 1GMHG 2WPKS 2FPZA 4B1TA 2I6SA 5E0HA 3A82A 1TRMA 3CS7A 3IG6B 1H9IE 2FOCA 1Y3UA 1SR5C 1GG6B 3RUOA 3L3TA 3M3SA 3LT3A 5DJ7A 4I33A 1N6YA 1YPHC 4CRGA 3RXEA 1ABIH 1ZGIA 1OSSA 2BD9A 1W14U 2ZDLA 3T25A 1TQ7B 2PTCE 1QTFA 1TGNA 3UPEA 1GJ4H 1OS8A 3GISB 2HPQH 2CHAC 4XFQA 1XUHA 1ZSKA 1GPZA 2V3OH 1DXPA 3SQHE 2BQWB 3AW0A 1T8NA 3RXMA 3NZIA 2BQ7B 1LQDB 2Y81A 1YM0A 4LXBH 2FZZA 1DUEA 4MVNA 1FLEE 4ABJA 1IHTH 2WPMS 3KIDU 2A5IA 4GUXA 1KXAA 1YPLH 5HYOA 1MQ6A 3ODFA 5EG4A 1W0ZU 2WPIS 4KGAA 1HBTH 4K69A 1ZHPA 1SGFA 1GVZA 1GI7B 2R2MB 1YPMH 5JB8S 1RTLA 6GCHG 3RXBA 3FZZA 2AIQA 1P03A 2QXIA 3BTFE 1O3MA 5DO4H 7KMEH 1K1LA 1ESAA 3TVJB 1XKBC 3VXEH 1SL3A 3A86A 3QGNB 1CBWC 3PO1B 1YCPK 5JB9S 3ENSB 4BAKB 1TQ0B 1XM1A 1ZPZA 4O3UA 1WTGH 1TPPA 1P3EA 2WUBA 1TWXB 3TNTA 3BG4B 8LPRA 3S0NA 4AFQA 4U01A 3QX5H 2FOAA 3KCGH 2SFAA 4TY7A 2GGVB 2PLXA 1RGQA 3ZZ5A 3LGIA 2PGBB 4NA7A 5JBCS 1EZSC 3PYHA 3PMJA 2ZO3H 5T6GA 1GG6C 4FUFA 1WBGB 4TY6A 3L6PA 1HAZB 4BTUB 1O3FA 2BD2A 2TRMA 2BLWA 2QY0B 2UWLA 1AI8H 5EW1H 1V2ST 4WXVA 4MPUA 3ZVBA 1GGDB 2ZHQH 4AOQA 3U8RH 2BY7X 1E37B 1TNLA 2F9PA 1O2MA 2BY5X 4BAOB 3GCNA 4JZ1A 1PPGE 1XXDA 1GCTC 4NIXA 4I31A 1NESE 1C5WB 2SGQE 3EQ0H 3PTBA 2ZPSA 4XBBA 1UTLM 1EB1H 1LPZB 1CBWB 2OCVB 1ELBA 1RRKA 1D6RA 2BZAA 3KQEA 1KDQB 2W7SA 4UE7H 1GWAA 1K1OA 2FOHA 4TPIZ 1EZQA 1SGNE 4ZKRU 1BA8B 7ESTE 5L2YH 4NWKA 4CRCA 5L6NH 1P10A 4Q7YA 2ODYB 5GPIB 1GBJA 3FP8E 2ZF0H 4GHQA 1QJ7B 1MBMA 1ZGVA 5BRRE 4BXSA 1C1QA 1P01A 1QIXB 2VGCB 3QLPH 3BF6H 1MU8B 3BTTE 8KME2 3LU9B 4AG1A 1THSH 4XBDA 4IC5A 4LK4A 1ZJKA 2H2ZA 3VPKA 2VJ1A 3PMAB 1SGRE 1LMWB 3F1SB 2STAE 3MNCA 3ATKA 3D65E 1W10U 1SGQE 3B8JA 2WPLS 2XWBI 1C5RA 3A7TA 3A85A 3BEFB 2GMTB 1T8MA 1LHGH 4YOIA 1AN1E 3KQDA 4I8LA 3TK6A 4Q80A 4E06H 1XX9A 1V2QT 3UR6A 2O8MA 3PM3A 1BBRE 1GBKA 1O2KA 1O3JA 1HAVB 1C1WH 1D4PB 3SNEA 1KXCA 5EW2H 1QL7A 1WOFA 4AB9A 3UREA 2WV4A 8ESTE 2BLVA 1Z1IA 2CV3A 1ZMJA 4R8TB 1CVWH 1TX6A 1DS2E 4X8VH 1MTVA 2VWOA 1FXYA 1SQTA 2VIWA 3BEUA 1GI0A 1TNKA 3ZZ4A 5FAHA 2JH5D 1O5AB 4R0IA 2V6NA 3A81A 3SUFA 4YM9A 1P0SH 1GJ9B 1W2KH 1JRSA 1PQ5A 3VXFH 1PPBH 1F7ZA 5DK1A 1BMLA 1GI3A 3A8DA 3QN7A 1Q31A 1JOUB 1MTNB 4Y8XA 1Z8IB 3T62A 1AB9B 1VITH 1UK3A 1KLIH 2UWPA 1O2XA 3E1XB 5K0HA 1JWTA 1C5SA 3BIVH 3M3TA 3OY6U 5BPEA 3MNXA 4YLUA 3ELAH 1L1GA 2A5KA 1TRNA 3UFAA 1ANDA 5A2MH 3RXDA 3FFGA 2J4IA 1J9CH 4X8SH 1F5RA 3BTQE 4U32A 1QJ1B 1K28D 4ABDA 3LOXA 2OP9A 1SGCA 5CE1A 1SLXB 3G01A 2G8TA 2A7CA 1YLDA 2BDIA 1S6HA 3PWBA 1O5DH 1SGTA 3GICB 2VINA 4E7NA 1O2WA 3ATMA 1AFQC 3A84A 1UTJA 1HRTH 1HIAB 3TITA 2ZU4A 2HNTE 2ZDKA 2QCYA 3RXTA 3FANA 1FN8A 1WQSA 4UFEH 1FAXA 2A1DB 1K2I1 2ESTE 1TNJA 1C1MA 2XWAA 1HNEE 1SSXA 3GOVB 3SU1A 1YPJH 4ZAEA 3QGJA 1O3OA 4ABAA 3RMNH 2AGIX 5A8ZA 4DIHH 1JRTA 3GY6A 1C5ZB 1ZLRA 2GCTB 5B6OA 1QB1A 3MI4A 5FPTA 3QZQA 4OGYA 1M9UA 6CHAB 1CT2E 3KHVA 1S83A 2HRVA 4HTCH 4TPYA 1GHWH 8GCHF 3T29A 2FLRH 3DT0H 2NU1E 1MKWK 1NRPH 1AVGH 1O3DA 1QBOA 2Y80A 1EASA 3A8AA 2J92A 4IMZA 2OBQA 2ZDMA 3WY8A 3GDVA 2ZFQH 3KL6A 1QRXA 3STIA 1GJ5H 3DUXH 4CBOA 3JZ1B 1MZDA 3RP2A 2O8TA 2JH6D 1JMOH 2ZTZA 1O3BA 1O5GH 5DGJA 4BAMB 5FX5A 1XUJA 1GJBB 4D9RA 2WYGA 4X2WA 3UNRA 1IQKA 2C8WB 2ULLA 1YC0A 1S84A 2A7HA 1O2IA 3TJOA 4U2WA 2GKVE 1PPEE 2A4OA 4NZQA 5DP7A 1V2VT 1XMNB 3MH5A 4BAHB 3NCLA 1ZJDA 5LPRA 2BVSH 2BD7A 5EXNA 1O5FH 5F8ZA 2BY8X 2Y6TA 1MAYA 1AZ8A 4GLYA 3ZZDA 1GI9B 4PROA 4DVAU 2BDGA 1AE5A 3RXQA 2VWLA 4WY3A 1P2JA 1H4WA 2Y5FA 5AFYH 2BVRH 1GBHA 1ETRH 3C1KA 1YBWA 2FOMB 3MTYA 4AB8A 3TGIE 1O33A 3RC5A 1DSTA 3E0PB 1YYY1 2JKHA 1CHOF 3M3VA 1ZR0A 2QIQA 2P3UB 2V35A 3Q76A 4Y8YA 1KY9A 1GVKB 3PLPA 2CHAB 4CH2B 2ZIQH 2BY9X 1OP0A 3BTDE 1MZAA 3SJKA 1LO6A 1OXGA 2FOGA 2XBYA 4UEHH 3P95A 3GY5A 4DT7B 1HJAB 1SQAA 1P2IA 4Q7XA 1IQNA 1UTPA 4X6NA 1C1UH 1GBLA 1FJSA 1MAXA 2R3UA 5A8XA 4VGCC 2BDYA 1E38B 1GI5A 3P8OA 4A7IB 1CU1A 2XTTB 1BRCE 2Z9LA 2R0LA 4YT7H 1XVOA 1G3BA 1C2IA 1QY6A 1OWEA 3E90B 1KDQA 2SGAA 1O3HA 4NSYA 4OGXA 1ZTKA 2P93A 1O2PA 2RA3A 3ZVEA 1BUIA 2AYWA 4O9VA 1PQAA 1D3TB 1QL8A 3ZZ7A 1LTOA 1GBCA 1O2UA 1YGCH 1GBTA 1PQ8A 1Y3XA 1KXEA 1O3NA 2FP7B 2YNAA 4K1TA 1YPGH 1TALA 2G5VA 2ALPA 4KTUA 1A1RA 3CS0A 2GT7A 3F9GA 3Q00A 3ZVGA 2F3CE 1OP2A 2ZCHP 5IDKA 1UVOA 2ZKSA 1LPGB 1OPHB 2FOEA 1GGDC 1UVUH 3PV4A 3BEIB 1EJAA 4WMEA 5F03A 2UWOA 2A0QB 5HGGA 1FONA 2TBSA 3RXPA 1ZRBA 2KAIB 1ESTA 3LC5A 4UFDH 3GCHC 1MCTA 3RDZA 3E6PH 4GSOA 1PPCE 4BTTB 1RJXB 5C20A 4ABFA 2VH0A 3M5NA 1GCDA 3TIUA 2VVUA 1C5QA 1EAXA 3GYMA 4IBLH 1DE7H 4MPXA 3RXIA 4BOHA 4THNH 1BRAA 3ESTA 3LH1A 2G5NA 4UFGH 5C1YA 2J94A 4ZXXH 5DP8A 1DFPA 1O3CA 2P3TB 2VVCA 1K1NA 1HLTH 1SQOA 2FS8A 1MU6B 2XBVA 1N6XA 3MU5A 1FZZA 4F4OC 1EAUA 4ZHMU 4NIYA 5T3HA 5T6FA 3ZZCA 4K1EA 4X1QU 2I6QA 3MWIU 2ZECA 1YPEH 2R2WU 4RKOB 4JYTA 1MQ5A 5EODA 1GL1A 1PPHE 5EPYA 2OINA 1TGTA 3AW1A 4I32A 4FUHA 1G3EA 1IAUA 1L1NA 3ZZBA 5FHTA 4K3JA 3MH7A 3V13A 2FESH 1C1NA 5DG6A 1Q3XA 1AU8A 1BTZA 3RXJA 2VU8E 1ZSJA 2SNWA 1O35A 3GY8A 4QT8C 3GDUA 4O97A 3STJA 3U98H 3A7VA 2PR3A 2ZGCA 4Y7AA 1ZRKA 2P8OC 1G3DA 3ZVDA 2PSYA 1P02A 4D7FA 1MKWH 1O5EH 1HAXB 2WINI 3R0FA 1BITA 1IQEA 2ZTYA 1KXBA 1CHOG 3LPRA 1AHTH 4GVUA 3MO9A 1D3DB 1BOQA 1Z1JA 4ZKSU 3QTOH 3KQCA 4B74A 1S82A 1LKAA 2ZCLP 3QO6A 1BMNH 4ZHLU 1TYNA 3UIRA 1O2NA 2FDAA 1AZZA 4CR5A 4LZ4B 2AERH 1GDQA 1WUNH 3LGUA 1IQJA 2H5CA 1TGBA 1SGYE 3TH3H 1O5BB 4AFSA 1IQIA 1EQ9A 2XC4A 2ZU1A 3RXOA 1D9IA 1ELDE 4DURA 2Q1JA 1SLUB 2P8OB 3T5FH 2QXHA 3TJNA 1ELCA 4ZROA 2GV7A 3F9HA 3EE0B 3NPSA
chains in the Genus database with same CATH superfamily
3O8BA 2LNCA 2G55A 1HAIH 4A5TS 3AAVA 3SU0A 5TCCA 2W3IA 4P02A 5E2PA 3OY5U 4GPGA 3SORA 3VB3A 1O37A 3LJJA 3RXVA 1HPGA 1GI2A 4RKJB 1CGHA 2JETC 4WVPE 1A4WH 1F5LA 4ZKNU 4NCYA 4ABGA 3LGVA 2KCAA 1O2YA 4FUIA 1E35B 2WV9A 3GYLB 4TWYA 1TGSZ 3A7YA 2ILNA 2ZP0H 4UONA 2XOKD 2H9TH 1AKSA 1DICA 1GI4A 2ANYA 1AVXA 2ZQ1A 1Y5AT 3ZZ6A 1SBWA 1ETSH 1DY9A 2Z3EA 2GCTC 3SJOA 4ZMAH 5JBBS 2BZ6H 3SGQE 1TNHA 3TK5A 1QURH 3K65B 1O3KA 1ESBA 3BSQA 1O2VA 1Z7KA 1P2NA 4FUJA 4AYVB 5GCHG 1T8LA 2GCHG 2J38A 2QGRA 1VCWA 1BTYA 3E91A 1ANBA 3P17H 8GCHG 4CREA 4WJG2 3I29A 3ZYEA 1UK4A 2UUYA 4FU9A 1EUFA 3SV2H 1QJ6B 1T32A 1V2PT 1P06A 1SLWB 2H5DA 3GS9A 2O9QA 2ASUB 2DE8A 1HJ9A 3DA9B 5FCKA 5LGOA 1FNIA 1G37A 3S7KB 5GDSH 2VIPA 2JIZD 2TGPZ 2C90B 4B2CA 5SGAE 3R3GB 2XBXA 3SUGA 3S69A 2PKSC 3SNAA 1MKXH 2SNVA 3F68H 1C1PA 4HG6A 2ZU3A 2Z6BD 4J1YA 1SQRA 2XW9A 4FOUC 1IQFA 1C2DA 1S81A 1TRYA 3FOAA 4MPVA 1LQEA 1O5CB 2W7UA 4MNWA 4AN7A 1NO9H 4IMQA 3LDXH 2YOLA 5G4BA 4HGCA 1UTMA 3SHAH 4H42U 1GJ7B 1HXFH 4F49A 2TGDA 2OLGA 2NU0E 3K2UA 3ZZ3A 3M35A 1H8IH 2ZCKP 3A87A 2F9UA 4O3TA 1W7GH 1CSOE 4JK6A 1BJVA 2VBCA 4X8UH 2F43B 1CO7E 1S0RA 1T8OA 2ZGBH 6LPRA 2J34A 3LIWA 1AUJA 3NXPA 2KFWA 1F5KU 1QBVH 5F8XA 1TX7A 3MYWA 5CHBA 4MNVA 4F55A 4KELA 3URDA 1BT7A 1P2MA 1TE0A 2BX3A 1SOTA 2TGAA 1EATA 2BD5A 1C2HA 5J4QA 3OU0A 1FDPA 3Q77A 4WMDA 3MH6A 1FAKH 1L2EA 1T7CA 3D23A 1SFQB 4B71A 2FIRH 4D76A 1GMDG 2BXUH 1OWJA 1ZZZA 3PROA 3EGKH 3M37A 1SVPA 1LCYA 1C1OA 1NFWA 3HK3B 1FUJA 1RTKA 1NRNH 3PTNA 4A1TA 2W6ID 3CP7A 5EXLA 5FCRA 2B5TB 2QV1A 4FU8A 4AGKA 4CRBA 2ZGHA 1T4VH 2G81E 1NT1A 3LGTA 2GZ8A 3WWBA 1S5SA 4NIVA 1O2HA 2SGDE 1W8BH 4NFEA 2F9VA 1GHZA 3N7EA 3B9FH 1O2RA 1L4DA 1SI5H 2L6OA 3K9XB 3KNXA 1TMBH 3Q3KA 4NZLA 2ZFPH 5LPEA 3RXGA 1TA6A 4LOYH 3I77A 2QXJA 4Y10E 2QXGA 2FOBA 1DM4B 1HFDA 5GXPA 1TIOA 4AX9H 1F0TA 2CXVA 1DDJA 2A7JA 2CJIA 1TMUH 3A7ZA 5JDUB 1D3PB 2KX4A 5C5NA 3RXLA 1TLDA 2ZNKH 3LKWA 1CA0C 1HUTH 1OWHA 1FY1A 4X1SU 2STBE 1ORFA 1O36A 4FXGH 4X6MA 5I25A 1V2UT 1O39A 2XYAA 1OWKA 2ZWLH 4AYYB 2ZU5A 1YY3A 5EJLA 5TCAA 5EGMA 1HDTH 2WUCA 3E0NB 5DN6D 2RDEA 1VCPA 4ZHAA 2Z9KA 4Q63A 4B2BA 2IN2A 1C2KA 3UR9A 3VGCC 2CF8H 3ZZAA 1HAHH 1TMTH 1HB0B 1EOJA 1NU7B 2B8OH 3HKJB 1DXWA 1CA8B 2OQUA 3BTKE 3P8GA 4YOGA 3RXHA 2QYIA 3BG4C 1GL0E 1G3CA 4ISIH 1BTPA 2XCNA 2P94A 3VB5A 2BM2A 3TH2H 3GCHB 1PFXC 2Y5GA 2GDEH 3RM2H 1V2NT 1C2JA 2TGTA 3K6ZA 1FN6A 1DWCH 4Z0KA 1RTFB 1AIXH 1YKTA 2LPRA 2XCFA 1LDTT 2IJOB 5A8YA 3UQVA 1DY8A 2AS9A 1C2EA 1G2LA 1QA7A 1WYKA 1O2QA 1WXRA 3SU3A 3PLKA 4A6LA 1CA0B 4RSPA 1GHVH 1ZMNA 2FEQH 2AGGX 4XD7D 1EAWA 3AASA 5HM2A 4B73A 1QL9A 1Y8TA 1LVYA 1BTHH 2NU2E 3VG8A 2CK3D 1FMGA 1PPFE 1Z6EA 4UDWH 2GVFA 1UTNA 3LJOA 3HATH 3M7QA 3N7DA 5FX6A 4OS6A 4YOJA 2GZ7A 2D26C 3VGCB 3RU4D 4JYUH 3ZZ8A 3S9BA 1QRZA 2V3HH 1TGCA 4H6SB 1A3BH 3H7OA 2R9PA 1QNJA 3UQOA 2V0BA 2IPQX 4ZH8A 2NU3E 3BN9A 1Y59T 5JBAS 4FVBA 1W13U 3MFJA 3BTHE 1KYNA 2FLBH 1P11E 1HAVA 2PUXB 3TGKE 3HGNA 1FI8A 1A0JA 3UNQA 1Y3VA 2Z9GA 3BTGE 1J15A 5GWZA 1SB1H 3PWCA 1FQ3A 2ZHEH 3O8DA 1B0EA 2SGPE 4DW2U 1XXFA 2Y82A 2P3FH 3MU1A 1G2MA 1XUKA 2JDID 2UUKB 4MNYA 3MO6A 4K8BA 4M9FA 1EXFA 2A31A 1Z8RA 2IPHA 2WPDD 1ZSLA 1K1IA 3W94A 1S6FA 3ZIAD 3SU5A 1X7AC 1Z71A 4Y76A 2AMPA 2G4UA 4FUCA 4ISLA 1QZ8A 1Y5BT 1GI1A 2PTNA 1ACBE 1VR1H 2KR7A 3U1JB 5EJ1A 3ZVFA 3SOSA 3RXKA 3SV6A 1GBMA 3SN8A 3ODDA 3BIUH 4K60A 4XE4A 1O0DH 2ZDNA 4MTBA 2A4RA 5K7RA 2OC8A 1DSUA 5AFZH 2CF9H 3P70B 4Y6DA 4ESTE 1O3PB 2ZG0H 4B75A 2EA3A 2HGTH 2J2UA 3FAOA 1BRBE 1HXEH 2XRCA 5CHAC 3MU4A 4OS7A 2BDCA 1E0FD 2GZ9A 3JZ2B 1ZMLA 4JZIA 3U9AH 4CBNA 2D8WA 1IHSH 3QK1A 5C1UA 2G00A 5C94A 2A4QA 2ZFTA 1J17T 2P16A 2AMDA 2WPHS 3P8NA 4XBCA 1EOLA 4E05H 2BOHB 1ZTJA 3D49H 2OTVA 2IJD1 2PUQH 2D2DA 3NKKA 1NS3A 1TNIA 4LZ1H 2GT8A 4UFFH 1AGJA 1SPJA 1NRQH 3QWCH 4CRDA 3SNCA 1SGDE 1NTPA 4Y7BA 1VGCB 4NFFA 1AFEH 3TU7H 1AFQB 2HOBA 1FPCH 1FY3A 5TJXA 1O3AA 3RMLH 3UAIC 1SFIA 3PRDA 2JETB 2H1UA 3B23B 3RU4E 3MHWU 3HK6B 3SNBA 3OX7U 1FIWA 5KECA 1A5HA 2QAAA 2BLQA 2OK5A 3TLOA 1D6WA 3URCA 1J14A 3Q3YA 2M5TA 4FU7A 2YMSD 4J2YB 4MG3A 5HIYA 1H8HD 1FY8E 3FN8A 4NG9H 2XC0A 3MNSA 4K2YA 1GJ8B 4X1RU 4E7RG 2BDBA 1UK2A 1RIWC 3ZV8A 2GJGA 1QR3E 4CHAB 4ABHA 1CQQA 2A5AA 3SJIA 1UCYK 2PGQB 5CHAB 2RDLA 1P9SA 4WWYA 4XOJA 3A8CA 4YT6H 1S85A 1YLCA 3U8TH 2EI7A 1WDIA 2CN0H 4YZUA 5EQRA 1TOMH 1MMJN 2J95A 4ABIA 2HLCA 5FL7D 2H9HA 4DJZB 1F0SA 1LPKB 1YPHE 1KMHB 1OWDA 7GCHF 1W12U 1K9OE 1PPZA 4OS1A 1SMFE 2GMTC 4MNXA 2F9NA 1QA0A 1LVMA 2BD4A 1GBEA 1O30A 3Q3XA 2Q6FA 1COWD 1NBMD 2OBOA 1GBIA 1HAPH 4B76A 5FBEA 1A5IA 1AQ7A 5CMXH 1B0FA 3FKSD 1C5NH 1TA2A 3F2FA 1YWUA 1GBDA 3SNDA 4JZFH 5DP4A 3F0OA 1KTTB 3F9FA 3SGBE 3O8CA 1GDNA 3ZV9A 1NRRH 5DKMA 1YPKH 1KIGH 2O8LA 3SO3A 2FWWA 3M61U 1P09A 2UUFB 1GJAB 5EQQA 2FTLE 2ZPRA 3PMBB 4TWWA 1TNGA 2VWMA 4DY7B 1HAOH 2R0KA 1H9LB 2B0FA 2G52A 4JYVH 4DOQA 2DUCA 1FPHH 3P6ZB 5I46H 1CT0E 3EA8A 4O03A 2XC5A 3SUDA 4AFZA 2A45B 2AH4X 4CH8B 5T1VA 3SV9A 2A2XH 2ZFFH 1E1QD 1WQVH 2NU4E 3DCLA 1P9UA 3MQKC 4Y0ZE 3M7TA 3A7XA 1A3EH 1DUAA 5EU8A 1EPTA 1UMAH 3LONA 1DT2A 5JPMH 5GJ4B 2BDHA 3P8FA 3EDXB 1BTXA 4NWLA 5EOKA 1C5XB 1Y5UT 2BDAA 3FVFB 1H1BA 2VB0A 3RLYH 3ITIA 2BYAX 4INHA 2K8IA 4JZEH 4B2AA 1EPTC 4CRAA 1BZXE 3VB6A 1N8OB 4KP0A 2ZGJA 1JIRA 5F8TA 3M36A 1Z8JB 3FP6E 1HGTH 1O3LA 4AZ2B 1C2FA 1YLNA 3ZVAA 2ZEBA 1Z6JH 1K21H 1P57B 1C4V2 1UTKA 4I8HA 2TIOA 3MO3A 2QA9E 1WTHD 4OS2A 2FI4E 2BB4A 2C3SA 5H4IB 2PV9B 1BMFD 3GDSA 3T26A 1GHYH 3M5LA 1RXPA 3FO8D 1WU1A 5B6LA 2ANWA 1HJ8A 3H7TA 3UOUA 2HPPH 1P8VC 3GY2A 1V2OT 4TSFD 5E2OA 1AMHA 1HAYB 9ESTA 1TB6H 4ZXYH 1C4U2 2ZU2A 2Z94A 1WAYB 4AGJA 4GCHG 1GJCB 5J4SA 1AWFH 2H9EH 3DSGA 3ZVCA 4H6TA 1EPTB 1AD8H 6ESTA 5JBTA 1KLJH 2A2QH 2OUAA 3V12A 2VH6A 1C5TA 2KAIA 4JMYA 1UHBA 5A0BA 2FYRA 1E79D 2P95A 5AVDA 4ACAA 1FIZA 2ODPA 1C1SA 1WSSH 1KXFA 5T6DA 3MOCA 3SJ9A 1NN6A 2GV6A 1U6QA 1DITH 4D7GA 1O34A 1OP8A 5DP3A 2BXTH 1IQGA 4Q4LA 3SW2B 4X2VA 2WHXA 1DANH 1CGIE 3IWMA 2HALA 3E8LA 4A1VA 1DWBH 2NWNA 1V2LT 2D1JA 2Y7XA 4Y79A 2QF0A 3RXAA 2BMGB 2C8YB 1UVSH 1TBZH 3SU4A 3UWIA 3OFND 5ESBA 4ZKOU 2BTCE 1OHHD 3UTUH 4BANB 5A0AE 1C1RA 2R3YA 3SHCH 4FUBA 1UVPA 1QFKH 3MU0A 1MTUA 1V2JT 5JYIA 1XKAC 2CGAA 1NY22 2OQ5A 4X2XA 1IQHA 5HMAA 1GHAF 4Q7ZA 3NWUA 4MPWA 2EEKA 4NA8A 2OXSA 4GAWA 4XSKU 1MCVA 5GIBA 4NIWA 5IYTA 4ZUHA 5HXFA 2ANMH 4HI3A 1C2MA 2PSXA 4ASHA 1BDAA 1K22H 2AGEX 2VNTA 1O38A 1EP5A 4IN1A 4KTCA 1OX1A 1O3GA 4AFUA 1LHEH 1ARBA 1SLVB 2FXRA 1V2MT 4YTAA 3RC4A 3RXCA 3NK8A 3LH3A 1GHBF 3F9EA 1A61H 3SJ8A 4ISOA 2FI3E 2ALVA 4IGDA 1AVWA 5C5OA 1A2CH 3M5MA 1C9PA 1A5GH 3GY3A 1NROH 1SHYA 4U30A 1RFNA 1W11U 1AB9C 1NFUA 2ANKH 4OS5A 2EI6A 1H9HE 1RS0A 1INCA 1VGCC 3GCTF 2YMSC 2GDDA 1VITF 4YO9A 2VIQA 1MUEB 3DFJA 1A0HB 2ZGXH 2PKSB 3KYGA 3NRLA 4M7GA 4UD9H 1QHRB 1QCPA 1SGIB 3TJUA 1NC6A 1ETTH 2XXLA 2SGEE 2B9LA 3RU4T 1K1JA 4GHTA 1UCYH 1HCGA 3LGYA 4D8NA 1P2QA 1GBBA 4X6PA 1GMCF 3FZDA 2XBWA 3TPIZ 2F9OA 4YESB 4Y11E 3E16B 4IS5A 3PB1E 3NUMA 3RMOH 2FI5E 1W3CA 2WZQA 5LH8A 1C5MD 3AAUA 1C1TA 1KSNA 1W7XH 1ANCA 1GCTB 4SGAE 1QBNA 1BQYA 2BX4A 2G4TA 2FTMA 4BXWA 3AK5A 2EC9H 4X1NU 2FODA 5HIZA 1PYTC 4ISNA 2HNTC 4A92A 1VJ9U 2C8ZB 2GD4B 5DP9A 3FP7E 4WXIA 1TPOA 1ARCA 4Q2KA 2QN5T 1F2SE 2TPIZ 5E0GA 2HVYB 1GI8B 1O2OA 4MQAA 4DGJA 7GCHG 1ZHMA 2ZDAH 5L30H 3KQBA 1ELGA 1GMDF 3SU6A 1PJPA 2B7DH 2Z7FE 2VGCC 3HKIB 1CGJE 2ZI2H 2ZZUH 3U8OH 3W95A 4H4FA 1B7XB 3UUZA 1GBFA 1KLTA 1GHXH 1MTSA 1BMMH 1AE8H 1RD3B 3BTME 1NZQH 2VIVA 1TPAE 2QF3A 4CR9A 1JXPA 2SGFE 3GY4A 1L4ZA 1MD7A 3A80A 1DLEA 2Q6GA 2LP6A 1BBRK 5C67A 3DD2H 1V3XA 4DG4A 3VEQB 1VJAU 2W26A 1NFXA 1EZUC 4K1SA 5C2ZA 3EAJA 1DVAH 1F0RA 1WV7H 2BHGA 2PFEA 1EAIA 3I78A 5L2ZH 1LKBA 3S9CA 2ZHFH 3SI3H 2AFQB 4NSVA 4D9QA 1O2GH 3MMGA 4HFPB 1OYTH 4Y71A 4MLFB 2Y7ZA 4ABEA 1P2OA 5EJZA 1GBAA 1HYLA 2FX6A 2QF5A 3U69H 4Y0YE 2RG3A 3ZYDA 1WCZA 1J16A 3A89A 1F0UA 2IOTA 1P05A 1C2GA 2AIPA 4I7YH 3BTWE 3QDZB 3RXFA 2GP9B 3RXSA 3O8RA 4X8TH 2VIOA 4OS4A 3N7OA 2ZFSA 4KKDA 3TGJE 3V7TA 1LHCH 1TAWA 4I8JA 2C8XB 3VB7A 2RA0A 3UY9A 1ELAA 1MTNC 3AVZA 1HJAC 3PV2A 3U1IB 1L0ZA 4Z6AH 7LPRA 2QC2A 1KTSB 3SGAE 5GCHF 1Z8GA 1FY4A 2GCHF 1TPSA 3QTVH 1W0KD 3RLWH 5FPYA 2AMQA 2M2AA 4VGCB 1OOKB 2ZTXA 4RT1A 1OKXA 1N8OC 2VIDA 1DOJA 1EP6A 2OD3B 4WH8A 2VVVA 1LVOA 5PTPA 5ETXA 2FOFA 2LELA 4HZHA 2Z9IA 4RN6A 1BJUA 1YCPH 4Y8ZA 1THPB 2O8WA 2FX4A 1TOCB 4SGBE 4INKA 1NFYA 2G51A 1GI6A 1SC8U 1ANEA 1AY6H 1SOZA 5AF9H 1BTWA 1BCUH 1UO6A 5FXLA 3WWFA 1BIOA 1MH0A 1RIWB 2Y5HA 4DIIH 1YCPM 1ZOMA 1ELTA 4KTSA 1YP9A 1C5VA 2PW8H 2OC0A 4BAQB 3OYPA 1LHFH 3ATWA 4AG2A 2W5EA 1IQLA 3SBKA 1NU9A 1O2JA 2DE9A 1O2SA 2V3MA 4NA9H 1TFXA 1C5YB 1EFRD 3RMMH 2BD8A 2HLDD 5FBIA 1V2TT 5HM9A 1NPMA 1SGPE 3UOPA 1AUTC 2BD3A 2FM2A 3RM0H 2F9BH 1GJDB 5DSFA 1TX8A 2K1QA 3U28C 3MNBA 3UWJH 2OC7A 1C5UA 2ZHDA 5DP5A 2KCOA 3N99A 1A7SA 4TYDA 1UTQA 2EY4C 2FS9A 3SQEE 2J9NA 3L33A 1ZPCA 3EYDA 1ID5H 2BLOA 1GJ6A 1XUFA 1P04A 3SV8A 1MTWA 3T27A 3SV7A 2EQNA 1PQ7A 4INLA 1OYQA 3BTEE 1GDUA 4I8GA 1HV7A 1KXDA 1IQMA 2OC1A 1OWIA 3A83A 5EXMA 1V2RT 2PWXA 1MKXK 1TBQH 4MDSA 2WV5A 2Q6DA 1FY5A 5AHGH 1L1JA 1W0YH 2ZPQA 3SU2A 4IC6A 2A32A 1DLKB 1QB9A 1NM6A 2P59A 3TNSA 1QB6A 1O3EA 2WPJS 3BG8A 3C27B 4X1PU 1O2LA 1V2WT 3VB4A 1F92A 1K1MA 2Z3CA 3PV5A 1FX0B 3E3TA 3S9AA 1LVBA 1FV9A 1GMHF 3SUEA 1EJNA 1QQUA 1C5PA 4NGAH 1GHBG 3V0XA 3K6YA 1UTOA 1XUGA 3MH4A 5E8EH 3ATIA 1E34B 5EQSA 1G30B 1V6DA 1Y3WA 1C5LH 1T31A 1DPOA 3GY7A 3TH4H 2ZA5A 2C93B 3SI4H 3SZEA 4ABBA 4XDEA 1MABB 2A4GA 2BOKA 1B5GH 2BVXH 3GCTG 1O2TA 3HGPA 1C9TA 5C3NA 4JZDH 1VITG 1P2KA 1O2ZA 4B6EA 3KYFA 2XNIA 2UUJB 2W3KA 3M5OA 5E0JA 2AHME 3VFEA 1G32B 1EZXC 3KEEA 3UB0A 3HPTB 1S0QA 1E36B 1GMCG 1V2KT 1EKBB 2THFB 1TONA 1J8AA 3M7UA 4FUDA 1O3IA 2FO9A 4FETA 3OTJE 1P3CA 1A0LA 2YNBA 4WF8A 1CE5A 4I8KA 2BQ6B 1HAGE 1YF4A 3QUMP 1TBRH 2HNTF 3KF2A 2GTBA 3WW7A 2FYQA 1IOEA 2RCEA 3DHKH 2J98A 1UCYE 1BB0B 3UNSA 1SHHB 3V3MA 1T4UH 1ZTLA 3A7WA 4AORA 3ZZ9A 1QRWA 3QZRA 1SGFG 3F6UH 3MU8A 6GCHF 4BNRA 1K1PA 2V7QD 1BTUA 3CENA 4RT0A 5GNDA 4GCHF 3A88A 1NRSH 3RXUA 2FMJA 4F48B 2GX4A 2HWLB 4FUGA 4WMFA 4YLQH 1CHGA 1BBRH 1G9IE 3EA7A 3EA9A 1ELVA 1EX3A 3IITA 3A8BA 1H8ED 5FPSA 1ZPBA 2JH0D 1SG8B 1EB2A 2VWNA 3PMHB 3P92A 2H6MA 1Q2WA 6CHAC 4CHAC 2J5UA 3W1EA 1QGFA 4FUEA 1UHBB 1ELFA 2CMYA 1BHXF 1CT4E 4IN2A 1BHXB 3SZNA 1MD8A 5EPNA 3BV9B 3KGPA 3H5CB 2WYJA 1THRH 2PHBA 5F6MA 2Z3DA 3PLBA 1MBQA 4ISHH 2ZFRH 3KN2A 1VZQH 1AO5A 1VCQA 3TK9A 4BTIB 2BY6X 1ELEE 1ZYOA 3GCOA 4A1XA 1TABE 4X2YA 3ATLA 1UJ1A 4FVDA 1C4Y2 2F83A 3RXRA 5DP6A 4IW4E 5LPFA 1XVMA 2PKAB 1P12E 1Y3YA 3OSYA 1AKSB 1GVLA 2AEIH 2ODQA 1A46H 5KEDA 2F91A 3F3BA 1QQ4A 2C4FH 3LGWA 1JBUH 3SYJA 4CRFA 9LPRA 4WH6A 1SGEE 1BRUP 1UVTH 1GHAG 1HIAA 3D62A 3RC6A 2PKAA 2KCPA 1H8DH 2O8UA 4K5ZA 2ZHWH 1EJMA 5ABWA 2EI8A 5ESTE 2HVXA 1AWHB 3LC3A 1O32A 5KGOA 1ABJH 3S7HB 2Z9JA 1JIMA 4P00A 1DX5M 3T2NA 1C2LA 5C1XA 1O31A 1DWEH 2L74A 3PO1C 1N1LA 3TJVA 5A0CA 2ZDVH 2ZQ2A 1ZHRA 1XUIA 1BMAA 4K8YA 2ZC9H 1PYTD 4X6OA 4B6FA 4JK5A 3DFLA 4X0WU 5A09A 1C1VH 1NBME 1LHDH 1D3QB 3T28A 1G36A 1C5OH 4JCNA 5DPAA 4DCDA 1DWDH 1GMHG 2WPKS 2FPZA 4B1TA 2I6SA 5E0HA 3A82A 1TRMA 3CS7A 3IG6B 1H9IE 4I86A 2FOCA 1Y3UA 1SR5C 1GG6B 3RUOA 2JJ2D 3L3TA 3M3SA 3LT3A 4YXWD 5DJ7A 4I33A 1N6YA 1YPHC 2XNDD 3RXEA 4CRGA 1ABIH 1ZGIA 1OSSA 2BD9A 1W14U 2ZDLA 3T25A 1TQ7B 1K0HA 2PTCE 5C17A 1QTFA 1TGNA 3UPEA 1GJ4H 1OS8A 3GISB 2HPQH 2CHAC 4XFQA 1XUHA 1ZSKA 1GPZA 2V3OH 1DXPA 3SQHE 2BQWB 3AW0A 1T8NA 2QF4A 3RXMA 3NZIA 2BQ7B 1LQDB 2Y81A 1YM0A 4LXBH 2FZZA 1DUEA 4MVNA 1FLEE 4ABJA 1IHTH 2WPMS 3KIDU 2A5IA 4GUXA 1KXAA 1YPLH 5HYOA 3OEED 1MQ6A 3ODFA 5EG4A 1W0ZU 2WPIS 4KGAA 1HBTH 4K69A 1ZHPA 1SGFA 1GVZA 1GI7B 2R2MB 1YPMH 5JB8S 1RTLA 6GCHG 3RXBA 3FZZA 2AIQA 1P03A 2QXIA 3BTFE 1O3MA 5DO4H 7KMEH 1K1LA 1ESAA 3TVJB 1XKBC 3VXEH 1SL3A 3A86A 3QGNB 1CBWC 3PO1B 1YCPK 5JB9S 3ENSB 4BAKB 1TQ0B 1XM1A 1ZPZA 5F53A 4O3UA 1WTGH 1TPPA 1P3EA 2WUBA 1TWXB 3TNTA 3BG4B 8LPRA 3S0NA 4ASUD 4AFQA 4U01A 3QX5H 2FOAA 3KCGH 2SFAA 4TY7A 2GGVB 2PLXA 1RGQA 3ZZ5A 3LGIA 2PGBB 4NA7A 5JBCS 1EZSC 3PYHA 3PMJA 2ZO3H 5T6GA 1GG6C 4FUFA 1WBGB 4TY6A 3L6PA 1HAZB 4BTUB 1O3FA 2BD2A 2TRMA 2BLWA 2QY0B 2UWLA 3OTPA 1AI8H 5EW1H 1V2ST 4WXVA 4MPUA 3ZVBA 1GGDB 2K0QA 2ZHQH 4AOQA 3U8RH 1SKYE 2BY7X 2W6JD 1E37B 1TNLA 2F9PA 1O2MA 2BY5X 4BAOB 3GCNA 4JZ1A 1PPGE 1XXDA 1GCTC 4NIXA 4I31A 1NESE 1C5WB 2SGQE 3EQ0H 3PTBA 2ZPSA 4XBBA 1UTLM 1EB1H 1LPZB 1CBWB 2OCVB 1ELBA 1RRKA 1D6RA 2BZAA 3KQEA 1KDQB 2W7SA 4UE7H 1GWAA 1K1OA 2FOHA 4TPIZ 1EZQA 1SGNE 4ZKRU 1BA8B 7ESTE 5L2YH 4NWKA 4CRCA 5L6NH 1P10A 4Q7YA 2ODYB 5GPIB 1GBJA 3FP8E 2ZF0H 4GHQA 1QJ7B 1MBMA 1ZGVA 5BRRE 4BXSA 1C1QA 1P01A 2YMSB 1QIXB 2VGCB 3QLPH 3BF6H 1MU8B 3BTTE 8KME2 3LU9B 4AG1A 1THSH 4XBDA 2JJ1D 4IC5A 4LK4A 1ZJKA 2H2ZA 4Z1MD 3VPKA 2VJ1A 3PMAB 1SGRE 1LMWB 3F1SB 2STAE 3MNCA 3ATKA 3D65E 1W10U 1SGQE 3B8JA 2WPLS 2XWBI 1C5RA 3A7TA 3A85A 3BEFB 2GMTB 1T8MA 1LHGH 4YOIA 1AN1E 3KQDA 4I8LA 3TK6A 4Q80A 4E06H 1XX9A 1V2QT 3UR6A 2O8MA 5IK2D 3PM3A 1BBRE 1GBKA 1O2KA 1O3JA 1HAVB 1C1WH 1D4PB 3SNEA 1KXCA 3CNRA 5EW2H 1QL7A 2PP6A 1WOFA 4AB9A 3UREA 2WV4A 8ESTE 2BLVA 1Z1IA 2CV3A 1ZMJA 4R8TB 1CVWH 1TX6A 1DS2E 4X8VH 1MTVA 2VWOA 1FXYA 1SQTA 2VIWA 3BEUA 1GI0A 1TNKA 3ZZ4A 5FAHA 2JH5D 1O5AB 4R0IA 2V6NA 3A81A 3SUFA 4YM9A 1P0SH 1GJ9B 1W2KH 1JRSA 1PQ5A 3VXFH 1PPBH 1F7ZA 5DK1A 1BMLA 1GI3A 3A8DA 3QN7A 1Q31A 1JOUB 1MTNB 4Y8XA 3OE7D 1Z8IB 3T62A 1AB9B 1VITH 1UK3A 1KLIH 2UWPA 1O2XA 3E1XB 5K0HA 1JWTA 1C5SA 3BIVH 3OEHD 3M3TA 3OY6U 5BPEA 3MNXA 4YLUA 3ELAH 1L1GA 2A5KA 1TRNA 3UFAA 1ANDA 5A2MH 3RXDA 3FFGA 2J4IA 1J9CH 4X8SH 5EIYA 1F5RA 3BTQE 4U32A 1QJ1B 1K28D 4ABDA 3LOXA 2OP9A 1SGCA 5CE1A 1SLXB 3G01A 2G8TA 2A7CA 4RI0A 1YLDA 2BDIA 1S6HA 3PWBA 1O5DH 1SGTA 3GICB 2VINA 4E7NA 1O2WA 3ATMA 1AFQC 3A84A 1UTJA 1HRTH 1HIAB 3TITA 2ZU4A 2HNTE 2ZDKA 2QCYA 3RXTA 3FANA 1FN8A 1WQSA 4UFEH 1FAXA 2J97A 2A1DB 1K2I1 2ESTE 1TNJA 4ZCNA 1C1MA 2XWAA 1HNEE 1SSXA 3GOVB 3SU1A 1YPJH 4ZAEA 3QGJA 1O3OA 4ABAA 3RMNH 2F4LA 2AGIX 5A8ZA 4DIHH 1JRTA 3GY6A 1C5ZB 1ZLRA 2GCTB 5B6OA 1QB1A 3MI4A 5FPTA 3QZQA 4OGYA 1M9UA 6CHAB 1CT2E 3KHVA 1S83A 2HRVA 4HTCH 4TPYA 1GHWH 8GCHF 5HKKD 3T29A 2FLRH 3DT0H 2NU1E 1MKWK 1NRPH 1AVGH 1O3DA 1QBOA 2Y80A 1VKYA 1EASA 3A8AA 2J92A 4IMZA 2OBQA 2ZDMA 3WY8A 3GDVA 2ZFQH 3KL6A 1QRXA 3STIA 3PRBA 1GJ5H 3DUXH 4CBOA 3JZ1B 1MZDA 3RP2A 2O8TA 2JH6D 1JMOH 2ZTZA 1O3BA 1O5GH 5DGJA 4BAMB 5FX5A 1XUJA 1GJBB 4D9RA 2WYGA 4X2WA 2RFKC 3UNRA 3F2GA 1IQKA 2C8WB 1S6LA 2ULLA 1YC0A 1S84A 2A7HA 1O2IA 3TJOA 4U2WA 2GKVE 1PPEE 2A4OA 4NZQA 5DP7A 1V2VT 1XMNB 3MH5A 4BAHB 1E1RD 3NCLA 1ZJDA 5LPRA 2BVSH 2BD7A 5EXNA 1O5FH 5F8ZA 2BY8X 2Y6TA 1MAYA 1AZ8A 4GLYA 3ZZDA 1GI9B 4ACBA 4PROA 4DVAU 2BDGA 1AE5A 3RXQA 2VWLA 4WY3A 1P2JA 1H4WA 2Y5FA 1W0JD 5AFYH 2BVRH 1GBHA 1ETRH 3C1KA 1YBWA 2FOMB 3MTYA 4AB8A 3TGIE 1O33A 3RC5A 1DSTA 3E0PB 1YYY1 2JKHA 1CHOF 3M3VA 1ZR0A 2QIQA 2P3UB 2V35A 3Q76A 4Y8YA 1KY9A 1GVKB 3PLPA 2CHAB 4CH2B 2ZIQH 2BY9X 1OP0A 3BTDE 1MZAA 3SJKA 1LO6A 1OXGA 2FOGA 2XBYA 4UEHH 3P95A 3GY5A 4DT7B 1HJAB 1SQAA 1P2IA 4Q7XA 1IQNA 1UTPA 3DSPA 4X6NA 5CDFE 1C1UH 1GBLA 1FJSA 1MAXA 2R3UA 5A8XA 3EE7A 4VGCC 2BDYA 1E38B 1GI5A 3P8OA 4A7IB 1CU1A 2XTTB 1BRCE 2Z9LA 2R0LA 4YT7H 1XVOA 1G3BA 1C2IA 1QY6A 1OWEA 3E90B 3F2HA 1KDQA 2SGAA 1O3HA 4NSYA 4OGXA 1ZTKA 2P93A 1O2PA 2RA3A 3ZVEA 1BUIA 2AYWA 4O9VA 1PQAA 1D3TB 1QL8A 3ZZ7A 1LTOA 1GBCA 1O2UA 1YGCH 1GBTA 1PQ8A 1Y3XA 1KXEA 1O3NA 2FP7B 2YNAA 4K1TA 1YPGH 1TALA 2G5VA 4TT3D 2ALPA 4KTUA 1A1RA 3CS0A 2GT7A 3F9GA 3Q00A 3ZVGA 1UW7A 2F3CE 1OP2A 2ZCHP 5IDKA 1UVOA 2ZKSA 1LPGB 1OPHB 2FOEA 1GGDC 1UVUH 3PV4A 3BEIB 1EJAA 3OAAD 4WMEA 5F03A 2UWOA 2A0QB 5HGGA 1FONA 2TBSA 3RXPA 1ZRBA 2KAIB 1ESTA 3LC5A 4UFDH 3GCHC 1MCTA 3RDZA 3E6PH 3KQ5A 4GSOA 4DT4A 1PPCE 4BTTB 1RJXB 5C20A 4ABFA 4XRNA 2VH0A 3M5NA 1GCDA 3TIUA 2VVUA 3F0PA 1C5QA 1EAXA 3GYMA 4IBLH 5C0TA 3H09A 1DE7H 4MPXA 3RXIA 4BOHA 4THNH 1BRAA 3ESTA 3LH1A 2G5NA 4UFGH 5C1YA 2J94A 4ZXXH 5DP8A 4OM9A 1DFPA 1O3CA 2P3TB 2VVCA 1K1NA 1HLTH 1SQOA 2FS8A 1MU6B 2XBVA 1N6XA 3MU5A 1FZZA 4F4OC 1EAUA 3DSOA 4ZHMU 4NIYA 5T3HA 5T6FA 3ZZCA 4K1EA 4X1QU 2I6QA 3MWIU 2ZECA 1YPEH 2R2WU 4RKOB 4JYTA 1MQ5A 5EODA 1GL1A 1PPHE 5EPYA 2OINA 1TGTA 3AW1A 4I32A 4FUHA 1G3EA 1IAUA 1L1NA 3ZZBA 5FHTA 4K3JA 3MH7A 3V13A 2FESH 1C1NA 5DG6A 1Q3XA 1AU8A 1BTZA 3RXJA 2VU8E 2KM0A 1ZSJA 2SNWA 1O35A 3GY8A 4QT8C 3GDUA 4O97A 3STJA 3U98H 3A7VA 2PR3A 2ZGCA 4Y7AA 1ZRKA 2P8OC 1G3DA 3ZVDA 2PSYA 1P02A 2KCYA 4D7FA 1MKWH 1O5EH 1HAXB 2WINI 3R0FA 1BITA 2KZ4A 1IQEA 2ZTYA 1KXBA 1CHOG 3LPRA 1AHTH 4GVUA 2QE7D 1D3DB 3MO9A 1BOQA 1Z1JA 4ZKSU 3QTOH 3KQCA 4B74A 1S82A 1LKAA 2ZCLP 3QO6A 1BMNH 4ZHLU 1TYNA 3UIRA 5C0UA 1O2NA 2FDAA 1AZZA 4CR5A 4LZ4B 2AERH 1GDQA 1WUNH 3LGUA 1IQJA 2H5CA 1TGBA 2WSSD 1SGYE 3TH3H 1O5BB 4AFSA 4AC9A 1IQIA 1EQ9A 2XC4A 2ZU1A 3RXOA 1D9IA 1ELDE 4DURA 2Q1JA 1SLUB 2J98B 2P8OB 3T5FH 2QXHA 3TJNA 1ELCA 4ZROA 2GV7A 3F9HA 3EE0B 3NPSA
chains in the Genus database with same CATH topology
3O8BA 2LNCA 2G55A 1HAIH 4A5TS 3AAVA 3SU0A 5TCCA 2W3IA 5E2PA 3OY5U 4GPGA 3SORA 3VB3A 1O37A 3LJJA 3RXVA 1HPGA 1GI2A 4RKJB 1CGHA 2JETC 4WVPE 1A4WH 1F5LA 4ZKNU 4NCYA 4ABGA 3LGVA 1O2YA 4FUIA 1E35B 3GYLB 4TWYA 1TGSZ 3A7YA 2ILNA 2ZP0H 4UONA 2H9TH 1AKSA 1DICA 1GI4A 2ANYA 1AVXA 2ZQ1A 1Y5AT 3ZZ6A 1SBWA 1ETSH 1DY9A 2Z3EA 2GCTC 3SJOA 4ZMAH 5JBBS 2BZ6H 3SGQE 1TNHA 3TK5A 1QURH 3K65B 1O3KA 1ESBA 3BSQA 1O2VA 1Z7KA 1P2NA 4FUJA 4AYVB 5GCHG 1T8LA 2GCHG 2J38A 2QGRA 1VCWA 1BTYA 3E91A 1ANBA 3P17H 8GCHG 4CREA 4WJG2 3I29A 3ZYEA 1UK4A 2UUYA 4FU9A 1EUFA 3SV2H 1QJ6B 1T32A 1V2PT 1P06A 1SLWB 2H5DA 2O9QA 2ASUB 2DE8A 1HJ9A 3DA9B 5FCKA 5LGOA 1FNIA 1G37A 3S7KB 5GDSH 2VIPA 2TGPZ 2C90B 4B2CA 5SGAE 3R3GB 2XBXA 3SUGA 3S69A 2PKSC 3SNAA 1MKXH 2SNVA 3F68H 1C1PA 2ZU3A 2Z6BD 4J1YA 2XW9A 1IQFA 1C2DA 1S81A 1TRYA 4MPVA 1LQEA 1O5CB 2W7UA 4MNWA 4AN7A 1NO9H 4IMQA 3LDXH 2YOLA 5G4BA 4HGCA 1UTMA 3SHAH 4H42U 1GJ7B 1HXFH 4F49A 2TGDA 2OLGA 2NU0E 3K2UA 3ZZ3A 3M35A 1H8IH 2ZCKP 3A87A 2F9UA 4O3TA 1W7GH 1CSOE 4JK6A 1BJVA 4X8UH 1CO7E 1S0RA 1T8OA 2ZGBH 6LPRA 2J34A 3LIWA 1AUJA 3NXPA 1F5KU 1QBVH 5F8XA 1TX7A 3MYWA 4MNVA 4KELA 3URDA 1BT7A 1P2MA 1TE0A 2BX3A 1SOTA 2TGAA 1EATA 2BD5A 1C2HA 5J4QA 3OU0A 1FDPA 3Q77A 4WMDA 3MH6A 1FAKH 1L2EA 1T7CA 3D23A 1SFQB 4B71A 2FIRH 4D76A 1GMDG 2BXUH 1OWJA 1ZZZA 3PROA 3EGKH 3M37A 1SVPA 1LCYA 1C1OA 1NFWA 3HK3B 1FUJA 1RTKA 1NRNH 3PTNA 4A1TA 3CP7A 5EXLA 5FCRA 2B5TB 2QV1A 4FU8A 4AGKA 4CRBA 2ZGHA 1T4VH 2G81E 1NT1A 3LGTA 2GZ8A 1S5SA 4NIVA 1O2HA 2SGDE 1W8BH 4NFEA 2F9VA 1GHZA 3B9FH 1O2RA 1L4DA 1SI5H 3K9XB 3KNXA 1TMBH 3Q3KA 4NZLA 2ZFPH 5LPEA 3RXGA 1TA6A 4LOYH 3I77A 2QXJA 4Y10E 2QXGA 2FOBA 1DM4B 1HFDA 5GXPA 1TIOA 4AX9H 1F0TA 2CXVA 1DDJA 2A7JA 2CJIA 1TMUH 3A7ZA 5JDUB 1D3PB 5C5NA 3RXLA 1TLDA 2ZNKH 3LKWA 1CA0C 1HUTH 1OWHA 1FY1A 4X1SU 2STBE 1ORFA 1O36A 4FXGH 4X6MA 5I25A 1V2UT 1O39A 2XYAA 1OWKA 2ZWLH 4AYYB 2ZU5A 5TCAA 5EGMA 1HDTH 2WUCA 3E0NB 1VCPA 4ZHAA 2Z9KA 4B2BA 2IN2A 1C2KA 3UR9A 3VGCC 2CF8H 3ZZAA 1HAHH 1TMTH 1HB0B 1EOJA 1NU7B 2B8OH 3HKJB 1DXWA 1CA8B 2OQUA 3BTKE 3P8GA 4YOGA 3RXHA 2QYIA 3BG4C 1GL0E 1G3CA 4ISIH 1BTPA 2XCNA 2P94A 3VB5A 2BM2A 3TH2H 3GCHB 1PFXC 2Y5GA 2GDEH 3RM2H 1V2NT 1C2JA 2TGTA 3K6ZA 1FN6A 1DWCH 4Z0KA 1RTFB 1AIXH 1YKTA 2LPRA 2XCFA 1LDTT 2IJOB 5A8YA 3UQVA 1DY8A 2AS9A 1C2EA 1G2LA 1QA7A 1WYKA 1O2QA 3SU3A 3PLKA 4A6LA 1CA0B 4RSPA 1GHVH 1ZMNA 2FEQH 2AGGX 1EAWA 3AASA 5HM2A 4B73A 1QL9A 1Y8TA 1LVYA 1BTHH 2NU2E 1FMGA 1PPFE 1Z6EA 4UDWH 2GVFA 1UTNA 3LJOA 3HATH 3M7QA 5FX6A 4OS6A 4YOJA 2GZ7A 2D26C 3VGCB 3RU4D 4JYUH 3ZZ8A 3S9BA 1QRZA 2V3HH 1TGCA 4H6SB 1A3BH 3H7OA 2R9PA 1QNJA 3UQOA 2V0BA 4ZH8A 2NU3E 3BN9A 1Y59T 5JBAS 4FVBA 1W13U 3MFJA 3BTHE 1KYNA 2FLBH 1P11E 1HAVA 2PUXB 3TGKE 3HGNA 1FI8A 1A0JA 3UNQA 1Y3VA 2Z9GA 3BTGE 1J15A 5GWZA 1SB1H 3PWCA 1FQ3A 2ZHEH 3O8DA 1B0EA 2SGPE 4DW2U 1XXFA 2Y82A 2P3FH 3MU1A 1G2MA 1XUKA 2UUKB 4MNYA 3MO6A 4K8BA 1EXFA 2A31A 1Z8RA 2IPHA 1ZSLA 1K1IA 3W94A 1S6FA 3SU5A 1X7AC 1Z71A 4Y76A 2AMPA 2G4UA 4FUCA 4ISLA 1Y5BT 1GI1A 2PTNA 1ACBE 1VR1H 3U1JB 3ZVFA 3SOSA 3RXKA 3SV6A 1GBMA 3SN8A 3ODDA 3BIUH 4K60A 4XE4A 1O0DH 2ZDNA 4MTBA 2A4RA 5K7RA 2OC8A 1DSUA 5AFZH 2CF9H 3P70B 4Y6DA 4ESTE 1O3PB 2ZG0H 4B75A 2EA3A 2HGTH 2J2UA 3FAOA 1BRBE 1HXEH 2XRCA 5CHAC 3MU4A 4OS7A 2BDCA 1E0FD 2GZ9A 3JZ2B 1ZMLA 4JZIA 3U9AH 4CBNA 2D8WA 1IHSH 3QK1A 5C1UA 2G00A 2A4QA 2ZFTA 1J17T 2P16A 2AMDA 2WPHS 3P8NA 4XBCA 1EOLA 4E05H 2BOHB 1ZTJA 3D49H 2OTVA 2PUQH 2D2DA 3NKKA 1NS3A 1TNIA 4LZ1H 2GT8A 4UFFH 1AGJA 1SPJA 1NRQH 3QWCH 4CRDA 3SNCA 1SGDE 1NTPA 4Y7BA 1VGCB 4NFFA 1AFEH 3TU7H 1AFQB 2HOBA 1FPCH 1FY3A 5TJXA 1O3AA 3RMLH 1SFIA 2JETB 2H1UA 3B23B 3RU4E 3MHWU 3HK6B 3SNBA 3OX7U 1FIWA 1A5HA 2QAAA 2BLQA 3TLOA 1D6WA 3URCA 1J14A 3Q3YA 2M5TA 4FU7A 4J2YB 4MG3A 4NG9H 1FY8E 2XC0A 3MNSA 4K2YA 1GJ8B 4X1RU 4E7RG 2BDBA 1UK2A 1RIWC 3ZV8A 1QR3E 4CHAB 4ABHA 1CQQA 2A5AA 3SJIA 1UCYK 2PGQB 5CHAB 2RDLA 1P9SA 4WWYA 4XOJA 3A8CA 4YT6H 1S85A 1YLCA 3U8TH 2EI7A 2CN0H 4YZUA 5EQRA 1TOMH 1MMJN 2J95A 4ABIA 2HLCA 2H9HA 4DJZB 1F0SA 1LPKB 1YPHE 1OWDA 7GCHF 1W12U 1K9OE 1PPZA 4OS1A 1SMFE 2GMTC 4MNXA 2F9NA 1QA0A 1LVMA 2BD4A 1GBEA 1O30A 3Q3XA 2Q6FA 2OBOA 1GBIA 1HAPH 4B76A 5FBEA 1A5IA 1AQ7A 5CMXH 1B0FA 1C5NH 1TA2A 1GBDA 3SNDA 4JZFH 5DP4A 1KTTB 3F9FA 3SGBE 3O8CA 1GDNA 3ZV9A 1NRRH 5DKMA 1YPKH 1KIGH 2O8LA 3SO3A 2FWWA 3M61U 1P09A 2UUFB 1GJAB 5EQQA 2FTLE 2ZPRA 3PMBB 4TWWA 1TNGA 2VWMA 4DY7B 1HAOH 2R0KA 1H9LB 2B0FA 2G52A 4JYVH 4DOQA 2DUCA 1FPHH 3P6ZB 5I46H 1CT0E 3EA8A 4O03A 2XC5A 3SUDA 4AFZA 2A45B 2AH4X 4CH8B 3SV9A 2A2XH 2ZFFH 1WQVH 2NU4E 1P9UA 4Y0ZE 3M7TA 3A7XA 1A3EH 1DUAA 5EU8A 1EPTA 1UMAH 3LONA 1DT2A 5JPMH 5GJ4B 2BDHA 3P8FA 3EDXB 1BTXA 4NWLA 5EOKA 1C5XB 1Y5UT 2BDAA 3FVFB 1H1BA 2VB0A 3RLYH 3ITIA 2BYAX 4INHA 4B2AA 4JZEH 4CRAA 1EPTC 1BZXE 3VB6A 1N8OB 4KP0A 2ZGJA 1JIRA 5F8TA 3M36A 1Z8JB 3FP6E 1HGTH 1O3LA 4AZ2B 1C2FA 3ZVAA 2ZEBA 1Z6JH 1K21H 1P57B 1C4V2 1UTKA 4I8HA 2TIOA 3MO3A 2QA9E 1WTHD 4OS2A 2FI4E 2BB4A 2C3SA 5H4IB 2PV9B 3GDSA 3T26A 1GHYH 3M5LA 1RXPA 1WU1A 2ANWA 1HJ8A 3H7TA 3UOUA 2HPPH 1P8VC 3GY2A 1V2OT 5E2OA 1AMHA 1HAYB 9ESTA 1TB6H 4ZXYH 1C4U2 2ZU2A 2Z94A 1WAYB 4AGJA 4GCHG 1GJCB 5J4SA 1AWFH 2H9EH 3ZVCA 4H6TA 1EPTB 1AD8H 6ESTA 5JBTA 1KLJH 2A2QH 2OUAA 3V12A 2VH6A 1C5TA 2KAIA 4JMYA 1UHBA 5A0BA 2FYRA 2P95A 5AVDA 1FIZA 2ODPA 1C1SA 1WSSH 1KXFA 5T6DA 3MOCA 3SJ9A 1NN6A 2GV6A 1U6QA 1DITH 4D7GA 1O34A 1OP8A 5DP3A 2BXTH 1IQGA 3SW2B 4X2VA 1DANH 1CGIE 3IWMA 2HALA 3E8LA 4A1VA 1DWBH 2NWNA 1V2LT 2D1JA 2Y7XA 4Y79A 2QF0A 3RXAA 2BMGB 2C8YB 1UVSH 1TBZH 3SU4A 3UWIA 5ESBA 4ZKOU 2BTCE 3UTUH 4BANB 5A0AE 1C1RA 2R3YA 3SHCH 4FUBA 1UVPA 1QFKH 3MU0A 1MTUA 1V2JT 5JYIA 1XKAC 2CGAA 1NY22 2OQ5A 4X2XA 1IQHA 5HMAA 1GHAF 4Q7ZA 3NWUA 4MPWA 2EEKA 4NA8A 2OXSA 4GAWA 4XSKU 1MCVA 5GIBA 4NIWA 5IYTA 4ZUHA 5HXFA 2ANMH 4HI3A 1C2MA 2PSXA 4ASHA 1BDAA 1K22H 2AGEX 2VNTA 1O38A 1EP5A 4IN1A 4KTCA 1OX1A 1O3GA 4AFUA 1LHEH 1ARBA 1SLVB 2FXRA 1V2MT 4YTAA 3RC4A 3RXCA 3NK8A 3LH3A 1GHBF 3F9EA 1A61H 3SJ8A 4ISOA 2FI3E 2ALVA 4IGDA 1AVWA 5C5OA 1A2CH 3M5MA 1C9PA 1A5GH 3GY3A 1NROH 1SHYA 4U30A 1RFNA 1W11U 1AB9C 1NFUA 2ANKH 4OS5A 2EI6A 1H9HE 1RS0A 1INCA 1VGCC 3GCTF 2GDDA 1VITF 4YO9A 2VIQA 1MUEB 3DFJA 1A0HB 2ZGXH 2PKSB 4M7GA 4UD9H 1QHRB 1QCPA 1SGIB 3TJUA 1NC6A 1ETTH 2XXLA 2SGEE 2B9LA 3RU4T 1K1JA 4GHTA 1UCYH 1HCGA 3LGYA 4D8NA 1P2QA 1GBBA 4X6PA 1GMCF 3FZDA 2XBWA 3TPIZ 2F9OA 4YESB 4Y11E 3E16B 4IS5A 3PB1E 3NUMA 3RMOH 2FI5E 1W3CA 5LH8A 1C5MD 3AAUA 1C1TA 1KSNA 1W7XH 1ANCA 1GCTB 4SGAE 1QBNA 1BQYA 2BX4A 2G4TA 2FTMA 4BXWA 2EC9H 4X1NU 2FODA 1PYTC 4ISNA 2HNTC 4A92A 1VJ9U 2C8ZB 2GD4B 5DP9A 3FP7E 4WXIA 1TPOA 1ARCA 4Q2KA 2QN5T 1F2SE 2TPIZ 5E0GA 1GI8B 1O2OA 4MQAA 4DGJA 7GCHG 1ZHMA 2ZDAH 5L30H 3KQBA 1ELGA 1GMDF 3SU6A 1PJPA 2B7DH 2Z7FE 2VGCC 3HKIB 1CGJE 2ZI2H 2ZZUH 3U8OH 3W95A 4H4FA 1B7XB 3UUZA 1GBFA 1KLTA 1GHXH 1MTSA 1BMMH 1AE8H 1RD3B 3BTME 1NZQH 2VIVA 1TPAE 2QF3A 4CR9A 1JXPA 2SGFE 3GY4A 1L4ZA 1MD7A 3A80A 1DLEA 2Q6GA 5C67A 1BBRK 3DD2H 1V3XA 4DG4A 3VEQB 1VJAU 2W26A 1NFXA 1EZUC 4K1SA 5C2ZA 3EAJA 1DVAH 1F0RA 1WV7H 2BHGA 2PFEA 1EAIA 3I78A 5L2ZH 1LKBA 3S9CA 2ZHFH 3SI3H 2AFQB 4NSVA 4D9QA 1O2GH 3MMGA 4HFPB 1OYTH 4Y71A 4MLFB 2Y7ZA 4ABEA 1P2OA 1GBAA 1HYLA 2FX6A 3U69H 4Y0YE 2RG3A 3ZYDA 1WCZA 1J16A 3A89A 1F0UA 2IOTA 1P05A 1C2GA 2AIPA 4I7YH 3BTWE 3QDZB 3RXFA 2GP9B 3RXSA 3O8RA 4X8TH 2VIOA 4OS4A 3N7OA 2ZFSA 4KKDA 3TGJE 3V7TA 1LHCH 1TAWA 4I8JA 2C8XB 3VB7A 2RA0A 3UY9A 1ELAA 1MTNC 3AVZA 1HJAC 3U1IB 1L0ZA 4Z6AH 7LPRA 2QC2A 1KTSB 3SGAE 5GCHF 1Z8GA 1FY4A 2GCHF 1TPSA 3QTVH 3RLWH 5FPYA 2AMQA 4VGCB 1OOKB 2ZTXA 1OKXA 1N8OC 2VIDA 1DOJA 1EP6A 2OD3B 4WH8A 2VVVA 1LVOA 5PTPA 5ETXA 2FOFA 4HZHA 2Z9IA 4RN6A 1BJUA 1YCPH 4Y8ZA 1THPB 2O8WA 2FX4A 1TOCB 4SGBE 4INKA 1NFYA 2G51A 1GI6A 1SC8U 1ANEA 1AY6H 1SOZA 5AF9H 1BTWA 1BCUH 1UO6A 5FXLA 1BIOA 1MH0A 1RIWB 2Y5HA 4DIIH 1YCPM 1ZOMA 1ELTA 4KTSA 1YP9A 1C5VA 2PW8H 2OC0A 4BAQB 3OYPA 1LHFH 3ATWA 4AG2A 2W5EA 1IQLA 3SBKA 1NU9A 1O2JA 2DE9A 1O2SA 4NA9H