1P2KA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsinogen, cationic
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2kA02
1V2KT 1ZRKA 1GBIA 1GJ4H 1QRWA 1JRSA 1GMCG 3SQHE 4Z0KA 3OYPA 2BDAA 1T31A 1J16A 1YCPK 1O31A 4GHTA 1O2ZA 3P8GA 5C20A 3LJOA 3MO3A 3PMJA 4YO9A 1ARCA 4KELA 2ILNA 3D62A 3QUMP 1DSUA 1TQ0B 5ABWA 3BEFB 4OS2A 4YT6H 2ZGHA 4BAMB 2ULLA 1NN6A 1UCYK 5EXLA 2BB4A 1Y3UA 3GYLB 3ZZ6A 1ZPCA 5JB8S 1ORFA 2Y6TA 3E90B 5AHGH 1BT7A 3FP8E 1HJAB 5AF9H 2Y5FA 2QIQA 3RLYH 4X1RU 4BANB 1W7GH 1XUJA 2XTTB 1GMHF 1IAUA 4Y71A 2FOBA 1CA8B 1F5KU 4NSVA 4B2BA 4LXBH 1SGTA 4DIHH 1SHHB 2ZNKH 2STBE 3K65B 5L30H 2A45B 1HAGE 4NZLA 2BHGA 2FO9A 5EGMA 1P57B 3DHKH 3MTYA 1LVOA 2VWMA 3T29A 1C4U2 2FOFA 1WUNH 4VGCB 1QA7A 3L33A 1O33A 5FPYA 1YPHE 1V2TT 1MD7A 3GY3A 1ELVA 3TNSA 5DP4A 4DY7B 1AI8H 2V35A 3UY9A 1OS8A 3UUZA 1O3EA 3SV6A 2RA0A 2SNVA 1GHZA 1MU6B 2B8OH 1C5UA 5A0CA 2WYJA 2SGQE 3ATKA 1TX8A 4ISOA 4GSOA 5FCKA 2ODQA 2DUCA 3RMLH 2J9NA 2QAAA 1UK4A 3ZV8A 1C5NH 4I8GA 2UUKB 2OQUA 3UQOA 3ITIA 1B0FA 3LPRA 1MQ6A 1V2MT 2QY0B 1C1UH 1C2DA 2OC1A 1L4DA 1GBKA 3BTKE 4JZFH 1ELTA 5I46H 2FLBH 1BTUA 4GCHG 4KTSA 1GJAB 1DY9A 2QGRA 4E7NA 1KYNA 3KQCA 1ZMNA 2HGTH 4I33A 3MHWU 3P17H 1A1RA 1GBJA 1ABIH 3L6PA 3E6PH 1LO6A 1ANEA 4FUDA 2UUFB 3STIA 3ATIA 1ARBA 1V2JT 1FIZA 3UNQA 4MLFB 1A61H 2KAIB 3RXIA 4DW2U 4AG1A 2BDYA 3F9GA 1VITG 3SU5A 1YKTA 3QDZB 1GHYH 1FONA 2YOLA 4CR5A 3SNAA 1QIXB 1UO6A 1SB1H 1HAYB 1OWIA 1ELAA 2BY7X 2FI4E 1U6QA 1VCWA 3A7XA 2ZU1A 1AKSB 1TNKA 4RSPA 2ZHQH 3NCLA 3PWBA 4MG3A 4WH6A 1C2FA 3GY5A 1AB9C 1O3IA 1VCQA 1UCYH 1AVGH 4D76A 2O8TA 4JYUH 3BG8A 1DFPA 1GHXH 1ETTH 3SGBE 1O0DH 1FAXA 4JCNA 2ZWLH 1J8AA 5BRRE 1FY3A 2HVXA 1AY6H 1J14A 2GKVE 1PPCE 2A7JA 3SJ9A 1EZUC 2BDHA 2C90B 1QY6A 2VJ1A 1ZOMA 4FUJA 4WXIA 2XWBI 1XXDA 4R8TB 2SFAA 1Z8JB 2ZPQA 4Y0ZE 3UQVA 5FBIA 1ELFA 4IS5A 4WJG2 1XVMA 5FBEA 1QBVH 4HTCH 3I78A 3B8JA 1BRBE 4CHAB 1ZJKA 2ZFPH 1TFXA 1BMLA 2AH4X 2ZZUH 2V0BA 2EI6A 5LPRA 3RM2H 4H6TA 3PWCA 1O2UA 2C8WB 1NTPA 1GCTB 3PMAB 1GBDA 1AO5A 1LVYA 1S6HA 2A5IA 3JZ1B 2PTCE 3T26A 4CH8B 4X1SU 2Y5GA 1KTSB 1HB0B 1YPHC 1Z8IB 5DP8A 3SV9A 2QF3A 2Z9GA 3AVZA 3SU1A 1DDJA 3GY6A 2FS8A 1X7AC 2GT8A 4GUXA 2EC9H 3RXKA 2FTLE 2AERH 1GBAA 1ZLRA 3RXAA 1UVOA 2PFEA 1O2JA 4J2YB 3K6ZA 2TGDA 2Z9IA 2GCTB 2BQ6B 1HJ9A 1HXFH 2EA3A 1GPZA 4FUHA 3SUGA 1O5FH 3TK9A 5EU8A 1H9HE 1MCVA 4YLUA 5FAHA 5HMAA 2NU4E 3ZVAA 4WMEA 1F2SE 2LPRA 3EE0B 1T32A 4CBNA 1TRMA 2PW8H 1TPOA 1QRZA 4K8YA 2FYQA 1TA6A 8LPRA 2GMTB 2FIRH 1YLDA 4MPXA 7KMEH 2G5NA 2J2UA 4JK5A 2FS9A 4IC6A 1QURH 5AVDA 1NROH 3A88A 5TJXA 4SGAE 1P03A 2BZ6H 5B6OA 2FOCA 1O3NA 4NFEA 4UDWH 2XBXA 4MNVA 1C9TA 4FUEA 4NIXA 4ABHA 2HOBA 1GDNA 1L1NA 4BAQB 2C8ZB 4Y8ZA 2BXTH 4UFGH 7LPRA 4FUBA 5C1UA 1IQIA 4FU7A 2F9BH 2JH0D 1GL1A 3EYDA 2BLVA 4O03A 3B9FH 3URDA 1OWHA 1A4WH 3A86A 3BEIB 1BTHH 3TU7H 1BJVA 1TIOA 4D7GA 4ESTE 1HJAC 3GCOA 2UWLA 2GZ8A 2PUQH 2ZU4A 2NU0E 2TBSA 4MQAA 2H5DA 1MH0A 1XVOA 1EZSC 1GI4A 2VGCB 3RU4E 2HNTC 1Q31A 2FX6A 4DVAU 2IJOB 1HAXB 8GCHF 3E16B 3O8BA 2PKSB 2ODYB 4X6OA 5EXNA 4Q80A 3QTOH 1NFWA 3ZZ8A 2R2WU 1V2UT 3AW0A 1VGCC 4A7IB 2WPJS 5DK1A 1SGFG 2HRVA 1O36A 1JXPA 1M9UA 4ZHMU 2XBWA 1Z71A 4LK4A 2WUCA 1CHGA 2J34A 4AB9A 1SI5H 2QXIA 3BIUH 4WF8A 3SO3A 1C2LA 5F8ZA 1DPOA 3RXGA 1GWAA 2R3YA 1Y5AT 3VB4A 1T8MA 2VIDA 2FLRH 4K3JA 1CT2E 1CGJE 3ZZ9A 3LT3A 4ZUHA 2ZGXH 2R0KA 4Q7XA 6GCHF 1HIAA 2FP7B 4CBOA 1K1IA 1N6XA 1C5XB 3RDZA 4Y8YA 5C2ZA 4KP0A 4X8VH 1GBMA 3O8DA 4RKJB 2OTVA 1O2YA 3GY8A 4NSYA 3EA9A 3NWUA 1T8LA 4BXWA 1RXPA 1RS0A 1SLWB 4H6SB 1J9CH 2GCHF 3M7UA 3G01A 4Y76A 1MTNC 1XM1A 1DSTA 1FIWA 1Y3XA 2C8XB 1ZSJA 3KQEA 7GCHG 3TK5A 2QC2A 4I31A 4UEHH 2JH5D 4INLA 5GCHG 3U8TH 4BXSA 5F6MA 3GDSA 5T6FA 2QYIA 1IQNA 2NU3E 4Y8XA 5C1YA 3GICB 2YNAA 1G2LA 1BRUP 1GDQA 1Z1JA 2O8MA 4A5TS 2G4UA 4DG4A 2GD4B 1MKXK 3MNXA 2IOTA 3K2UA 4JZDH 2J95A 2BDGA 2Z9LA 3PM3A 1H8IH 4DGJA 2A31A 1KXBA 1MTWA 2ZHEH 1GJ6A 4B74A 3TJOA 1FLEE 1UVPA 1GHBG 1W13U 2ASUB 1QJ1B 1NRPH 4ZXYH 4IN2A 4Q2KA 1RGQA 3GDVA 3S69A 2HNTF 4ZHLU 5JBAS 1ETRH 4MNYA 5EXMA 3KNXA 4F4OC 2B5TB 3KCGH 1CBWB 1YPLH 1G2MA 4GHQA 1NU9A 4B1TA 1IQHA 1LHFH 1AQ7A 1SC8U 1HDTH 1Q3XA 4I8HA 1T4UH 2O8LA 4AN7A 1TAWA 3T5FH 4DOQA 1GG6C 4CHAC 1BHXB 1SOTA 3MFJA 2ZHWH 3EGKH 1BDAA 3S7KB 3SORA 2QA9E 2XW9A 2F91A 2SGPE 1GHAF 2IPHA 3K6YA 1TBRH 1WOFA 1PYTD 3V12A 3DUXH 3SW2B 1SMFE 2Q6GA 2SGDE 1EASA 1ZTJA 2G81E 2QXGA 3Q3YA 2O8WA 1DANH 1V2QT 3P6ZB 3SGQE 1CHOF 2ZECA 5E0HA 1SGPE 2J4IA 1QCPA 9ESTA 2BD4A 2PR3A 3KL6A 3MMGA 1G3CA 4Z6AH 4TPIZ 1C4Y2 5JBTA 4YTAA 4IGDA 2QF0A 3QGNB 2P16A 2FPZA 1G3BA 2G55A 4X0WU 3FZZA 2WINI 4E06H 1CT4E 1V2LT 2P93A 1SSXA 1UVUH 1QJ6B 2ZTZA 5DJ7A 2W3KA 1EAIA 3SNBA 1D9IA 2PSXA 3SJIA 1P01A 1EUFA 1QR3E 2WUBA 1O2WA 2CN0H 1BTYA 2VIPA 3BTQE 5FXLA 1O5AB 1UHBA 3QTVH 4A1VA 1FY1A 1NPMA 1UTQA 1WTGH 4WMDA 3U9AH 2HPPH 3MNCA 1Z8RA 1K1LA 2GMTC 1OKXA 1GJBB 3S0NA 1ELGA 3BTEE 1CVWH 3ZZ4A 3FAOA 4R0IA 3LU9B 3IITA 1HAVA 3F1SB 4XSKU 4FUGA 1IQLA 1TMTH 2F3CE 4UD9H 3ZZBA 2RG3A 4I8KA 3BG4C 3MNSA 1O3DA 3A8CA 2SNWA 3M3VA 3BV9B 1C4V2 2FDAA 1SGQE 1O35A 2PLXA 4ABJA 1GI9B 3UR6A 1MAYA 4RN6A 3A8DA 3O8RA 3L3TA 4YT7H 1W2KH 1DWEH 1FY8E 3M3TA 1BTWA 1HUTH 1TRYA 4NA8A 4MPWA 5A8YA 5LPEA 5ESTE 2A4QA 1TOCB 1PPFE 1VR1H 4O3TA 4U30A 4LZ4B 1UVSH 2FX4A 4Q7ZA 2FI3E 1YP9A 2D2DA 1WU1A 1YC0A 1ESBA 1AZZA 2P95A 1YYY1 4WXVA 1IHTH 1NESE 2VGCC 2G51A 1DUEA 3MH5A 1SQTA 1HNEE 2PTNA 4TYDA 4X8UH 5TCAA 1K1NA 3SUEA 3P70B 1ZGVA 1TONA 2PKSC 4BTUB 3S9AA 2ZHFH 1ZMJA 2CF9H 2F9UA 3RXJA 1A3BH 3GCTF 4NGAH 2ANKH 1QFKH 1BOQA 1DITH 4AZ2B 1KXCA 4ISLA 9LPRA 1FNIA 1EOLA 5EW2H 1GI5A 2ZCLP 1AUTC 1MTSA 3RXHA 2BDIA 2ZPSA 2FOGA 1RD3B 5BPEA 3ATWA 1O3AA 2EI7A 3U8RH 1HFDA 2B0FA 5FPTA 3TIUA 4I7YH 5EG4A 3UREA 4ISIH 3M5LA 1ESAA 2A4GA 1O5DH 1YGCH 3RXQA 2ZPRA 2A0QB 1OWDA 1DT2A 4YESB 1LQEA 1HIAB 1KY9A 1ANDA 3NXPA 1GBLA 3A8AA 4WMFA 2C93B 4NG9H 1ELEE 3TH4H 1L0ZA 1QL9A 1N8OB 1S0RA 4HGCA 5E0JA 1O38A 4DURA 1ABJH 3BTFE 3CP7A 3A8BA 2AYWA 1FN6A 4QT8C 1D3PB 3LGTA 2D8WA 1MZDA 1OWKA 4JYVH 2WPHS 4AFUA 2H5CA 3JZ2B 1HXEH 1VGCB 8ESTE 2D1JA 2W7UA 3TJUA 2ZTXA 1EATA 5T6DA 3DD2H 3BTGE 3A81A 2Z9KA 4U32A 4AX9H 1S82A 3OSYA 5F03A 1LKAA 5I25A 1ZTLA 5EQQA 2ZDNA 2XC4A 3RC6A 3ODDA 1CGIE 1P9UA 4GPGA 3C1KA 1QBNA 1C2GA 1O2GH 4ZKRU 1A5IA 3M7QA 3ZZCA 3F9HA 3SZNA 1UK3A 2V3OH 2XBYA 1MTVA 1SVPA 4AORA 3MYWA 2V3HH 2ZC9H 4FU9A 2AS9A 3T62A 4TY7A 3MU8A 1CO7E 1GBEA 5C5OA 4BNRA 1GMHG 2GDEH 1Y3WA 2BY6X 3A89A 3TLOA 2HPQH 1AU8A 4HI3A 1QQUA 2OP9A 1SQAA 3T27A 1LVBA 4OGYA 3AW1A 2A5AA 4BAOB 1MTNB 4F49A 1TGNA 1CBWC 3EA7A 3HKIB 1DOJA 1INCA 5DG6A 1THRH 3BTHE 3LGWA 3DT0H 4YOIA 1P04A 2PWXA 1IQKA 3RXDA 4YLQH 3OX7U 2VIQA 4ZAEA 5TCCA 1DS2E 1SQOA 1VJ9U 2OBQA 2W5EA 3M35A 1ZPBA 1S85A 3ZZ7A 4NA7A 1O3BA 1RTKA 1OYTH 1KLIH 5LGOA 1G30B 2OINA 2ZKSA 4OS4A 3SBKA 1G37A 4FXGH 1YCPH 2HNTE 3IWMA 5FX5A 1WCZA 1SGDE 1ELBA 3RXPA 1BZXE 3PTNA 3CENA 1EX3A 4AB8A 1AE5A 5EOKA 1B0EA 1DICA 2Y7ZA 1GI0A 1N6YA 2XXLA 1XX9A 2BMGB 3UTUH 1CSOE 5K0HA 1AN1E 3H7TA 4AFSA 1MBMA 1ZZZA 4Y7BA 3KEEA 4NA9H 1O3KA 1NFYA 1ZJDA 3U69H 1AVXA 1KLTA 1NFXA 1UHBB 1KLJH 2ZF0H 4MTBA 1C5OH 5JB9S 1YPEH 1QA0A 1HV7A 3A7WA 2GDDA 1SGNE 4CREA 1JRTA 2Z3EA 3ATLA 1WYKA 1GVLA 2Y7XA 3SJKA 4BTIB 1PPGE 1ZHMA 1C5QA 1C2MA 1WTHD 4INHA 5F8TA 1PJPA 3A84A 3M61U 1GJ5H 5T3HA 2DE8A 3SV2H 1A0HB 1HAPH 5C5NA 1ZHRA 1HAVB 5A09A 1GG6B 3MH4A 5GDSH 4LZ1H 1K22H 1RTFB 2A2QH 1H9LB 2ANWA 1W14U 2OC7A 1SGRE 4NIYA 1Z6JH 1O2VA 1SOZA 4KGAA 2OC0A 1F5LA 1NO9H 1Y3VA 3RXOA 1AWHB 3RXMA 5JBCS 2WPIS 1ETSH 5JPMH 1O2SA 1IQMA 2Z7FE 3E0PB 1NC6A 1A5HA 3AAVA 2RDLA 1W8BH 1DWBH 1C1WH 5ESBA 2GV7A 3A87A 2YNBA 5HGGA 4NWLA 3ZYDA 1F0TA 3SQEE 1K9OE 1HRTH 2Q6FA 1G36A 3RXUA 2ZFSA 1P0SH 1UTJA 2ZFRH 2XRCA 3U1JB 3H7OA 3TH2H 1L4ZA 4DJZB 5E2OA 1BMAA 1O2MA 3QN7A 1C5PA 1SLUB 4YOJA 1H4WA 3BSQA 2ZU5A 4JZEH 5L2YH 5H4IB 3SJOA 2VNTA 4INKA 4X2WA 1BTPA 3HGPA 3LDXH 4BAKB 1TMUH 1V2RT 2ODPA 4D9QA 4JYTA 1UTMA 1GI6A 3B23B 1BHXF 4ABIA 3BG4B 5FX6A 3NZIA 2CV3A 1IQJA 1RIWB 1O3HA 1H9IE 1GI8B 3E8LA 1HJ8A 2ZI2H 4X2VA 2AGGX 2QV1A 3HPTB 1TABE 1KDQA 1Z6EA 2GX4A 3Q3KA 4ABDA 1TA2A 2ZTYA 2H6MA 2HWLB 3A85A 1T7CA 3RMOH 2ZQ1A 3PV4A 4WY3A 1TNGA 1A5GH 1N8OC 1C1MA 1EPTA 1HAZB 1WQSA 3I77A 3EAJA 1K2I1 1YF4A 1GBCA 3TK6A 4ZKOU 2PKAA 1P2NA 3FZDA 4XDEA 1C5MD 1DY8A 1NRQH 1A7SA 2AFQB 1Q2WA 5DO4H 1TQ7B 4A6LA 1OPHB 5JDUB 1EAUA 2BLWA 1CT0E 1ZTKA 3A82A 5EQSA 3LH1A 1L1JA 2BD3A 1ESTA 2BY8X 3SOSA 1ACBE 2WV4A 1C5RA 1BTXA 2W26A 3LC3A 3STJA 2ZO3H 1BTZA 2J94A 2I6QA 1BBRE 1AUJA 3QO6A 2OBOA 1W7XH 1P10A 5E0GA 1UVTH 4AYYB 1OSSA 2SGEE 2OUAA 1F7ZA 5GWZA 2G00A 1TRNA 2VINA 2A2XH 3FFGA 3M5MA 3RXTA 2UWOA 3T25A 1HLTH 1T8OA 1TX6A 3VB7A 3A7TA 5PTPA 1GBHA 1QL8A 3VB3A 4ABBA 1A0JA 4MNWA 1EJAA 2CJIA 1O2TA 3ZZ3A 3Q00A 1O5CB 2XCNA 2A32A 1A46H 3KN2A 3LIWA 1YLCA 4AGJA 3SNDA 3RLWH 1UTKA 3S9BA 1W0ZU 3D23A 3R3GB 1MD8A 1K1OA 4KTUA 1H8DH 1P2KA 3P8NA 3ZV9A 1HPGA 5LH8A 1EB2A 1GCDA 2ZA5A 4NCYA 4Y6DA 2BDBA 3TPIZ 2P8OB 1AGJA 1UTOA 1C1PA 1K1JA 4TWYA 1D6RA 3S7HB 5FHTA 1O5EH 5A8ZA 1BITA 1EKBB 2AIPA 2VU8E 3BTME 3CS7A 2WPMS 2BD9A 1V2WT 3O8CA 3HK6B 1TGSZ 4K1SA 1TNLA 3RXLA 3VB5A 3RU4D 4O9VA 1C1TA 1GDUA 3PMHB 3Q76A 4OS5A 2CGAA 6GCHG 1A2CH 5AFYH 1ZSKA 4B73A 2TIOA 3MOCA 3SUFA 2FZZA 1SL3A 3WY8A 2H9TH 3PLKA 4K5ZA 4ZXXH 2GGVB 4NZQA 1VJAU 4B76A 5C1XA 6CHAC 1QNJA 1O2IA 4ZMAH 3SHCH 1ZHPA 1HBTH 5A0AE 1C1VH 1AE8H 2BD2A 2ALVA 3E1XB 3SU3A 4X1NU 3ZVFA 1LKBA 4AOQA 1IQGA 2GCHG 1ZSLA 1FAKH 4BOHA 2NU2E 1GVKB 4ABGA 1UTPA 3LH3A 4Y11E 2Z6BD 2H1UA 3MH7A 3ZYEA 3DA9B 3VFEA 1FUJA 1MKWK 1TGCA 1SHYA 3SU6A 2AMQA 3EDXB 1PPHE 2ESTE 2STAE 1C2IA 5C3NA 2PHBA 2A4OA 4THNH 1XUIA 1LHGH 4K60A 2GT7A 4UE7H 1BRCE 2UWPA 3KGPA 5E2PA 2AGIX 1HAHH 1OOKB 3KHVA 1GJ7B 4ABAA 1EXFA 3LJJA 1FN8A 1MQ5A 1P2IA 1TPSA 2WYGA 1S81A 1BJUA 4AYVB 3D49H 3ESTA 3GOVB 5CMXH 2A5KA 2P59A 1TOMH 3AAUA 1YCPM 1GJCB 4ZH8A 3DFLA 3ENSB 2BY9X 1F0RA 2CXVA 2A7HA 2G8TA 1QTFA 1GI3A 1O30A 1QBOA 3A7YA 1ELDE 1GJ9B 3ZZ5A 3R0FA 4X1PU 1S0QA 1WAYB 2F9OA 2BYAX 4XBDA 2GVFA 1UMAH 2BXUH 1C5ZB 1GMDF 1O2QA 1FPCH 2ZCHP 4MDSA 1QB6A 1DX5M 1SGEE 1BCUH 1NRNH 2B9LA 2XC5A 4OS7A 2ZU3A 4IW4E 1HAIH 4MNXA 2BD5A 1W11U 3UWIA 1SGYE 2PUXB 1V3XA 2VB0A 3MH6A 1VZQH 3BTTE 3BTDE 4M7GA 2Y80A 1GHAG 2BY5X 2A1DB 4TY6A 4JMYA 3Q3XA 5EODA 4D7FA 3IG6B 5DKMA 1RJXB 5DGJA 3MI4A 1SLVB 1CHOG 1CQQA 1KDQB 1G32B 1RIWC 3FP7E 3SU2A 1TWXB 1MKXH 4ZKNU 1GBTA 1XUGA 2J92A 2G52A 1YPGH 2R0LA 1Z7KA 1GMCF 2TRMA 4U2WA 1KXEA 2OCVB 1EPTB 1C5VA 2ZDKA 3PO1B 3V0XA 5L2ZH 1TYNA 1O39A 4X8TH 3U1IB 1AMHA 2PKAB 2FESH 3M37A 4ISNA 1UK2A 2GZ7A 1WV7H 1O3LA 1PQ7A 2ZEBA 1HGTH 1WSSH 4XOJA 1DWCH 5JBBS 1SGCA 1PPZA 1S84A 1GGDB 1XXFA 1TGBA 2SGAA 4CRAA 1B5GH 2LNCA 1DVAH 2P3UB 1E38B 3RXEA 1O3MA 3TNTA 1YBWA 3NPSA 4AG2A 1H1BA 1IOEA 3TGIE 1K1MA 3TJNA 5EW1H 1YPJH 2ZIQH 1GI2A 1HYLA 2R3UA 2UUYA 1ZR0A 3BIVH 4KTCA 5E8EH 5J4SA 1MCTA 1MKWH 3ZVDA 4H4FA 1F92A 3RU4T 2TGAA 5SGAE 2BOHB 2Z94A 1P02A 1C2JA 2P94A 4FU8A 2P3FH 2NWNA 1SR5C 2A4RA 5F8XA 1O2XA 1NRRH 4UFEH 1FV9A 4Q7YA 1CU1A 2QXHA 3OU0A 1W0YH 1C9PA 1G3DA 3PLPA 4MVNA 2BLOA 1KSNA 3PB1E 2FI5E 1XUFA 4GLYA 1Y5UT 4CRBA 3LGUA 3FP6E 3M3SA 1W12U 3UIRA 3PYHA 1Y5BT 1TNIA 1K1PA 1C1OA 2XYAA 4IMQA 2JETB 1EZXC 1WBGB 1NY22 4GVUA 1Y59T 3QK1A 4ABFA 1Z8GA 1LHCH 1LPKB 3RXRA 3GCTG 1AFQB 1C5YB 4E05H 2XWAA 2VIOA 1ANBA 1A0LA 1F5RA 1ZPZA 2DE9A 4GCHF 3TGKE 2W3IA 2QN5T 1TLDA 3SNCA 4AGKA 2G4TA 3LGYA 1PFXC 4K8BA 1GHVH 3LONA 2P8OC 1KIGH 1IQEA 3GY7A 2ZDVH 3A80A 1KXFA 2CHAB 2ZCKP 4CR9A 1P06A 1EJNA 2M5TA 2ZGBH 2ZFQH 2RCEA 1EZQA 3RM0H 1VITF 1PPBH 2Z3DA 2FWWA 1MUEB 2F9PA 3GISB 3A7VA 4B2CA 2ANMH 1RTLA 4Y0YE 1OX1A 3SU4A 3TGJE 4PROA 1NRSH 1O2OA 3SI3H 4ISHH 1NS3A 1SLXB 2JKHA 1P12E 1FDPA 3ZVBA 1P11E 4UFDH 2G5VA 1QB1A 1O37A 1ZYOA 1RRKA 1P3CA 3NKKA 1C5LH 1C1RA 1W3CA 3TVJB 5GXPA 4X2YA 5L6NH 2HLCA 2K1QA 4J1YA 4BAHB 5G4BA 2AEIH 3AASA 4X1QU 2Y5HA 4DIIH 1T8NA 1SGIB 1BBRK 1AHTH 3MO9A 3URCA 1C5TA 1P2OA 1HAOH 1DE7H 2WPLS 2FM2A 2P3TB 3RP2A 5DP7A 1O34A 5DP5A 2J38A 2D26C 5GPIB 1G9IE 1C1QA 3GY2A 2Q6DA 5DPAA 1FI8A 2AMDA 4CRDA 3KF2A 2ZGJA 1JIMA 1N1LA 2XNIA 1QHRB 3BTWE 1LVMA 1O5GH 5CHAC 1GBBA 3QZQA 1J17T 1GHWH 2GP9B 6CHAB 3SNEA 2FODA 3UOUA 1P3EA 3RXSA 5HXFA 2WPKS 1AVWA 3W95A 8KME2 2ZDAH 1F0SA 3GY4A 3HATH 4NFFA 1CA0B 4OGXA 5AFZH 4A1TA 1W10U 4CH2B 2GZ9A 1QRXA 2O8UA 1Z1IA 2ZDLA 2ZFTA 3SU0A 1UTLM 2GTBA 3FANA 3P8FA 4XBCA 1ZRBA 3N7OA 1V2PT 1Y8TA 1TMBH 5FPSA 4ZHAA 3SV7A 1O3CA 2VVUA 3QLPH 1LHEH 4IMZA 5IDKA 4FVBA 1F0UA 2F83A 1PQ5A 3OY5U 3F9FA 4AFZA 1SGFA 1P8VC 3GYMA 5GIBA 1LPZB 2ALPA 2VWLA 1LMWB 3DFJA 3RXCA 3SHAH 1JWTA 1CE5A 5EQRA 1MU8B 1EPTC 5DP3A 1TPPA 3PO1C 1SBWA 3RXBA 1WQVH 1DLKB 1D3QB 1FZZA 2R2MB 1D3DB 3UNSA 2AGEX 3TH3H 1QGFA 1MZAA 1E34B 5EPNA 1LQDB 2BM2A 7ESTE 3BEUA 4BTTB 1UCYE 1GI7B 4HZHA 1GGDC 2V6NA 4DT7B 1O2LA 1XUKA 4K1EA 2WV5A 2GV6A 1JOUB 3M7TA 4B75A 1XKAC 3RMMH 4ABEA 4B2AA 1P2JA 3UNRA 3VGCB 1O2HA 1BMMH 3QZRA 3GCHB 3FVFB 3Q77A 5T6GA 1FY5A 1AZ8A 3QX5H 4K69A 4K2YA 2OC8A 3RUOA 1BBRH 1P09A 1OWJA 2O9QA 1P2MA 1QQ4A 4SGBE 2UUJB 3U8OH 5ETXA 3CS0A 1O2KA 1BRAA 3K9XB 1AWFH 1FY4A 3LOXA 1E36B 3NK8A 1NZQH 3SI4H 1K21H 2FXRA 3VXEH 4E7RG 2VWNA 1E35B 1S6FA 3KQBA 5LPFA 3ODFA 2NU1E 3P92A 2AIQA 1V2VT 3ELAH 5J4QA 1C5WB 1TBZH 3UFAA 1Y3YA 1SPJA 1P9SA 3SJ8A 1TALA 2XBVA 2JETC 2VWOA 1BUIA 1C2EA 3D65E 1JBUH 5JYIA 1ZGIA 3LKWA 1AFQC 3MWIU 2VIWA 5IYTA 5A8XA 1EAWA 1VITH 3A83A 2OQ5A 1GBFA 1FMGA 5HM9A 4TPYA 4A1XA 1O2PA 4JK6A 4IN1A 3W94A 3S9CA 3F68H 4OS1A 1TBQH 2VVVA 2R9PA 3ZVEA 7GCHF 2QCYA 4VGCC 2OD3B 4Y7AA 1BA8B 1C5SA 1O3FA 2CHAC 1QJ7B 2H9HA 3M5NA 1FQ3A 3MU0A 3GDUA 5GCHF 2HALA 3OTJE 3P8OA 3RMNH 3RC5A 2OXSA 3H5CB 1YPMH 1YM0A 1OP0A 3MU1A 1V2OT 2W7SA 1AFEH 1EQ9A 5A2MH 1NFUA 1S5SA 1E37B 2IN2A 2ZGCA 1O32A 2TGTA 1MMJN 2FOEA 1D4PB 2BOKA 1MBQA 8GCHG 4Y79A 3ATMA 2JH6D 4NIWA 4RKOB 3EQ0H 1EOJA 2VH0A 3E0NB 2BZAA 3C27B 4X6NA 1EP5A 1CGHA 1DUAA 1O3JA 3UPEA 3LC5A 3TITA 1DM4B 3VXFH 1IHSH 1OWEA 1GHBF 4X6MA 3SV8A 3E3TA 4XE4A 1TNHA 4DCDA 3OY6U 2RA3A 3P95A 1DXWA 2F9VA 2VVCA 1SG8B 2BD8A 4FUCA 3LGIA 4IBLH 1BIOA 1XUHA 3M5OA 4YM9A 5DP6A 1GVZA 1C2HA 5HYOA 3V3MA 3M36A 2EI8A 1ZMLA 1SFIA 1DWDH 1TPAE 1MTUA 1XKBC 1EP6A 2CF8H 1HCGA 1GJDB 4NIVA 1B7XB 1O3PB 4Y10E 5K7RA 4CRCA 4GAWA 3LGVA 4CRFA 3ZZAA 1QB9A 4XFQA 1EAXA 1JMOH 1JIRA 1OP8A 1TX7A 2Z9JA 4WVPE 5FCRA 1THSH 5C67A 4X2XA 3ZZDA 3SGAE 1FPHH 1OYQA 4A92A 1MAXA 3MU5A 4WWYA 2ZHDA 1NT1A 3UOPA 4X8SH 3V13A 5DP9A 4MPVA 4I8JA 3VPKA 1V6DA 1O2NA 2BX4A 1CA0C 1ID5H 2PGQB 1ANCA 1GL0E 3RXFA 4YZUA 4AFQA 4FUIA 2H2ZA 2A7CA 4CRGA 2FOAA 3HK3B 1UTNA 2B7DH 1L2EA 1TE0A 3ZVCA 1TNJA 3QGJA 2ZQ2A 4ZROA 2Y82A 4OS6A 3MO6A 1O5BB 3PLBA 2ZU2A 1V2NT 1XMNB 3UWJH 1LCYA 3E91A 2ZDMA 1KXAA 1O3OA 5GJ4B 3EA8A 2BQ7B 2KAIA 2QXJA 2FEQH 1GJ8B 2C4FH 1L1GA 2BD7A 3F9EA 5CHAB 1V2ST 3MU4A 4NWKA 2TGPZ 1FXYA 1THPB 4D9RA 1SFQB 2I6SA 4KKDA 1AIXH 4WH8A 2AMPA 2BTCE 1GCTC 4TWWA 4FVDA 3VEQB 1IQFA 2VH6A 1RFNA 2OLGA 5CE1A 2SGFE 3HKJB 1PQAA 3F6UH 1P2QA 2BVXH 3VB6A 4K1TA 1GI1A 2TPIZ 4O97A 1AB9B 1AKSA 2XCFA 1KTTB 1EJMA 1QL7A 2BLQA 2FYRA 3U98H 4D8NA 3GCNA 3SUDA 1O3GA 1P05A 4LOYH 4FUFA 1LDTT 4I32A 1E0FD 4I8LA 4X6PA 2ANYA 2GCTC 3A7ZA 2BVSH 3V7TA 3PMBB 1VCPA 3BF6H 1C2KA 4UONA 4B71A 3VGCC 5A0BA 2VIVA 3QWCH 3GCHC 1PYTC 3PTBA 2BX3A 1T4VH 3PROA 1YPKH 1ELCA 2FMJA 5HM2A 1O2RA 2Y81A 2PV9B 2BVRH 3T2NA 2PSYA 2BQWB 3MNBA 4HFPB 3T28A 1DXPA 1NU7B 1S83A 1NM6A 6ESTA 1BMNH 4MPUA 2XC0A 4JZ1A 3HGNA 1K28D 1BB0B 2C8YB 3SN8A 1EB1H 1C1NA 5EPYA 1LTOA 1LPGB 3BN9A 2ZP0H 1A3EH 2THFB 2Q1JA 2H9EH 1GMDG 4ASHA 1D6WA 4H42U 1OP2A 3KIDU 2BDCA 2CMYA 2ZFFH 2ZG0H 3NUMA 1FJSA 3ZVGA 3RXVA 2FTMA 4IC5A 1TGTA 3RC4A 2Z3CA 1UJ1A 1KXDA 4O3UA 4U01A 4XBBA 3TJVA 1BQYA 1G3EA 1LHDH 1PQ8A 4JZIA 4ZKSU 2C3SA 2EEKA 3UR9A 2FOMB 1DLEA 2FOHA 1D3TB 3KQDA 4YOGA 1AD8H 3I29A 4UFFH 2F9NA 1J15A 1C1SA 1OXGA 1PPEE 1TB6H 2PGBB 6LPRA
chains in the Genus database with same CATH superfamily
1V2KT 1ZRKA 1GBIA 1GJ4H 1QRWA 1JRSA 1GMCG 3SQHE 4Z0KA 3OYPA 2BDAA 1T31A 4Q4LA 1J16A 1MABB 1O31A 1YCPK 4GHTA 1O2ZA 3P8GA 5C20A 3LJOA 3MO3A 3PMJA 4YO9A 1ARCA 4KELA 2ILNA 3D62A 3QUMP 1DSUA 1TQ0B 5ABWA 3BEFB 4OS2A 4YT6H 2ZGHA 4BAMB 2ULLA 1NN6A 1UCYK 5EXLA 2BB4A 2LELA 1Y3UA 3GYLB 3ZZ6A 1ZPCA 5JB8S 1ORFA 4Q63A 2Y6TA 3E90B 2KCPA 5AHGH 1BT7A 3FP8E 1HJAB 4TSFD 5AF9H 2Y5FA 2QIQA 3RLYH 4X1RU 4BANB 1W7GH 1XUJA 2W6ID 1GMHF 1IAUA 2XTTB 4Y71A 2FOBA 1CA8B 1F5KU 4NSVA 4B2BA 4LXBH 1SGTA 4DIHH 1SHHB 2ZNKH 2STBE 3K65B 2WZQA 5L30H 2A45B 1HAGE 4NZLA 4ACAA 2BHGA 2FO9A 5EGMA 3F0PA 1P57B 3DHKH 3MTYA 1LVOA 2VWMA 3T29A 2WHXA 3DSOA 3NRLA 1C4U2 2FOFA 1WUNH 4VGCB 1QA7A 3L33A 1O33A 5FPYA 1YPHE 2J5UA 1V2TT 1MD7A 3GY3A 1ELVA 3KYFA 3TNSA 5DP4A 2YMSD 4DY7B 1AI8H 2V35A 3UY9A 1OS8A 3UUZA 1O3EA 3SV6A 2RA0A 2SNVA 1GHZA 1MU6B 2B8OH 1C5UA 5A0CA 2WYJA 2SGQE 3ATKA 5FL7D 1TX8A 4ISOA 4GSOA 5FCKA 2ODQA 2DUCA 3RMLH 2J9NA 2QAAA 1UK4A 3ZV8A 1C5NH 4I8GA 2UUKB 2OQUA 3UQOA 3ITIA 1B0FA 3LPRA 1MQ6A 1V2MT 2QY0B 1C1UH 1C2DA 2OC1A 1L4DA 1GBKA 3BTKE 4JZFH 1ELTA 5I46H 2FLBH 1BTUA 4GCHG 4KTSA 1GJAB 2K0QA 1DY9A 2QGRA 4E7NA 1KYNA 3KQCA 1ZMNA 2HGTH 4I33A 1YY3A 3MHWU 3P17H 1A1RA 1GBJA 1ABIH 3L6PA 3E6PH 1LO6A 1ANEA 4FUDA 2UUFB 3STIA 3ATIA 1ARBA 1V2JT 3FN8A 1FIZA 4M9FA 4MLFB 3UNQA 1A61H 2KAIB 3RXIA 4DW2U 3F2FA 4AG1A 2BDYA 3F9GA 1VITG 3DCLA 3SU5A 1YKTA 3QDZB 1GHYH 1FONA 2YOLA 4CR5A 3SNAA 1QIXB 1UO6A 1SB1H 1HAYB 1OWIA 1ELAA 2BY7X 2FI4E 1U6QA 1VCWA 3A7XA 2ZU1A 1AKSB 3PV5A 1TNKA 4RSPA 2ZHQH 3NCLA 3PWBA 4MG3A 4WH6A 5B6LA 1C2FA 3GY5A 1AB9C 1O3IA 1VCQA 1UCYH 1AVGH 4D76A 2O8TA 4JYUH 3BG8A 1DFPA 1GHXH 1ETTH 3SGBE 1O0DH 1FAXA 4JCNA 2ZWLH 1J8AA 5BRRE 1FY3A 2HVXA 1AY6H 1J14A 2GKVE 1PPCE 2A7JA 3SJ9A 1COWD 1EZUC 2BDHA 2C90B 1QY6A 2VJ1A 1ZOMA 4FUJA 4WXIA 2XWBI 1XXDA 4R8TB 2SFAA 1Z8JB 4YXWD 2ZPQA 4Y0ZE 3UQVA 5FBIA 3KYGA 1ELFA 4IS5A 4WJG2 1XVMA 5FBEA 1QBVH 4HTCH 3I78A 3B8JA 1BRBE 4CHAB 1ZJKA 2RDEA 1TFXA 1BMLA 2ZFPH 2AH4X 2ZZUH 2V0BA 2EI6A 5LPRA 3RM2H 4H6TA 3PWCA 1O2UA 2C8WB 1NTPA 1GCTB 3PMAB 1GBDA 1AO5A 1LVYA 1S6HA 2A5IA 3JZ1B 2PTCE 3T26A 1YWUA 4CH8B 4X1SU 2Y5GA 1KTSB 1HB0B 1YPHC 1Z8IB 5DP8A 2WV9A 2QF3A 3SV9A 1H8HD 2Z9GA 3AVZA 3SU1A 1DDJA 3GY6A 2FS8A 1X7AC 2GT8A 4GUXA 2EC9H 3RXKA 2FTLE 2AERH 1GBAA 1ZLRA 3RXAA 1UVOA 2PFEA 1O2JA 4J2YB 3K6ZA 2TGDA 2Z9IA 2GCTB 2BQ6B 1HJ9A 1HXFH 2EA3A 1GPZA 4FUHA 3SUGA 5C0UA 4TT3D 1O5FH 3TK9A 5EU8A 1H9HE 1MCVA 3WWFA 4YLUA 5FAHA 5HMAA 2NU4E 2KCAA 3ZVAA 4WMEA 1F2SE 2LPRA 3EE0B 1T32A 4CBNA 1TRMA 2PW8H 1TPOA 1QRZA 4K8YA 2FYQA 1TA6A 8LPRA 2GMTB 2FIRH 1YLDA 4MPXA 7KMEH 2G5NA 2J2UA 4JK5A 2FS9A 4IC6A 1QURH 5AVDA 1NROH 3A88A 5TJXA 4SGAE 1P03A 2BZ6H 5B6OA 2FOCA 1O3NA 4NFEA 2OK5A 4UDWH 3PRBA 2XBXA 4MNVA 1C9TA 4FUEA 4NIXA 4ABHA 2HOBA 1GDNA 1L1NA 4BAQB 2C8ZB 4Y8ZA 2BXTH 4UFGH 7LPRA 4FUBA 5C1UA 1IQIA 4FU7A 2F9BH 2JH0D 1GL1A 3EYDA 2BLVA 4O03A 3B9FH 3URDA 1OWHA 3F2GA 1A4WH 3A86A 3BEIB 1BTHH 3TU7H 5DSFA 1BJVA 1TIOA 4D7GA 4ESTE 1HJAC 2QE7D 3GCOA 2UWLA 2GZ8A 2PUQH 2ZU4A 2NU0E 2TBSA 4MQAA 2H5DA 1MH0A 1XVOA 1EZSC 1GI4A 2VGCB 4RT1A 3RU4E 2HNTC 1Q31A 2FX6A 4DVAU 2IJOB 1HAXB 8GCHF 3E16B 3O8BA 1EFRD 2PKSB 2ODYB 4X6OA 5EXNA 4Q80A 3QTOH 1NFWA 3ZZ8A 2R2WU 1V2UT 3AW0A 1VGCC 4A7IB 2WPJS 1E79D 5DK1A 1SGFG 2HRVA 1O36A 1JXPA 1M9UA 4ZHMU 2XBWA 1Z71A 4LK4A 2WUCA 1CHGA 2J34A 5C17A 4AB9A 1SI5H 2QXIA 3BIUH 4WF8A 3SO3A 1C2LA 5F8ZA 1DPOA 3RXGA 1GWAA 2R3YA 1Y5AT 3VB4A 1T8MA 2VIDA 2FLRH 2WPDD 4K3JA 1CT2E 1CGJE 3ZZ9A 3LT3A 4ZUHA 2ZGXH 2R0KA 4Q7XA 6GCHF 1HIAA 2QF4A 2FP7B 4CBOA 1K1IA 1N6XA 1C5XB 3RDZA 4Y8YA 5C2ZA 4KP0A 4X8VH 1GBMA 3O8DA 2JDID 4RKJB 2OTVA 1O2YA 3GY8A 4NSYA 3EA9A 3NWUA 1T8LA 4BXWA 1RXPA 1RS0A 1SLWB 4H6SB 1J9CH 2GCHF 3M7UA 2KFWA 3G01A 4Y76A 1MTNC 1XM1A 1DSTA 5EJ1A 1S6LA 1FIWA 1Y3XA 2C8XB 1ZSJA 3KQEA 7GCHG 3TK5A 2QC2A 3OTPA 5GNDA 4I31A 4UEHH 2JH5D 4INLA 5GCHG 3U8TH 4BXSA 5F6MA 3GDSA 5T6FA 2QYIA 1IQNA 2NU3E 4Y8XA 5C1YA 3GICB 2YNAA 1G2LA 1BRUP 1GDQA 1Z1JA 2O8MA 4A5TS 2G4UA 4DG4A 2GD4B 1MKXK 3MNXA 2IOTA 3K2UA 4JZDH 2J95A 2BDGA 2Z9LA 2KCOA 3PM3A 3W1EA 1H8IH 2VBCA 4DGJA 1W0KD 2A31A 1KXBA 1MTWA 2ZHEH 1GJ6A 4B74A 3TJOA 1FLEE 1UVPA 1GHBG 1W13U 2ASUB 1QJ1B 1NRPH 4ZXYH 4IN2A 3OEED 4Q2KA 1RGQA 3GDVA 1H8ED 3S69A 2HNTF 4ZHLU 1NBMD 5JBAS 1ETRH 4MNYA 5EXMA 3KNXA 4F4OC 2B5TB 3KCGH 1CBWB 1YPLH 1G2MA 4GHQA 1NU9A 4B1TA 1IQHA 1LHFH 5C94A 1AQ7A 1SC8U 1HDTH 1Q3XA 4I8HA 1T4UH 2O8LA 4AN7A 1TAWA 3T5FH 4DOQA 1GG6C 4CHAC 1BHXB 1SOTA 3MFJA 2ZHWH 3EGKH 2LP6A 1BDAA 3S7KB 3SORA 2QA9E 2XW9A 2F91A 2SGPE 1GHAF 2IPHA 3K6YA 1TBRH 1WOFA 1PYTD 3V12A 3DUXH 3SW2B 1SMFE 2Q6GA 2SGDE 1EASA 1ZTJA 2G81E 2QXGA 3Q3YA 2O8WA 1DANH 1V2QT 3P6ZB 3SGQE 1CHOF 2ZECA 5E0HA 1SGPE 2J4IA 1QCPA 9ESTA 2BD4A 2PR3A 3KL6A 3MMGA 1G3CA 4Z6AH 4TPIZ 1C4Y2 2F43B 5JBTA 4YTAA 4IGDA 2QF0A 3QGNB 2P16A 2FPZA 1G3BA 2G55A 4X0WU 3FZZA 2WINI 4E06H 1CT4E 1V2LT 2P93A 4DT4A 1SSXA 1UVUH 1QJ6B 3FKSD 2ZTZA 5DJ7A 2W3KA 1EAIA 3SNBA 1D9IA 2PSXA 3SJIA 1P01A 1EUFA 1QR3E 2WUBA 1O2WA 2CN0H 1BTYA 2VIPA 2QF5A 3BTQE 5FXLA 1O5AB 1UHBA 4FETA 3QTVH 4A1VA 1FY1A 1NPMA 1UTQA 1WTGH 4WMDA 3U9AH 2HPPH 3MNCA 1Z8RA 1K1LA 2GMTC 3OAAD 1OKXA 1GJBB 3S0NA 4I86A 1ELGA 3BTEE 1CVWH 3ZZ4A 3FAOA 4R0IA 1W0JD 3LU9B 3IITA 1HAVA 3F1SB 4XSKU 4FUGA 1IQLA 1TMTH 2F3CE 4UD9H 1UW7A 3ZZBA 2RG3A 4I8KA 3BG4C 3MNSA 1O3DA 3A8CA 2SNWA 3M3VA 3BV9B 1C4V2 2FDAA 1SGQE 1O35A 2PLXA 4ABJA 1GI9B 3UR6A 1MAYA 4RN6A 3A8DA 3O8RA 3L3TA 4YT7H 1W2KH 1DWEH 1FY8E 3M3TA 1BTWA 1HUTH 1TRYA 4NA8A 4MPWA 5A8YA 5LPEA 5ESTE 2A4QA 1TOCB 1PPFE 1VR1H 4O3TA 4U30A 4LZ4B 3H09A 1UVSH 2FX4A 4Q7ZA 2FI3E 1YP9A 2D2DA 1WU1A 1YC0A 1ESBA 1AZZA 2P95A 1YYY1 4WXVA 1IHTH 1NESE 2VGCC 2G51A 1DUEA 2KX4A 3MH5A 1SQTA 1HNEE 2PTNA 4TYDA 4X8UH 5KEDA 5TCAA 1K1NA 3SUEA 3P70B 1ZGVA 1TONA 2PKSC 4BTUB 3S9AA 2ZHFH 1ZMJA 2CF9H 2F9UA 3RXJA 1A3BH 3GCTF 4NGAH 2ANKH 1QFKH 1BOQA 1DITH 4AZ2B 1KXCA 4ISLA 9LPRA 1FNIA 1EOLA 5EW2H 1GI5A 2ZCLP 1AUTC 1MTSA 3RXHA 2BDIA 2ZPSA 2FOGA 1RD3B 5BPEA 3ATWA 1O3AA 2EI7A 3U8RH 1HFDA 2B0FA 5FPTA 3TIUA 4I7YH 5EG4A 3UREA 4ISIH 3M5LA 1ESAA 2A4GA 1O5DH 1YGCH 3RXQA 2ZPRA 5CDFE 2A0QB 5EIYA 1OWDA 1DT2A 4YESB 1LQEA 1HIAB 1KY9A 1ANDA 3NXPA 3DSGA 1GBLA 3A8AA 4WMFA 2C93B 4NG9H 1ELEE 3TH4H 1L0ZA 1QL9A 1N8OB 1S0RA 4HGCA 5E0JA 1O38A 4DURA 1ABJH 3BTFE 3CP7A 3A8BA 2AYWA 1FN6A 4QT8C 1D3PB 3LGTA 2D8WA 1MZDA 1OWKA 4JYVH 2WPHS 4AFUA 2H5CA 3JZ2B 1HXEH 1VGCB 8ESTE 2D1JA 2W7UA 3TJUA 2ZTXA 1EATA 5T6DA 3DD2H 3BTGE 3A81A 2Z9KA 4U32A 4AX9H 1S82A 3OSYA 5F03A 1LKAA 5I25A 1QZ8A 1ZTLA 5EQQA 2ZDNA 2XC4A 3RC6A 3ODDA 1CGIE 1P9UA 4GPGA 3C1KA 1QBNA 3SZEA 1C2GA 1O2GH 4ZKRU 1A5IA 3M7QA 3ZZCA 3F9HA 3SZNA 1UK3A 2V3OH 2XBYA 1MTVA 1SVPA 4AORA 3MYWA 2V3HH 2ZC9H 4FU9A 2AS9A 3T62A 4TY7A 3MU8A 1CO7E 1GBEA 1E1QD 5C5OA 4BNRA 1GMHG 2GDEH 4FOUC 1Y3WA 2BY6X 3A89A 3TLOA 2HPQH 1AU8A 4HI3A 1QQUA 2OP9A 4RT0A 1SQAA 3T27A 1LVBA 4OGYA 3AW1A 2A5AA 4BAOB 1MTNB 4F49A 1TGNA 1CBWC 3EA7A 3HKIB 1DOJA 1INCA 5DG6A 1THRH 3BTHE 3LGWA 3DT0H 4YOIA 1P04A 2PWXA 1IQKA 3RXDA 4YLQH 3OX7U 2VIQA 4ZAEA 5TCCA 1DS2E 1SQOA 1VJ9U 2OBQA 2W5EA 3SYJA 3M35A 1ZPBA 1S85A 3ZZ7A 4NA7A 1O3BA 1RTKA 1OYTH 1KLIH 5LGOA 1G30B 2OINA 2ZKSA 4OS4A 5KGOA 3SBKA 1G37A 4FXGH 1YCPH 2HNTE 3IWMA 5FX5A 1WCZA 1SGDE 1ELBA 3RXPA 1BZXE 3KQ5A 3CENA 3PTNA 1EX3A 4AB8A 1AE5A 5EOKA 1B0EA 1DICA 2Y7ZA 1GI0A 1N6YA 2XXLA 1XX9A 2BMGB 3UTUH 1CSOE 5K0HA 1AN1E 3H7TA 4AFSA 1MBMA 2HVYB 1ZZZA 4Y7BA 3KEEA 3FOAA 1O3KA 4NA9H 1NFYA 1ZJDA 3U69H 3CNRA 1AVXA 1KLTA 1NFXA 1UHBB 1KLJH 2ZF0H 4MTBA 1C5OH 5JB9S 1YPEH 1QA0A 1HV7A 3A7WA 1E1RD 2GDDA 1SGNE 4CREA 1JRTA 2Z3EA 3ATLA 1WYKA 1GVLA 2Y7XA 3SJKA 4BTIB 1PPGE 1ZHMA 2KM0A 1C5QA 1C2MA 1WTHD 4INHA 5F8TA 1PJPA 3A84A 3M61U 1GJ5H 5T3HA 2DE8A 3SV2H 1A0HB 1HAPH 5C5NA 1ZHRA 1HAVB 5A09A 1GG6B 2IJD1 3MH4A 5GDSH 4LZ1H 1K22H 1RTFB 2A2QH 1H9LB 2ANWA 1W14U 4Z1MD 2OC7A 1SGRE 4NIYA 1Z6JH 1O2VA 1SOZA 4KGAA 2OC0A 1F5LA 1NO9H 1Y3VA 3RXOA 1AWHB 3RXMA 5JBCS 5HKKD 2WPIS 1ETSH 5JPMH 1O2SA 1IQMA 2Z7FE 3E0PB 1NC6A 2L6OA 1A5HA 3AAVA 2RDLA 1W8BH 1DWBH 1C1WH 5ESBA 2GV7A 3A87A 2YNBA 5HGGA 4NWLA 3ZYDA 1F0TA 3SQEE 1K9OE 1HRTH 2Q6FA 1G36A 3RXUA 2ZFSA 1P0SH 1UTJA 3EE7A 2ZFRH 2XRCA 3U1JB 3H7OA 3TH2H 1L4ZA 4DJZB 5E2OA 1BMAA 1O2MA 3OFND 3QN7A 1C5PA 1SLUB 3N7DA 4YOJA 1H4WA 3BSQA 2ZU5A 4JZEH 5L2YH 5H4IB 3SJOA 2VNTA 4INKA 4X2WA 1BTPA 3HGPA 3LDXH 4BAKB 1TMUH 1V2RT 2ODPA 4D9QA 4JYTA 1UTMA 1GI6A 3B23B 1BHXF 4ABIA 3BG4B 5FX6A 3NZIA 2CV3A 1IQJA 1RIWB 1O3HA 5EJZA 1H9IE 1GI8B 3E8LA 1HJ8A 2ZI2H 4X2VA 2AGGX 2QV1A 3HPTB 1TABE 1KDQA 1Z6EA 2GX4A 3Q3KA 4ABDA 1TA2A 2ZTYA 2H6MA 2HWLB 3A85A 1T7CA 3RMOH 2ZQ1A 3PV4A 4WY3A 1TNGA 1A5GH 1N8OC 1C1MA 1EPTA 1HAZB 1WQSA 3I77A 3EAJA 1K2I1 1YF4A 1GBCA 3TK6A 4ZKOU 2PKAA 1P2NA 3FZDA 4XDEA 1C5MD 1DY8A 1NRQH 1A7SA 2AFQB 1Q2WA 5DO4H 1TQ7B 4A6LA 1OPHB 5JDUB 2HLDD 1EAUA 2BLWA 1CT0E 1ZTKA 3A82A 5EQSA 3LH1A 1L1JA 2BD3A 1ESTA 2BY8X 3SOSA 1ACBE 2WV4A 1C5RA 2M2AA 1BTXA 2W26A 3LC3A 3STJA 2ZO3H 1BTZA 2J94A 2I6QA 3N99A 1BBRE 1AUJA 3QO6A 2OBOA 1W7XH 1P10A 5E0GA 1UVTH 4AYYB 1OSSA 2SGEE 2OUAA 1F7ZA 5GWZA 2G00A 1TRNA 2VINA 2A2XH 3FFGA 3M5MA 3RXTA 2UWOA 3T25A 1HLTH 1T8OA 1TX6A 3VB7A 3A7TA 5PTPA 1GBHA 1QL8A 3VB3A 4ABBA 2JJ1D 1A0JA 4MNWA 1EJAA 2CJIA 1O2TA 3ZZ3A 3Q00A 2KCYA 1O5CB 2XCNA 2A32A 1A46H 3KN2A 3LIWA 1YLCA 4AGJA 3SNDA 3RLWH 1UTKA 3S9BA 2XOKD 4P00A 1W0ZU 3D23A 3R3GB 1MD8A 1K1OA 4KTUA 1H8DH 1P2KA 3P8NA 3WWBA 3ZV9A 1HPGA 5LH8A 1EB2A 1GCDA 2ZA5A 4NCYA 4Y6DA 2BDBA 3TPIZ 2P8OB 1AGJA 2PP6A 1UTOA 1C1PA 1K1JA 4TWYA 1D6RA 3S7HB 5FHTA 1O5EH 5A8ZA 1BITA 1EKBB 2AIPA 2VU8E 2V7QD 3BTME 3CS7A 2WPMS 2BD9A 1V2WT 3O8CA 3HK6B 1TGSZ 4K1SA 1TNLA 3RXLA 3VB5A 3RU4D 4XRNA 4O9VA 1C1TA 1GDUA 3PMHB 3Q76A 4OS5A 2CGAA 4F55A 6GCHG 1A2CH 5AFYH 1ZSKA 4B73A 2TIOA 3MOCA 3SUFA 2FZZA 1SL3A 3WY8A 2H9TH 3PLKA 4K5ZA 4ZXXH 2GGVB 4NZQA 1VJAU 4B76A 5C1XA 6CHAC 1QNJA 1O2IA 4ZMAH 3SHCH 1ZHPA 1HBTH 5A0AE 1C1VH 1AE8H 2BD2A 2ALVA 3E1XB 3SU3A 4X1NU 3ZVFA 1LKBA 4AOQA 1IQGA 2GCHG 1ZSLA 1FAKH 4BOHA 2NU2E 4B6EA 1GVKB 4ABGA 1UTPA 3LH3A 4Y11E 2Z6BD 2H1UA 3MH7A 3PRDA 3ZYEA 3DA9B 3VFEA 1FUJA 1MKWK 3F0OA 1TGCA 1SHYA 4OM9A 2YMSB 3SU6A 2AMQA 3EDXB 1PPHE 2ESTE 2STAE 1C2IA 5C3NA 2PHBA 4ASUD 2A4OA 4THNH 1XUIA 1LHGH 4K60A 2GT7A 4P02A 4UE7H 1BRCE 5EJLA 2UWPA 3KGPA 5E2PA 2AGIX 1HAHH 1OOKB 3KHVA 1GJ7B 4ABAA 1EXFA 3LJJA 1FN8A 1MQ5A 1P2IA 1TPSA 2WYGA 1S81A 1BJUA 4AYVB 3D49H 3ESTA 3GOVB 5CMXH 2A5KA 2P59A 1TOMH 3AAUA 1YCPM 1GJCB 4ZH8A 3DFLA 3ENSB 2BY9X 1F0RA 2CXVA 2A7HA 2G8TA 1QTFA 1GI3A 1O30A 1QBOA 3A7YA 1ELDE 1GJ9B 3ZZ5A 3R0FA 4X1PU 1S0QA 1WAYB 2F9OA 4ZCNA 2BYAX 4XBDA 2GVFA 1UMAH 2BXUH 1C5ZB 1GMDF 1O2QA 1FPCH 2ZCHP 4MDSA 1QB6A 1DX5M 1SGEE 1BCUH 1NRNH 2B9LA 2XC5A 4OS7A 2ZU3A 4IW4E 1HAIH 2K8IA 2BD5A 4MNXA 1W11U 3UWIA 1SGYE 2PUXB 1V3XA 2VB0A 3MH6A 1VZQH 3BTTE 3BTDE 4M7GA 2Y80A 1GHAG 2BY5X 2A1DB 4TY6A 4JMYA 3Q3XA 5EODA 4D7FA 3IG6B 5DKMA 1RJXB 5DGJA 3MI4A 1SLVB 1CHOG 1CQQA 1KDQB 1G32B 1RIWC 3FP7E 3SU2A 1TWXB 1MKXH 4ZKNU 1GBTA 1XUGA 2J92A 2G52A 1YPGH 2R0LA 1Z7KA 1GMCF 2TRMA 4U2WA 1KXEA 2OCVB 1EPTB 1C5VA 2ZDKA 3PO1B 3V0XA 5L2ZH 1TYNA 1O39A 4X8TH 3U1IB 1AMHA 2PKAB 2FESH 3M37A 4ISNA 1UK2A 2GZ7A 1WV7H 1O3LA 1PQ7A 2ZEBA 1HGTH 1WSSH 4XOJA 1DWCH 5JBBS 1SGCA 1PPZA 1S84A 1GGDB 1XXFA 1TGBA 2SGAA 4CRAA 1B5GH 2LNCA 3F3BA 1DVAH 2KZ4A 2P3UB 1E38B 3RXEA 1O3MA 3TNTA 1YBWA 3NPSA 4AG2A 2WSSD 1H1BA 1IOEA 3TGIE 1K1MA 3TJNA 5EW1H 2GJGA 1YPJH 2ZIQH 1GI2A 1HYLA 2AHME 2R3UA 2UUYA 1ZR0A 3BIVH 4KTCA 5E8EH 5J4SA 1MCTA 1MKWH 3ZVDA 4H4FA 1F92A 3RU4T 2TGAA 5SGAE 2BOHB 2Z94A 1P02A 1C2JA 2P94A 4FU8A 2P3FH 2NWNA 1SR5C 2A4RA 5F8XA 1O2XA 1NRRH 4UFEH 3U28C 1FV9A 4Q7YA 1CU1A 2QXHA 3OU0A 1W0YH 1C9PA 1G3DA 1SQRA 3PLPA 4MVNA 2BLOA 1KSNA 3PB1E 2FI5E 1XUFA 2L74A 4GLYA 1Y5UT 4CRBA 3LGUA 3FP6E 3M3SA 2PGBB 1W12U 3UIRA 3PYHA 1Y5BT 1TNIA 1K1PA 1C1OA 2XYAA 4IMQA 2JETB 1EZXC 1WXRA 1WBGB 1NY22 4GVUA 1Y59T 3QK1A 4ABFA 1Z8GA 1LHCH 1LPKB 3RXRA 3GCTG 1AFQB 1C5YB 4E05H 2XWAA 2VIOA 1ANBA 1A0LA 1F5RA 1ZPZA 2DE9A 4GCHF 3TGKE 2W3IA 3GS9A 2QN5T 1TLDA 3SNCA 4AGKA 2G4TA 3LGYA 1PFXC 4K8BA 1GHVH 3LONA 2P8OC 1KIGH 1IQEA 3GY7A 2ZDVH 3A80A 1KXFA 2CHAB 2ZCKP 3ZIAD 4CR9A 1P06A 1EJNA 2M5TA 2ZGBH 2ZFQH 2RCEA 1EZQA 3RM0H 1VITF 1PPBH 2Z3DA 1OHHD 2FWWA 1MUEB 2F9PA 3GISB 3A7VA 4B2CA 2ANMH 1RTLA 4Y0YE 1OX1A 3SU4A 3TGJE 4PROA 1NRSH 1O2OA 3SI3H 4ISHH 2KR7A 1K0HA 1NS3A 1SLXB 2JKHA 1P12E 1FDPA 3ZVBA 1P11E 4UFDH 2G5VA 1QB1A 1O37A 1ZYOA 1RRKA 1P3CA 3NKKA 1C5LH 1C1RA 1W3CA 3TVJB 5GXPA 4X2YA 3UB0A 5L6NH 2HLCA 2K1QA 4J1YA 4ACBA 4BAHB 2YMSC 5G4BA 2AEIH 3AASA 4X1QU 2Y5HA 4DIIH 1T8NA 1SGIB 1BBRK 1AHTH 3MO9A 3URCA 1C5TA 1P2OA 1HAOH 3N7EA 1DE7H 2WPLS 2FM2A 2P3TB 3RP2A 5DP7A 1O34A 5DP5A 2J38A 2D26C 5GPIB 1G9IE 1C1QA 3GY2A 2Q6DA 2V3MA 5DPAA 1FI8A 2AMDA 2J97A 4CRDA 3KF2A 2ZGJA 1JIMA 1N1LA 2XNIA 1QHRB 3BTWE 1LVMA 1O5GH 5CHAC 1GBBA 3QZQA 1J17T 1GHWH 2GP9B 6CHAB 3SNEA 5HIYA 2FODA 3UOUA 1P3EA 3RXSA 5HXFA 2WPKS 1AVWA 3W95A 8KME2 5DN6D 2ZDAH 1F0SA 3GY4A 3HATH 4NFFA 1CA0B 4OGXA 5AFZH 4A1TA 1W10U 5IK2D 4CH2B 2GZ9A 1QRXA 2O8UA 1Z1IA 2ZDLA 2ZFTA 3SU0A 1UTLM 2GTBA 3FANA 3P8FA 4XBCA 1ZRBA 3N7OA 1V2PT 1Y8TA 1TMBH 5FPSA 4ZHAA 3SV7A 1O3CA 2VVUA 3QLPH 1LHEH 4IMZA 5IDKA 4FVBA 1F0UA 2F83A 1PQ5A 3OY5U 3F9FA 4AFZA 1SGFA 1P8VC 3GYMA 5GIBA 3DSPA 1LPZB 2ALPA 2VWLA 1LMWB 3DFJA 3RXCA 3SHAH 1JWTA 1CE5A 5EQRA 1MU8B 1EPTC 5DP3A 1TPPA 2CK3D 3PO1C 1SBWA 3RXBA 1WQVH 1DLKB 1D3QB 2JJ2D 1FZZA 2R2MB 1D3DB 3UNSA 2AGEX 3TH3H 1QGFA 2JIZD 1MZAA 1E34B 5EPNA 1LQDB 2BM2A 1WDIA 7ESTE 3BEUA 4BTTB 1UCYE 1GI7B 4HZHA 1GGDC 2V6NA 4XD7D 4DT7B 1O2LA 1XUKA 4K1EA 2WV5A 2GV6A 1JOUB 3M7TA 4B75A 1XKAC 3RMMH 4ABEA 4B2AA 5KECA 1P2JA 5HIZA 3UNRA 3VGCB 1O2HA 1BMMH 3QZRA 3GCHB 3FVFB 3Q77A 5T6GA 1FY5A 1AZ8A 3QX5H 4K69A 3OE7D 4K2YA 2OC8A 3RUOA 1BBRH 1P09A 1OWJA 2O9QA 1P2MA 1QQ4A 4SGBE 2UUJB 1KMHB 3U8OH 5ETXA 3CS0A 4HG6A 1O2KA 1BRAA 3K9XB 1AWFH 1FY4A 3LOXA 1E36B 3NK8A 1NZQH 3SI4H 1K21H 2W6JD 2FXRA 3VXEH 4E7RG 2VWNA 1E35B 1S6FA 3KQBA 5LPFA 3ODFA 2F4LA 2NU1E 3P92A 2AIQA 1V2VT 3ELAH 3FO8D 5J4QA 1C5WB 1TBZH 3UFAA 1Y3YA 1SPJA 1P9SA 3SJ8A 1TALA 2XBVA 2JETC 2VWOA 1BUIA 1C2EA 3D65E 1JBUH 5JYIA 1ZGIA 3LKWA 5CHBA 1AFQC 3MWIU 2VIWA 5IYTA 4RI0A 5A8XA 1EAWA 1VITH 3A83A 2OQ5A 1GBFA 1FMGA 3OEHD 5HM9A 4TPYA 4A1XA 1O2PA 4JK6A 4IN1A 3W94A 3S9CA 3F68H 4OS1A 1TBQH 2VVVA 2R9PA 3ZVEA 7GCHF 2QCYA 4VGCC 2OD3B 4Y7AA 3PV2A 1BA8B 1C5SA 1O3FA 2CHAC 1QJ7B 2H9HA 3M5NA 1NBME 1FQ3A 2J98A 3GDUA 3MU0A 5GCHF 2HALA 3OTJE 3P8OA 3RMNH 3RC5A 2OXSA 3H5CB 1YPMH 1YM0A 1OP0A 3MU1A 1V2OT 2W7SA 1AFEH 1EQ9A 5A2MH 1NFUA 1S5SA 1E37B 2IN2A 2ZGCA 1O32A 2TGTA 1MMJN 2FOEA 1D4PB 1VKYA 2BOKA 1MBQA 8GCHG 4Y79A 1BMFD 3AK5A 3ATMA 4NIWA 4RKOB 3EQ0H 1EOJA 2VH0A 3E0NB 2BZAA 3C27B 4X6NA 1EP5A 1CGHA 1DUAA 1O3JA 3UPEA 3LC5A 3TITA 1DM4B 3VXFH 1IHSH 1OWEA 1GHBF 4X6MA 3SV8A 3E3TA 4XE4A 1TNHA 4DCDA 3OY6U 2RA3A 3P95A 1DXWA 2F9VA 2VVCA 1SG8B 2BD8A 4FUCA 3LGIA 4IBLH 1BIOA 1XUHA 3M5OA 4YM9A 5DP6A 1GVZA 1C2HA 5HYOA 3V3MA 3M36A 2EI8A 1ZMLA 1SFIA 1DWDH 1TPAE 1MTUA 1XKBC 1EP6A 2CF8H 1HCGA 1GJDB 4NIVA 1B7XB 1O3PB 4Y10E 5K7RA 4CRCA 4GAWA 3LGVA 4CRFA 3ZZAA 2EY4C 1QB9A 4XFQA 1EAXA 1JMOH 1JIRA 1OP8A 1TX7A 2Z9JA 4WVPE 5FCRA 1THSH 5C67A 4X2XA 3ZZDA 3SGAE 1FPHH 1OYQA 4A92A 1MAXA 3MU5A 4WWYA 2ZHDA 1NT1A 3UOPA 4X8SH 3V13A 5DP9A 4MPVA 4I8JA 3F2HA 3VPKA 1V6DA 1O2NA 2BX4A 1CA0C 1ID5H 2PGQB 3UAIC 1ANCA 1GL0E 3RXFA 4YZUA 4AFQA 4FUIA 2H2ZA 2A7CA 4CRGA 2FOAA 3HK3B 1UTNA 2B7DH 1L2EA 1TE0A 3ZVCA 1TNJA 3QGJA 2ZQ2A 4ZROA 2Y82A 4OS6A 5C0TA 3MO6A 1O5BB 3PLBA 2ZU2A 1V2NT 1XMNB 3UWJH 1LCYA 3E91A 2ZDMA 1KXAA 1O3OA 5GJ4B 3EA8A 2BQ7B 2KAIA 2QXJA 5T1VA 2FEQH 1GJ8B 2C4FH 1L1GA 2BD7A 3F9EA 5CHAB 1V2ST 3MU4A 4NWKA 4AC9A 2TGPZ 1FXYA 1THPB 4D9RA 1SFQB 2I6SA 4KKDA 1AIXH 4WH8A 2AMPA 2BTCE 1GCTC 4TWWA 4FVDA 3VEQB 1IQFA 2VH6A 1RFNA 2OLGA 5CE1A 2SGFE 3HKJB 1PQAA 3F6UH 1P2QA 2BVXH 3VB6A 4K1TA 1GI1A 2TPIZ 4O97A 1AB9B 1SKYE 1AKSA 2RFKC 2XCFA 1KTTB 1EJMA 1QL7A 2BLQA 2FYRA 3U98H 4F48B 3MQKC 4D8NA 3GCNA 3SUDA 1O3GA 1P05A 1FX0B 4LOYH 4FUFA 1LDTT 4I32A 1E0FD 4I8LA 4X6PA 2ANYA 2GCTC 3A7ZA 2BVSH 3V7TA 3PMBB 1VCPA 3BF6H 1C2KA 4UONA 4B71A 3VGCC 5A0BA 2VIVA 3QWCH 3WW7A 3GCHC 5F53A 1PYTC 3PTBA 2BX3A 1T4VH 3PROA 1YPKH 1ELCA 2FMJA 5HM2A 1O2RA 2Y81A 2PV9B 2BVRH 3T2NA 2PSYA 2BQWB 3MNBA 4HFPB 3T28A 1DXPA 1NU7B 1S83A 1NM6A 6ESTA 1BMNH 4MPUA 2XC0A 4JZ1A 3HGNA 1K28D 2EQNA 3VG8A 1BB0B 2C8YB 3SN8A 1EB1H 1C1NA 5EPYA 1LTOA 1LPGB 3BN9A 2ZP0H 1A3EH 2THFB 2Q1JA 2H9EH 1GMDG 4ASHA 1D6WA 4H42U 1OP2A 3KIDU 2XNDD 2BDCA 2CMYA 1YLNA 2ZFFH 2ZG0H 3NUMA 1FJSA 3ZVGA 3RXVA 2FTMA 4IC5A 1TGTA 3RC4A 2Z3CA 1UJ1A 1KXDA 4O3UA 4U01A 4XBBA 3TJVA 4B6FA 1BQYA 1G3EA 1LHDH 1PQ8A 4JZIA 4ZKSU 2C3SA 2EEKA 3UR9A 2FOMB 1DLEA 2FOHA 1D3TB 3KQDA 4YOGA 1AD8H 2J98B 3I29A 4UFFH 2F9NA 1J15A 1C1SA 1OXGA 1PPEE 2IPQX 1TB6H 2JH6D 6LPRA
chains in the Genus database with same CATH topology
1V2KT 1ZRKA 1GBIA 1GJ4H 1QRWA 1JRSA 1GMCG 3SQHE 4Z0KA 3OYPA 2BDAA 1T31A 1J16A 1YCPK 1O31A 4GHTA 1O2ZA 3P8GA 5C20A 3LJOA 3MO3A 3PMJA 4YO9A 1ARCA 4KELA 2ILNA 3D62A 3QUMP 1DSUA 1TQ0B 5ABWA 3BEFB 4OS2A 4YT6H 2ZGHA 4BAMB 2ULLA 1NN6A 1UCYK 5EXLA 2BB4A 1Y3UA 3GYLB 3ZZ6A 1ZPCA 5JB8S 1ORFA 2Y6TA 3E90B 5AHGH 1BT7A 3FP8E 1HJAB 5AF9H 2Y5FA 2QIQA 3RLYH 4X1RU 4BANB 1W7GH 1XUJA 2XTTB 1GMHF 1IAUA 4Y71A 2FOBA 1CA8B 1F5KU 4NSVA 4B2BA 4LXBH 1SGTA 4DIHH 1SHHB 2ZNKH 2STBE 3K65B 5L30H 2A45B 1HAGE 4NZLA 2BHGA 2FO9A 5EGMA 1P57B 3DHKH 3MTYA 1LVOA 2VWMA 3T29A 1C4U2 2FOFA 1WUNH 4VGCB 1QA7A 3L33A 1O33A 5FPYA 1YPHE 1V2TT 1MD7A 3GY3A 1ELVA 3TNSA 5DP4A 4DY7B 1AI8H 2V35A 3UY9A 1OS8A 3UUZA 1O3EA 3SV6A 2RA0A 2SNVA 1GHZA 1MU6B 2B8OH 1C5UA 5A0CA 2WYJA 2SGQE 3ATKA 1TX8A 4ISOA 4GSOA 5FCKA 2ODQA 2DUCA 3RMLH 2J9NA 2QAAA 1UK4A 3ZV8A 1C5NH 4I8GA 2UUKB 2OQUA 3UQOA 3ITIA 1B0FA 3LPRA 1MQ6A 1V2MT 2QY0B 1C1UH 1C2DA 2OC1A 1L4DA 1GBKA 3BTKE 4JZFH 1ELTA 5I46H 2FLBH 1BTUA 4GCHG 4KTSA 1GJAB 1DY9A 2QGRA 4E7NA 1KYNA 3KQCA 1ZMNA 2HGTH 4I33A 3MHWU 3P17H 1A1RA 1GBJA 1ABIH 3L6PA 3E6PH 1LO6A 1ANEA 4FUDA 2UUFB 3STIA 3ATIA 1ARBA 1V2JT 1FIZA 3UNQA 4MLFB 1A61H 2KAIB 3RXIA 4DW2U 4AG1A 2BDYA 3F9GA 1VITG 3SU5A 1YKTA 3QDZB 1GHYH 1FONA 2YOLA 4CR5A 3SNAA 1QIXB 1UO6A 1SB1H 1HAYB 1OWIA 1ELAA 2BY7X 2FI4E 1U6QA 1VCWA 3A7XA 2ZU1A 1AKSB 1TNKA 4RSPA 2ZHQH 3NCLA 3PWBA 4MG3A 4WH6A 1C2FA 3GY5A 1AB9C 1O3IA 1VCQA 1UCYH 1AVGH 4D76A 2O8TA 4JYUH 3BG8A 1DFPA 1GHXH 1ETTH 3SGBE 1O0DH 1FAXA 4JCNA 2ZWLH 1J8AA 5BRRE 1FY3A 2HVXA 1AY6H 1J14A 2GKVE 1PPCE 2A7JA 3SJ9A 1EZUC 2BDHA 2C90B 1QY6A 2VJ1A 1ZOMA 4FUJA 4WXIA 2XWBI 1XXDA 4R8TB 2SFAA 1Z8JB 2ZPQA 4Y0ZE 3UQVA 5FBIA 1ELFA 4IS5A 4WJG2 1XVMA 5FBEA 1QBVH 4HTCH 3I78A 3B8JA 1BRBE 4CHAB 1ZJKA 2ZFPH 1TFXA 1BMLA 2AH4X 2ZZUH 2V0BA 2EI6A 5LPRA 3RM2H 4H6TA 3PWCA 1O2UA 2C8WB 1NTPA 1GCTB 3PMAB 1GBDA 1AO5A 1LVYA 1S6HA 2A5IA 3JZ1B 2PTCE 3T26A 4CH8B 4X1SU 2Y5GA 1KTSB 1HB0B 1YPHC 1Z8IB 5DP8A 3SV9A 2QF3A 2Z9GA 3AVZA 3SU1A 1DDJA 3GY6A 2FS8A 1X7AC 2GT8A 4GUXA 2EC9H 3RXKA 2FTLE 2AERH 1GBAA 1ZLRA 3RXAA 1UVOA 2PFEA 1O2JA 4J2YB 3K6ZA 2TGDA 2Z9IA 2GCTB 2BQ6B 1HJ9A 1HXFH 2EA3A 1GPZA 4FUHA 3SUGA 1O5FH 3TK9A 5EU8A 1H9HE 1MCVA 4YLUA 5FAHA 5HMAA 2NU4E 3ZVAA 4WMEA 1F2SE 2LPRA 3EE0B 1T32A 4CBNA 1TRMA 2PW8H 1TPOA 1QRZA 4K8YA 2FYQA 1TA6A 8LPRA 2GMTB 2FIRH 1YLDA 4MPXA 7KMEH 2G5NA 2J2UA 4JK5A 2FS9A 4IC6A 1QURH 5AVDA 1NROH 3A88A 5TJXA 4SGAE 1P03A 2BZ6H 5B6OA 2FOCA 1O3NA 4NFEA 4UDWH 2XBXA 4MNVA 1C9TA 4FUEA 4NIXA 4ABHA 2HOBA 1GDNA 1L1NA 4BAQB 2C8ZB 4Y8ZA 2BXTH 4UFGH 7LPRA 4FUBA 5C1UA 1IQIA 4FU7A 2F9BH 2JH0D 1GL1A 3EYDA 2BLVA 4O03A 3B9FH 3URDA 1OWHA 1A4WH 3A86A 3BEIB 1BTHH 3TU7H 1BJVA 1TIOA 4D7GA 4ESTE 1HJAC 3GCOA 2UWLA 2GZ8A 2PUQH 2ZU4A 2NU0E 2TBSA 4MQAA 2H5DA 1MH0A 1XVOA 1EZSC 1GI4A 2VGCB 3RU4E 2HNTC 1Q31A 2FX6A 4DVAU 2IJOB 1HAXB 8GCHF 3E16B 3O8BA 2PKSB 2ODYB 4X6OA 5EXNA 4Q80A 3QTOH 1NFWA 3ZZ8A 2R2WU 1V2UT 3AW0A 1VGCC 4A7IB 2WPJS 5DK1A 1SGFG 2HRVA 1O36A 1JXPA 1M9UA 4ZHMU 2XBWA 1Z71A 4LK4A 2WUCA 1CHGA 2J34A 4AB9A 1SI5H 2QXIA 3BIUH 4WF8A 3SO3A 1C2LA 5F8ZA 1DPOA 3RXGA 1GWAA 2R3YA 1Y5AT 3VB4A 1T8MA 2VIDA 2FLRH 4K3JA 1CT2E 1CGJE 3ZZ9A 3LT3A 4ZUHA 2ZGXH 2R0KA 4Q7XA 6GCHF 1HIAA 2FP7B 4CBOA 1K1IA 1N6XA 1C5XB 3RDZA 4Y8YA 5C2ZA 4KP0A 4X8VH 1GBMA 3O8DA 4RKJB 2OTVA 1O2YA 3GY8A 4NSYA 3EA9A 3NWUA 1T8LA 4BXWA 1RXPA 1RS0A 1SLWB 4H6SB 1J9CH 2GCHF 3M7UA 3G01A 4Y76A 1MTNC 1XM1A 1DSTA 1FIWA 1Y3XA 2C8XB 1ZSJA 3KQEA 7GCHG 3TK5A 2QC2A 4I31A 4UEHH 2JH5D 4INLA 5GCHG 3U8TH 4BXSA 5F6MA 3GDSA 5T6FA 2QYIA 1IQNA 2NU3E 4Y8XA 5C1YA 3GICB 2YNAA 1G2LA 1BRUP 1GDQA 1Z1JA 2O8MA 4A5TS 2G4UA 4DG4A 2GD4B 1MKXK 3MNXA 2IOTA 3K2UA 4JZDH 2J95A 2BDGA 2Z9LA 3PM3A 1H8IH 4DGJA 2A31A 1KXBA 1MTWA 2ZHEH 1GJ6A 4B74A 3TJOA 1FLEE 1UVPA 1GHBG 1W13U 2ASUB 1QJ1B 1NRPH 4ZXYH 4IN2A 4Q2KA 1RGQA 3GDVA 3S69A 2HNTF 4ZHLU 5JBAS 1ETRH 4MNYA 5EXMA 3KNXA 4F4OC 2B5TB 3KCGH 1CBWB 1YPLH 1G2MA 4GHQA 1NU9A 4B1TA 1IQHA 1LHFH 1AQ7A 1SC8U 1HDTH 1Q3XA 4I8HA 1T4UH 2O8LA 4AN7A 1TAWA 3T5FH 4DOQA 1GG6C 4CHAC 1BHXB 1SOTA 3MFJA 2ZHWH 3EGKH 1BDAA 3S7KB 3SORA 2QA9E 2XW9A 2F91A 2SGPE 1GHAF 2IPHA 3K6YA 1TBRH 1WOFA 1PYTD 3V12A 3DUXH 3SW2B 1SMFE 2Q6GA 2SGDE 1EASA 1ZTJA 2G81E 2QXGA 3Q3YA 2O8WA 1DANH 1V2QT 3P6ZB 3SGQE 1CHOF 2ZECA 5E0HA 1SGPE 2J4IA 1QCPA 9ESTA 2BD4A 2PR3A 3KL6A 3MMGA 1G3CA 4Z6AH 4TPIZ 1C4Y2 5JBTA 4YTAA 4IGDA 2QF0A 3QGNB 2P16A 2FPZA 1G3BA 2G55A 4X0WU 3FZZA 2WINI 4E06H 1CT4E 1V2LT 2P93A 1SSXA 1UVUH 1QJ6B 2ZTZA 5DJ7A 2W3KA 1EAIA 3SNBA 1D9IA 2PSXA 3SJIA 1P01A 1EUFA 1QR3E 2WUBA 1O2WA 2CN0H 1BTYA 2VIPA 3BTQE 5FXLA 1O5AB 1UHBA 3QTVH 4A1VA 1FY1A 1NPMA 1UTQA 1WTGH 4WMDA 3U9AH 2HPPH 3MNCA 1Z8RA 1K1LA 2GMTC 1OKXA 1GJBB 3S0NA 1ELGA 3BTEE 1CVWH 3ZZ4A 3FAOA 4R0IA 3LU9B 3IITA 1HAVA 3F1SB 4XSKU 4FUGA 1IQLA 1TMTH 2F3CE 4UD9H 3ZZBA 2RG3A 4I8KA 3BG4C 3MNSA 1O3DA 3A8CA 2SNWA 3M3VA 3BV9B 1C4V2 2FDAA 1SGQE 1O35A 2PLXA 4ABJA 1GI9B 3UR6A 1MAYA 4RN6A 3A8DA 3O8RA 3L3TA 4YT7H 1W2KH 1DWEH 1FY8E 3M3TA 1BTWA 1HUTH 1TRYA 4NA8A 4MPWA 5A8YA 5LPEA 5ESTE 2A4QA 1TOCB 1PPFE 1VR1H 4O3TA 4U30A 4LZ4B 1UVSH 2FX4A 4Q7ZA 2FI3E 1YP9A 2D2DA 1WU1A 1YC0A 1ESBA 1AZZA 2P95A 1YYY1 4WXVA 1IHTH 1NESE 2VGCC 2G51A 1DUEA 3MH5A 1SQTA 1HNEE 2PTNA 4TYDA 4X8UH 5TCAA 1K1NA 3SUEA 3P70B 1ZGVA 1TONA 2PKSC 4BTUB 3S9AA 2ZHFH 1ZMJA 2CF9H 2F9UA 3RXJA 1A3BH 3GCTF 4NGAH 2ANKH 1QFKH 1BOQA 1DITH 4AZ2B 1KXCA 4ISLA 9LPRA 1FNIA 1EOLA 5EW2H 1GI5A 2ZCLP 1AUTC 1MTSA 3RXHA 2BDIA 2ZPSA 2FOGA 1RD3B 5BPEA 3ATWA 1O3AA 2EI7A 3U8RH 1HFDA 2B0FA 5FPTA 3TIUA 4I7YH 5EG4A 3UREA 4ISIH 3M5LA 1ESAA 2A4GA 1O5DH 1YGCH 3RXQA 2ZPRA 2A0QB 1OWDA 1DT2A 4YESB 1LQEA 1HIAB 1KY9A 1ANDA 3NXPA 1GBLA 3A8AA 4WMFA 2C93B 4NG9H 1ELEE 3TH4H 1L0ZA 1QL9A 1N8OB 1S0RA 4HGCA 5E0JA 1O38A 4DURA 1ABJH 3BTFE 3CP7A 3A8BA 2AYWA 1FN6A 4QT8C 1D3PB 3LGTA 2D8WA 1MZDA 1OWKA 4JYVH 2WPHS 4AFUA 2H5CA 3JZ2B 1HXEH 1VGCB 8ESTE 2D1JA 2W7UA 3TJUA 2ZTXA 1EATA 5T6DA 3DD2H 3BTGE 3A81A 2Z9KA 4U32A 4AX9H 1S82A 3OSYA 5F03A 1LKAA 5I25A 1ZTLA 5EQQA 2ZDNA 2XC4A 3RC6A 3ODDA 1CGIE 1P9UA 4GPGA 3C1KA 1QBNA 1C2GA 1O2GH 4ZKRU 1A5IA 3M7QA 3ZZCA 3F9HA 3SZNA 1UK3A 2V3OH 2XBYA 1MTVA 1SVPA 4AORA 3MYWA 2V3HH 2ZC9H 4FU9A 2AS9A 3T62A 4TY7A 3MU8A 1CO7E 1GBEA 5C5OA 4BNRA 1GMHG 2GDEH 1Y3WA 2BY6X 3A89A 3TLOA 2HPQH 1AU8A 4HI3A 1QQUA 2OP9A 1SQAA 3T27A 1LVBA 4OGYA 3AW1A 2A5AA 4BAOB 1MTNB 4F49A 1TGNA 1CBWC 3EA7A 3HKIB 1DOJA 1INCA 5DG6A 1THRH 3BTHE 3LGWA 3DT0H 4YOIA 1P04A 2PWXA 1IQKA 3RXDA 4YLQH 3OX7U 2VIQA 4ZAEA 5TCCA 1DS2E 1SQOA 1VJ9U 2OBQA 2W5EA 3M35A 1ZPBA 1S85A 3ZZ7A 4NA7A 1O3BA 1RTKA 1OYTH 1KLIH 5LGOA 1G30B 2OINA 2ZKSA 4OS4A 3SBKA 1G37A 4FXGH 1YCPH 2HNTE 3IWMA 5FX5A 1WCZA 1SGDE 1ELBA 3RXPA 1BZXE 3PTNA 3CENA 1EX3A 4AB8A 1AE5A 5EOKA 1B0EA 1DICA 2Y7ZA 1GI0A 1N6YA 2XXLA 1XX9A 2BMGB 3UTUH 1CSOE 5K0HA 1AN1E 3H7TA 4AFSA 1MBMA 1ZZZA 4Y7BA 3KEEA 4NA9H 1O3KA 1NFYA 1ZJDA 3U69H 1AVXA 1KLTA 1NFXA 1UHBB 1KLJH 2ZF0H 4MTBA 1C5OH 5JB9S 1YPEH 1QA0A 1HV7A 3A7WA 2GDDA 1SGNE 4CREA 1JRTA 2Z3EA 3ATLA 1WYKA 1GVLA 2Y7XA 3SJKA 4BTIB 1PPGE 1ZHMA 1C5QA 1C2MA 1WTHD 4INHA 5F8TA 1PJPA 3A84A 3M61U 1GJ5H 5T3HA 2DE8A 3SV2H 1A0HB 1HAPH 5C5NA 1ZHRA 1HAVB 5A09A 1GG6B 3MH4A 5GDSH 4LZ1H 1K22H 1RTFB 2A2QH 1H9LB 2ANWA 1W14U 2OC7A 1SGRE 4NIYA 1Z6JH 1O2VA 1SOZA 4KGAA 2OC0A 1F5LA 1NO9H 1Y3VA 3RXOA 1AWHB 3RXMA 5JBCS 2WPIS 1ETSH 5JPMH 1O2SA 1IQMA 2Z7FE 3E0PB 1NC6A 1A5HA 3AAVA 2RDLA 1W8BH 1DWBH 1C1WH 5ESBA 2GV7A 3A87A 2YNBA 5HGGA 4NWLA 3ZYDA 1F0TA 3SQEE 1K9OE 1HRTH 2Q6FA 1G36A 3RXUA 2ZFSA 1P0SH 1UTJA 2ZFRH 2XRCA 3U1JB 3H7OA 3TH2H 1L4ZA 4DJZB 5E2OA 1BMAA 1O2MA 3QN7A 1C5PA 1SLUB 4YOJA 1H4WA 3BSQA 2ZU5A 4JZEH 5L2YH 5H4IB 3SJOA 2VNTA 4INKA 4X2WA 1BTPA 3HGPA 3LDXH 4BAKB 1TMUH 1V2RT 2ODPA 4D9QA 4JYTA 1UTMA 1GI6A 3B23B 1BHXF 4ABIA 3BG4B 5FX6A 3NZIA 2CV3A 1IQJA 1RIWB 1O3HA 1H9IE 1GI8B 3E8LA 1HJ8A 2ZI2H 4X2VA 2AGGX 2QV1A 3HPTB 1TABE 1KDQA 1Z6EA 2GX4A 3Q3KA 4ABDA 1TA2A 2ZTYA 2H6MA 2HWLB 3A85A 1T7CA 3RMOH 2ZQ1A