1AUJA

Bovine trypsin complexed to meta-cyano-benzylic inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New inhibitors of thrombin and other trypsin-like proteases: hydrogen bonding of an aromatic cyano group with a backbone amide of the P1 binding site replaces binding of a basic side chain.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA02
1V2TT 3QX5H 1GBEA 1F5KU 3TU7H 2D8WA 2NU4E 4YOGA 1ZLRA 1DDJA 5L2ZH 4GAWA 3STIA 3TNTA 1GI5A 1QFKH 1TWXB 2LNCA 4GLYA 2VGCB 3STJA 1C2GA 4MPVA 1HV7A 5C1XA 1SGFG 1V2JT 4AB8A 1PPGE 3SV6A 2XBXA 1C5OH 5A2MH 2JETB 1C2HA 1A5IA 3QO6A 2VVVA 1D3PB 1A61H 1B5GH 4FUHA 3UREA 4BAHB 5LPRA 2EI7A 4U30A 3SV2H 1GVZA 4LOYH 2CN0H 1O3OA 3RXLA 3EQ0H 3UOPA 3TGKE 4Q7XA 2ZKSA 2HOBA 4WXVA 4ABGA 1K1IA 1P0SH 1O2XA 3RLYH 3DHKH 1MKXK 3DUXH 3ENSB 5DP4A 4SGAE 1S6HA 4H4FA 3PMAB 1DPOA 3D23A 1EXFA 3ESTA 1UTOA 3F9FA 4HTCH 4A1XA 5EQRA 1P9UA 2R3YA 3BEIB 2ZG0H 4X0WU 2F9UA 1OWIA 2FTMA 3T25A 4TYDA 5GJ4B 2BQ6B 5E0HA 3MH7A 5ETXA 1OPHB 2ALPA 5HXFA 1G3DA 1S82A 2IOTA 2WUCA 3M3VA 2PKSB 1TA2A 1E37B 1RXPA 1TMUH 1TPAE 1JBUH 2FEQH 3PLBA 1TLDA 4NG9H 2FI3E 1JMOH 2Y82A 3AAVA 3M5LA 1IHSH 1TRMA 3MH6A 1EJNA 1EPTB 1MD7A 4U32A 3LJJA 1LHCH 1QRXA 3RM2H 3UOUA 4LXBH 3AASA 1ETTH 3F9HA 1LHFH 4UFEH 3NWUA 4NWLA 2ZPQA 1FPCH 3K9XB 1S81A 3KL6A 4FU7A 3E6PH 2F9NA 1TQ7B 2Z94A 2UWLA 3A7ZA 1AFEH 1ZZZA 4DW2U 1GL0E 1A5GH 4K1TA 2UUJB 5B6OA 1H9LB 3SGBE 4OS6A 1E35B 3VB6A 2VWLA 1UK3A 4FU9A 2ZFRH 1W10U 4XFQA 4WY3A 2OC7A 1NU7B 1NC6A 4I31A 1ELDE 3RXEA 1C1PA 2A4QA 2ZFFH 3TNSA 1HLTH 2HWLB 3LC5A 2G4TA 4D9RA 2VIVA 1A5HA 6LPRA 1BHXB 3T28A 3GY6A 1GBIA 2BOKA 2J94A 3UWJH 1AGJA 1OX1A 8KME2 1JIMA 5FAHA 2QXJA 1V2RT 4IGDA 1OKXA 1QNJA 1IQKA 4ABBA 3TIUA 1DM4B 4BAMB 1K28D 1F7ZA 1AZ8A 3SU2A 2I6QA 4DIIH 2ZNKH 1H9IE 5DKMA 4H42U 1EKBB 2CHAB 3SUFA 2ALVA 2ZC9H 4NZQA 1C1UH 1UTQA 1YP9A 2HALA 3M5MA 4JZ1A 3VB5A 1GBFA 1GHAG 2R3UA 5DP6A 3SOSA 2EC9H 3A7YA 4NSYA 4IBLH 1W3CA 4UDWH 1KXAA 1J8AA 2Q6GA 1ESTA 2BTCE 1ZHMA 3E8LA 3GYMA 1SGYE 4TPYA 5LPFA 1MZAA 1MD8A 1C5TA 1SGDE 4OS7A 2RA0A 1W8BH 1BDAA 1OWJA 3A89A 3BTME 4ABIA 4KELA 1SGPE 2DE9A 1GCTC 3RXDA 4YZUA 3UQVA 1OWEA 1TNJA 3PMBB 4DY7B 1SHYA 2W26A 1XUJA 3LGWA 1GDQA 4DIHH 2GMTB 2WPHS 1KSNA 2J2UA 1ZTLA 3K6ZA 1QA7A 1BBRH 1K1JA 2GTBA 3SZNA 2CHAC 2GX4A 2BXUH 1K1MA 1UVPA 3UNQA 2ZU1A 1TAWA 2AH4X 4AZ2B 1Y5AT 3EYDA 1FN6A 3I77A 3PYHA 1Z7KA 5GCHG 1PPCE 2ZU3A 3GY2A 3KQBA 2ANYA 3B23B 4ZHLU 1K2I1 1GBKA 1CT0E 3RU4E 3SGAE 3RMMH 1MQ6A 5EOKA 1GBHA 2CF9H 2HLCA 2JETC 3Q77A 5GCHF 3OTJE 2Z9IA 1WSSH 4CRBA 4WVPE 4E7RG 1O30A 1SLVB 5A8XA 2ZQ1A 1CSOE 2QF3A 1LKAA 1EAXA 2OBQA 1O2KA 1O38A 4BTUB 1ZOMA 1BBRE 3RXPA 1C5UA 4Q80A 2BQWB 1LVBA 4VGCB 4SGBE 2FS9A 2Y80A 4J1YA 2ZTXA 4D9QA 1SI5H 3TH2H 1QRWA 2A32A 2JH5D 5CMXH 3SJ9A 2ASUB 1EZSC 4AYYB 3A8DA 1YCPK 1XM1A 2Y5GA 3EAJA 1K1LA 3ATIA 1FDPA 2ULLA 1SMFE 4X6MA 1FAKH 2FTLE 1OOKB 4K1EA 1RTKA 1O5FH 4OS1A 1HDTH 2GZ7A 3FVFB 1ZSLA 5H4IB 1ELFA 1LPZB 3CS7A 3BTGE 1O3NA 1SQAA 3SN8A 1THRH 1O2SA 3KQDA 1ETRH 4BTIB 4Q2KA 5E8EH 2Q6FA 1TNLA 1GI0A 1W12U 2FMJA 1B0EA 2NWNA 2UUFB 4ZKSU 5BPEA 1P2QA 3E91A 4OS4A 4ZH8A 1ESAA 1V2UT 1NM6A 1VGCB 2FESH 2PGBB 1QR3E 3ZZAA 2P8OB 1AE5A 1QBNA 2QXIA 3TK5A 4KTSA 2W3IA 3ATWA 3Q3YA 1BHXF 3HK6B 4THNH 5L2YH 1PPHE 1KYNA 1EAWA 1PQ5A 2FOAA 5FBIA 1O3IA 1F5RA 3OX7U 3ZZ7A 2FM2A 2CV3A 2GD4B 1XUFA 1GI9B 1DXWA 2C8ZB 4OGYA 3IITA 2BQ7B 1LO6A 1S0RA 2J4IA 1Z1IA 2FOEA 3T5FH 2BZ6H 4MDSA 4PROA 1UTKA 1P8VC 1TA6A 7ESTE 1SGFA 1SOTA 1RS0A 1WTHD 2HNTE 3Q00A 5F8XA 3AAUA 2Z9GA 1NESE 1C1OA 2OP9A 3E1XB 2P8OC 1V2NT 1ELAA 3SI4H 1EJMA 4MNXA 4MPWA 4IN2A 5LGOA 4UFFH 3P70B 4CH8B 3GY4A 2ZZUH 4Y7AA 1ZR0A 1DWDH 2BX4A 1F0SA 2BLWA 1H8DH 1F2SE 3A7WA 3BIUH 5AFYH 1ELGA 1Y3XA 3A83A 2BDYA 1EOLA 4K60A 2GDDA 3A87A 1C9TA 3P92A 1NU9A 1SQTA 3U1IB 4FU8A 4UEHH 3ZZBA 1ZSJA 3LH1A 3KQEA 2AERH 3A88A 6CHAC 1S83A 2TIOA 1HAVA 3K65B 1MKXH 2FO9A 2G5NA 2FPZA 2TBSA 1AVGH 3AVZA 2BD9A 4AOQA 2R0KA 3T2NA 4ZXYH 1FPHH 1BIOA 2ZP0H 4DCDA 4R8TB 1Z6EA 4ASHA 1HAYB 3PB1E 1C2LA 2ZCKP 2ZCLP 1V6DA 1H9HE 4ABEA 2OC1A 1EX3A 1FJSA 2AYWA 4FVBA 1GBBA 4YT7H 8GCHF 1BTZA 1C1QA 1KXDA 3NPSA 3RMLH 2QC2A 1QIXB 1FQ3A 1VITG 2ZU2A 1AY6H 1EAUA 2FX4A 3Q3XA 3OY6U 1IQMA 3RUOA 1UJ1A 1Q3XA 4NA7A 3S9AA 1GDNA 1YCPH 1C4U2 1VITH 2ZI2H 2VVUA 3RXTA 1VITF 3SNEA 1FI8A 1V2OT 1A1RA 1A0JA 2SNWA 1HPGA 3T26A 1TOMH 2V35A 2Y81A 1CO7E 1SGNE 3VB3A 3U1JB 1O3CA 1SGQE 1PPFE 2ZHEH 1AB9B 4NCYA 2XBYA 2ZO3H 3SV8A 5GXPA 4VGCC 1CU1A 2BLOA 3A82A 3ITIA 2HNTC 3LKWA 4X6OA 2ZTZA 1S85A 3E90B 1AUJA 1TBZH 1PQ7A 3PMHB 2W7SA 2A31A 4WMEA 1O3EA 1PPZA 3DFJA 4FUIA 4JZFH 1G3CA 2QAAA 1AWFH 2PW8H 1T31A 1MTSA 2WPJS 2ZA5A 2F3CE 1C5XB 3NXPA 1DWCH 3W94A 1N8OB 1QCPA 3A8BA 4RKJB 3SBKA 2D1JA 2CF8H 1ZSKA 3KCGH 1AI8H 1DX5M 2A5IA 3RXVA 2AMDA 4Y10E 1O2LA 3P17H 4RN6A 1KXCA 1VZQH 5FCRA 1E34B 4MTBA 3QN7A 2D2DA 3V7TA 3EDXB 3SUDA 1C5LH 4BNRA 1FXYA 1LPGB 1RTLA 3H7TA 3LOXA 3KQCA 3MO9A 4AFZA 3GICB 5EU8A 2FODA 3P8GA 1A3EH 4TWWA 5FXLA 1WQSA 2VU8E 2VIQA 1LMWB 4X2VA 1O2UA 2ZFPH 1V2MT 1UVTH 1AFQC 3I78A 2WV4A 1O32A 2BX3A 3LDXH 3H5CB 2WPLS 2P95A 3UNRA 4B2BA 1L1NA 2F91A 4GPGA 2HPQH 1TGNA 3RXIA 5F8TA 2AFQB 1Z8JB 2BDBA 1MKWK 3ZVFA 3P8FA 2ZEBA 1A7SA 1IQLA 1DFPA 3EA8A 3Q76A 4AFSA 4HGCA 3O8DA 1KTTB 3TPIZ 1AKSA 1GBDA 2PR3A 1QB9A 2BHGA 2BVXH 1Z8GA 1NFYA 3EGKH 3TH3H 2QY0B 1T8NA 1MCVA 4X6NA 1ZGIA 4YOIA 2SGAA 1PFXC 1KLTA 1F0UA 1RIWC 3RMNH 1SLUB 2XWAA 6GCHF 5FCKA 3B9FH 4BTTB 1C4Y2 5F8ZA 3QGJA 1GBJA 3SNAA 1ANBA 1GI8B 2IJOB 2Z3DA 3UFAA 2OINA 1PYTC 1SBWA 4NZLA 2THFB 1EP5A 2VIOA 1QRZA 1SB1H 1TNHA 4WJG2 1BZXE 1H4WA 5C5OA 1P06A 2ZGHA 1AVWA 1EATA 3ATLA 1C5WB 2Q6DA 2NU1E 1LVYA 2A1DB 3A7VA 1DWBH 3M5NA 2Z3CA 3S9BA 5ESBA 2XCNA 1Y3VA 4BAKB 1FLEE 2QGRA 3SU1A 1YCPM 1ELVA 1CHOF 1CQQA 4BXSA 1B0FA 4JYUH 5L6NH 2QV1A 2A2QH 4K2YA 1F0TA 1LHDH 1GHZA 3GISB 4B74A 1YPHE 3ZYDA 1HNEE 2PV9B 5EXNA 1QBVH 1T4UH 1CBWC 1ABIH 3SU3A 2ZHFH 1CHOG 2ZHDA 1KY9A 1J16A 5C20A 1LDTT 4K69A 2H9HA 1TBRH 3SNCA 1BTPA 1ARBA 3U8OH 1BRUP 2C3SA 1C2EA 2ZPSA 4CR5A 2ZFSA 3SU6A 3BTKE 1N6YA 2J92A 1O37A 1CHGA 2XC5A 2ZGXH 3SU0A 3ATKA 1X7AC 3VB4A 4A7IB 5GWZA 1MTUA 4ZMAH 2P59A 3RDZA 1HAPH 3VB7A 1P12E 5GIBA 1MMJN 2BY6X 4NWKA 2FLBH 1O3LA 1WUNH 2ZGBH 3CENA 1ANEA 1GJBB 5JYIA 4UE7H 2BD8A 3E16B 3GY5A 1NY22 1OWKA 4B75A 4KP0A 3A85A 4QT8C 1SGEE 1TGCA 1FY5A 3UR9A 2BY5X 3HGPA 1DLKB 2PTNA 3K2UA 4D7GA 2BOHB 2P3FH 4KTCA 1TALA 3PTNA 5LPEA 3S0NA 1Z71A 3MTYA 4FUFA 4FVDA 3URDA 3KHVA 5I25A 1CGIE 2BDHA 3GDUA 3QTOH 4NGAH 4Y7BA 1NRSH 1AUTC 1O2OA 5E0GA 3A7TA 2Z9LA 4MG3A 5DP9A 1TABE 1PPBH 1GHAF 3RP2A 1GMHF 3UTUH 1B7XB 1C2MA 1UCYH 1DLEA 1ETSH 1HJAC 4Q7YA 1IQGA 3SORA 2GCHF 1YKTA 4ISNA 1L1JA 1C1VH 1XX9A 2A7HA 3SNBA 3M36A 4Y8YA 4BOHA 1C5PA 3ODFA 1GMHG 2ZHQH 3M7TA 3GOVB 1OXGA 5EW2H 1SPJA 4X8SH 2ZPRA 1HUTH 1G3BA 4XE4A 3P6ZB 1YPJH 5K0HA 1C2KA 3PWBA 2GCHG 1DICA 2V3OH 1G2LA 4ZROA 1XVMA 3TK6A 1FONA 2CXVA 2CGAA 3HKJB 2XYAA 4GHTA 1CE5A 1N8OC 1TX8A 4O9VA 3T62A 1DS2E 4B2CA 1TIOA 2Y7ZA 1L1GA 2P94A 8ESTE 3GDSA 1NRRH 5ESTE 1O3KA 3AW0A 2EA3A 1MZDA 1CGJE 2B8OH 1UTJA 1TMTH 2Y6TA 1BMMH 3N7OA 3QDZB 2BLVA 4WMDA 1WBGB 1XXFA 1HJAB 1Y8TA 1NROH 5F03A 1JOUB 5FPYA 1AB9C 9LPRA 3UIRA 3MH5A 2AEIH 1O5DH 1FY4A 3R3GB 3M7QA 1TPSA 1C1WH 2DE8A 1NO9H 2P93A 2ZTYA 4I32A 1Z8IB 4IW4E 1MAXA 2ZF0H 4K1SA 1S6FA 2SGQE 1P3EA 2A5AA 1O2VA 5FPTA 1FIWA 4YT6H 2VJ1A 3BV9B 1S5SA 1NTPA 1THPB 2HGTH 1QA0A 1ELCA 1SFQB 1SVPA 1ZYOA 1GHXH 4U2WA 5HM2A 4NIWA 4AN7A 3AW1A 1ELTA 1HAHH 1OSSA 2AGGX 1SLXB 2KAIA 1RIWB 1GI1A 2ANMH 1IQIA 1KXFA 3RC5A 4I8KA 1TNGA 3GY8A 1IQFA 1PQAA 1ZJKA 2GV7A 1QURH 1K21H 1GMDF 3RXJA 4OS5A 5EXMA 1D6WA 2FXRA 1EPTA 1T7CA 1XMNB 2BD4A 2NU3E 3VGCC 3RXQA 2G8TA 1O39A 1Y3YA 1LVOA 4E06H 1TB6H 3MH4A 4X2YA 5EQQA 4NFFA 4I8LA 1GI6A 1HRTH 3D62A 4O03A 1DY8A 2A2XH 1HJ9A 1MQ5A 5EXLA 1G36A 1V2VT 2XTTB 4JYTA 2A0QB 1AD8H 5EW1H 1GI3A 2TPIZ 3EE0B 4X1SU 1V3XA 1Z1JA 1C9PA 3ZVBA 2QXGA 4Y0ZE 2BVSH 2LPRA 2GZ9A 3LGTA 4NIYA 3V3MA 2ZQ2A 1FY8E 1TNIA 4I33A 1BBRK 2O9QA 1LHEH 2JKHA 5TJXA 3TJNA 3SHAH 1LTOA 4XBDA 2AGEX 2ZDKA 4RKOB 5L30H 1W7XH 2FP7B 5EGMA 2OQUA 2P16A 2QIQA 1G30B 2HNTF 3VGCB 2Z7FE 5AHGH 2FS8A 2C90B 2ANWA 1P04A 3RU4D 3UPEA 1XUGA 1DWEH 1BTWA 1IAUA 1DVAH 2FOHA 1C2IA 3SQEE 1NFWA 1O35A 3SW2B 1O5CB 4NIXA 1EZQA 1EOJA 2ESTE 4JK6A 1E36B 1NRPH 2PKSC 4WXIA 1ZHPA 1HB0B 3TJOA 1YPGH 1O5AB 3RXCA 1DE7H 1UK2A 2A4GA 3R0FA 1HIAA 1ESBA 4Y8XA 1C5VA 1J15A 1GJ6A 1V2LT 1ZTJA 1AVXA 3VXEH 1ARCA 3F1SB 1TX6A 2SFAA 1QGFA 4ZHAA 2H5DA 3MHWU 3RXHA 1O3BA 1CBWB 1O3AA 2WPMS 3PM3A 4CR9A 3PO1C 1DSUA 5EPNA 4ABHA 2FOGA 1Z6JH 2FYQA 5T6GA 2W7UA 4MQAA 1IQNA 2QXHA 2SNVA 3DD2H 1YLCA 3G01A 5C1UA 1AKSB 4AX9H 5CHAC 1HXEH 2TGDA 5BRRE 1GI4A 1O36A 1QJ6B 2EI8A 3MNBA 3A8AA 3T29A 2AMPA 4A1TA 3BTTE 1OP0A 4M7GA 1Y5UT 3ELAH 4ISIH 4DVAU 2BM2A 1DANH 3E0NB 3SJ8A 5JB9S 4ISHH 1GVKB 2BY7X 4F49A 1AN1E 3DT0H 4X8UH 3OU0A 2UUYA 8LPRA 2K1QA 1HAOH 3M7UA 1XUHA 4HZHA 4WH8A 1H1BA 3P8NA 1TQ0B 1YF4A 5C3NA 1GDUA 2C8XB 1THSH 3GCNA 3C27B 4FUEA 3U8TH 1GJ4H 1IHTH 1JIRA 4MPUA 1SSXA 3OYPA 1GHBF 3LC3A 8GCHG 1D4PB 1O2TA 1QBOA 1KIGH 4IS5A 1ELBA 1Y3WA 1WYKA 1VCQA 2P3UB 5EPYA 2IPHA 4XSKU 1T8OA 3RM0H 5FPSA 1GJ9B 4MVNA 4ZXXH 3FZDA 4CREA 4JMYA 2STBE 1HXFH 3QZRA 1GHBG 1QB1A 1W14U 1PYTD 2O8MA 2PLXA 2YNAA 2XXLA 4A1VA 4NFEA 3SV7A 3PLPA 1QB6A 1TOCB 3B8JA 3SJKA 2STAE 2XRCA 3SUGA 3JZ1B 3W95A 1EASA 1KDQB 1CT4E 3RXGA 1EB2A 3BTHE 1SR5C 5ABWA 1O2YA 3M3SA 1T8MA 5HYOA 1C2JA 3BN9A 2GMTC 5IYTA 3HGNA 3VXFH 4B71A 2OC8A 4YTAA 2B7DH 3QLPH 3MMGA 1HAVB 1HYLA 1RRKA 3LGYA 1BQYA 3ZVAA 2B5TB 3RXMA 4I8JA 1O3GA 1P05A 3RXOA 1N6XA 1K9OE 4XBCA 5EODA 1GHYH 1YPKH 4HI3A 5J4SA 1LQDB 4J2YB 1GBLA 5I46H 1JWTA 2OBOA 1ZPBA 1XXDA 1BUIA 4FUGA 1O33A 2VVCA 1ELEE 4IMZA 5JB8S 4MPXA 4CBOA 1QL9A 4CBNA 1G37A 2GZ8A 1EPTC 2FDAA 3WY8A 2V3HH 1OYTH 1F92A 1NT1A 2AMQA 3GDVA 4UFDH 4JYVH 2AIQA 3M5OA 1O5EH 1P2MA 2WV5A 3U8RH 4AG2A 1ANDA 4XDEA 1GI2A 3A84A 5C1YA 3UNSA 3TGIE 5DP8A 5A0AE 1ZJDA 2XWBI 5DGJA 2VWMA 5DP5A 4NSVA 4B73A 4E05H 1GJ8B 4IC5A 3MO6A 1GJDB 2A7JA 3KNXA 2A4OA 2JH0D 5GPIB 2RCEA 5JBCS 2TGPZ 1MU8B 4ZUHA 4KKDA 5T6FA 1A0LA 2GDEH 3GY3A 1P10A 4GHQA 1TNKA 1A2CH 1UTPA 1OYQA 1UHBA 4YLUA 1GBMA 1MH0A 1TGSZ 6GCHG 1OWHA 3M37A 1O3DA 4H6SB 3LGVA 2J38A 1C5SA 1BRBE 1SC8U 2DUCA 1SGCA 3E0PB 1GI7B 4MNWA 2HVXA 4WMFA 2EI6A 2H1UA 4WF8A 1W0ZU 5DP3A 3E3TA 1O31A 4Y71A 1C1RA 3BTWE 1SLWB 1L2EA 1GPZA 1LPKB 4O97A 2BB4A 2TRMA 3SU5A 1JRSA 3MU5A 3HKIB 1CA8B 2BVRH 1T4VH 2UWPA 4JZDH 3FFGA 2QA9E 3S69A 1M9UA 2SGFE 4X1QU 3D65E 1WQVH 4INHA 1UCYK 1BA8B 2WYJA 2A45B 1G32B 1GL1A 1OWDA 1EB1H 3FP7E 2YOLA 4AGJA 3O8RA 1XKBC 2WYGA 1FY1A 2CMYA 3TJVA 4UONA 1QHRB 1A3BH 1UVSH 2UWOA 4DOQA 1GHVH 1O5GH 3MNXA 2FI5E 2WPKS 4D7FA 1OP8A 5DP7A 2XBWA 2ZWLH 1TGBA 2GVFA 5DPAA 1E38B 2C93B 5A8YA 4MNYA 3S7HB 2SGEE 1AFQB 1IQHA 2BY8X 1RTFB 4NA8A 2VH6A 1GG6C 4WWYA 4DT7B 4TPIZ 5PTPA 2F9BH 2R9PA 1INCA 3NCLA 2OLGA 4Y79A 3RMOH 1XUKA 1C4V2 2P3TB 4AG1A 3TJUA 2G00A 4ISLA 4AFUA 1EAIA 5SGAE 1YGCH 1ZMLA 4YM9A 3LU9B 1BOQA 1KXEA 3QGNB 2EEKA 4Y6DA 3A7XA 3FZZA 5JDUB 3V0XA 2ZFTA 3QTVH 1UVUH 4GCHF 1BTXA 3MOCA 1O2HA 1P01A 1C1SA 1BMNH 2H5CA 4E7NA 2XC0A 3IG6B 2FWWA 4X2XA 2OUAA 5A8ZA 4Z0KA 3OY5U 1SHHB 1ZMJA 3QK1A 5AVDA 1ACBE 1QJ1B 3K6YA 1O2MA 2G81E 1D3QB 3ZZ8A 5HMAA 1FNIA 3HATH 1WU1A 2TGAA 5K7RA 1MTVA 1TYNA 3RU4T 7GCHG 2PKAA 1AIXH 1GG6B 2H9EH 3VFEA 2V6NA 2RG3A 1Y3UA 1OP2A 2PTCE 2FOFA 1JRTA 3LIWA 3SJIA 3QZQA 4ZKRU 4YLQH 4GVUA 7GCHF 1YPHC 2ODYB 3URCA 3FANA 4CHAC 1U6QA 1NPMA 1AQ7A 1XUIA 1J9CH 1GWAA 1BB0B 1MTNC 5FHTA 1ZRBA 1QQUA 1FY3A 1K1NA 1TGTA 1TMBH 3CS0A 3BG4C 2W5EA 2VINA 1L0ZA 1ZRKA 2BD2A 2BDAA 4BXWA 2C8WB 4MLFB 2BY9X 2XNIA 2FOBA 2G5VA 1DSTA 3H7OA 1ANCA 4GUXA 2ZU4A 2BDIA 4YO9A 3S7KB 2J34A 1RJXB 5IDKA 1P02A 1QY6A 2VB0A 1HFDA 1BITA 1LQEA 1P57B 1UO6A 4KTUA 5T6DA 1VGCC 2VWOA 2G55A 3UR6A 1C1MA 1SGIB 1CA0B 3OSYA 2WPIS 4AORA 2Z6BD 3LONA 1TFXA 3KGPA 1D6RA 1SGRE 4KGAA 1V2QT 1BJVA 1P9SA 3MU0A 4K5ZA 4XBBA 1O3JA 1SL3A 2FX6A 4Y11E 1T32A 1FV9A 3L33A 1A0HB 2XW9A 3TH4H 3DFLA 1HCGA 4AFQA 3SGQE 1NRNH 5JPMH 7KMEH 1ZMNA 4ZHMU 4UFGH 5JBAS 1P2IA 2OXSA 4X8TH 1L4ZA 1GGDB 2OD3B 1YPMH 4INKA 4A5TS 2VIPA 1KTSB 2GT8A 4ZAEA 2FOMB 3BEFB 1LKBA 1SQOA 1AMHA 1LVMA 1NN6A 1SOZA 1V2WT 1GMDG 2QN5T 4FXGH 4CRCA 4D8NA 2FI4E 3ZV8A 1UVOA 2F9OA 1GCTB 1FUJA 2QF0A 3SHCH 1BMAA 2FOCA 1SGTA 4Z6AH 1Z8RA 3F68H 4A6LA 3TVJB 4F4OC 2Y7XA 3LPRA 1O34A 1G3EA 2GKVE 3FP8E 2M5TA 4CRGA 1SG8B 4OGXA 3TGJE 1J17T 4AGKA 2QYIA 2HPPH 3SU4A 4ZKOU 3U9AH 3MU8A 1GMCF 3RXKA 6ESTA 4OS2A 1K1OA 1O3MA 2ZECA 4I8GA 2RA3A 1QL8A 2BMGB 4ISOA 3BTFE 2F9VA 4B2AA 1GGDC 2BLQA 2PWXA 5A09A 3PWCA 3O8BA 2F9PA 2A5KA 1GMCG 4B1TA 3GCHC 1WTGH 3BTDE 1JXPA 3RXSA 2ODPA 3SV9A 4CRAA 3BG4B 3ZZ6A 1F5LA 1NRQH 3ZVGA 1ID5H 1O2WA 2BDCA 4HFPB 2VNTA 4WH6A 2BXTH 4ABJA 1QTFA 1YM0A 3KIDU 1KLIH 1OS8A 1Y59T 1BTHH 4X8VH 5HM9A 1L4DA 3GYLB 3LH3A 1DXPA 3MNCA 1TPPA 3JZ2B 4LK4A 1UK4A 4A92A 1CA0C 3LJOA 2H6MA 1SFIA 4CRFA 4MNVA 1TRYA 5EG4A 1YBWA 2F83A 2G51A 2ZDNA 1UTNA 1VCPA 4BAOB 1EJAA 1DUAA 1YPLH 1O2GH 2PUQH 3PTBA 3ZZ4A 1O2IA 1GCDA 3SUEA 1D9IA 2RDLA 1O2NA 5GDSH 1CGHA 1HAIH 4X1PU 1H8IH 1CT2E 2PKAB 3C1KA 2WINI 1TX7A 3A8CA 2OTVA 5C2ZA 2O8WA 1WCZA 1O3HA 2CJIA 4XOJA 3BSQA 3BEUA 3CP7A 1C2DA 2GCTC 2J9NA 4INLA 3SNDA 2BZAA 3PLKA 2XBVA 1FAXA 2KAIB 7LPRA 1DT2A 3KF2A 3ZZ5A 1O2JA 1A4WH 1QJ7B 1DITH 1CVWH 1NS3A 1AWHB 1KLJH 3RC4A 3O8CA 5DJ7A 1W0YH 3RC6A 4X6PA 2ZDVH 4JK5A 2C4FH 1EZUC 1W2KH 1ORFA 1BMLA 1P2NA 4R0IA 3GCTF 1A46H 1MBMA 4ABDA 1DOJA 5DO4H 2ODQA 3QUMP 1BCUH 1EZXC 3F9GA 4DURA 1HJ8A 5C67A 1MTNB 2O8TA 2H2ZA 1EQ9A 4YOJA 2OC0A 3U98H 4NA9H 2WUBA 3GCTG 1VR1H 3V13A 3NK8A 2ZGJA 4I8HA 1VJAU 4TWYA 3TLOA 5TCAA 2BD3A 3GCHB 1GHWH 1MU6B 2OQ5A 4X1NU 1O2ZA 2GCTB 3SJOA 1V2PT 5E2PA 2HRVA 3ZVCA 3ZV9A 1BJUA 9ESTA 4DGJA 4JZIA 3FP6E 2PGQB 1Q31A 1GJ5H 1MTWA 1YPEH 4Q7ZA 1O2QA 1LHGH 1HAGE 3LT3A 4DJZB 3L3TA 1D3DB 1WAYB 3BTQE 4O3UA 1P09A 1GBTA 2FZZA 3MWIU 3RXUA 1FIZA 5CE1A 2ZHWH 2Z9JA 3MI4A 1P11E 5HGGA 2Q1JA 1XKAC 2Y5FA 4D76A 3M61U 2O8LA 3EA7A 3BIVH 1O3FA 1YYY1 5DK1A 1KXBA 4NIVA 1P03A 1MKWH 4IMQA 1WOFA 1PJPA 2PSXA 2BYAX 1O5BB 6CHAB 1UTLM 3PROA 3P95A 2H9TH 4ESTE 3M3TA 3TK9A 2BD5A 3F6UH 4FUJA 1TBQH 1VCWA 1DUEA 2NU2E 2W3KA 4CH2B 1UHBB 5T3HA 2XCFA 1Q2WA 3I29A 1GVLA 1FMGA 5C5NA 3ZVEA 2PUXB 3BTEE 2VIWA 1C1TA 1V2KT 2YNBA 3KEEA 4K3JA 5FX6A 1GJCB 2AIPA 1K22H 2BD7A 1GBAA 3F9EA 4JCNA 5EQSA 3ZVDA 3S9CA 1EUFA 1YC0A 4Y8ZA 3SI3H 1ZGVA 4ZKNU 1TONA 1W7GH 1RD3B 1TE0A 2AS9A 2B9LA 3U69H 1G2MA 4Y0YE 4K8BA 1Y5BT 2PSYA 2FYRA 1QQ4A 1O2PA 1VJ9U 2R2MB 3TITA 1G9IE 1HGTH 4TY7A 5TCCA 2VWNA 2OCVB 2ZIQH 2Z3EA 3EA9A 5G4BA 4UD9H 3Q3KA 1F0RA 2G4UA 1BRCE 2O8UA 2AGIX 4JZEH 3MO3A 2A7CA 3LGIA 3VEQB 3HK3B 1C1NA 1C5NH 3M35A 5E2OA 4DG4A 1PPEE 3MNSA 3IWMA 3LGUA 4H6TA 4IC6A 3GY7A 1ZHRA 3BF6H 1ZTKA 4LZ4B 1HBTH 4IN1A 2Z9KA 4X2WA 2I6SA 3KN2A 5E0JA 1LCYA 1XVOA 2GP9B 4LZ1H 4AYVB 5F6MA 3NZIA 2QCYA 1IQEA 1C5RA 3QWCH 4ABAA 2ZCHP 4FUCA 5JBBS 2IN2A 3P8OA 2B0FA 1HAZB 4K8YA 1V2ST 4GSOA 2ZFQH 4O3TA 4BANB 3MU4A 2PFEA 3RXBA 3PV4A 1EP6A 3PMJA 2SGDE 2FIRH 2GT7A 3HPTB 1RFNA 5A0CA 1MCTA 4BAQB 2R2WU 4Y76A 3T27A 2R0LA 1DY9A 1P2JA 2Y5HA 2ILNA 1QL7A 5AF9H 1AZZA 3MFJA 3SQHE 2VIDA 2BDGA 1NFUA 2ZDAH 3MYWA 1GBCA 3UUZA 1NFXA 3ATMA 3RLWH 1O2RA 2ZDLA 1P2KA 5FX5A 1UCYE 3FAOA 1IQJA 2C8YB 3GCOA 3UWIA 4X1RU 4AB9A 3ZZ3A 3V12A 1BTYA 3VPKA 3A80A 1TRNA 3RXAA 3MU1A 3UY9A 4B76A 1C5MD 3NUMA 3RXFA 1YLDA 1NZQH 1C5YB 1O3PB 1BRAA 5J4QA 3DA9B 2V0BA 1BT7A 1RGQA 1FN8A 3A86A 2GGVB 3A81A 5A0BA 2ZU5A 1IOEA 1E0FD 1UMAH 4YESB 2ZDMA 3PO1B 3ZZ9A 3RXRA 1KDQA 1MBQA 1HAXB 2XC4A 3BG8A 4FUDA 2A4RA 4CHAB 4ABFA 2G52A 1AO5A 1BTUA 1MUEB 1C2FA 1K1PA 5CHAB 3SO3A 2UUKB 2TGTA 3ODDA 2ZGCA 4TY6A 3L6PA 1GJ7B 5FBEA 2PHBA 4FUBA 1O0DH 4GCHG 1P2OA 1PQ8A 1S0QA 4U01A 1WV7H 1FZZA 3ZZCA 1W13U 2NU0E 5DG6A 2VGCC 3ZYEA 1N1LA 2ANKH 1ZPZA 3D49H 2FLRH 2D26C 1MAYA 1C5ZB 1S84A 2JH6D 1AU8A 5AFZH 2GV6A 1AHTH 2J95A 1J14A 1T8LA 1W11U 4CRDA 1ZPCA 5LH8A 2SGPE 1UTMA 1ABJH 1AE8H 1P3CA 1D3TB 3ZZDA 2VH0A 3UQOA 1GJAB 1TPOA 1C5QA 4I7YH 3NKKA 5JBTA 1HIAB 4RSPA
chains in the Genus database with same CATH superfamily
1V2TT 3QX5H 1GBEA 1F5KU 3TU7H 2D8WA 2KM0A 2NU4E 4YOGA 2KCYA 1ZLRA 1DDJA 5L2ZH 4GAWA 3F0PA 3STIA 3TNTA 1GI5A 1QFKH 1BMFD 1TWXB 2LNCA 4GLYA 2VGCB 3STJA 1C2GA 4MPVA 1HV7A 5C1XA 2JDID 1SGFG 1OHHD 1V2JT 4AB8A 1PPGE 2JJ1D 3SV6A 2XBXA 1C5OH 5A2MH 2JETB 1C2HA 1A5IA 3QO6A 2VVVA 1D3PB 1A61H 1B5GH 4FUHA 3UREA 4BAHB 5LPRA 2EI7A 4U30A 3SV2H 1GVZA 4LOYH 2CN0H 1O3OA 3RXLA 3EQ0H 3UOPA 3TGKE 4Q7XA 2ZKSA 2HOBA 4WXVA 4ABGA 2J5UA 1K1IA 1P0SH 1O2XA 3RLYH 3DHKH 1MKXK 3DUXH 3ENSB 5DP4A 4SGAE 1S6HA 4H4FA 3PMAB 1DPOA 3D23A 3SZEA 1EXFA 3ESTA 1UTOA 3F9FA 2KFWA 4HTCH 4A1XA 5EQRA 1P9UA 2R3YA 3BEIB 2ZG0H 4X0WU 2F9UA 1OWIA 2FTMA 3T25A 4TYDA 5GJ4B 1EFRD 2BQ6B 5E0HA 3MH7A 5ETXA 1OPHB 2ALPA 5HXFA 1G3DA 1S82A 2IOTA 2WUCA 3M3VA 2PKSB 1TA2A 4DT4A 1E37B 1RXPA 1TMUH 1TPAE 1JBUH 2FEQH 2RDEA 3PLBA 1TLDA 4NG9H 2FI3E 1JMOH 2Y82A 3AAVA 3M5LA 1IHSH 1TRMA 3MH6A 1EJNA 1EPTB 1MD7A 4U32A 3LJJA 1LHCH 1QRXA 3RM2H 3UOUA 4LXBH 3AASA 1ETTH 3F9HA 1LHFH 4UFEH 3NWUA 4NWLA 2ZPQA 1FPCH 3K9XB 1S81A 3WWBA 3KL6A 4FU7A 3E6PH 2F9NA 1TQ7B 2Z94A 2UWLA 3WW7A 3A7ZA 1AFEH 1ZZZA 4DW2U 1GL0E 1A5GH 4K1TA 2UUJB 5B6OA 1H9LB 3SGBE 4OS6A 1E35B 3VB6A 2VWLA 1UK3A 4FU9A 2ZFRH 3FKSD 1W10U 4XFQA 4WY3A 2OC7A 1NU7B 1NC6A 4I31A 1ELDE 3RXEA 4YXWD 1W0KD 1C1PA 2A4QA 2JIZD 2ZFFH 3TNSA 1HLTH 2HWLB 3LC5A 2G4TA 4D9RA 2VIVA 1A5HA 6LPRA 1BHXB 3T28A 3GY6A 1GBIA 2BOKA 2J94A 3UWJH 1AGJA 1OX1A 8KME2 1JIMA 5FAHA 2QXJA 1V2RT 4IGDA 1OKXA 1QNJA 1IQKA 4ABBA 3TIUA 1DM4B 4BAMB 1K28D 1F7ZA 1AZ8A 2K8IA 3SU2A 2I6QA 5HKKD 4AC9A 4DIIH 2ZNKH 1H9IE 1SQRA 5DKMA 4H42U 1EKBB 2CHAB 3SUFA 2ALVA 2ZC9H 4NZQA 1C1UH 1UTQA 1YP9A 2HALA 3M5MA 4JZ1A 3VB5A 1GBFA 1GHAG 2R3UA 5DP6A 3SOSA 2EC9H 3A7YA 5KEDA 4NSYA 4IBLH 1W3CA 4UDWH 1KXAA 1J8AA 2Q6GA 1ESTA 3DSGA 2BTCE 1ZHMA 3E8LA 3GYMA 1SGYE 4TPYA 5LPFA 1MZAA 1MD8A 1C5TA 1SGDE 4OS7A 2RA0A 1W8BH 1BDAA 1OWJA 3A89A 3BTME 4ABIA 4KELA 1SGPE 2DE9A 1GCTC 3RXDA 4YZUA 3UQVA 1OWEA 1TNJA 3PMBB 4DY7B 1SHYA 2W26A 1XUJA 3LGWA 1GDQA 4DIHH 2GMTB 2WPHS 1KSNA 2J2UA 1ZTLA 3K6ZA 1QA7A 1BBRH 1K1JA 2GTBA 3SZNA 2CHAC 2GX4A 3OEED 2BXUH 1K1MA 1UVPA 3UNQA 2ZU1A 1TAWA 2AH4X 3FO8D 4AZ2B 1Y5AT 3EYDA 1FN6A 3I77A 3PYHA 1Z7KA 2XOKD 5GCHG 1PPCE 2ZU3A 3GY2A 3KQBA 2ANYA 3B23B 1FX0B 4ZHLU 1K2I1 1GBKA 1CT0E 3RU4E 3SGAE 3RMMH 1MQ6A 5EOKA 1GBHA 2CF9H 2HLCA 2JETC 3Q77A 5GCHF 3OTJE 2Z9IA 1WSSH 4CRBA 4WVPE 4E7RG 1O30A 1SLVB 5A8XA 2ZQ1A 1CSOE 2QF3A 1LKAA 1EAXA 2OBQA 1O2KA 1O38A 1SKYE 1ZOMA 3ZIAD 4BTUB 1BBRE 3RXPA 2HVYB 1C5UA 4Q80A 2BQWB 1LVBA 4VGCB 4SGBE 2FS9A 2Y80A 4J1YA 4ACBA 2ZTXA 4D9QA 1SI5H 3TH2H 1QRWA 2A32A 2JH5D 5CMXH 3SJ9A 2ASUB 1EZSC 4AYYB 3A8DA 1YCPK 1XM1A 2Y5GA 3EAJA 1K1LA 3ATIA 1FDPA 2ULLA 1SMFE 4X6MA 1FAKH 2FTLE 1OOKB 4K1EA 1RTKA 1O5FH 4OS1A 1HDTH 2GZ7A 3FVFB 1ZSLA 5H4IB 1ELFA 1LPZB 3CS7A 3BTGE 1O3NA 1SQAA 3SN8A 4P00A 1THRH 1O2SA 3KQDA 1ETRH 4BTIB 4Q2KA 5E8EH 2LELA 2Q6FA 5EIYA 1TNLA 1GI0A 1W12U 2FMJA 1B0EA 2NWNA 2UUFB 4ZKSU 5BPEA 1P2QA 3E91A 4OS4A 4ZH8A 1ESAA 1V2UT 1NM6A 1VGCB 4Q63A 2FESH 2PGBB 1QR3E 3ZZAA 2P8OB 1AE5A 1QBNA 2QXIA 3TK5A 4KTSA 2KCOA 2W3IA 3ATWA 3Q3YA 1BHXF 3HK6B 4THNH 5L2YH 1PPHE 1KYNA 1EAWA 1PQ5A 2FOAA 5FBIA 1O3IA 1F5RA 3OX7U 3ZZ7A 2FM2A 4B6FA 2CV3A 2GD4B 1XUFA 3UB0A 1GI9B 1DXWA 2C8ZB 4OGYA 3IITA 2BQ7B 1LO6A 1S0RA 2J4IA 1Z1IA 2FOEA 3T5FH 2BZ6H 4MDSA 4PROA 1UTKA 1P8VC 1E1RD 1TA6A 7ESTE 1SGFA 1SOTA 1RS0A 1WTHD 1YWUA 2HNTE 3Q00A 5F8XA 3AAUA 2Z9GA 1NESE 1C1OA 2OP9A 1YY3A 3E1XB 2P8OC 1V2NT 1ELAA 3SI4H 1EJMA 4MNXA 4MPWA 4IN2A 5LGOA 4UFFH 3P70B 4CH8B 3GY4A 2ZZUH 4Y7AA 1ZR0A 1DWDH 2BX4A 1F0SA 2BLWA 1H8DH 1F2SE 3A7WA 3BIUH 3GS9A 5AFYH 1ELGA 1Y3XA 2VBCA 3A83A 2BDYA 1EOLA 4K60A 2GDDA 3A87A 1C9TA 3P92A 1NU9A 1SQTA 3U1IB 4FU8A 4UEHH 3ZZBA 1ZSJA 3LH1A 3KQEA 2AERH 3A88A 6CHAC 1S83A 2TIOA 1HAVA 3K65B 1MKXH 2FO9A 2G5NA 2FPZA 2TBSA 1AVGH 3AVZA 2BD9A 4AOQA 2R0KA 3T2NA 4ZXYH 1FPHH 1BIOA 2ZP0H 4DCDA 4R8TB 1Z6EA 4ASHA 1E79D 1HAYB 3PB1E 1C2LA 2ZCKP 2ZCLP 5C0TA 2L6OA 1V6DA 1H9HE 4ABEA 2OC1A 1EX3A 1FJSA 2AYWA 4FVBA 1GBBA 4YT7H 2CK3D 3UAIC 8GCHF 1BTZA 1C1QA 1KXDA 3NPSA 3RMLH 2QC2A 1QIXB 1FQ3A 5DN6D 1VITG 2ZU2A 1AY6H 1EAUA 2FX4A 3Q3XA 3OY6U 1IQMA 3RUOA 1UJ1A 2KX4A 1Q3XA 4NA7A 3S9AA 1MABB 1GDNA 1YCPH 1C4U2 1VITH 2ZI2H 3KQ5A 2VVUA 3RXTA 1VITF 3SNEA 1FI8A 1V2OT 1A1RA 1A0JA 2SNWA 1HPGA 3T26A 1TOMH 2V35A 2Y81A 1CO7E 1SGNE 3VB3A 3FN8A 3U1JB 1O3CA 1SGQE 2F4LA 1PPFE 2ZHEH 1AB9B 4NCYA 2XBYA 2ZO3H 3SV8A 5GXPA 4VGCC 1CU1A 2BLOA 3A82A 3ITIA 2HNTC 3LKWA 4X6OA 2ZTZA 1S85A 3E90B 1AUJA 1TBZH 1PQ7A 2AHME 3PMHB 2W7SA 2A31A 4WMEA 1O3EA 1PPZA 3DFJA 4FUIA 4JZFH 1G3CA 2QAAA 1AWFH 2PW8H 1T31A 5HIZA 1MTSA 2WPJS 3OE7D 2ZA5A 2F3CE 1C5XB 3NXPA 1DWCH 3W94A 1N8OB 1QCPA 3A8BA 4RKJB 3SBKA 2D1JA 2CF8H 1ZSKA 3KCGH 1AI8H 1DX5M 2A5IA 3RXVA 2AMDA 4Y10E 1O2LA 3P17H 3F3BA 4RN6A 3F2HA 1KXCA 1VZQH 5FCRA 1E34B 4MTBA 3QN7A 2D2DA 5C0UA 3V7TA 3EDXB 3SUDA 1C5LH 4BNRA 1FXYA 1LPGB 1RTLA 3H7TA 3LOXA 3KQCA 3MO9A 4AFZA 3GICB 5EU8A 2FODA 3P8GA 1A3EH 4TWWA 5FXLA 1WQSA 2VU8E 2VIQA 1LMWB 4X2VA 3EE7A 1O2UA 2ZFPH 1V2MT 1UVTH 1AFQC 3I78A 2WV4A 1O32A 2BX3A 3LDXH 3H5CB 2WPLS 2P95A 3UNRA 4B2BA 1L1NA 2F91A 4GPGA 2HPQH 1TGNA 3RXIA 5F8TA 2AFQB 1Z8JB 2BDBA 1MKWK 3ZVFA 3P8FA 2ZEBA 1A7SA 1IQLA 1DFPA 3EA8A 3Q76A 4AFSA 4HGCA 3O8DA 1KTTB 3TPIZ 1AKSA 1GBDA 2PR3A 1QB9A 2BHGA 2BVXH 1Z8GA 1NFYA 3EGKH 3TH3H 2YMSB 2QY0B 1T8NA 1MCVA 4X6NA 1ZGIA 4YOIA 2SGAA 1PFXC 1KLTA 1F0UA 1RIWC 3RMNH 1SLUB 2XWAA 6GCHF 5FCKA 3B9FH 4BTTB 1C4Y2 5F8ZA 3QGJA 1GBJA 3SNAA 1ANBA 1GI8B 2IJOB 2Z3DA 3UFAA 2OINA 1PYTC 1SBWA 4NZLA 2THFB 1EP5A 2VIOA 1QRZA 1SB1H 1TNHA 3N7EA 4WJG2 1BZXE 1H4WA 5C5OA 1P06A 2ZGHA 1AVWA 1EATA 3ATLA 1C5WB 2Q6DA 2NU1E 1LVYA 2A1DB 3A7VA 1DWBH 3M5NA 2Z3CA 3S9BA 5ESBA 2XCNA 1Y3VA 4BAKB 1FLEE 2QGRA 4HG6A 3SU1A 1YCPM 1ELVA 1CHOF 1CQQA 4BXSA 1B0FA 4JYUH 5L6NH 2QV1A 2A2QH 4K2YA 1F0TA 1LHDH 1GHZA 3GISB 4B74A 1YPHE 3ZYDA 1HNEE 2PV9B 5EXNA 1QBVH 1T4UH 3W1EA 1CBWC 1ABIH 3SU3A 3WWFA 2ZHFH 1CHOG 2ZHDA 1KY9A 4RT1A 1J16A 5C20A 1LDTT 4K69A 2H9HA 1TBRH 3SNCA 1BTPA 1ARBA 3U8OH 1BRUP 2C3SA 1C2EA 2ZPSA 4CR5A 2ZFSA 3SU6A 3BTKE 1N6YA 2J92A 1O37A 1CHGA 2XC5A 2ZGXH 3SU0A 3ATKA 1X7AC 3VB4A 4A7IB 5GWZA 1MTUA 4ZMAH 2P59A 3RDZA 1HAPH 3VB7A 1P12E 5GIBA 1MMJN 2BY6X 4NWKA 1WXRA 2FLBH 1O3LA 1WUNH 2ZGBH 3CENA 1ANEA 1GJBB 5JYIA 4UE7H 2BD8A 3E16B 3GY5A 1NY22 5EJ1A 1OWKA 4B75A 4KP0A 3A85A 4QT8C 1SGEE 1TGCA 1FY5A 3UR9A 2BY5X 3HGPA 1DLKB 2PTNA 3K2UA 4D7GA 2BOHB 2P3FH 4KTCA 1TALA 3PTNA 5LPEA 3S0NA 2J98A 1Z71A 3MTYA 4FUFA 4FVDA 3URDA 3KHVA 5I25A 1CGIE 2BDHA 3GDUA 3QTOH 4NGAH 4Y7BA 1NRSH 1AUTC 1O2OA 5E0GA 3A7TA 2Z9LA 4MG3A 5DP9A 1TABE 1PPBH 1GHAF 3RP2A 1GMHF 3UTUH 1B7XB 1C2MA 1UCYH 1DLEA 5EJLA 1ETSH 1HJAC 4Q7YA 1IQGA 3SORA 2GCHF 1YKTA 4ISNA 1L1JA 1C1VH 1XX9A 2A7HA 3SNBA 3M36A 4Y8YA 4BOHA 1C5PA 3ODFA 1GMHG 2ZHQH 3M7TA 3GOVB 1OXGA 2QE7D 2V7QD 5EW2H 1SPJA 4X8SH 2ZPRA 1HUTH 1G3BA 4XE4A 3P6ZB 1YPJH 5K0HA 1C2KA 3PWBA 2GCHG 1DICA 2V3OH 1G2LA 4ZROA 1XVMA 3TK6A 1FONA 2CXVA 2CGAA 3HKJB 2XYAA 4GHTA 1CE5A 1N8OC 1TX8A 4O9VA 3T62A 1DS2E 4B2CA 1TIOA 2Y7ZA 1L1GA 2IPQX 2P94A 1H8HD 8ESTE 3GDSA 1NRRH 5ESTE 1O3KA 3AW0A 2EA3A 1MZDA 1CGJE 2B8OH 1UTJA 1TMTH 2Y6TA 3PV2A 5C94A 1BMMH 3N7OA 3QDZB 2BLVA 4WMDA 1WBGB 1XXFA 1HJAB 1Y8TA 5DSFA 1NROH 5F03A 1JOUB 5FPYA 1AB9C 9LPRA 3UIRA 3MH5A 2AEIH 1O5DH 1FY4A 3R3GB 3M7QA 1TPSA 1C1WH 3DSOA 2DE8A 1NO9H 2KZ4A 2P93A 2ZTYA 4I32A 1Z8IB 4IW4E 1MAXA 2ZF0H 4K1SA 1S6FA 2SGQE 1P3EA 2A5AA 1O2VA 5FPTA 1FIWA 4YT6H 2VJ1A 3BV9B 1S5SA 1NTPA 1THPB 2HGTH 1QA0A 1ELCA 1SFQB 1SVPA 1ZYOA 1GHXH 4U2WA 5HM2A 4NIWA 4AN7A 3AW1A 1ELTA 1HAHH 1OSSA 2AGGX 1SLXB 2KAIA 1RIWB 1GI1A 2ANMH 1IQIA 1KXFA 3RC5A 4I8KA 1TNGA 3GY8A 1IQFA 1PQAA 1ZJKA 2GV7A 1QURH 1K21H 2KCPA 1GMDF 3RXJA 4OS5A 5EXMA 1D6WA 2FXRA 1EPTA 1T7CA 1XMNB 2BD4A 2NU3E 3VGCC 3RXQA 2G8TA 1O39A 1Y3YA 1LVOA 4E06H 1TB6H 3MH4A 4X2YA 5EQQA 4NFFA 4I8LA 1GI6A 1HRTH 3D62A 4O03A 1DY8A 2WPDD 2A2XH 1HJ9A 1MQ5A 5EXLA 1G36A 1V2VT 2XTTB 4JYTA 2A0QB 3DCLA 1AD8H 5EW1H 1GI3A 2TPIZ 3EE0B 4X1SU 1V3XA 1Z1JA 1C9PA 3ZVBA 2QXGA 4Y0ZE 2BVSH 2LPRA 2GZ9A 3LGTA 4NIYA 3V3MA 2ZQ2A 1FY8E 1TNIA 4I33A 1BBRK 2O9QA 1LHEH 2JKHA 5TJXA 3TJNA 3SHAH 1LTOA 4XBDA 2AGEX 2ZDKA 4RKOB 5L30H 1W7XH 2FP7B 5EGMA 2OQUA 2P16A 2QIQA 1G30B 2HNTF 3VGCB 2Z7FE 5AHGH 2FS8A 2C90B 2ANWA 1P04A 3RU4D 3UPEA 1XUGA 1DWEH 1BTWA 1IAUA 1DVAH 4XRNA 2FOHA 1C2IA 3SQEE 1NFWA 1O35A 3SW2B 1O5CB 4NIXA 1EZQA 1EOJA 2ESTE 4JK6A 1E36B 1NRPH 2PKSC 4WXIA 1ZHPA 1HB0B 3TJOA 1YPGH 4OM9A 1O5AB 3RXCA 1DE7H 1UK2A 2A4GA 3R0FA 1HIAA 1ESBA 4RI0A 4Y8XA 1C5VA 1J15A 1GJ6A 1V2LT 1ZTJA 1AVXA 3VXEH 1ARCA 3F1SB 1TX6A 2SFAA 1QGFA 4ZHAA 2H5DA 3MHWU 3RXHA 1O3BA 1CBWB 1O3AA 2WPMS 3PM3A 4CR9A 3PO1C 1DSUA 5EPNA 4ABHA 2FOGA 1Z6JH 5B6LA 2FYQA 5T6GA 2W7UA 4MQAA 2QF4A 1IQNA 3DSPA 2QXHA 2SNVA 2WV9A 5T1VA 3DD2H 1YLCA 3G01A 2QF5A 5C1UA 1AKSB 4AX9H 5CHAC 1HXEH 2TGDA 5BRRE 1GI4A 1O36A 1QJ6B 2EI8A 2YMSD 3MNBA 3A8AA 3T29A 2AMPA 4A1TA 3BTTE 1OP0A 4M7GA 1Y5UT 3ELAH 4ISIH 4DVAU 2BM2A 1DANH 3E0NB 3SJ8A 3NRLA 5JB9S 4ISHH 1GVKB 2BY7X 4F49A 1AN1E 3DT0H 4X8UH 3OU0A 2UUYA 8LPRA 2K1QA 1HAOH 3M7UA 1XUHA 4HZHA 4WH8A 1H1BA 3P8NA 1TQ0B 1YF4A 5C3NA 1GDUA 2C8XB 1THSH 3GCNA 3C27B 4FUEA 3U8TH 1GJ4H 1H8ED 1IHTH 1JIRA 4MPUA 1SSXA 3OYPA 1GHBF 3LC3A 8GCHG 1D4PB 1O2TA 1QBOA 1KIGH 4IS5A 1ELBA 1Y3WA 1WYKA 1VCQA 2P3UB 5EPYA 2IPHA 4XSKU 1T8OA 3RM0H 5FPSA 1GJ9B 4MVNA 4ZXXH 3FZDA 4CREA 5CHBA 4JMYA 2STBE 1HXFH 3QZRA 1GHBG 1QB1A 1W14U 1PYTD 2O8MA 2PLXA 2YNAA 2XXLA 4A1VA 4NFEA 3SV7A 3PLPA 1QB6A 1TOCB 3B8JA 3SJKA 2STAE 2XRCA 3SUGA 3JZ1B 3W95A 1EASA 1KDQB 1CT4E 3RXGA 1EB2A 3BTHE 1SR5C 5ABWA 1O2YA 3M3SA 1T8MA 5HYOA 2K0QA 1C2JA 3BN9A 2GMTC 5IYTA 3HGNA 1KMHB 1S6LA 3VXFH 4B71A 2OC8A 4YTAA 2B7DH 3QLPH 3MMGA 1HAVB 1HYLA 1RRKA 3LGYA 1BQYA 3ZVAA 2B5TB 5HIYA 3RXMA 4I8JA 1O3GA 1P05A 3RXOA 1N6XA 1K9OE 4XBCA 5EODA 1GHYH 1YPKH 4HI3A 5J4SA 1LQDB 4J2YB 1GBLA 5I46H 1JWTA 2OBOA 1ZPBA 1XXDA 1BUIA 4FUGA 1O33A 2VVCA 1ELEE 4IMZA 5JB8S 4MPXA 4TSFD 4CBOA 1QL9A 4CBNA 1G37A 2GZ8A 1EPTC 2FDAA 3WY8A 2V3HH 1OYTH 1F92A 1NT1A 2AMQA 3GDVA 4UFDH 4JYVH 2AIQA 3M5OA 1O5EH 1P2MA 2WV5A 3U8RH 4AG2A 1ANDA 4XDEA 1GI2A 3A84A 5C1YA 3UNSA 3TGIE 5DP8A 5A0AE 1ZJDA 3SYJA 2XWBI 5DGJA 2VWMA 5DP5A 4NSVA 4B73A 4E05H 1GJ8B 4IC5A 3MO6A 1GJDB 2A7JA 3KNXA 2A4OA 2JH0D 5GPIB 3U28C 2RCEA 5JBCS 2TGPZ 1MU8B 4ZUHA 4KKDA 5T6FA 1A0LA 2GDEH 3GY3A 1P10A 4GHQA 1TNKA 1A2CH 1UTPA 1OYQA 1UHBA 4YLUA 1GBMA 1MH0A 1TGSZ 6GCHG 1OWHA 5CDFE 3M37A 1O3DA 4H6SB 3LGVA 2J38A 1C5SA 1BRBE 1SC8U 2DUCA 4ASUD 1SGCA 3E0PB 1GI7B 4MNWA 2HVXA 4WMFA 2EI6A 2H1UA 4WF8A 1W0ZU 3OAAD 5DP3A 3E3TA 4RT0A 1O31A 4Y71A 1C1RA 3BTWE 1SLWB 1L2EA 1GPZA 1LPKB 4O97A 2BB4A 2TRMA 3SU5A 1JRSA 3MU5A 3HKIB 1CA8B 2BVRH 1T4VH 2UWPA 4JZDH 3FFGA 2QA9E 3S69A 1M9UA 2SGFE 4X1QU 3D65E 3PRDA 1WQVH 4INHA 1UCYK 1BA8B 2WYJA 2A45B 1G32B 1GL1A 1OWDA 1EB1H 3FP7E 2YOLA 4AGJA 3O8RA 1XKBC 2WYGA 1FY1A 2CMYA 3TJVA 4UONA 1QHRB 1A3BH 1UVSH 2UWOA 4DOQA 1GHVH 1O5GH 3MNXA 2FI5E 2WPKS 4D7FA 1OP8A 5DP7A 2XBWA 2ZWLH 1TGBA 2GVFA 5DPAA 1E38B 2WZQA 2C93B 5A8YA 4MNYA 3S7HB 2SGEE 1AFQB 1IQHA 2BY8X 1RTFB 4NA8A 2VH6A 1GG6C 4WWYA 4DT7B 4TPIZ 5PTPA 2F9BH 2R9PA 1INCA 3NCLA 2OLGA 4Y79A 1NBME 3RMOH 4ACAA 1XUKA 1C4V2 2P3TB 4AG1A 3TJUA 2G00A 4ISLA 4AFUA 1EAIA 5SGAE 1YGCH 1ZMLA 4YM9A 3LU9B 1BOQA 1KXEA 3QGNB 2EEKA 4Y6DA 3A7XA 3FZZA 5JDUB 3V0XA 2ZFTA 2YMSC 3QTVH 1UVUH 4GCHF 3MQKC 1BTXA 3MOCA 1O2HA 1P01A 1C1SA 2LP6A 1BMNH 2H5CA 4E7NA 2M2AA 2XC0A 3IG6B 2FWWA 1UW7A 4X2XA 2OUAA 5A8ZA 4Z0KA 3OY5U 1SHHB 1ZMJA 3QK1A 5AVDA 1ACBE 1QJ1B 3K6YA 1O2MA 2G81E 1D3QB 3ZZ8A 5HMAA 1FNIA 3HATH 1WU1A 2TGAA 5K7RA 1MTVA 1TYNA 3RU4T 7GCHG 2PKAA 1AIXH 1GG6B 2H9EH 3VFEA 2V6NA 2RG3A 1Y3UA 1OP2A 2PTCE 2FOFA 1JRTA 3LIWA 3SJIA 3QZQA 3F2FA 4YLQH 4ZKRU 4GVUA 7GCHF 2W6ID 3KYFA 5KGOA 1YPHC 2ODYB 3URCA 3FANA 4CHAC 1U6QA 1NPMA 1AQ7A 1XUIA 1J9CH 1QZ8A 1GWAA 1BB0B 1MTNC 5FHTA 1ZRBA 1QQUA 1FY3A 3VG8A 1K1NA 1TGTA 1TMBH 3CS0A 3BG4C 2RFKC 2W5EA 1L0ZA 2VINA 1ZRKA 2BD2A 2BDAA 4BXWA 2C8WB 4XD7D 4MLFB 2BY9X 2XNIA 2FOBA 2G5VA 1DSTA 3H7OA 1ANCA 4GUXA 2ZU4A 2BDIA 4YO9A 3S7KB 2J34A 1RJXB 5IDKA 1P02A 1QY6A 2VB0A 1HFDA 1BITA 1LQEA 1P57B 1UO6A 4KTUA 5T6DA 1VGCC 2VWOA 2G55A 3UR6A 1C1MA 1SGIB 1CA0B 3OSYA 2WPIS 4AORA 2Z6BD 3LONA 1TFXA 3KGPA 1D6RA 1SGRE 4KGAA 3OFND 1V2QT 1BJVA 1P9SA 3MU0A 4K5ZA 4XBBA 1O3JA 1SL3A 2FX6A 4Y11E 1T32A 1FV9A 3L33A 1A0HB 2XW9A 3TH4H 3DFLA 1HCGA 4AFQA 3SGQE 1NRNH 5JPMH 7KMEH 1ZMNA 4ZHMU 4UFGH 5JBAS 1P2IA 2OXSA 4X8TH 2KCAA 1L4ZA 1GGDB 2OD3B 1YPMH 4INKA 4A5TS 2VIPA 1KTSB 2PP6A 2GT8A 4ZAEA 2FOMB 3BEFB 1LKBA 1SQOA 1AMHA 1LVMA 1NN6A 1SOZA 3KYGA 1V2WT 1GMDG 2QN5T 4FXGH 4CRCA 4D8NA 2FI4E 3ZV8A 1NBMD 1UVOA 2F9OA 1GCTB 1FUJA 2QF0A 3SHCH 1BMAA 2FOCA 1SGTA 4Z6AH 1Z8RA 3F68H 4A6LA 3TVJB 4F4OC 2Y7XA 3LPRA 1O34A 1G3EA 2GKVE 3FP8E 2M5TA 4CRGA 1SG8B 4OGXA 3TGJE 1J17T 4AGKA 2QYIA 2HPPH 5IK2D 3SU4A 4ZKOU 2EY4C 4FETA 3U9AH 3MU8A 1GMCF 3RXKA 6ESTA 4OS2A 1K1OA 1O3MA 2ZECA 4I8GA 2RA3A 1QL8A 2BMGB 4ISOA 3BTFE 2F9VA 4B2AA 1GGDC 2BLQA 2PWXA 5A09A 3PWCA 3O8BA 2F9PA 2A5KA 1GMCG 1W0JD 4B1TA 3GCHC 1WTGH 3BTDE 1JXPA 3RXSA 2ODPA 3SV9A 4CRAA 3BG4B 3ZZ6A 1F5LA 1NRQH 3ZVGA 1ID5H 3CNRA 1O2WA 2BDCA 4HFPB 2VNTA 4WH6A 2BXTH 4ABJA 1QTFA 1YM0A 3KIDU 1KLIH 1OS8A 1Y59T 1BTHH 4X8VH 5HM9A 1L4DA 3GYLB 3LH3A 1DXPA 3MNCA 1TPPA 3JZ2B 4LK4A 1UK4A 4A92A 1CA0C 4P02A 3LJOA 2H6MA 1SFIA 4CRFA 4MNVA 1TRYA 5EG4A 1YBWA 2F83A 2G51A 2ZDNA 1UTNA 1VCPA 4BAOB 1EJAA 1DUAA 1YPLH 1O2GH 2PUQH 3PTBA 3ZZ4A 1O2IA 1GCDA 3SUEA 1D9IA 2RDLA 1O2NA 5GDSH 1CGHA 1HAIH 4X1PU 1H8IH 1CT2E 2PKAB 3F0OA 3C1KA 2WINI 5C17A 1TX7A 3A8CA 2OTVA 5C2ZA 3PRBA 2O8WA 5FL7D 1WCZA 1O3HA 2CJIA 4XOJA 3BSQA 2W6JD 3BEUA 3CP7A 1C2DA 2GCTC 2J9NA 4INLA 4Q4LA 2BZAA 3SNDA 3PLKA 2XBVA 1FAXA 2KAIB 7LPRA 1DT2A 3KF2A 3ZZ5A 1O2JA 1A4WH 1QJ7B 1DITH 1CVWH 1NS3A 1AWHB 1K0HA 1KLJH 3RC4A 3O8CA 5DJ7A 1W0YH 3RC6A 4X6PA 2ZDVH 4JK5A 2C4FH 1EZUC 1W2KH 1ORFA 1BMLA 1P2NA 2J97A 4R0IA 1E1QD 2IJD1 3GCTF 1A46H 1MBMA 4ABDA 1DOJA 5DO4H 2ODQA 3QUMP 2F43B 1BCUH 1EZXC 3F9GA 4DURA 1HJ8A 5C67A 1MTNB 2O8TA 2H2ZA 1EQ9A 3PV5A 4YOJA 2OC0A 3U98H 4NA9H 2WUBA 3GCTG 1VR1H 3V13A 3NK8A 2ZGJA 4I8HA 1VJAU 4TWYA 1COWD 3TLOA 5TCAA 2JJ2D 2BD3A 3GCHB 1GHWH 1MU6B 2OQ5A 4X1NU 1O2ZA 2GCTB 3SJOA 1V2PT 5E2PA 2HRVA 4M9FA 3ZVCA 3ZV9A 1BJUA 9ESTA 4DGJA 4JZIA 3FP6E 3N7DA 2PGQB 1Q31A 1GJ5H 5F53A 1MTWA 1YPEH 4Q7ZA 1O2QA 1LHGH 1HAGE 3LT3A 4DJZB 1WDIA 3L3TA 1D3DB 1WAYB 3BTQE 4O3UA 5EJZA 1P09A 1GBTA 2FZZA 3MWIU 3RXUA 1FIZA 5CE1A 2ZHWH 2Z9JA 3MI4A 1P11E 5HGGA 2Q1JA 1XKAC 2Y5FA 4D76A 3M61U 2O8LA 4Z1MD 3EA7A 3BIVH 1O3FA 1YYY1 5DK1A 4FOUC 2GJGA 1KXBA 4NIVA 1P03A 1MKWH 3FOAA 4IMQA 1WOFA 1PJPA 2PSXA 2BYAX 1O5BB 6CHAB 1UTLM 3PROA 3P95A 2H9TH 4ESTE 3M3TA 3TK9A 2BD5A 3F6UH 2OK5A 4FUJA 2J98B 1TBQH 1VCWA 1DUEA 2NU2E 2W3KA 4CH2B 1UHBB 5T3HA 2XCFA 1Q2WA 3I29A 1GVLA 1FMGA 5C5NA 3ZVEA 2PUXB 3BTEE 4F48B 2VIWA 1C1TA 1V2KT 2L74A 2YNBA 3KEEA 4K3JA 3N99A 5FX6A 1GJCB 2AIPA 1K22H 2BD7A 1GBAA 3F9EA 4JCNA 5EQSA 3ZVDA 3S9CA 1EUFA 1YC0A 4Y8ZA 3SI3H 1ZGVA 4ZKNU 1TONA 1W7GH 1RD3B 1TE0A 2AS9A 2B9LA 3U69H 1G2MA 4Y0YE 4K8BA 1Y5BT 2PSYA 4F55A 2FYRA 1QQ4A 1O2PA 1VJ9U 2R2MB 3TITA 1G9IE 1HGTH 4TY7A 5TCCA 2VWNA 2OCVB 4I86A 2ZIQH 2Z3EA 3EA9A 5G4BA 3H09A 4UD9H 3Q3KA 1F0RA 2G4UA 1BRCE 2O8UA 2AGIX 4JZEH 3MO3A 2A7CA 3LGIA 3VEQB 3HK3B 1C1NA 1C5NH 3M35A 5E2OA 4DG4A 1PPEE 3MNSA 3IWMA 3LGUA 4H6TA 4IC6A 3GY7A 1ZHRA 3BF6H 1ZTKA 4LZ4B 1HBTH 4IN1A 2Z9KA 4X2WA 2I6SA 3KN2A 5E0JA 1LCYA 1XVOA 2GP9B 4LZ1H 4AYVB 5F6MA 3NZIA 2WSSD 2QCYA 3F2GA 1IQEA 1C5RA 3QWCH 4ABAA 2ZCHP 4FUCA 5JBBS 2IN2A 3P8OA 2B0FA 1HAZB 4K8YA 1V2ST 4GSOA 2ZFQH 4O3TA 4BANB 3MU4A 2PFEA 3RXBA 3PV4A 1EP6A 2HLDD 4ZCNA 3PMJA 2SGDE 2FIRH 2GT7A 3HPTB 1RFNA 5A0CA 1MCTA 4BAQB 2R2WU 4Y76A 3T27A 2R0LA 1DY9A 1P2JA 2Y5HA 2XNDD 2ILNA 1QL7A 5AF9H 1AZZA 3MFJA 3SQHE 2VIDA 2BDGA 3OEHD 1NFUA 2ZDAH 3MYWA 1GBCA 3UUZA 1NFXA 3ATMA 2WHXA 3RLWH 1O2RA 2ZDLA 1P2KA 5FX5A 1UCYE 3FAOA 1IQJA 2C8YB 3GCOA 3UWIA 4X1RU 4AB9A 3ZZ3A 3V12A 1BTYA 3VPKA 3A80A 1TRNA 3RXAA 2V3MA 3MU1A 1YLNA 3UY9A 4B76A 1C5MD 3NUMA 3RXFA 1YLDA 1NZQH 1C5YB 1O3PB 1BRAA 5J4QA 3DA9B 2V0BA 1BT7A 1RGQA 2KR7A 1FN8A 3A86A 2GGVB 3A81A 5A0BA 2ZU5A 1IOEA 1E0FD 1UMAH 4YESB 2ZDMA 3PO1B 3ZZ9A 3RXRA 1KDQA 3OTPA 1MBQA 1HAXB 2XC4A 3BG8A 4FUDA 2A4RA 4CHAB 4ABFA 2G52A 1AO5A 5KECA 1BTUA 1MUEB 1C2FA 1K1PA 5CHAB 3SO3A 2UUKB 2TGTA 3ODDA 2ZGCA 4TY6A 3L6PA 1GJ7B 4B6EA 5FBEA 2PHBA 4FUBA 1O0DH 4GCHG 5GNDA 1P2OA 1PQ8A 1S0QA 4U01A 1WV7H 1FZZA 3ZZCA 1W13U 2NU0E 5DG6A 1VKYA 2VGCC 3ZYEA 1N1LA 2EQNA 2ANKH 1ZPZA 3D49H 2FLRH 2D26C 4TT3D 1MAYA 1C5ZB 1S84A 2JH6D 3AK5A 1AU8A 5AFZH 2GV6A 1AHTH 2J95A 1J14A 1T8LA 1W11U 4CRDA 1ZPCA 5LH8A 2SGPE 1UTMA 1ABJH 1AE8H 1P3CA 1D3TB 3ZZDA 2VH0A 3UQOA 1GJAB 1TPOA 1C5QA 4I7YH 3NKKA 5JBTA 1HIAB 4RSPA
chains in the Genus database with same CATH topology
1V2TT 3QX5H 1GBEA 1F5KU 3TU7H 2D8WA 2NU4E 4YOGA 1ZLRA 1DDJA 5L2ZH 4GAWA 3STIA 3TNTA 1GI5A 1QFKH 1TWXB 2LNCA 4GLYA 2VGCB 3STJA 1C2GA 4MPVA 1HV7A 5C1XA 1SGFG 1V2JT 4AB8A 1PPGE 3SV6A 2XBXA 1C5OH 5A2MH 2JETB 1C2HA 1A5IA 3QO6A 2VVVA 1D3PB 1A61H 1B5GH 4FUHA 3UREA 4BAHB 5LPRA 2EI7A 4U30A 3SV2H 1GVZA 4LOYH 2CN0H 1O3OA 3RXLA 3EQ0H 3UOPA 3TGKE 4Q7XA 2ZKSA 2HOBA 4WXVA 4ABGA 1K1IA 1P0SH 1O2XA 3RLYH 3DHKH 1MKXK 3DUXH 3ENSB 5DP4A 4SGAE 1S6HA 4H4FA 3PMAB 1DPOA 3D23A 1EXFA 3ESTA 1UTOA 3F9FA 4HTCH 4A1XA 5EQRA 1P9UA 2R3YA 3BEIB 2ZG0H 4X0WU 2F9UA 1OWIA 2FTMA 3T25A 4TYDA 5GJ4B 2BQ6B 5E0HA 3MH7A 5ETXA 1OPHB 2ALPA 5HXFA 1G3DA 1S82A 2IOTA 2WUCA 3M3VA 2PKSB 1TA2A 1E37B 1RXPA 1TMUH 1TPAE 1JBUH 2FEQH 3PLBA 1TLDA 4NG9H 2FI3E 1JMOH 2Y82A 3AAVA 3M5LA 1IHSH 1TRMA 3MH6A 1EJNA 1EPTB 1MD7A 4U32A 3LJJA 1LHCH 1QRXA 3RM2H 3UOUA 4LXBH 3AASA 1ETTH 3F9HA 1LHFH 4UFEH 3NWUA 4NWLA 2ZPQA 1FPCH 3K9XB 1S81A 3KL6A 4FU7A 3E6PH 2F9NA 1TQ7B 2Z94A 2UWLA 3A7ZA 1AFEH 1ZZZA 4DW2U 1GL0E 1A5GH 4K1TA 2UUJB 5B6OA 1H9LB 3SGBE 4OS6A 1E35B 3VB6A 2VWLA 1UK3A 4FU9A 2ZFRH 1W10U 4XFQA 4WY3A 2OC7A 1NU7B 1NC6A 4I31A 1ELDE 3RXEA 1C1PA 2A4QA 2ZFFH 3TNSA 1HLTH 2HWLB 3LC5A 2G4TA 4D9RA 2VIVA 1A5HA 6LPRA 1BHXB 3T28A 3GY6A 1GBIA 2BOKA 2J94A 3UWJH 1AGJA 1OX1A 8KME2 1JIMA 5FAHA 2QXJA 1V2RT 4IGDA 1OKXA 1QNJA 1IQKA 4ABBA 3TIUA 1DM4B 4BAMB 1K28D 1F7ZA 1AZ8A 3SU2A 2I6QA 4DIIH 2ZNKH 1H9IE 5DKMA 4H42U 1EKBB 2CHAB 3SUFA 2ALVA 2ZC9H 4NZQA 1C1UH 1UTQA 1YP9A 2HALA 3M5MA 4JZ1A 3VB5A 1GBFA 1GHAG 2R3UA 5DP6A 3SOSA 2EC9H 3A7YA 4NSYA 4IBLH 1W3CA 4UDWH 1KXAA 1J8AA 2Q6GA 1ESTA 2BTCE 1ZHMA 3E8LA 3GYMA 1SGYE 4TPYA 5LPFA 1MZAA 1MD8A 1C5TA 1SGDE 4OS7A 2RA0A 1W8BH 1BDAA 1OWJA 3A89A 3BTME 4ABIA 4KELA 1SGPE 2DE9A 1GCTC 3RXDA 4YZUA 3UQVA 1OWEA 1TNJA 3PMBB 4DY7B 1SHYA 2W26A 1XUJA 3LGWA 1GDQA 4DIHH 2GMTB 2WPHS 1KSNA 2J2UA 1ZTLA 3K6ZA 1QA7A 1BBRH 1K1JA 2GTBA 3SZNA 2CHAC 2GX4A 2BXUH 1K1MA 1UVPA 3UNQA 2ZU1A 1TAWA 2AH4X 4AZ2B 1Y5AT 3EYDA 1FN6A 3I77A 3PYHA 1Z7KA 5GCHG 1PPCE 2ZU3A 3GY2A 3KQBA 2ANYA 3B23B 4ZHLU 1K2I1 1GBKA 1CT0E 3RU4E 3SGAE 3RMMH 1MQ6A 5EOKA 1GBHA 2CF9H 2HLCA 2JETC 3Q77A 5GCHF 3OTJE 2Z9IA 1WSSH 4CRBA 4WVPE 4E7RG 1O30A 1SLVB 5A8XA 2ZQ1A 1CSOE 2QF3A 1LKAA 1EAXA 2OBQA 1O2KA 1O38A 4BTUB 1ZOMA 1BBRE 3RXPA 1C5UA 4Q80A 2BQWB 1LVBA 4VGCB 4SGBE 2FS9A 2Y80A 4J1YA 2ZTXA 4D9QA 1SI5H 3TH2H 1QRWA 2A32A 2JH5D 5CMXH 3SJ9A 2ASUB 1EZSC 4AYYB 3A8DA 1YCPK 1XM1A 2Y5GA 3EAJA 1K1LA 3ATIA 1FDPA 2ULLA 1SMFE 4X6MA 1FAKH 2FTLE 1OOKB 4K1EA 1RTKA 1O5FH 4OS1A 1HDTH 2GZ7A 3FVFB 1ZSLA 5H4IB 1ELFA 1LPZB 3CS7A 3BTGE 1O3NA 1SQAA 3SN8A 1THRH 1O2SA 3KQDA 1ETRH 4BTIB 4Q2KA 5E8EH 2Q6FA 1TNLA 1GI0A 1W12U 2FMJA 1B0EA 2NWNA 2UUFB 4ZKSU 5BPEA 1P2QA 3E91A 4OS4A 4ZH8A 1ESAA 1V2UT 1NM6A 1VGCB 2FESH 2PGBB 1QR3E 3ZZAA 2P8OB 1AE5A 1QBNA 2QXIA 3TK5A 4KTSA 2W3IA 3ATWA 3Q3YA 1BHXF 3HK6B 4THNH 5L2YH 1PPHE 1KYNA 1EAWA 1PQ5A 2FOAA 5FBIA 1O3IA 1F5RA 3OX7U 3ZZ7A 2FM2A 2CV3A 2GD4B 1XUFA 1GI9B 1DXWA 2C8ZB 4OGYA 3IITA 2BQ7B 1LO6A 1S0RA 2J4IA 1Z1IA 2FOEA 3T5FH 2BZ6H 4MDSA 4PROA 1UTKA 1P8VC 1TA6A 7ESTE 1SGFA 1SOTA 1RS0A 1WTHD 2HNTE 3Q00A 5F8XA 3AAUA 2Z9GA 1NESE 1C1OA 2OP9A 3E1XB 2P8OC 1V2NT 1ELAA 3SI4H 1EJMA 4MNXA 4MPWA 4IN2A 5LGOA 4UFFH 3P70B 4CH8B 3GY4A 2ZZUH 4Y7AA 1ZR0A 1DWDH 2BX4A 1F0SA 2BLWA 1H8DH 1F2SE 3A7WA 3BIUH 5AFYH 1ELGA 1Y3XA 3A83A 2BDYA 1EOLA 4K60A 2GDDA 3A87A 1C9TA 3P92A 1NU9A 1SQTA 3U1IB 4FU8A 4UEHH 3ZZBA 1ZSJA 3LH1A 3KQEA 2AERH 3A88A 6CHAC 1S83A 2TIOA 1HAVA 3K65B 1MKXH 2FO9A 2G5NA 2FPZA 2TBSA 1AVGH 3AVZA 2BD9A 4AOQA 2R0KA 3T2NA 4ZXYH 1FPHH 1BIOA 2ZP0H 4DCDA 4R8TB 1Z6EA 4ASHA 1HAYB 3PB1E 1C2LA 2ZCKP 2ZCLP 1V6DA 1H9HE 4ABEA 2OC1A 1EX3A 1FJSA 2AYWA 4FVBA 1GBBA 4YT7H 8GCHF 1BTZA 1C1QA 1KXDA 3NPSA 3RMLH 2QC2A 1QIXB 1FQ3A 1VITG 2ZU2A 1AY6H 1EAUA 2FX4A 3Q3XA 3OY6U 1IQMA 3RUOA 1UJ1A 1Q3XA 4NA7A 3S9AA 1GDNA 1YCPH 1C4U2 1VITH 2ZI2H 2VVUA 3RXTA 1VITF 3SNEA 1FI8A 1V2OT 1A1RA 1A0JA 2SNWA 1HPGA 3T26A 1TOMH 2V35A 2Y81A 1CO7E 1SGNE 3VB3A 3U1JB 1O3CA 1SGQE 1PPFE 2ZHEH 1AB9B 4NCYA 2XBYA 2ZO3H 3SV8A 5GXPA 4VGCC 1CU1A 2BLOA 3A82A 3ITIA 2HNTC 3LKWA 4X6OA 2ZTZA 1S85A 3E90B 1AUJA 1TBZH 1PQ7A 3PMHB 2W7SA 2A31A 4WMEA 1O3EA 1PPZA 3DFJA 4FUIA 4JZFH 1G3CA 2QAAA 1AWFH 2PW8H 1T31A 1MTSA 2WPJS 2ZA5A 2F3CE 1C5XB 3NXPA 1DWCH 3W94A 1N8OB 1QCPA 3A8BA 4RKJB 3SBKA 2D1JA 2CF8H 1ZSKA 3KCGH 1AI8H 1DX5M 2A5IA 3RXVA 2AMDA 4Y10E 1O2LA 3P17H 4RN6A 1KXCA 1VZQH 5FCRA 1E34B 4MTBA 3QN7A 2D2DA 3V7TA 3EDXB 3SUDA 1C5LH 4BNRA 1FXYA 1LPGB 1RTLA 3H7TA 3LOXA 3KQCA 3MO9A 4AFZA 3GICB 5EU8A 2FODA 3P8GA 1A3EH 4TWWA 5FXLA 1WQSA 2VU8E 2VIQA 1LMWB 4X2VA 1O2UA 2ZFPH 1V2MT 1UVTH 1AFQC 3I78A 2WV4A 1O32A 2BX3A 3LDXH 3H5CB 2WPLS 2P95A 3UNRA 4B2BA 1L1NA 2F91A 4GPGA 2HPQH 1TGNA 3RXIA 5F8TA 2AFQB 1Z8JB 2BDBA 1MKWK 3ZVFA 3P8FA 2ZEBA 1A7SA 1IQLA 1DFPA 3EA8A 3Q76A 4AFSA 4HGCA 3O8DA 1KTTB 3TPIZ 1AKSA 1GBDA 2PR3A 1QB9A 2BHGA 2BVXH 1Z8GA 1NFYA 3EGKH 3TH3H 2QY0B 1T8NA 1MCVA 4X6NA 1ZGIA 4YOIA 2SGAA 1PFXC 1KLTA 1F0UA 1RIWC 3RMNH 1SLUB 2XWAA 6GCHF 5FCKA 3B9FH 4BTTB 1C4Y2 5F8ZA 3QGJA 1GBJA 3SNAA 1ANBA 1GI8B 2IJOB 2Z3DA 3UFAA 2OINA 1PYTC 1SBWA 4NZLA 2THFB 1EP5A 2VIOA 1QRZA 1SB1H 1TNHA 4WJG2 1BZXE 1H4WA 5C5OA 1P06A 2ZGHA 1AVWA 1EATA 3ATLA 1C5WB 2Q6DA 2NU1E 1LVYA 2A1DB 3A7VA 1DWBH 3M5NA 2Z3CA 3S9BA 5ESBA 2XCNA 1Y3VA 4BAKB 1FLEE 2QGRA 3SU1A 1YCPM 1ELVA 1CHOF 1CQQA 4BXSA 1B0FA 4JYUH 5L6NH 2QV1A 2A2QH 4K2YA 1F0TA 1LHDH 1GHZA 3GISB 4B74A 1YPHE 3ZYDA 1HNEE 2PV9B 5EXNA 1QBVH 1T4UH 1CBWC 1ABIH 3SU3A 2ZHFH 1CHOG 2ZHDA 1KY9A 1J16A 5C20A 1LDTT 4K69A 2H9HA 1TBRH 3SNCA 1BTPA 1ARBA 3U8OH 1BRUP 2C3SA 1C2EA 2ZPSA 4CR5A 2ZFSA 3SU6A 3BTKE 1N6YA 2J92A 1O37A 1CHGA 2XC5A 2ZGXH 3SU0A 3ATKA 1X7AC 3VB4A 4A7IB 5GWZA 1MTUA 4ZMAH 2P59A 3RDZA 1HAPH 3VB7A 1P12E 5GIBA 1MMJN 2BY6X 4NWKA 2FLBH 1O3LA 1WUNH 2ZGBH 3CENA 1ANEA 1GJBB 5JYIA 4UE7H 2BD8A 3E16B 3GY5A 1NY22 1OWKA 4B75A 4KP0A 3A85A 4QT8C 1SGEE 1TGCA 1FY5A 3UR9A 2BY5X 3HGPA 1DLKB 2PTNA 3K2UA 4D7GA 2BOHB 2P3FH 4KTCA 1TALA 3PTNA 5LPEA 3S0NA 1Z71A 3MTYA 4FUFA 4FVDA 3URDA 3KHVA 5I25A 1CGIE 2BDHA 3GDUA 3QTOH 4NGAH 4Y7BA 1NRSH 1AUTC 1O2OA 5E0GA 3A7TA 2Z9LA 4MG3A 5DP9A 1TABE 1PPBH 1GHAF 3RP2A 1GMHF 3UTUH 1B7XB 1C2MA 1UCYH 1DLEA 1ETSH 1HJAC 4Q7YA 1IQGA 3SORA 2GCHF 1YKTA 4ISNA 1L1JA 1C1VH 1XX9A 2A7HA 3SNBA 3M36A 4Y8YA 4BOHA 1C5PA 3ODFA 1GMHG 2ZHQH 3M7TA 3GOVB 1OXGA 5EW2H 1SPJA 4X8SH 2ZPRA 1HUTH 1G3BA 4XE4A 3P6ZB 1YPJH 5K0HA 1C2KA 3PWBA 2GCHG 1DICA 2V3OH 1G2LA 4ZROA 1XVMA 3TK6A 1FONA 2CXVA 2CGAA 3HKJB 2XYAA 4GHTA 1CE5A 1N8OC 1TX8A 4O9VA 3T62A 1DS2E 4B2CA 1TIOA 2Y7ZA 1L1GA 2P94A 8ESTE 3GDSA 1NRRH 5ESTE 1O3KA 3AW0A 2EA3A 1MZDA 1CGJE 2B8OH 1UTJA 1TMTH 2Y6TA 1BMMH 3N7OA 3QDZB 2BLVA 4WMDA 1WBGB 1XXFA 1HJAB 1Y8TA 1NROH 5F03A 1JOUB 5FPYA 1AB9C 9LPRA 3UIRA 3MH5A 2AEIH 1O5DH 1FY4A 3R3GB 3M7QA 1TPSA 1C1WH 2DE8A 1NO9H 2P93A 2ZTYA 4I32A 1Z8IB 4IW4E 1MAXA 2ZF0H 4K1SA 1S6FA 2SGQE 1P3EA 2A5AA 1O2VA 5FPTA 1FIWA 4YT6H 2VJ1A 3BV9B 1S5SA 1NTPA 1THPB 2HGTH 1QA0A 1ELCA 1SFQB 1SVPA 1ZYOA 1GHXH 4U2WA 5HM2A 4NIWA 4AN7A 3AW1A 1ELTA 1HAHH 1OSSA 2AGGX 1SLXB 2KAIA 1RIWB 1GI1A 2ANMH 1IQIA 1KXFA 3RC5A 4I8KA 1TNGA 3GY8A 1IQFA 1PQAA 1ZJKA 2GV7A 1QURH 1K21H 1GMDF 3RXJA 4OS5A 5EXMA 1D6WA 2FXRA 1EPTA 1T7CA 1XMNB 2BD4A 2NU3E 3VGCC 3RXQA 2G8TA 1O39A 1Y3YA 1LVOA 4E06H 1TB6H 3MH4A 4X2YA 5EQQA 4NFFA 4I8LA 1GI6A 1HRTH 3D62A 4O03A 1DY8A 2A2XH 1HJ9A 1MQ5A 5EXLA 1G36A 1V2VT 2XTTB 4JYTA 2A0QB 1AD8H 5EW1H 1GI3A 2TPIZ 3EE0B 4X1SU 1V3XA 1Z1JA 1C9PA 3ZVBA 2QXGA 4Y0ZE 2BVSH 2LPRA 2GZ9A 3LGTA 4NIYA 3V3MA 2ZQ2A 1FY8E 1TNIA 4I33A 1BBRK 2O9QA 1LHEH 2JKHA 5TJXA 3TJNA 3SHAH 1LTOA 4XBDA 2AGEX 2ZDKA 4RKOB 5L30H 1W7XH 2FP7B 5EGMA 2OQUA 2P16A 2QIQA 1G30B 2HNTF 3VGCB 2Z7FE 5AHGH 2FS8A 2C90B 2ANWA 1P04A 3RU4D 3UPEA 1XUGA 1DWEH 1BTWA 1IAUA 1DVAH 2FOHA 1C2IA 3SQEE 1NFWA 1O35A 3SW2B 1O5CB 4NIXA 1EZQA 1EOJA 2ESTE 4JK6A 1E36B 1NRPH 2PKSC 4WXIA 1ZHPA 1HB0B 3TJOA 1YPGH 1O5AB 3RXCA 1DE7H 1UK2A 2A4GA 3R0FA 1HIAA 1ESBA 4Y8XA 1C5VA 1J15A