1AUJA

Bovine trypsin complexed to meta-cyano-benzylic inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title New inhibitors of thrombin and other trypsin-like proteases: hydrogen bonding of an aromatic cyano group with a backbone amide of the P1 binding site replaces binding of a basic side chain.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA02
1S0QA 2FS9A 5E0JA 4H4FA 2OTVA 4WH6A 2A32A 3A8CA 3M7TA 2SGDE 1S83A 2VIPA 3M5OA 1ARCA 1TA2A 5EODA 1CSOE 1GGDB 5TJXA 3M3TA 2SGFE 1KSNA 1D9IA 3LGVA 4ISNA 3UOUA 2ZU5A 5AFZH 4I8HA 1ETTH 4ABFA 4WH8A 8GCHF 3M61U 2UWOA 4O3TA 5J4SA 1O2PA 5FHTA 1Z1JA 1RIWB 1HAHH 2JKHA 3O8DA 3VFEA 4IN1A 1CGHA 4OGYA 4I31A 1V2LT 1GBBA 1PPHE 5H4IB 2XBWA 1K2I1 1TQ0B 3OU0A 4JCNA 3T62A 4U32A 7GCHF 2QXHA 2XWAA 3DFLA 4BOHA 1O3OA 1HAOH 1SGYE 4AYVB 5F6MA 1JBUH 1GG6B 2TBSA 1FNIA 1ETSH 2NU0E 4HTCH 4VGCB 5EQSA 1GBCA 1AHTH 1GGDC 1U6QA 2P16A 1DITH 2FODA 5F8TA 1SGFG 1P3CA 3ZVGA 3KL6A 4NA9H 6ESTA 2ZIQH 1SOZA 1BB0B 1O3IA 1YPEH 2OC0A 2J94A 1FN6A 5JBBS 1RIWC 1ZSLA 6CHAC 3PMBB 1H9HE 3CP7A 3LGIA 2XC0A 3SV2H 3ODDA 2B8OH 3DHKH 2O8WA 2CN0H 1ELAA 3QX5H 1VITH 1MTWA 1TMBH 2Y5FA 3TGJE 2ZDKA 4LOYH 2EI8A 2WYGA 5EW1H 1EZUC 1TRNA 5FPYA 1OYTH 2Q1JA 4ABAA 3C27B 4DIHH 1NY22 1GG6C 2ZDAH 1G9IE 4MNYA 1FIWA 2ESTE 1THRH 1AY6H 1O0DH 1K9OE 3HKJB 4GHTA 1KY9A 1ANCA 4THNH 5SGAE 4JZIA 3AW1A 2SNWA 2RDLA 2PGQB 1SR5C 1ZHRA 2XTTB 2R2WU 4ZKOU 3E90B 4XOJA 4YT7H 4KTUA 3S69A 4WXVA 4AFZA 2PR3A 1IHSH 2XXLA 3A8AA 2FTLE 1G2MA 2OUAA 5TCCA 3NPSA 1JMOH 1C5MD 2NU4E 1VITG 3FAOA 1ZRKA 2BXUH 3NZIA 5E2OA 2BLQA 1GHAG 1UHBA 5IDKA 3VPKA 1MTNB 1F0TA 3QDZB 1VGCB 1XMNB 4RKJB 2ZFRH 1XX9A 1BMLA 2A4OA 3ATIA 4Z6AH 1SLVB 3RM0H 2PUQH 2H5DA 4U01A 4Y8ZA 2GZ7A 3L33A 4NGAH 2XCFA 5AVDA 7ESTE 1O2SA 1TNHA 3RXDA 2A5AA 1SI5H 4GAWA 3E8LA 1J14A 1FPCH 1MU8B 1LHCH 2XRCA 2BVRH 1UVPA 1FY3A 1NRPH 1GI3A 3VB7A 1GJ4H 3RDZA 4I32A 3HGPA 4ISHH 2W26A 1HAGE 2GVFA 4FVBA 2VH6A 1O3NA 1MTNC 2FLRH 1NRSH 2BDYA 3BN9A 2XNIA 3QZRA 1VGCC 2ZHFH 4UFFH 3RXCA 1GI5A 1O3MA 4B2BA 3LPRA 3LC5A 1ZGVA 2BDAA 3F9FA 3LOXA 1QL7A 4I8GA 3QK1A 1ZTKA 5DP6A 2V3OH 4CH8B 5HYOA 2FIRH 1IOEA 1WBGB 2A5KA 3SW2B 1O32A 3V3MA 3BG8A 4WXIA 1P57B 3T29A 2ZDMA 3E0NB 3HK6B 1A0JA 1BHXB 4ZXXH 1DWDH 4I7YH 4O9VA 3A8BA 1JOUB 4FUIA 1GI4A 3V7TA 4DY7B 2ZQ2A 3GY7A 3Q00A 3E91A 2K1QA 1SGQE 5EXMA 3H5CB 2ZFTA 1LPGB 1NO9H 2Q6DA 3UNQA 3BIVH 3AW0A 2VGCB 4B75A 4SGAE 2BB4A 4WMDA 4A7IB 2G52A 1BTUA 2J92A 1S0RA 1XXDA 1OWIA 1OWEA 1LHDH 3LGYA 4ZKSU 1IQNA 3C1KA 1S85A 2GDEH 1Z6EA 2D2DA 1DDJA 1FDPA 2ZPRA 1UHBB 2I6SA 4NG9H 3RU4E 1QJ1B 4Q7YA 2LNCA 1QL9A 5FPTA 2UUYA 1GHBF 1GBAA 2ZGBH 4GPGA 1BTZA 1MKXH 1YPGH 4KP0A 5A8YA 4B2CA 1OX1A 3A7YA 4OS1A 1G37A 3Q77A 1Y5BT 2H9EH 4IBLH 4AB8A 3M5NA 2W3KA 1K1IA 1HJAB 4OS4A 3S7HB 1QBNA 3MH6A 3M36A 4K1SA 1ZTJA 4BXWA 2BVSH 3TH3H 2G5VA 4IC5A 3L6PA 3QUMP 4XBDA 3VEQB 2FM2A 1EX3A 3S0NA 4AGKA 3KN2A 3M35A 1GMCF 4OS5A 5DJ7A 2BD4A 3E6PH 3QGNB 1N8OB 1UTNA 2OC7A 2XW9A 1WTGH 3EQ0H 1GMDG 4NWKA 2J4IA 1XUKA 5A0CA 4ISOA 2BY5X 1E0FD 2R2MB 3BTGE 4D76A 1GI0A 1SGTA 4ISLA 2BX4A 4ZROA 3BIUH 5C1YA 1SLUB 1G2LA 3ATKA 3LKWA 3ZYEA 2AMDA 4BAKB 4I8JA 2ZDLA 4A6LA 5C5OA 1V2NT 4OGXA 1CHGA 1S81A 1SGDE 2TGAA 2BHGA 2OCVB 3MU1A 1F0SA 1TNGA 5CHAB 3RLWH 1P11E 1SOTA 1V2JT 1AUTC 2A2XH 2OP9A 1N8OC 4X1PU 2AS9A 2BDIA 3SGAE 1HIAB 1E35B 5JYIA 5HXFA 1SFIA 3UR9A 2H9HA 1QCPA 1NU9A 4E7NA 2BZ6H 2SGPE 3CENA 4AX9H 3NKKA 1FY4A 3Q76A 2OINA 2VIQA 1O2IA 2HOBA 3VB6A 2D8WA 1ZZZA 1GI1A 2PUXB 4NSVA 1TX6A 3U8OH 1WQVH 2RA3A 4MPUA 1QIXB 1LCYA 1T31A 2FS8A 3QN7A 4Q2KA 1YYY1 3FVFB 3U1IB 5HM9A 3HKIB 5E8EH 3SJ9A 1BTHH 3BTFE 1J9CH 1MBMA 1P9UA 5CHAC 1P06A 2VWOA 2V6NA 1C2FA 1QY6A 3MH5A 1QL8A 1TQ7B 3DUXH 5GPIB 2PGBB 3SQEE 2ZHEH 1RFNA 2VH0A 4JK6A 4INHA 3VXEH 1O2QA 1TIOA 2Q6GA 1SMFE 4NFEA 1NS3A 4NZQA 3STJA 3RXGA 1P2NA 3SJOA 1YLCA 1KLTA 1KXCA 1TPOA 4YZUA 1EJNA 3LJOA 4B74A 1EUFA 4K1TA 3TIUA 1A61H 4HZHA 4D9QA 3T25A 2VVCA 1B0EA 2O8TA 2AH4X 5A0AE 3SU3A 3U8RH 1ZSJA 1ZJKA 1DUAA 3KIDU 5DG6A 4ZHLU 1ELVA 3SNEA 1EXFA 1RGQA 1W8BH 1Q31A 3G01A 1TPAE 1O34A 1P03A 1SGEE 2XC5A 2OQ5A 2TGTA 3OSYA 1FLEE 4HGCA 3VB4A 4Q80A 3PWBA 3KQBA 2BLVA 4ABHA 1C2JA 3URDA 2HALA 3BTME 2P8OB 2ZHDA 1O5AB 1GHVH 1F92A 2EC9H 5LGOA 1L1NA 4JYTA 1A5GH 3K6YA 4D7FA 4NIVA 2GCTB 3OX7U 4B2AA 1LQEA 1QQUA 3TH4H 3ATMA 3K6ZA 1HAYB 5A2MH 4CBOA 2BQ6B 5HGGA 1SGCA 4BAHB 1WV7H 3F9HA 3UQOA 3O8BA 1CT2E 2GT7A 5ESBA 1P04A 3PMJA 5GCHG 4J1YA 8LPRA 2J34A 1OKXA 4AFUA 1ZRBA 2SFAA 3SJKA 1P2QA 3A82A 3MNXA 2FMJA 1A0LA 3BTHE 5JBAS 4U2WA 1Y3WA 1Y3VA 2QY0B 3GDUA 3QZQA 1QFKH 1FY1A 3IWMA 1C5WB 3SJ8A 4AZ2B 1P01A 1DICA 1P9SA 1ZMLA 1TOCB 1W0YH 2GCTC 1GJ9B 1AVWA 1BHXF 1O2LA 1AQ7A 3RMMH 4K8BA 2R3UA 1C2HA 2FXRA 1C1PA 1GI8B 2W3IA 5FX6A 3FP7E 3QTOH 1AKSA 1MTVA 2UUFB 1ZYOA 1C5PA 1KXFA 3V0XA 4YLQH 1TOMH 4Y76A 1DE7H 1W3CA 2JH6D 5BRRE 1Z71A 4O3UA 2VWLA 1G30B 3MMGA 3MU0A 4BAQB 1G32B 1XUIA 2P94A 4GCHF 3RC5A 3MO6A 1SQOA 1DY8A 1C4Y2 3HATH 4Y8YA 4DURA 4CRGA 5JB9S 3HPTB 3ZZ4A 3TNSA 5LPFA 2NU2E 2I6QA 3FZDA 3BEFB 3UPEA 3TPIZ 1PFXC 1NFXA 3E3TA 3F6UH 2WPJS 1QTFA 1A1RA 4A1VA 1GJ7B 4OS2A 5AHGH 1SQTA 1QGFA 3FP6E 3TLOA 3SNDA 1EPTA 2H1UA 4AGJA 1DT2A 2EI7A 2YNAA 1BZXE 5EGMA 3GY4A 2O9QA 2P3FH 1KLJH 1MKWH 5GDSH 1TFXA 3NCLA 1PJPA 1C5NH 1ZPCA 3UY9A 1GCDA 3ATLA 1GDQA 1G3CA 3KEEA 1ACBE 1C5QA 3TJOA 1EQ9A 1HAVA 1SLWB 2HPPH 1MKXK 1HAIH 2F9VA 5C5NA 1CHOG 1O2TA 1CT4E 3A84A 3HK3B 1HAXB 4X6PA 1GL0E 1GL1A 3MU5A 1AD8H 3BTEE 1HXEH 2SGQE 1V6DA 1TBQH 1XKBC 5E2PA 1TBRH 1Y3YA 1LTOA 2XBXA 2ZQ1A 4CRBA 1FN8A 5EOKA 1C2LA 1Z6JH 2P95A 2IN2A 4ZHMU 1UVTH 1ZLRA 2AGIX 2OBQA 3ZVBA 4E7RG 4JMYA 3UUZA 3E16B 1PPCE 2AGGX 3EDXB 2Y6TA 5JBCS 1YP9A 4KGAA 1GJDB 4K3JA 3P8GA 4E06H 2A31A 1PPFE 4X2XA 3BF6H 3K2UA 3RXFA 3KCGH 1ABJH 4YOJA 2ULLA 4BXSA 1HDTH 2FDAA 3MWIU 3P70B 1GHWH 2CHAB 1WSSH 1GMHG 4BAMB 2FOHA 4AORA 1KXDA 1QBVH 1V2KT 2Z3EA 2WYJA 4ZXYH 2WUCA 5T3HA 3ZYDA 1TGSZ 5DP7A 2HWLB 4XDEA 1P2IA 1O5GH 3M7QA 3U8TH 1O36A 3SUGA 2GKVE 3MNCA 3MU4A 1A2CH 1TGTA 2GD4B 3MNBA 1BTYA 3PM3A 5A0BA 1C1WH 1B0FA 1T32A 1LHFH 1UK4A 3T2NA 3W94A 1FY8E 3T26A 2A2QH 1ELEE 1ESTA 4ABIA 2NU3E 2CHAC 1FJSA 3A7WA 4WMEA 1D3QB 4BTUB 1AE8H 1O3FA 3BV9B 1EPTB 4AB9A 1EP6A 1EP5A 2GZ8A 2PKAA 3UOPA 1Y5AT 1GI2A 1ARBA 1UK3A 3ESTA 4FU9A 1J15A 1VCQA 1QQ4A 3BTKE 2ZU1A 1BJVA 4DW2U 5C1XA 1O2HA 4ABBA 2GDDA 1BIOA 1JWTA 1P02A 4JZ1A 4VGCC 3PMHB 3EGKH 4FUGA 3UNSA 2G55A 3Q3YA 3S7KB 1QRWA 5DP5A 3LJJA 3ZZ3A 1ZSKA 3SV7A 4DOQA 1HV7A 1PQ8A 1YCPH 1ZR0A 1GI6A 1HJ9A 1A4WH 2H6MA 1D6RA 4FUEA 3TGKE 2OD3B 1V2VT 2Z9KA 3RXSA 1IQJA 1NC6A 4TPYA 2QYIA 3UWIA 1SSXA 3F1SB 4RN6A 3PTBA 2FOAA 2P3TB 3EA7A 3RXKA 4I8KA 3NK8A 1O2JA 5EPNA 2UWLA 2ODQA 3P95A 2FOFA 1W7GH 2CGAA 4H6SB 1QJ6B 1UVOA 1OP0A 1D6WA 3UREA 2WPLS 3SU2A 1P05A 3RXIA 6LPRA 3TGIE 1P8VC 2Z9GA 1VCPA 1DWEH 2HLCA 1ELFA 2G8TA 1BCUH 1GBHA 1GJ5H 2VJ1A 2IPHA 3TITA 1XUJA 1LDTT 2Z3CA 1BITA 1IAUA 2ZG0H 5G4BA 1KYNA 1NROH 3GYLB 1S84A 1OP8A 4NFFA 3MO3A 4DCDA 1T4VH 1K21H 4WVPE 8GCHG 1FY5A 2H9TH 1A0HB 3URCA 3OY5U 2O8LA 3ZVDA 2NWNA 3RXMA 1TNKA 1VJAU 4ZHAA 4Y7BA 4UFDH 1NT1A 1Y8TA 3GICB 1ELBA 4WWYA 1DWCH 1UVSH 4TPIZ 1C5ZB 4YOIA 1V2PT 2QXJA 3RXAA 1Z8RA 4JYVH 3PO1B 7GCHG 1O2ZA 1GBTA 2O8MA 4DGJA 1BQYA 3SQHE 2A0QB 3A88A 1YCPM 3KQEA 2FEQH 1O37A 4R0IA 1W12U 3EA9A 4XFQA 1F2SE 3I77A 3PLPA 2BDGA 5C3NA 4CRFA 4BTIB 5L30H 2WPIS 5T6FA 1TYNA 3ZZDA 1H8IH 1FUJA 2G51A 2A1DB 4WJG2 3KQDA 3I78A 3ZZ9A 4MQAA 5FBIA 1FMGA 2BDCA 3SU6A 1Y3UA 1LPKB 2HVXA 2KAIA 2ZDNA 1SHYA 1O2KA 1O5EH 4KTSA 4PROA 2QV1A 2QF3A 1XVMA 5DK1A 3PO1C 4A1TA 3BTTE 1TRMA 3S9BA 5EG4A 1MTUA 3RXOA 3DFJA 1SB1H 2XBVA 4H42U 3ZZ7A 2W7UA 1NRNH 1WYKA 2QXGA 1F5LA 3AAVA 1GBMA 2HGTH 2G5NA 3TK9A 2ZGXH 2Z7FE 2BD7A 2P3UB 1MKWK 1O2GH 3M3SA 1QB1A 1EZSC 4QT8C 1SGNE 3TH2H 4XE4A 2QGRA 1VJ9U 4UDWH 4XBCA 1GDUA 3LIWA 1UK2A 4INLA 1YPMH 2A5IA 1M9UA 4RSPA 3RXPA 1AO5A 4MDSA 1MZAA 1KDQA 4ZKRU 1PYTC 2ZNKH 2FYQA 1FONA 3FZZA 3KF2A 2ZZUH 4H6TA 3RLYH 3N7OA 1UTMA 1UVUH 3D65E 3RXHA 3TJUA 1S82A 2SGEE 4Y0ZE 4A1XA 3V12A 4AYYB 1MD7A 2VGCC 2DE9A 1MUEB 4FUDA 3SU5A 2ZU4A 5CE1A 3GCTF 3A83A 1LKBA 5PTPA 2A7CA 3ZVAA 1ZJDA 3P6ZB 2Z94A 1HYLA 2G4UA 4WF8A 1WOFA 1GJ6A 3ZZ6A 4AFQA 1O3HA 1XXFA 2ZHQH 3QWCH 3R0FA 2ZEBA 1TMUH 3LDXH 1AZ8A 3H7TA 1WTHD 1Z8JB 1GCTB 3SGQE 3SHCH 4CBNA 3RXRA 1SFQB 1TMTH 1C5LH 2QA9E 1N6XA 1TPSA 4BANB 2AMQA 1F5RA 2VVVA 3P8OA 1HJAC 3ELAH 2W5EA 2FI4E 2FOBA 6GCHF 1NM6A 4JK5A 1Z8IB 9LPRA 2BOKA 1BMAA 4OS6A 1UO6A 2C8XB 1LVBA 3TNTA 2C93B 2ZCHP 3RM2H 2PW8H 1ANDA 4A92A 3SN8A 4X2VA 2TGDA 1KXEA 1ESBA 1GVZA 1LVMA 1Q2WA 4D7GA 1GCTC 1V2MT 1CBWB 2JETB 1GVKB 3AAUA 3A7VA 1ZPZA 1TABE 3ZV9A 1NTPA 3MYWA 4K60A 4INKA 3U98H 2FI3E 2VIOA 1OYQA 2P93A 3JZ2B 3RMLH 2SNVA 3PROA 3S9AA 5EQQA 1GWAA 2BOHB 5A8XA 1OS8A 2YNBA 1QJ7B 1S5SA 1C2DA 3SU0A 4CREA 1O39A 4NZLA 1H9LB 1YGCH 3MO9A 1QHRB 3RXQA 1KTTB 2B0FA 1SC8U 1F0UA 2BVXH 3NWUA 1MMJN 5CMXH 2ODYB 3PB1E 1E36B 1K1OA 2QAAA 4TWYA 2WV4A 1KDQB 1CBWC 2JETC 5EPYA 4SGBE 1O31A 1YCPK 3A86A 3CS7A 3H7OA 2H2ZA 1J17T 1W14U 1XM1A 2OBOA 3P17H 1CA0B 1HUTH 2VINA 1MAYA 1WCZA 1FIZA 2ALVA 1KIGH 1BDAA 2EEKA 2ZTZA 1ZOMA 1EAWA 1X7AC 2TPIZ 3SUFA 1GHBG 3TU7H 1C5TA 2SGAA 1UTLM 1ZHMA 1RS0A 2Y81A 3GY2A 2XWBI 1DANH 3RUOA 1ETRH 2VVUA 1P2OA 1MQ5A 4ZAEA 1GHZA 3PWCA 4Y8XA 5ESTE 1DPOA 3SORA 1NFUA 3SUDA 3W95A 1GBKA 5JB8S 2BD5A 2ZU3A 1K1JA 2ANYA 2BD3A 1GMCG 1V2UT 2BTCE 1ZHPA 5FX5A 3QGJA 1YLDA 1BRUP 4K2YA 1CA0C 1GBLA 2BQWB 1WUNH 3TK6A 3Q3XA 8ESTE 1E37B 1GBIA 3ZVCA 1UJ1A 2AGEX 1C5VA 1RXPA 2VB0A 4ESTE 1JRTA 5C20A 3BTQE 3MH4A 1QNJA 3B9FH 1CGIE 2GCHF 1FAKH 1NRRH 2ANMH 4B73A 1ABIH 2ZFQH 1QRZA 3A7XA 3SV6A 1AIXH 1O2YA 1FI8A 4BAOB 4Y6DA 1XUHA 2A7JA 5DPAA 3OYPA 1J8AA 2P8OC 3GYMA 1CO7E 2BZAA 3IITA 1FAXA 2J38A 1MQ6A 2ZU2A 3U69H 1VCWA 2BY6X 4MG3A 4Y71A 4XBBA 2BMGB 1V2WT 2ZHWH 1YPKH 2HNTC 4AOQA 3A80A 3KNXA 1ELTA 2BDBA 3P92A 2BQ7B 3A7TA 4Y0YE 1DXWA 4FU7A 1QURH 1RTFB 1OWDA 1V2TT 5K0HA 5C67A 2UUJB 2B9LA 3TVJB 2O8UA 1TBZH 1DXPA 2QF0A 3UFAA 9ESTA 1HPGA 1TNLA 1AFEH 2GV6A 3MOCA 4MNVA 1BRCE 1IQEA 2ZWLH 2OLGA 1P10A 3RMOH 2NU1E 2VIDA 1SGPE 3ZVFA 2F91A 1EJMA 3ATWA 5FBEA 1A3EH 2M5TA 1C4U2 4NIWA 3RXJA 1GPZA 4CR5A 2PLXA 1UTPA 2C3SA 1AZZA 3JZ1B 2ANKH 2HPQH 2F3CE 2GV7A 3KGPA 3SNCA 2VIWA 2ZPSA 1DSTA 1EB1H 2XCNA 1TLDA 4AG2A 1O5BB 5A8ZA 2BDHA 2C4FH 2YOLA 4I33A 2CXVA 1C5SA 1O2MA 1G3EA 1TWXB 3M37A 1NZQH 1DS2E 3GCHB 2WUBA 2ZFPH 2Y5HA 2HNTE 2V35A 5AFYH 3Q3KA 1GDNA 1GI7B 1GI9B 2XYAA 3P8FA 4D8NA 1FV9A 1UMAH 1H1BA 1GJBB 1TNJA 4UFGH 1YF4A 2WINI 2BX3A 4KTCA 2QCYA 3RP2A 2PSYA 1V3XA 2BD8A 3ZZ8A 1TGNA 5J4QA 4X8SH 1F5KU 3B8JA 4X8TH 1WU1A 2BLOA 1O3DA 2P59A 3FP8E 1INCA 3D49H 2C8WB 3BTDE 2Q6FA 4B76A 2ZCLP 1FZZA 1QA0A 4ASHA 2PFEA 4WY3A 2H5CA 2PWXA 1YM0A 2BM2A 3FANA 3SV8A 1NU7B 1C2IA 2UWPA 2B7DH 2BYAX 5ABWA 4TYDA 3M3VA 1UCYH 3GCHC 2FTMA 1OWJA 2W7SA 1VITF 1NPMA 1TA6A 1GHAF 1W13U 4Y10E 3EE0B 4X2WA 2A4QA 3LH3A 4MTBA 1AB9B 4D9RA 2BD2A 4J2YB 5GWZA 1EAUA 1PPBH 3F9EA 1VR1H 1W0ZU 2GZ9A 4JZFH 1TGCA 1J16A 5F8XA 1MU6B 1PQ7A 4UONA 1K28D 5GIBA 1S6FA 4GLYA 4AN7A 2ZF0H 3OY6U 1AFQB 1ZGIA 1FPHH 4Z0KA 5EXLA 1O3JA 1UTOA 1K1PA 1BA8B 4IW4E 4LK4A 1AKSB 1OP2A 4O03A 1UTJA 3RC4A 3RU4T 4TY6A 3DD2H 1BTWA 4IN2A 1A7SA 4DT7B 1GBFA 1GJ8B 1O3PB 1EJAA 2G81E 2THFB 3PLBA 5F03A 6CHAB 1O5CB 2JH5D 1AB9C 1O30A 1WQSA 2R9PA 2BD9A 1IQFA 3QO6A 3K9XB 1SGRE 1MCTA 1O2NA 3RXBA 3UWJH 1SGIB 4OS7A 2ZGHA 3RC6A 4MNWA 1GBEA 4GCHG 3T5FH 1CGJE 1O3AA 3T28A 1OOKB 1LKAA 1EOLA 3DT0H 4DVAU 3SU4A 1O33A 1AFQC 4R8TB 2Z9JA 2FZZA 2IJOB 3A81A 2TIOA 4YM9A 2G4TA 1L1GA 5L2YH 2ALPA 3AASA 1HB0B 2FWWA 3RXVA 4DG4A 5I25A 1K1LA 1LHEH 2PHBA 4NIXA 4UFEH 1L4ZA 2FX6A 1E34B 1SHHB 1O3GA 4ZMAH 4JZEH 1DM4B 1DVAH 5T6GA 1F0RA 1IHTH 2R3YA 2VWNA 1BRAA 1AUJA 1ZMJA 5DGJA 1ELCA 1HAVB 1YC0A 4UD9H 4X1QU 4X8VH 1ZPBA 1CU1A 2AERH 2TRMA 4IS5A 1EKBB 4NWLA 5LH8A 2AMPA 1Z8GA 4NCYA 2AYWA 1W7XH 1PPGE 3NXPA 1EPTC 4GSOA 1K1NA 5FXLA 4CR9A 1AVGH 1BMMH 1A46H 4IGDA 1UTQA 1ELGA 1PPZA 2CF9H 1T8LA 1C5RA 1AMHA 1KTSB 2CJIA 3D23A 4MPWA 1Q3XA 2HNTF 1ORFA 4FVDA 1C4V2 3R3GB 1SQAA 1OPHB 2LPRA 2RA0A 1BBRH 5IYTA 1SGFA 2ZO3H 4FUJA 3RXUA 1GBJA 1BTPA 3RU4D 4O97A 1JRSA 5LPEA 2AEIH 2FOCA 3GISB 2Y82A 4YLUA 2CF8H 4LZ4B 4GVUA 4A5TS 1BRBE 5DP4A 4CHAB 2FOMB 2C8YB 2ZFSA 4NA8A 1HLTH 3ZZBA 1HRTH 5T6DA 3STIA 2F9OA 1ID5H 1BJUA 2GGVB 5DP3A 5I46H 1GMDF 1YPHC 1PQ5A 1EAXA 1C1UH 3SU1A 1HCGA 1FXYA 1C1VH 3TJNA 1O2UA 1T4UH 1BOQA 1Z1IA 2A7HA 3FFGA 5JDUB 1HJ8A 1D3TB 1RTKA 2D1JA 1C5OH 1D3PB 2FP7B 4KKDA 2TGPZ 1O2RA 4BNRA 1KXBA 4RKOB 1O2OA 1O3BA 2PKAB 2AIPA 5EXNA 2J2UA 5DP8A 1C1SA 4CHAC 4MPXA 3U1JB 4IMQA 3A87A 1C2GA 1YBWA 3BSQA 3DA9B 1T8NA 1V2OT 1EAIA 1LHGH 1HFDA 2J9NA 2V3HH 3UTUH 1TONA 1PYTD 2FYRA 1P2KA 3MNSA 3RXEA 2AFQB 2BXTH 4YT6H 3L3TA 1C1MA 1O35A 3GDSA 1EB2A 2ZKSA 1DY9A 1GVLA 3BTWE 2RCEA 1ANEA 4ZUHA 1EATA 1YPHE 3SGBE 1HIAA 1C1RA 3M5LA 2ZP0H 5BPEA 2BY8X 4HFPB 4YO9A 3WY8A 2GTBA 2OC1A 2XBYA 3VXFH 2WV5A 4AFSA 1C1OA 3M5MA 1MAXA 1TX8A 3A89A 3GY5A 1P2MA 2FLBH 5LPRA 3UIRA 3OTJE 3PYHA 3GY6A 4FU8A 3MH7A 1W11U 4MLFB 1O5DH 1OXGA 3LH1A 1CE5A 1UTKA 4X1SU 3RXLA 2ZTYA 1LPZB 3ZZCA 1A3BH 3LC3A 1C9TA 3PTNA 4ZH8A 1VZQH 4X1NU 1L2EA 5DKMA 2R0KA 4DJZB 1MD8A 1JIRA 1O2VA 1C2MA 3MFJA 2ZDVH 1AU8A 1TPPA 4B71A 4TY7A 5C1UA 4IC6A 1O38A 4ABJA 5F8ZA 4X6MA 5ETXA 4NIYA 1UCYK 5DP9A 4JYUH 5FPSA 3V13A 3ZVEA 1BT7A 2XC4A 3TK5A 4BTTB 1V2RT 2QIQA 1TNIA 5AF9H 4K1EA 5L6NH 2Z3DA 3GY3A 3SI3H 2C90B 1AGJA 3AVZA 1DFPA 3GDVA 5A09A 4HI3A 2ZGCA 2VNTA 4MPVA 1IQMA 3SO3A 4Q7XA 1Y5UT 2UUKB 3MTYA 1P3EA 2ANWA 3F9GA 1KLIH 2ZI2H 3RXTA 1EASA 4CRAA 1H9IE 2Y7XA 1XUFA 4YESB 2BY7X 2GMTB 4B1TA 3BEUA 1UCYE 1AN1E 3ODFA 5FAHA 1SG8B 1MH0A 2OQUA 1HBTH 2RG3A 5L2ZH 5GCHF 1IQLA 1Y3XA 5EU8A 2ZPQA 1B7XB 1OSSA 1C9PA 1DX5M 1G3DA 3GCNA 1C1NA 4ABDA 3IG6B 1LO6A 1O2XA 2FX4A 2HRVA 2KAIB 1LMWB 1ANBA 2QC2A 3ENSB 1TGBA 4TWWA 2C8ZB 2F9NA 5E0HA 1O3CA 3KHVA 2GT8A 1RJXB 2VWMA 3QTVH 1DUEA 4X6NA 3UQVA 1KXAA 2ASUB 1T8OA 5HM2A 3EAJA 2GMTC 1TX7A 3F68H 3KQCA 1A5IA 2BY9X 4FXGH 1SBWA 4CH2B 3E1XB 3PLKA 2ZFFH 1CVWH 2WPHS 4K5ZA 1C2EA 2ODPA 4F4OC 4NA7A 4YTAA 5E0GA 3RMNH 2OXSA 1O3KA 3PV4A 3SJIA 1AI8H 2FOEA 4LZ1H 1AWHB 1CT0E 1OWKA 5GJ4B 1TALA 1AE5A 4M7GA 1RD3B 2V0BA 2PTNA 5C2ZA 1GBDA 1MZDA 1V2QT 1DOJA 3D62A 1E38B 3PMAB 1PQAA 1P09A 1NRQH 3BG4B 3UR6A 1IQHA 2ZA5A 1G3BA 2WPMS 2Z6BD 2STAE 2PSXA 1SPJA 1XVOA 1TE0A 3A7ZA 4Q7ZA 1QR3E 3K65B 2Y5GA 3SNAA 3LGTA 2PKSB 4FUFA 4FUHA 1BMNH 1B5GH 2PV9B 1F7ZA 2A4GA 3SBKA 1NFWA 2FPZA 2ZTXA 2AIQA 4JZDH 2A45B 3O8CA 2OC8A 3GCTG 1EZXC 1BBRK 2STBE 1LVYA 2CV3A 4MNXA 3BEIB 3E0PB 3EYDA 1T7CA 1CHOF 3BG4C 1EZQA 4X1RU 2FI5E 2DE8A 1QB9A 2F9PA 3VGCB 2B5TB 2FOGA 1P0SH 3S9CA 1JIMA 4F49A 1RRKA 4KELA 1MCVA 4GHQA 1MTSA 2BLWA 3GY8A 4Y11E 1FQ3A 2ILNA 3ZV8A 1GJCB 2PKSC 3MU8A 2F9BH 1G36A 1THSH 1P12E 1QB6A 4K69A 1SL3A 3SOSA 6GCHG 4UE7H 1HXFH 1BBRE 1GJAB 1AVXA 1BUIA 1O3EA 5GXPA 1QA7A 1GHYH 1NN6A 1L0ZA 1IQGA 1TRYA 4I8LA 1TAWA 1DSUA 1NESE 2ZGJA 5TCAA 1O2WA 3SUEA 3HGNA 1HAZB 3NUMA 4Y79A 1HNEE 1NFYA 2D26C 2IOTA 4U30A 5DO4H 3SZNA 3VGCC 1GMHF 1O3LA 4AG1A 4GUXA 3A85A 1LQDB 1N6YA 2WPKS 1K1MA 1N1LA 1OWHA 1MBQA 2Y80A 3VB5A 4X2YA 1H8DH 4ZKNU 1YKTA 1C1TA 3O8RA 2CMYA 4CRCA 4LXBH 4IMZA 2J95A 2A4RA 5FCKA 2ZC9H 1IQIA 3I29A 3P8NA 5FCRA 2Z9LA 3U9AH 3SI4H 2Y7ZA 5HMAA 1W2KH 3TJVA 3ITIA 2DUCA 1O5FH 1CA8B 2QN5T 3SV9A 3GCOA 3M7UA 4XSKU 1WAYB 4DIIH 3MHWU 1SVPA 3LONA 1EOJA 2F83A 4ABGA 1DWBH 1V2ST 1Z7KA 4YOGA 4FUCA 4X8UH 2ZECA 2GX4A 2PTCE 3VB3A 1AWFH 2GP9B 3SHAH 2QXIA 2JH0D 3ZZAA 4Y7AA 1H4WA 2VU8E 1T8MA 3QLPH 1YPJH 1ESAA 1TB6H 2ZCKP 1C2KA 1HAPH 1K22H 2EI6A 1DLEA 1SLXB 1YPLH 4WMFA 1LVOA 8KME2 3ZZ5A 1ZTLA 4X0WU 4X6OA 4FUBA 3MI4A 2FO9A 3CS0A 1XUGA 3B23B 5K7RA 3LGUA 2EA3A 1A5HA 1RTLA 5EQRA 1IQKA 1JXPA 1Y59T 5JPMH 2R0LA 1W10U 4MVNA 7KMEH 2Z9IA 1GHXH 1QBOA 1C1QA 4ABEA 1D4PB 2F9UA 1BTXA 3LT3A 1HGTH 1P2JA 3SNBA 4CRDA 5B6OA 1D3DB 1C5UA 2G00A 5EW2H 3UNRA 1C5YB 3EA8A 3LGWA 5JBTA 1C5XB 1ELDE 1S6HA 1THPB 2FESH 3A8DA 3LU9B 7LPRA 3GOVB 4NSYA 1CQQA 2VIVA 1L4DA 1QRXA 4E05H 1XKAC 1DLKB 2GCHG 4K8YA 1ZMNA 4UEHH 1PPEE 4ISIH 3T27A 1L1JA
chains in the Genus database with same CATH superfamily
1S0QA 2FS9A 5E0JA 4H4FA 2OTVA 4WH6A 2A32A 3A8CA 3M7TA 2SGDE 1S83A 2VIPA 3M5OA 1ARCA 1TA2A 5EODA 1CSOE 1GGDB 5TJXA 3M3TA 2SGFE 1KSNA 1D9IA 3LGVA 4ISNA 3UOUA 2ZU5A 2J98B 5AFZH 4I8HA 1ETTH 4ABFA 4WH8A 8GCHF 3M61U 2UWOA 4O3TA 5J4SA 1O2PA 5FHTA 1Z1JA 1RIWB 1HAHH 2JKHA 3O8DA 3VFEA 4IN1A 1CGHA 4OGYA 4I31A 1V2LT 1GBBA 1PPHE 5H4IB 2XBWA 1K2I1 1TQ0B 3OU0A 4JCNA 3T62A 4U32A 7GCHF 2QXHA 2XWAA 3DFLA 4BOHA 1O3OA 1HAOH 1SGYE 4AYVB 5F6MA 1JBUH 1GG6B 2TBSA 1FNIA 1ETSH 2NU0E 2EQNA 4HTCH 4VGCB 5EQSA 1GBCA 1AHTH 1GGDC 3OFND 1U6QA 2P16A 1DITH 2FODA 5F8TA 1SGFG 1P3CA 3ZVGA 3KL6A 4NA9H 6ESTA 2ZIQH 1SOZA 1BB0B 1O3IA 1YPEH 2OC0A 2J94A 1FN6A 5JBBS 1RIWC 1ZSLA 6CHAC 3PMBB 1H9HE 3CP7A 3LGIA 2XC0A 3SV2H 3ODDA 2B8OH 3DHKH 2O8WA 2CN0H 1ELAA 3QX5H 1VITH 1MTWA 1TMBH 2Y5FA 3TGJE 2ZDKA 4LOYH 2EI8A 2WYGA 3WW7A 5EW1H 2GJGA 1EZUC 1TRNA 5FPYA 1OYTH 2Q1JA 4ABAA 3PRBA 3C27B 4DIHH 1NY22 1GG6C 2WSSD 2ZDAH 1G9IE 4MNYA 1FIWA 2ESTE 1THRH 1AY6H 1O0DH 1K9OE 3HKJB 4GHTA 1KY9A 1ANCA 4THNH 5SGAE 4JZIA 3AW1A 2SNWA 2RDLA 2PGQB 1SR5C 1ZHRA 2XTTB 2R2WU 4ZKOU 3E90B 4XOJA 4YT7H 4KTUA 2V3MA 3S69A 4WXVA 4AFZA 2PR3A 1IHSH 2XXLA 3A8AA 2KCPA 2FTLE 1G2MA 2OUAA 5TCCA 3NPSA 1JMOH 1UW7A 1C5MD 2NU4E 1VITG 3FAOA 1ZRKA 2BXUH 3NZIA 5E2OA 2BLQA 1GHAG 1UHBA 5IDKA 3VPKA 1MTNB 1F0TA 3QDZB 1VGCB 1XMNB 2QE7D 4RKJB 2ZFRH 1XX9A 1BMLA 2A4OA 3ATIA 4Z6AH 1SLVB 3RM0H 2PUQH 2H5DA 4U01A 4Y8ZA 2GZ7A 4AC9A 3L33A 4NGAH 2XCFA 5AVDA 7ESTE 1O2SA 1TNHA 3RXDA 2A5AA 1SI5H 4GAWA 2KM0A 3E8LA 1J14A 1FPCH 1MU8B 1LHCH 2XRCA 2BVRH 1UVPA 1FY3A 1NRPH 1GI3A 3VB7A 1GJ4H 3RDZA 4I32A 3HGPA 4ISHH 2W26A 1HAGE 2GVFA 4FVBA 2VH6A 1O3NA 1MTNC 2FLRH 1NRSH 2BDYA 3BN9A 2XNIA 3QZRA 1VGCC 2ZHFH 4UFFH 3RXCA 1GI5A 1O3MA 4B2BA 3LPRA 3LC5A 1ZGVA 2BDAA 3F9FA 3LOXA 1QL7A 4I8GA 3QK1A 1ZTKA 5DP6A 2V3OH 4CH8B 2J97A 5HYOA 2FIRH 1IOEA 1WBGB 2A5KA 3SW2B 1O32A 3V3MA 3BG8A 4WXIA 1P57B 3T29A 2ZDMA 5GNDA 3E0NB 3HK6B 1A0JA 1BHXB 4ZXXH 2F4LA 1DWDH 4I7YH 4O9VA 2KR7A 3A8BA 1JOUB 4FUIA 1GI4A 3V7TA 4DY7B 2ZQ2A 3GY7A 3Q00A 3E91A 2K1QA 1SGQE 5EXMA 5KGOA 3UAIC 3H5CB 2ZFTA 1LPGB 1NO9H 2Q6DA 3UNQA 3BIVH 3AW0A 2VGCB 4B75A 4SGAE 2BB4A 4WMDA 4A7IB 2G52A 1BTUA 2J92A 1S0RA 1XXDA 1OWIA 1OWEA 1LHDH 3LGYA 4ZKSU 1IQNA 3C1KA 1S85A 2GDEH 1Z6EA 2D2DA 1DDJA 1FDPA 2ZPRA 1UHBB 2I6SA 4NG9H 4XRNA 1QJ1B 4Q7YA 2LNCA 1QL9A 3RU4E 5FPTA 2UUYA 1GHBF 1GBAA 2ZGBH 4GPGA 1BTZA 1MKXH 1YPGH 4KP0A 5A8YA 4B2CA 1OX1A 3A7YA 4OS1A 1G37A 3Q77A 1Y5BT 2H9EH 4IBLH 4AB8A 3M5NA 2W3KA 1K1IA 1HJAB 4OS4A 3S7HB 1QBNA 3MH6A 3M36A 4K1SA 1ZTJA 4BXWA 2BVSH 3TH3H 2G5VA 4IC5A 3L6PA 3QUMP 4XBDA 3VEQB 2FM2A 1EX3A 3S0NA 4AGKA 3NRLA 3KN2A 3M35A 1GMCF 4OS5A 5DJ7A 2BD4A 3E6PH 3QGNB 1N8OB 1UTNA 2OC7A 2XW9A 1WTGH 3EQ0H 1GMDG 4NWKA 2J4IA 1XUKA 5A0CA 4ISOA 2BY5X 1E0FD 2R2MB 3BTGE 4D76A 1GI0A 1SGTA 4ISLA 2BX4A 4ZROA 3BIUH 5C1YA 1SLUB 1G2LA 1E1RD 3ATKA 3LKWA 3ZYEA 2AMDA 4BAKB 4I8JA 2ZDLA 4A6LA 5C5OA 1V2NT 4OGXA 1CHGA 5HIZA 1S81A 1SGDE 2F43B 2TGAA 2BHGA 2OCVB 3MU1A 1F0SA 4P00A 1TNGA 2CK3D 5CHAB 3RLWH 1P11E 1SOTA 1V2JT 1AUTC 2A2XH 2OP9A 1N8OC 4X1PU 2AS9A 2BDIA 3SGAE 1HIAB 1E35B 5JYIA 5HXFA 1SFIA 3UR9A 2H9HA 1BMFD 1NU9A 1QCPA 2BZ6H 2SGPE 3CENA 4E7NA 4AX9H 3NKKA 1EFRD 4M9FA 1FY4A 2QF5A 3Q76A 2OINA 2VIQA 1O2IA 2HOBA 3VB6A 2D8WA 1ZZZA 1GI1A 2PUXB 4NSVA 1TX6A 3U8OH 2KX4A 1WQVH 2RA3A 4MPUA 1QIXB 1LCYA 1T31A 2FS8A 3QN7A 4Q2KA 1YYY1 3FVFB 3U1IB 5HM9A 3HKIB 5E8EH 3SJ9A 1BTHH 3BTFE 1J9CH 1MBMA 1P9UA 5CHAC 1P06A 2VWOA 2V6NA 1C2FA 1QY6A 3MH5A 1QL8A 1TQ7B 3DUXH 5GPIB 2PGBB 3SQEE 2ZHEH 1RFNA 2VH0A 4JK6A 4INHA 3VXEH 1O2QA 1TIOA 2Q6GA 1SMFE 4NFEA 1NS3A 4NZQA 3STJA 3RXGA 3EE7A 1P2NA 3SJOA 1YLCA 1KLTA 1KXCA 1TPOA 4YZUA 2OK5A 1EJNA 3LJOA 4B74A 1EUFA 4K1TA 3TIUA 1A61H 4HZHA 4D9QA 3T25A 2VVCA 1B0EA 2O8TA 2AH4X 5A0AE 1E1QD 3SU3A 3U8RH 1ZSJA 1ZJKA 1DUAA 3KIDU 5DG6A 4ZHLU 1ELVA 3SNEA 1EXFA 1RGQA 2WPDD 1W8BH 1Q31A 3G01A 1TPAE 1O34A 1P03A 1SGEE 2XC5A 2OQ5A 2TGTA 3OSYA 1FLEE 4HGCA 3VB4A 4Q80A 1S6LA 3PWBA 3KQBA 2BLVA 4ABHA 1C2JA 3URDA 2HALA 3BTME 2P8OB 2ZHDA 1O5AB 1GHVH 1F92A 2EC9H 5LGOA 1L1NA 4JYTA 1A5GH 3K6YA 4D7FA 4NIVA 2GCTB 3OX7U 4B2AA 1LQEA 1QQUA 3TH4H 3ATMA 3K6ZA 1HAYB 5A2MH 4CBOA 2BQ6B 5HGGA 1SGCA 4BAHB 1WV7H 1FX0B 3F9HA 3UQOA 3O8BA 1CT2E 2GT7A 5ESBA 1P04A 3PMJA 5GCHG 4J1YA 8LPRA 2J34A 1OKXA 2L74A 4AFUA 1ZRBA 2SFAA 3SJKA 1P2QA 3A82A 3MNXA 2FMJA 1A0LA 3BTHE 5JBAS 4U2WA 1Y3WA 1Y3VA 2QY0B 2IJD1 3GDUA 3QZQA 1QFKH 5FL7D 1FY1A 3IWMA 1C5WB 3SJ8A 2WHXA 4AZ2B 1P01A 1DICA 1P9SA 1ZMLA 3DSPA 1TOCB 1W0YH 2XOKD 2GCTC 1GJ9B 1AVWA 1BHXF 1O2LA 1AQ7A 3RMMH 4K8BA 2R3UA 1C2HA 2FXRA 3VG8A 1C1PA 1GI8B 2W3IA 5FX6A 3FP7E 3QTOH 1AKSA 1MTVA 2UUFB 1ZYOA 1C5PA 1KXFA 3V0XA 4YLQH 1YY3A 1TOMH 4Y76A 1DE7H 1W3CA 2JH6D 5BRRE 1Z71A 4O3UA 2VWLA 1G30B 3MMGA 3MU0A 4BAQB 1G32B 1XUIA 2P94A 4GCHF 3RC5A 3MO6A 1SQOA 1DY8A 1C4Y2 3HATH 4Y8YA 4DURA 4CRGA 5JB9S 3HPTB 3ZZ4A 3TNSA 5LPFA 2NU2E 2I6QA 3FZDA 3BEFB 3UPEA 3TPIZ 1PFXC 1E79D 1NFXA 3E3TA 3F6UH 2WPJS 1QTFA 1A1RA 4A1VA 4YXWD 1GJ7B 4OS2A 5AHGH 1SQTA 1QGFA 3FP6E 3TLOA 3SNDA 1EPTA 2H1UA 4AGJA 1DT2A 2EI7A 2YNAA 1BZXE 5EGMA 3GY4A 2O9QA 2P3FH 1KLJH 1MKWH 5C94A 5GDSH 1TFXA 3NCLA 1PJPA 1C5NH 1ZPCA 3UY9A 1GCDA 3ATLA 1GDQA 2IPQX 3KYFA 3UB0A 1G3CA 3KEEA 1ACBE 1C5QA 3TJOA 1EQ9A 1HAVA 1SLWB 2HPPH 1MKXK 1HAIH 2F9VA 5C5NA 1CHOG 1O2TA 1CT4E 3A84A 3HK3B 1HAXB 4X6PA 1GL0E 1GL1A 3MU5A 1AD8H 3BTEE 1HXEH 2SGQE 1V6DA 4ZCNA 4TSFD 4FETA 1TBQH 1XKBC 5E2PA 1TBRH 1Y3YA 1LTOA 3F2FA 2XBXA 2ZQ1A 4CRBA 1FN8A 5EOKA 1C2LA 1Z6JH 2P95A 2IN2A 4ZHMU 1UVTH 1ZLRA 2AGIX 2OBQA 3OAAD 3ZVBA 2KCOA 4Q4LA 4E7RG 4JMYA 3UUZA 3E16B 1PPCE 2AGGX 3EDXB 2Y6TA 5JBCS 1YP9A 4KGAA 1GJDB 4K3JA 3P8GA 4E06H 2A31A 1PPFE 4X2XA 3BF6H 3K2UA 3RXFA 3KCGH 3N7DA 1ABJH 4YOJA 2ULLA 4BXSA 1HDTH 2FDAA 3MWIU 3P70B 1GHWH 2CHAB 1WSSH 1GMHG 4BAMB 2FOHA 4AORA 1KXDA 1QBVH 1V2KT 2Z3EA 2WYJA 4ZXYH 2WUCA 5T3HA 3ZYDA 2J5UA 3FOAA 1TGSZ 5DP7A 2HWLB 4XDEA 1P2IA 1W0JD 1O5GH 3M7QA 3U8TH 1O36A 3SUGA 2GKVE 3MNCA 3MU4A 1A2CH 1TGTA 2GD4B 3MNBA 1BTYA 3PM3A 5A0BA 1C1WH 1B0FA 1T32A 1LHFH 2L6OA 1UK4A 3T2NA 3W94A 1FY8E 3T26A 2A2QH 3FKSD 1ELEE 1ESTA 4ABIA 2NU3E 2CHAC 1FJSA 3A7WA 4WMEA 1OHHD 1D3QB 4BTUB 1AE8H 1O3FA 3BV9B 1EPTB 4AB9A 1EP6A 1EP5A 2GZ8A 2PKAA 3UOPA 1Y5AT 1GI2A 5IK2D 1ARBA 1UK3A 3ESTA 4FU9A 1J15A 1VCQA 1QQ4A 3BTKE 2ZU1A 1BJVA 4DW2U 5C1XA 1O2HA 2K0QA 4ABBA 2GDDA 1BIOA 1JWTA 1P02A 4JZ1A 4VGCC 3PMHB 3EGKH 4FUGA 3UNSA 2G55A 3Q3YA 3S7KB 1QRWA 5DP5A 3LJJA 3ZZ3A 1ZSKA 3PRDA 3SV7A 2YMSD 4DOQA 1HV7A 1PQ8A 1YCPH 1ZR0A 1GI6A 1HJ9A 4P02A 1A4WH 2H6MA 1D6RA 4FUEA 3TGKE 2OD3B 1V2VT 2Z9KA 3RXSA 1IQJA 1NC6A 4TPYA 2QYIA 3UWIA 1SSXA 3F1SB 4RN6A 3PTBA 2FOAA 2P3TB 3EA7A 3RXKA 4I8KA 3NK8A 1O2JA 5EPNA 2UWLA 2ODQA 3P95A 2FOFA 3U28C 1W7GH 2CGAA 4H6SB 1QJ6B 1UVOA 1OP0A 1D6WA 3UREA 2WPLS 3SU2A 1P05A 3RXIA 6LPRA 3TGIE 1P8VC 2Z9GA 1VCPA 1DWEH 2HLCA 1ELFA 2G8TA 1BCUH 1GBHA 1GJ5H 2VJ1A 2IPHA 3TITA 1W0KD 1XUJA 1LDTT 2Z3CA 1BITA 1IAUA 2ZG0H 5G4BA 1KYNA 1NROH 3GYLB 1S84A 1OP8A 3OEHD 4NFFA 3MO3A 4DCDA 4RT1A 1T4VH 1K21H 4WVPE 8GCHG 1FY5A 2H9TH 1A0HB 3URCA 3OY5U 2O8LA 3ZVDA 2NWNA 3RXMA 1TNKA 1VJAU 4ZHAA 4Y7BA 4UFDH 1NT1A 1Y8TA 3GICB 1ELBA 4WWYA 1DWCH 1UVSH 4TPIZ 1C5ZB 4YOIA 1V2PT 2QXJA 3RXAA 1Z8RA 4JYVH 3PO1B 3OE7D 7GCHG 1O2ZA 2HVYB 1GBTA 2O8MA 4DGJA 1BQYA 3SQHE 2A0QB 3A88A 1YCPM 3KQEA 2FEQH 5C0TA 1O37A 4R0IA 1W12U 3EA9A 4XFQA 1F2SE 3I77A 3PLPA 2BDGA 5C3NA 4CRFA 4BTIB 5L30H 2WPIS 4Q63A 5T6FA 1TYNA 3ZZDA 1H8IH 1FUJA 2G51A 5CDFE 2A1DB 4WJG2 3KQDA 5EJZA 3I78A 3ZZ9A 4MQAA 2JJ2D 3OEED 5FBIA 1FMGA 2BDCA 3SU6A 1Y3UA 1LPKB 2W6ID 2HVXA 2KAIA 2ZDNA 1SHYA 1O2KA 1O5EH 4KTSA 2KFWA 4PROA 2QV1A 2QF3A 1XVMA 5DK1A 3PO1C 4A1TA 3BTTE 1TRMA 3S9BA 5EG4A 1MTUA 3RXOA 3DFJA 1SB1H 2XBVA 4H42U 3PV5A 3ZZ7A 2W7UA 1NRNH 1WYKA 2QXGA 1F5LA 3AAVA 1GBMA 2HGTH 2G5NA 3TK9A 2ZGXH 2Z7FE 2BD7A 2P3UB 1MKWK 1O2GH 3M3SA 1QB1A 1EZSC 4QT8C 1SGNE 3TH2H 4XE4A 2QGRA 1VJ9U 4UDWH 4XBCA 1GDUA 3LIWA 1UK2A 4INLA 1YPMH 2A5IA 1M9UA 4RSPA 3RXPA 1AO5A 4MDSA 3N99A 1MZAA 1KDQA 4ZKRU 1PYTC 2ZNKH 2FYQA 1FONA 3FZZA 3KF2A 5DSFA 2ZZUH 4H6TA 3RLYH 3N7OA 1UTMA 1UVUH 3D65E 3RXHA 3TJUA 1S82A 2SGEE 4Y0ZE 4A1XA 3V12A 4AYYB 1MD7A 2VGCC 2DE9A 1NBMD 1MUEB 4FUDA 3SU5A 2ZU4A 5CE1A 3GCTF 3A83A 1LKBA 5PTPA 2A7CA 3ZVAA 1ZJDA 3P6ZB 2Z94A 1HYLA 2G4UA 4WF8A 1WOFA 1GJ6A 3ZZ6A 4AFQA 1O3HA 1XXFA 2ZHQH 3QWCH 3R0FA 2ZEBA 1TMUH 3LDXH 1AZ8A 3H7TA 1WTHD 1Z8JB 1GCTB 3SGQE 3SHCH 4B6FA 5C0UA 4CBNA 3RXRA 1SFQB 1TMTH 1C5LH 2QA9E 1WDIA 3FN8A 1N6XA 1TPSA 4BANB 4RI0A 2AMQA 1F5RA 2VVVA 3P8OA 1HJAC 3ELAH 2W5EA 2FI4E 2FOBA 6GCHF 1NM6A 4JK5A 1Z8IB 9LPRA 2BOKA 1BMAA 4OS6A 1UO6A 2C8XB 1LVBA 3TNTA 2C93B 2ZCHP 3RM2H 2PW8H 1ANDA 4A92A 3SN8A 4X2VA 2TGDA 1KXEA 4DT4A 1ESBA 1GVZA 1LVMA 1Q2WA 4D7GA 2RDEA 1GCTC 1V2MT 1CBWB 2JETB 1GVKB 3AAUA 3A7VA 1ZPZA 3AK5A 1TABE 3ZV9A 1NTPA 2QF4A 3MYWA 4K60A 4INKA 3U98H 2FI3E 2VIOA 1OYQA 2P93A 3PV2A 3JZ2B 3RMLH 2SNVA 3PROA 3S9AA 5EQQA 1WXRA 1GWAA 2BOHB 5A8XA 1OS8A 2YNBA 1QJ7B 1S5SA 1C2DA 3SU0A 4CREA 1O39A 4NZLA 1H9LB 1YGCH 3MO9A 1QHRB 3RXQA 1KTTB 2B0FA 1SC8U 1F0UA 2BVXH 3NWUA 1MMJN 5CMXH 1COWD 2ODYB 3PB1E 1E36B 1K1OA 2QAAA 4TWYA 2WV4A 1KDQB 1CBWC 2JETC 5EPYA 4SGBE 1O31A 1YCPK 3A86A 3CS7A 3H7OA 2H2ZA 1J17T 1W14U 1XM1A 2OBOA 3P17H 1CA0B 1HUTH 2VINA 1MAYA 1WCZA 1FIZA 2ALVA 1KIGH 1BDAA 2EEKA 2ZTZA 1ZOMA 1EAWA 1X7AC 2TPIZ 3SUFA 1GHBG 3TU7H 1C5TA 2SGAA 1UTLM 1ZHMA 1RS0A 2Y81A 3GY2A 2XWBI 1DANH 3RUOA 2AHME 1ETRH 2VVUA 1P2OA 4RT0A 1MQ5A 4ZAEA 1GHZA 3PWCA 4Y8XA 5ESTE 1DPOA 3SORA 1NFUA 3SUDA 2LELA 3W95A 4HG6A 1GBKA 5JB8S 2BD5A 2ZU3A 1K1JA 2ANYA 2BD3A 1GMCG 1V2UT 2BTCE 1ZHPA 5FX5A 3QGJA 1YLDA 4ACAA 1BRUP 4K2YA 1CA0C 1GBLA 2BQWB 1WUNH 3TK6A 3Q3XA 8ESTE 1E37B 1GBIA 5EJLA 3ZVCA 1UJ1A 3KQ5A 2AGEX 1C5VA 1RXPA 2VB0A 4ESTE 1JRTA 5C20A 3BTQE 3MH4A 1QNJA 3B9FH 1CGIE 2GCHF 1FAKH 1NRRH 2ANMH 4B73A 1ABIH 2ZFQH 1QRZA 3A7XA 5C17A 1AIXH 1O2YA 3SV6A 1FI8A 4BAOB 4Y6DA 1XUHA 2A7JA 5DPAA 3OYPA 1J8AA 2P8OC 3GYMA 1CO7E 2BZAA 3IITA 1FAXA 2J38A 1MQ6A 2ZU2A 3U69H 1VCWA 2BY6X 4MG3A 4Y71A 4XBBA 2BMGB 1V2WT 2ZHWH 1YPKH 2HNTC 4AOQA 3A80A 3KNXA 1ELTA 2BDBA 3P92A 2BQ7B 3A7TA 4Y0YE 1DXWA 4FU7A 1QURH 1RTFB 4ACBA 1OWDA 1V2TT 5K0HA 5EJ1A 5C67A 2J98A 2UUJB 2B9LA 3TVJB 2O8UA 1TBZH 1DXPA 2QF0A 3UFAA 9ESTA 1HPGA 1TNLA 1AFEH 2GV6A 3MOCA 4MNVA 1BRCE 1IQEA 3F0PA 2ZWLH 2OLGA 3DCLA 1P10A 3RMOH 2NU1E 2VIDA 1SGPE 3ZVFA 2F91A 1EJMA 3ATWA 5FBEA 1A3EH 2M5TA 1C4U2 4NIWA 3RXJA 1GPZA 4CR5A 2PLXA 1UTPA 2C3SA 1AZZA 3FO8D 3JZ1B 2ANKH 2HPQH 2F3CE 2GV7A 3KGPA 3SNCA 2VIWA 2ZPSA 1DSTA 1EB1H 2XCNA 1TLDA 4AG2A 1O5BB 5A8ZA 2BDHA 2C4FH 2YOLA 4I33A 2CXVA 1C5SA 1O2MA 1G3EA 1TWXB 3M37A 1NZQH 1DS2E 3GCHB 2WUBA 2ZFPH 2Y5HA 2HNTE 2V35A 5AFYH 3Q3KA 1GDNA 1GI7B 2M2AA 1GI9B 2XYAA 3P8FA 4D8NA 1FV9A 1UMAH 1H1BA 1GJBB 1TNJA 4UFGH 1YF4A 2WINI 2BX3A 4KTCA 2QCYA 3RP2A 2KZ4A 1V3XA 2PSYA 2BD8A 3ZZ8A 1TGNA 5J4QA 4X8SH 1F5KU 3B8JA 4X8TH 1WU1A 2BLOA 1O3DA 5B6LA 2P59A 3FP8E 1INCA 3D49H 2C8WB 3BTDE 2Q6FA 4B76A 2ZCLP 1FZZA 1QA0A 4ASHA 2PFEA 4WY3A 2H5CA 2PWXA 1YM0A 2BM2A 3FANA 3SV8A 1NU7B 1C2IA 2UWPA 2B7DH 2BYAX 2JIZD 5ABWA 4TYDA 3M3VA 1UCYH 3GCHC 2FTMA 1OWJA 2W7SA 1VITF 1NPMA 1TA6A 1GHAF 1W13U 4Y10E 3EE0B 4X2WA 2A4QA 3LH3A 4MTBA 1AB9B 4D9RA 2BD2A 4J2YB 5GWZA 1EAUA 1PPBH 1K0HA 2JJ1D 3F9EA 1VR1H 1W0ZU 2GZ9A 4JZFH 1TGCA 1J16A 5F8XA 1MU6B 1PQ7A 4UONA 1K28D 5GIBA 1S6FA 4GLYA 4XD7D 4AN7A 2ZF0H 3OY6U 1AFQB 1ZGIA 2XNDD 5EIYA 1FPHH 4Z0KA 5EXLA 1O3JA 1UTOA 1K1PA 1BA8B 4IW4E 4LK4A 1AKSB 1OP2A 4O03A 1UTJA 3RC4A 3RU4T 4TY6A 3DD2H 1BTWA 4IN2A 1A7SA 4DT7B 1GBFA 1GJ8B 1O3PB 1EJAA 2G81E 2THFB 3PLBA 3SZEA 5F03A 6CHAB 5HKKD 1O5CB 2JH5D 1AB9C 4Z1MD 1O30A 1WQSA 2R9PA 2BD9A 1IQFA 3QO6A 3K9XB 1SGRE 1MCTA 1O2NA 3RXBA 3UWJH 1SGIB 3OTPA 4OS7A 2ZGHA 3RC6A 4MNWA 1GBEA 4GCHG 3T5FH 1CGJE 1O3AA 3T28A 1OOKB 1LKAA 1EOLA 3DT0H 4DVAU 3SU4A 1O33A 1AFQC 4R8TB 2Z9JA 2FZZA 2IJOB 3A81A 2TIOA 5T1VA 4YM9A 2G4TA 1L1GA 5L2YH 2ALPA 3AASA 1HB0B 2FWWA 3RXVA 4DG4A 5I25A 1K1LA 1LHEH 2PHBA 3GS9A 4NIXA 4UFEH 1L4ZA 2FX6A 1E34B 1SHHB 1O3GA 4ZMAH 4JZEH 1DM4B 1DVAH 5T6GA 1F0RA 1IHTH 2R3YA 2VWNA 1BRAA 1AUJA 1ZMJA 5DGJA 1ELCA 1HAVB 1YC0A 4UD9H 4X1QU 4X8VH 1ZPBA 1CU1A 2AERH 2TRMA 4IS5A 5KECA 1EKBB 4NWLA 5LH8A 2AMPA 1Z8GA 4NCYA 2AYWA 1W7XH 1PPGE 3NXPA 1EPTC 2KCAA 4GSOA 1K1NA 5FXLA 5DN6D 4CR9A 1AVGH 5CHBA 1BMMH 1A46H 4IGDA 1UTQA 1ELGA 1PPZA 2CF9H 2LP6A 1T8LA 1C5RA 2YMSB 1AMHA 1KTSB 2CJIA 3D23A 4MPWA 5KEDA 1Q3XA 2HNTF 1ORFA 4FVDA 1C4V2 3R3GB 2RFKC 1SQAA 1OPHB 2LPRA 2RA0A 4I86A 1BBRH 5IYTA 1SGFA 2ZO3H 3W1EA 4FUJA 3RXUA 1GBJA 3WWFA 1BTPA 3RU4D 4O97A 1JRSA 5LPEA 2AEIH 2FOCA 3GISB 2K8IA 2Y82A 4YLUA 2CF8H 4LZ4B 4GVUA 4A5TS 1BRBE 2WV9A 5DP4A 3KYGA 4CHAB 2FOMB 2C8YB 2ZFSA 4NA8A 1HLTH 2W6JD 2YMSC 3ZZBA 1HRTH 5T6DA 3STIA 4F48B 2WZQA 2F9OA 1ID5H 1BJUA 2GGVB 5DP3A 5I46H 1GMDF 1YPHC 1PQ5A 3ZIAD 1EAXA 1C1UH 3SU1A 1SKYE 1HCGA 1FXYA 1C1VH 3TJNA 1O2UA 1T4UH 1BOQA 3CNRA 1Z1IA 2A7HA 2KCYA 3FFGA 5JDUB 1HJ8A 1D3TB 1RTKA 2D1JA 1C5OH 1D3PB 2FP7B 4KKDA 2TGPZ 1O2RA 4BNRA 1KXBA 4RKOB 1O2OA 1O3BA 2PKAB 2AIPA 5EXNA 2J2UA 5DP8A 4TT3D 1C1SA 4CHAC 4MPXA 3U1JB 4IMQA 3A87A 1C2GA 1YBWA 3BSQA 3DA9B 1T8NA 1V2OT 1EAIA 1LHGH 1HFDA 2J9NA 2V3HH 3UTUH 1TONA 1PYTD 2FYRA 1P2KA 3MNSA 3RXEA 2AFQB 2BXTH 4YT6H 3L3TA 1C1MA 1VKYA 1O35A 3GDSA 1EB2A 2ZKSA 1DY9A 1GVLA 3BTWE 2RCEA 1ANEA 4ZUHA 1EATA 1YPHE 3SGBE 1HIAA 1SQRA 1C1RA 3M5LA 2ZP0H 5BPEA 2BY8X 4HFPB 4YO9A 3WY8A 2GTBA 2OC1A 2XBYA 3VXFH 3F2GA 2WV5A 4AFSA 1C1OA 3M5MA 1MAXA 1TX8A 3A89A 3GY5A 1P2MA 2FLBH 5LPRA 3UIRA 3OTJE 3PYHA 4ASUD 3GY6A 4FU8A 3MH7A 1W11U 2JDID 4MLFB 1H8ED 1O5DH 1OXGA 3LH1A 1CE5A 1UTKA 4X1SU 3RXLA 2ZTYA 1LPZB 3ZZCA 1A3BH 2VBCA 3LC3A 1C9TA 3PTNA 4ZH8A 1VZQH 4X1NU 1L2EA 5DKMA 2R0KA 4DJZB 1MD8A 1JIRA 1O2VA 1MABB 1C2MA 3MFJA 2ZDVH 1AU8A 1TPPA 4B71A 4TY7A 5C1UA 4IC6A 1O38A 4ABJA 5F8ZA 4X6MA 5ETXA 4NIYA 1UCYK 5DP9A 4JYUH 5FPSA 2HLDD 3V13A 3ZVEA 1BT7A 2XC4A 3TK5A 4BTTB 1V2RT 2QIQA 1TNIA 5AF9H 4OM9A 4K1EA 5L6NH 2Z3DA 3GY3A 3SI3H 2C90B 3WWBA 1AGJA 3AVZA 1DFPA 3GDVA 5A09A 4HI3A 2ZGCA 2VNTA 3DSGA 4MPVA 1IQMA 3SO3A 4Q7XA 1Y5UT 2UUKB 3MTYA 1P3EA 3DSOA 2ANWA 3F9GA 1KLIH 2ZI2H 3RXTA 1EASA 4CRAA 1H9IE 2Y7XA 1H8HD 1XUFA 4YESB 2BY7X 2GMTB 4B1TA 3BEUA 1UCYE 1AN1E 3ODFA 5FAHA 1SG8B 1MH0A 2OQUA 1HBTH 2RG3A 5L2ZH 5GCHF 1IQLA 5F53A 1Y3XA 5EU8A 2ZPQA 1B7XB 1OSSA 1C9PA 1DX5M 1G3DA 3GCNA 1C1NA 4ABDA 3IG6B 1LO6A 1O2XA 2FX4A 2HRVA 2KAIB 1LMWB 1ANBA 2QC2A 3ENSB 1TGBA 4TWWA 2C8ZB 2F9NA 5E0HA 1O3CA 3KHVA 2GT8A 1RJXB 2VWMA 3QTVH 1DUEA 4X6NA 3UQVA 1KXAA 2ASUB 1T8OA 5HM2A 3EAJA 2GMTC 1TX7A 3F68H 3KQCA 1A5IA 2BY9X 4FXGH 1SBWA 4CH2B 3E1XB 3PLKA 2ZFFH 1CVWH 2WPHS 4K5ZA 1C2EA 2ODPA 4F4OC 4NA7A 4YTAA 5E0GA 3RMNH 1YLNA 1O3KA 2OXSA 3PV4A 3SJIA 1AI8H 2FOEA 4LZ1H 1AWHB 1CT0E 1OWKA 5GJ4B 3N7EA 1TALA 1AE5A 4M7GA 1RD3B 2V0BA 2PTNA 5C2ZA 1GBDA 1MZDA 1V2QT 1DOJA 3D62A 1E38B 3H09A 1PQAA 1P09A 1NRQH 3BG4B 3PMAB 3UR6A 1IQHA 2ZA5A 1G3BA 2WPMS 2Z6BD 1NBME 2STAE 2PSXA 1SPJA 1XVOA 1TE0A 3A7ZA 4Q7ZA 1QR3E 3K65B 2Y5GA 3SNAA 3LGTA 2PKSB 4FUFA 4FUHA 1BMNH 1B5GH 2PV9B 1F7ZA 2A4GA 3SBKA 1NFWA 2FPZA 2ZTXA 2AIQA 4JZDH 2A45B 3O8CA 2OC8A 4FOUC 3GCTG 1EZXC 1YWUA 1BBRK 2STBE 1LVYA 2CV3A 4MNXA 3BEIB 3E0PB 3EYDA 1T7CA 1CHOF 3BG4C 1EZQA 4X1RU 2FI5E 2DE8A 1QB9A 2F9PA 3VGCB 2B5TB 2FOGA 1P0SH 3S9CA 1JIMA 4F49A 1RRKA 4KELA 1MCVA 4GHQA 1MTSA 2BLWA 3GY8A 4Y11E 1FQ3A 2ILNA 3ZV8A 1GJCB 2PKSC 3MU8A 2F9BH 1G36A 1THSH 1P12E 1QB6A 4K69A 1SL3A 3SOSA 6GCHG 3F2HA 4UE7H 1HXFH 1BBRE 1GJAB 1AVXA 1BUIA 1O3EA 5GXPA 1QA7A 1GHYH 1NN6A 1L0ZA 1IQGA 1TRYA 4I8LA 5HIYA 1TAWA 1DSUA 1NESE 3MQKC 2ZGJA 5TCAA 1O2WA 3SUEA 3HGNA 1HAZB 3NUMA 4Y79A 1HNEE 1NFYA 2D26C 2IOTA 4U30A 5DO4H 3SZNA 3VGCC 1GMHF 1O3LA 4AG1A 4GUXA 3A85A 1LQDB 1N6YA 2WPKS 1K1MA 1N1LA 1OWHA 1MBQA 2Y80A 3VB5A 4X2YA 1H8DH 4ZKNU 1YKTA 1C1TA 3O8RA 3SYJA 2CMYA 4CRCA 2PP6A 4LXBH 4IMZA 2J95A 2A4RA 5FCKA 2ZC9H 1IQIA 3I29A 3P8NA 5FCRA 2Z9LA 3U9AH 3SI4H 2Y7ZA 5HMAA 1W2KH 3TJVA 3ITIA 2DUCA 1O5FH 1CA8B 2QN5T 3SV9A 3GCOA 3M7UA 4XSKU 1WAYB 4DIIH 3MHWU 1SVPA 3LONA 2F83A 1EOJA 1KMHB 4ABGA 1DWBH 1V2ST 1Z7KA 4YOGA 4FUCA 4X8UH 2ZECA 2GX4A 2PTCE 3VB3A 1AWFH 2GP9B 3SHAH 2QXIA 2JH0D 2V7QD 4B6EA 3ZZAA 4Y7AA 1H4WA 2VU8E 1T8MA 3QLPH 1YPJH 1ESAA 1TB6H 2ZCKP 1C2KA 1HAPH 3F3BA 1K22H 2EI6A 1DLEA 1SLXB 1YPLH 4WMFA 1LVOA 8KME2 3ZZ5A 1ZTLA 4X0WU 4X6OA 4FUBA 3MI4A 2FO9A 3CS0A 4F55A 1XUGA 3B23B 5K7RA 3LGUA 2EA3A 1A5HA 1RTLA 5EQRA 1IQKA 1JXPA 1Y59T 5JPMH 2R0LA 1W10U 4MVNA 7KMEH 2Z9IA 1GHXH 1QBOA 1C1QA 4ABEA 1D4PB 2F9UA 1BTXA 3LT3A 1HGTH 1P2JA 3SNBA 4CRDA 5B6OA 1D3DB 1C5UA 3F0OA 2G00A 5EW2H 3UNRA 1C5YB 3EA8A 3LGWA 5JBTA 1C5XB 1ELDE 1S6HA 1THPB 2FESH 3A8DA 2EY4C 3LU9B 7LPRA 3GOVB 4NSYA 1CQQA 2VIVA 1L4DA 1QRXA 4E05H 1XKAC 1DLKB 2GCHG 4K8YA 1ZMNA 4UEHH 1PPEE 4ISIH 3T27A 1L1JA 1QZ8A
chains in the Genus database with same CATH topology
1S0QA 2FS9A 5E0JA 4H4FA 2OTVA 4WH6A 2A32A 3A8CA 3M7TA 2SGDE 1S83A 2VIPA 3M5OA 1ARCA 1TA2A 5EODA 1CSOE 1GGDB 5TJXA 3M3TA 2SGFE 1KSNA 1D9IA 3LGVA 4ISNA 3UOUA 2ZU5A 5AFZH 4I8HA 1ETTH 4ABFA 4WH8A 8GCHF 3M61U 2UWOA 4O3TA 5J4SA 1O2PA 5FHTA 1Z1JA 1RIWB 1HAHH 2JKHA 3O8DA 3VFEA 4IN1A 1CGHA 4OGYA 4I31A 1V2LT 1GBBA 1PPHE 5H4IB 2XBWA 1K2I1 1TQ0B 3OU0A 4JCNA 3T62A 4U32A 7GCHF 2QXHA 2XWAA 3DFLA 4BOHA 1O3OA 1HAOH 1SGYE 4AYVB 5F6MA 1JBUH 1GG6B 2TBSA 1FNIA 1ETSH 2NU0E 4HTCH 4VGCB 5EQSA 1GBCA 1AHTH 1GGDC 1U6QA 2P16A 1DITH 2FODA 5F8TA 1SGFG 1P3CA 3ZVGA 3KL6A 4NA9H 6ESTA 2ZIQH 1SOZA 1BB0B 1O3IA 1YPEH 2OC0A 2J94A 1FN6A 5JBBS 1RIWC 1ZSLA 6CHAC 3PMBB 1H9HE 3CP7A 3LGIA 2XC0A 3SV2H 3ODDA 2B8OH 3DHKH 2O8WA 2CN0H 1ELAA 3QX5H 1VITH 1MTWA 1TMBH 2Y5FA 3TGJE 2ZDKA 4LOYH 2EI8A 2WYGA 5EW1H 1EZUC 1TRNA 5FPYA 1OYTH 2Q1JA 4ABAA 3C27B 4DIHH 1NY22 1GG6C 2ZDAH 1G9IE 4MNYA 1FIWA 2ESTE 1THRH 1AY6H 1O0DH 1K9OE 3HKJB 4GHTA 1KY9A 1ANCA 4THNH 5SGAE 4JZIA 3AW1A 2SNWA 2RDLA 2PGQB 1SR5C 1ZHRA 2XTTB 2R2WU 4ZKOU 3E90B 4XOJA 4YT7H 4KTUA 3S69A 4WXVA 4AFZA 2PR3A 1IHSH 2XXLA 3A8AA 2FTLE 1G2MA 2OUAA 5TCCA 3NPSA 1JMOH 1C5MD 2NU4E 1VITG 3FAOA 1ZRKA 2BXUH 3NZIA 5E2OA 2BLQA 1GHAG 1UHBA 5IDKA 3VPKA 1MTNB 1F0TA 3QDZB 1VGCB 1XMNB 4RKJB 2ZFRH 1XX9A 1BMLA 2A4OA 3ATIA 4Z6AH 1SLVB 3RM0H 2PUQH 2H5DA 4U01A 4Y8ZA 2GZ7A 3L33A 4NGAH 2XCFA 5AVDA 7ESTE 1O2SA 1TNHA 3RXDA 2A5AA 1SI5H 4GAWA 3E8LA 1J14A 1FPCH 1MU8B 1LHCH 2XRCA 2BVRH 1UVPA 1FY3A 1NRPH 1GI3A 3VB7A 1GJ4H 3RDZA 4I32A 3HGPA 4ISHH 2W26A 1HAGE 2GVFA 4FVBA 2VH6A 1O3NA 1MTNC 2FLRH 1NRSH 2BDYA 3BN9A 2XNIA 3QZRA 1VGCC 2ZHFH 4UFFH 3RXCA 1GI5A 1O3MA 4B2BA 3LPRA 3LC5A 1ZGVA 2BDAA 3F9FA 3LOXA 1QL7A 4I8GA 3QK1A 1ZTKA 5DP6A 2V3OH 4CH8B 5HYOA 2FIRH 1IOEA 1WBGB 2A5KA 3SW2B 1O32A 3V3MA 3BG8A 4WXIA 1P57B 3T29A 2ZDMA 3E0NB 3HK6B 1A0JA 1BHXB 4ZXXH 1DWDH 4I7YH 4O9VA 3A8BA 1JOUB 4FUIA 1GI4A 3V7TA 4DY7B 2ZQ2A 3GY7A 3Q00A 3E91A 2K1QA 1SGQE 5EXMA 3H5CB 2ZFTA 1LPGB 1NO9H 2Q6DA 3UNQA 3BIVH 3AW0A 2VGCB 4B75A 4SGAE 2BB4A 4WMDA 4A7IB 2G52A 1BTUA 2J92A 1S0RA 1XXDA 1OWIA 1OWEA 1LHDH 3LGYA 4ZKSU 1IQNA 3C1KA 1S85A 2GDEH 1Z6EA 2D2DA 1DDJA 1FDPA 2ZPRA 1UHBB 2I6SA 4NG9H 3RU4E 1QJ1B 4Q7YA 2LNCA 1QL9A 5FPTA 2UUYA 1GHBF 1GBAA 2ZGBH 4GPGA 1BTZA 1MKXH 1YPGH 4KP0A 5A8YA 4B2CA 1OX1A 3A7YA 4OS1A 1G37A 3Q77A 1Y5BT 2H9EH 4IBLH 4AB8A 3M5NA 2W3KA 1K1IA 1HJAB 4OS4A 3S7HB 1QBNA 3MH6A 3M36A 4K1SA 1ZTJA 4BXWA 2BVSH 3TH3H 2G5VA 4IC5A 3L6PA 3QUMP 4XBDA 3VEQB 2FM2A 1EX3A 3S0NA 4AGKA 3KN2A 3M35A 1GMCF 4OS5A 5DJ7A 2BD4A 3E6PH 3QGNB 1N8OB 1UTNA 2OC7A 2XW9A 1WTGH 3EQ0H 1GMDG 4NWKA 2J4IA 1XUKA 5A0CA 4ISOA 2BY5X 1E0FD 2R2MB 3BTGE 4D76A 1GI0A 1SGTA 4ISLA 2BX4A 4ZROA 3BIUH 5C1YA 1SLUB 1G2LA 3ATKA 3LKWA 3ZYEA 2AMDA 4BAKB 4I8JA 2ZDLA 4A6LA 5C5OA 1V2NT 4OGXA 1CHGA 1S81A 1SGDE 2TGAA 2BHGA 2OCVB 3MU1A 1F0SA 1TNGA 5CHAB 3RLWH 1P11E 1SOTA 1V2JT 1AUTC 2A2XH 2OP9A 1N8OC 4X1PU 2AS9A 2BDIA 3SGAE 1HIAB 1E35B 5JYIA 5HXFA 1SFIA 3UR9A 2H9HA 1QCPA 1NU9A 4E7NA 2BZ6H 2SGPE 3CENA 4AX9H 3NKKA 1FY4A 3Q76A 2OINA 2VIQA 1O2IA 2HOBA 3VB6A 2D8WA 1ZZZA 1GI1A 2PUXB 4NSVA 1TX6A 3U8OH 1WQVH 2RA3A 4MPUA 1QIXB 1LCYA 1T31A 2FS8A 3QN7A 4Q2KA 1YYY1 3FVFB 3U1IB 5HM9A 3HKIB 5E8EH 3SJ9A 1BTHH 3BTFE 1J9CH 1MBMA 1P9UA 5CHAC 1P06A 2VWOA 2V6NA 1C2FA 1QY6A 3MH5A 1QL8A 1TQ7B 3DUXH 5GPIB 2PGBB 3SQEE 2ZHEH 1RFNA 2VH0A 4JK6A 4INHA 3VXEH 1O2QA 1TIOA 2Q6GA 1SMFE 4NFEA 1NS3A 4NZQA 3STJA 3RXGA 1P2NA 3SJOA 1YLCA 1KLTA 1KXCA 1TPOA 4YZUA 1EJNA 3LJOA 4B74A 1EUFA 4K1TA 3TIUA 1A61H 4HZHA 4D9QA 3T25A 2VVCA 1B0EA 2O8TA 2AH4X 5A0AE 3SU3A 3U8RH 1ZSJA 1ZJKA 1DUAA 3KIDU 5DG6A 4ZHLU 1ELVA 3SNEA 1EXFA 1RGQA 1W8BH 1Q31A 3G01A 1TPAE 1O34A 1P03A 1SGEE 2XC5A 2OQ5A 2TGTA 3OSYA 1FLEE 4HGCA 3VB4A 4Q80A 3PWBA 3KQBA 2BLVA 4ABHA 1C2JA 3URDA 2HALA 3BTME 2P8OB 2ZHDA 1O5AB 1GHVH 1F92A 2EC9H 5LGOA 1L1NA 4JYTA 1A5GH 3K6YA 4D7FA 4NIVA 2GCTB 3OX7U 4B2AA 1LQEA 1QQUA 3TH4H 3ATMA 3K6ZA 1HAYB 5A2MH 4CBOA 2BQ6B 5HGGA 1SGCA 4BAHB 1WV7H 3F9HA 3UQOA 3O8BA 1CT2E 2GT7A 5ESBA 1P04A 3PMJA 5GCHG 4J1YA 8LPRA 2J34A 1OKXA 4AFUA 1ZRBA 2SFAA 3SJKA 1P2QA 3A82A 3MNXA 2FMJA 1A0LA 3BTHE 5JBAS 4U2WA 1Y3WA 1Y3VA 2QY0B 3GDUA 3QZQA 1QFKH 1FY1A 3IWMA 1C5WB 3SJ8A 4AZ2B 1P01A 1DICA 1P9SA 1ZMLA 1TOCB 1W0YH 2GCTC 1GJ9B 1AVWA 1BHXF 1O2LA 1AQ7A 3RMMH 4K8BA 2R3UA 1C2HA 2FXRA 1C1PA 1GI8B 2W3IA 5FX6A 3FP7E 3QTOH 1AKSA 1MTVA 2UUFB 1ZYOA 1C5PA 1KXFA 3V0XA 4YLQH 1TOMH 4Y76A 1DE7H 1W3CA 2JH6D 5BRRE 1Z71A 4O3UA 2VWLA 1G30B 3MMGA 3MU0A 4BAQB 1G32B 1XUIA 2P94A 4GCHF 3RC5A 3MO6A 1SQOA 1DY8A 1C4Y2 3HATH 4Y8YA 4DURA 4CRGA 5JB9S 3HPTB 3ZZ4A 3TNSA 5LPFA 2NU2E 2I6QA 3FZDA 3BEFB 3UPEA 3TPIZ 1PFXC 1NFXA 3E3TA 3F6UH 2WPJS 1QTFA 1A1RA 4A1VA 1GJ7B 4OS2A 5AHGH 1SQTA 1QGFA 3FP6E 3TLOA 3SNDA 1EPTA 2H1UA 4AGJA 1DT2A 2EI7A 2YNAA 1BZXE 5EGMA 3GY4A 2O9QA 2P3FH 1KLJH 1MKWH 5GDSH 1TFXA 3NCLA 1PJPA 1C5NH 1ZPCA 3UY9A 1GCDA 3ATLA 1GDQA 1G3CA 3KEEA 1ACBE 1C5QA 3TJOA 1EQ9A 1HAVA 1SLWB 2HPPH 1MKXK 1HAIH 2F9VA 5C5NA 1CHOG 1O2TA 1CT4E 3A84A 3HK3B 1HAXB 4X6PA 1GL0E 1GL1A 3MU5A 1AD8H 3BTEE 1HXEH 2SGQE 1V6DA 1TBQH 1XKBC 5E2PA 1TBRH 1Y3YA 1LTOA 2XBXA 2ZQ1A 4CRBA 1FN8A 5EOKA 1C2LA 1Z6JH 2P95A 2IN2A 4ZHMU 1UVTH 1ZLRA 2AGIX 2OBQA 3ZVBA 4E7RG 4JMYA 3UUZA 3E16B 1PPCE 2AGGX 3EDXB 2Y6TA 5JBCS 1YP9A 4KGAA 1GJDB 4K3JA 3P8GA 4E06H 2A31A 1PPFE 4X2XA 3BF6H 3K2UA 3RXFA 3KCGH 1ABJH 4YOJA 2ULLA 4BXSA 1HDTH 2FDAA 3MWIU 3P70B 1GHWH 2CHAB 1WSSH 1GMHG 4BAMB 2FOHA 4AORA 1KXDA 1QBVH 1V2KT 2Z3EA 2WYJA 4ZXYH 2WUCA 5T3HA 3ZYDA 1TGSZ 5DP7A 2HWLB 4XDEA 1P2IA 1O5GH 3M7QA 3U8TH 1O36A 3SUGA 2GKVE 3MNCA 3MU4A 1A2CH 1TGTA 2GD4B 3MNBA 1BTYA 3PM3A 5A0BA 1C1WH 1B0FA 1T32A 1LHFH 1UK4A 3T2NA 3W94A 1FY8E 3T26A 2A2QH 1ELEE 1ESTA 4ABIA 2NU3E 2CHAC 1FJSA 3A7WA 4WMEA 1D3QB 4BTUB 1AE8H 1O3FA 3BV9B 1EPTB 4AB9A 1EP6A 1EP5A 2GZ8A 2PKAA 3UOPA 1Y5AT 1GI2A 1ARBA 1UK3A 3ESTA 4FU9A 1J15A 1VCQA 1QQ4A 3BTKE 2ZU1A 1BJVA 4DW2U 5C1XA 1O2HA 4ABBA 2GDDA 1BIOA 1JWTA 1P02A 4JZ1A 4VGCC 3PMHB 3EGKH 4FUGA 3UNSA 2G55A 3Q3YA 3S7KB 1QRWA 5DP5A 3LJJA 3ZZ3A 1ZSKA 3SV7A 4DOQA 1HV7A 1PQ8A 1YCPH 1ZR0A 1GI6A 1HJ9A 1A4WH 2H6MA 1D6RA 4FUEA 3TGKE 2OD3B 1V2VT 2Z9KA 3RXSA 1IQJA 1NC6A 4TPYA 2QYIA 3UWIA 1SSXA 3F1SB 4RN6A 3PTBA 2FOAA 2P3TB 3EA7A 3RXKA 4I8KA 3NK8A 1O2JA 5EPNA 2UWLA 2ODQA 3P95A 2FOFA 1W7GH 2CGAA 4H6SB 1QJ6B 1UVOA 1OP0A 1D6WA 3UREA 2WPLS 3SU2A 1P05A 3RXIA 6LPRA 3TGIE 1P8VC 2Z9GA 1VCPA 1DWEH 2HLCA 1ELFA 2G8TA 1BCUH 1GBHA 1GJ5H 2VJ1A 2IPHA 3TITA 1XUJA 1LDTT 2Z3CA 1BITA 1IAUA 2ZG0H 5G4BA 1KYNA 1NROH 3GYLB 1S84A 1OP8A 4NFFA 3MO3A 4DCDA 1T4VH 1K21H 4WVPE 8GCHG 1FY5A 2H9TH 1A0HB 3URCA 3OY5U 2O8LA 3ZVDA 2NWNA 3RXMA 1TNKA 1VJAU 4ZHAA 4Y7BA 4UFDH 1NT1A 1Y8TA 3GICB 1ELBA 4WWYA 1DWCH 1UVSH 4TPIZ 1C5ZB 4YOIA 1V2PT 2QXJA 3RXAA 1Z8RA 4JYVH 3PO1B 7GCHG 1O2ZA 1GBTA 2O8MA 4DGJA 1BQYA 3SQHE 2A0QB 3A88A 1YCPM 3KQEA 2FEQH 1O37A 4R0IA 1W12U 3EA9A 4XFQA 1F2SE 3I77A 3PLPA 2BDGA 5C3NA 4CRFA 4BTIB 5L30H 2WPIS 5T6FA 1TYNA 3ZZDA 1H8IH 1FUJA 2G51A 2A1DB 4WJG2 3KQDA 3I78A 3ZZ9A 4MQAA 5FBIA 1FMGA 2BDCA 3SU6A 1Y3UA 1LPKB 2HVXA 2KAIA 2ZDNA 1SHYA 1O2KA 1O5EH 4KTSA 4PROA 2QV1A 2QF3A 1XVMA 5DK1A 3PO1C 4A1TA 3BTTE 1TRMA 3S9BA 5EG4A 1MTUA 3RXOA 3DFJA 1SB1H 2XBVA 4H42U 3ZZ7A 2W7UA 1NRNH 1WYKA 2QXGA 1F5LA 3AAVA 1GBMA 2HGTH 2G5NA 3TK9A 2ZGXH 2Z7FE 2BD7A 2P3UB 1MKWK 1O2GH 3M3SA 1QB1A 1EZSC 4QT8C 1SGNE 3TH2H 4XE4A 2QGRA 1VJ9U 4UDWH 4XBCA 1GDUA 3LIWA 1UK2A 4INLA 1YPMH 2A5IA 1M9UA 4RSPA 3RXPA 1AO5A 4MDSA 1MZAA 1KDQA 4ZKRU 1PYTC 2ZNKH 2FYQA 1FONA 3FZZA 3KF2A 2ZZUH 4H6TA 3RLYH 3N7OA 1UTMA 1UVUH 3D65E 3RXHA 3TJUA 1S82A 2SGEE 4Y0ZE 4A1XA 3V12A 4AYYB 1MD7A 2VGCC 2DE9A 1MUEB 4FUDA 3SU5A 2ZU4A 5CE1A 3GCTF 3A83A 1LKBA 5PTPA 2A7CA 3ZVAA 1ZJDA 3P6ZB 2Z94A 1HYLA 2G4UA 4WF8A 1WOFA 1GJ6A 3ZZ6A 4AFQA 1O3HA 1XXFA 2ZHQH 3QWCH 3R0FA 2ZEBA 1TMUH 3LDXH 1AZ8A 3H7TA 1WTHD 1Z8JB 1GCTB 3SGQE 3SHCH 4CBNA 3RXRA 1SFQB 1TMTH 1C5LH 2QA9E 1N6XA 1TPSA 4BANB 2AMQA 1F5RA 2VVVA 3P8OA 1HJAC 3ELAH 2W5EA 2FI4E 2FOBA 6GCHF 1NM6A 4JK5A <