1AUJA

Bovine trypsin complexed to meta-cyano-benzylic inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title New inhibitors of thrombin and other trypsin-like proteases: hydrogen bonding of an aromatic cyano group with a backbone amide of the P1 binding site replaces binding of a basic side chain.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA02
1GJBB 5A09A 2FLRH 2A7HA 3T28A 5A0BA 4U30A 1ZHPA 4ABBA 1ZR0A 2P8OC 3PLBA 2BY9X 1PPBH 1YBWA 1UCYK 2C93B 5F03A 1ZPZA 1QRZA 1TAWA 3RLYH 4ABJA 1MKWH 4ISHH 1GBCA 4LZ4B 2GCTB 4Q7YA 1YGCH 2VGCB 1GPZA 1PPFE 1TFXA 3F9EA 1ANDA 2XCNA 4ZKNU 1JMOH 2SGDE 3RXIA 2IOTA 3RC4A 3BF6H 2ANWA 1S83A 4OS5A 1ANEA 4A7IB 1V3XA 3KHVA 1V2WT 3KIDU 3Q77A 1UVPA 1C1QA 1W7XH 3UPEA 3K9XB 5FPTA 3PMHB 2C90B 4GAWA 3RMOH 2ZF0H 3URCA 3S7HB 3VB6A 3KCGH 2UWLA 3EA7A 1T7CA 2SGEE 3EAJA 3QDZB 5JBAS 5C67A 1YLCA 2EI6A 1OPHB 2O8UA 3SUFA 2VH0A 4RN6A 1UVSH 4BANB 2RDLA 1GWAA 4I8GA 1TE0A 1TA6A 1XUHA 3VPKA 2Y81A 2OINA 9LPRA 3GY2A 1ELCA 3DD2H 2FTLE 1S6FA 1P12E 2JH5D 1FDPA 5C1UA 1O3CA 1SGFG 2F9NA 4X1PU 1AE5A 1TPSA 2OXSA 3OY5U 4UEHH 1CA0C 1C2DA 1Q3XA 1F0RA 4HZHA 4DURA 3UQVA 3SN8A 4BTIB 3FFGA 5IDKA 3KQCA 1J16A 4RSPA 1GBHA 3E91A 1A46H 1EASA 6GCHF 1NZQH 4ZH8A 2BD8A 4I7YH 1NFWA 2AGGX 1GG6C 4NFFA 3ATWA 1IQLA 1K22H 3GY3A 5E2OA 1BMMH 1SPJA 1X7AC 5B6OA 1DWEH 1G3DA 4D76A 4RKJB 4Y7AA 1FN6A 2I6SA 2WUCA 3ZVFA 5E8EH 2O8LA 1AE8H 3TU7H 1A0LA 2ALPA 2B5TB 1KTSB 2G52A 1N6YA 1VITG 3A86A 1H8DH 2VU8E 1A3EH 2AIQA 1V2ST 1LPZB 2FOCA 1EATA 2VH6A 1GHZA 1ZTKA 2P16A 1MUEB 3N7OA 3AW0A 4AGKA 1KDQA 2G51A 1HB0B 1WSSH 3QN7A 3CP7A 1UK2A 1EJMA 3H7OA 1C5TA 3T62A 3TGKE 3PWBA 2UUKB 2VIOA 1GI1A 2QYIA 1GBJA 5A8XA 3PROA 4Y8ZA 3VB4A 1AFEH 3BTME 3I78A 1TMTH 2A0QB 1BUIA 1GJ4H 2BYAX 2R3YA 3UR6A 2PKSC 4HI3A 4YOJA 1VJ9U 4BTTB 1K9OE 1FY4A 5L30H 4B2BA 2TGAA 1XMNB 3BTGE 3LC3A 1O2VA 5E0JA 4CRDA 2QIQA 1C1PA 1A0JA 1V6DA 1E36B 2UUFB 1ZSKA 1MAXA 1FAXA 3W94A 2ZHEH 4ZMAH 1NU9A 1E35B 3VXEH 2ZHWH 1O2LA 1KIGH 2ZCLP 2TGPZ 2H6MA 2QC2A 2WPIS 1FY1A 1TABE 3PO1C 1TMUH 1TLDA 1ZGVA 1O2TA 1TX7A 1O2KA 3UNQA 3BG8A 5A8YA 1TOMH 3SNAA 2A31A 2W7SA 1BTPA 4TY6A 2QXGA 1GCDA 3M5LA 4CR5A 1A2CH 1O39A 4MTBA 1SBWA 4ISOA 3VFEA 2BY6X 1GMDG 4TPYA 2ZFFH 5BRRE 2FTMA 1XXFA 4O03A 3V12A 4WY3A 4NFEA 1W2KH 2FYQA 2BDHA 1GBKA 3F6UH 1P0SH 3K65B 5C2ZA 4HGCA 1F92A 1GJ8B 3TNSA 1VCPA 4U2WA 4IGDA 1PYTD 3A82A 3SJKA 2XXLA 1LKBA 2R2WU 5EG4A 5E2PA 3ZVEA 3PLPA 3Q3KA 1AKSA 3S7KB 1QL8A 2OBQA 2ZI2H 4QT8C 1K2I1 3EGKH 3A88A 1HV7A 1SSXA 1H9LB 2ZU4A 1V2JT 5EPYA 1FIWA 1F2SE 1MBQA 3F68H 3GCHB 3HK6B 3SJIA 3PO1B 4A5TS 4CH8B 4U01A 5C5NA 1DDJA 2BD4A 4FUHA 1VGCC 2P3FH 5TCAA 3QTVH 1K1MA 1GJAB 4ISNA 3L6PA 1VCQA 1YF4A 4JZDH 1UHBA 4B74A 1MKXH 7ESTE 1SLWB 1TNHA 2BD7A 1SGTA 3L3TA 2ZDKA 3NUMA 1EP5A 1C9PA 1GHBF 2BVXH 3AAVA 1GHXH 4AB9A 3LC5A 4MPVA 4AORA 1EQ9A 1FNIA 1GDQA 3RMLH 3V13A 1C5LH 1OOKB 1K1PA 1UK3A 1BBRK 3MU4A 1C5OH 4FUFA 4TWYA 3DFJA 4Y7BA 2FEQH 3TK9A 1AB9B 2XBVA 4KGAA 5PTPA 1GI3A 1WBGB 2A1DB 3QTOH 1C5UA 2FI4E 2NU0E 2RA0A 2Z3EA 4FU9A 4SGBE 3ITIA 2CF8H 4CREA 2AYWA 1BJVA 1TNLA 2BDCA 2ZDMA 1C4Y2 2R0LA 2ZTZA 1F7ZA 2H9EH 4A92A 3L33A 2G4UA 2XYAA 5CE1A 2C8ZB 1QJ1B 1JXPA 1GVKB 1TRMA 2GMTB 1IOEA 2CHAB 4INHA 1MTVA 1C2EA 1KY9A 1O5AB 2Z3DA 3M3TA 4ZHAA 2BY5X 1A1RA 1HAOH 4B1TA 4WH8A 1ORFA 4VGCB 5C20A 3UQOA 4AOQA 1KXDA 3F9HA 5GWZA 3E8LA 1K1LA 2BD2A 2F9PA 1GCTC 1SL3A 1MU8B 2HPQH 3TGJE 3UNRA 1O2HA 3R0FA 1MZDA 2ODPA 3ZVAA 3ZZBA 1Z6JH 4INLA 4PROA 3RXBA 1IQHA 2OC7A 3E1XB 1AQ7A 1ETRH 1MTUA 2ZPQA 1BJUA 4GHQA 1HJ9A 4UE7H 2SGFE 2TIOA 5EQSA 2H9HA 5FPYA 1CT0E 1O2ZA 3U8OH 2YNBA 5HYOA 2QXHA 1DVAH 2HALA 1QL7A 2Q6FA 4A1XA 3MO9A 1U6QA 1BA8B 4K3JA 3RXKA 2GCHG 1D9IA 1SGEE 2PW8H 2BVSH 1QJ7B 2ZDLA 4Y10E 5JB8S 1DWBH 1P02A 3F1SB 4ABFA 1D3QB 1HXEH 2VVUA 4O97A 1S85A 3OU0A 1G30B 4FXGH 1BT7A 2P95A 1V2LT 1MZAA 1QQ4A 2PR3A 2PWXA 7GCHF 5DKMA 3GCNA 2H5DA 2RA3A 4X2WA 1UTPA 1RTKA 3A8CA 1E0FD 1FY5A 3OTJE 6ESTA 4YOGA 4AFQA 1MKWK 4X6NA 1C5WB 1ZYOA 3FP6E 4IN2A 3GDSA 4X2YA 3STJA 2FI5E 2WV4A 4DGJA 3P8FA 2VB0A 1OWKA 1CGHA 2V6NA 3LH3A 4GCHF 1Z8RA 1UVOA 1AY6H 2WINI 3A8AA 1O2SA 5AHGH 4E7NA 4K8YA 1GCTB 3M7TA 1DUEA 1NY22 3RXGA 8GCHG 1C2FA 1O38A 3SGAE 1GDUA 1THSH 3LGIA 1TNKA 1UTKA 2PUQH 4IW4E 1FUJA 4LZ1H 3HK3B 1MTWA 1TONA 4UFFH 1ARBA 3LT3A 3M37A 2Z6BD 2A2XH 1FLEE 3BTHE 1O33A 1P2MA 1K1JA 5DG6A 1QQUA 1RIWC 1AWFH 3GDUA 2AFQB 1O36A 2CN0H 3ZV9A 1NTPA 1GI7B 4X0WU 2NWNA 1EZSC 2BOKA 2B9LA 3E0PB 4NWKA 2C8XB 5A2MH 2W26A 3LU9B 1O3NA 1O3IA 1GBMA 1S6HA 5FCRA 2BDIA 2H9TH 4JK5A 1ZSLA 1IQMA 2VNTA 5ABWA 3RXMA 4AZ2B 1MTNC 3RU4E 2RCEA 4MDSA 1QB6A 1ELAA 2J4IA 4CHAB 4I8HA 4UFEH 3GY6A 1DICA 4XSKU 1TBZH 1C1MA 1B0EA 1OP8A 3TJUA 3ZZ5A 4AFSA 2AMQA 1OWIA 2A2QH 1AD8H 3U8TH 4A6LA 1BMAA 9ESTA 3SZNA 1TGBA 3JZ2B 1TALA 4ZKOU 1LHGH 3SUGA 4D9RA 2BM2A 5GCHG 2BXTH 2R2MB 4TWWA 1SGDE 1SVPA 3ZZDA 2Z9IA 4AN7A 4I8JA 2TGDA 1GI5A 1UJ1A 4FU7A 1ZMNA 4OS2A 2UUYA 4F4OC 3E0NB 1P2JA 4Z0KA 3PTBA 2GVFA 2IPHA 1H1BA 1MBMA 1PFXC 2IN2A 3HKIB 2R3UA 4HFPB 5EXNA 3E3TA 1KDQB 1FIZA 2GCTC 1THPB 2VGCC 3MO6A 3ZZ7A 3RC6A 2EC9H 1D6WA 1RXPA 3UREA 2O8TA 4TYDA 3P92A 5C3NA 1TNJA 3SNDA 3AAUA 1VCWA 3TK6A 1PQ5A 1OYQA 2SGPE 3QZRA 1JIMA 1DANH 4UD9H 4K69A 1WOFA 4MNYA 4X1SU 4Y0YE 1MTSA 1RTFB 1T4VH 1TX6A 3V3MA 1ZSJA 3HATH 3BEFB 2V3OH 4FUDA 1L1NA 1RRKA 3ZVCA 4D8NA 3JZ1B 1AMHA 3RXDA 2A4RA 1TNIA 3RMNH 2K1QA 4HTCH 3RMMH 3MNBA 3P8OA 4FUJA 3A85A 4Y76A 2FLBH 4IMZA 4MG3A 4Z6AH 3A84A 1NN6A 3BTWE 1BTYA 3QGNB 1TMBH 2PLXA 2EI7A 1P10A 5L2YH 3MTYA 1VITF 3EYDA 3IWMA 1ZMLA 2XNIA 1AI8H 1CVWH 1BRAA 1HAHH 2ZHFH 2GX4A 4ZAEA 2XTTB 1QTFA 1O3PB 4F49A 1ACBE 2G00A 2ODQA 1EB2A 2F91A 1IAUA 3MH6A 2FPZA 1HJ8A 1BDAA 1PQ8A 1Y5AT 5HM2A 4A1TA 2FX6A 2NU1E 1PQAA 1SGQE 1TGCA 4YTAA 1XUIA 2VVCA 1QRXA 1QB1A 1O2UA 1S82A 1BITA 2SNWA 1C5XB 5C1YA 2UWOA 1NPMA 2FDAA 4BTUB 1HPGA 1ZRKA 4CRBA 5T6FA 3A7ZA 1AO5A 3R3GB 3P70B 2M5TA 2ZFRH 2ZFTA 1CHOG 3ZZ4A 3GCOA 2CXVA 4RKOB 2ZG0H 1AVXA 5ESTE 1EJAA 5F8ZA 2BMGB 3RXLA 1DT2A 1RTLA 1DFPA 1YPMH 1C1SA 3GOVB 2ZKSA 1ELEE 1HNEE 2XBYA 1E37B 1CGJE 3RXFA 1L4DA 2BY7X 1AKSB 4NA7A 1WUNH 2BDAA 3D49H 6CHAB 1SOTA 4BNRA 1G32B 2SGQE 1HJAB 3EE0B 3FP7E 4BAOB 2Z9GA 1QJ6B 4OGYA 1MD8A 4XFQA 1ABJH 1ESBA 4X6OA 1LHDH 1GI2A 2W3KA 4NCYA 1AFQB 3ATMA 5GPIB 2FXRA 1JRTA 3ZZCA 4AX9H 4NSVA 3M5OA 1PQ7A 3M7QA 2FODA 1T32A 1AVGH 3V0XA 8ESTE 2FX4A 1O3GA 1P2OA 1UHBB 1EP6A 1XUGA 1A7SA 1C5SA 1OP0A 1Z71A 4SGAE 1QRWA 2THFB 3MOCA 2HNTF 1KXFA 3F9FA 2PFEA 3O8RA 2P59A 1P06A 1ZHRA 4LK4A 1Q2WA 1FV9A 3VXFH 1GMDF 1ESAA 1SGNE 1MKXK 1NU7B 3SU0A 4Y11E 1C2KA 2QF3A 5J4SA 1Y8TA 3UWJH 2BDBA 1LPKB 3KQBA 2Z94A 3STIA 6LPRA 1RS0A 5FCKA 1IQGA 1V2KT 1HXFH 3GYMA 1C1UH 1SGFA 1EAUA 1HFDA 1TRNA 1KLTA 5GDSH 2TGTA 2FOHA 1MCTA 4UDWH 3OYPA 1ZZZA 1W7GH 1GJDB 2XC4A 1AWHB 5DP4A 2VIVA 3U9AH 1BRUP 1PJPA 3LGYA 3S0NA 5DP9A 1YPHE 1V2TT 2TBSA 5A8ZA 2YOLA 3Q00A 1L2EA 1OWHA 1OX1A 1BIOA 1HGTH 1CT4E 1EPTA 1FY8E 3MI4A 3TJNA 4IS5A 4BOHA 4DIHH 1TYNA 3TJOA 4AYYB 1OWEA 3F9GA 2C4FH 2SFAA 1K1IA 3UNSA 2XC5A 5TCCA 2DE9A 2BX3A 3SGBE 3K2UA 1LCYA 2EI8A 1DLEA 1O2NA 1E34B 1LHEH 2VIQA 1G37A 1YPHC 3S69A 1CA8B 3MHWU 1O32A 3SV2H 1O3OA 5AFYH 5FX5A 4DVAU 5FXLA 2AMDA 1KLJH 2BD3A 4I8LA 1YPGH 1O2JA 4Q80A 1E38B 4BAMB 5EOKA 1EZQA 5F8XA 5JDUB 1S0QA 4I8KA 2GZ8A 2BQWB 2GT8A 3SQHE 1BMNH 1PPZA 1G2MA 2UWPA 1O5BB 2F9VA 4LXBH 3GCHC 1HAPH 2WYJA 1YCPH 4BAKB 3SNBA 1SQTA 2A5IA 3LGVA 3RP2A 2GV7A 4ZXYH 4BXSA 1K28D 2I6QA 1TQ7B 4CBOA 1LVYA 2D8WA 2G5VA 3OY6U 1EKBB 4JCNA 2O9QA 1T8LA 1P3CA 1G36A 1PPGE 1FPHH 2J95A 1BTUA 1LTOA 1GMHG 1SGPE 4NZQA 4YLUA 2Y80A 1EOJA 1O3DA 1QA0A 2OLGA 3FAOA 4NIXA 2BX4A 2G55A 5F6MA 1P9UA 3NK8A 1GVLA 1EAIA 2P3UB 2A5AA 2BLWA 4H4FA 4MVNA 1KSNA 1PPEE 2GT7A 1AB9C 4D7GA 1A61H 1SGIB 1TB6H 2FESH 1O3FA 3KQEA 1P09A 3P17H 1MCVA 2OC0A 1S81A 4AG2A 4K2YA 1DSTA 3BV9B 3SUDA 1XVMA 3LGTA 2GCHF 1S0RA 1RFNA 2ZU5A 4NA8A 1XKBC 2G8TA 3SU2A 1DX5M 2O8WA 2PHBA 1P2QA 4Y79A 2GDEH 1HBTH 1AZZA 1ZTJA 2GGVB 1V2NT 3BG4B 1OKXA 2HPPH 2ZFPH 4NIYA 4OS7A 1P11E 2CHAC 2GMTC 2HVXA 1ANBA 5FBIA 1OWJA 1SLVB 3LIWA 4VGCC 1D6RA 4BXWA 3KGPA 2Z9JA 4GUXA 1LQEA 8GCHF 1J14A 4YZUA 5AF9H 2FP7B 1XVOA 3SHCH 3LONA 4K60A 4NSYA 1O2OA 3VGCB 2HGTH 3M5NA 3DHKH 4ZKRU 1Y3UA 1PYTC 1MMJN 1UTJA 4ZHMU 1CBWB 5T6GA 1KXEA 1W12U 2OP9A 1Z7KA 2IJOB 1TGSZ 3MU5A 1C5MD 1EXFA 2ZPSA 1YYY1 2ZGJA 5E0GA 1Y3YA 3EA9A 5CHAB 2KAIA 1J17T 1MQ6A 4IBLH 5LPRA 1G2LA 1A4WH 1GBDA 3H5CB 1MD7A 4FVBA 3D62A 1NRNH 1SOZA 2GDDA 2ILNA 4B73A 1O2PA 3S9CA 3W95A 1GBBA 2JETB 2XWAA 2ZEBA 3BEIB 4WMEA 3TNTA 3IG6B 1QGFA 4FUBA 2PGQB 2Y5GA 4TPIZ 1P2NA 4XOJA 3RXQA 2OUAA 1O34A 3A8BA 1TRYA 1P04A 3V7TA 5L6NH 3B9FH 1IHTH 4NGAH 3P8NA 3QWCH 1QHRB 3BTQE 2Y6TA 1O2RA 1W13U 2SGAA 1C1RA 1DM4B 1O3JA 2BXUH 2Y5FA 2Z7FE 5GCHF 3SNCA 1O3LA 2QV1A 4WVPE 3VB3A 4E06H 3RXPA 2WYGA 3SU6A 1J9CH 3T25A 1VR1H 1NM6A 1NFYA 5J4QA 1F5LA 2Y5HA 2H5CA 1CQQA 2XW9A 1AU8A 1TPAE 1V2VT 1LO6A 2ASUB 1BRCE 1S84A 1GI4A 1HAYB 5GXPA 3KL6A 4R0IA 1XXDA 4CHAC 1C4U2 1KXAA 3ZVGA 2DUCA 2TPIZ 1GHAG 1GVZA 1C2LA 2ANYA 3CS0A 4YLQH 1AZ8A 1SFIA 2ZTYA 1EZXC 4AFUA 1AGJA 5T6DA 1YPJH 1H9IE 4K5ZA 2Z9LA 3FANA 3GDVA 2NU3E 3RDZA 1SC8U 1O3AA 1TPPA 1GGDB 2BHGA 5BPEA 2ZA5A 1XX9A 4GPGA 4IN1A 1K1OA 5FX6A 1RD3B 3HKJB 1GI9B 4ZXXH 1KXBA 2OC8A 3U1JB 2A7JA 1FQ3A 3TH4H 1J15A 4J1YA 1UK4A 1YC0A 1GDNA 1ARCA 5G4BA 1TWXB 2ZDAH 1YCPM 1Q31A 1GHWH 1Y5BT 1EUFA 2QCYA 4INKA 1C5NH 2EA3A 1UO6A 1OWDA 1S5SA 1T8NA 1G3EA 1FPCH 1QURH 4XDEA 2BQ7B 2GZ9A 5DP8A 2XRCA 2ZHDA 1QFKH 2FOGA 1UVUH 1UTNA 2QA9E 3RXAA 3TIUA 2VVVA 1GJ9B 1IQKA 5LPEA 5AVDA 1O5DH 2OQUA 4GVUA 1K1NA 2Y7ZA 1YPLH 5L2ZH 1ZMJA 3MWIU 4K1EA 1EZUC 2GV6A 4B2CA 2FZZA 3LGUA 3GY7A 3RU4D 1HRTH 3H7TA 1QBNA 2ULLA 8LPRA 1O5CB 4A1VA 2FOMB 1XUJA 1CU1A 1ETSH 1QB9A 3ZVBA 3OSYA 1DWDH 4YT7H 1QNJA 5I25A 2FOEA 1NESE 1CHOF 1QIXB 3SV6A 1WAYB 2VWLA 4H6TA 1TGTA 1SHYA 2FI3E 5FAHA 1EOLA 1H8IH 4Y6DA 1GJ7B 3C27B 1DPOA 1Z8IB 3GISB 3ZZAA 1O2IA 5GJ4B 1DWCH 1SMFE 1DSUA 1OS8A 2BD5A 3RXHA 3GICB 2D26C 1ELBA 4KTUA 3RXJA 3SU3A 1V2PT 3ZV8A 2BOHB 5GIBA 4D9QA 3LJOA 4ZHLU 1OXGA 1HAGE 2J92A 3SJOA 1SQAA 3BEUA 5SGAE 1RGQA 1MH0A 2XWBI 1C5RA 1FMGA 3ZYEA 1EPTB 3AW1A 2ZHQH 4D7FA 2A4GA 2BY8X 1AHTH 3CS7A 3M3SA 5A0AE 1YKTA 1BTZA 4DOQA 1GHYH 4WH6A 3U69H 3SI3H 4AFZA 2ZU2A 1DXWA 1EAXA 1YM0A 3BTEE 1Z8GA 3ZZ9A 1O35A 4ISLA 3RXEA 2VWNA 4AG1A 2QAAA 2LPRA 3SI4H 2FM2A 2ZO3H 1AUTC 4ESTE 3A7XA 3G01A 3I29A 3S9AA 3HPTB 2AERH 1D3TB 1DLKB 1O31A 1NFXA 2OBOA 5ESBA 2BVRH 3SJ9A 4MPXA 3SW2B 3Q76A 3IITA 1K21H 4X8VH 2P94A 1HAIH 3PM3A 4WMFA 1GMCG 1M9UA 3RXUA 4BAHB 3UOUA 1UVTH 1SI5H 3Q3YA 4Y0ZE 2ZDVH 4CRAA 1HLTH 6CHAC 3K6YA 3A80A 3SGQE 3RLWH 5C5OA 1HJAC 1SLXB 1GBLA 2BLVA 2LNCA 2C3SA 2ZGHA 1UTMA 1DITH 1AFQC 3DUXH 4YM9A 1A5GH 4UFGH 1MAYA 4YT6H 1BHXF 3MH7A 2CJIA 1EJNA 1SGYE 1TQ0B 1XUKA 3TH3H 4AB8A 1GBTA 4I31A 5EQQA 1CO7E 3BIVH 3SOSA 1HIAB 1YCPK 2A4QA 3QO6A 4KP0A 1F5KU 2Q6GA 5DP6A 4WXVA 3VB5A 1CT2E 1A3BH 3GY5A 3D65E 4ABGA 5HXFA 3TGIE 3TK5A 5F8TA 2W5EA 5JBTA 4ABHA 1D3DB 2Z3CA 3EDXB 3A81A 4FUEA 3SNEA 5EODA 2Q1JA 1W11U 1N8OB 3CENA 4AGJA 3M5MA 3MYWA 1BTXA 5I46H 1LVOA 1XKAC 4WWYA 1LPGB 2W3IA 4O3UA 2WPMS 1C2HA 1ID5H 2A5KA 2B0FA 4X8UH 4ZUHA 1ABIH 4CR9A 4TY7A 4JYTA 2UUJB 1F0TA 3B8JA 4X1RU 3ESTA 1YPKH 1NRQH 1T8OA 3GCTG 3MU0A 4ABAA 2J9NA 2WPJS 1NO9H 2V35A 1DE7H 1O0DH 3FZZA 2P8OB 1FZZA 3O8CA 3NZIA 1LMWB 3KQDA 4KKDA 3RXSA 4X8TH 1TA2A 4FUGA 1FAKH 3FP8E 2XBWA 3VB7A 1O37A 2QF0A 4DW2U 1ZOMA 1JIRA 1GMHF 1C2JA 5EXMA 1DOJA 1QA7A 1J8AA 1TGNA 1SLUB 2VIPA 2YNAA 4DG4A 1Y59T 2PSXA 5ETXA 1GJ5H 3K6ZA 1C5YB 4OS6A 1AVWA 4XBBA 3RM0H 3SORA 1AN1E 1MQ5A 1Y3XA 1ZTLA 2P3TB 3ZZ3A 2ZDNA 4Q7XA 1GL0E 1GBAA 1Y3WA 1ELFA 3NPSA 3MH4A 3RM2H 4B2AA 4ZROA 2J38A 2KAIB 4X2XA 4DIIH 4X8SH 8KME2 1DY9A 1IQJA 2HOBA 5DP3A 1W0ZU 1QR3E 2BDYA 3QLPH 2PKAA 1FY3A 4ZKSU 4GSOA 3I77A 1V2RT 4WJG2 5EQRA 4LOYH 3MNXA 3RXTA 3UOPA 4NZLA 2FOBA 1UCYE 1B0FA 3M35A 3QX5H 4DT7B 2WV5A 5DPAA 2ZU1A 3DFLA 3M3VA 1O3KA 1V2OT 3MH5A 2BD9A 4B75A 2F9BH 2PUXB 3BN9A 1CA0B 3TLOA 4CRCA 2AGEX 3S9BA 5FBEA 2G81E 4THNH 1HUTH 1EAWA 1C5QA 1CE5A 2ZCKP 1GL1A 3A87A 1ZJKA 2GZ7A 2HRVA 3SBKA 3SU4A 4NIVA 3E6PH 2FS8A 3SV8A 2ALVA 1P03A 2GKVE 3QZQA 5T3HA 3M7UA 3O8BA 3GY4A 3SU1A 1C2MA 4YESB 4U32A 3BTDE 3C1KA 3SV7A 4E05H 1WCZA 1O3BA 1GG6B 4H42U 2SNVA 4WMDA 1GI8B 1UTOA 1AUJA 3UUZA 3DT0H 1QL9A 1L1JA 1LHFH 5CMXH 2ZFSA 3A7VA 4DY7B 1V2QT 5HM9A 1NRRH 1YPEH 3T5FH 1EB1H 1OSSA 3ATLA 3P6ZB 3RC5A 3RXOA 2R0KA 5DP5A 1UCYH 5DO4H 3BG4C 4JK6A 4JZIA 3NWUA 1SGCA 4CRGA 2G5NA 1XUFA 1FXYA 1O2YA 2ZGXH 3EQ0H 2AS9A 5EU8A 4YO9A 3TVJB 1L1GA 1HIAA 4R8TB 5DJ7A 3UFAA 2PTCE 1C5PA 2ZNKH 1C5VA 3MMGA 1JWTA 1C1OA 3RUOA 4ABIA 1BOQA 1TBRH 4X6PA 3VGCC 1O2XA 1DS2E 1Z8JB 1OYTH 2GTBA 2FWWA 1CBWC 6GCHG 5A0CA 5C1XA 5DGJA 1ZHMA 2H2ZA 1C4V2 1CHGA 1V2MT 1PPHE 2ODYB 4X1NU 4K1TA 3SJ8A 1P8VC 1SQOA 1TIOA 4FUCA 2F3CE 3QUMP 1P2KA 3A7WA 4I32A 2ESTE 1SG8B 3P8GA 3SQEE 5CHAC 1O3MA 2FOFA 2AMPA 2JH6D 2PKSB 3UTUH 2ZGBH 4X6MA 1G9IE 1HAVB 5E0HA 1P3EA 1AIXH 1ZPBA 1IQNA 3LH1A 2ZFQH 1PPCE 1BTHH 2JETC 2ZC9H 2QXIA 4OS1A 4Q2KA 3KEEA 5JPMH 3UR9A 1GHAF 3HGNA 5JYIA 4YOIA 2AGIX 4Y71A 2W7UA 4KTCA 3BTFE 1SGRE 1B7XB 2ZZUH 4IC6A 1F0UA 2AH4X 5DK1A 4MLFB 1H9HE 2STAE 3LGWA 1BQYA 1L4ZA 3KN2A 5H4IB 3DA9B 2FS9A 1IQFA 2GP9B 1O3HA 4NWLA 2HLCA 4NIWA 1BRBE 3AASA 1QBVH 2WPLS 3NCLA 3U98H 1BZXE 1WTGH 1Z1JA 1NT1A 4OS4A 3T26A 2P93A 2A4OA 4ABDA 1SFQB 2PV9B 3TPIZ 4XBDA 1Y5UT 3PYHA 3O8DA 2GD4B 1Y3VA 4Y8XA 1ELDE 2OTVA 2VIWA 1MU6B 1WTHD 4OGXA 4M7GA 4JMYA 2OQ5A 1IQIA 2ZIQH 5EW1H 2XCFA 1GJ6A 2FMJA 3PV4A 1HAXB 3KNXA 3MFJA 2ZCHP 2FO9A 2RG3A 4E7RG 1Z6EA 4FVDA 1LHCH 3GY8A 4UFDH 2WPHS 1V2UT 1Z1IA 2BB4A 2BLQA 5JB9S 3EA8A 5LH8A 1IHSH 3RXCA 2F9UA 1W8BH 4NA9H 2AEIH 4KTSA 1NS3A 4MNWA 1O2WA 2JKHA 2R9PA 5FPSA 2O8MA 3FVFB 1UMAH 2PTNA 2AIPA 1WQVH 5FHTA 1ZJDA 1W3CA 1ZLRA 4DCDA 1GGDC 4K1SA 1BTWA 1W14U 2NU2E 3LKWA 1NROH 2J34A 2CF9H 2ZU3A 1VGCB 1JRSA 1KLIH 2ZP0H 1NRSH 2ANKH 3A7TA 3T27A 1TPOA 4AYVB 3RU4T 1D3PB 2HWLB 4FU8A 1ELGA 2A32A 4ASHA 1N6XA 1SB1H 1TNGA 2CGAA 1F5RA 1NFUA 1VZQH 1WQSA 2VJ1A 3A89A 3M36A 3OX7U 3LOXA 4WF8A 1INCA 1VJAU 2BZAA 1T31A 3LDXH 2EEKA 4KELA 1O2MA 1THRH 2ZTXA 3BTTE 2CMYA 3SU5A 3D23A 2J94A 4ISIH 1JBUH 1NC6A 3LPRA 3Q3XA 3U8RH 1BB0B 1DXPA 1HCGA 1TX8A 2QXJA 1HYLA 3MO3A 1G3BA 2BTCE 4O3TA 2OD3B 3URDA 4NG9H 7KMEH 3SV9A 3PB1E 5LGOA 3A7YA 1ELVA 4GLYA 3SO3A 3ZYDA 4JZ1A 1FJSA 1LQDB 3ODFA 3A83A 3PMJA 2ZQ1A 3NKKA 5EW2H 1LKAA 3BIUH 2OC1A 3VEQB 5K7RA 5TJXA 1A0HB 1P01A 5AFZH 5JBBS 2FOAA 1H4WA 4K8BA 2STBE 1LDTT 2G4TA 4BAQB 1HAZB 3PWCA 4ABEA 3ENSB 2QN5T 1G3CA 2Y7XA 1HDTH 4XBCA 2VINA 1GHBG 1UTQA 1GMCF 1GI6A 3MNSA 4O9VA 1LVMA 5K0HA 3ZVDA 1BBRE 2VWOA 1FONA 2DE8A 3RXVA 4CH2B 2CV3A 4UONA 2FIRH 3MU1A 4B76A 7LPRA 1GBFA 2ZGCA 4X2VA 2ZQ2A 1HAVA 1JOUB 3QGJA 4J2YB 1BCUH 3HGPA 1WV7H 1EX3A 3ZZ8A 4DJZB 1A5IA 1EPTC 1SHHB 2D1JA 3U1IB 3LJJA 1GBEA 2Z9KA 3UY9A 1QBOA 1P2IA 1GBIA 1OP2A 1L0ZA 1TOCB 3M61U 3A8DA 2Y82A 2ZWLH 1O2GH 1O3EA 1O5EH 1T8MA 1C5ZB 4Q7ZA 5HGGA 1CGIE 1WU1A 3PLKA 3MNCA 2QGRA 3BSQA 4MNVA 1B5GH 1IQEA 1C2IA 4IMQA 2F9OA 1GI0A 1ETTH 1O5FH 4B71A 2C8YB 5EPNA 3SUEA 1F0SA 1SR5C 1VITH 4JYVH 5EGMA 1O5GH 1RJXB 1C2GA 1LVBA 3UWIA 2NU4E 2FYRA 1FN8A 4XE4A 1P57B 2WPKS 1C1TA 3ATIA 3ZZ6A 1BBRH 1ZGIA 2B7DH 2A45B 4CRFA 3TITA 1C1VH 5LPFA 2BQ6B 1C1WH 3GYLB 3ODDA 2PKAB 2Q6DA 2VIDA 2ZPRA 1P05A 4MNXA 3SHAH 1ANCA 5JBCS 4WXIA 4H6SB 3PMBB 1N1LA 1O2QA 2BZ6H 3GCTF 1DUAA 2OCVB 3FZDA 4FUIA 1T4UH 1DY8A 1RIWB 4MPUA 4IC5A 1ZRBA 5IYTA 1ELTA 3E90B 1KYNA 5HMAA 1TBQH 4MPWA 2XBXA 4GHTA 2HNTE 2ZECA 4JZEH 3ELAH 2TRMA 1KXCA 3KF2A 3P95A 1UTLM 4Y8YA 1WYKA 2BDGA 1KTTB 2H1UA 1W0YH 1W10U 2PSYA 1CSOE 1A5HA 1D4PB 1P9SA 1GJCB 1C1NA 7GCHG 1QCPA 4CBNA 1ESTA 2F83A 2WUBA 3QK1A 1MTNB 3NXPA 3PMAB 1BMLA 2D2DA 1XM1A 2A7CA 1ZPCA 3AVZA 3UIRA 2J2UA 4X1QU 3T2NA 2ANMH 1FI8A 1QY6A 3E16B 2C8WB 4I33A 3PTNA 3WY8A 2V3HH 3B23B 1NRPH 4GCHG 5DP7A 2V0BA 3T29A 4JZFH 1YLDA 2PGBB 1N8OC 2BLOA 1BHXB 4MQAA 3MU8A 2QY0B 5EXLA 4JYUH 2JH0D 1GHVH 3TH2H 2XC0A 3BTKE 3TJVA 3RXRA 2HNTC 2B8OH 3ATKA 1C9TA 1YP9A 2VWMA 1O30A
chains in the Genus database with same CATH superfamily
1GJBB 5A09A 2FLRH 2A7HA 3T28A 5A0BA 2KM0A 4U30A 1ZHPA 4ABBA 1ZR0A 2P8OC 3PLBA 2BY9X 1PPBH 1YBWA 1UCYK 2C93B 1COWD 5F03A 1ZPZA 1QRZA 1TAWA 3RLYH 4ABJA 1MKWH 4ISHH 5CDFE 1GBCA 4LZ4B 2GCTB 4Q7YA 1YGCH 2VGCB 1K0HA 1GPZA 1PPFE 1TFXA 3F9EA 1ANDA 2XCNA 4ZKNU 1JMOH 2SGDE 2LP6A 3RXIA 2IOTA 3RC4A 3BF6H 2ANWA 1S83A 4OS5A 1ANEA 4HG6A 4A7IB 1V3XA 3KHVA 1V2WT 3KIDU 3Q77A 1UVPA 1C1QA 1W7XH 1H8ED 3UPEA 3K9XB 5FPTA 3PMHB 2C90B 4GAWA 3RMOH 2ZF0H 3URCA 3S7HB 3VB6A 3KCGH 2UWLA 3EA7A 1T7CA 2SGEE 3EAJA 3QDZB 5JBAS 5C67A 1YLCA 2EI6A 1OPHB 2O8UA 2KR7A 3SUFA 2VH0A 4RN6A 1UVSH 4BANB 2RDLA 1GWAA 3PV2A 4I8GA 1TE0A 1TA6A 1XUHA 3VPKA 2Y81A 2OINA 9LPRA 3GY2A 1ELCA 3DD2H 2FTLE 1S6FA 1P12E 2JH5D 1FDPA 5C1UA 3WW7A 1O3CA 1SGFG 2F9NA 4X1PU 1AE5A 1TPSA 2OXSA 3OY5U 4UEHH 1CA0C 1C2DA 1Q3XA 1F0RA 4HZHA 4DURA 3UQVA 3SN8A 4BTIB 3FFGA 5IDKA 3KQCA 1J16A 4RSPA 1GBHA 3N7EA 3E91A 1A46H 1EASA 6GCHF 1NZQH 1S6LA 4ZH8A 2BD8A 4I7YH 1NFWA 2AGGX 1GG6C 4NFFA 3ATWA 3UB0A 1IQLA 1K22H 3GY3A 5E2OA 1BMMH 1SPJA 1X7AC 5B6OA 1DWEH 1G3DA 4D76A 2W6JD 4RKJB 4Y7AA 1FN6A 2I6SA 2WUCA 3ZVFA 5E8EH 2O8LA 1AE8H 3TU7H 1A0LA 2ALPA 2B5TB 4M9FA 1KTSB 2G52A 1N6YA 1VITG 3A86A 1H8DH 2VU8E 1A3EH 2J98A 2AIQA 1V2ST 1LPZB 2FOCA 1W0KD 5C0TA 1EATA 2VH6A 1GHZA 1ZTKA 2P16A 1MUEB 3N7OA 3AW0A 4AGKA 1KDQA 2G51A 1HB0B 1WSSH 3QN7A 3CP7A 1UK2A 4RT0A 1EJMA 3H7OA 1C5TA 3T62A 3TGKE 3PWBA 1VKYA 2UUKB 2VIOA 1GI1A 2QYIA 1GBJA 5A8XA 2QF5A 2HVYB 3F2GA 3PROA 4Y8ZA 3VB4A 1AFEH 3BTME 3I78A 1TMTH 2A0QB 1BUIA 1GJ4H 2BYAX 2R3YA 3UR6A 2PKSC 4HI3A 4YOJA 5C94A 1VJ9U 4BTTB 1H8HD 1K9OE 1FY4A 5L30H 4B2BA 2TGAA 1XMNB 3BTGE 3LC3A 1O2VA 5E0JA 4CRDA 3DCLA 2QIQA 1C1PA 1A0JA 1V6DA 1E36B 2UUFB 1ZSKA 1MAXA 1FAXA 3W94A 2ZHEH 4ZMAH 1NU9A 1E35B 3VXEH 2ZHWH 1O2LA 1KIGH 2ZCLP 2TGPZ 2H6MA 2QC2A 2WPIS 1FY1A 1TABE 3PO1C 1TMUH 1TLDA 1ZGVA 1O2TA 1TX7A 1O2KA 3UNQA 3BG8A 5A8YA 1TOMH 3SNAA 2A31A 2W7SA 1BTPA 4TY6A 2QXGA 1GCDA 3M5LA 4CR5A 1A2CH 1O39A 4MTBA 1SBWA 4ISOA 3VFEA 2BY6X 1GMDG 4TPYA 2ZFFH 5BRRE 2FTMA 1XXFA 4O03A 3V12A 4WY3A 4NFEA 1W2KH 2FYQA 2BDHA 1GBKA 3F6UH 1P0SH 3K65B 5C2ZA 4HGCA 1F92A 1GJ8B 3TNSA 1VCPA 4U2WA 4IGDA 1PYTD 3A82A 3SJKA 2XXLA 1LKBA 2R2WU 5EG4A 5E2PA 3ZVEA 5IK2D 4Q4LA 3PLPA 3Q3KA 1AKSA 3S7KB 1QL8A 2OBQA 2ZI2H 4QT8C 1K2I1 2YMSC 3EGKH 3A88A 1HV7A 1SSXA 1H9LB 2ZU4A 1V2JT 5EPYA 1FIWA 1F2SE 1MBQA 3F68H 3GCHB 3HK6B 3SJIA 3PO1B 4P02A 4A5TS 4CH8B 4U01A 5C5NA 1DDJA 2BD4A 4FUHA 1VGCC 2P3FH 5TCAA 4RI0A 3QTVH 1K1MA 1GJAB 4ISNA 3L6PA 1VCQA 1YF4A 4JZDH 1UHBA 4B74A 1MKXH 7ESTE 1SLWB 1TNHA 2BD7A 1SGTA 3L3TA 2ZDKA 3NUMA 1EP5A 1C9PA 1GHBF 2BVXH 3AAVA 1GHXH 4AB9A 3LC5A 4MPVA 4AORA 1EQ9A 1FNIA 1GDQA 3RMLH 3V13A 4AC9A 1C5LH 1OOKB 1K1PA 1UK3A 2J5UA 1BBRK 3MU4A 1C5OH 4FUFA 4TWYA 2M2AA 3DFJA 4Y7BA 2FEQH 3TK9A 1AB9B 2XBVA 4KGAA 5PTPA 1GI3A 1WBGB 2A1DB 3QTOH 1C5UA 2FI4E 2NU0E 2RA0A 2Z3EA 1E79D 4FU9A 4SGBE 3ITIA 2CF8H 4CREA 2AYWA 2KX4A 1BJVA 1TNLA 2BDCA 2ZDMA 2QE7D 1C4Y2 1E1QD 2R0LA 2ZTZA 1F7ZA 2H9EH 4A92A 3L33A 2G4UA 2XYAA 5CE1A 2C8ZB 1NBMD 1QJ1B 1JXPA 1GVKB 1TRMA 2GMTB 1IOEA 2CHAB 2L6OA 4INHA 1MTVA 1C2EA 1KY9A 1O5AB 2Z3DA 3M3TA 4ZHAA 2BY5X 1A1RA 1HAOH 4B1TA 4WH8A 1ORFA 4VGCB 5C20A 3UQOA 4AOQA 1KXDA 3F9HA 5GWZA 3AK5A 3E8LA 1K1LA 2BD2A 2F9PA 1GCTC 1SL3A 1MU8B 2HPQH 3TGJE 3UNRA 1O2HA 3R0FA 1MZDA 2ODPA 3ZVAA 3ZZBA 1Z6JH 4INLA 4PROA 3RXBA 1IQHA 2OC7A 3E1XB 1AQ7A 1ETRH 1MTUA 2ZPQA 1BJUA 4GHQA 1HJ9A 4UE7H 2SGFE 2TIOA 5EQSA 2H9HA 5FPYA 4XRNA 1CT0E 1O2ZA 3U8OH 2YNBA 5HYOA 2QXHA 1DVAH 2HALA 2JDID 1QL7A 2Q6FA 4A1XA 3MO9A 1U6QA 1BA8B 4K3JA 3RXKA 2GCHG 1D9IA 1SGEE 2PW8H 2BVSH 1QJ7B 2ZDLA 4Y10E 5JB8S 1DWBH 2GJGA 1P02A 3F1SB 4ABFA 1D3QB 1HXEH 2VVUA 4O97A 1S85A 3OU0A 1G30B 4FXGH 1BT7A 2P95A 1V2LT 1MZAA 1QQ4A 2PR3A 2PWXA 7GCHF 5DKMA 3GCNA 2H5DA 2RA3A 4X2WA 1UTPA 1RTKA 3A8CA 1E0FD 1FY5A 3OTJE 6ESTA 4YOGA 4AFQA 1MKWK 4X6NA 1C5WB 1ZYOA 3FP6E 4IN2A 3GDSA 4X2YA 3STJA 2FI5E 2WV4A 4DGJA 3P8FA 2VB0A 1OWKA 1CGHA 2V6NA 3LH3A 4GCHF 1Z8RA 1UVOA 1AY6H 2WINI 3A8AA 1O2SA 5AHGH 4E7NA 4K8YA 1GCTB 3M7TA 1DUEA 1NY22 4P00A 3RXGA 8GCHG 1C2FA 1O38A 3SGAE 1GDUA 1THSH 3LGIA 1TNKA 1UTKA 2XNDD 2RFKC 2PUQH 4IW4E 1FUJA 4LZ1H 3HK3B 1MTWA 1TONA 4UFFH 1ARBA 3LT3A 3M37A 2Z6BD 2A2XH 1FLEE 3BTHE 1O33A 1P2MA 1K1JA 5DG6A 1QQUA 1RIWC 4XD7D 1AWFH 3GDUA 2AFQB 1O36A 2CN0H 3ZV9A 1NTPA 1GI7B 4X0WU 2NWNA 1EZSC 2BOKA 2B9LA 3E0PB 4NWKA 2C8XB 5A2MH 2W26A 3LU9B 1O3NA 5DN6D 1O3IA 1GBMA 1S6HA 5FCRA 2BDIA 2H9TH 4JK5A 1ZSLA 2JJ1D 1IQMA 2VNTA 5ABWA 3RXMA 4AZ2B 1MTNC 3RU4E 2RCEA 4MDSA 1QB6A 1ELAA 2J4IA 4CHAB 4I8HA 4UFEH 3GY6A 1DICA 4XSKU 1TBZH 1C1MA 1B0EA 1OP8A 3TJUA 3ZZ5A 4AFSA 2AMQA 1OWIA 2A2QH 1AD8H 3U8TH 4A6LA 1BMAA 3GS9A 9ESTA 3SZNA 1TGBA 3JZ2B 1TALA 4ZKOU 2WHXA 1LHGH 3SUGA 4D9RA 2BM2A 5GCHG 2BXTH 2R2MB 4TWWA 1SGDE 2WPDD 1SVPA 3ZZDA 2Z9IA 4AN7A 4I8JA 2TGDA 1GI5A 1UJ1A 2J98B 4FU7A 1ZMNA 4OS2A 2UUYA 4F4OC 3E0NB 1P2JA 2EQNA 4Z0KA 3PTBA 2GVFA 2IPHA 1H1BA 1MBMA 1PFXC 2IN2A 3HKIB 2R3UA 4HFPB 5EXNA 3E3TA 1KDQB 1FIZA 2GCTC 5B6LA 1THPB 2VGCC 3MO6A 3ZZ7A 2KCOA 3RC6A 2EC9H 1D6WA 1RXPA 3UREA 2O8TA 4TYDA 3P92A 5C3NA 1TNJA 3SNDA 3AAUA 1VCWA 3TK6A 1PQ5A 1OYQA 2SGPE 3QZRA 1JIMA 1DANH 4UD9H 4K69A 1WOFA 1E1RD 4MNYA 5EIYA 4X1SU 4Y0YE 1MTSA 1RTFB 1T4VH 1TX6A 3V3MA 1ZSJA 3HATH 3BEFB 2V3OH 4FUDA 1L1NA 1RRKA 3ZVCA 4D8NA 3JZ1B 2WZQA 1AMHA 3RXDA 2A4RA 1TNIA 3RMNH 2K1QA 4HTCH 3RMMH 3MNBA 3P8OA 4FUJA 3FKSD 2CK3D 3A85A 4Y76A 2FLBH 4IMZA 4MG3A 4Z6AH 3A84A 1NN6A 3BTWE 1BTYA 3QGNB 1TMBH 2PLXA 2EI7A 1P10A 5L2YH 3F3BA 1VITF 3EYDA 3IWMA 3MTYA 1ZMLA 3DSOA 2XOKD 2XNIA 1AI8H 1CVWH 1BRAA 1HAHH 2ZHFH 2GX4A 3UAIC 4ZAEA 2XTTB 1QTFA 1WXRA 1O3PB 4F49A 1ACBE 2G00A 2ODQA 1EB2A 2F91A 1IAUA 3MH6A 2FPZA 1HJ8A 1BDAA 1PQ8A 1Y5AT 5HM2A 4A1TA 2FX6A 2NU1E 1PQAA 1SGQE 1TGCA 4YTAA 1XUIA 2VVCA 1QRXA 1QB1A 1O2UA 1S82A 1BITA 2SNWA 5KECA 1C5XB 5C1YA 2UWOA 1NPMA 2FDAA 2KFWA 4BTUB 1HPGA 1ZRKA 4CRBA 5T6FA 3A7ZA 1AO5A 3R3GB 3P70B 2M5TA 2ZFRH 2ZFTA 5F53A 1CHOG 3ZZ4A 3GCOA 2CXVA 4RKOB 2ZG0H 1AVXA 5ESTE 4F48B 1EJAA 5F8ZA 2BMGB 3RXLA 1DT2A 1RTLA 1DFPA 1YPMH 1C1SA 3GOVB 2ZKSA 1ELEE 1HNEE 2XBYA 1E37B 1CGJE 3RXFA 1L4DA 2BY7X 1AKSB 4NA7A 1WUNH 2BDAA 3D49H 6CHAB 1SOTA 4BNRA 1G32B 2SGQE 1HJAB 3EE0B 3FP7E 4BAOB 2Z9GA 1QJ6B 4OGYA 1MD8A 4XFQA 1ABJH 1ESBA 4X6OA 1LHDH 1GI2A 2W3KA 4NCYA 1AFQB 3ATMA 5GPIB 2FXRA 1JRTA 3ZZCA 4AX9H 4NSVA 3M5OA 1PQ7A 3M7QA 4B6EA 2FODA 1T32A 1AVGH 3V0XA 8ESTE 2FX4A 1O3GA 1P2OA 1UHBB 1EP6A 1XUGA 1A7SA 1C5SA 2F4LA 1OP0A 1Z71A 4SGAE 1QRWA 2THFB 3MOCA 2HNTF 1KXFA 3F9FA 2PFEA 3DSPA 3O8RA 4TT3D 2P59A 1P06A 1ZHRA 4LK4A 1Q2WA 1FV9A 3VXFH 1GMDF 1EFRD 1ESAA 1SGNE 3WWFA 1MKXK 1NU7B 3SU0A 4Y11E 1C2KA 2QF3A 5J4SA 1Y8TA 3UWJH 2BDBA 1LPKB 3KQBA 2Z94A 3STIA 6LPRA 1RS0A 5FCKA 1IQGA 1V2KT 1HXFH 3GYMA 1C1UH 1SGFA 1EAUA 3FOAA 1HFDA 1TRNA 1KLTA 5GDSH 2TGTA 2FOHA 1MCTA 4UDWH 4B6FA 3OYPA 1ZZZA 1W7GH 1GJDB 2XC4A 1AWHB 5DP4A 2VIVA 4OM9A 3U9AH 1BRUP 1PJPA 3LGYA 3S0NA 5DP9A 1YPHE 5HIYA 1V2TT 2TBSA 1YLNA 5A8ZA 2YOLA 3Q00A 1L2EA 1OWHA 1OX1A 1BIOA 1HGTH 1CT4E 1EPTA 1FY8E 3MI4A 3TJNA 4IS5A 3N99A 4BOHA 4DIHH 1TYNA 3TJOA 4AYYB 1OWEA 3F9GA 2C4FH 3PRDA 2SFAA 1K1IA 3UNSA 2XC5A 5TCCA 2DE9A 3ZIAD 2BX3A 3SGBE 3K2UA 1LCYA 2EI8A 1DLEA 1O2NA 1E34B 1LHEH 2VIQA 1G37A 1YPHC 3S69A 1CA8B 3MHWU 1O32A 3SV2H 1O3OA 5AFYH 5FX5A 4DVAU 5FXLA 2AMDA 1KLJH 2BD3A 4I8LA 1YPGH 1O2JA 4Q80A 1E38B 4BAMB 5EOKA 1EZQA 3SZEA 5F8XA 5JDUB 1S0QA 4I8KA 4TSFD 2GZ8A 2BQWB 2GT8A 3SQHE 5EJ1A 1BMNH 1PPZA 1G2MA 2UWPA 1O5BB 2F9VA 4LXBH 3GCHC 1HAPH 2WYJA 1YCPH 4BAKB 3SNBA 1SQTA 2A5IA 3LGVA 3RP2A 2GV7A 4ZXYH 4BXSA 1K28D 2I6QA 1TQ7B 4CBOA 1LVYA 2D8WA 2G5VA 3OY6U 1EKBB 4JCNA 2O9QA 1T8LA 1P3CA 1G36A 1PPGE 2VBCA 1FPHH 2J95A 1BTUA 3SYJA 1BMFD 1LTOA 3MQKC 1GMHG 1SGPE 4NZQA 4YLUA 2Y80A 1EOJA 1O3DA 1QA0A 2OLGA 3FAOA 4NIXA 2BX4A 2G55A 5F6MA 1P9UA 3NK8A 1GVLA 1EAIA 2P3UB 2A5AA 2BLWA 4H4FA 4MVNA 1KSNA 1PPEE 2GT7A 1AB9C 4D7GA 1A61H 1SGIB 1TB6H 2FESH 1O3FA 3KQEA 1P09A 3P17H 1MCVA 2OC0A 5HKKD 1S81A 4AG2A 4K2YA 1DSTA 3BV9B 3SUDA 1XVMA 3LGTA 4ZCNA 2GCHF 1S0RA 1RFNA 2ZU5A 4NA8A 1XKBC 2G8TA 3SU2A 1DX5M 2O8WA 2PHBA 1P2QA 4Y79A 2GDEH 1HBTH 1AZZA 1ZTJA 2GGVB 1V2NT 3BG4B 1OKXA 2HPPH 2ZFPH 4NIYA 4OS7A 1P11E 2CHAC 2GMTC 2HVXA 3F2FA 1ANBA 5FBIA 1OWJA 1SLVB 3LIWA 4VGCC 1D6RA 4BXWA 3KGPA 2Z9JA 4GUXA 1LQEA 8GCHF 1J14A 4YZUA 5AF9H 2FP7B 1XVOA 3SHCH 3LONA 4K60A 4NSYA 1O2OA 3VGCB 2HGTH 3M5NA 3DHKH 3OFND 4ZKRU 4Z1MD 1Y3UA 1PYTC 1MMJN 1UTJA 4ZHMU 3VG8A 1CBWB 5T6GA 1KXEA 1W12U 2OP9A 1Z7KA 2IJOB 1TGSZ 2W6ID 3MU5A 1C5MD 1EXFA 3F0OA 2ZPSA 1YYY1 2ZGJA 5E0GA 1Y3YA 3EA9A 5CHAB 2KAIA 1J17T 1MQ6A 4IBLH 5LPRA 5C17A 1G2LA 1A4WH 1GBDA 3H5CB 1MD7A 4FVBA 4YXWD 3D62A 1NRNH 1SOZA 2GDDA 2ILNA 4B73A 1O2PA 3S9CA 3W95A 1GBBA 2JETB 2XWAA 3PRBA 2ZEBA 3BEIB 4WMEA 3TNTA 3IG6B 1QGFA 4FUBA 2PGQB 2Y5GA 4TPIZ 1P2NA 4XOJA 3RXQA 2OUAA 1O34A 3A8BA 1TRYA 1P04A 3V7TA 5L6NH 5FL7D 3B9FH 1IHTH 4NGAH 3P8NA 3QWCH 1QHRB 3BTQE 2Y6TA 1O2RA 1W13U 2SGAA 1C1RA 1DM4B 1O3JA 2BXUH 2Y5FA 2Z7FE 5GCHF 3SNCA 1O3LA 2QV1A 4WVPE 3VB3A 4E06H 3RXPA 2WYGA 3SU6A 1J9CH 3T25A 1VR1H 1NM6A 1NFYA 5J4QA 1F5LA 2Y5HA 2H5CA 5T1VA 1CQQA 2XW9A 1AU8A 1TPAE 1V2VT 1LO6A 2ASUB 4FOUC 1BRCE 1S84A 1GI4A 4RT1A 1HAYB 5GXPA 3KL6A 4R0IA 1XXDA 5EJLA 4CHAC 1C4U2 1KXAA 5CHBA 3ZVGA 2DUCA 2TPIZ 1GHAG 1GVZA 1C2LA 2ANYA 3CS0A 4YLQH 1AZ8A 1SFIA 2ZTYA 1EZXC 4AFUA 1AGJA 5T6DA 1YPJH 1H9IE 4K5ZA 2Z9LA 3FANA 3GDVA 2NU3E 3RDZA 4F55A 1SC8U 1O3AA 1TPPA 1GGDB 2BHGA 5BPEA 2ZA5A 1XX9A 4GPGA 4IN1A 1K1OA 5FX6A 1RD3B 3HKJB 1GI9B 2L74A 2V7QD 4ZXXH 1KXBA 2OC8A 3U1JB 2A7JA 1FQ3A 3TH4H 1J15A 4J1YA 1UK4A 1YC0A 1GDNA 1ARCA 5G4BA 1TWXB 2ZDAH 2JJ2D 1YCPM 1Q31A 1GHWH 1Y5BT 1EUFA 2QCYA 4INKA 1C5NH 2EA3A 1UO6A 1OWDA 1S5SA 1T8NA 1G3EA 1FPCH 1QURH 4XDEA 2BQ7B 2GZ9A 5DP8A 2XRCA 2ZHDA 5KEDA 1SQRA 1QFKH 2FOGA 1UVUH 1UTNA 2QA9E 3RXAA 3TIUA 2VVVA 1GJ9B 1IQKA 5LPEA 5AVDA 1O5DH 2OQUA 4GVUA 1K1NA 2Y7ZA 1YPLH 5L2ZH 1ZMJA 2QF4A 3MWIU 1EZUC 2GV6A 4K1EA 4B2CA 2FZZA 3LGUA 3GY7A 3RU4D 1HRTH 5DSFA 3W1EA 3H7TA 1QBNA 2ULLA 8LPRA 1O5CB 4A1VA 2FOMB 1XUJA 1CU1A 1ETSH 1QB9A 3ZVBA 3OSYA 1DWDH 4YT7H 1QNJA 5I25A 2FOEA 1NESE 1CHOF 1QIXB 3SV6A 1WAYB 2VWLA 4H6TA 1TGTA 1SHYA 2FI3E 5FAHA 1EOLA 1H8IH 4Y6DA 1GJ7B 3C27B 1DPOA 1Z8IB 3GISB 3ZZAA 1O2IA 5GJ4B 1DWCH 1SMFE 1DSUA 1OS8A 2BD5A 1KMHB 3RXHA 3GICB 2D26C 1ELBA 4KTUA 3RXJA 3SU3A 1V2PT 3ZV8A 2BOHB 5GIBA 4D9QA 3LJOA 4ZHLU 1OXGA 1HAGE 2J92A 3SJOA 1SQAA 3BEUA 1UW7A 5SGAE 1RGQA 1MH0A 2XWBI 1C5RA 1FMGA 3ZYEA 1EPTB 3AW1A 2ZHQH 4D7FA 2A4GA 2BY8X 1AHTH 3CS7A 3KQ5A 3M3SA 5A0AE 1YKTA 1BTZA 2V3MA 4DOQA 1GHYH 4WH6A 3OE7D 3U69H 3SI3H 4AFZA 2ZU2A 1DXWA 1EAXA 1YM0A 3BTEE 1Z8GA 3ZZ9A 1O35A 4ISLA 3RXEA 2VWNA 4AG1A 2QAAA 2LPRA 3SI4H 2FM2A 2ZO3H 1AUTC 4ESTE 3A7XA 3G01A 3I29A 3S9AA 3HPTB 2AERH 1D3TB 1DLKB 1O31A 1NFXA 2OBOA 5ESBA 2BVRH 3SJ9A 4MPXA 3SW2B 3Q76A 2HLDD 3IITA 1K21H 4X8VH 2P94A 1MABB 1HAIH 3PM3A 4WMFA 1GMCG 1M9UA 3RXUA 4BAHB 3UOUA 1UVTH 1SI5H 3Q3YA 3OTPA 4Y0ZE 2ZDVH 4CRAA 1HLTH 6CHAC 3K6YA 3A80A 3SGQE 3RLWH 5C5OA 1HJAC 1SLXB 1GBLA 2BLVA 2C3SA 2LNCA 2ZGHA 1UTMA 1DITH 1AFQC 3DUXH 4YM9A 1A5GH 4UFGH 1MAYA 4YT6H 1BHXF 2K8IA 3MH7A 2CJIA 1EJNA 1SGYE 1TQ0B 1XUKA 3TH3H 4AB8A 1GBTA 4I31A 5EQQA 1CO7E 3BIVH 3SOSA 1HIAB 2LELA 1YCPK 2A4QA 3QO6A 4KP0A 1F5KU 2Q6GA 5DP6A 1QZ8A 4WXVA 3VB5A 1CT2E 1A3BH 3GY5A 3D65E 4ABGA 5HXFA 3TGIE 3TK5A 5F8TA 2W5EA 5JBTA 4ABHA 1D3DB 2Z3CA 3EDXB 4FETA 3A81A 4FUEA 3SNEA 5EODA 2Q1JA 1W11U 1N8OB 3CENA 4AGJA 3M5MA 3MYWA 1BTXA 5I46H 1LVOA 1XKAC 4WWYA 1LPGB 2W3IA 4O3UA 2WPMS 1C2HA 1ID5H 2A5KA 2B0FA 4X8UH 4ZUHA 1ABIH 4CR9A 4TY7A 4JYTA 2UUJB 1F0TA 3B8JA 4X1RU 3ESTA 1YPKH 1NRQH 1T8OA 3GCTG 3MU0A 4ABAA 2J9NA 2WPJS 1NO9H 2KCAA 1DE7H 2V35A 1O0DH 3FZZA 2P8OB 1FZZA 3O8CA 3NZIA 1LMWB 3KQDA 4KKDA 3RXSA 1WDIA 4X8TH 1TA2A 4FUGA 1YY3A 1FAKH 3FP8E 2XBWA 3VB7A 1O37A 2QF0A 4DW2U 1ZOMA 1JIRA 4I86A 1GMHF 1C2JA 5EXMA 1DOJA 1QA7A 1J8AA 1TGNA 1SLUB 2VIPA 2YNAA 4DG4A 1Y59T 2PSXA 5ETXA 1GJ5H 3K6ZA 1C5YB 4OS6A 1AVWA 4XBBA 3KYFA 3RM0H 3SORA 1AN1E 1MQ5A 1Y3XA 1ZTLA 2IPQX 2P3TB 3ZZ3A 2ZDNA 4Q7XA 1GL0E 1GBAA 1Y3WA 1ELFA 3NPSA 3MH4A 3RM2H 4B2AA 4ZROA 2J38A 2KAIB 4X2XA 4ASUD 4DIIH 4X8SH 8KME2 1DY9A 1IQJA 2HOBA 5DP3A 1W0ZU 1QR3E 2BDYA 3QLPH 2PKAA 1FY3A 4ZKSU 4GSOA 3I77A 1V2RT 4WJG2 5EQRA 4LOYH 3MNXA 3RXTA 3UOPA 4NZLA 2FOBA 1UCYE 1B0FA 3M35A 3QX5H 4DT7B 2WV5A 5DPAA 2ZU1A 3DFLA 3M3VA 1O3KA 1V2OT 3MH5A 3CNRA 2BD9A 5EJZA 4B75A 2F9BH 2PUXB 3BN9A 1CA0B 3TLOA 4CRCA 2AGEX 3S9BA 3FO8D 5FBEA 5GNDA 2G81E 4THNH 1HUTH 1EAWA 1C5QA 1CE5A 2ZCKP 1GL1A 3A87A 1ZJKA 2GZ7A 2HRVA 3SBKA 3SU4A 4NIVA 3E6PH 2FS8A 3SV8A 2ALVA 1P03A 2GKVE 2AHME 3QZQA 3M7UA 3O8BA 5T3HA 3GY4A 3PV5A 3SU1A 1C2MA 4YESB 4U32A 4Q63A 3BTDE 3C1KA 3SV7A 4E05H 1WCZA 1O3BA 1GG6B 4H42U 2SNVA 4WMDA 1GI8B 1UTOA 1AUJA 3UUZA 3DT0H 1QL9A 1L1JA 1LHFH 5CMXH 2WV9A 2ZFSA 3A7VA 4DY7B 1V2QT 5HM9A 1NRRH 1YPEH 3T5FH 1EB1H 1OSSA 3ATLA 3P6ZB 3RC5A 3RXOA 2R0KA 5DP5A 1UCYH 5DO4H 3BG4C 4JK6A 2PP6A 4JZIA 3NWUA 1SGCA 4CRGA 2G5NA 1XUFA 1FXYA 1O2YA 2ZGXH 3EQ0H 3F0PA 2AS9A 5EU8A 4YO9A 3TVJB 1L1GA 1HIAA 4R8TB 5DJ7A 3UFAA 2PTCE 1C5PA 2ZNKH 1C5VA 3MMGA 4ACBA 1JWTA 1C1OA 3RUOA 4ABIA 1BOQA 1TBRH 4X6PA 3VGCC 1O2XA 2YMSD 1DS2E 1Z8JB 1SKYE 1OYTH 2GTBA 2FWWA 1CBWC 6GCHG 5A0CA 5C1XA 5DGJA 1YWUA 1ZHMA 2H2ZA 2WSSD 1C4V2 1CHGA 1V2MT 1PPHE 2ODYB 4X1NU 4K1TA 3SJ8A 1P8VC 1SQOA 1TIOA 4FUCA 2F3CE 5HIZA 3QUMP 1P2KA 3A7WA 2J97A 4I32A 2ESTE 1SG8B 3P8GA 3SQEE 5CHAC 1O3MA 2FOFA 2AMPA 2JH6D 2PKSB 3UTUH 2ZGBH 4X6MA 1G9IE 1HAVB 5E0HA 1P3EA 1AIXH 1ZPBA 1IQNA 3LH1A 2ZFQH 1PPCE 1BTHH 2JETC 2ZC9H 2QXIA 4OS1A 4Q2KA 3KEEA 5JPMH 3UR9A 1GHAF 3HGNA 5JYIA 4YOIA 2AGIX 2KCYA 4Y71A 2W7UA 4KTCA 3BTFE 1SGRE 1B7XB 2ZZUH 3F2HA 4IC6A 1F0UA 2AH4X 5DK1A 4MLFB 1H9HE 2STAE 3LGWA 1BQYA 1L4ZA 3KN2A 5H4IB 3DA9B 2FS9A 1IQFA 2GP9B 1O3HA 4NWLA 2HLCA 4NIWA 1BRBE 3AASA 1QBVH 2WPLS 3NCLA 3U98H 1BZXE 1WTGH 1Z1JA 1NT1A 4OS4A 3T26A 2P93A 2A4OA 4ABDA 1SFQB 2PV9B 3TPIZ 4XBDA 1Y5UT 3PYHA 3O8DA 2GD4B 1Y3VA 4Y8XA 1ELDE 2OTVA 2VIWA 1MU6B 1WTHD 4OGXA 4M7GA 2F43B 4JMYA 2OQ5A 1IQIA 2ZIQH 5EW1H 2XCFA 1GJ6A 2FMJA 3U28C 3PV4A 1HAXB 3KNXA 3MFJA 2ZCHP 2FO9A 2RG3A 4E7RG 1Z6EA 4FVDA 1LHCH 1NBME 3GY8A 4UFDH 2WPHS 1V2UT 1Z1IA 2BB4A 2BLQA 5JB9S 3EA8A 5LH8A 1IHSH 3RXCA 2F9UA 1W8BH 2YMSB 4NA9H 2AEIH 4KTSA 1NS3A 4MNWA 1O2WA 2JKHA 2R9PA 5FPSA 2O8MA 3FVFB 1UMAH 2PTNA 2AIPA 1WQVH 5FHTA 1ZJDA 1W3CA 1ZLRA 4DCDA 1GGDC 4K1SA 1BTWA 1W14U 2NU2E 3LKWA 1NROH 2J34A 2CF9H 2ZU3A 1VGCB 1JRSA 1KLIH 2ZP0H 1NRSH 2ANKH 3A7TA 2K0QA 3T27A 1TPOA 4AYVB 3RU4T 1D3PB 2HWLB 4FU8A 1ELGA 2A32A 4ASHA 1N6XA 1SB1H 1TNGA 2CGAA 1F5RA 1NFUA 1VZQH 1W0JD 3DSGA 1WQSA 2VJ1A 3A89A 3M36A 3OX7U 3LOXA 4WF8A 1INCA 1VJAU 2EY4C 2BZAA 1T31A 3LDXH 2EEKA 4KELA 1O2MA 1THRH 2ZTXA 3BTTE 2CMYA 3SU5A 3D23A 2J94A 4ISIH 1JBUH 1NC6A 3LPRA 3Q3XA 3U8RH 4DT4A 1BB0B 1DXPA 1HCGA 1TX8A 2QXJA 1HYLA 3MO3A 1G3BA 2BTCE 4O3TA 2OD3B 3URDA 4NG9H 7KMEH 3SV9A 3PB1E 5LGOA 3A7YA 1ELVA 4GLYA 3SO3A 3ZYDA 4JZ1A 1FJSA 1LQDB 3ODFA 3A83A 3PMJA 2ZQ1A 3NKKA 5EW2H 1LKAA 3BIUH 2OC1A 3VEQB 5K7RA 5TJXA 1A0HB 1P01A 2IJD1 5AFZH 5JBBS 2FOAA 1FX0B 1H4WA 4K8BA 2STBE 1LDTT 2G4TA 4BAQB 1HAZB 3PWCA 4ABEA 3ENSB 2QN5T 1G3CA 2Y7XA 1HDTH 4XBCA 2VINA 1GHBG 1UTQA 1GMCF 1GI6A 3MNSA 4O9VA 1LVMA 5K0HA 3ZVDA 1BBRE 2VWOA 1FONA 2DE8A 3RXVA 4CH2B 2CV3A 4UONA 2FIRH 3MU1A 2KCPA 4B76A 7LPRA 1GBFA 2ZGCA 4X2VA 2ZQ2A 1HAVA 1JOUB 3QGJA 4J2YB 1BCUH 3HGPA 1WV7H 1EX3A 3ZZ8A 4DJZB 1A5IA 1EPTC 1SHHB 2D1JA 3U1IB 3LJJA 1GBEA 4ACAA 2Z9KA 3UY9A 1QBOA 1P2IA 1GBIA 1OP2A 1L0ZA 1TOCB 3M61U 3A8DA 2Y82A 2ZWLH 1O2GH 1O3EA 1O5EH 1T8MA 1C5ZB 4Q7ZA 5HGGA 1CGIE 1WU1A 3PLKA 3MNCA 2QGRA 2JIZD 3BSQA 4MNVA 1B5GH 1IQEA 1C2IA 4IMQA 2F9OA 1GI0A 1ETTH 1O5FH 4B71A 2C8YB 5EPNA 3SUEA 1F0SA 3FN8A 1SR5C 1VITH 4JYVH 5EGMA 1O5GH 1RJXB 1C2GA 1LVBA 3UWIA 2NU4E 2FYRA 1FN8A 4XE4A 1P57B 2WPKS 1C1TA 1OHHD 3ATIA 3ZZ6A 1BBRH 1ZGIA 2B7DH 2A45B 4CRFA 3TITA 1C1VH 5LPFA 2BQ6B 1C1WH 3GYLB 3ODDA 3WWBA 2PKAB 2Q6DA 2VIDA 2ZPRA 1P05A 4MNXA 3SHAH 1ANCA 5JBCS 4WXIA 4H6SB 3PMBB 1N1LA 1O2QA 2BZ6H 3GCTF 5C0UA 1DUAA 2OCVB 3FZDA 4FUIA 1T4UH 1DY8A 1RIWB 4MPUA 4IC5A 1ZRBA 5IYTA 1ELTA 3E90B 1KYNA 5HMAA 1TBQH 2KZ4A 4MPWA 2RDEA 2XBXA 4GHTA 2HNTE 2ZECA 4JZEH 3OEED 3ELAH 2TRMA 1KXCA 3KF2A 3P95A 1UTLM 4Y8YA 2OK5A 1WYKA 2BDGA 1KTTB 2H1UA 1W0YH 1W10U 2PSYA 1CSOE 1A5HA 3NRLA 1D4PB 1P9SA 1GJCB 1C1NA 7GCHG 1QCPA 4CBNA 1ESTA 2F83A 2WUBA 3QK1A 1MTNB 5KGOA 3NXPA 3KYGA 3PMAB 1BMLA 2D2DA 1XM1A 2A7CA 1ZPCA 3AVZA 3UIRA 2J2UA 3H09A 4X1QU 3OEHD 3T2NA 2ANMH 1FI8A 1QY6A 3E16B 2C8WB 4I33A 3PTNA 3WY8A 2V3HH 3B23B 1NRPH 4GCHG 5DP7A 2V0BA 3T29A 4JZFH 1YLDA 2PGBB 1N8OC 2BLOA 1BHXB 4MQAA 3MU8A 2QY0B 5EXLA 4JYUH 2JH0D 1GHVH 3OAAD 3N7DA 3TH2H 2XC0A 3BTKE 3TJVA 3RXRA 2HNTC 2B8OH 3ATKA 1C9TA 3EE7A 1YP9A 2VWMA 1O30A
chains in the Genus database with same CATH topology
1GJBB 5A09A 2FLRH 2A7HA 3T28A 5A0BA 4U30A 1ZHPA 4ABBA 1ZR0A 2P8OC 3PLBA 2BY9X 1PPBH 1YBWA 1UCYK 2C93B 5F03A 1ZPZA 1QRZA 1TAWA 3RLYH 4ABJA 1MKWH 4ISHH 1GBCA 4LZ4B 2GCTB 4Q7YA 1YGCH 2VGCB 1GPZA 1PPFE 1TFXA 3F9EA 1ANDA 2XCNA 4ZKNU 1JMOH 2SGDE 3RXIA 2IOTA 3RC4A 3BF6H 2ANWA 1S83A 4OS5A 1ANEA 4A7IB 1V3XA 3KHVA 1V2WT 3KIDU 3Q77A 1UVPA 1C1QA 1W7XH 3UPEA 3K9XB 5FPTA 3PMHB 2C90B 4GAWA 3RMOH 2ZF0H 3URCA 3S7HB 3VB6A 3KCGH 2UWLA 3EA7A 1T7CA 2SGEE 3EAJA 3QDZB 5JBAS 5C67A 1YLCA 2EI6A 1OPHB 2O8UA 3SUFA 2VH0A 4RN6A 1UVSH 4BANB 2RDLA 1GWAA 4I8GA 1TE0A 1TA6A 1XUHA 3VPKA 2Y81A 2OINA 9LPRA 3GY2A 1ELCA 3DD2H 2FTLE 1S6FA 1P12E 2JH5D 1FDPA 5C1UA 1O3CA 1SGFG 2F9NA 4X1PU 1AE5A 1TPSA 2OXSA 3OY5U 4UEHH 1CA0C 1C2DA 1Q3XA 1F0RA 4HZHA 4DURA 3UQVA 3SN8A 4BTIB 3FFGA 5IDKA 3KQCA 1J16A 4RSPA 1GBHA 3E91A 1A46H 1EASA 6GCHF 1NZQH 4ZH8A 2BD8A 4I7YH 1NFWA 2AGGX 1GG6C 4NFFA 3ATWA 1IQLA 1K22H 3GY3A 5E2OA 1BMMH 1SPJA 1X7AC 5B6OA 1DWEH 1G3DA 4D76A 4RKJB 4Y7AA 1FN6A 2I6SA 2WUCA 3ZVFA 5E8EH 2O8LA 1AE8H 3TU7H 1A0LA 2ALPA 2B5TB 1KTSB 2G52A 1N6YA 1VITG 3A86A 1H8DH 2VU8E 1A3EH 2AIQA 1V2ST 1LPZB 2FOCA 1EATA 2VH6A 1GHZA 1ZTKA 2P16A 1MUEB 3N7OA 3AW0A 4AGKA 1KDQA 2G51A 1HB0B 1WSSH 3QN7A 3CP7A 1UK2A 1EJMA 3H7OA 1C5TA 3T62A 3TGKE 3PWBA 2UUKB 2VIOA 1GI1A 2QYIA 1GBJA 5A8XA 3PROA 4Y8ZA 3VB4A 1AFEH 3BTME 3I78A 1TMTH 2A0QB 1BUIA 1GJ4H 2BYAX 2R3YA 3UR6A 2PKSC 4HI3A 4YOJA 1VJ9U 4BTTB 1K9OE 1FY4A 5L30H 4B2BA 2TGAA 1XMNB 3BTGE 3LC3A 1O2VA 5E0JA 4CRDA 2QIQA 1C1PA 1A0JA 1V6DA 1E36B 2UUFB 1ZSKA 1MAXA 1FAXA 3W94A 2ZHEH 4ZMAH 1NU9A 1E35B 3VXEH 2ZHWH 1O2LA 1KIGH 2ZCLP 2TGPZ 2H6MA 2QC2A 2WPIS 1FY1A 1TABE 3PO1C 1TMUH 1TLDA 1ZGVA 1O2TA 1TX7A 1O2KA 3UNQA 3BG8A 5A8YA 1TOMH 3SNAA 2A31A 2W7SA 1BTPA 4TY6A 2QXGA 1GCDA 3M5LA 4CR5A 1A2CH 1O39A 4MTBA 1SBWA 4ISOA 3VFEA 2BY6X 1GMDG 4TPYA 2ZFFH 5BRRE 2FTMA 1XXFA 4O03A 3V12A 4WY3A 4NFEA 1W2KH 2FYQA 2BDHA 1GBKA 3F6UH 1P0SH 3K65B 5C2ZA 4HGCA 1F92A 1GJ8B 3TNSA 1VCPA 4U2WA 4IGDA 1PYTD 3A82A 3SJKA 2XXLA 1LKBA 2R2WU 5EG4A 5E2PA 3ZVEA 3PLPA 3Q3KA 1AKSA 3S7KB 1QL8A 2OBQA 2ZI2H 4QT8C 1K2I1 3EGKH 3A88A 1HV7A 1SSXA 1H9LB 2ZU4A 1V2JT 5EPYA 1FIWA 1F2SE 1MBQA 3F68H 3GCHB 3HK6B 3SJIA 3PO1B 4A5TS 4CH8B 4U01A 5C5NA 1DDJA 2BD4A 4FUHA 1VGCC 2P3FH 5TCAA 3QTVH 1K1MA 1GJAB 4ISNA 3L6PA 1VCQA 1YF4A 4JZDH 1UHBA 4B74A 1MKXH 7ESTE 1SLWB 1TNHA 2BD7A 1SGTA 3L3TA 2ZDKA 3NUMA 1EP5A 1C9PA 1GHBF 2BVXH 3AAVA 1GHXH 4AB9A 3LC5A 4MPVA 4AORA 1EQ9A 1FNIA 1GDQA 3RMLH 3V13A 1C5LH 1OOKB 1K1PA 1UK3A 1BBRK 3MU4A 1C5OH 4FUFA 4TWYA 3DFJA 4Y7BA 2FEQH 3TK9A 1AB9B 2XBVA 4KGAA 5PTPA 1GI3A 1WBGB 2A1DB 3QTOH 1C5UA 2FI4E 2NU0E 2RA0A 2Z3EA 4FU9A 4SGBE 3ITIA 2CF8H 4CREA 2AYWA 1BJVA 1TNLA 2BDCA 2ZDMA 1C4Y2 2R0LA 2ZTZA 1F7ZA 2H9EH 4A92A 3L33A 2G4UA 2XYAA 5CE1A 2C8ZB 1QJ1B 1JXPA 1GVKB 1TRMA 2GMTB 1IOEA 2CHAB 4INHA 1MTVA 1C2EA 1KY9A 1O5AB 2Z3DA 3M3TA 4ZHAA 2BY5X 1A1RA 1HAOH 4B1TA 4WH8A 1ORFA 4VGCB 5C20A 3UQOA 4AOQA 1KXDA 3F9HA 5GWZA 3E8LA 1K1LA 2BD2A 2F9PA 1GCTC 1SL3A 1MU8B 2HPQH 3TGJE 3UNRA 1O2HA 3R0FA 1MZDA 2ODPA 3ZVAA 3ZZBA 1Z6JH 4INLA 4PROA 3RXBA 1IQHA 2OC7A 3E1XB 1AQ7A 1ETRH 1MTUA 2ZPQA 1BJUA 4GHQA 1HJ9A 4UE7H 2SGFE 2TIOA 5EQSA 2H9HA 5FPYA 1CT0E 1O2ZA 3U8OH 2YNBA 5HYOA 2QXHA 1DVAH 2HALA 1QL7A 2Q6FA 4A1XA 3MO9A 1U6QA 1BA8B 4K3JA 3RXKA 2GCHG 1D9IA 1SGEE 2PW8H 2BVSH 1QJ7B 2ZDLA 4Y10E 5JB8S 1DWBH 1P02A 3F1SB 4ABFA 1D3QB 1HXEH 2VVUA 4O97A 1S85A 3OU0A 1G30B 4FXGH 1BT7A 2P95A 1V2LT 1MZAA 1QQ4A 2PR3A 2PWXA 7GCHF 5DKMA 3GCNA 2H5DA 2RA3A 4X2WA 1UTPA 1RTKA 3A8CA 1E0FD 1FY5A 3OTJE 6ESTA 4YOGA 4AFQA 1MKWK 4X6NA 1C5WB 1ZYOA 3FP6E 4IN2A 3GDSA 4X2YA 3STJA 2FI5E 2WV4A 4DGJA 3P8FA 2VB0A 1OWKA 1CGHA 2V6NA 3LH3A 4GCHF 1Z8RA 1UVOA 1AY6H 2WINI 3A8AA 1O2SA 5AHGH 4E7NA 4K8YA 1GCTB 3M7TA 1DUEA 1NY22 3RXGA 8GCHG 1C2FA 1O38A 3SGAE 1GDUA 1THSH 3LGIA 1TNKA 1UTKA 2PUQH 4IW4E 1FUJA 4LZ1H 3HK3B 1MTWA 1TONA 4UFFH 1ARBA 3LT3A 3M37A 2Z6BD 2A2XH 1FLEE 3BTHE 1O33A 1P2MA 1K1JA 5DG6A 1QQUA 1RIWC 1AWFH 3GDUA 2AFQB 1O36A 2CN0H 3ZV9A 1NTPA 1GI7B 4X0WU 2NWNA 1EZSC 2BOKA 2B9LA 3E0PB 4NWKA 2C8XB 5A2MH 2W26A 3LU9B 1O3NA 1O3IA 1GBMA 1S6HA 5FCRA 2BDIA 2H9TH 4JK5A 1ZSLA 1IQMA 2VNTA 5ABWA 3RXMA 4AZ2B 1MTNC 3RU4E 2RCEA 4MDSA 1QB6A 1ELAA 2J4IA 4CHAB 4I8HA 4UFEH 3GY6A 1DICA 4XSKU 1TBZH 1C1MA 1B0EA 1OP8A 3TJUA 3ZZ5A 4AFSA 2AMQA 1OWIA 2A2QH 1AD8H 3U8TH 4A6LA 1BMAA 9ESTA 3SZNA 1TGBA 3JZ2B 1TALA 4ZKOU 1LHGH 3SUGA 4D9RA 2BM2A 5GCHG 2BXTH 2R2MB 4TWWA 1SGDE 1SVPA 3ZZDA 2Z9IA 4AN7A 4I8JA 2TGDA 1GI5A 1UJ1A 4FU7A 1ZMNA 4OS2A 2UUYA 4F4OC 3E0NB 1P2JA 4Z0KA 3PTBA 2GVFA 2IPHA 1H1BA 1MBMA 1PFXC 2IN2A 3HKIB 2R3UA 4HFPB 5EXNA 3E3TA 1KDQB 1FIZA 2GCTC 1THPB 2VGCC 3MO6A 3ZZ7A 3RC6A 2EC9H 1D6WA 1RXPA 3UREA 2O8TA 4TYDA 3P92A 5C3NA 1TNJA 3SNDA 3AAUA 1VCWA 3TK6A 1PQ5A 1OYQA 2SGPE 3QZRA 1JIMA 1DANH 4UD9H 4K69A 1WOFA 4MNYA 4X1SU 4Y0YE 1MTSA 1RTFB 1T4VH 1TX6A 3V3MA 1ZSJA 3HATH 3BEFB 2V3OH 4FUDA 1L1NA 1RRKA 3ZVCA 4D8NA 3JZ1B 1AMHA 3RXDA 2A4RA 1TNIA 3RMNH 2K1QA 4HTCH 3RMMH 3MNBA 3P8OA 4FUJA 3A85A 4Y76A 2FLBH 4IMZA 4MG3A 4Z6AH 3A84A 1NN6A 3BTWE 1BTYA 3QGNB 1TMBH 2PLXA 2EI7A 1P10A 5L2YH 3MTYA 1VITF 3EYDA 3IWMA 1ZMLA 2XNIA 1AI8H 1CVWH 1BRAA 1HAHH 2ZHFH 2GX4A 4ZAEA 2XTTB 1QTFA 1O3PB 4F49A 1ACBE 2G00A 2ODQA 1EB2A 2F91A 1IAUA 3MH6A 2FPZA 1HJ8A 1BDAA 1PQ8A 1Y5AT 5HM2A 4A1TA 2FX6A 2NU1E 1PQAA 1SGQE 1TGCA 4YTAA 1XUIA 2VVCA 1QRXA 1QB1A 1O2UA 1S82A 1BITA 2SNWA 1C5XB 5C1YA 2UWOA 1NPMA 2FDAA 4BTUB 1HPGA 1ZRKA 4CRBA 5T6FA 3A7ZA 1AO5A 3R3GB 3P70B 2M5TA 2ZFRH 2ZFTA 1CHOG 3ZZ4A 3GCOA 2CXVA 4RKOB 2ZG0H 1AVXA 5ESTE 1EJAA 5F8ZA 2BMGB 3RXLA 1DT2A 1RTLA 1DFPA 1YPMH 1C1SA 3GOVB 2ZKSA 1ELEE 1HNEE 2XBYA 1E37B 1CGJE 3RXFA 1L4DA 2BY7X 1AKSB 4NA7A 1WUNH 2BDAA 3D49H 6CHAB 1SOTA 4BNRA 1G32B 2SGQE 1HJAB 3EE0B 3FP7E 4BAOB 2Z9GA 1QJ6B 4OGYA 1MD8A 4XFQA 1ABJH 1ESBA 4X6OA 1LHDH 1GI2A 2W3KA 4NCYA 1AFQB 3ATMA 5GPIB 2FXRA 1JRTA 3ZZCA 4AX9H 4NSVA 3M5OA 1PQ7A 3M7QA 2FODA 1T32A 1AVGH 3V0XA 8ESTE 2FX4A 1O3GA 1P2OA 1UHBB 1EP6A 1XUGA 1A7SA 1C5SA 1OP0A 1Z71A 4SGAE 1QRWA 2THFB 3MOCA 2HNTF 1KXFA 3F9FA 2PFEA 3O8RA 2P59A 1P06A 1ZHRA 4LK4A 1Q2WA 1FV9A 3VXFH 1GMDF 1ESAA 1SGNE 1MKXK 1NU7B 3SU0A 4Y11E 1C2KA 2QF3A 5J4SA 1Y8TA 3UWJH 2BDBA 1LPKB 3KQBA 2Z94A 3STIA 6LPRA 1RS0A 5FCKA 1IQGA 1V2KT 1HXFH 3GYMA 1C1UH 1SGFA 1EAUA 1HFDA 1TRNA 1KLTA 5GDSH 2TGTA 2FOHA 1MCTA 4UDWH 3OYPA 1ZZZA 1W7GH 1GJDB 2XC4A 1AWHB 5DP4A 2VIVA 3U9AH 1BRUP 1PJPA 3LGYA 3S0NA 5DP9A 1YPHE 1V2TT 2TBSA 5A8ZA 2YOLA 3Q00A 1L2EA 1OWHA 1OX1A 1BIOA 1HGTH 1CT4E 1EPTA 1FY8E 3MI4A 3TJNA 4IS5A 4BOHA 4DIHH 1TYNA 3TJOA 4AYYB 1OWEA 3F9GA 2C4FH 2SFAA 1K1IA 3UNSA 2XC5A 5TCCA 2DE9A 2BX3A 3SGBE 3K2UA 1LCYA 2EI8A 1DLEA 1O2NA 1E34B 1LHEH 2VIQA 1G37A 1YPHC 3S69A 1CA8B 3MHWU 1O32A 3SV2H 1O3OA 5AFYH 5FX5A 4DVAU 5FXLA 2AMDA 1KLJH 2BD3A 4I8LA 1YPGH 1O2JA 4Q80A 1E38B 4BAMB 5EOKA 1EZQA 5F8XA 5JDUB 1S0QA 4I8KA 2GZ8A 2BQWB 2GT8A 3SQHE 1BMNH 1PPZA 1G2MA 2UWPA 1O5BB 2F9VA 4LXBH 3GCHC 1HAPH 2WYJA 1YCPH 4BAKB 3SNBA 1SQTA 2A5IA 3LGVA 3RP2A 2GV7A 4ZXYH 4BXSA 1K28D 2I6QA 1TQ7B 4CBOA 1LVYA 2D8WA 2G5VA 3OY6U 1EKBB 4JCNA 2O9QA 1T8LA 1P3CA 1G36A 1PPGE 1FPHH 2J95A 1BTUA 1LTOA 1GMHG 1SGPE 4NZQA 4YLUA 2Y80A 1EOJA 1O3DA 1QA0A 2OLGA 3FAOA 4NIXA 2BX4A 2G55A 5F6MA 1P9UA 3NK8A 1GVLA 1EAIA 2P3UB 2A5AA 2BLWA 4H4FA 4MVNA 1KSNA 1PPEE 2GT7A 1AB9C 4D7GA 1A61H 1SGIB 1TB6H 2FESH 1O3FA 3KQEA 1P09A 3P17H 1MCVA 2OC0A 1S81A 4AG2A 4K2YA 1DSTA 3BV9B 3SUDA 1XVMA 3LGTA 2GCHF 1S0RA 1RFNA 2ZU5A 4NA8A 1XKBC 2G8TA 3SU2A 1DX5M 2O8WA 2PHBA 1P2QA 4Y79A 2GDEH 1HBTH 1AZZA 1ZTJA 2GGVB 1V2NT 3BG4B 1OKXA 2HPPH 2ZFPH 4NIYA 4OS7A 1P11E 2CHAC 2GMTC 2HVXA 1ANBA 5FBIA 1OWJA 1SLVB 3LIWA 4VGCC 1D6RA 4BXWA 3KGPA 2Z9JA 4GUXA 1LQEA 8GCHF 1J14A 4YZUA 5AF9H 2FP7B 1XVOA 3SHCH 3LONA 4K60A 4NSYA 1O2OA 3VGCB 2HGTH 3M5NA 3DHKH 4ZKRU 1Y3UA 1PYTC 1MMJN 1UTJA 4ZHMU 1CBWB 5T6GA 1KXEA 1W12U 2OP9A 1Z7KA 2IJOB 1TGSZ 3MU5A 1C5MD 1EXFA 2ZPSA 1YYY1 2ZGJA 5E0GA 1Y3YA 3EA9A 5CHAB 2KAIA 1J17T 1MQ6A 4IBLH 5LPRA 1G2LA 1A4WH