1AUJA

Bovine trypsin complexed to meta-cyano-benzylic inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New inhibitors of thrombin and other trypsin-like proteases: hydrogen bonding of an aromatic cyano group with a backbone amide of the P1 binding site replaces binding of a basic side chain.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA02
2CHAB 4B76A 1BMAA 3R0FA 3PLBA 1PQ7A 1WQSA 6LPRA 2BD2A 1UMAH 4CH8B 2D1JA 4DOQA 1W7GH 2WPMS 3E6PH 3TJOA 3M61U 1J16A 2XNIA 3MU0A 1P09A 1ELGA 1EX3A 1V2PT 1BTUA 1C5WB 3L6PA 1P9SA 3RU4T 1CBWB 4D7GA 4ZHAA 1TA2A 2BTCE 1TNLA 2PKSC 5EU8A 1VITG 2ZQ1A 2VIVA 8LPRA 1V2UT 2YNAA 3T62A 3TJUA 4ABJA 3QO6A 1C5TA 1C1TA 1P04A 1O2WA 3UOPA 1OS8A 3OTJE 4XBBA 4XSKU 3V7TA 2OTVA 2A45B 2BDHA 2BXTH 2P95A 4ABFA 4YT7H 4CBOA 3LKWA 3TGIE 1MCVA 2STAE 4GVUA 1MBMA 3OY6U 1M9UA 1TIOA 1JMOH 2VH0A 3ATWA 2ANWA 3GYLB 4TPYA 3T2NA 2ASUB 1GHAF 2NWNA 2GT7A 1D6RA 1ANCA 1P02A 2RDLA 3KIDU 3UREA 1HAVA 3FAOA 3UY9A 5A8YA 4JK6A 1DFPA 1A5GH 1IHTH 1UVTH 2IPHA 5DGJA 2VJ1A 4INLA 2QXJA 2G51A 1DT2A 3ZVEA 3BSQA 4DCDA 1C1UH 1GWAA 4YOIA 3RC6A 3U9AH 4GPGA 2FOFA 3FVFB 4K8BA 1BCUH 1ESBA 1T8NA 1S84A 1BTYA 1FLEE 1B5GH 2BXUH 1F0TA 4WH8A 3SNAA 2PR3A 4NIVA 1GHAG 1ZSKA 5T6GA 4A7IB 2FEQH 1L4DA 1RGQA 4ZKSU 3K9XB 4Y79A 3PMHB 4IN2A 1HCGA 2FOCA 2F83A 2FX4A 1V6DA 2SNVA 2H5CA 2O8LA 3RXGA 1HRTH 1AB9B 1EZXC 1ZLRA 1EZUC 1HIAB 2ZNKH 5FPYA 4B2BA 1CA0C 1NT1A 2BDGA 4NA8A 4Y7AA 1Z8IB 3A87A 5LGOA 3A8DA 3AVZA 1C2GA 3P17H 2WUBA 1XKAC 1UTPA 5GJ4B 2VIQA 3LGYA 5EQSA 2W7UA 1HLTH 2Y80A 3RLYH 4MPUA 1DWDH 4YLQH 3ODDA 3CP7A 1CGIE 3HKJB 1EUFA 3BTWE 2KAIA 1ZMLA 4KGAA 5DP4A 4XFQA 1ZSLA 3A8CA 1LHGH 3S69A 4DT7B 1W0ZU 1O2KA 3BTME 7ESTE 2ZCKP 2GP9B 1DLEA 4SGAE 5HYOA 2ZI2H 3M5LA 4HI3A 2VWNA 4ZHMU 3QK1A 3ITIA 2FWWA 2ZHFH 1FY1A 3ZZ8A 1S85A 2FI3E 1HJ8A 1UVUH 2P3UB 3S9CA 3UWIA 2YNBA 1F5KU 3UTUH 1Z6JH 1BBRE 1BTZA 1FQ3A 1O2OA 3AAVA 5GCHF 1AQ7A 3RDZA 2OINA 2DE9A 4MNVA 1TGBA 1AY6H 1D3PB 1DANH 4JZIA 2SNWA 5GCHG 1K22H 5AFZH 2ZTXA 4YOGA 1NRSH 9LPRA 3RXOA 1ZTJA 1AE8H 2BDIA 1C2EA 1KY9A 3GY7A 4AZ2B 2GMTB 3A89A 2Q1JA 2VNTA 3RM0H 1CU1A 1BMNH 2BVXH 2PTCE 2W3KA 3SJOA 1VITH 1C2FA 2Y5FA 1N6YA 2B0FA 2PWXA 2Y6TA 5AVDA 6GCHG 1SOZA 1LCYA 3MO3A 3UWJH 5F6MA 4MPVA 5FAHA 1O30A 4Y10E 4THNH 1YM0A 1EOJA 5FBEA 4DIIH 1WAYB 2ZQ2A 1OP2A 3MU5A 4HGCA 1UTOA 3ZVDA 4D76A 1KXAA 3VB4A 1GJ4H 3ATLA 1BBRK 3MNBA 4MQAA 1E35B 4NA7A 5J4SA 1Y5BT 4UDWH 1HDTH 1C1SA 1EJMA 3SNBA 4ZHLU 1C1QA 1P2KA 1WYKA 1GBTA 3MFJA 1CVWH 2G55A 1TE0A 1V3XA 1QURH 1TNJA 1ZGVA 5L2YH 1NN6A 2D8WA 1AWFH 1KLIH 1OSSA 2ZDLA 4X0WU 4K5ZA 4XOJA 1KSNA 4BANB 1D6WA 3SV2H 1GBBA 1C1WH 3QTVH 5LPFA 2BDYA 1OWHA 4BAHB 4JZEH 4E05H 5AFYH 1WUNH 3GY5A 1FAKH 2ZCLP 1TONA 5E0HA 1L1GA 3I78A 1C2MA 1GI2A 3QZRA 1GBCA 3ZZ3A 4X8VH 3P8GA 1K2I1 4UD9H 4AB9A 3VB5A 4E06H 1VJ9U 1AFEH 4QT8C 5L30H 4I8HA 1IAUA 1W7XH 1ID5H 2AMPA 3QLPH 3KEEA 1OOKB 5T3HA 1BTWA 1O5BB 1LHEH 2FI5E 3AW1A 1C1RA 3TPIZ 2ZTYA 1V2ST 3AAUA 1K1IA 4MTBA 1NFYA 1BRAA 5FCRA 4SGBE 2JH6D 4I8KA 1OWIA 1O31A 2AYWA 1XMNB 3M3VA 1JOUB 4Y76A 1QIXB 3SJ8A 3PROA 3U98H 1TGCA 1Z8GA 4HZHA 4DG4A 4ABIA 1IQLA 4F4OC 1IQJA 2V0BA 4WWYA 2EA3A 1NRNH 1O2RA 1ZTLA 2GV6A 2FLRH 1O2JA 1UO6A 4Y8ZA 1TNHA 1HAYB 1VR1H 2OP9A 1H9IE 1ESTA 3SOSA 4ZMAH 1CBWC 4DVAU 1B0FA 5GWZA 4OGXA 3FFGA 1GPZA 2A7JA 4WJG2 1UCYK 2Z9GA 2ZEBA 3RXKA 2VGCB 1F5RA 3LJJA 1C2IA 1F2SE 1J17T 1PPFE 1AWHB 1C4Y2 4I33A 3ZZ7A 1TOMH 3GCTF 3VPKA 1O5AB 1CQQA 5C1XA 3UQVA 5FHTA 2C3SA 3Q3KA 1C2HA 2ZDKA 3UNQA 3RMMH 3I77A 2VWMA 3RC4A 4NIXA 1RFNA 2QN5T 1FPHH 2UWPA 2FTMA 1ELTA 1GGDC 3ZVGA 1BB0B 1CSOE 4K60A 1QFKH 2AFQB 1O2MA 1ANEA 5E8EH 1KDQB 3MU8A 1JIRA 1QCPA 3FZZA 4LZ1H 2G5NA 2PGQB 1SHYA 1ELFA 1TNGA 2BZ6H 4FUEA 3GY8A 1D4PB 3H7OA 2CGAA 2TGAA 1MCTA 2O8MA 1PYTD 4ZKOU 1NPMA 3GICB 4WY3A 2NU3E 2R2MB 1MQ5A 3F9EA 1A5IA 1P0SH 1DPOA 3LOXA 1MZAA 1G37A 1G32B 1C5ZB 3PMJA 1P3EA 2VIOA 2H1UA 4DY7B 3W94A 2PV9B 2OQ5A 2PTNA 1QHRB 2IOTA 1D3DB 3I29A 1Y3UA 1P2IA 1OKXA 4IC5A 2ZGCA 3RXLA 2CF9H 2FS8A 1TYNA 1BBRH 3BG4B 2PHBA 3LH1A 2ANMH 2Y7XA 2ZPRA 1LTOA 1ARBA 3K6ZA 4YM9A 3BN9A 2NU0E 4UFGH 2O8TA 3OYPA 2JH5D 1OX1A 4YLUA 5DP7A 4Z6AH 2FOMB 2WINI 4Y0ZE 1TB6H 2XC5A 1TX7A 4WF8A 2SFAA 1UTJA 5HM2A 4CRBA 4ABGA 1EQ9A 1AVXA 3VB7A 2VB0A 3PWBA 4ZKNU 2J94A 1HAXB 1GL0E 4NZQA 4NA9H 3LC5A 3ZYDA 4YOJA 4NGAH 4FUDA 3A7WA 5DP8A 4D8NA 2VIPA 1D9IA 4X2VA 1AVWA 1WTHD 3RMLH 1TRMA 2D26C 3UR6A 2F91A 2Z9IA 1AKSA 1GJDB 1QB6A 1INCA 1OWDA 4X2WA 3VB6A 1ZOMA 1RJXB 1S6HA 1YPEH 1BMMH 2FOEA 4FU9A 2ZGHA 2FOGA 4FUGA 1EXFA 1GI4A 1LDTT 1GBKA 1EOLA 4U2WA 5A09A 1H9HE 1SGEE 2F9OA 4X1RU 1DITH 1RTFB 3NCLA 4DW2U 4X6MA 1TBZH 4O97A 2BY5X 1O3AA 2BD5A 3T28A 5HXFA 2HNTE 3DUXH 1YLDA 4KELA 2BD4A 3SGBE 3TH4H 1UCYE 2RA0A 3P70B 1TOCB 2IN2A 3KL6A 2BY9X 1GHWH 1QA7A 1OYQA 2BQ6B 1FAXA 2XTTB 2CXVA 2WYJA 1UK4A 2ALPA 2OC1A 1VCQA 1O3BA 2ODQA 3A83A 4A1XA 1RIWB 1T4UH 3NWUA 2TRMA 4MG3A 3VGCB 1O3HA 1V2MT 3GDSA 2DE8A 3LGWA 1FJSA 2ULLA 3OX7U 2BLWA 1C5PA 4MPWA 2GDDA 1DM4B 3SHAH 2ZU3A 3D23A 3VFEA 2THFB 1Z1JA 3PO1C 2QA9E 3GY6A 4OS5A 2A4RA 4AGJA 1E38B 1K1LA 1Z71A 2STBE 4BXSA 3ZVCA 1LHDH 2G52A 2PUQH 4BAOB 1ELBA 1TMUH 2J95A 1G3CA 1K9OE 2PW8H 2QF3A 4BTUB 1IQMA 1SG8B 1SMFE 4LXBH 3RU4D 3ENSB 4OS7A 1A46H 4ZAEA 3H7TA 1GVKB 1Z1IA 1SGRE 8GCHG 4LZ4B 4TY6A 2A4GA 2ZA5A 1KXDA 5GPIB 1JWTA 4CRDA 3A7VA 2OLGA 2YOLA 1K1OA 2ZC9H 3RXEA 2WUCA 3T27A 4X1QU 4CRFA 1ETSH 2BHGA 5GDSH 2BD8A 7LPRA 2TGTA 3GISB 2G8TA 2J34A 3M7UA 1P12E 3BTEE 2F3CE 1LQEA 4RKOB 3TK5A 1UCYH 1XXFA 1MZDA 2HGTH 3F9GA 4O3TA 3RXCA 1A5HA 2ZU5A 4I31A 3RXFA 1C9TA 1LO6A 2BX3A 1NESE 3H5CB 4NCYA 2PSYA 2BY7X 1CHGA 1DWEH 4FUIA 3ZVFA 1H4WA 1PPCE 5E2PA 3KN2A 3UUZA 5C5NA 2W7SA 3HK3B 1QJ6B 3L3TA 1IQNA 1V2WT 1Y3VA 3TH3H 3S0NA 2Z9LA 1FY4A 1QJ1B 1ZMNA 1MAXA 4DURA 3LPRA 3SGQE 5H4IB 4AG1A 3LU9B 4O9VA 1SGDE 1YF4A 2QXIA 1V2NT 5ESBA 2G81E 4DGJA 3TNTA 2HOBA 3NKKA 3ZZ5A 1C2KA 1O2XA 1T8LA 1UTQA 2BY8X 2P93A 3BTDE 2PLXA 1LHFH 1Y5UT 3M35A 3U8RH 3SHCH 3RXVA 1O2SA 7GCHF 1T8OA 3ATIA 4JZFH 4AG2A 3STJA 1GVLA 1F0SA 1AFQC 4ISLA 1AE5A 1GVZA 1NO9H 3BEIB 2VWLA 4NFEA 1ZHRA 4NFFA 4CBNA 4MLFB 1AMHA 1SLXB 1Y3YA 3Q00A 3RXUA 1ZPZA 1GJBB 2CMYA 1EZQA 4X1NU 4FXGH 1BMLA 3SUDA 1FN6A 1O3NA 1N8OC 3RXAA 1KXFA 1T4VH 1HAVB 1L1JA 1CT0E 1QJ7B 1RXPA 1ZPBA 2P94A 2XBVA 4Y7BA 5EPNA 2ZPQA 1C5VA 4FUFA 2C8XB 5LPRA 2Z6BD 1ZRBA 4A6LA 1DLKB 1W11U 4MNXA 4B71A 1SLWB 1THSH 1NU7B 2FYRA 4R8TB 1BHXB 1BTPA 1O2GH 4LK4A 5EQQA 1E34B 4B73A 1NFXA 2B5TB 2ZCHP 3JZ2B 3F9HA 4AB8A 1FN8A 2XC4A 3U69H 2ZDMA 3A80A 3S7KB 2UWLA 1HBTH 2R3UA 3EE0B 4JZDH 1RTLA 4PROA 1GHBF 4CRAA 4NZLA 4KP0A 2BQWB 4CHAB 2AMQA 2XW9A 2H9TH 1BHXF 1A3EH 1GI5A 3BIVH 2R0LA 3D62A 1SPJA 5EXNA 5C1UA 3SV7A 3FP7E 1O3KA 3MMGA 2XCFA 1KYNA 2SGEE 1XX9A 5L2ZH 1ACBE 1GMDG 4ZKRU 1EJAA 2V3HH 4XBCA 1C9PA 2Z7FE 5A0AE 1TGSZ 1NFUA 1UHBB 1O3EA 1NS3A 4K2YA 4MVNA 1TRNA 1FXYA 1K1PA 3E0NB 1N1LA 1P57B 4FUHA 4Q7YA 4F49A 3NZIA 4J2YB 4U01A 2Q6FA 3Q3XA 1SGFG 3SI3H 2JETC 5BPEA 2H6MA 2M5TA 2A31A 3BTTE 1QRWA 4Y8XA 1GI3A 2OC8A 4UONA 3ZV8A 5EXMA 1TPOA 1GMHF 5JBBS 5C3NA 1ZSJA 5F03A 3HK6B 1Y5AT 1O3MA 4TYDA 3SO3A 2A32A 1GJ6A 3TGKE 1DOJA 1D3QB 4CR5A 1W13U 1O3PB 4INHA 4JYUH 3SBKA 3RXSA 5DG6A 5AF9H 1S0QA 4Q7XA 4OGYA 1N6XA 1IQIA 1Z8RA 2OC7A 1FI8A 1EP5A 1F0UA 1VGCC 4FU8A 4ISHH 3KF2A 5DKMA 5F8XA 1T8MA 3ZYEA 2RA3A 2K1QA 2VIWA 1C5NH 1YGCH 2HNTC 1T32A 4FU7A 5FBIA 2ZHQH 2BYAX 1PPEE 2ZO3H 1NFWA 5ESTE 3TVJB 2OUAA 3U1IB 1YKTA 2BOKA 3ATMA 1Y8TA 1O2LA 2ZHEH 2XBXA 1K1MA 1O3LA 2VVCA 1SGFA 5ETXA 4Z0KA 1A7SA 2QGRA 3G01A 5FPTA 2HNTF 9ESTA 3P92A 5JBCS 1TPAE 1ELEE 2B9LA 2BDBA 2PSXA 1SGTA 1DXWA 4JCNA 4YTAA 1XVOA 2TGPZ 2GMTC 3URDA 4UFFH 1SHHB 1MUEB 4B1TA 2SGAA 1O2HA 1TALA 1WU1A 1HNEE 1P9UA 3BTHE 4FVBA 1SQTA 1HJAC 1IOEA 2Z3EA 3BF6H 1EZSC 1AU8A 3HGPA 4OS2A 3F68H 3MTYA 4ZXYH 5JPMH 2AGGX 1A4WH 2ZF0H 2C8YB 3V12A 2H9HA 1WV7H 1UHBA 1BITA 5HMAA 5EW1H 1GHYH 1ABJH 1SI5H 2FPZA 1TPSA 4BXWA 3ZVBA 3RC5A 1ZRKA 1QR3E 4X6OA 1YCPH 2QY0B 3ZZCA 1WCZA 2F9VA 1KXEA 1EPTB 1ORFA 3GOVB 4U30A 4CRGA 1GCDA 5DP6A 2Y82A 1C2JA 3SU1A 3QTOH 1MU6B 2C93B 1TQ7B 1MD8A 4Q80A 2JKHA 3NK8A 5FCKA 3B23B 1MAYA 1GJ8B 1OP8A 2GX4A 1O38A 1DDJA 1A0JA 1YPGH 1V2LT 3ELAH 3ODFA 1THRH 2P16A 1SGCA 2Z9KA 2LNCA 3MH7A 3RUOA 2FOHA 3PMBB 2W3IA 2QIQA 1C5OH 2FMJA 2VWOA 5C20A 2R0KA 3DFJA 3MH4A 1F5LA 2CF8H 1GBAA 2GV7A 1GBMA 1O5FH 2TBSA 3C27B 5SGAE 1GBEA 1H9LB 2H9EH 1B0EA 3QX5H 4B74A 3E91A 3HATH 2EI6A 5GIBA 3LT3A 3C1KA 3LJOA 1VGCB 3MU4A 2QXGA 1TAWA 1Y59T 1HAGE 1P8VC 2P3TB 2TGDA 1GI9B 4Y6DA 4NIWA 1C5QA 1RIWC 1ETTH 5EQRA 2BVSH 3P95A 2ZGBH 5EOKA 3IITA 3P8OA 1AUJA 1ELAA 1EPTC 2Q6DA 3A7TA 2ZDAH 2AS9A 1FIZA 2GZ8A 1NRQH 1VITF 2ZG0H 2WPHS 2C90B 4BAMB 1DICA 1O3DA 1GMHG 4H42U 5A2MH 2SGFE 4I8JA 4X2XA 4YZUA 5F8TA 3UFAA 3DT0H 1VCPA 3Q77A 3S7HB 1AZZA 1L0ZA 1LPGB 1AHTH 4A92A 1IQKA 3A82A 3KQBA 3FP6E 4NSVA 1CGHA 2A1DB 2BLVA 1GL1A 7GCHG 3F6UH 1TBQH 3BG8A 1QL8A 1GG6C 2PFEA 2KAIB 1O2IA 4RKJB 4DJZB 1YCPK 2EEKA 1V2QT 1JIMA 2XBYA 3ZZDA 5A8XA 3U1JB 4Y71A 2ZU4A 4E7RG 1O35A 1ZR0A 3TU7H 1MMJN 1SL3A 2Z3CA 4AN7A 1P05A 2QXHA 2PKSB 3SGAE 2FXRA 3SNDA 3N7OA 1S5SA 1GJ9B 2C4FH 1G3DA 4B2AA 1O37A 1GHZA 4ABDA 4NIYA 1EATA 1QBOA 2AGIX 1KIGH 2BB4A 3TITA 3TK9A 3W95A 2WV5A 4CHAC 1TMBH 1C5LH 1QB1A 4A5TS 5L6NH 1FDPA 4AX9H 3DD2H 3RMNH 1KLTA 3BEFB 1QL7A 1SLUB 1NTPA 1MTUA 2ILNA 1FPCH 3A85A 4R0IA 3SU6A 4X8TH 4ABBA 1W10U 1L4ZA 2BY6X 1V2VT 2HRVA 4I7YH 1IQEA 2FIRH 3ZVAA 2I6QA 4E7NA 1VJAU 2VINA 1AZ8A 5TCAA 1G2LA 1LPZB 3FP8E 1HIAA 4ASHA 3UNSA 3QUMP 3FANA 1QQUA 1Z8JB 1D3TB 1BJVA 3K6YA 4CRCA 3QZQA 3QGNB 4WMEA 2QAAA 3SN8A 1T31A 2C8ZB 2QF0A 1BT7A 3DA9B 2EI8A 2JETB 3D49H 1H8IH 2P8OB 3E90B 1PJPA 1SGIB 1A1RA 1XUIA 2SGPE 3U8TH 4X1SU 3GY4A 1XUFA 6CHAB 4FVDA 4D7FA 3UQOA 4VGCC 1CHOF 1C5SA 1IHSH 4WMFA 3E1XB 4CH2B 3MHWU 4D9QA 1O36A 1S83A 1W8BH 3D65E 6ESTA 3KQCA 4Q2KA 3SU0A 1OWEA 1A61H 5DP9A 5BRRE 1UTNA 4JYTA 2OC0A 1V2KT 2BD3A 1GHXH 2BVRH 3U8OH 2BQ7B 1J9CH 4J1YA 4NWKA 5C1YA 5PTPA 3MI4A 1EAUA 2OBQA 1QL9A 2P3FH 4K1SA 1TX6A 3BTFE 5FXLA 3GY2A 3M36A 1GGDB 3MYWA 1O2UA 3O8DA 2UUYA 4X1PU 3P8NA 4BOHA 1KDQA 1Z7KA 2RCEA 1P01A 2GZ7A 1SLVB 2BDAA 3T26A 5C5OA 2XCNA 3A81A 3EA7A 3S9AA 3TIUA 3ZZ4A 1ZPCA 4XBDA 2A2QH 1GI0A 3SU5A 2GTBA 3BTQE 1S82A 3RXPA 1BIOA 5J4QA 1BOQA 2AERH 1FY5A 1LVBA 4Y11E 2NU1E 4AFSA 4NG9H 2B7DH 2VIDA 3A7ZA 1EB2A 2F9PA 5FPSA 1WTGH 1PQAA 2BD9A 1JBUH 1AGJA 2FTLE 1G3BA 1O3OA 1S0RA 1O2ZA 5HM9A 3MWIU 3SJKA 2G4TA 1ELCA 2ZKSA 4Q7ZA 1A0HB 6GCHF 4OS4A 2PUXB 1K1JA 4A1TA 5IDKA 1YPLH 1SGQE 1AIXH 1SVPA 5HGGA 2FM2A 8GCHF 3RMOH 5LH8A 1SR5C 4WH6A 3DFLA 1QGFA 2CN0H 3ESTA 1DE7H 4K1TA 5C67A 1GDQA 1SSXA 3IG6B 3SV6A 2XRCA 1ESAA 1O5GH 3V0XA 3ZV9A 1CA0B 1EP6A 4YESB 4AGKA 1E37B 1OWJA 4AYVB 1CO7E 1CT2E 3GDUA 3KQDA 3SU2A 3A7YA 2ZGJA 1W14U 2WPJS 1DX5M 1XKBC 5EG4A 1YPJH 5TJXA 2Y5HA 1Z6EA 2DUCA 2BX4A 3OY5U 1JRTA 1ANBA 1YPMH 1UTKA 5EODA 3FZDA 2CV3A 4B2CA 1ETRH 1C1PA 1FZZA 3T29A 2ZFQH 2HALA 1WOFA 2EC9H 2VU8E 4ISOA 5F8ZA 3LGUA 1BDAA 1YPKH 1LVOA 1NU9A 3ATKA 1KLJH 1OYTH 1QY6A 2F9BH 2WV4A 2ZHDA 3LH3A 4AFUA 3M7TA 1O5DH 5TCCA 2ESTE 2WPLS 3UR9A 4H6TA 1BTXA 1W12U 3QDZB 4TY7A 1XUGA 2VH6A 3QWCH 1GHBG 2PKAB 2UUKB 1G2MA 1YPHE 4M7GA 1P2JA 3P6ZB 4ZROA 1KTTB 4O3UA 8KME2 1GI6A 3PTBA 3VB3A 3LGVA 1MTSA 4GAWA 2P59A 3T25A 1ZJKA 8ESTE 2FLBH 3PMAB 1GDUA 1HB0B 3M5OA 1SQOA 5JBTA 1FONA 1QB9A 1WBGB 1VCWA 4UE7H 1AD8H 2GDEH 4UFDH 2GCTB 3T5FH 1UTMA 1V2JT 1XUJA 1K28D 4X8SH 1MTNC 4GCHG 1Y3WA 3MO9A 2FESH 1A3BH 4INKA 3V13A 2XBWA 2RG3A 1SFQB 2GD4B 3A88A 3SU4A 2WPKS 3STIA 5EPYA 1NY22 2ZFFH 4MDSA 1C5YB 4CREA 1LMWB 5CE1A 1GCTB 1C5UA 4FUBA 1TBRH 1O0DH 1EJNA 4WXIA 1BZXE 1YBWA 1UVSH 3RP2A 1O34A 1ELVA 1ELDE 5JYIA 1UVOA 2ZDVH 1P2MA 2GZ9A 1B7XB 2Z9JA 3SZNA 3PO1B 1EASA 4MNYA 1W3CA 1GJCB 2UUFB 1QBNA 4IMQA 1UK2A 3BTGE 2XC0A 2J92A 3A84A 1GI7B 2AMDA 1C2DA 5I25A 1W0YH 1LKAA 5JB9S 1H1BA 2J2UA 4KTCA 1J15A 3BV9B 1DWBH 1OPHB 2C8WB 3B9FH 5E0GA 1MTVA 1LHCH 5GXPA 5A0BA 1ABIH 2BLOA 2WPIS 1O2VA 1KXCA 3Q3YA 3RXIA 2ZFSA 3PV4A 2A4QA 4KTUA 2CHAC 2HVXA 4AYYB 1C4U2 3SJ9A 2JH0D 1MBQA 2ZPSA 2B8OH 3SV8A 1F92A 4XDEA 1U6QA 2R9PA 5E0JA 1RRKA 1GMCG 2QCYA 4X8UH 1V2TT 4AFZA 2Z3DA 1PPBH 1MKWK 3RM2H 1UJ1A 1P2OA 2OCVB 4JZ1A 3MU1A 1NROH 5I46H 4ABAA 1QRZA 3TJVA 2BOHB 4MNWA 3WY8A 1KXBA 1EAIA 2FOBA 5FX5A 3MNSA 1IQFA 1QQ4A 4IMZA 4ZXXH 1QA0A 1PPGE 2NU4E 1GBDA 1BUIA 1MD7A 1Q3XA 3MH5A 3RXRA 1DVAH 1S81A 4BTIB 1SGYE 1C1OA 4BAKB 3EA8A 4X6NA 1G9IE 5CMXH 1XVMA 1TNKA 3K2UA 3RXTA 2ZZUH 3GDVA 1LVMA 1GCTC 3CENA 1MU8B 3NXPA 4WVPE 2GCHF 1LKBA 3VEQB 1EB1H 3PB1E 4Y8YA 1AVGH 1RD3B 4O03A 1O2QA 2BD7A 3F1SB 1YCPM 3B8JA 2GCHG 5IYTA 2A5AA 1IQHA 4GCHF 2GCTC 1QBVH 3R3GB 1ZJDA 2WYGA 2Y7ZA 2A0QB 5CHAB 4I8LA 1PYTC 4OS6A 4K69A 1XUHA 3SNEA 4ISNA 1GHVH 3O8CA 3A8AA 5LPEA 1HV7A 1MQ6A 4ZUHA 1ZHMA 3GCNA 1O3CA 1SOTA 3KNXA 4H6SB 4Y0YE 2FDAA 4BTTB 5DPAA 1L1NA 3K65B 2W26A 1O2PA 2FODA 4LOYH 3A8BA 1RS0A 3UIRA 2A7HA 1O5CB 3TH2H 3NUMA 3HKIB 3URCA 2A4OA 3M3SA 1S6FA 1ZHPA 3PLKA 1EKBB 1JXPA 2J4IA 4FUCA 1LQDB 5B6OA 1HJAB 4GHQA 4AOQA 2CJIA 1QRXA 2O8WA 1PPZA 3TK6A 1GBHA 1TA6A 3BG4C 3UPEA 2LPRA 3SNCA 1F7ZA 2OXSA 4A1VA 1YP9A 4KTSA 5A0CA 1AO5A 2O9QA 1CT4E 1BRUP 1QTFA 2HLCA 4KKDA 1HAOH 1NRPH 2HPPH 1OWKA 1PFXC 3OSYA 3VXEH 2ANYA 1DS2E 1F0RA 1BRCE 2G4UA 2HWLB 1O5EH 4GSOA 5DP5A 2OQUA 2Y5GA 4WXVA 2GGVB 4BAQB 1AFQB 1DY9A 4TWWA 1CGJE 2FOAA 3S9BA 3DHKH 1SGPE 1O33A 2QYIA 4YT6H 2ODYB 4ESTE 2FX6A 1SFIA 1PQ8A 3HPTB 1GBJA 2F9NA 2ZWLH 5EW2H 1Q31A 1EAWA 5DO4H 1SQAA 1NC6A 1DXPA 1E0FD 3GCHC 4H4FA 3LDXH 1GMDF 1HXEH 1XXDA 3MNCA 2FO9A 3MOCA 1H8DH 2J38A 3UNRA 3L33A 2FI4E 3LGTA 2AEIH 3KGPA 2ZECA 2G5VA 3EQ0H 2ALVA 3VGCC 4DIHH 1TX8A 3BTKE 1A2CH 4TPIZ 3ZZAA 1PQ5A 4WMDA 2W5EA 1TABE 2V35A 3TNSA 4RSPA 5DK1A 1SB1H 1YLCA 1BA8B 3QGJA 5AHGH 2VGCC 1ARCA 1WSSH 3KHVA 1BRBE 1P11E 2A2XH 2ZDNA 2QC2A 3VXFH 3A7XA 3SUEA 1IQGA 2ZFTA 1VZQH 3SJIA 3LC3A 3RU4E 1MTWA 1FV9A 1GJ7B 3BIUH 5T6FA 1BTHH 1ZMJA 1UK3A 2VVUA 1MKXK 3RXMA 3Q76A 1P06A 4AORA 1G30B 3TLOA 1GJAB 4I32A 1TGNA 2A5KA 2XWBI 1SBWA 1GBLA 4IN1A 3LIWA 2A7CA 3UOUA 2H5DA 1BJUA 1EAXA 2ZFRH 1HAIH 4K1EA 1O32A 1C5RA 1GDNA 4K3JA 3SORA 1O3IA 2BM2A 2Z94A 2V6NA 1MTNB 1RTKA 4IBLH 1O3JA 1GG6B 3EAJA 2BMGB 1FIWA 1TWXB 1NRRH 1AN1E 1P2QA 2ZP0H 2TIOA 4TWYA 1TLDA 5G4BA 1HAHH 1ZTKA 2P8OC 1EPTA 5EGMA 3IWMA 1FMGA 3KCGH 1C2LA 1ZZZA 4OS1A 3M37A 1BQYA 3SUFA 1TQ0B 2OBOA 2BLQA 4UFEH 1TPPA 3JZ1B 3TJNA 3RXBA 3OU0A 1V2OT 4ISIH 2XXLA 1J14A 3GCHB 2GKVE 3EYDA 3EA9A 3RXDA 1DY8A 1MKXH 1MKWH 2ANKH 1N8OB 1HJ9A 1DSTA 3SU3A 3AW0A 2G00A 3PLPA 1WQVH 1Y3XA 1P03A 4IS5A 1CE5A 3V3MA 4GUXA 1O3GA 1HXFH 3SV9A 3M5NA 3QN7A 3RXJA 1DSUA 1O39A 3PWCA 2GT8A 1MH0A 3SI4H 4MPXA 3PTNA 1OXGA 1HPGA 4B75A 3PM3A 2R2WU 2FP7B 2HPQH 1W2KH 1SGNE 2IJOB 1XM1A 2ZFPH 1Q2WA 4D9RA 2SGQE 1THPB 4HTCH 3M3TA 3SQEE 1AI8H 3EGKH 3RXHA 4ZH8A 1GMCF 1YYY1 3BEUA 4IW4E 5E2OA 3F9FA 4JMYA 1G36A 4CR9A 3RLWH 3RXQA 1AB9C 2BDCA 5A8ZA 1GI8B 2XWAA 4NSYA 1HYLA 1YPHC 1C5MD 3KQEA 4RN6A 2QV1A 1XUKA 4JK5A 2F9UA 4X6PA 1G3EA 1DWCH 1GI1A 1SC8U 5EXLA 3TGJE 5K7RA 1TGTA 1O2YA 2ZTZA 4JYVH 4HFPB 5ABWA 5C2ZA 1HAZB 2FZZA 1JRSA 1L2EA 4IGDA 3NPSA 3M7QA 4NWLA 2Q6GA 2H2ZA 1LPKB 1GBIA 3E3TA 3AASA 4K8YA 1X7AC 3ZZ9A 3CS7A 1DUEA 2AGEX 1V2RT 1YC0A 2FYQA 1CHOG 1DUAA 3GCTG 1UTLM 3CS0A 1P2NA 5JBAS 2NU2E 2AH4X 3MNXA 4IC6A 5CHAC 2J9NA 2Y81A 4AFQA 1O2TA 2FS9A 3PYHA 2UUJB 1T7CA 5JB8S 1HUTH 1ANDA 1FNIA 1O2NA 2I6SA 3GCOA 2R3YA 4ABHA 7KMEH 1O3FA 1UVPA 2AIQA 1PPHE 2PGBB 5T6DA 3LGIA 3MO6A 2ZGXH 1TFXA 1J8AA 2ZU2A 2GVFA 3SQHE 2AIPA 1KTSB 1P10A 1K1NA 3P8FA 4GLYA 3ZZBA 1C1NA 1A0LA 5JDUB 2PKAA 5FX6A 1OP0A 1C5XB 4YO9A 2ZU1A 3E16B 1NM6A 4GHTA 4VGCB 1E36B 3M5MA 1AUTC 2D2DA 1C4V2 3E0PB 3SUGA 3SW2B 2A5IA 1HFDA 1AKSB 5K0HA 4U32A 2OD3B 1TRYA 4BNRA 2BZAA 2ZIQH 2ODPA 2SGDE 3EDXB 5DP3A 6CHAC 1P3CA 2EI7A 1K21H 3O8BA 3GY3A 3MH6A 4ABEA 3LONA 2UWOA 1LVYA 1TNIA 1ZYOA 1GBFA 2ZHWH 4X2YA 1C1MA 1NZQH 2VVVA 1TMTH 3O8RA 1FUJA 3E8LA 5DJ7A 1FY8E 4XE4A 4I8GA 3ZZ6A 1FY3A 3A86A 1ZGIA 2TPIZ 2O8UA 3HGNA 4FUJA 1GJ5H 2XYAA 4UEHH 2V3OH 1C1VH 1CA8B 1HAPH 3GYMA 1HGTH 1QNJA
chains in the Genus database with same CATH superfamily
2CHAB 4B76A 1BMAA 3R0FA 1H8ED 3PLBA 1PQ7A 1WQSA 6LPRA 2BD2A 1UMAH 4CH8B 2D1JA 4DOQA 1W7GH 2WPMS 3E6PH 3TJOA 3M61U 1J16A 2XNIA 3MU0A 1P09A 1ELGA 1EX3A 1V2PT 1BTUA 1WDIA 1C5WB 3L6PA 1P9SA 3RU4T 1CBWB 4D7GA 4ZHAA 1TA2A 2BTCE 1TNLA 2PKSC 5EU8A 1VITG 2ZQ1A 2VIVA 8LPRA 1V2UT 2YNAA 5FL7D 3T62A 3TJUA 4ABJA 3QO6A 1C5TA 1C1TA 1P04A 1O2WA 3UOPA 1OS8A 3OTJE 4XBBA 4XSKU 3V7TA 2OTVA 2A45B 2BDHA 2BXTH 2P95A 4ABFA 4YT7H 4CBOA 3LKWA 3TGIE 1MCVA 2STAE 4GVUA 1MBMA 3CNRA 3OY6U 1M9UA 5C17A 3DSOA 1TIOA 1JMOH 2VH0A 3ATWA 5C0TA 2ANWA 3GYLB 4TPYA 3T2NA 2ASUB 1GHAF 2NWNA 2GT7A 3F0OA 1D6RA 1ANCA 1P02A 2RDLA 3KIDU 3UREA 1HAVA 1NBME 3FAOA 3UY9A 5A8YA 4JK6A 1DFPA 1A5GH 1IHTH 1UVTH 2IPHA 5DGJA 2VJ1A 4INLA 2QXJA 2G51A 1DT2A 3ZVEA 3BSQA 4DCDA 1C1UH 1GWAA 4YOIA 3RC6A 3U9AH 4GPGA 2FOFA 2VBCA 3FVFB 4K8BA 1BCUH 1ESBA 1T8NA 1S84A 1BTYA 1FLEE 1B5GH 2BXUH 1F0TA 4WH8A 3SNAA 2PR3A 4NIVA 1GHAG 1ZSKA 5T6GA 4A7IB 2FEQH 1L4DA 1RGQA 1BMFD 5F53A 4ZKSU 3K9XB 5IK2D 4Y79A 3PMHB 4IN2A 1HCGA 2FOCA 1E1QD 2F83A 2FX4A 1V6DA 2SNVA 1K0HA 2H5CA 2O8LA 3RXGA 1HRTH 1AB9B 1EZXC 1ZLRA 1EZUC 1HIAB 2ZNKH 5FPYA 4B2BA 1CA0C 1NT1A 2BDGA 4NA8A 4Y7AA 1Z8IB 3A87A 5LGOA 3A8DA 3AVZA 1C2GA 2HLDD 2WUBA 3P17H 1XKAC 1UTPA 5GJ4B 2VIQA 3LGYA 5EQSA 2W7UA 1HLTH 2Y80A 3RLYH 4MPUA 1DWDH 4YLQH 3ODDA 3CP7A 1CGIE 3HKJB 1EUFA 3BTWE 2KAIA 1ZMLA 4KGAA 5DP4A 4XFQA 1ZSLA 3A8CA 1LHGH 3S69A 4DT7B 1W0ZU 1O2KA 3BTME 7ESTE 2QF5A 2ZCKP 2GP9B 1DLEA 4SGAE 5HYOA 2ZI2H 3M5LA 4HI3A 2VWNA 4ZHMU 3QK1A 3ITIA 2FWWA 2ZHFH 1FY1A 3ZZ8A 2QF4A 1S85A 1W0JD 2FI3E 1HJ8A 1UVUH 2P3UB 3S9CA 3UWIA 2YNBA 1F5KU 3UTUH 1Z6JH 1BBRE 1BTZA 1FQ3A 1O2OA 3AAVA 5GCHF 1AQ7A 3RDZA 2OINA 2DE9A 4MNVA 1TGBA 1AY6H 1D3PB 1DANH 4JZIA 2J5UA 2SNWA 5GCHG 1K22H 5AFZH 2ZTXA 4YOGA 1NRSH 9LPRA 3RXOA 1ZTJA 1AE8H 2OK5A 2BDIA 1C2EA 5CDFE 1KY9A 3GY7A 4AZ2B 2GMTB 3A89A 2Q1JA 2VNTA 3RM0H 1CU1A 1BMNH 2BVXH 2PTCE 2W3KA 2YMSD 1VITH 3SJOA 1C2FA 2Y5FA 1N6YA 2B0FA 2PWXA 2Y6TA 5AVDA 6GCHG 1SOZA 1LCYA 3MO3A 3UWJH 5F6MA 4MPVA 5FAHA 1O30A 4Y10E 4THNH 1YM0A 1EOJA 5FBEA 4DIIH 1WAYB 2ZQ2A 1OP2A 3MU5A 4HGCA 1UTOA 3ZVDA 4D76A 1KXAA 3VB4A 1GJ4H 3ATLA 1BBRK 3MNBA 4MQAA 1E35B 2IJD1 4NA7A 5J4SA 1Y5BT 4UDWH 1HDTH 1C1SA 1EJMA 3SNBA 4ZHLU 1C1QA 1P2KA 2CK3D 1WYKA 1GBTA 3MFJA 1CVWH 2G55A 1TE0A 1V3XA 1QURH 1TNJA 1ZGVA 5KECA 5L2YH 1NN6A 2D8WA 1AWFH 1KLIH 1OSSA 2ZDLA 4X0WU 4K5ZA 3AK5A 4XOJA 1KSNA 4BANB 1D6WA 3SV2H 1GBBA 1C1WH 3QTVH 5LPFA 2BDYA 1OWHA 4BAHB 4JZEH 5EJZA 4E05H 5AFYH 1WUNH 3GY5A 1FAKH 2ZCLP 1TONA 5E0HA 1L1GA 3I78A 1C2MA 1GI2A 3QZRA 1GBCA 3ZZ3A 4X8VH 3P8GA 1K2I1 3DCLA 4UD9H 4AB9A 3VB5A 4E06H 1VJ9U 1AFEH 4QT8C 5L30H 4I8HA 1IAUA 1W7XH 1ID5H 2AMPA 3QLPH 3KEEA 1OOKB 5T3HA 1BTWA 1O5BB 1LHEH 2FI5E 3AW1A 1C1RA 3TPIZ 2ZTYA 1V2ST 3AAUA 1K1IA 2JJ1D 4MTBA 1NFYA 1BRAA 4FOUC 5FCRA 5B6LA 4SGBE 2JH6D 2LP6A 4I8KA 1OWIA 1O31A 2AYWA 1XMNB 3M3VA 1JOUB 4Y76A 2QE7D 1QIXB 2KFWA 3SJ8A 3PROA 3U98H 1TGCA 1Z8GA 4HZHA 4TSFD 4DG4A 3NRLA 4ABIA 1IQLA 4F4OC 1IQJA 2V0BA 4WWYA 2EA3A 1NRNH 1O2RA 1ZTLA 2GV6A 2FLRH 1O2JA 1UO6A 4Y8ZA 1TNHA 1HAYB 1VR1H 2OP9A 1H9IE 1ESTA 3SOSA 4ZMAH 1CBWC 4DVAU 1B0FA 5GWZA 4OGXA 4AC9A 3FFGA 1GPZA 2A7JA 3FOAA 1UCYK 2Z9GA 2ZEBA 4WJG2 3RXKA 2VGCB 1F5RA 3LJJA 2RDEA 1C2IA 1F2SE 1J17T 1PPFE 1AWHB 1C4Y2 4I33A 3ZZ7A 1TOMH 3GCTF 3VPKA 1SQRA 1O5AB 1CQQA 5C1XA 3UQVA 1FX0B 5FHTA 2C3SA 3Q3KA 1C2HA 2ZDKA 3UNQA 3RMMH 3I77A 2VWMA 3RC4A 4NIXA 1RFNA 2QN5T 2PP6A 1FPHH 2UWPA 2FTMA 1ELTA 1GGDC 3ZVGA 1BB0B 1CSOE 4K60A 1QFKH 2AFQB 1O2MA 1ANEA 5E8EH 1KDQB 3MU8A 1JIRA 1QCPA 3FZZA 5EJLA 4LZ1H 2G5NA 2PGQB 1SHYA 1ELFA 1TNGA 2BZ6H 4FUEA 3GY8A 1D4PB 3H7OA 2CGAA 2TGAA 1MCTA 2O8MA 1PYTD 2JIZD 4ZKOU 1NPMA 3GICB 4WY3A 2NU3E 5DN6D 2R2MB 1MQ5A 3F9EA 1A5IA 1P0SH 1DPOA 3LOXA 1MZAA 1G37A 1G32B 1C5ZB 3PMJA 1P3EA 2VIOA 2H1UA 4DY7B 3W94A 2PV9B 2OQ5A 2PTNA 1QHRB 2IOTA 1D3DB 3I29A 1Y3UA 1P2IA 1OKXA 4IC5A 2ZGCA 3RXLA 2CF9H 2FS8A 1TYNA 1BBRH 3BG4B 2PHBA 4F55A 3LH1A 2ANMH 2Y7XA 2ZPRA 1LTOA 2KR7A 1ARBA 3K6ZA 4YM9A 3BN9A 2NU0E 4UFGH 2O8TA 3OYPA 2JH5D 1OX1A 4YLUA 5DP7A 5GNDA 4Z6AH 2FOMB 2WINI 4Y0ZE 1TB6H 2XC5A 1TX7A 4WF8A 2SFAA 1UTJA 5HM2A 4CRBA 4ABGA 1EQ9A 1AVXA 2M2AA 3VB7A 2VB0A 3PWBA 4ZKNU 3F3BA 2J94A 1HAXB 1GL0E 2EQNA 4NZQA 4NA9H 3LC5A 3ZYDA 4YOJA 4NGAH 4FUDA 3A7WA 5DP8A 4D8NA 2VIPA 3DSGA 1D9IA 4X2VA 1AVWA 1WTHD 3RMLH 1TRMA 2D26C 3UR6A 2F91A 2Z9IA 1AKSA 1GJDB 1QB6A 1INCA 1OWDA 3MQKC 4X2WA 3VB6A 1ZOMA 1RJXB 1S6HA 1YPEH 1BMMH 2FOEA 4FU9A 3F2GA 2ZGHA 2FOGA 4FUGA 1EXFA 1GI4A 1LDTT 1GBKA 1EOLA 4U2WA 5A09A 1H9HE 1SGEE 2F9OA 4X1RU 1DITH 1RTFB 3NCLA 4DW2U 4X6MA 1TBZH 4O97A 2BY5X 1O3AA 2BD5A 3T28A 5HXFA 2HNTE 3DUXH 3KYGA 1YLDA 4KELA 2BD4A 3SGBE 3TH4H 1OHHD 1UCYE 2RA0A 3P70B 1TOCB 2IN2A 3KL6A 2BY9X 1GHWH 1QA7A 1OYQA 2BQ6B 1FAXA 2XTTB 2CXVA 2WYJA 1UK4A 2ALPA 2OC1A 1VCQA 1O3BA 2ODQA 4P02A 4YXWD 2J98B 3A83A 4A1XA 1RIWB 1T4UH 3NWUA 2TRMA 4MG3A 3VGCB 1O3HA 1V2MT 3GDSA 2DE8A 3LGWA 1FJSA 2ULLA 3OX7U 2BLWA 1C5PA 4MPWA 2GDDA 1DM4B 3SHAH 2ZU3A 3D23A 3VFEA 2THFB 1Z1JA 3PO1C 2QA9E 3PRDA 3GY6A 4OS5A 2A4RA 4AGJA 1E38B 1K1LA 1Z71A 2STBE 4BXSA 3ZVCA 1LHDH 2G52A 2PUQH 4BAOB 1ELBA 1TMUH 2J95A 1G3CA 1K9OE 2PW8H 2QF3A 4BTUB 1IQMA 1SG8B 1SMFE 4LXBH 3RU4D 3ENSB 4OS7A 1A46H 4ZAEA 3H7TA 1GVKB 1Z1IA 1SGRE 8GCHG 4LZ4B 4TY6A 2A4GA 2ZA5A 1KXDA 5GPIB 1JWTA 4CRDA 3A7VA 2OLGA 2YOLA 1K1OA 2ZC9H 3RXEA 2WUCA 3T27A 4X1QU 4CRFA 1ETSH 2BHGA 5GDSH 2BD8A 7LPRA 2TGTA 3GISB 2G8TA 2J34A 3M7UA 1P12E 3BTEE 2F3CE 1LQEA 4RKOB 3TK5A 1UCYH 1XXFA 1MZDA 2HGTH 3F9GA 4O3TA 3RXCA 1A5HA 2ZU5A 4I31A 3RXFA 1C9TA 1LO6A 2BX3A 1NESE 3H5CB 4NCYA 2PSYA 2BY7X 1CHGA 1DWEH 4FUIA 3ZVFA 1H4WA 1PPCE 5E2PA 3KN2A 3UUZA 5C5NA 2W7SA 3HK3B 1QJ6B 3L3TA 1IQNA 4Q4LA 1V2WT 1Y3VA 3TH3H 3S0NA 5KEDA 2Z9LA 1FY4A 1QJ1B 1ZMNA 1MAXA 4DURA 3LPRA 3SGQE 5H4IB 4AG1A 3LU9B 4O9VA 1SGDE 1YF4A 2QXIA 1V2NT 5ESBA 2G81E 4DGJA 3TNTA 2HOBA 3NKKA 3ZZ5A 1C2KA 1O2XA 1T8LA 1UTQA 2BY8X 2P93A 3BTDE 2JJ2D 2PLXA 4TT3D 1LHFH 1Y5UT 3M35A 3U8RH 3SHCH 3RXVA 1O2SA 7GCHF 1T8OA 3ATIA 4JZFH 4AG2A 3STJA 1GVLA 1F0SA 1AFQC 4ISLA 1AE5A 1GVZA 1NO9H 3BEIB 2VWLA 2L74A 4NFEA 1ZHRA 4NFFA 4CBNA 4MLFB 1AMHA 1SLXB 1Y3YA 3Q00A 3RXUA 1ZPZA 3WWFA 1GJBB 2CMYA 1EZQA 4X1NU 4FXGH 1BMLA 2L6OA 1FN6A 3SUDA 1O3NA 1N8OC 5C0UA 3RXAA 1KXFA 1T4VH 1HAVB 1L1JA 1CT0E 1QJ7B 1RXPA 1ZPBA 2P94A 2XBVA 4Y7BA 5EPNA 2ZPQA 1C5VA 4FUFA 2C8XB 5LPRA 2Z6BD 1ZRBA 4A6LA 1DLKB 1W11U 4MNXA 4B71A 1SLWB 1THSH 1NU7B 2FYRA 4R8TB 1BHXB 1BTPA 1O2GH 4LK4A 5EQQA 1E34B 4B73A 1NFXA 2B5TB 2ZCHP 3JZ2B 3F9HA 4AB8A 1FN8A 2XC4A 3U69H 2ZDMA 3A80A 3S7KB 2UWLA 2KZ4A 1HBTH 2R3UA 3EE0B 4JZDH 1RTLA 4PROA 1GHBF 4CRAA 4NZLA 4KP0A 2BQWB 4CHAB 2AMQA 2XW9A 2H9TH 1BHXF 1A3EH 1GI5A 3BIVH 2R0LA 3D62A 1SPJA 5EXNA 5C1UA 3SV7A 3FP7E 1O3KA 3MMGA 2XCFA 1KYNA 2SGEE 1XX9A 5L2ZH 1ACBE 1GMDG 4ZKRU 1EJAA 2V3HH 4XBCA 1C9PA 2Z7FE 5A0AE 3OEHD 1TGSZ 1NFUA 1UHBB 3OAAD 1O3EA 1NS3A 4K2YA 4MVNA 1TRNA 1FXYA 1K1PA 3E0NB 1N1LA 1P57B 4FUHA 4Q7YA 4F49A 3NZIA 4ACBA 4J2YB 4U01A 2Q6FA 3Q3XA 1SGFG 3SI3H 2JETC 5BPEA 2H6MA 2M5TA 2A31A 3BTTE 1QRWA 4Y8XA 2W6JD 2W6ID 1GI3A 2OC8A 4UONA 3ZV8A 5EXMA 1TPOA 1GMHF 5JBBS 5C3NA 1ZSJA 5F03A 3HK6B 1Y5AT 1O3MA 3UAIC 4TYDA 3SO3A 2A32A 1GJ6A 3TGKE 2KCYA 1DOJA 1D3QB 2K0QA 4CR5A 1W13U 1O3PB 1MABB 3GS9A 2WSSD 4INHA 4JYUH 3SBKA 3RXSA 5DG6A 5AF9H 1S0QA 1QZ8A 1SKYE 4Q7XA 4OGYA 1N6XA 1IQIA 1Z8RA 2OC7A 1FI8A 1EP5A 1F0UA 3SYJA 1VGCC 4FU8A 4ISHH 3KF2A 5DKMA 5F8XA 1T8MA 3ZYEA 2RA3A 2K1QA 2VIWA 1C5NH 1YGCH 1YLNA 2HNTC 1T32A 2KM0A 4FU7A 5FBIA 2ZHQH 2BYAX 1PPEE 2ZO3H 1NFWA 5ESTE 3TVJB 2OUAA 3U1IB 1YKTA 2BOKA 3ATMA 1Y8TA 3H09A 1O2LA 2ZHEH 2XBXA 1K1MA 1O3LA 2VVCA 1SGFA 5ETXA 4Z0KA 1A7SA 2QGRA 3G01A 5FPTA 3DSPA 2HNTF 9ESTA 3P92A 5JBCS 3N7DA 1TPAE 1ELEE 2B9LA 2BDBA 2PSXA 1SGTA 1DXWA 4JCNA 4YTAA 1XVOA 2AHME 2GMTC 2TGPZ 3URDA 4UFFH 1SHHB 1MUEB 4B1TA 2SGAA 1O2HA 1TALA 1WU1A 1HNEE 1P9UA 3BTHE 4FVBA 1SQTA 2GJGA 1HJAC 1IOEA 2Z3EA 3BF6H 1EZSC 1AU8A 3HGPA 4OS2A 3F68H 3MTYA 4ZXYH 5JPMH 2AGGX 1A4WH 2ZF0H 2C8YB 3V12A 2H9HA 1WV7H 1UHBA 1BITA 5HMAA 5EW1H 1GHYH 1ABJH 1SI5H 2FPZA 1TPSA 4BXWA 3ZVBA 3RC5A 1ZRKA 1QR3E 4X6OA 5EIYA 1YCPH 1W0KD 2QY0B 3ZZCA 1WCZA 2F9VA 1KXEA 1EPTB 1ORFA 3GOVB 4U30A 4CRGA 1GCDA 5DP6A 2Y82A 1C2JA 3SU1A 3QTOH 1MU6B 2C93B 1TQ7B 1MD8A 4Q80A 2JKHA 3NK8A 5FCKA 3B23B 1MAYA 1GJ8B 1OP8A 2GX4A 1O38A 1DDJA 1A0JA 1YPGH 1V2LT 5HIYA 3ELAH 3ODFA 1THRH 2P16A 1SGCA 2Z9KA 3U28C 2LNCA 3MH7A 3RUOA 3PRBA 2FOHA 3PMBB 2W3IA 2QIQA 1C5OH 2FMJA 2VWOA 5C20A 2R0KA 1NBMD 3DFJA 3MH4A 1F5LA 2CF8H 1GBAA 2GV7A 3KQ5A 1GBMA 1O5FH 2F4LA 2TBSA 3C27B 5SGAE 1GBEA 1H9LB 2H9EH 1B0EA 3QX5H 4B74A 3E91A 3HATH 2EI6A 5GIBA 3LT3A 4P00A 3C1KA 3LJOA 1VGCB 3MU4A 3OTPA 2QXGA 1TAWA 1Y59T 1HAGE 1P8VC 2P3TB 4ACAA 2TGDA 1GI9B 4Y6DA 4ZCNA 4NIWA 1C5QA 1RIWC 1ETTH 5EQRA 2BVSH 3P95A 2ZGBH 5EOKA 3IITA 3P8OA 1AUJA 1ELAA 1EPTC 2Q6DA 3A7TA 2ZDAH 2AS9A 1FIZA 2GZ8A 1NRQH 1VITF 2ZG0H 2WPHS 2C90B 4BAMB 1DICA 1O3DA 1GMHG 4H42U 3UB0A 5A2MH 2SGFE 4I8JA 4X2XA 4YZUA 5F8TA 3UFAA 3DT0H 1VCPA 3Q77A 3S7HB 1AZZA 1L0ZA 1LPGB 1AHTH 2V3MA 4A92A 1IQKA 3A82A 3KQBA 3FP6E 4NSVA 1CGHA 2A1DB 2BLVA 1GL1A 7GCHG 3F6UH 1TBQH 3BG8A 1QL8A 1GG6C 2PFEA 2KAIB 1O2IA 4RKJB 4DJZB 1YCPK 2EEKA 1V2QT 1JIMA 2XBYA 3ZZDA 5A8XA 3U1JB 4Y71A 2ZU4A 4E7RG 1O35A 1ZR0A 3TU7H 1MMJN 2JDID 1SL3A 2Z3CA 4AN7A 1P05A 2QXHA 4RT0A 2PKSB 3SGAE 2FXRA 3SNDA 3N7OA 5DSFA 1S5SA 1GJ9B 2C4FH 1G3DA 4B2AA 1O37A 1GHZA 4ABDA 4NIYA 1EATA 1QBOA 2AGIX 1KIGH 2BB4A 3TITA 3TK9A 3W95A 2WV5A 4CHAC 1TMBH 1C5LH 1QB1A 4A5TS 5L6NH 1FDPA 4AX9H 3DD2H 3RMNH 1KLTA 3BEFB 1QL7A 1SLUB 1NTPA 1MTUA 2ILNA 2XOKD 1FPCH 3A85A 4R0IA 3SU6A 4X8TH 4ABBA 1W10U 1L4ZA 2BY6X 1V2VT 2HRVA 4I7YH 1IQEA 2FIRH 3ZVAA 2I6QA 4E7NA 1VJAU 2VINA 1AZ8A 5TCAA 1G2LA 1LPZB 3FP8E 1HIAA 4ASHA 3UNSA 3QUMP 3FANA 1QQUA 1Z8JB 1D3TB 1BJVA 3K6YA 3WWBA 4CRCA 3QZQA 3QGNB 4WMEA 2QAAA 3FO8D 3SN8A 1T31A 2C8ZB 2QF0A 1BT7A 3DA9B 2EI8A 1YY3A 2JETB 3D49H 1H8IH 2P8OB 3VG8A 3E90B 1PJPA 1SGIB 1A1RA 1XUIA 4M9FA 2SGPE 3U8TH 4X1SU 3GY4A 1XUFA 6CHAB 4FVDA 4D7FA 3UQOA 4VGCC 2WV9A 1CHOF 1C5SA 1IHSH 4WMFA 3E1XB 4CH2B 3MHWU 4D9QA 1O36A 1S83A 1W8BH 3D65E 6ESTA 3KQCA 4Q2KA 3SU0A 1OWEA 1A61H 5DP9A 5BRRE 1UTNA 4JYTA 2OC0A 1V2KT 2BD3A 1GHXH 2BVRH 3U8OH 2BQ7B 1J9CH 4J1YA 4NWKA 5C1YA 5PTPA 3MI4A 1EAUA 2OBQA 1QL9A 2P3FH 4K1SA 2K8IA 1TX6A 3BTFE 5FXLA 5HIZA 3GY2A 3M36A 1GGDB 3MYWA 2HVYB 1O2UA 3O8DA 2UUYA 4X1PU 3P8NA 4BOHA 1KDQA 1Z7KA 2RCEA 1P01A 2GZ7A 1SLVB 2BDAA 3T26A 5C5OA 2XCNA 3A81A 3EA7A 3S9AA 3TIUA 3ZZ4A 1ZPCA 4XBDA 2A2QH 1GI0A 3SU5A 2GTBA 3BTQE 1S82A 3RXPA 1BIOA 5J4QA 1BOQA 2AERH 1FY5A 1LVBA 4Y11E 2NU1E 4AFSA 4NG9H 2B7DH 2VIDA 3ZIAD 3A7ZA 1EB2A 2F9PA 5FPSA 2YMSB 1WTGH 4I86A 1PQAA 2BD9A 5KGOA 1JBUH 1AGJA 2FTLE 1G3BA 1O3OA 1S0RA 1O2ZA 5HM9A 3MWIU 3SJKA 2G4TA 1ELCA 2ZKSA 4Q7ZA 1A0HB 6GCHF 4OS4A 2PUXB 1K1JA 4ASUD 4A1TA 5IDKA 1YPLH 1SGQE 1AIXH 1SVPA 5HGGA 2FM2A 8GCHF 3RMOH 5LH8A 1SR5C 4WH6A 3DFLA 1QGFA 2CN0H 3ESTA 1DE7H 4K1TA 5C67A 1GDQA 1SSXA 3IG6B 3SV6A 2XRCA 1ESAA 1O5GH 3V0XA 3ZV9A 1CA0B 1EP6A 4YESB 4AGKA 1E37B 1OWJA 4Q63A 4AYVB 1CO7E 1CT2E 3GDUA 1KMHB 3KQDA 3SU2A 3A7YA 2ZGJA 1W14U 2WPJS 1DX5M 1XKBC 2F43B 1YPJH 5EG4A 5TJXA 2Y5HA 1Z6EA 2DUCA 2BX4A 3OY5U 1JRTA 1ANBA 1YPMH 1UTKA 5EODA 3FZDA 2CV3A 4B2CA 1ETRH 1C1PA 1FZZA 3T29A 2KCAA 2ZFQH 2HALA 1WOFA 2EC9H 2VU8E 4ISOA 5F8ZA 3LGUA 1BDAA 1YPKH 1LVOA 1NU9A 3ATKA 1KLJH 1OYTH 1QY6A 2F9BH 2WV4A 2ZHDA 3LH3A 4AFUA 3M7TA 1O5DH 5TCCA 2ESTE 2WPLS 3UR9A 4H6TA 1BTXA 1W12U 3QDZB 4TY7A 2J98A 1XUGA 2VH6A 3QWCH 1GHBG 2PKAB 2UUKB 2KX4A 1G2MA 1YPHE 4M7GA 1P2JA 3P6ZB 4ZROA 1KTTB 4O3UA 8KME2 1GI6A 3PTBA 3VB3A 3LGVA 4F48B 1MTSA 4GAWA 2P59A 3T25A 1ZJKA 8ESTE 2FLBH 3PMAB 1GDUA 1HB0B 3M5OA 1SQOA 5JBTA 1FONA 1QB9A 1WBGB 1VCWA 4UE7H 1AD8H 2GDEH 3OFND 4UFDH 2GCTB 3T5FH 1UTMA 1V2JT 1XUJA 1K28D 4X8SH 1MTNC 4GCHG 1Y3WA 3MO9A 2FESH 1A3BH 4INKA 3V13A 2XBWA 2RG3A 1SFQB 2GD4B 3A88A 3SU4A 2WPKS 3STIA 5EPYA 1NY22 2ZFFH 4MDSA 1C5YB 4CREA 1LMWB 5CE1A 1GCTB 1C5UA 4FUBA 1TBRH 4FETA 1O0DH 1EJNA 4WXIA 1BZXE 1YBWA 1UVSH 3RP2A 1O34A 1ELVA 1ELDE 4XD7D 5JYIA 1UVOA 2ZDVH 1P2MA 2GZ9A 1B7XB 2Z9JA 3SZNA 3PO1B 1EASA 4MNYA 1W3CA 1GJCB 4RT1A 2UUFB 1QBNA 4IMQA 1UK2A 3BTGE 2XC0A 2J92A 3A84A 1GI7B 2AMDA 1C2DA 5I25A 1W0YH 1LKAA 5JB9S 1H1BA 2J2UA 4KTCA 1J15A 3BV9B 1VKYA 1DWBH 1OPHB 2C8WB 3B9FH 5E0GA 1MTVA 1LHCH 5GXPA 5A0BA 1ABIH 2BLOA 2WPIS 1O2VA 1KXCA 3Q3YA 3RXIA 2ZFSA 3PV4A 2A4QA 4KTUA 2CHAC 2HVXA 4AYYB 1YWUA 1C4U2 3SJ9A 2JH0D 1MBQA 2ZPSA 2B8OH 3SV8A 3OE7D 1F92A 4XDEA 1U6QA 2R9PA 5E0JA 1RRKA 1GMCG 2QCYA 4X8UH 1V2TT 4AFZA 2Z3DA 1PPBH 1MKWK 3RM2H 1UJ1A 1P2OA 2OCVB 4JZ1A 4B6FA 3MU1A 1NROH 5I46H 4ABAA 1QRZA 3TJVA 2BOHB 4MNWA 3WY8A 1KXBA 1EAIA 2FOBA 5FX5A 3MNSA 1IQFA 1QQ4A 4IMZA 4ZXXH 1QA0A 1PPGE 2NU4E 1GBDA 1BUIA 1E1RD 1MD7A 1Q3XA 3MH5A 3RXRA 1DVAH 1S81A 4BTIB 1SGYE 1C1OA 2EY4C 4BAKB 3EA8A 4X6NA 1G9IE 5CMXH 1XVMA 1TNKA 3K2UA 3RXTA 2ZZUH 3GDVA 1LVMA 1GCTC 3CENA 1MU8B 3NXPA 4WVPE 2GCHF 1LKBA 3VEQB 1EB1H 3PB1E 4Y8YA 1AVGH 1RD3B 4O03A 1O2QA 2BD7A 3F1SB 1YCPM 3B8JA 2GCHG 2WHXA 5IYTA 2A5AA 1IQHA 4GCHF 2GCTC 1QBVH 3R3GB 1ZJDA 2WYGA 2Y7ZA 2A0QB 5CHAB 4I8LA 1PYTC 4OS6A 5HKKD 4K69A 2YMSC 1XUHA 3SNEA 4ISNA 1GHVH 3O8CA 3A8AA 5LPEA 1HV7A 1MQ6A 4ZUHA 1ZHMA 3GCNA 1O3CA 1SOTA 3KNXA 4H6SB 4Y0YE 2FDAA 4BTTB 5DPAA 1L1NA 3K65B 2W26A 1O2PA 2FODA 4LOYH 3A8BA 1RS0A 3UIRA 2A7HA 1O5CB 3TH2H 3NUMA 3HKIB 3URCA 2A4OA 3M3SA 1S6FA 1ZHPA 3PLKA 1EKBB 1S6LA 3PV5A 1JXPA 2J4IA 4FUCA 1LQDB 5B6OA 1HJAB 4GHQA 4AOQA 2CJIA 1QRXA 3SZEA 2O8WA 3F2HA 1PPZA 3TK6A 1GBHA 1TA6A 3BG4C 3UPEA 2LPRA 3SNCA 3OEED 1F7ZA 2OXSA 4A1VA 1YP9A 4KTSA 5A0CA 1AO5A 2O9QA 1CT4E 1BRUP 1QTFA 2HLCA 4KKDA 1HAOH 1NRPH 2HPPH 1OWKA 1PFXC 3OSYA 3VXEH 2ANYA 1DS2E 1F0RA 1BRCE 2G4UA 2HWLB 1O5EH 4GSOA 1EFRD 5DP5A 2OQUA 2Y5GA 4WXVA 2GGVB 4BAQB 1AFQB 1DY9A 4TWWA 1CGJE 2FOAA 3S9BA 2J97A 3DHKH 1SGPE 1O33A 2QYIA 4YT6H 2ODYB 4ESTE 2FX6A 1SFIA 1PQ8A 3HPTB 1GBJA 2F9NA 2ZWLH 5EW2H 1Q31A 1EAWA 5DO4H 1SQAA 3N7EA 1NC6A 1DXPA 1E0FD 3GCHC 4H4FA 3LDXH 1GMDF 1HXEH 1XXDA 3MNCA 2FO9A 3MOCA 1H8DH 2J38A 3UNRA 3L33A 2FI4E 3LGTA 2AEIH 3KGPA 2ZECA 2G5VA 3EQ0H 2ALVA 3VGCC 4DIHH 1TX8A 3BTKE 1A2CH 4TPIZ 3ZZAA 1PQ5A 4WMDA 2W5EA 1TABE 2V35A 3TNSA 4RSPA 5DK1A 1SB1H 1YLCA 1BA8B 3QGJA 5AHGH 2VGCC 1ARCA 1WSSH 3KHVA 1BRBE 1P11E 2A2XH 2ZDNA 2QC2A 3VXFH 3A7XA 3SUEA 1IQGA 2ZFTA 1VZQH 3SJIA 3LC3A 3RU4E 1MTWA 1FV9A 1GJ7B 3BIUH 5T6FA 1BTHH 1ZMJA 2V7QD 1UK3A 2VVUA 1MKXK 3RXMA 3Q76A 1P06A 4AORA 1G30B 2KCPA 3TLOA 1GJAB 4I32A 4RI0A 1TGNA 2A5KA 2XWBI 1SBWA 1GBLA 4IN1A 3LIWA 2A7CA 3UOUA 2H5DA 1BJUA 1EAXA 2ZFRH 1HAIH 4K1EA 1O32A 1C5RA 1GDNA 4K3JA 3SORA 1O3IA 2BM2A 2Z94A 2V6NA 1MTNB 1RTKA 4IBLH 1O3JA 1GG6B 3EAJA 2BMGB 3EE7A 1FIWA 1TWXB 1NRRH 5CHBA 1AN1E 1P2QA 2ZP0H 2TIOA 4TWYA 1TLDA 5G4BA 1HAHH 1ZTKA 2P8OC 1EPTA 5EGMA 3IWMA 1FMGA 3KCGH 1C2LA 1ZZZA 4OS1A 3M37A 1BQYA 3SUFA 1TQ0B 2KCOA 2OBOA 2BLQA 4UFEH 1TPPA 3JZ1B 3TJNA 3RXBA 4OM9A 5C94A 3OU0A 1V2OT 4ISIH 2XXLA 1J14A 3GCHB 2GKVE 3EYDA 3EA9A 3RXDA 1DY8A 1MKXH 1MKWH 2ANKH 1N8OB 1HJ9A 1DSTA 3SU3A 3AW0A 4DT4A 2LELA 2G00A 3PLPA 4HG6A 1WQVH 1WXRA 1UW7A 1Y3XA 1P03A 4IS5A 1CE5A 3V3MA 4GUXA 1O3GA 1COWD 1HXFH 3SV9A 3M5NA 3QN7A 1H8HD 3RXJA 1DSUA 1O39A 3PWCA 2GT8A 3F2FA 1MH0A 3SI4H 4MPXA 3PTNA 1OXGA 1HPGA 4B75A 3PM3A 2R2WU 2FP7B 2HPQH 1W2KH 1SGNE 2IJOB 1XM1A 2ZFPH 1Q2WA 4D9RA 2SGQE 1THPB 4HTCH 3M3TA 3SQEE 1AI8H 3EGKH 3RXHA 4ZH8A 1GMCF 1YYY1 3BEUA 4IW4E 5E2OA 3WW7A 4Z1MD 3F9FA 4JMYA 2IPQX 1G36A 4CR9A 3RLWH 3RXQA 1AB9C 2BDCA 5A8ZA 1GI8B 2XWAA 4NSYA 1HYLA 1YPHC 1C5MD 3KQEA 4RN6A 2QV1A 1XUKA 4JK5A 2F9UA 4X6PA 1G3EA 1DWCH 1GI1A 1SC8U 5EXLA 3F0PA 3TGJE 5K7RA 1TGTA 1O2YA 2ZTZA 4JYVH 4HFPB 5ABWA 5C2ZA 1HAZB 2FZZA 1JRSA 1L2EA 4IGDA 3NPSA 3M7QA 4NWLA 2Q6GA 2H2ZA 1LPKB 1GBIA 3E3TA 3AASA 4K8YA 1X7AC 3ZZ9A 3CS7A 1DUEA 2AGEX 1V2RT 1YC0A 2FYQA 1CHOG 1DUAA 3GCTG 1UTLM 3CS0A 1P2NA 5JBAS 2NU2E 3W1EA 2AH4X 3MNXA 4IC6A 4B6EA 5CHAC 2J9NA 2Y81A 4AFQA 1O2TA 2FS9A 3PYHA 2UUJB 1T7CA 5JB8S 1HUTH 1ANDA 3N99A 1FNIA 1O2NA 2I6SA 2XNDD 2R3YA 3GCOA 4ABHA 7KMEH 1O3FA 1UVPA 2AIQA 1PPHE 2PGBB 5T6DA 3LGIA 2WPDD 3MO6A 2ZGXH 1TFXA 1J8AA 2ZU2A 2GVFA 3SQHE 2AIPA 1KTSB 1P10A 1K1NA 3P8FA 4GLYA 3ZZBA 1C1NA 1A0LA 5JDUB 2PKAA 4XRNA 2WZQA 5FX6A 1OP0A 1C5XB 4YO9A 2ZU1A 3E16B 1NM6A 3KYFA 3PV2A 4GHTA 4VGCB 1E36B 3M5MA 1AUTC 2D2DA 2RFKC 1C4V2 3E0PB 3SUGA 3SW2B 5T1VA 2A5IA 1HFDA 1AKSB 5K0HA 4U32A 2OD3B 1TRYA 4BNRA 2BZAA 2ZIQH 2ODPA 2SGDE 3EDXB 5DP3A 6CHAC 1E79D 1P3CA 2EI7A 1K21H 3O8BA 3GY3A 3MH6A 4ABEA 3LONA 2UWOA 1LVYA 3FN8A 1TNIA 1ZYOA 1GBFA 2ZHWH 4X2YA 1C1MA 1NZQH 2VVVA 1TMTH 3O8RA 1FUJA 3E8LA 5DJ7A 1FY8E 4XE4A 4I8GA 3ZZ6A 1FY3A 3A86A 1ZGIA 2TPIZ 2O8UA 3HGNA 4FUJA 1GJ5H 2XYAA 4UEHH 2V3OH 1C1VH 1CA8B 1HAPH 3GYMA 3FKSD 1HGTH 1QNJA 5EJ1A
chains in the Genus database with same CATH topology
2CHAB 4B76A 1BMAA 3R0FA 3PLBA 1PQ7A 1WQSA 6LPRA 2BD2A 1UMAH 4CH8B 2D1JA 4DOQA 1W7GH 2WPMS 3E6PH 3TJOA 3M61U 1J16A 2XNIA 3MU0A 1P09A 1ELGA 1EX3A 1V2PT 1BTUA 1C5WB 3L6PA 1P9SA 3RU4T 1CBWB 4D7GA 4ZHAA 1TA2A 2BTCE 1TNLA 2PKSC 5EU8A 1VITG 2ZQ1A 2VIVA 8LPRA 1V2UT 2YNAA 3T62A 3TJUA 4ABJA 3QO6A 1C5TA 1C1TA 1P04A 1O2WA 3UOPA 1OS8A 3OTJE 4XBBA 4XSKU 3V7TA 2OTVA 2A45B 2BDHA 2BXTH 2P95A 4ABFA 4YT7H 4CBOA 3LKWA 3TGIE 1MCVA 2STAE 4GVUA 1MBMA 3OY6U 1M9UA 1TIOA 1JMOH 2VH0A 3ATWA 2ANWA 3GYLB 4TPYA 3T2NA 2ASUB 1GHAF 2NWNA 2GT7A 1D6RA 1ANCA 1P02A 2RDLA 3KIDU 3UREA 1HAVA 3FAOA 3UY9A 5A8YA 4JK6A 1DFPA 1A5GH 1IHTH 1UVTH 2IPHA 5DGJA 2VJ1A 4INLA 2QXJA 2G51A 1DT2A 3ZVEA 3BSQA 4DCDA 1C1UH 1GWAA 4YOIA 3RC6A 3U9AH 4GPGA 2FOFA 3FVFB 4K8BA 1BCUH 1ESBA 1T8NA 1S84A 1BTYA 1FLEE 1B5GH 2BXUH 1F0TA 4WH8A 3SNAA 2PR3A 4NIVA 1GHAG 1ZSKA 5T6GA 4A7IB 2FEQH 1L4DA 1RGQA 4ZKSU 3K9XB 4Y79A 3PMHB 4IN2A 1HCGA 2FOCA 2F83A 2FX4A 1V6DA 2SNVA 2H5CA 2O8LA 3RXGA 1HRTH 1AB9B 1EZXC 1ZLRA 1EZUC 1HIAB 2ZNKH 5FPYA 4B2BA 1CA0C 1NT1A 2BDGA 4NA8A 4Y7AA 1Z8IB 3A87A 5LGOA 3A8DA 3AVZA 1C2GA 3P17H 2WUBA 1XKAC 1UTPA 5GJ4B 2VIQA 3LGYA 5EQSA 2W7UA 1HLTH 2Y80A 3RLYH 4MPUA 1DWDH 4YLQH 3ODDA 3CP7A 1CGIE 3HKJB 1EUFA 3BTWE 2KAIA 1ZMLA 4KGAA 5DP4A 4XFQA 1ZSLA 3A8CA 1LHGH 3S69A 4DT7B 1W0ZU 1O2KA 3BTME 7ESTE 2ZCKP 2GP9B 1DLEA 4SGAE 5HYOA 2ZI2H 3M5LA 4HI3A 2VWNA 4ZHMU 3QK1A 3ITIA 2FWWA 2ZHFH 1FY1A 3ZZ8A 1S85A 2FI3E 1HJ8A 1UVUH 2P3UB 3S9CA 3UWIA 2YNBA 1F5KU 3UTUH 1Z6JH 1BBRE 1BTZA 1FQ3A 1O2OA 3AAVA 5GCHF 1AQ7A 3RDZA 2OINA 2DE9A 4MNVA 1TGBA 1AY6H 1D3PB 1DANH 4JZIA 2SNWA 5GCHG 1K22H 5AFZH 2ZTXA 4YOGA 1NRSH 9LPRA 3RXOA 1ZTJA 1AE8H 2BDIA 1C2EA 1KY9A 3GY7A 4AZ2B 2GMTB 3A89A 2Q1JA 2VNTA 3RM0H 1CU1A 1BMNH 2BVXH 2PTCE 2W3KA 3SJOA 1VITH 1C2FA 2Y5FA 1N6YA 2B0FA 2PWXA 2Y6TA 5AVDA 6GCHG 1SOZA 1LCYA 3MO3A 3UWJH 5F6MA 4MPVA 5FAHA 1O30A 4Y10E 4THNH 1YM0A 1EOJA 5FBEA 4DIIH 1WAYB 2ZQ2A 1OP2A 3MU5A 4HGCA 1UTOA 3ZVDA 4D76A 1KXAA 3VB4A 1GJ4H 3ATLA 1BBRK 3MNBA 4MQAA 1E35B 4NA7A 5J4SA 1Y5BT 4UDWH 1HDTH 1C1SA 1EJMA 3SNBA 4ZHLU 1C1QA 1P2KA 1WYKA 1GBTA 3MFJA 1CVWH 2G55A 1TE0A 1V3XA 1QURH 1TNJA 1ZGVA 5L2YH 1NN6A 2D8WA 1AWFH 1KLIH 1OSSA 2ZDLA 4X0WU 4K5ZA 4XOJA 1KSNA 4BANB 1D6WA 3SV2H 1GBBA 1C1WH 3QTVH 5LPFA 2BDYA 1OWHA 4BAHB 4JZEH 4E05H 5AFYH 1WUNH 3GY5A 1FAKH 2ZCLP 1TONA 5E0HA 1L1GA 3I78A 1C2MA 1GI2A 3QZRA 1GBCA 3ZZ3A 4X8VH 3P8GA 1K2I1 4UD9H 4AB9A 3VB5A 4E06H 1VJ9U 1AFEH 4QT8C 5L30H 4I8HA 1IAUA 1W7XH 1ID5H 2AMPA 3QLPH 3KEEA 1OOKB 5T3HA 1BTWA 1O5BB 1LHEH 2FI5E 3AW1A 1C1RA 3TPIZ 2ZTYA 1V2ST 3AAUA 1K1IA 4MTBA 1NFYA 1BRAA 5FCRA 4SGBE 2JH6D 4I8KA 1OWIA 1O31A 2AYWA 1XMNB 3M3VA 1JOUB 4Y76A 1QIXB 3SJ8A 3PROA 3U98H 1TGCA 1Z8GA 4HZHA 4DG4A 4ABIA 1IQLA 4F4OC 1IQJA 2V0BA 4WWYA 2EA3A 1NRNH 1O2RA 1ZTLA 2GV6A 2FLRH 1O2JA 1UO6A 4Y8ZA 1TNHA 1HAYB 1VR1H 2OP9A 1H9IE 1ESTA 3SOSA 4ZMAH 1CBWC 4DVAU 1B0FA 5GWZA 4OGXA 3FFGA 1GPZA 2A7JA 4WJG2 1UCYK 2Z9GA 2ZEBA 3RXKA 2VGCB 1F5RA 3LJJA 1C2IA 1F2SE 1J17T 1PPFE 1AWHB 1C4Y2 4I33A 3ZZ7A 1TOMH 3GCTF 3VPKA 1O5AB 1CQQA 5C1XA 3UQVA 5FHTA 2C3SA 3Q3KA 1C2HA 2ZDKA 3UNQA 3RMMH 3I77A 2VWMA 3RC4A 4NIXA 1RFNA 2QN5T 1FPHH 2UWPA 2FTMA 1ELTA 1GGDC 3ZVGA 1BB0B 1CSOE 4K60A 1QFKH 2AFQB 1O2MA 1ANEA 5E8EH 1KDQB 3MU8A 1JIRA 1QCPA 3FZZA 4LZ1H 2G5NA 2PGQB 1SHYA 1ELFA 1TNGA 2BZ6H 4FUEA 3GY8A 1D4PB 3H7OA 2CGAA 2TGAA 1MCTA 2O8MA 1PYTD 4ZKOU 1NPMA 3GICB 4WY3A 2NU3E 2R2MB 1MQ5A 3F9EA 1A5IA 1P0SH 1DPOA 3LOXA 1MZAA 1G37A 1G32B 1C5ZB 3PMJA 1P3EA 2VIOA 2H1UA 4DY7B 3W94A 2PV9B 2OQ5A 2PTNA 1QHRB 2IOTA 1D3DB 3I29A 1Y3UA 1P2IA 1OKXA 4IC5A 2ZGCA 3RXLA 2CF9H 2FS8A 1TYNA 1BBRH 3BG4B 2PHBA 3LH1A 2ANMH 2Y7XA 2ZPRA 1LTOA 1ARBA 3K6ZA 4YM9A 3BN9A 2NU0E 4UFGH 2O8TA 3OYPA 2JH5D 1OX1A 4YLUA 5DP7A 4Z6AH 2FOMB 2WINI 4Y0ZE 1TB6H 2XC5A 1TX7A 4WF8A 2SFAA 1UTJA 5HM2A 4CRBA 4ABGA 1EQ9A 1AVXA 3VB7A 2VB0A 3PWBA 4ZKNU 2J94A 1HAXB 1GL0E 4NZQA 4NA9H 3LC5A 3ZYDA 4YOJA 4NGAH 4FUDA 3A7WA 5DP8A 4D8NA 2VIPA 1D9IA 4X2VA 1AVWA 1WTHD 3RMLH 1TRMA 2D26C 3UR6A 2F91A 2Z9IA 1AKSA 1GJDB 1QB6A 1INCA 1OWDA 4X2WA 3VB6A 1ZOMA 1RJXB 1S6HA 1YPEH 1BMMH 2FOEA 4FU9A 2ZGHA 2FOGA 4FUGA 1EXFA 1GI4A 1LDTT 1GBKA 1EOLA 4U2WA 5A09A 1H9HE 1SGEE 2F9OA 4X1RU 1DITH 1RTFB 3NCLA 4DW2U 4X6MA 1TBZH 4O97A 2BY5X 1O3AA 2BD5A 3T28A 5HXFA 2HNTE 3DUXH 1YLDA 4KELA 2BD4A 3SGBE 3TH4H 1UCYE 2RA0A 3P70B 1TOCB 2IN2A 3KL6A 2BY9X 1GHWH 1QA7A 1OYQA 2BQ6B 1FAXA 2XTTB 2CXVA 2WYJA 1UK4A 2ALPA 2OC1A 1VCQA 1O3BA 2ODQA 3A83A 4A1XA 1RIWB 1T4UH 3NWUA 2TRMA 4MG3A 3VGCB 1O3HA 1V2MT 3GDSA 2DE8A 3LGWA 1FJSA 2ULLA 3OX7U 2BLWA 1C5PA 4MPWA 2GDDA 1DM4B 3SHAH 2ZU3A 3D23A 3VFEA 2THFB 1Z1JA 3PO1C 2QA9E 3GY6A 4OS5A 2A4RA 4AGJA 1E38B 1K1LA 1Z71A 2STBE 4BXSA 3ZVCA 1LHDH 2G52A 2PUQH 4BAOB 1ELBA 1TMUH 2J95A 1G3CA 1K9OE 2PW8H 2QF3A 4BTUB 1IQMA 1SG8B 1SMFE 4LXBH 3RU4D 3ENSB 4OS7A 1A46H 4ZAEA 3H7TA 1GVKB 1Z1IA 1SGRE 8GCHG 4LZ4B 4TY6A 2A4GA 2ZA5A 1KXDA 5GPIB 1JWTA 4CRDA 3A7VA 2OLGA 2YOLA 1K1OA 2ZC9H 3RXEA 2WUCA 3T27A 4X1QU 4CRFA 1ETSH 2BHGA 5GDSH 2BD8A 7LPRA 2TGTA 3GISB 2G8TA 2J34A 3M7UA 1P12E 3BTEE 2F3CE 1LQEA 4RKOB 3TK5A 1UCYH 1XXFA 1MZDA 2HGTH 3F9GA 4O3TA 3RXCA 1A5HA 2ZU5A 4I31A 3RXFA 1C9TA 1LO6A 2BX3A 1NESE 3H5CB 4NCYA 2PSYA 2BY7X 1CHGA 1DWEH 4FUIA 3ZVFA 1H4WA 1PPCE 5E2PA 3KN2A 3UUZA 5C5NA 2W7SA 3HK3B 1QJ6B 3L3TA 1IQNA 1V2WT 1Y3VA 3TH3H 3S0NA 2Z9LA 1FY4A 1QJ1B 1ZMNA 1MAXA 4DURA 3LPRA 3SGQE 5H4IB 4AG1A 3LU9B 4O9VA 1SGDE 1YF4A 2QXIA 1V2NT 5ESBA 2G81E 4DGJA 3TNTA 2HOBA 3NKKA 3ZZ5A 1C2KA 1O2XA 1T8LA 1UTQA 2BY8X 2P93A 3BTDE 2PLXA 1LHFH 1Y5UT 3M35A 3U8RH 3SHCH 3RXVA 1O2SA 7GCHF 1T8OA 3ATIA 4JZFH 4AG2A 3STJA 1GVLA 1F0SA 1AFQC 4ISLA 1AE5A 1GVZA 1NO9H 3BEIB 2VWLA 4NFEA 1ZHRA 4NFFA 4CBNA 4MLFB 1AMHA 1SLXB 1Y3YA 3Q00A 3RXUA 1ZPZA 1GJBB 2CMYA 1EZQA 4X1NU 4FXGH 1BMLA 3SUDA 1FN6A 1O3NA 1N8OC 3RXAA 1KXFA 1T4VH 1HAVB 1L1JA 1CT0E 1QJ7B 1RXPA 1ZPBA 2P94A 2XBVA 4Y7BA 5EPNA 2ZPQA 1C5VA 4FUFA 2C8XB 5LPRA 2Z6BD 1ZRBA 4A6LA 1DLKB 1W11U 4MNXA 4B71A 1SLWB 1THSH 1NU7B 2FYRA 4R8TB 1BHXB 1BTPA 1O2GH 4LK4A 5EQQA 1E34B 4B73A 1NFXA 2B5TB 2ZCHP 3JZ2B 3F9HA 4AB8A 1FN8A 2XC4A 3U69H 2ZDMA 3A80A 3S7KB 2UWLA 1HBTH 2R3UA 3EE0B 4JZDH 1RTLA 4PROA 1GHBF 4CRAA 4NZLA 4KP0A 2BQWB 4CHAB 2AMQA 2XW9A 2H9TH 1BHXF 1A3EH 1GI5A 3BIVH 2R0LA 3D62A 1SPJA 5EXNA 5C1UA 3SV7A 3FP7E 1O3KA 3MMGA 2XCFA 1KYNA 2SGEE 1XX9A 5L2ZH 1ACBE 1GMDG 4ZKRU 1EJAA 2V3HH 4XBCA 1C9PA 2Z7FE 5A0AE 1TGSZ 1NFUA 1UHBB 1O3EA 1NS3A 4K2YA 4MVNA 1TRNA 1FXYA 1K1PA 3E0NB 1N1LA 1P57B 4FUHA 4Q7YA 4F49A 3NZIA 4J2YB 4U01A 2Q6FA 3Q3XA 1SGFG 3SI3H 2JETC 5BPEA 2H6MA 2M5TA 2A31A 3BTTE 1QRWA 4Y8XA 1GI3A 2OC8A 4UONA 3ZV8A 5EXMA 1TPOA 1GMHF 5JBBS 5C3NA 1ZSJA 5F03A 3HK6B 1Y5AT 1O3MA 4TYDA 3SO3A 2A32A 1GJ6A 3TGKE 1DOJA 1D3QB 4CR5A 1W13U 1O3PB 4INHA 4JYUH 3SBKA 3RXSA 5DG6A 5AF9H 1S0QA 4Q7XA 4OGYA 1N6XA 1IQIA 1Z8RA 2OC7A 1FI8A 1EP5A 1F0UA 1VGCC 4FU8A 4ISHH 3KF2A 5DKMA 5F8XA 1T8MA 3ZYEA 2RA3A 2K1QA 2VIWA 1C5NH 1YGCH 2HNTC 1T32A 4FU7A 5FBIA 2ZHQH 2BYAX 1PPEE 2ZO3H 1NFWA 5ESTE 3TVJB 2OUAA 3U1IB 1YKTA 2BOKA 3ATMA 1Y8TA 1O2LA 2ZHEH 2XBXA 1K1MA 1O3LA 2VVCA 1SGFA 5ETXA 4Z0KA 1A7SA 2QGRA 3G01A 5FPTA 2HNTF 9ESTA 3P92A 5JBCS 1TPAE 1ELEE 2B9LA 2BDBA 2PSXA 1SGTA 1DXWA 4JCNA 4YTAA 1XVOA 2TGPZ 2GMTC 3URDA 4UFFH 1SHHB 1MUEB 4B1TA 2SGAA 1O2HA 1TALA 1WU1A 1HNEE 1P9UA 3BTHE 4FVBA 1SQTA 1HJAC 1IOEA 2Z3EA 3BF6H 1EZSC 1AU8A 3HGPA 4OS2A 3F68H 3MTYA 4ZXYH 5JPMH 2AGGX 1A4WH 2ZF0H 2C8YB 3V12A 2H9HA 1WV7H 1UHBA 1BITA 5HMAA 5EW1H 1GHYH 1ABJH 1SI5H 2FPZA 1TPSA 4BXWA 3ZVBA 3RC5A 1ZRKA 1QR3E 4X6OA 1YCPH 2QY0B 3ZZCA 1WCZA 2F9VA 1KXEA 1EPTB 1ORFA 3GOVB 4U30A 4CRGA 1GCDA 5DP6A 2Y82A 1C2JA 3SU1A 3QTOH 1MU6B 2C93B 1TQ7B 1MD8A 4Q80A 2JKHA 3NK8A 5FCKA 3B23B 1MAYA 1GJ8B 1OP8A 2GX4A 1O38A 1DDJA 1A0JA 1YPGH 1V2LT 3ELAH 3ODFA 1THRH 2P16A 1SGCA 2Z9KA 2LNCA 3MH7A 3RUOA 2FOHA 3PMBB 2W3IA 2QIQA 1C5OH 2FMJA 2VWOA 5C20A 2R0KA 3DFJA 3MH4A 1F5LA 2CF8H 1GBAA 2GV7A 1GBMA 1O5FH 2TBSA 3C27B 5SGAE 1GBEA 1H9LB 2H9EH 1B0EA 3QX5H 4B74A