1AUJA

Bovine trypsin complexed to meta-cyano-benzylic inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title New inhibitors of thrombin and other trypsin-like proteases: hydrogen bonding of an aromatic cyano group with a backbone amide of the P1 binding site replaces binding of a basic side chain.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aujA02
4QT8C 2EI8A 1S0QA 1PPFE 2BDYA 2P59A 3A7VA 3RXHA 1C4U2 1YPHC 4AFZA 4JMYA 3LKWA 2VIVA 3HKJB 1O0DH 1TNKA 2FZZA 8KME2 2PUXB 5GCHF 4KP0A 4IN2A 1T4VH 4THNH 3DA9B 1SFQB 1K1LA 1TBQH 3ENSB 2ANWA 4K5ZA 1QQUA 1LVMA 1F7ZA 4BAHB 2BY5X 1O3EA 1CBWB 1MKXK 2BHGA 1A0JA 1GBCA 2D8WA 3RMOH 2GDEH 3GY2A 3B23B 4A7IB 1P2QA 1TIOA 1C5SA 2ZHEH 3B9FH 4J1YA 1TX6A 1OWDA 1YP9A 4I8JA 2C90B 2ZPSA 1TNIA 4BTIB 1O2TA 1WQVH 2Z9IA 1V2UT 1FJSA 2C8ZB 5JBCS 1UK4A 1B0EA 4B74A 2J95A 2SNVA 3D49H 1RTLA 5A2MH 2OC1A 1NRPH 1TFXA 2BDIA 2AYWA 1UVPA 2JKHA 4FUGA 1SGNE 1KYNA 3T29A 2FMJA 1L4ZA 2G52A 1YPEH 4KELA 5E0GA 3KHVA 1O2NA 5FHTA 4O03A 3GISB 3T28A 5DO4H 1KLTA 3EAJA 2BX3A 4X2VA 2XYAA 1LHFH 1B0FA 1W11U 1A5IA 2O9QA 1TMTH 2RA0A 3M3SA 5L6NH 1HAVA 1QB6A 1O5BB 1ANCA 1BMMH 2VGCB 1EB1H 1UMAH 1P04A 1JXPA 2ZGBH 3V12A 4CHAB 1IQNA 1KXFA 1AE5A 1SHHB 4O3UA 4CRFA 1CHOG 3GDVA 5FPTA 1HPGA 1V2JT 1TRNA 5C67A 1VJAU 4UFEH 1N1LA 3W94A 1AVWA 4Z0KA 8GCHG 2F3CE 5TCCA 3UR9A 1S5SA 1P02A 2ZPRA 7LPRA 1IHSH 4X1NU 4ZKOU 4K69A 2WPIS 4WH6A 3SV2H 2CJIA 3PMAB 1MQ5A 1MU8B 1GWAA 1O39A 7GCHG 5BRRE 4OS7A 1BTYA 2XWAA 1TNJA 2G51A 2H9HA 4X6PA 1GI1A 3ZZAA 4AFSA 2VWMA 3V0XA 4YLUA 4ZXYH 2TRMA 2A31A 2ZHFH 3RLYH 2PW8H 1TX8A 3M7TA 2ZA5A 1PYTD 1P01A 3GDUA 2ZHWH 3SBKA 2Y7XA 3KQCA 4Y8ZA 2BMGB 3HGNA 2R0LA 2DE9A 2GVFA 1HAOH 5K7RA 1BTPA 2Y5GA 1SGDE 3LGYA 1TQ7B 1G2LA 9ESTA 4XBBA 1H1BA 3F9HA 1RJXB 1P11E 2GV6A 2QGRA 3ELAH 5E2OA 1QBOA 2PHBA 1HCGA 5EGMA 4UONA 4E7NA 6ESTA 1ELFA 1QRWA 1SLWB 4SGBE 1GGDC 1UVUH 4X1SU 3QWCH 3E0PB 1ELBA 3F9EA 4A6LA 3GY8A 2ZDAH 2FDAA 1AFQC 2QCYA 3GICB 1XX9A 2QIQA 3ZYEA 2CMYA 3PMJA 4YESB 1OOKB 1AVGH 1Y3VA 2ZFTA 3PO1C 1AN1E 3VGCC 2B8OH 4BTTB 2FX6A 2FOGA 1GJAB 3ATKA 4BAOB 2THFB 1HUTH 2NU4E 4INHA 4KTCA 2D26C 1MUEB 1W2KH 1A61H 1OWHA 1ACBE 3HK6B 1OKXA 3SU5A 1O38A 1RIWC 1Q2WA 2GCHG 4FUJA 5EU8A 3ZZ4A 1ETTH 1A2CH 1W10U 1S6FA 1MD7A 1O2OA 3SV6A 2GMTC 2QY0B 1F0UA 3QDZB 1NM6A 2Y7ZA 1HYLA 2F9OA 2ZHDA 2NU0E 5PTPA 3M37A 3MH6A 3QX5H 1IQHA 1KTTB 1YPGH 3A88A 4CRGA 2FYQA 1DWDH 3TGKE 3MNBA 3P92A 4K1SA 3OSYA 3TJNA 3ZVBA 1NPMA 4WF8A 1F2SE 3TH4H 1ZMLA 2WV4A 4X2WA 1THSH 4A1TA 3SJIA 5GJ4B 2BOHB 1WCZA 4B2CA 2IPHA 2NU3E 1BRCE 5EPNA 1SG8B 3TLOA 4JK5A 2VIDA 1LMWB 2ZDLA 2BD2A 1VR1H 2ZNKH 3ZZ7A 1O3PB 3A82A 1A7SA 1DLEA 1C5PA 3EA9A 4ISIH 6CHAC 2ZFRH 3VB3A 1ZR0A 1AZ8A 4DCDA 1EPTA 2GT8A 1LVOA 2BVXH 2WPHS 3TH2H 3UNQA 2ZPQA 3U1JB 1B7XB 1MKWH 4Q2KA 1FIWA 4FUDA 3C1KA 4IN1A 5HM9A 1BA8B 1WAYB 3DD2H 1IQJA 2A2QH 1FY3A 3RXDA 1JRSA 2AGIX 2ZFFH 4K3JA 4TY6A 5FPSA 2AIQA 4XDEA 1NC6A 2I6SA 1O5FH 3BG4C 4WWYA 1GHAG 3MNSA 4D9QA 1TMBH 1N8OC 1FY4A 3ITIA 1AHTH 2BD7A 2P3TB 1ZOMA 5AFYH 4KKDA 1BMNH 5AHGH 5HM2A 5JBBS 2UWOA 1C2EA 3TJUA 4JYTA 1P10A 1CA0C 1GVLA 1TX7A 4IW4E 1MQ6A 2R9PA 2FOHA 5A8XA 1O3OA 2R2MB 1E0FD 2FOMB 3QK1A 3E1XB 1MBQA 3SI3H 1GI8B 2FOAA 4BAMB 5DP7A 1LO6A 3P6ZB 3P8GA 3U69H 1G32B 2IJOB 4NA9H 2AEIH 4YT6H 3SV7A 2BYAX 3UTUH 4B2BA 1DE7H 4U30A 1H9IE 3RUOA 3BTDE 5I25A 2HOBA 2XBVA 1UJ1A 3MTYA 1E35B 1O2RA 2YNBA 4DW2U 2QN5T 4AB8A 4UD9H 1ELDE 1TNHA 5CMXH 1SPJA 2D2DA 2Z7FE 4ZUHA 2JETC 3ZVFA 3MO6A 1GCTB 2FPZA 2Z6BD 1C2JA 1DPOA 2ALVA 2EEKA 2OBQA 1LQDB 3ATWA 1SL3A 2ZDMA 3SU4A 1WV7H 3PROA 5DGJA 1YKTA 4K60A 1JMOH 3UOPA 3P70B 1ANDA 5EXLA 1C1VH 2C8WB 4H6SB 1QGFA 2PSYA 2P8OB 1ZTJA 2Y82A 2C8YB 1V2VT 3MU0A 1MKWK 3FZZA 4KTUA 1TGSZ 2ZEBA 1EKBB 4DOQA 4ASHA 3E16B 2G4UA 1FAXA 1GMCF 3VXEH 3G01A 1GDQA 3SO3A 3RU4D 4U32A 1TPSA 2A7JA 3BTHE 3T25A 3ZVEA 1O3BA 1V2QT 2R0KA 1EB2A 1AE8H 1GHBG 3OU0A 4Z6AH 2H1UA 1MZDA 1ZJDA 3GCTG 2GDDA 1VGCB 2ZG0H 4SGAE 4I8LA 4FU8A 3CS0A 1G3EA 2O8WA 2BD4A 3MFJA 1OXGA 2CHAB 5GWZA 2ZCLP 1UVTH 1AUJA 1V2OT 5IYTA 1W8BH 5FCKA 1L0ZA 1DX5M 1SR5C 2A32A 1EP6A 1EQ9A 2K1QA 5C20A 3T5FH 5JBTA 4FUIA 3GY6A 3H5CB 3I29A 1NRNH 1AMHA 4Y76A 2STAE 1C1QA 1NN6A 1NY22 1FONA 3HATH 5DPAA 3RXBA 2HGTH 3VB6A 1C1PA 1Z6EA 2KAIA 2IN2A 3A8CA 1BHXB 1UK2A 3UR6A 4I8GA 3ZYDA 3UPEA 1GBTA 1WTGH 2ZC9H 2HLCA 5C1UA 1GJBB 1T8NA 1Y3UA 1AD8H 2ZKSA 3LGTA 3M61U 2FO9A 3P95A 2J38A 2HPPH 3ZVGA 1MCTA 3TGJE 1HJAB 2HVXA 1OX1A 2SGFE 4B71A 3SU3A 1QQ4A 3F6UH 1O37A 3TU7H 1XUGA 1ZPCA 3M35A 4CRAA 3FVFB 1TRYA 4MNVA 3ZZ5A 9LPRA 1QRXA 4MPXA 4F49A 1Y5UT 5J4SA 5LH8A 2ZTYA 3M5LA 2YNAA 4FUBA 5CE1A 2PKSC 1BIOA 4YOJA 5EQRA 4GHTA 1ZSJA 4OGXA 4D7FA 1GCDA 1QJ7B 7KMEH 2BZAA 4ZAEA 2AH4X 1BBRH 5DKMA 1YYY1 1CVWH 1KXAA 3RMLH 5F8TA 3FP7E 3V7TA 3VB7A 1F5LA 1VCWA 1SGQE 1GHYH 3BV9B 3HK3B 1A4WH 4NA7A 3CENA 1BTUA 3RXOA 4ZROA 2OUAA 1BJUA 3LDXH 3PV4A 3STJA 1AKSB 3K2UA 3QTVH 3SZNA 2R3YA 2VWNA 1TPAE 3SJKA 2ILNA 5A09A 4NSYA 3LONA 2W7UA 1GBIA 4JZEH 2A2XH 3T62A 1K2I1 1D3DB 2ZF0H 3BIVH 3RDZA 1O32A 1O3NA 2BQ7B 1BMAA 1AY6H 1WU1A 5LPEA 4X6MA 1GBEA 2ZQ2A 4LZ1H 2QF0A 4GPGA 1TYNA 1OP8A 2SGEE 2GV7A 1GI6A 1L1JA 1TQ0B 1AB9C 2Z3EA 3SJ9A 4X6OA 3LH3A 3V13A 1K1IA 3H7OA 1C4V2 2VWOA 5EXMA 2G8TA 1UTLM 3BTTE 5GXPA 3GCHC 1ESAA 1ETRH 3A86A 4FUFA 1A0LA 1T8LA 2FI3E 5DP9A 1HGTH 1UCYH 3O8RA 3M7QA 3MOCA 1LTOA 3RC6A 5DK1A 1SGCA 1ZMNA 2FWWA 1EJMA 1V2LT 1Y3YA 4NG9H 1V2TT 2AMQA 1C2HA 4Y79A 2O8LA 4AZ2B 4I8KA 1AQ7A 3A87A 5E2PA 2ODYB 1U6QA 4UFFH 1ZHMA 1YLDA 1O2GH 2BY8X 3H7TA 2FM2A 4TY7A 1SGTA 1ZHPA 1QL8A 3LGWA 3RXKA 1DFPA 5T3HA 2ZP0H 2Q6GA 5LPFA 2FOFA 1OYQA 3TJVA 4YLQH 1C5LH 3MU1A 2ZO3H 1GJCB 2A5KA 2WPLS 3EDXB 3SQEE 3LC5A 1UO6A 5ESTE 1BT7A 1C1NA 3ATMA 2XCNA 3FP8E 5CHAC 1C2IA 4WMDA 3SNAA 3BTGE 4U2WA 2OC8A 1AWFH 2Q6DA 2XTTB 3TGIE 5T6FA 3GY7A 2V3HH 1GBMA 3S7HB 4NCYA 3SW2B 1L2EA 2XNIA 1K1PA 1MTWA 2F91A 2ZU3A 1ELTA 3P8NA 5C1YA 3LIWA 1D6RA 1GGDB 5FX6A 2BDHA 3TIUA 3NKKA 7ESTE 1EATA 4K8YA 5JPMH 2ZWLH 3RXQA 3GY3A 1MAXA 4D8NA 3RP2A 1K28D 4FVBA 5FCRA 1VJ9U 4GCHF 3RM0H 1EPTC 1C1WH 3PO1B 2P95A 3QLPH 2Y81A 4OS4A 2FI4E 3F68H 1S83A 3LPRA 1UHBB 1D3TB 1O2PA 2XC4A 1SGFG 3M7UA 2AMPA 4Y0ZE 4B2AA 1LHCH 1BRBE 5DP5A 4KTSA 2DE8A 1RIWB 4ABAA 1C9TA 1TGBA 4WH8A 4K8BA 2G55A 1SGEE 4FU7A 2Y80A 1C5WB 5C3NA 4ZMAH 2HALA 2FI5E 1LPGB 3SORA 3SHAH 1WSSH 1ELVA 1PPEE 1P2NA 3PMHB 3PLKA 1G2MA 1HIAA 2BLVA 4I8HA 3RXRA 3TJOA 4IGDA 4NIXA 3E90B 2Z9JA 2ESTE 2ZGHA 1FDPA 4B73A 3NUMA 5E0HA 4DVAU 4H6TA 1GDNA 4J2YB 3V3MA 2IOTA 3OTJE 4X8VH 1HV7A 1E37B 3A8AA 2QXIA 1GBBA 1UTMA 3MMGA 1SQOA 1GJ5H 1ZSKA 4Q80A 2H6MA 1GMDG 1W3CA 2C8XB 2P16A 4AYYB 2O8TA 3MU4A 6CHAB 1KXDA 2PUQH 2VU8E 5B6OA 4Y71A 1ID5H 2OXSA 5ABWA 1DSTA 5E0JA 4X0WU 3UFAA 1Q3XA 1H9LB 1D9IA 3D65E 2AERH 2PLXA 5JBAS 3A85A 1L1GA 3MU8A 1PQAA 2OC0A 1VITF 4JK6A 1BTZA 4Y10E 3A81A 1GBFA 2FESH 1JIRA 1BCUH 1F5KU 1BJVA 1GJ9B 1C2MA 4ABEA 1EZUC 3BG4B 3LU9B 2EA3A 1N8OB 3S9AA 3HKIB 4NZLA 3PB1E 1C5NH 4I7YH 3QZRA 2Q1JA 3SNEA 2BQ6B 3ZZ9A 1KY9A 2J4IA 1ANEA 1TGNA 1LCYA 1RTKA 4MPUA 1S6HA 1CA0B 1CBWC 1X7AC 3AVZA 4OGYA 2Z9LA 3ZVDA 3KEEA 1YLCA 1DICA 3A89A 1BOQA 3LGIA 4BANB 1TOMH 1SQTA 2A45B 2ZDNA 1S84A 4WJG2 4X1RU 1EJNA 5A8ZA 2W3KA 2WYGA 3HGPA 3K6ZA 3RMNH 4TPIZ 4FUCA 1XMNB 1BZXE 4UFGH 1DWCH 2ZTZA 3TK6A 4AB9A 2ZGCA 1HBTH 3QGJA 5JB9S 2BDAA 4X1QU 1O2HA 4DJZB 2HNTE 3IITA 1GHWH 4DIHH 1MTNC 2PKAA 5EG4A 4UDWH 3BF6H 3ZZCA 2P3FH 2BY7X 5DP4A 2JETB 1O2YA 1E34B 2H9EH 1FY5A 2A4GA 1CT0E 2P3UB 3P8OA 2FXRA 3SOSA 3Q3KA 3U8OH 3BTKE 1BMLA 2VNTA 1O5DH 1PFXC 3MH7A 3DFLA 1WOFA 4HTCH 3KN2A 4NFEA 3BSQA 1IQLA 3DT0H 1TAWA 2VWLA 2BXUH 2H5DA 1P2MA 5GPIB 1P06A 4VGCC 2GD4B 4Y7AA 4A1XA 3S9CA 1OWEA 4MLFB 3MU5A 4NIVA 3KQBA 2UWLA 1V2PT 1RXPA 5C2ZA 1MTSA 2CF9H 1P09A 3RU4E 1UTPA 1YPHE 4B1TA 3I78A 1UTKA 3U98H 1SLVB 4ISOA 1WQSA 4DY7B 3SU6A 4CH8B 1FLEE 3RXTA 4YO9A 1KDQB 2A7CA 2JH5D 1C5OH 1KLJH 3E91A 1RS0A 1TBZH 2O8UA 2G5NA 4Y0YE 2ZIQH 3DFJA 1ETSH 3TK9A 2Y5HA 5A0BA 2W5EA 1DVAH 4X1PU 1C5RA 1MZAA 1P8VC 1ZMJA 1SGPE 2XBWA 2M5TA 1WYKA 3EGKH 1Y59T 2LNCA 2QYIA 2RCEA 2A0QB 2F83A 2SGPE 1O2ZA 1DLKB 2Z9KA 4R0IA 1QL7A 5T6GA 4WXIA 4Q7ZA 1LHGH 3RXVA 2EC9H 2ZU2A 3A8DA 4MPVA 1T8OA 1C1MA 3CS7A 5GCHG 1T31A 4BAKB 4X8SH 1SBWA 5C5OA 2VH0A 3IG6B 1FXYA 3MYWA 1FI8A 1O5CB 2ULLA 1F5RA 3PYHA 1PPCE 2BDGA 1JIMA 1D3QB 2PGQB 4MG3A 3KF2A 2XBYA 2ODPA 2RDLA 1C1OA 1T32A 1SOZA 2J2UA 4ABJA 4CBNA 1TBRH 1T8MA 1EZQA 1O2XA 1O2UA 1JWTA 2TIOA 3MNCA 1S85A 1E38B 2HWLB 1GBLA 1GBJA 2PTCE 2J34A 3DUXH 4FUHA 1A3EH 1SGIB 1GDUA 3M5MA 1ZPBA 2BXTH 1SVPA 3ZZ3A 4AFQA 1PYTC 1HAVB 3VFEA 4H42U 1NTPA 2ZI2H 3E6PH 5E8EH 1NFYA 1P3CA 3TPIZ 1LPKB 3M5NA 3O8CA 1NT1A 4DURA 2J9NA 2OQ5A 2Z94A 4WMEA 3F9GA 1CGJE 2CF8H 2GP9B 2G00A 2R2WU 1W13U 2OBOA 5L2YH 1BTXA 1LPZB 3T26A 1PPBH 1XUIA 1IQGA 3KCGH 1GBAA 5HYOA 3PLPA 4ZHMU 3GCNA 1C5TA 1AVXA 3S69A 1YC0A 1G3DA 3RC5A 4M7GA 1CHOF 2ZCKP 1T4UH 1QFKH 2XXLA 4ESTE 3RU4T 4MNYA 2SGDE 1TNLA 1GL1A 4MPWA 8GCHF 2C93B 1AB9B 3GYMA 3BTQE 2VIQA 3LGUA 3RXMA 1QR3E 7GCHF 3PM3A 1GMDF 1HAPH 2A7HA 2C3SA 4HGCA 2UUYA 1ARBA 3SQHE 3GCHB 4ZKRU 2ZU1A 1C4Y2 2V6NA 1BITA 1FZZA 1TOCB 1HNEE 1HJ9A 4X6NA 3UNRA 2SGQE 4PROA 3MHWU 1IAUA 1QA7A 1RGQA 3BEIB 1ZSLA 5LPRA 3A7TA 3C27B 2FP7B 4Q7XA 2W26A 3BG8A 1G3BA 2YOLA 2CV3A 3PTBA 1M9UA 1SFIA 1CU1A 1AIXH 2PR3A 3NCLA 1TE0A 1KSNA 1YCPM 3QO6A 1HAHH 5HXFA 1ORFA 1DUAA 1G3CA 4CR5A 1VCQA 1O3LA 3GDSA 3L33A 1MD8A 2BY6X 4K1TA 2BQWB 5ETXA 4BNRA 1XVOA 2ZHQH 4ISLA 3ZVCA 4X2YA 4BXWA 1J17T 1D3PB 1TA2A 4DT7B 1O33A 1P0SH 2BDBA 3RXJA 1LDTT 5CHAB 2W7SA 5F03A 1O5GH 2BDCA 2HRVA 1G30B 1ZZZA 4RKOB 1C5UA 1O5EH 2AIPA 1PJPA 1FPCH 1YPKH 4YM9A 1GMHG 1Y3XA 5FBEA 2GCHF 3UQOA 2C4FH 2J92A 1KXBA 3JZ2B 5A0CA 3RXCA 3SV8A 4AX9H 2XBXA 4AFUA 1Y8TA 3GYLB 2TGTA 4CH2B 2XRCA 4CREA 3SUFA 1GI3A 2BLQA 3EYDA 4RN6A 4AG2A 4IC5A 2ZZUH 4RSPA 5BPEA 3SGQE 1SOTA 3P8FA 4AGJA 3UOUA 4E7RG 3SN8A 1EPTB 3AASA 3UWIA 1F0RA 1PPHE 3BTWE 1MH0A 1P2OA 1MKXH 2BVRH 3KGPA 4E05H 4AORA 5SGAE 1K1MA 1HXEH 2BD9A 1PQ5A 2EI7A 2F9NA 2BM2A 3RXEA 1W14U 2NU2E 3VB5A 4B75A 2BY9X 2Y6TA 1AWHB 3IWMA 4RKJB 3KNXA 1EX3A 4LK4A 1DY9A 1NRRH 1W7GH 3ATIA 1LKAA 1K1JA 1G37A 2BD5A 1A1RA 1DXWA 1NZQH 3RXAA 1SQAA 2HPQH 3OYPA 3NK8A 1TABE 5HGGA 4OS6A 1HXFH 2WV5A 1ZTKA 3TH3H 3RXLA 1NRQH 1P2KA 2A5AA 1AU8A 3K6YA 1YF4A 1BBRE 1XUJA 4NIYA 4D76A 3SJ8A 5F8XA 1ANBA 1A3BH 3R0FA 1JRTA 3SU1A 4AGKA 3M3VA 3O8BA 1VCPA 1V3XA 2QA9E 1V2WT 3LJOA 1TPOA 4WXVA 3U9AH 3STIA 3M36A 1SMFE 1SB1H 1GHAF 2GCTC 1C2KA 2VIPA 4MNWA 1T7CA 3LOXA 6GCHG 5TCAA 4JZFH 1QCPA 1OYTH 1BBRK 1C5XB 2V35A 1BTWA 2XC5A 3PLBA 4INKA 1OWJA 2OQUA 4LOYH 1D4PB 1ARCA 1O3KA 1W0ZU 2BZ6H 2ZECA 1S81A 4AN7A 1V2ST 5A0AE 3BIUH 1DT2A 3O8DA 1CHGA 1FMGA 1FNIA 4FU9A 3VXFH 1KXCA 4ABGA 3Q76A 2WYJA 1O35A 1DUEA 1ZRKA 1C5MD 1DWEH 1VZQH 1Z8RA 4MNXA 2FS9A 3VB4A 1C5YB 1C2FA 2GT7A 1BRAA 2GX4A 2ZDKA 1XXFA 3A84A 4BOHA 1N6XA 1TB6H 2I6QA 1NROH 2EI6A 2H5CA 1SI5H 1QB9A 2LPRA 3UUZA 3CP7A 1AFQB 2TGDA 1GVZA 1W12U 1ZPZA 1O3AA 1EZXC 1CT4E 1V2MT 1EJAA 1O31A 3VGCB 1BDAA 1UTJA 1HAIH 1UCYE 1YPMH 1GL0E 1TLDA 4ISHH 1F0TA 1OP0A 3TNSA 3PWCA 1FQ3A 1FY8E 4Y8YA 1C5VA 4IBLH 1CGIE 2FOEA 4TYDA 2BX4A 3A7YA 2QXJA 3F1SB 2P94A 2Q6FA 2ASUB 3UREA 2WUCA 5HMAA 3KQDA 2HNTF 4IMZA 5JB8S 1V2KT 2GMTB 4IS5A 5EXNA 4E06H 1UCYK 3Q3XA 1ELCA 1HAYB 3PTNA 1BHXF 1K1OA 1P9SA 1O2SA 2PV9B 5GIBA 3SNBA 5G4BA 1PQ7A 1GMCG 1WBGB 4NWKA 3D62A 3ZV8A 1MTNB 1P3EA 4NFFA 1H8DH 1FPHH 4CR9A 1AUTC 2F9UA 2BVSH 2AMDA 1XM1A 1NS3A 4ZKSU 1DANH 4Q7YA 1DDJA 1FN8A 2FOBA 4O9VA 2AFQB 4AG1A 5F6MA 2V0BA 2VVCA 1GHBF 1GI2A 1SC8U 4YZUA 3AAVA 3GCTF 1GHZA 1O2MA 1FIZA 4K1EA 4NSVA 4DG4A 2XW9A 2UUKB 1MCVA 3FP6E 3M3TA 3ZVAA 1DY8A 1QY6A 1EAIA 2KAIB 4ZXXH 3KL6A 2OLGA 1WTHD 1O2VA 2VB0A 2OD3B 1QJ6B 3FZDA 1AZZA 1GG6C 1Z7KA 3GY4A 2ALPA 4VGCB 1BRUP 4X2XA 1Z71A 2JH0D 1CQQA 1QHRB 2CGAA 1TGTA 2OTVA 2BD8A 4ZKNU 2AS9A 3RXIA 1H8IH 1TWXB 1GI5A 3MO9A 2ODQA 2QV1A 2ZQ1A 1OS8A 1QNJA 1FAKH 1EAUA 3UNSA 1KLIH 2VIOA 4X8UH 4XFQA 5L30H 2WINI 1LVBA 1MAYA 2Y5FA 1THPB 4ABBA 2GGVB 1BTHH 4H4FA 2ZFSA 1O3FA 5T6DA 1MU6B 1W0YH 1FV9A 1C5ZB 3F9FA 3RM2H 1HAXB 3OY5U 3ZZ8A 1W7XH 2GZ8A 3BTME 3ZZ6A 2B9LA 4F4OC 1O36A 4DGJA 1PPGE 1SGRE 1DM4B 5DG6A 1SGYE 1P03A 1P12E 3SGBE 4YOGA 4ABDA 1LHDH 5K0HA 5J4QA 1Z8GA 1BUIA 1GJ6A 1J16A 2WPMS 1S0RA 3T27A 3I77A 2ZU4A 1SLUB 1EXFA 5FXLA 4BTUB 1QIXB 1YBWA 4FVDA 1GI7B 5EW1H 3MO3A 1F92A 1A46H 2ZDVH 1O2JA 5EW2H 4NA8A 5FAHA 3KQEA 4FXGH 1KTSB 1IQEA 1VITH 4TPYA 1SHYA 1G9IE 2TGPZ 1PQ8A 4JZIA 4LXBH 1TALA 3K9XB 4YTAA 1O3DA 2A4QA 4MDSA 1XVMA 1XXDA 3WY8A 1IQIA 5F8ZA 4YOIA 1XUFA 1GMHF 1Z8JB 3LT3A 1NRSH 2QXGA 1ABJH 1QA0A 5FPYA 3GY5A 2FODA 3MI4A 2VGCC 3NWUA 1O3HA 1EUFA 1A5HA 1TA6A 2ZU5A 5C1XA 3FAOA 4CHAC 4ABHA 1MMJN 1ZGIA 5C5NA 1HAGE 2FEQH 1UK3A 1HFDA 1GHVH 4GUXA 1RRKA 3QTOH 8ESTE 3S7KB 4Y11E 1AKSA 5DP3A 3EE0B 1GBDA 1J9CH 2P93A 2BLWA 5JDUB 2SFAA 1O2WA 2QC2A 1IQFA 3ODFA 3LH1A 2UUFB 4CRCA 1A5GH 4BXSA 3FANA 4JZ1A 3RMMH 4GSOA 1P2IA 1DWBH 1MTUA 4MQAA 3BTEE 3SU2A 3E8LA 1TPPA 1L4DA 4I31A 3MH5A 1C1TA 1O3GA 1O5AB 4IC6A 1QL9A 2CN0H 3PWBA 3RXGA 3RXPA 3SJOA 2ANKH 2PGBB 4K2YA 4D9RA 4DIIH 1C2LA 2VVUA 3OX7U 3P17H 1Y3WA 4UE7H 1S82A 1ZTLA 2JH6D 1AGJA 3S9BA 3B8JA 1AO5A 3L3TA 4XBDA 4U01A 1OP2A 1BB0B 2BB4A 1V6DA 2A4RA 5DJ7A 1YM0A 1Y5AT 4B76A 3L6PA 1GJDB 3BN9A 6GCHF 4HZHA 2D1JA 2XC0A 1OSSA 3ESTA 2J94A 4UEHH 4Y6DA 5AF9H 2GTBA 3SHCH 3ATLA 3UWJH 2FIRH 1P2JA 5LGOA 3RXSA 1IQKA 3UQVA 3AAUA 2SGAA 1TGCA 3SNDA 4GAWA 1XKAC 1FN6A 2ZCHP 2B7DH 2FYRA 1Q31A 1EAXA 2AGGX 1ZJKA 1H4WA 2V3OH 1LVYA 2TPIZ 1GJ4H 3A80A 1GVKB 2RA3A 3EA8A 2STBE 4HI3A 1H9HE 1IQMA 1RTFB 3QZQA 3GCOA 4CRBA 4A5TS 1C2DA 1INCA 1LQEA 4IMQA 3RXFA 1NFXA 1GPZA 3LGVA 4X8TH 2F9BH 1HJ8A 2OINA 2PKSB 1CSOE 1NU7B 1DS2E 4UFDH 3UIRA 1KIGH 3Q00A 4GCHG 3E0NB 4GVUA 2OC7A 2Z3CA 1THRH 1A0HB 5GDSH 4AOQA 1J15A 1YPJH 3R3GB 1C1RA 1C5QA 1HDTH 3ZZBA 1ELAA 1TRMA 3SI4H 2ZFQH 2PWXA 3JZ1B 2AGEX 1DITH 1QURH 1V2RT 3NXPA 3SUEA 1JBUH 1O3MA 3QN7A 4WY3A 1XUKA 1HIAB 1O2KA 1ZHRA 5L2ZH 3EA7A 1J8AA 8LPRA 1MTVA 1GI9B 3RLWH 1Z1IA 1QBNA 4JYUH 3RXUA 1K9OE 2VH6A 4AYVB 3U8RH 1CE5A 2BLOA 1K21H 1QBVH 3K65B 1UHBA 2G81E 1C1SA 4FUEA 1YPLH 1G36A 2SNWA 1EAWA 4WVPE 4Y7BA 3UY9A 5ESBA 2VVVA 3E3TA 2ZGJA 1QTFA 3N7OA 5H4IB 1GJ8B 3A7ZA 3GOVB 1CO7E 2A4OA 3U1IB 3TITA 5EOKA 1GHXH 2O8MA 1TMUH 2ZTXA 4I33A 2R3UA 2GZ7A 3A7XA 4O3TA 1UTOA 1C1UH 5EQQA 1K22H 1D6WA 1HLTH 1YCPH 1SLXB 1GI4A 3AW0A 1TNGA 4GLYA 2FLBH 4LZ4B 1QJ1B 1K1NA 1NFWA 2ZFPH 4A92A 2OCVB 1CGHA 5I46H 2BOKA 3MWIU 1Z1JA 1LKBA 4Y8XA 1CA8B 3W95A 3NPSA 1HRTH 4TWYA 2QAAA 4BAQB 4XOJA 1TONA 2OP9A 2FTLE 2VINA 1O3CA 2TGAA 1AFEH 1VITG 4TWWA 5TJXA 1GI0A 1DXPA 3T2NA 1EOJA 1XKBC 2B0FA 2XCFA 3AW1A 4INLA 1AI8H 4ZHAA 4ABFA 2VJ1A 2FS8A 4WMFA 2RG3A 1SGFA 2FLRH 1L1NA 2WUBA 3TNTA 1OWKA 1O2IA 2CXVA 1UVOA 3FFGA 2GCTB 1ABIH 2TBSA 3ODDA 1ESBA 4OS5A 1FY1A 3BEFB 3Q3YA 3PMBB 4OS1A 4GHQA 1ZYOA 1YGCH 2UUJB 1ZGVA 1RFNA 1XUHA 1GCTC 1NU9A 3ZV9A 2ANMH 4ZH8A 4MVNA 5JYIA 3KIDU 3A83A 1DSUA 3MNXA 3VEQB 2BD3A 1NESE 1O2QA 2A5IA 2WPKS 3SV9A 1IOEA 3OY6U 4XBCA 1GBKA 2FOCA 2PKAB 2QXHA 2UWPA 1P57B 3SGAE 2BTCE 3Q77A 1Y5BT 3SUDA 4JZDH 1O3IA 2P8OC 2PSXA 1KXEA 2H9TH 1O3JA 2F9PA 1O34A 1EASA 2H2ZA 4HFPB 4KGAA 1GJ7B 5EODA 4R8TB 1CT2E 1P05A 1ESTA 1N6YA 3M5OA 3LC3A 1LHEH 2Z3DA 4O97A 3A7WA 3RC4A 1P9UA 3QUMP 3D23A 2A1DB 4I32A 1FUJA 3S0NA 3MH4A 2Z9GA 1VGCC 4YT7H 1JOUB 1EP5A 1EZSC 3A8BA 1DOJA 2XWBI 3ZZDA 1O30A 2CHAC 2NU1E 4XSKU 3NZIA 6LPRA 3LJJA 1YCPK 3SUGA 5EPYA 5AVDA 1GBHA 4NWLA 5DP6A 1BQYA 3QGNB 5A8YA 5EQSA 4XE4A 4A1VA 4JYVH 3URDA 1UTNA 1HB0B 2ANYA 1UTQA 1IHTH 1ZRBA 2W3IA 2GZ9A 5AFZH 4ABIA 3TK5A 5FBIA 1OPHB 1Z8IB 2HNTC 5IDKA 3URCA 1EOLA 2G5VA 4JCNA 1QRZA 1ZLRA 1O2LA 1Z6JH 1MBMA 3DHKH 4MTBA 3TVJB 2B5TB 3VPKA 3HPTB 3U8TH 1WUNH 4NGAH 1ELGA 1V2NT 2F9VA 4ISNA 1F0SA 2G4TA 4CRDA 2WPJS 5FX5A 2PFEA 2GKVE 1HJAC 1E36B 1SSXA 2DUCA 2FX4A 4ZHLU 4CBOA 1PPZA 1J14A 4OS2A 3EQ0H 1C9PA 4NIWA 1RD3B 3BEUA 2QF3A 2PTNA 1OWIA 4D7GA 1UVSH 2ZGXH 1GG6B 2NWNA 1HAZB 2VIWA 1KDQA 1B5GH 1NO9H 1C2GA 5DP8A 3BTFE 1QB1A 3SNCA 2FTMA 1NFUA 3SU0A 4NZQA 1ELEE
chains in the Genus database with same CATH superfamily
4QT8C 2V7QD 2EI8A 1S0QA 1PPFE 2BDYA 2P59A 3A7VA 3RXHA 1C4U2 1YPHC 4AFZA 4JMYA 3LKWA 2VIVA 3HKJB 1O0DH 2V3MA 1K0HA 1TNKA 2FZZA 8KME2 2PUXB 5GCHF 4KP0A 4IN2A 1T4VH 4THNH 3DA9B 3PV2A 1SFQB 1K1LA 1TBQH 3ENSB 2ANWA 4K5ZA 2K0QA 1QQUA 1LVMA 1F7ZA 4BAHB 2BY5X 1O3EA 1CBWB 1MKXK 2BHGA 1A0JA 1GBCA 2D8WA 3RMOH 2GDEH 3GY2A 3B23B 4A7IB 1P2QA 1TIOA 1C5SA 2ZHEH 3B9FH 4J1YA 1TX6A 1OWDA 1YP9A 4I8JA 5KEDA 2C90B 2ZPSA 1TNIA 4BTIB 1O2TA 1WQVH 2Z9IA 1V2UT 1FJSA 2C8ZB 5JBCS 1UK4A 1B0EA 2RDEA 3UB0A 4B74A 2J95A 2SNVA 3D49H 1RTLA 5A2MH 2OC1A 3FKSD 1NRPH 1TFXA 2BDIA 2AYWA 1UVPA 2JKHA 4FUGA 1SGNE 1KYNA 3T29A 2FMJA 1L4ZA 1EFRD 2G52A 1YPEH 4KELA 5E0GA 3KHVA 1O2NA 5FHTA 4O03A 3GISB 3T28A 5DO4H 1KLTA 3EAJA 2BX3A 4X2VA 3SYJA 2XYAA 1LHFH 1B0FA 1W11U 3F3BA 1A5IA 2O9QA 1TMTH 2RA0A 3M3SA 5L6NH 1HAVA 1QB6A 1O5BB 1ANCA 1BMMH 2VGCB 1EB1H 1UMAH 1P04A 1JXPA 2ZGBH 3PRBA 3V12A 4CHAB 1IQNA 1KXFA 1AE5A 1SHHB 4O3UA 4CRFA 1CHOG 3GDVA 5FPTA 1HPGA 2KCPA 1V2JT 1TRNA 5C67A 1VJAU 4UFEH 1N1LA 3W94A 2F43B 1AVWA 4Z0KA 8GCHG 2F3CE 5TCCA 3UR9A 1S5SA 1P02A 2ZPRA 7LPRA 1IHSH 4X1NU 4ZKOU 4K69A 2WPIS 4WH6A 3SV2H 2CJIA 3PMAB 1MQ5A 1MU8B 1GWAA 1O39A 7GCHG 5BRRE 4OS7A 1BTYA 2XWAA 1TNJA 2G51A 2H9HA 4X6PA 1GI1A 3ZZAA 4AFSA 2VWMA 3V0XA 4YLUA 4ZXYH 2TRMA 2A31A 2ZHFH 3RLYH 2PW8H 1TX8A 3M7TA 2ZA5A 1PYTD 1P01A 3GDUA 2ZHWH 3SBKA 2Y7XA 1OHHD 3KQCA 4Y8ZA 2BMGB 3HGNA 2R0LA 2DE9A 2GVFA 1HAOH 5K7RA 1BTPA 2Y5GA 1SGDE 3LGYA 1TQ7B 1G2LA 9ESTA 4XBBA 1H1BA 3F9HA 1RJXB 1P11E 2GV6A 2QGRA 3ELAH 5E2OA 1QBOA 2PHBA 1HCGA 5EGMA 4UONA 4E7NA 6ESTA 1ELFA 1QRWA 1SLWB 4SGBE 1GGDC 1UVUH 4X1SU 3QWCH 3E0PB 1ELBA 3F9EA 4A6LA 3GY8A 2ZDAH 2FDAA 1AFQC 2QCYA 3GICB 1XX9A 2QIQA 3ZYEA 2CMYA 3PMJA 4YESB 1OOKB 1AVGH 1QZ8A 1Y3VA 2ZFTA 3PO1C 1AN1E 3VGCC 2B8OH 4BTTB 2FX6A 2FOGA 5C17A 1GJAB 3ATKA 4BAOB 2THFB 1HUTH 2NU4E 4INHA 4KTCA 2D26C 1MUEB 1W2KH 1A61H 1OWHA 3W1EA 1ACBE 3HK6B 1OKXA 3SU5A 1O38A 1RIWC 4TSFD 1Q2WA 2GCHG 4FUJA 5EU8A 3ZZ4A 1ETTH 1A2CH 1W10U 1S6FA 1MD7A 1O2OA 3SV6A 2GMTC 2QY0B 1F0UA 3QDZB 1NM6A 2Y7ZA 1HYLA 2F9OA 2ZHDA 2NU0E 5PTPA 3M37A 3MH6A 3QX5H 1IQHA 1KTTB 1YPGH 3A88A 4CRGA 2FYQA 1DWDH 3TGKE 3MNBA 3P92A 4K1SA 3OSYA 3TJNA 3ZVBA 1NPMA 4WF8A 1F2SE 2J98B 3TH4H 1ZMLA 2WV4A 4X2WA 1THSH 4A1TA 3SJIA 5GJ4B 2BOHB 1WCZA 4B2CA 2IPHA 2NU3E 1BRCE 5EPNA 1SG8B 3TLOA 4JK5A 2VIDA 1LMWB 2ZDLA 2BD2A 3OAAD 1VR1H 2ZNKH 3ZZ7A 1O3PB 3A82A 1A7SA 1DLEA 1C5PA 3EA9A 4ISIH 6CHAC 2ZFRH 3VB3A 1ZR0A 1AZ8A 4DCDA 4OM9A 1EPTA 2GT8A 3PRDA 1LVOA 2BVXH 2WPHS 3TH2H 3UNQA 2ZPQA 3U1JB 3OE7D 1B7XB 1MKWH 4Q2KA 1FIWA 4FUDA 3C1KA 4IN1A 5HM9A 1BA8B 1WAYB 3DD2H 1IQJA 2A2QH 1FY3A 3RXDA 1JRSA 2AGIX 2ZFFH 4TT3D 4K3JA 4TY6A 5FPSA 2AIQA 4XDEA 1NC6A 2I6SA 1O5FH 3BG4C 4WWYA 1GHAG 3MNSA 4D9QA 1TMBH 1N8OC 1FY4A 3ITIA 1AHTH 2BD7A 2P3TB 1ZOMA 5AFYH 4KKDA 1BMNH 5AHGH 5HM2A 5JBBS 2UWOA 1C2EA 3TJUA 4JYTA 1P10A 1CA0C 1GVLA 4Q63A 1TX7A 4IW4E 1MQ6A 2R9PA 2FOHA 5A8XA 1O3OA 2R2MB 1E0FD 2FOMB 3QK1A 3E1XB 1MBQA 3SI3H 1GI8B 2FOAA 4BAMB 5DP7A 1LO6A 3P6ZB 3P8GA 3U69H 1G32B 2IJOB 2OK5A 4NA9H 2AEIH 4YT6H 3SV7A 2BYAX 3UTUH 4B2BA 1YWUA 1DE7H 1S6LA 4U30A 1H9IE 3RUOA 3BTDE 5I25A 2HOBA 2XBVA 1UJ1A 3MTYA 5HKKD 1E35B 1O2RA 2YNBA 4DW2U 2QN5T 4AB8A 4UD9H 1ELDE 1TNHA 5CMXH 1SPJA 2D2DA 2Z7FE 4ZUHA 2JETC 3ZVFA 3MO6A 1GCTB 2FPZA 2Z6BD 1C2JA 2JIZD 1DPOA 2ALVA 2EEKA 2YMSD 2OBQA 1LQDB 3ATWA 1SL3A 2ZDMA 3SU4A 1WV7H 3PROA 5DGJA 1YKTA 4K60A 1JMOH 3UOPA 3P70B 1ANDA 5EXLA 1C1VH 2C8WB 2W6JD 4H6SB 1QGFA 2PSYA 2P8OB 1ZTJA 2Y82A 2C8YB 1V2VT 3MU0A 1MKWK 3FZZA 4KTUA 2GJGA 1TGSZ 2ZEBA 1EKBB 4DOQA 4ASHA 3E16B 2G4UA 1FAXA 1GMCF 3VXEH 3G01A 1GDQA 3KQ5A 3SO3A 3RU4D 4U32A 1TPSA 2A7JA 3BTHE 3T25A 3ZVEA 1O3BA 1V2QT 2R0KA 1EB2A 1AE8H 1GHBG 3OU0A 4Z6AH 2H1UA 1MZDA 1ZJDA 3GCTG 2GDDA 1VGCB 2ZG0H 4SGAE 4I8LA 4FU8A 3CS0A 2KCYA 1G3EA 2O8WA 2BD4A 3MFJA 1OXGA 2CHAB 5GWZA 1UW7A 2ZCLP 4Z1MD 1UVTH 1AUJA 1V2OT 5IYTA 1W8BH 5FCKA 1L0ZA 2KFWA 1DX5M 2KCOA 1SR5C 2A32A 1EP6A 1EQ9A 2K1QA 5C20A 3T5FH 5JBTA 4FUIA 3GY6A 3H5CB 3I29A 1NRNH 1AMHA 4Y76A 2STAE 1C1QA 1NN6A 1NY22 1FONA 3HATH 5DPAA 3RXBA 2HGTH 3VB6A 1C1PA 1Z6EA 2KAIA 2IN2A 3A8CA 1BHXB 1UK2A 3UR6A 4I8GA 3ZYDA 3UPEA 1GBTA 1WTGH 2ZC9H 2HLCA 5C1UA 1GJBB 1T8NA 1Y3UA 1AD8H 2ZKSA 3LGTA 3M61U 2FO9A 2YMSB 3P95A 1E1QD 2J38A 2HPPH 3ZVGA 1MCTA 3TGJE 1HJAB 2HVXA 1OX1A 2SGFE 4B71A 3SU3A 1QQ4A 3F6UH 2WSSD 1O37A 3TU7H 1XUGA 1ZPCA 3M35A 4CRAA 3FVFB 1TRYA 4MNVA 3ZZ5A 9LPRA 1QRXA 4MPXA 4F49A 1Y5UT 5J4SA 5LH8A 2ZTYA 3M5LA 2YNAA 4FUBA 5CE1A 2PKSC 1WXRA 1BIOA 4YOJA 5EQRA 4GHTA 1ZSJA 4OGXA 4D7FA 1GCDA 1QJ7B 7KMEH 2BZAA 4ZAEA 2AH4X 1BBRH 5DKMA 1YYY1 1CVWH 1KXAA 3RMLH 5F8TA 3FP7E 3V7TA 2LELA 3VB7A 1F5LA 1VCWA 1SGQE 1GHYH 3BV9B 3HK3B 1A4WH 4NA7A 3CENA 1BTUA 3RXOA 4ZROA 3OEED 2OUAA 4YXWD 1BJUA 3LDXH 3PV4A 3STJA 1AKSB 2CK3D 3K2UA 3QTVH 2W6ID 3SZNA 2R3YA 2VWNA 1TPAE 3SJKA 2ILNA 5A09A 4NSYA 3LONA 2W7UA 1GBIA 4JZEH 2A2XH 3T62A 1K2I1 1D3DB 2ZF0H 3BIVH 3RDZA 1O32A 1O3NA 2BQ7B 1BMAA 1AY6H 1WU1A 5LPEA 4X6MA 1GBEA 2ZQ2A 4LZ1H 2QF0A 4GPGA 1TYNA 1OP8A 2WPDD 2SGEE 2GV7A 1GI6A 1L1JA 1TQ0B 1AB9C 1YLNA 4XRNA 2Z3EA 3SJ9A 4X6OA 3LH3A 3V13A 3DSGA 1K1IA 3WWFA 3H7OA 1C4V2 2VWOA 5EXMA 2G8TA 1UTLM 3BTTE 5GXPA 4F55A 3GCHC 1ESAA 1ETRH 3A86A 4FUFA 1A0LA 1T8LA 2FI3E 5DP9A 1HGTH 1UCYH 3O8RA 3M7QA 3MOCA 1LTOA 3RC6A 5DK1A 1SGCA 1ZMNA 2FWWA 1EJMA 1V2LT 1Y3YA 4NG9H 1V2TT 2AMQA 1C2HA 4Y79A 2O8LA 4AZ2B 4I8KA 1AQ7A 3A87A 5E2PA 2ODYB 1U6QA 4RT0A 4UFFH 1ZHMA 1YLDA 5KGOA 1O2GH 2BY8X 3H7TA 2FM2A 4TY7A 4P02A 1SGTA 1ZHPA 1QL8A 3LGWA 3RXKA 1DFPA 5T3HA 2ZP0H 2Q6GA 5LPFA 2FOFA 1OYQA 3TJVA 4YLQH 1C5LH 3MU1A 2ZO3H 1GJCB 2A5KA 2WPLS 3EDXB 3SQEE 3LC5A 1UO6A 4Q4LA 5ESTE 1BT7A 1C1NA 3ATMA 2XCNA 3FP8E 5CHAC 1C2IA 4WMDA 3SNAA 3BTGE 4U2WA 2OC8A 1AWFH 2Q6DA 2XTTB 3TGIE 5T6FA 3GY7A 2V3HH 1GBMA 3S7HB 4NCYA 3SW2B 1L2EA 2XNIA 1K1PA 1MTWA 2F91A 2ZU3A 1ELTA 3P8NA 5C1YA 3F2HA 3SZEA 3LIWA 1D6RA 1GGDB 5FX6A 2BDHA 3TIUA 3NKKA 3H09A 7ESTE 1EATA 4K8YA 5JPMH 2ZWLH 3RXQA 3GY3A 1MAXA 4D8NA 3RP2A 1K28D 4FVBA 5FCRA 1VJ9U 4GCHF 3RM0H 1EPTC 1C1WH 3PO1B 2P95A 3QLPH 2Y81A 4OS4A 2FI4E 3F68H 1S83A 3LPRA 1UHBB 1D3TB 1O2PA 2XC4A 1SGFG 3M7UA 2AMPA 4Y0ZE 4B2AA 1LHCH 1BRBE 5DP5A 4KTSA 2DE8A 1RIWB 4FETA 4ABAA 1C9TA 1TGBA 4WH8A 4K8BA 2G55A 1SGEE 4FU7A 2KR7A 2Y80A 1C5WB 5C3NA 3WWBA 4ZMAH 2HALA 2FI5E 1LPGB 3SORA 3SHAH 1WSSH 4I86A 2IPQX 1ELVA 1PPEE 1P2NA 3PMHB 3PLKA 1G2MA 1HIAA 2BLVA 4I8HA 3RXRA 3TJOA 4IGDA 4NIXA 3E90B 2Z9JA 2ESTE 2ZGHA 1FDPA 4B73A 3NUMA 5E0HA 4DVAU 4H6TA 1GDNA 4J2YB 3V3MA 2IOTA 3OTJE 4X8VH 1HV7A 5DSFA 1E37B 3A8AA 2QXIA 3DCLA 1GBBA 1UTMA 3MMGA 1SQOA 1GJ5H 1ZSKA 4Q80A 2H6MA 1GMDG 1W3CA 2C8XB 2P16A 4AYYB 2O8TA 3MU4A 6CHAB 1KXDA 2PUQH 2VU8E 5B6OA 3N99A 4Y71A 1ID5H 2OXSA 5ABWA 1DSTA 5E0JA 4X0WU 3UFAA 1Q3XA 1H9LB 1D9IA 3D65E 2AERH 2PLXA 5HIZA 5JBAS 3A85A 1L1GA 3MU8A 1PQAA 2OC0A 1VITF 4JK6A 5IK2D 1E79D 1BTZA 4Y10E 3A81A 1GBFA 2FESH 1JIRA 1BCUH 1F5KU 1BJVA 1GJ9B 1C2MA 4ABEA 1EZUC 3BG4B 3LU9B 2EA3A 1N8OB 3S9AA 3WW7A 3HKIB 4NZLA 3PB1E 1C5NH 4I7YH 1YY3A 3QZRA 2Q1JA 3SNEA 2BQ6B 3AK5A 3ZZ9A 1KY9A 2J4IA 1ANEA 1TGNA 1LCYA 1RTKA 4MPUA 1S6HA 1CA0B 1CBWC 1X7AC 3AVZA 4OGYA 2Z9LA 3ZVDA 3KEEA 1YLCA 1DICA 3A89A 1BOQA 3LGIA 5KECA 4ASUD 1TOMH 4BANB 1SQTA 2A45B 2ZDNA 1S84A 4WJG2 4X1RU 1EJNA 5A8ZA 2W3KA 2WYGA 3HGPA 3K6ZA 3RMNH 4TPIZ 4FUCA 1XMNB 1BZXE 4UFGH 1DWCH 2ZTZA 3TK6A 4AB9A 2ZGCA 1HBTH 3QGJA 5JB9S 2BDAA 4X1QU 1O2HA 4DJZB 5B6LA 2HNTE 3IITA 1GHWH 4DIHH 2K8IA 1MTNC 2PKAA 5EG4A 4UDWH 3BF6H 3ZZCA 1W0KD 2P3FH 2BY7X 2M2AA 5DP4A 2JETB 1O2YA 1E34B 2H9EH 1FY5A 2A4GA 1CT0E 2P3UB 3P8OA 2FXRA 3SOSA 3Q3KA 3U8OH 3BTKE 1BMLA 2VNTA 1O5DH 1PFXC 3MH7A 3DFLA 1WOFA 4HTCH 3KN2A 4NFEA 3BSQA 1IQLA 3DT0H 1TAWA 2KX4A 2VWLA 2BXUH 2H5DA 1P2MA 3FO8D 5GPIB 1P06A 4VGCC 2GD4B 4Y7AA 4A1XA 3S9CA 1OWEA 4MLFB 3MU5A 4NIVA 3KQBA 2UWLA 1V2PT 1RXPA 5C2ZA 1MTSA 2CF9H 2QF4A 1P09A 3RU4E 1UTPA 1YPHE 4B1TA 2LP6A 3I78A 1UTKA 3U98H 1SLVB 4ISOA 1WQSA 4DY7B 3SU6A 4CH8B 1FLEE 3RXTA 4YO9A 1KDQB 2A7CA 2JH5D 1C5OH 1KLJH 3E91A 5HIYA 1RS0A 1TBZH 2O8UA 2G5NA 4Y0YE 2ZIQH 3DFJA 1ETSH 3TK9A 2Y5HA 3KYFA 2W5EA 5A0BA 1DVAH 4X1PU 1C5RA 1MZAA 1P8VC 1ZMJA 1SGPE 2XBWA 2M5TA 1WYKA 3EGKH 1Y59T 2LNCA 2QYIA 2RCEA 2A0QB 2F83A 2SGPE 1O2ZA 1DLKB 2Z9KA 4R0IA 1QL7A 5T6GA 4WXIA 4Q7ZA 1LHGH 2WV9A 5F53A 3RXVA 2EC9H 2ZU2A 3A8DA 4MPVA 1T8OA 1C1MA 3CS7A 5GCHG 1T31A 4BAKB 4X8SH 2JDID 3MQKC 1SBWA 5C5OA 2VH0A 3IG6B 1FXYA 3MYWA 1FI8A 1O5CB 2ULLA 1F5RA 3PYHA 1PPCE 2BDGA 1JIMA 1D3QB 2PGQB 4MG3A 3KF2A 1WDIA 2XBYA 2ODPA 2RDLA 1C1OA 1T32A 2WZQA 1SOZA 2J2UA 4ABJA 4CBNA 1COWD 1TBRH 1T8MA 1EZQA 1O2XA 1O2UA 1JWTA 2TIOA 3MNCA 1S85A 1E38B 2HWLB 1GBLA 1GBJA 2PTCE 2J34A 3DUXH 4FUHA 1A3EH 1SGIB 1GDUA 3M5MA 1ZPBA 2BXTH 1SVPA 3ZZ3A 4AFQA 1PYTC 1HAVB 3VFEA 4H42U 1NTPA 2ZI2H 3E6PH 3DSPA 5E8EH 1NFYA 2PP6A 1P3CA 3TPIZ 1LPKB 3M5NA 3O8CA 4M9FA 1NT1A 4DURA 2J9NA 2OQ5A 2Z94A 2QF5A 4WMEA 3F9GA 4DT4A 1CGJE 2CF8H 2GP9B 2G00A 2R2WU 1W13U 2OBOA 5L2YH 1BTXA 1LPZB 3T26A 1PPBH 1XUIA 1IQGA 3KCGH 1GBAA 5HYOA 3PLPA 4ZHMU 3GCNA 1C5TA 1AVXA 3S69A 1YC0A 1G3DA 3RC5A 4M7GA 1CHOF 2ZCKP 1T4UH 1QFKH 2XXLA 4ESTE 3RU4T 4MNYA 2SGDE 1TNLA 1GL1A 4MPWA 8GCHF 2C93B 1AB9B 3GYMA 3BTQE 2VIQA 2VBCA 3UAIC 3LGUA 3RXMA 5GNDA 1QR3E 7GCHF 3PM3A 4F48B 1GMDF 1HAPH 2A7HA 2C3SA 4HGCA 2UUYA 1ARBA 3SQHE 3GCHB 4ZKRU 2ZU1A 5C94A 1C4Y2 2V6NA 1BITA 1FZZA 1TOCB 1HNEE 1HJ9A 4X6NA 3UNRA 2SGQE 4PROA 3MHWU 3PV5A 1IAUA 2EQNA 1QA7A 1RGQA 3BEIB 1ZSLA 2J5UA 5LPRA 1VKYA 3A7TA 2FP7B 3C27B 4Q7XA 2W26A 3BG8A 1G3BA 2YOLA 2CV3A 3PTBA 1M9UA 1SFIA 1CU1A 1AIXH 2PR3A 3NCLA 1TE0A 1KSNA 1YCPM 3QO6A 1HAHH 5HXFA 1ORFA 1DUAA 1G3CA 4CR5A 1VCQA 1O3LA 3GDSA 3L33A 1MD8A 2BY6X 4K1TA 2BQWB 5ETXA 4BNRA 1XVOA 2ZHQH 4ISLA 3ZVCA 4X2YA 4BXWA 1J17T 1D3PB 1TA2A 4DT7B 1O33A 1E1RD 1P0SH 2BDBA 3RXJA 1LDTT 5CHAB 2W7SA 5F03A 1O5GH 2BDCA 2HRVA 2QE7D 1G30B 1ZZZA 4RKOB 1C5UA 1O5EH 2AIPA 5CHBA 1PJPA 1FPCH 1YPKH 4YM9A 1GMHG 1Y3XA 5FBEA 2GCHF 3UQOA 2C4FH 2J92A 1KXBA 3JZ2B 5A0CA 3RXCA 1NBME 2XOKD 3SV8A 4AX9H 2XBXA 4AFUA 1Y8TA 3GYLB 2TGTA 4CH2B 2XRCA 4CREA 3SUFA 1GI3A 2BLQA 3EYDA 4RN6A 4AG2A 4IC5A 2ZZUH 4RSPA 5BPEA 3SGQE 1SOTA 3P8FA 4AGJA 3UOUA 4E7RG 3SN8A 1EPTB 3AASA 3UWIA 3VG8A 1F0RA 1PPHE 3BTWE 1MH0A 1P2OA 1MKXH 2BVRH 3KGPA 4E05H 4AORA 5SGAE 1K1MA 1HXEH 2BD9A 1PQ5A 2EI7A 2F9NA 2BM2A 3RXEA 1W14U 2NU2E 3VB5A 4B75A 2BY9X 2Y6TA 1AWHB 3IWMA 4RKJB 3KNXA 1EX3A 1H8HD 4LK4A 1DY9A 2J98A 1NRRH 1W7GH 3ATIA 1LKAA 1K1JA 5EJ1A 1G37A 2BD5A 1A1RA 1DXWA 1NZQH 3RXAA 1H8ED 1SQAA 2HPQH 3OYPA 3NK8A 1TABE 5HGGA 4OS6A 1HXFH 2WV5A 4FOUC 1ZTKA 3TH3H 3RXLA 1NRQH 1P2KA 2A5AA 1AU8A 3K6YA 1YF4A 1BBRE 1XUJA 4NIYA 4D76A 3SJ8A 5F8XA 1ANBA 1A3BH 3R0FA 1JRTA 3SU1A 4AGKA 3M3VA 3O8BA 1VCPA 1V3XA 2QA9E 1V2WT 3LJOA 1TPOA 4WXVA 2EY4C 3U9AH 3STIA 2JJ2D 3M36A 1SMFE 1SB1H 1GHAF 2GCTC 1C2KA 2VIPA 4MNWA 1T7CA 3LOXA 6GCHG 3KYGA 5TCAA 4JZFH 1QCPA 3GS9A 1OYTH 1BBRK 1C5XB 5EJZA 2V35A 1BTWA 2XC5A 3PLBA 4INKA 1OWJA 2OQUA 4LOYH 1D4PB 1ARCA 1O3KA 1W0ZU 2BZ6H 2ZECA 1S81A 4AN7A 1V2ST 5A0AE 3BIUH 1DT2A 1W0JD 3O8DA 1CHGA 1FMGA 1FNIA 4FU9A 3VXFH 3F2GA 1KXCA 4ABGA 3Q76A 2WYJA 1O35A 1DUEA 3OTPA 1ZRKA 1C5MD 1DWEH 1VZQH 1Z8RA 4MNXA 2FS9A 3VB4A 1C5YB 1C2FA 2GT7A 1BRAA 2GX4A 2ZDKA 1XXFA 3A84A 4BOHA 1NBMD 1N6XA 1TB6H 2I6QA 1NROH 2EI6A 2H5CA 1SI5H 1QB9A 2LPRA 3UUZA 3CP7A 1AFQB 2TGDA 1GVZA 1W12U 1ZPZA 1O3AA 1EZXC 1CT4E 1V2MT 1EJAA 1O31A 3VGCB 1BDAA 1UTJA 1HAIH 1UCYE 1YPMH 1GL0E 1TLDA 4ISHH 1F0TA 1OP0A 3TNSA 3F2FA 3PWCA 1FQ3A 1FY8E 2IJD1 4Y8YA 1C5VA 4IBLH 1CGIE 2FOEA 4TYDA 2BX4A 3A7YA 2QXJA 3F1SB 2P94A 2Q6FA 2ASUB 1MABB 3UREA 2WUCA 5HMAA 3KQDA 2HNTF 4IMZA 2L74A 5JB8S 1V2KT 2GMTB 4IS5A 5EXNA 4E06H 1UCYK 3Q3XA 1ELCA 1HAYB 3PTNA 1BHXF 1K1OA 1P9SA 1O2SA 2PV9B 5GIBA 3SNBA 5G4BA 1PQ7A 1GMCG 1WBGB 4NWKA 3D62A 3ZV8A 1MTNB 1P3EA 4NFFA 1H8DH 1FPHH 4CR9A 1AUTC 2F9UA 2BVSH 2AMDA 1XM1A 1NS3A 4ZKSU 1DANH 4Q7YA 1DDJA 1FN8A 2FOBA 4O9VA 2AFQB 4AG1A 5F6MA 2V0BA 2VVCA 1GHBF 1GI2A 1KMHB 1SC8U 2AHME 4YZUA 3AAVA 3GCTF 1GHZA 1O2MA 4XD7D 1FIZA 3CNRA 4K1EA 4NSVA 4DG4A 2XW9A 2UUKB 1MCVA 3FP6E 3M3TA 3ZVAA 1DY8A 1QY6A 1EAIA 2KAIB 4ZXXH 3U28C 3KL6A 2OLGA 1WTHD 1O2VA 2VB0A 4ACBA 2OD3B 1QJ6B 3FZDA 1AZZA 1GG6C 1Z7KA 3GY4A 2ALPA 4VGCB 1BRUP 4X2XA 1Z71A 1FX0B 2JH0D 1CQQA 1QHRB 2CGAA 1TGTA 2OTVA 2BD8A 4ZKNU 2AS9A 3RXIA 1H8IH 1TWXB 1GI5A 3MO9A 3OEHD 2ODQA 2QV1A 2ZQ1A 1OS8A 1QNJA 1FAKH 1EAUA 3UNSA 1KLIH 2VIOA 4X8UH 4XFQA 5L30H 2WINI 1LVBA 1MAYA 2Y5FA 1THPB 3EE7A 4ABBA 2GGVB 1BTHH 4H4FA 2ZFSA 1O3FA 5T6DA 1MU6B 2HVYB 1W0YH 1FV9A 1C5ZB 4ACAA 3F9FA 3RM2H 1HAXB 3OY5U 3ZZ8A 1W7XH 2GZ8A 3BTME 3ZZ6A 2B9LA 4F4OC 1O36A 4DGJA 1PPGE 1SGRE 1DM4B 5DG6A 1SGYE 1P03A 1P12E 3SGBE 4YOGA 4ABDA 1LHDH 5K0HA 5J4QA 1Z8GA 1BUIA 1GJ6A 1J16A 2WPMS 1S0RA 3T27A 3I77A 2ZU4A 1SLUB 1EXFA 5FXLA 4BTUB 1QIXB 1YBWA 3NRLA 3N7EA 4FVDA 1GI7B 5EW1H 3MO3A 1F92A 1A46H 2ZDVH 1O2JA 5EW2H 4NA8A 5FAHA 3KQEA 4FXGH 2WHXA 1KTSB 1IQEA 1VITH 4TPYA 1SHYA 1G9IE 2TGPZ 1PQ8A 4JZIA 4LXBH 1TALA 3K9XB 4YTAA 1O3DA 2A4QA 4MDSA 3FN8A 1XVMA 1XXDA 3WY8A 1IQIA 5F8ZA 4YOIA 1XUFA 1GMHF 1Z8JB 3LT3A 1NRSH 2QXGA 1ABJH 1QA0A 4RT1A 5FPYA 3GY5A 2FODA 3MI4A 2VGCC 3NWUA 1O3HA 1EUFA 1A5HA 1TA6A 2ZU5A 5C1XA 4RI0A 3FAOA 4CHAC 4ABHA 1MMJN 1ZGIA 5C5NA 1HAGE 2FEQH 1UK3A 1HFDA 1GHVH 4GUXA 1RRKA 3QTOH 8ESTE 3S7KB 4Y11E 1AKSA 5DP3A 3EE0B 1GBDA 1J9CH 2P93A 3OFND 2BLWA 5JDUB 4B6EA 2SFAA 1O2WA 2QC2A 1IQFA 3ODFA 3LH1A 2UUFB 4CRCA 1A5GH 4BXSA 3FANA 4JZ1A 3RMMH 4GSOA 1P2IA 1DWBH 1MTUA 4MQAA 3BTEE 3SU2A 3E8LA 1TPPA 1L4DA 4I31A 3MH5A 1C1TA 1O3GA 1O5AB 4IC6A 1QL9A 2CN0H 3PWBA 3RXGA 3RXPA 3SJOA 2ANKH 2PGBB 4K2YA 4D9RA 4DIIH 1C2LA 2VVUA 3OX7U 3P17H 1Y3WA 4UE7H 1S82A 1ZTLA 2JH6D 1AGJA 3S9BA 3B8JA 1AO5A 3DSOA 3L3TA 4XBDA 4U01A 1OP2A 1BB0B 2BB4A 5T1VA 1V6DA 2A4RA 5DJ7A 1YM0A 1Y5AT 5FL7D 4B76A 3L6PA 1GJDB 3BN9A 6GCHF 4HZHA 2D1JA 2XC0A 1OSSA 3ESTA 2J94A 4UEHH 4Y6DA 5AF9H 2GTBA 3SHCH 3ATLA 3UWJH 2FIRH 1P2JA 5LGOA 3RXSA 1IQKA 3UQVA 2HLDD 3AAUA 2SGAA 1TGCA 3SNDA 4GAWA 1XKAC 1FN6A 2ZCHP 2B7DH 2FYRA 1Q31A 1EAXA 2AGGX 1ZJKA 1H4WA 2V3OH 1LVYA 2TPIZ 4HG6A 1GJ4H 3A80A 1GVKB 2RA3A 3EA8A 2STBE 4HI3A 1H9HE 1IQMA 1RTFB 3QZQA 3GCOA 4CRBA 4A5TS 1C2DA 1INCA 1LQEA 4IMQA 3RXFA 1NFXA 1GPZA 3LGVA 4X8TH 2F9BH 1HJ8A 2OINA 2PKSB 1CSOE 1NU7B 1DS2E 4UFDH 3UIRA 1KIGH 3Q00A 4GCHG 3ZIAD 3E0NB 4GVUA 2OC7A 2Z3CA 1THRH 1A0HB 5GDSH 4AOQA 1J15A 1YPJH 2XNDD 3R3GB 1C1RA 1C5QA 1HDTH 3ZZBA 1ELAA 1TRMA 3SI4H 2ZFQH 2PWXA 3JZ1B 2AGEX 1DITH 1QURH 1V2RT 3NXPA 3SUEA 1JBUH 1O3MA 3QN7A 4WY3A 1XUKA 1HIAB 1O2KA 1ZHRA 2J97A 5L2ZH 5C0TA 3EA7A 1J8AA 8LPRA 1MTVA 1GI9B 3RLWH 1Z1IA 1QBNA 4JYUH 3RXUA 1K9OE 2VH6A 4AYVB 3U8RH 1CE5A 2BLOA 1K21H 1QBVH 3K65B 1UHBA 2G81E 1C1SA 4P00A 4FUEA 1YPLH 1G36A 2SNWA 2L6OA 1EAWA 4WVPE 4Y7BA 3UY9A 5ESBA 2VVVA 3E3TA 2ZGJA 3F0OA 1QTFA 3N7OA 5H4IB 1GJ8B 3A7ZA 3GOVB 1CO7E 2A4OA 3U1IB 3TITA 5EOKA 1GHXH 2O8MA 1TMUH 2ZTXA 4I33A 2R3UA 2GZ7A 3A7XA 4O3TA 1UTOA 1C1UH 5EQQA 1K22H 1D6WA 1HLTH 1YCPH 1SLXB 1GI4A 3AW0A 1TNGA 4GLYA 2FLBH 4LZ4B 1QJ1B 1K1NA 1NFWA 2ZFPH 4A92A 2OCVB 1CGHA 5I46H 2BOKA 3MWIU 1Z1JA 1LKBA 4Y8XA 1CA8B 3W95A 2KM0A 1SQRA 3NPSA 1HRTH 4TWYA 2QAAA 4BAQB 4XOJA 1TONA 2OP9A 2FTLE 2VINA 1O3CA 2TGAA 1AFEH 1VITG 4TWWA 5TJXA 1GI0A 4B6FA 1DXPA 3T2NA 1EOJA 1XKBC 2B0FA 2XCFA 3AW1A 4INLA 1AI8H 4ZHAA 4ABFA 2VJ1A 2FS8A 2RFKC 4WMFA 5DN6D 2RG3A 1SGFA 2FLRH 1L1NA 2WUBA 3TNTA 1OWKA 1O2IA 2CXVA 1UVOA 3FFGA 2GCTB 1ABIH 2TBSA 4AC9A 3ODDA 1ESBA 4OS5A 1FY1A 3BEFB 3Q3YA 3PMBB 4OS1A 4GHQA 1ZYOA 3FOAA 1YGCH 2UUJB 3F0PA 1ZGVA 1RFNA 1XUHA 1GCTC 1NU9A 3ZV9A 2ANMH 4ZH8A 4MVNA 5EJLA 3KIDU 3A83A 1DSUA 3MNXA 3VEQB 5JYIA 2BD3A 1NESE 1O2QA 2A5IA 2WPKS 3SV9A 1IOEA 3OY6U 4XBCA 1GBKA 2FOCA 2PKAB 2QXHA 2UWPA 1P57B 3SGAE 2BTCE 3Q77A 1Y5BT 3SUDA 4JZDH 1O3IA 2P8OC 2PSXA 1KXEA 2H9TH 1O3JA 2F9PA 1O34A 1EASA 2H2ZA 4HFPB 4KGAA 1GJ7B 5EODA 4R8TB 1CT2E 1P05A 1ESTA 1N6YA 3M5OA 3LC3A 1LHEH 2Z3DA 4O97A 3A7WA 3RC4A 1P9UA 3QUMP 3D23A 4ZCNA 2A1DB 4I32A 1FUJA 3S0NA 3MH4A 2Z9GA 1VGCC 4YT7H 1JOUB 1EP5A 1EZSC 3A8BA 1BMFD 1DOJA 2XWBI 3ZZDA 1O30A 2KZ4A 2CHAC 2NU1E 4XSKU 3NZIA 6LPRA 3LJJA 1YCPK 3SUGA 5EPYA 5AVDA 1GBHA 5EIYA 4NWLA 5DP6A 1BQYA 3QGNB 5A8YA 5EQSA 4XE4A 4A1VA 5C0UA 4JYVH 3URDA 1UTNA 1HB0B 2ANYA 1UTQA 1IHTH 1ZRBA 2W3IA 2GZ9A 5AFZH 4ABIA 3TK5A 5FBIA 1OPHB 5CDFE 1Z8IB 2HNTC 5IDKA 3URCA 1EOLA 2G5VA 4JCNA 1QRZA 1ZLRA 1O2LA 1Z6JH 1MBMA 3DHKH 4MTBA 3TVJB 2B5TB 3VPKA 3HPTB 3U8TH 1WUNH 4NGAH 1ELGA 1V2NT 2F9VA 4ISNA 1F0SA 2G4TA 4CRDA 2YMSC 2WPJS 5FX5A 2PFEA 2GKVE 1HJAC 1E36B 1SSXA 2DUCA 2FX4A 4ZHLU 4CBOA 1PPZA 1J14A 4OS2A 3EQ0H 1C9PA 2F4LA 4NIWA 1RD3B 3BEUA 2QF3A 3N7DA 2PTNA 1OWIA 4D7GA 1UVSH 2ZGXH 1SKYE 1GG6B 2NWNA 1HAZB 2VIWA 2KCAA 1KDQA 1B5GH 1NO9H 1C2GA 5DP8A 3BTFE 1QB1A 3SNCA 2FTMA 2JJ1D 1NFUA 3SU0A 4NZQA 1ELEE
chains in the Genus database with same CATH topology
4QT8C 2EI8A 1S0QA 1PPFE 2BDYA 2P59A 3A7VA 3RXHA 1C4U2 1YPHC 4AFZA 4JMYA 3LKWA 2VIVA 3HKJB 1O0DH 1TNKA 2FZZA 8KME2 2PUXB 5GCHF 4KP0A 4IN2A 1T4VH 4THNH 3DA9B 1SFQB 1K1LA 1TBQH 3ENSB 2ANWA 4K5ZA 1QQUA 1LVMA 1F7ZA 4BAHB 2BY5X 1O3EA 1CBWB 1MKXK 2BHGA 1A0JA 1GBCA 2D8WA 3RMOH 2GDEH 3GY2A 3B23B 4A7IB 1P2QA 1TIOA 1C5SA 2ZHEH 3B9FH 4J1YA 1TX6A 1OWDA 1YP9A 4I8JA 2C90B 2ZPSA 1TNIA 4BTIB 1O2TA 1WQVH 2Z9IA 1V2UT 1FJSA 2C8ZB 5JBCS 1UK4A 1B0EA 4B74A 2J95A 2SNVA 3D49H 1RTLA 5A2MH 2OC1A 1NRPH 1TFXA 2BDIA 2AYWA 1UVPA 2JKHA 4FUGA 1SGNE 1KYNA 3T29A 2FMJA 1L4ZA 2G52A 1YPEH 4KELA 5E0GA 3KHVA 1O2NA 5FHTA 4O03A 3GISB 3T28A 5DO4H 1KLTA 3EAJA 2BX3A 4X2VA 2XYAA 1LHFH 1B0FA 1W11U 1A5IA 2O9QA 1TMTH 2RA0A 3M3SA 5L6NH 1HAVA 1QB6A 1O5BB 1ANCA 1BMMH 2VGCB 1EB1H 1UMAH 1P04A 1JXPA 2ZGBH 3V12A 4CHAB 1IQNA 1KXFA 1AE5A 1SHHB 4O3UA 4CRFA 1CHOG 3GDVA 5FPTA 1HPGA 1V2JT 1TRNA 5C67A 1VJAU 4UFEH 1N1LA 3W94A 1AVWA 4Z0KA 8GCHG 2F3CE 5TCCA 3UR9A 1S5SA 1P02A 2ZPRA 7LPRA 1IHSH 4X1NU 4ZKOU 4K69A 2WPIS 4WH6A 3SV2H 2CJIA 3PMAB 1MQ5A 1MU8B 1GWAA 1O39A 7GCHG 5BRRE 4OS7A 1BTYA 2XWAA 1TNJA 2G51A 2H9HA 4X6PA 1GI1A 3ZZAA 4AFSA 2VWMA 3V0XA 4YLUA 4ZXYH 2TRMA 2A31A 2ZHFH 3RLYH 2PW8H 1TX8A 3M7TA 2ZA5A 1PYTD 1P01A 3GDUA 2ZHWH 3SBKA 2Y7XA 3KQCA 4Y8ZA 2BMGB 3HGNA 2R0LA 2DE9A 2GVFA 1HAOH 5K7RA 1BTPA 2Y5GA 1SGDE 3LGYA 1TQ7B 1G2LA 9ESTA 4XBBA 1H1BA 3F9HA 1RJXB 1P11E 2GV6A 2QGRA 3ELAH 5E2OA 1QBOA 2PHBA 1HCGA 5EGMA 4UONA 4E7NA 6ESTA 1ELFA 1QRWA 1SLWB 4SGBE 1GGDC 1UVUH 4X1SU 3QWCH 3E0PB 1ELBA 3F9EA 4A6LA 3GY8A 2ZDAH 2FDAA 1AFQC 2QCYA 3GICB 1XX9A 2QIQA 3ZYEA 2CMYA 3PMJA 4YESB 1OOKB 1AVGH 1Y3VA 2ZFTA 3PO1C 1AN1E 3VGCC 2B8OH 4BTTB 2FX6A 2FOGA 1GJAB 3ATKA 4BAOB 2THFB 1HUTH 2NU4E 4INHA 4KTCA 2D26C 1MUEB 1W2KH 1A61H 1OWHA 1ACBE 3HK6B 1OKXA 3SU5A 1O38A 1RIWC 1Q2WA 2GCHG 4FUJA 5EU8A 3ZZ4A 1ETTH 1A2CH 1W10U 1S6FA 1MD7A 1O2OA 3SV6A 2GMTC 2QY0B 1F0UA 3QDZB 1NM6A 2Y7ZA 1HYLA 2F9OA 2ZHDA 2NU0E 5PTPA 3M37A 3MH6A 3QX5H 1IQHA 1KTTB 1YPGH 3A88A 4CRGA 2FYQA 1DWDH 3TGKE 3MNBA 3P92A 4K1SA 3OSYA 3TJNA 3ZVBA 1NPMA 4WF8A 1F2SE 3TH4H 1ZMLA 2WV4A 4X2WA 1THSH 4A1TA 3SJIA 5GJ4B 2BOHB 1WCZA 4B2CA 2IPHA 2NU3E 1BRCE 5EPNA 1SG8B 3TLOA 4JK5A 2VIDA 1LMWB 2ZDLA 2BD2A 1VR1H 2ZNKH 3ZZ7A 1O3PB 3A82A 1A7SA 1DLEA 1C5PA 3EA9A 4ISIH 6CHAC 2ZFRH 3VB3A 1ZR0A 1AZ8A 4DCDA 1EPTA 2GT8A 1LVOA 2BVXH 2WPHS 3TH2H 3UNQA 2ZPQA 3U1JB 1B7XB 1MKWH 4Q2KA 1FIWA 4FUDA 3C1KA 4IN1A 5HM9A 1BA8B 1WAYB 3DD2H 1IQJA 2A2QH 1FY3A 3RXDA 1JRSA 2AGIX 2ZFFH 4K3JA 4TY6A 5FPSA 2AIQA 4XDEA 1NC6A 2I6SA 1O5FH 3BG4C 4WWYA 1GHAG 3MNSA 4D9QA 1TMBH 1N8OC 1FY4A 3ITIA 1AHTH 2BD7A 2P3TB 1ZOMA 5AFYH 4KKDA 1BMNH 5AHGH 5HM2A 5JBBS 2UWOA 1C2EA 3TJUA 4JYTA 1P10A 1CA0C 1GVLA 1TX7A 4IW4E 1MQ6A 2R9PA 2FOHA 5A8XA 1O3OA 2R2MB 1E0FD 2FOMB 3QK1A 3E1XB 1MBQA 3SI3H 1GI8B 2FOAA 4BAMB 5DP7A 1LO6A 3P6ZB 3P8GA 3U69H 1G32B 2IJOB 4NA9H 2AEIH 4YT6H 3SV7A 2BYAX 3UTUH 4B2BA 1DE7H 4U30A 1H9IE 3RUOA 3BTDE 5I25A 2HOBA 2XBVA 1UJ1A 3MTYA 1E35B 1O2RA 2YNBA 4DW2U 2QN5T 4AB8A 4UD9H 1ELDE 1TNHA 5CMXH 1SPJA 2D2DA 2Z7FE 4ZUHA 2JETC 3ZVFA 3MO6A 1GCTB 2FPZA 2Z6BD 1C2JA 1DPOA 2ALVA 2EEKA 2OBQA 1LQDB 3ATWA 1SL3A 2ZDMA 3SU4A 1WV7H 3PROA 5DGJA 1YKTA 4K60A 1JMOH 3UOPA 3P70B 1ANDA 5EXLA 1C1VH 2C8WB 4H6SB 1QGFA 2PSYA 2P8OB 1ZTJA 2Y82A 2C8YB 1V2VT 3MU0A 1MKWK 3FZZA 4KTUA 1TGSZ 2ZEBA 1EKBB 4DOQA 4ASHA 3E16B 2G4UA 1FAXA 1GMCF 3VXEH 3G01A 1GDQA 3SO3A 3RU4D 4U32A 1TPSA 2A7JA 3BTHE 3T25A 3ZVEA 1O3BA 1V2QT 2R0KA 1EB2A 1AE8H 1GHBG 3OU0A 4Z6AH 2H1UA 1MZDA 1ZJDA 3GCTG 2GDDA 1VGCB 2ZG0H 4SGAE 4I8LA 4FU8A 3CS0A 1G3EA 2O8WA 2BD4A 3MFJA 1OXGA 2CHAB 5GWZA 2ZCLP 1UVTH 1AUJA 1V2OT 5IYTA 1W8BH 5FCKA 1L0ZA 1DX5M 1SR5C 2A32A 1EP6A 1EQ9A 2K1QA 5C20A 3T5FH 5JBTA 4FUIA 3GY6A 3H5CB 3I29A 1NRNH 1AMHA 4Y76A 2STAE 1C1QA 1NN6A 1NY22 1FONA 3HATH 5DPAA 3RXBA 2HGTH 3VB6A 1C1PA 1Z6EA 2KAIA 2IN2A 3A8CA 1BHXB 1UK2A 3UR6A 4I8GA 3ZYDA 3UPEA 1GBTA 1WTGH 2ZC9H 2HLCA 5C1UA 1GJBB 1T8NA 1Y3UA 1AD8H 2ZKSA 3LGTA 3M61U 2FO9A 3P95A 2J38A 2HPPH 3ZVGA 1MCTA 3TGJE 1HJAB 2HVXA 1OX1A 2SGFE 4B71A 3SU3A 1QQ4A 3F6UH 1O37A 3TU7H 1XUGA 1ZPCA 3M35A 4CRAA 3FVFB 1TRYA 4MNVA 3ZZ5A 9LPRA 1QRXA 4MPXA 4F49A 1Y5UT 5J4SA 5LH8A 2ZTYA 3M5LA 2YNAA 4FUBA 5CE1A 2PKSC 1BIOA 4YOJA 5EQRA 4GHTA 1ZSJA 4OGXA 4D7FA 1GCDA 1QJ7B 7KMEH 2BZAA 4ZAEA 2AH4X 1BBRH 5DKMA 1YYY1 1CVWH 1KXAA 3RMLH 5F8TA 3FP7E 3V7TA 3VB7A 1F5LA 1VCWA 1SGQE 1GHYH 3BV9B 3HK3B 1A4WH 4NA7A 3CENA 1BTUA 3RXOA 4ZROA 2OUAA 1BJUA 3LDXH 3PV4A 3STJA 1AKSB 3K2UA 3QTVH 3SZNA 2R3YA 2VWNA 1TPAE 3SJKA 2ILNA 5A09A 4NSYA 3LONA 2W7UA 1GBIA 4JZEH 2A2XH 3T62A 1K2I1 1D3DB 2ZF0H 3BIVH 3RDZA 1O32A 1O3NA 2BQ7B 1BMAA 1AY6H 1WU1A 5LPEA 4X6MA 1GBEA 2ZQ2A 4LZ1H 2QF0A 4GPGA 1TYNA 1OP8A 2SGEE 2GV7A 1GI6A 1L1JA 1TQ0B 1AB9C 2Z3EA 3SJ9A 4X6OA 3LH3A 3V13A 1K1IA 3H7OA 1C4V2 2VWOA 5EXMA 2G8TA 1UTLM 3BTTE 5GXPA 3GCHC 1ESAA 1ETRH 3A86A 4FUFA 1A0LA 1T8LA 2FI3E 5DP9A 1HGTH 1UCYH 3O8RA 3M7QA 3MOCA 1LTOA 3RC6A 5DK1A 1SGCA 1ZMNA 2FWWA 1EJMA 1V2LT 1Y3YA 4NG9H 1V2TT 2AMQA 1C2HA 4Y79A 2O8LA 4AZ2B 4I8KA 1AQ7A 3A87A 5E2PA 2ODYB 1U6QA 4UFFH 1ZHMA 1YLDA 1O2GH 2BY8X 3H7TA 2FM2A 4TY7A 1SGTA 1ZHPA 1QL8A 3LGWA 3RXKA 1DFPA 5T3HA 2ZP0H 2Q6GA 5LPFA 2FOFA 1OYQA 3TJVA 4YLQH 1C5LH 3MU1A 2ZO3H 1GJCB 2A5KA 2WPLS 3EDXB 3SQEE 3LC5A 1UO6A 5ESTE 1BT7A 1C1NA 3ATMA 2XCNA 3FP8E 5CHAC 1C2IA 4WMDA 3SNAA 3BTGE 4U2WA 2OC8A 1AWFH 2Q6DA 2XTTB 3TGIE 5T6FA 3GY7A 2V3HH 1GBMA 3S7HB 4NCYA 3SW2B 1L2EA 2XNIA 1K1PA 1MTWA 2F91A 2ZU3A 1ELTA 3P8NA 5C1YA 3LIWA 1D6RA 1GGDB 5FX6A 2BDHA 3TIUA 3NKKA 7ESTE 1EATA 4K8YA 5JPMH 2ZWLH 3RXQA 3GY3A 1MAXA 4D8NA 3RP2A 1K28D 4FVBA 5FCRA 1VJ9U 4GCHF 3RM0H 1EPTC 1C1WH 3PO1B 2P95A 3QLPH 2Y81A 4OS4A 2FI4E 3F68H 1S83A 3LPRA 1UHBB 1D3TB 1O2PA 2XC4A 1SGFG 3M7UA 2AMPA 4Y0ZE 4B2AA 1LHCH 1BRBE 5DP5A 4KTSA 2DE8A 1RIWB 4ABAA 1C9TA 1TGBA 4WH8A 4K8BA 2G55A 1SGEE 4FU7A 2Y80A 1C5WB 5C3NA 4ZMAH 2HALA 2FI5E 1LPGB 3SORA 3SHAH 1WSSH 1ELVA 1PPEE 1P2NA 3PMHB 3PLKA 1G2MA 1HIAA 2BLVA 4I8HA 3RXRA 3TJOA 4IGDA 4NIXA 3E90B 2Z9JA 2ESTE 2ZGHA 1FDPA 4B73A 3NUMA 5E0HA 4DVAU 4H6TA 1GDNA 4J2YB 3V3MA 2IOTA 3OTJE 4X8VH 1HV7A 1E37B 3A8AA 2QXIA 1GBBA 1UTMA 3MMGA 1SQOA 1GJ5H 1ZSKA 4Q80A 2H6MA 1GMDG 1W3CA 2C8XB 2P16A 4AYYB 2O8TA 3MU4A 6CHAB 1KXDA 2PUQH 2VU8E 5B6OA 4Y71A 1ID5H 2OXSA 5ABWA 1DSTA 5E0JA 4X0WU 3UFAA 1Q3XA 1H9LB 1D9IA 3D65E 2AERH 2PLXA 5JBAS 3A85A 1L1GA 3MU8A 1PQAA 2OC0A 1VITF 4JK6A 1BTZA 4Y10E 3A81A 1GBFA 2FESH 1JIRA 1BCUH 1F5KU 1BJVA 1GJ9B 1C2MA 4ABEA 1EZUC 3BG4B 3LU9B 2EA3A 1N8OB 3S9AA 3HKIB 4NZLA 3PB1E 1C5NH 4I7YH 3QZRA 2Q1JA 3SNEA 2BQ6B 3ZZ9A 1KY9A 2J4IA 1ANEA 1TGNA 1LCYA 1RTKA 4MPUA 1S6HA 1CA0B 1CBWC 1X7AC 3AVZA 4OGYA 2Z9LA 3ZVDA 3KEEA 1YLCA 1DICA 3A89A 1BOQA 3LGIA 4BANB 1TOMH 1SQTA 2A45B 2ZDNA 1S84A 4WJG2 4X1RU 1EJNA 5A8ZA 2W3KA 2WYGA 3HGPA 3K6ZA 3RMNH 4TPIZ 4FUCA 1XMNB 1BZXE 4UFGH 1DWCH 2ZTZA 3TK6A 4AB9A 2ZGCA 1HBTH 3QGJA 5JB9S 2BDAA 4X1QU 1O2HA 4DJZB 2HNTE 3IITA 1GHWH 4DIHH 1MTNC 2PKAA 5EG4A 4UDWH 3BF6H 3ZZCA 2P3FH 2BY7X 5DP4A 2JETB 1O2YA 1E34B 2H9EH 1FY5A 2A4GA 1CT0E 2P3UB 3P8OA 2FXRA 3SOSA 3Q3KA 3U8OH 3BTKE 1BMLA 2VNTA 1O5DH 1PFXC 3MH7A 3DFLA 1WOFA 4HTCH 3KN2A 4NFEA 3BSQA 1IQLA 3DT0H 1TAWA 2VWLA 2BXUH 2H5DA 1P2MA 5GPIB 1P06A 4VGCC 2GD4B 4Y7AA 4A1XA 3S9CA 1OWEA 4MLFB 3MU5A 4NIVA 3KQBA 2UWLA 1V2PT 1RXPA 5C2ZA 1MTSA 2CF9H 1P09A 3RU4E 1UTPA 1YPHE 4B1TA 3I78A 1UTKA 3U98H 1SLVB 4ISOA 1WQSA 4DY7B 3SU6A 4CH8B 1FLEE 3RXTA 4YO9A 1KDQB 2A7CA 2JH5D 1C5OH 1KLJH 3E91A 1RS0A 1TBZH 2O8UA 2G5NA 4Y0YE 2ZIQH 3DFJA 1ETSH 3TK9A 2Y5HA 5A0BA 2W5EA 1DVAH 4X1PU 1C5RA 1MZAA 1P8VC 1ZMJA 1SGPE 2XBWA 2M5TA 1WYKA 3EGKH 1Y59T 2LNCA 2QYIA 2RCEA 2A0QB 2F83A 2SGPE 1O2ZA 1DLKB 2Z9KA 4R0IA 1QL7A 5T6GA 4WXIA 4Q7ZA 1LHGH 3RXVA 2EC9H 2ZU2A 3A8DA 4MPVA 1T8OA 1C1MA 3CS7A 5GCHG 1T31A 4BAKB 4X8SH 1SBWA 5C5OA 2VH0A 3IG6B 1FXYA 3MYWA 1FI8A 1O5CB 2ULLA 1F5RA 3PYHA 1PPCE 2BDGA 1JIMA 1D3QB 2PGQB 4MG3A 3KF2A 2XBYA 2ODPA 2RDLA 1C1OA 1T32A 1SOZA 2J2UA 4ABJA 4CBNA 1TBRH 1T8MA 1EZQA