1ANCA

Anionic trypsin mutant with ser 214 replaced by lys
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVKWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the polar environment of Asp102 in trypsin: consequences of replacing conserved Ser214.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ancA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ancA02
1BMAA 3Q3YA 5EU8A 3ZYDA 1KTSB 3FVFB 3ZZ5A 2VIDA 1DWDH 5T6GA 1D3TB 2EI6A 3UR6A 2WV4A 3BG8A 4OS5A 1LVOA 1P01A 4E7RG 2OC7A 4NA9H 3NUMA 1LCYA 1GDNA 2PUQH 2ZZUH 4RSPA 5I46H 4ISIH 6CHAC 1BBRK 1GI8B 1EB2A 2XYAA 1XVMA 5A0BA 1W0YH 3LH3A 4INLA 1GCTC 3SNCA 1C4V2 3MU8A 4QT8C 3AW0A 3A83A 5C3NA 1PJPA 1PPGE 1OSSA 1UCYK 1TQ0B 3T27A 2CF8H 2FODA 1S0RA 2XCFA 3HGPA 1TGBA 1QB9A 2ZI2H 1BZXE 1A1RA 1LKAA 3O8BA 1DUEA 1TX7A 2FOMB 5TCAA 3MU1A 3RXRA 1QJ1B 4CRFA 1EZSC 1GI6A 3U1IB 3MNXA 2GCTB 2RG3A 2ZEBA 3VEQB 3MMGA 3E8LA 4IMZA 1C1NA 3RXPA 1GBAA 1K9OE 1T8LA 5FBIA 4ESTE 4YLQH 5L2YH 2LPRA 1C5LH 2BLWA 4AB9A 3MI4A 1HAZB 1KXFA 1HAIH 1C5XB 1ELBA 1TFXA 4A1TA 1K21H 2ASUB 1PPZA 1BRBE 1AD8H 3QDZB 6ESTA 1W11U 3ZZDA 4UFGH 4LZ4B 4AG1A 3PROA 1Z6JH 1VJ9U 5HM9A 1DUAA 2QY0B 5DP8A 3GDVA 1OXGA 2Z3DA 3FP8E 5GPIB 3LC5A 4B73A 2AGEX 1LVYA 1CT0E 3K6YA 1Z1IA 1GHBG 1KXCA 4XBCA 3U1JB 1XUIA 1YCPK 1ZR0A 4K1TA 1ZSKA 3R3GB 4JMYA 3HKJB 2F9UA 3FZDA 4LZ1H 4E7NA 1AI8H 1KY9A 1W14U 3ATIA 4NIVA 4RN6A 1Z8IB 3K9XB 1TBZH 2BOHB 4ISHH 2PSYA 2Y7XA 2P59A 3GCTG 5PTPA 5JBTA 2IOTA 8KME2 1M9UA 4ZKNU 1MD8A 2XC4A 1S0QA 2GZ8A 1S85A 1ZGVA 2W7SA 1O2RA 1VCWA 2OINA 3SW2B 3TLOA 1F92A 2GTBA 2VINA 2G4TA 3A87A 9ESTA 2QXGA 1UTJA 1V2LT 1IQMA 3TNTA 1W10U 2R2WU 1XMNB 4NWKA 5JYIA 3FP6E 1AVGH 1A5HA 1O5DH 3PV4A 2HPQH 4NZLA 3URCA 2FO9A 1NT1A 4FUEA 4TPYA 1N8OC 1OS8A 2BY8X 2M5TA 2Z7FE 1FMGA 3S9CA 3QGNB 2FTMA 1C2DA 1VR1H 2P16A 2FS9A 4GVUA 1FV9A 3BTQE 1SOTA 2ZDAH 2ZU2A 1ELEE 2SGQE 1QB1A 4Y7AA 3QGJA 1L1GA 3V3MA 3T5FH 2HLCA 4BOHA 5GIBA 4Y11E 1P2MA 2GD4B 1JRTA 1UTQA 1V2QT 2UWLA 3OY6U 1BTYA 1XKAC 1BDAA 5DP3A 2ZQ2A 3UWIA 5LPRA 3BV9B 1HUTH 1A7SA 1DX5M 1G36A 5HMAA 3ZZAA 5DG6A 1V2NT 1QA0A 1RS0A 1O2JA 3U98H 1DFPA 1S5SA 1RD3B 1YPJH 1RTFB 1TBQH 1HB0B 1GL0E 4WMDA 2HALA 1EB1H 3UQVA 1YLCA 1X7AC 1XUGA 1IQJA 1QIXB 1GBKA 1FN6A 1F7ZA 2TRMA 1BMNH 4K2YA 1IAUA 1LPGB 2UUJB 3TK9A 3MH5A 1V2UT 3RU4D 2BD3A 4UFFH 2NU0E 4A1VA 1NZQH 1TGSZ 2ANKH 1GJ6A 4GUXA 1CGJE 4I8LA 1EAWA 1O0DH 4AORA 1K1NA 2FOCA 1IQNA 4B74A 1SVPA 4MPXA 1DDJA 4ZROA 1FLEE 2G5VA 1GPZA 1NS3A 1TNHA 1FI8A 5AVDA 3SU2A 3VGCC 2J94A 3TNSA 2C8WB 1V2KT 1ELAA 1GJBB 1MCTA 1V2MT 1YYY1 1DSTA 2ZA5A 4KELA 4Y71A 3A8BA 3E16B 4INHA 3TJNA 2VU8E 2FYRA 4XBDA 2WPKS 3ZZ8A 5T6FA 1HCGA 1P2QA 1O35A 2TGTA 2BQ6B 3EA9A 1FY3A 1BRUP 3EA8A 2Z3EA 1YPEH 4A5TS 1T4UH 1YPHC 5DP7A 1C5OH 4CBOA 1SGRE 3SJ8A 2GT8A 4MNXA 3SI4H 1CBWB 1AVWA 1T8NA 1NU9A 5G4BA 1NRPH 1MZDA 2P3UB 2JETC 1FN8A 5T6DA 1WBGB 3T28A 1TPOA 3LGTA 3SUGA 5EGMA 3HK3B 4MTBA 2R3UA 5J4QA 3P8NA 1NPMA 3RC5A 2PFEA 2A1DB 2BY6X 2FLRH 2RA0A 3HPTB 1G30B 2ZDNA 1GI9B 1ETTH 2VH6A 1TPPA 4K3JA 5AF9H 2FM2A 3ZVGA 2ZU4A 2FX6A 1G3EA 1O33A 2Z9GA 1BCUH 2ANYA 1AFQC 2GMTC 1V2TT 3PM3A 1O2UA 1SLUB 3LGVA 1O2HA 1A61H 2VIVA 5F8TA 1P57B 1P05A 1UTPA 3FP7E 3EA7A 1THRH 3S69A 1HLTH 3M5OA 1O38A 1Q3XA 1G32B 1GHXH 1MU6B 2OTVA 1ARCA 4FU7A 2EI8A 4OS1A 3EAJA 2AIPA 1ZMJA 4ZHAA 1C9TA 1HDTH 1O3GA 2A4QA 2R9PA 2BY7X 4MPWA 4AGJA 1ESBA 5SGAE 5DO4H 2ZPSA 3BN9A 2EC9H 3QWCH 2R3YA 1JIRA 4X8VH 2B7DH 1UVPA 1FIWA 1O2KA 1O2OA 3TU7H 3TJVA 4ABHA 8LPRA 1C2FA 1WTHD 1PYTC 1K1IA 1RTLA 2F9BH 1SGFA 3LDXH 1SGQE 1UTLM 5CHAC 4FVBA 1P3EA 3PWBA 3QX5H 4CH8B 2STBE 3K2UA 1SGIB 2XWAA 4O97A 2GCHF 3DFLA 1G3BA 1AY6H 2XWBI 1XUHA 2BXUH 1BRAA 1T4VH 3LKWA 1EASA 3SV7A 3TGKE 1C1SA 2XBWA 1J15A 2I6SA 1VGCB 1GI1A 4B71A 2Z94A 2H1UA 4CRAA 5CE1A 2AYWA 1MQ6A 2ODYB 3Q3KA 1C2JA 3QN7A 4BAQB 2J38A 3QTVH 3RC4A 1V2WT 3BEFB 4H6SB 4CHAB 2ZHWH 1CGIE 1MQ5A 2TIOA 4NFEA 2BDAA 1G9IE 1MAYA 1QNJA 3NZIA 3BTTE 4LXBH 3L3TA 4JYTA 1VITH 3VPKA 1BHXB 2BVSH 2ZQ1A 2H5CA 1T32A 1GGDC 1DT2A 1SOZA 9LPRA 1L1JA 2JKHA 4R8TB 1AUTC 4CBNA 1YCPH 2ZFFH 4WMEA 1IHSH 1ZLRA 1SFQB 1GJDB 2A5IA 4Y79A 3CENA 2GX4A 1BTZA 4JYVH 4WWYA 4BTUB 3RDZA 2GDEH 1CBWC 3T2NA 3SV6A 2WPLS 5FHTA 3RMLH 5A0AE 1TMUH 2BM2A 3GISB 1EJMA 1GJ9B 1Y59T 1V2RT 4OS7A 4XSKU 3MU5A 3NKKA 1B7XB 4Q80A 4AYVB 1AHTH 4WF8A 1GVLA 1GCDA 1NM6A 1WU1A 1BJVA 3GYMA 3ZVCA 2FIRH 2ZFQH 2BX4A 2ZFPH 1FUJA 2QXIA 2VVCA 4BTTB 1SFIA 1CT4E 3PMJA 4AYYB 1E37B 1RJXB 4X2XA 3SU1A 3D62A 1OX1A 1JRSA 1DWCH 1GCTB 4X8UH 2C8ZB 2SGEE 2SGDE 1GJ8B 5BRRE 3NCLA 3BIUH 4DCDA 1TBRH 2BYAX 1KSNA 1SQAA 3M35A 1C1MA 3S0NA 1B5GH 2BY9X 2Y81A 5JBCS 4DJZB 3KIDU 1N6YA 3M3VA 4FU8A 1F0SA 2CJIA 1GBTA 1FPHH 3BTFE 1CO7E 3ZVEA 3GY5A 3RLYH 1QRXA 1KXAA 3QO6A 4NIYA 2BD2A 4Q2KA 1BBRH 1ZPCA 4DGJA 2GCTC 1P09A 3VB7A 1FAKH 3UUZA 2OP9A 2HWLB 1K1LA 1AZ8A 3SQHE 1CSOE 3QZRA 1AFQB 4KP0A 4JZFH 1HXEH 4WY3A 1SGPE 1ARBA 2P8OC 3SNBA 1LHCH 2G5NA 3CS0A 2A7JA 1O2SA 4YZUA 2G8TA 2PUXB 2P3TB 3DA9B 1S6HA 1CA8B 4XFQA 3MH7A 4DVAU 4FXGH 3HK6B 3S9AA 3KQDA 2ODQA 3F6UH 5GDSH 1S6FA 1Y3WA 2BVRH 1Z8JB 2GZ9A 1ZHMA 3TK5A 1O5EH 2SNWA 4VGCB 2H5DA 2DE8A 2A4GA 1YPHE 2IN2A 2R0KA 2ZCKP 4D7GA 2GP9B 1V2ST 4X6OA 3RUOA 4CHAC 1A0JA 4CH2B 4D7FA 4BAMB 1K22H 2PKAB 1AN1E 4CRDA 1C5MD 2NU2E 1D4PB 2PW8H 4E05H 2PGBB 2FI5E 3TH4H 1PPFE 3RC6A 3SUFA 1CQQA 2BLVA 1QJ6B 1BHXF 2C4FH 4FVDA 3SJOA 4X8SH 1ELCA 1P11E 2QN5T 2VB0A 5FAHA 3GDSA 3I29A 1C2GA 2ZC9H 2BDBA 1E34B 3U8TH 3EGKH 3STJA 1UO6A 1XKBC 1EJNA 1NESE 3SU5A 2P93A 1YP9A 1ETRH 3M5MA 4MG3A 1PQ7A 1ZSJA 3D65E 4JZEH 4GHTA 2VWOA 3RXSA 4FUFA 3L6PA 4BXWA 1GMHG 1C5NH 1C1UH 1ZMNA 4NFFA 1BIOA 4AFUA 2ZO3H 3O8CA 3KF2A 4B2BA 1PYTD 2VGCB 1Z71A 4X1RU 3P8GA 3P95A 3VXEH 1RIWC 1KTTB 1B0EA 1D6RA 1JIMA 1SGCA 1QL7A 3KEEA 4KTSA 1HV7A 1NC6A 1C4U2 3RP2A 1Y3XA 2UUFB 1FIZA 4Y10E 2CHAC 1B0FA 1AWFH 4Y8YA 1KXBA 1YCPM 1GBBA 1MTUA 1EPTB 1QFKH 7GCHF 1XVOA 1GHAF 1AZZA 1CE5A 4CREA 1TLDA 1BBRE 1O2GH 2AERH 2ZCHP 3DUXH 3LOXA 3PWCA 5A8ZA 2SGFE 4D8NA 6LPRA 1DSUA 4B76A 1PQAA 2J34A 1A5GH 5ESBA 1YF4A 1K1JA 3FAOA 1UTNA 2ZDKA 1A0HB 1O3AA 5EODA 1RFNA 1VCQA 4U32A 4DG4A 2HOBA 1BMLA 2GGVB 1T7CA 4X6PA 1C1PA 4FUDA 4ZKSU 2WPIS 1O30A 5HYOA 1MZAA 1CHOF 1GHZA 5T3HA 1ORFA 4MDSA 1AVXA 1S84A 5TCCA 1TRMA 5DP9A 3HGNA 4NSYA 1TRYA 2HGTH 1LDTT 2C3SA 3GCTF 3KNXA 3M5NA 2UWOA 5HGGA 2AFQB 4ABJA 2ZGHA 2B9LA 1KIGH 1N8OB 4WH6A 2H2ZA 1O3KA 4WVPE 4OGXA 1MTWA 1O31A 1TWXB 3RXUA 1HFDA 3UOUA 2ZTZA 5B6OA 1LQEA 4NZQA 4ZHLU 3LPRA 1SLXB 1A5IA 4GHQA 1GJCB 6GCHF 1O3CA 3O8RA 1ZTJA 1W13U 2ZFRH 5FPYA 3UQOA 1O3BA 2VWMA 4MVNA 3A8DA 1MTVA 2ULLA 1GI7B 4ABAA 1IOEA 1BQYA 1P0SH 1EQ9A 1VZQH 2WPMS 1W3CA 3MNBA 5J4SA 3P92A 1NRRH 5EQRA 2QCYA 3ZYEA 3OYPA 2TGDA 1HAVA 2AGIX 3PO1C 3UR9A 8GCHF 3KGPA 1SGDE 3I78A 4U01A 5BPEA 1J16A 1ZTKA 3U8RH 3SV9A 1OWKA 3M3TA 1AO5A 2XCNA 3BF6H 1FY1A 4B75A 1C5VA 5IYTA 1SHHB 3F68H 1C9PA 4X6MA 1CU1A 2NWNA 5F8XA 3SHCH 3SO3A 1O2LA 3GICB 1MH0A 2GVFA 2VIWA 2QF0A 3VB4A 2LNCA 5DP5A 1W7GH 3A8CA 2QC2A 3BIVH 2Q6DA 3JZ1B 3F9GA 5DPAA 1O2TA 4AG2A 3PLPA 4CRBA 3BTEE 2ANWA 3UPEA 1MKWK 2ZECA 3IWMA 3VB6A 5A8YA 4BXSA 2CF9H 3QLPH 1O3EA 5ETXA 1GBDA 1FAXA 1HJAB 1HAYB 2AMQA 4A1XA 1J9CH 1A3BH 3A85A 3PTNA 1MD7A 1FY5A 5LPFA 3RXEA 3MFJA 1INCA 1EPTC 1GBFA 2P8OB 1GMCF 3RXBA 2FS8A 2XBVA 2ZGJA 3NWUA 1O2PA 1WSSH 4AFSA 4DIIH 1JMOH 4A7IB 4ZXXH 2QV1A 1C1TA 3A7TA 3A88A 1YGCH 1HNEE 4X1QU 4JCNA 1C2MA 1KLTA 2CXVA 2G51A 1YC0A 1GBCA 1ZPZA 2ZU5A 1KXDA 1TMBH 1ELTA 5HM2A 3BG4B 2B0FA 3S9BA 3N7OA 1SC8U 1XUFA 2SNVA 1ZOMA 2ILNA 3EYDA 3GOVB 5E8EH 2FOFA 3PLBA 4CR9A 4IS5A 1SGTA 1TA6A 3M36A 1C1WH 1QQUA 3ZZ4A 2ZHDA 3ZZBA 4DOQA 2Q1JA 2KAIA 3SNDA 1SBWA 3O8DA 4UONA 1H8DH 2WUBA 1C5RA 1O2IA 4O9VA 2WYGA 2R0LA 3SJKA 1Y5AT 1YM0A 4CRGA 1GVKB 5EW1H 1LPKB 2BD9A 5F03A 1O32A 1ID5H 1BJUA 4HGCA 3UTUH 5C5OA 1TX6A 2PGQB 1E36B 1EAXA 1AE8H 5L2ZH 2EA3A 3A7VA 1UMAH 1UK4A 3OU0A 2G52A 2O8WA 3BTHE 1WYKA 1ELFA 4INKA 1KDQA 2FOBA 3GCOA 3QTOH 3MO9A 1Q31A 1A3EH 2PSXA 1P8VC 1C1RA 5CHAB 2Y5HA 2VIPA 2XXLA 3GY3A 3Q00A 5DGJA 3T62A 4FUIA 4OS2A 4GSOA 3T29A 2ZGBH 5AFZH 5C1UA 2WPJS 1UTKA 3EE0B 1QRWA 1YPLH 2A5KA 1P06A 2PHBA 5K0HA 3C27B 3RXGA 3T25A 1CGHA 3TGIE 3M3SA 2W3KA 4K1SA 1QBOA 3ITIA 4FUCA 4JYUH 6GCHG 1C2EA 4RKOB 1GJ5H 2CGAA 2FI4E 1OP8A 4Z0KA 3ZVDA 1A0LA 1TABE 1CHGA 3ATMA 1HBTH 4Y8ZA 3PO1B 2HRVA 1Y3VA 1D3PB 4DURA 2YNBA 4ZH8A 1O5GH 1O3DA 1Z8RA 3TITA 2W7UA 2QYIA 3GDUA 1EAIA 1PPCE 3P6ZB 4NSVA 3ZZ7A 1QHRB 4K1EA 1V2PT 1O3NA 1UVUH 2F9PA 3FANA 1LTOA 4K5ZA 2O9QA 2J92A 4K60A 5L6NH 3VFEA 2CN0H 1SLWB 2VVUA 2ZDLA 1OWHA 3K6ZA 1GHVH 1F5RA 3F1SB 3G01A 4X2YA 1DANH 1GJ7B 3DHKH 3MH4A 5ESTE 2FLBH 3ESTA 1CA0B 1C1VH 2C8YB 2VWNA 5FX5A 2PV9B 5EQSA 3PMBB 4I32A 1H4WA 2QGRA 4OS6A 1IQHA 2F9VA 2BLQA 4XDEA 4ZUHA 2QA9E 5A09A 1BT7A 1EJAA 5IDKA 3OSYA 1UHBB 2OC0A 1TB6H 3BTKE 3RXLA 2IPHA 2A31A 1HXFH 1ELGA 4FUHA 2BMGB 2ZCLP 1P2IA 3KHVA 1H9IE 1O2MA 3LJOA 4D9QA 4OS4A 2A7HA 1QY6A 1GMDG 3LU9B 3UWJH 2FXRA 4ASHA 3SU3A 4YT7H 2QXJA 2FYQA 5H4IB 1P03A 2C8XB 1LHDH 1LHEH 4CR5A 3LJJA 3RMOH 2AGGX 2PKSB 1P3CA 4Y6DA 4NIXA 3P70B 2XRCA 1TNIA 1VITF 1XM1A 4D76A 3ZVAA 1WV7H 1JWTA 2NU3E 1U6QA 4DW2U 1EP5A 2D26C 3PLKA 4KKDA 2AH4X 2B8OH 1DE7H 4AZ2B 2FMJA 5DP6A 1SB1H 1WQVH 4NG9H 3RMMH 1DM4B 4UDWH 1TRNA 5LPEA 1AKSB 1ZHRA 3R0FA 1XUJA 2OLGA 4IMQA 1NY22 1Y5BT 2Z3CA 1DXPA 3MU4A 2FI3E 2F91A 2GV7A 5C2ZA 1ANBA 1GG6B 1O2XA 1LVBA 4ZKRU 4ABBA 3A7ZA 5EQQA 2A4RA 2Z9KA 1QL8A 3RXTA 1UTOA 5CMXH 1SG8B 2O8LA 2RDLA 1UK3A 3SGAE 3RU4T 1FZZA 3NXPA 4TPIZ 1WUNH 4MPUA 1GBIA 3MWIU 3HKIB 4U2WA 1O2VA 2FP7B 2BD4A 4ABDA 3D23A 4J1YA 1O3JA 2ZF0H 3TGJE 1OYTH 1TIOA 4KTCA 5GXPA 1DWEH 2XW9A 3ZZ3A 4JZDH 1V2JT 1FNIA 3RXFA 4UFDH 2W26A 2F3CE 3E6PH 1MBMA 2XC5A 3RM0H 1MKXK 3GYLB 3KCGH 1H1BA 1HGTH 4ISLA 1G37A 1T31A 2NU1E 1ZRBA 2OUAA 1RTKA 5FPSA 2VIOA 1ACBE 1Z8GA 4NA7A 1TNLA 2V6NA 2ALPA 2TBSA 1A4WH 2G4UA 4DY7B 1MAXA 1SLVB 2BX3A 1ESAA 3UOPA 1C5PA 1DLEA 4H6TA 3TPIZ 1UTMA 3QZQA 5EPNA 4B2AA 4YOGA 3A81A 4SGBE 1H9LB 1E38B 1SGFG 1GI3A 1E35B 2NU4E 1DS2E 1P12E 1O34A 1V6DA 1TONA 1EPTA 1EX3A 1AB9C 1KLIH 5JB8S 3W94A 1QURH 1TPAE 1YKTA 4F49A 1S81A 2TPIZ 2CV3A 3RXIA 4X8TH 1NRNH 1GI0A 2FOHA 2RA3A 2BD8A 2H9HA 3E1XB 1OWEA 2FOEA 1IQIA 1H8IH 3OX7U 4JZ1A 1C2IA 3SHAH 2FDAA 1AQ7A 4TY6A 3SGQE 2KAIB 2Q6FA 3L33A 1Y8TA 3FFGA 4I8HA 2ALVA 1OYQA 2Y6TA 1MTNC 4THNH 5C1YA 5LGOA 5F8ZA 1IQEA 1QL9A 3S7KB 1J8AA 2PLXA 1G2MA 2BY5X 1NRQH 1ETSH 1PPBH 2HNTC 4WXVA 3CS7A 4WJG2 1SQTA 3M7QA 3V12A 2A0QB 2ZPQA 2W3IA 2YOLA 1O3HA 2HNTF 2PR3A 3GY7A 1G3CA 4WXIA 2ESTE 2VWLA 3VB3A 5LH8A 2ZDVH 1GI5A 1THPB 3TVJB 3SUDA 1NFYA 2ZU3A 2P95A 1PPEE 3HATH 2WUCA 1NFUA 4BAOB 2PKAA 4ZXYH 1FDPA 3Q77A 2BXTH 5FCRA 2ODPA 3E0NB 3V13A 1RXPA 1TALA 5AHGH 1GI2A 1P2OA 2BZAA 4U30A 1QBVH 2WYJA 4YM9A 1SGYE 2WV5A 1O5FH 1XXDA 2Y80A 1J14A 1MKWH 2O8UA 1N6XA 4H42U 1HJ9A 1MBQA 1Q2WA 2BDCA 1GHBF 2W5EA 3A7YA 1VJAU 3U8OH 3M37A 5E0GA 1GL1A 1NFXA 1A2CH 1Z6EA 2AMDA 3SU0A 4KGAA 2BLOA 1D3DB 1F5KU 1ZSLA 3RXCA 1CA0C 1BTUA 1UVTH 4ISNA 4YO9A 1V2VT 1AFEH 4X1NU 4MNVA 1NU7B 1C4Y2 3T26A 1YBWA 2CHAB 2V35A 4FUBA 3PTBA 2V0BA 1QCPA 5E0HA 2JH6D 4X2WA 1AE5A 1IQKA 1AWHB 1EUFA 3ZZ9A 1C1QA 3MU0A 1P9SA 2OQ5A 5C1XA 4ABIA 3LH1A 4I7YH 1Y3YA 2Z6BD 1WQSA 3TIUA 1K2I1 1LVMA 2ZP0H 3KL6A 1QJ7B 4FU9A 1GJAB 1ESTA 3SGBE 3E0PB 3SNEA 1KYNA 1ANCA 1LKBA 1IQLA 1LHFH 2JH0D 1GBHA 3UNSA 1VCPA 1AMHA 1OWDA 5GJ4B 1SI5H 3MH6A 4I8KA 2QIQA 2CMYA 1GHAG 3A89A 5GCHF 4MNYA 1GGDB 4IBLH 4B1TA 3ZV9A 3A7WA 3NK8A 2RCEA 1O3OA 3F9HA 1DY8A 5EG4A 3RU4E 2BQ7B 1SMFE 4AGKA 8ESTE 2F9OA 5JPMH 2DUCA 1AKSA 1ZJKA 1F2SE 1HAXB 3GY6A 1V2OT 1TNGA 2Y5FA 1P2KA 1MCVA 2FWWA 1JOUB 4UFEH 1CHOG 3OY5U 3SZNA 3VXFH 4B2CA 1KDQB 1MTNB 1NFWA 2VVVA 1UCYH 2ZDMA 2ZGCA 3ZVBA 4LOYH 3Q3XA 5E0JA 1O3PB 3P17H 1QRZA 1BITA 1YPMH 4TY7A 4H4FA 1GHYH 2HNTE 1GI4A 5EXMA 1UCYE 4ABFA 2QAAA 1AU8A 3LGUA 2Z9IA 3LT3A 5A8XA 4YT6H 4R0IA 7GCHG 1C5UA 3MO3A 2GV6A 3KQCA 1ABIH 1RGQA 4XBBA 3SU4A 2EEKA 3ZZCA 1YLDA 4I33A 3P8OA 6CHAB 4MQAA 1SPJA 1FXYA 4TWYA 5C67A 2J95A 5JB9S 2PWXA 2ZKSA 3STIA 1CT2E 1HAHH 1GVZA 4Q7YA 5EXNA 3RXVA 1UHBA 2O8MA 2O8TA 4D9RA 1GDQA 2Y5GA 1K1OA 1VGCC 3SOSA 4IW4E 3UFAA 1OP0A 3RXKA 1QGFA 5DKMA 1UJ1A 2SGAA 4X1SU 3KN2A 2XBYA 4FUJA 1SGNE 1Y5UT 4ISOA 2XBXA 2ZPRA 4CRCA 4JK6A 2AIQA 2GT7A 2XC0A 3SBKA 1QA7A 3BEIB 4AFZA 1HJAC 2FESH 2J9NA 2Y7ZA 2R2MB 3SV8A 4UE7H 1OWIA 1TMTH 2UUKB 2ZTXA 3RXQA 4K8BA 1H9HE 1SL3A 3BTWE 4ZHMU 1O3LA 1G2LA 1P10A 1O2ZA 3BTME 3LGYA 5JDUB 1RRKA 1W2KH 2STAE 4A92A 1SSXA 4Y7BA 1XUKA 1T8MA 4OGYA 5HXFA 2J4IA 1O5BB 3ATWA 1O37A 2IJOB 1Z1JA 1PPHE 3GCHB 3RM2H 3BTDE 2FEQH 5GCHG 1HIAB 1MU8B 8GCHG 2QF3A 3AW1A 4BAHB 3SV2H 3SN8A 1NRSH 1YPGH 1F0RA 1EATA 1F5LA 3E90B 2FZZA 3P8FA 2ANMH 3B9FH 3LGIA 2BDIA 3UIRA 4ABGA 3IG6B 2XNIA 3RMNH 2BB4A 2G55A 1V3XA 1EAUA 1Y3UA 4Q7ZA 1ZZZA 1O2YA 3UNRA 1TAWA 1FY8E 1VITG 1BTWA 1N1LA 3GCNA 4K69A 1TGCA 2Q6GA 3PMAB 4M7GA 1ANDA 2SFAA 1LMWB 1ZPBA 5AFYH 1BB0B 2A2QH 1AGJA 1FQ3A 1PQ5A 2HVXA 4O3UA 1FPCH 1BMMH 3ELAH 2VGCC 2G81E 4I31A 1AUJA 1A46H 1BRCE 3MTYA 3E3TA 2BD5A 3NPSA 1TOCB 3LGWA 2Z9JA 4LK4A 3RLWH 1CVWH 4PROA 1BTXA 1KLJH 3A86A 3D49H 3U9AH 3K65B 1WCZA 2OBOA 1TNKA 3F9EA 1PQ8A 2I6QA 5K7RA 2A5AA 3UREA 3ZVFA 2ZIQH 4XOJA 1YPKH 1W7XH 2XTTB 3RXJA 2V3HH 3F9FA 1DVAH 1C5SA 7LPRA 3TH3H 2BOKA 1ELDE 1O3IA 3QUMP 2J2UA 3FZZA 4YLUA 1P2JA 3GY8A 2JH5D 3ENSB 2TGPZ 3SJ9A 3C1KA 4GPGA 2B5TB 2THFB 1XXFA 4SGAE 2TGAA 4YOIA 3U69H 4JK5A 1RIWB 5C20A 3IITA 3E91A 2FTLE 1GHWH 3OTJE 5GWZA 2A2XH 2F83A 2D2DA 4ZAEA 4O3TA 2A45B 2WINI 1MKXH 2ZFTA 1EOLA 2GCHG 4IN1A 3AVZA 3ATLA 2H6MA 1HPGA 1GG6C 1Z7KA 1BUIA 1L2EA 3BTGE 4ABEA 1F0TA 4NIWA 4X2VA 5A0CA 1SGEE 2BZ6H 1KXEA 2Y82A 2FPZA 4RKJB 1EP6A 1DOJA 1AIXH 2ZHFH 1BOQA 2SGPE 1UK2A 3SQEE 1GBJA 5TJXA 4J2YB 1HAGE 5DP4A 1DITH 2ZNKH 3RXAA 1J17T 1C1OA 3UY9A 7ESTE 4BANB 3EDXB 1IQGA 1O36A 1LQDB 1HYLA 2ZTYA 3UNQA 3LONA 4GLYA 1C2KA 3GY2A 2AEIH 4AX9H 1GBLA 1SQOA 2ZHEH 4Q7XA 4X0WU 1OPHB 4IC5A 1TOMH 2VJ1A 1C5WB 3MHWU 1O3MA 3SORA 1S83A 3DD2H 1JXPA 3PYHA 4X6NA 4AN7A 1W8BH 3URDA 2H9EH 2C90B 4UD9H 3W95A 2DE9A 4I8GA 2JETB 2VIQA 3AAUA 4MPVA 3S7HB 1L0ZA 3ZZ6A 2QXHA 4Z6AH 4NCYA 2UWPA 2BQWB 2PKSC 3TJUA 3RXHA 1LPZB 2BTCE 3SU6A 2AMPA 2EI7A 1FJSA 5E2OA 3VGCB 1HAVB 1DLKB 2ZHQH 5EOKA 4UEHH 1OOKB 1NN6A 1K28D 4E06H 1TX8A 1E0FD 3DT0H 2BDHA 1ZTLA 4F4OC 3RXOA 4NA8A 1O5AB 1C5TA 3SI3H 1FY4A 1MTSA 4IGDA 3A7XA 3M61U 2BDYA 1O5CB 3ATKA 3B8JA 4TYDA 2ZWLH 1QTFA 2P94A 5FBEA 1OWJA 2BDGA 3LIWA 5F6MA 1BA8B 4NWLA 1FONA 1SR5C 3H7OA 3LC3A 1C2LA 3MO6A 1L1NA 1ABJH 2P3FH 3BG4C 2GZ7A 1NO9H 4Y0ZE 2FOAA 1IQFA 3ODDA 1D3QB 1P9UA 1QB6A 3M7TA 3I77A 1ZJDA 1GMCG 3RXMA 4MNWA 1DWBH 1BTHH 5JBBS 1C5YB 3PMHB 1LO6A 1ANEA 1HIAA 4HTCH 3VB5A 1C2HA 2D1JA 2UUYA 3MNCA 2OC8A 1LHGH 3GCHC 1QR3E 3SUEA 2OC1A 1GBMA 1ZHPA 2OBQA 2D8WA 4BNRA 4I8JA 1THSH 5E2PA 1K1MA 1IHTH 1ZGIA 1TE0A 2A7CA 1DPOA 2GKVE 2HPPH 5L30H 4DIHH 3H7TA 1TGNA 2H9TH 2PTCE 2GDDA 1GJ4H 1WOFA 1TGTA 2GMTB 2AS9A 2FOGA 1UVOA 5EPYA 3TH2H 2ZFSA 1GMDF 2VNTA 4GCHF 3M7UA 7KMEH 1TQ7B 1EZUC 5FCKA 1G3DA 3V0XA 1HJ8A 1O3FA 4Y76A 1F0UA 1QBNA 4XE4A 4AOQA 3V7TA 2VH0A 5FPTA 5C5NA 3BSQA 1WAYB 2G00A 4ZMAH 5DJ7A 1EZXC 4IN2A 2BD7A 2ZU1A 4WH8A 2OCVB 1TA2A 1GBEA 1O2NA 1W0ZU 1T8OA 1MMJN 5FX6A 1TYNA 1D6WA 3TK6A 5ABWA 4Y0YE 4YESB 4BAKB 5I25A 1HRTH 2FX4A 4HZHA 2A32A 1AB9B 1K1PA 3TJOA 1QQ4A 1ELVA 2C93B 1ZYOA 1S82A 1OP2A 1XX9A 3WY8A 1O39A 1TPSA 2K1QA 1L4ZA 4GCHG 4O03A 1C5ZB 1SHYA 2OD3B 4BTIB 1L4DA 1NTPA 1P02A 3A82A 4VGCC 1HAOH 5DK1A 1DY9A 1GWAA 2WPHS 2Z9LA 3A84A 4GAWA 3EQ0H 3MNSA 1O2QA 1D9IA 4TWWA 3SNAA 4A6LA 4FUGA 1MUEB 2PTNA 3AAVA 1ZRKA 1BTPA 4AB8A 3QK1A 4IC6A 2A4OA 1ZMLA 2OXSA 3H5CB 1NROH 2F9NA 1EXFA 1OKXA 1EZQA 4X1PU 2BVXH 3A8AA 5EW2H 1TNJA 5EXLA 4KTUA 1DXWA 4MLFB 2YNAA 5JBAS 3B23B 3JZ2B 1O2WA 4HFPB 3AASA 2OQUA 4NGAH 3MOCA 4DT7B 3ODFA 1P2NA 1PFXC 3A80A 4JZIA 2ZGXH 4ZKOU 1DICA 4AFQA 2ZG0H 3ZV8A 3PB1E 5A2MH 1P04A 1UVSH 3MYWA 3CP7A 1EKBB 3KQEA 4Y8XA 3RXDA 3Q76A 1JBUH 1EOJA 1W12U 4K8YA 3SJIA 3KQBA 3GY4A 4YTAA 3BEUA 1GDUA 4HI3A 3M5LA 2BHGA 3DFJA 4WMFA 2V3OH 5FXLA 4YOJA 1HAPH 1GMHF 1C5QA 1WTGH
chains in the Genus database with same CATH superfamily
1BMAA 3Q3YA 5EU8A 3ZYDA 1KTSB 3FVFB 3ZZ5A 2VIDA 1DWDH 5T6GA 1D3TB 2EI6A 3UR6A 5C0TA 2WV4A 3BG8A 4OS5A 1LVOA 1P01A 4E7RG 2OC7A 4NA9H 3NUMA 1LCYA 1GDNA 2PUQH 2ZZUH 4RSPA 5I46H 4ISIH 6CHAC 1BBRK 1GI8B 1EB2A 2XYAA 1XVMA 5A0BA 1W0YH 3LH3A 4INLA 1GCTC 5C0UA 3SNCA 1C4V2 3MU8A 4QT8C 3AW0A 3A83A 5C3NA 2K8IA 1PJPA 1PPGE 1OSSA 1UCYK 1TQ0B 3T27A 2CF8H 2FODA 1S0RA 2XCFA 3HGPA 1TGBA 1QB9A 2ZI2H 1BZXE 1A1RA 1LKAA 3O8BA 1DUEA 1TX7A 2FOMB 5TCAA 3MU1A 3RXRA 1QJ1B 4CRFA 1EZSC 1GI6A 3U1IB 3MNXA 2GCTB 2RG3A 2ZEBA 3VEQB 3MMGA 3E8LA 4IMZA 1C1NA 3RXPA 1GBAA 1K9OE 1T8LA 5FBIA 4ESTE 4YLQH 5L2YH 2LPRA 1C5LH 1SQRA 2BLWA 4AB9A 3MI4A 1HAZB 1KXFA 1HAIH 1C5XB 1ELBA 1TFXA 4A1TA 1K21H 2ASUB 1PPZA 1BRBE 1AD8H 3QDZB 6ESTA 1W11U 3ZZDA 4UFGH 4LZ4B 4AG1A 3PROA 1Z6JH 1VJ9U 5HM9A 1DUAA 2QY0B 5DP8A 3GDVA 1OXGA 2Z3DA 3FP8E 5GPIB 3LC5A 4B73A 2AGEX 1LVYA 1CT0E 3K6YA 1Z1IA 1GHBG 1KXCA 4XBCA 3U1JB 1XUIA 1YCPK 1ZR0A 4K1TA 1ZSKA 3R3GB 4JMYA 3HKJB 1H8HD 2F9UA 3UB0A 3FZDA 4LZ1H 4E7NA 1AI8H 2WPDD 1KY9A 1W14U 3ATIA 4NIVA 3CNRA 1Z8IB 4RN6A 5CDFE 3K9XB 1TBZH 2BOHB 4ISHH 2PSYA 2Y7XA 2P59A 2OK5A 3GCTG 5PTPA 5JBTA 2IOTA 8KME2 1BMFD 1M9UA 4ZKNU 1MD8A 1SKYE 2XC4A 1S0QA 2AHME 2GZ8A 1S85A 2F4LA 1ZGVA 2W7SA 1O2RA 1VCWA 2OINA 3SW2B 2WHXA 3TLOA 1F92A 2GTBA 2VINA 2G4TA 3A87A 9ESTA 2QXGA 1UTJA 1V2LT 1IQMA 3TNTA 5IK2D 1W10U 2R2WU 1XMNB 4NWKA 5JYIA 3FP6E 1AVGH 1A5HA 1O5DH 3PV4A 2HPQH 4NZLA 3URCA 2FO9A 1NT1A 4FUEA 4TPYA 1N8OC 1OS8A 2CK3D 2BY8X 2M5TA 2Z7FE 1FMGA 3S9CA 3QGNB 2FTMA 1C2DA 1VR1H 2P16A 2FS9A 4GVUA 3OTPA 1FV9A 3BTQE 1SOTA 2ZDAH 2ZU2A 1ELEE 2SGQE 1QB1A 4Y7AA 3QGJA 1L1GA 3V3MA 3T5FH 2HLCA 4BOHA 5GIBA 4Y11E 1P2MA 2GD4B 1JRTA 1UTQA 1V2QT 2UWLA 3OY6U 1BTYA 1XKAC 1BDAA 5DP3A 2ZQ2A 3UWIA 5LPRA 3BV9B 1HUTH 1A7SA 1DX5M 1G36A 5HMAA 3ZZAA 5DG6A 1V2NT 1QA0A 2QF4A 1RS0A 1O2JA 3U98H 1DFPA 1S5SA 1RD3B 1YPJH 1RTFB 1TBQH 1HB0B 1GL0E 4WMDA 2HALA 1EB1H 3UQVA 1YLCA 1X7AC 1XUGA 1IQJA 1QIXB 1GBKA 1FN6A 1F7ZA 2TRMA 1BMNH 2W6JD 4K2YA 1IAUA 1LPGB 2UUJB 3TK9A 3MH5A 1V2UT 3RU4D 2BD3A 4UFFH 2NU0E 4A1VA 1NZQH 1TGSZ 2ANKH 1GJ6A 4GUXA 1CGJE 4I8LA 1EAWA 1O0DH 4AORA 1K1NA 2FOCA 1IQNA 4B74A 1SVPA 4MPXA 1DDJA 1E1RD 4ZROA 1FLEE 2G5VA 1GPZA 1NS3A 1TNHA 1FI8A 5AVDA 3SU2A 3VGCC 2J94A 2J98A 3TNSA 2C8WB 1V2KT 1ELAA 1GJBB 1MCTA 1V2MT 1YYY1 1DSTA 2ZA5A 4KELA 4Y71A 1YLNA 3A8BA 3E16B 4INHA 3TJNA 2VU8E 2FYRA 4XBDA 2WPKS 3ZZ8A 5T6FA 1HCGA 1P2QA 1O35A 2TGTA 2BQ6B 3EA9A 1FY3A 1BRUP 3EA8A 2Z3EA 1YPEH 4A5TS 1T4UH 1YPHC 5DP7A 1C5OH 4CBOA 1SGRE 3SJ8A 2GT8A 4MNXA 3SI4H 1CBWB 2PP6A 1AVWA 1T8NA 1NU9A 5G4BA 1NRPH 1MZDA 2P3UB 2JETC 1FN8A 5T6DA 1WBGB 3T28A 1TPOA 3LGTA 3SUGA 5EGMA 3HK3B 4MTBA 2R3UA 5J4QA 3P8NA 1NPMA 3RC5A 2PFEA 2A1DB 2BY6X 2FLRH 2RA0A 3HPTB 1OHHD 1G30B 2ZDNA 1GI9B 1ETTH 2VH6A 1TPPA 4K3JA 5FL7D 2FM2A 5AF9H 3ZVGA 2ZU4A 2FX6A 1G3EA 4Z1MD 1O33A 2Z9GA 1BCUH 2ANYA 1AFQC 2GMTC 1V2TT 3PM3A 1O2UA 1SLUB 3LGVA 1O2HA 1A61H 2VIVA 5F8TA 1P57B 1P05A 1UTPA 3FP7E 3EA7A 1THRH 3S69A 1HLTH 3M5OA 1O38A 1Q3XA 4ACBA 1G32B 1GHXH 1MU6B 2OTVA 1ARCA 4ZCNA 4FU7A 2EI8A 4OS1A 3EAJA 2AIPA 1ZMJA 4ZHAA 1C9TA 1HDTH 1O3GA 2A4QA 2R9PA 2BY7X 4MPWA 4AGJA 1ESBA 5SGAE 5DO4H 2ZPSA 3BN9A 2EC9H 3QWCH 2XOKD 2R3YA 1JIRA 4X8VH 2B7DH 1UVPA 1FIWA 1O2KA 1O2OA 3TU7H 3TJVA 4ABHA 8LPRA 1C2FA 1WTHD 1PYTC 1K1IA 1RTLA 2F9BH 1SGFA 3LDXH 1SGQE 1UTLM 5CHAC 3OE7D 4TT3D 4FVBA 1P3EA 3PWBA 3QX5H 4CH8B 2STBE 3K2UA 1SGIB 2XWAA 4O97A 2GCHF 3DFLA 1G3BA 1AY6H 2XWBI 1XUHA 2BXUH 1BRAA 1T4VH 3LKWA 1EASA 3SV7A 3TGKE 1C1SA 2XBWA 1J15A 2I6SA 1VGCB 1GI1A 4B71A 2Z94A 2H1UA 4CRAA 5CE1A 2AYWA 1MQ6A 2ODYB 3Q3KA 1C2JA 3QN7A 4BAQB 2J38A 3QTVH 3RC4A 1V2WT 3BEFB 4H6SB 4CHAB 2ZHWH 1CGIE 1MQ5A 2TIOA 4NFEA 2BDAA 1G9IE 1MAYA 1QNJA 3NZIA 3BTTE 4LXBH 3L3TA 4JYTA 1VITH 3VPKA 1BHXB 2BVSH 2ZQ1A 2H5CA 1T32A 1GGDC 1DT2A 1SOZA 9LPRA 1L1JA 2K0QA 2JKHA 4R8TB 1AUTC 4CBNA 1YCPH 2ZFFH 4WMEA 1IHSH 1ZLRA 1SFQB 1GJDB 2A5IA 4Y79A 3CENA 2GX4A 1BTZA 4JYVH 4WWYA 4BTUB 3RDZA 2GDEH 1CBWC 3T2NA 3SV6A 2WPLS 5FHTA 3RMLH 5A0AE 1TMUH 2BM2A 3GISB 1EJMA 1GJ9B 1Y59T 1V2RT 4OS7A 4XSKU 3MU5A 3NKKA 1B7XB 4Q80A 4AYVB 1AHTH 3DSGA 1W0KD 4WF8A 1GVLA 1GCDA 1NM6A 1WU1A 1BJVA 3GYMA 3ZVCA 2FIRH 2ZFQH 2BX4A 2ZFPH 1FUJA 1NBME 1WXRA 2QXIA 2VVCA 4BTTB 1SFIA 1CT4E 3PMJA 4AYYB 1E37B 1RJXB 4X2XA 3SU1A 3D62A 1OX1A 1JRSA 1DWCH 1GCTB 4X8UH 2C8ZB 2SGEE 2SGDE 1GJ8B 5BRRE 3NCLA 3BIUH 4DCDA 5HIZA 1TBRH 2BYAX 1KSNA 1SQAA 3M35A 3N7EA 3KQ5A 1C1MA 3S0NA 1B5GH 2BY9X 2Y81A 5JBCS 4DJZB 5T1VA 3KIDU 1N6YA 3M3VA 4FU8A 1F0SA 3OAAD 2CJIA 1GBTA 3SYJA 1FPHH 3BTFE 3PRBA 1CO7E 3ZVEA 3GY5A 3RLYH 1QRXA 1KXAA 3QO6A 4NIYA 2BD2A 4Q2KA 1BBRH 1ZPCA 4DGJA 2GCTC 1P09A 3VB7A 1FAKH 3UUZA 2OP9A 2HWLB 1K1LA 1AZ8A 3SQHE 1CSOE 3QZRA 1AFQB 4KP0A 4JZFH 1HXEH 4WY3A 1SGPE 1ARBA 2P8OC 3SNBA 1LHCH 2G5NA 3CS0A 2A7JA 1O2SA 4M9FA 4YZUA 2G8TA 2PUXB 2P3TB 3DA9B 1S6HA 1CA8B 4XFQA 3MH7A 4DVAU 4FXGH 3HK6B 3S9AA 3KQDA 2ODQA 2LELA 3F6UH 1S6FA 5GDSH 4ASUD 1Y3WA 2BVRH 1Z8JB 2GZ9A 1ZHMA 3TK5A 1O5EH 2SNWA 4VGCB 2H5DA 1KMHB 2DE8A 2A4GA 1YPHE 2IN2A 2R0KA 2ZCKP 4D7GA 2GP9B 1V2ST 2WV9A 3GS9A 4X6OA 3RUOA 4CHAC 1A0JA 4CH2B 4D7FA 4BAMB 1K22H 2PKAB 1AN1E 4CRDA 1C5MD 2NU2E 1D4PB 2PW8H 4E05H 2PGBB 2FI5E 3TH4H 1PPFE 3RC6A 3SUFA 5EIYA 1CQQA 2BLVA 1QJ6B 1BHXF 2C4FH 4FVDA 4Q63A 3SJOA 4X8SH 1ELCA 1P11E 2QN5T 2VB0A 5FAHA 3GDSA 2YMSC 3I29A 1C2GA 2ZC9H 2BDBA 1E34B 3U8TH 4RT0A 3EGKH 3STJA 1UO6A 1XKBC 1EJNA 1NESE 3SU5A 2P93A 1YP9A 1ETRH 3M5MA 4MG3A 2IJD1 1PQ7A 1ZSJA 3D65E 4JZEH 4GHTA 2VWOA 3RXSA 4FUFA 3L6PA 4BXWA 1GMHG 1C5NH 1C1UH 1ZMNA 4NFFA 1BIOA 4AFUA 2ZO3H 3O8CA 3KF2A 4B2BA 1PYTD 2VGCB 1Z71A 4X1RU 3P8GA 3P95A 3VXEH 1RIWC 1KTTB 1B0EA 1D6RA 1JIMA 1SGCA 1QL7A 3KEEA 4KTSA 1HV7A 1NC6A 1C4U2 3RP2A 1Y3XA 1YWUA 2UUFB 1FIZA 4Y10E 5EJZA 2CHAC 1B0FA 1AWFH 4Y8YA 1KXBA 1YCPM 1GBBA 1MTUA 1EPTB 1QFKH 7GCHF 1XVOA 1GHAF 3DSPA 1AZZA 1CE5A 4CREA 1TLDA 1BBRE 1O2GH 2AERH 2ZCHP 3DUXH 3LOXA 3N7DA 3PWCA 1K0HA 5A8ZA 2SGFE 4D8NA 6LPRA 1DSUA 3F2FA 1PQAA 4B76A 2J34A 1A5GH 5ESBA 3EE7A 1YF4A 1K1JA 2LP6A 3FAOA 1UTNA 2ZDKA 1A0HB 3DSOA 1O3AA 5EODA 1RFNA 1VCQA 4U32A 4DG4A 2HOBA 1BMLA 2GGVB 2V7QD 1T7CA 4X6PA 1C1PA 4FUDA 4ZKSU 2WPIS 1O30A 5HYOA 1MZAA 1CHOF 1GHZA 5T3HA 1ORFA 4MDSA 1AVXA 1S84A 5TCCA 1TRMA 5DP9A 3HGNA 4NSYA 1TRYA 2HGTH 1LDTT 2C3SA 3GCTF 3KNXA 3M5NA 2UWOA 5HGGA 2AFQB 4ABJA 2ZGHA 2B9LA 1KIGH 1N8OB 4WH6A 2H2ZA 1O3KA 4WVPE 4OGXA 1MTWA 1O31A 1TWXB 3RXUA 1HFDA 3UOUA 2ZTZA 5B6OA 1LQEA 4NZQA 2KCYA 4ZHLU 3LPRA 1SLXB 1A5IA 4GHQA 1GJCB 3W1EA 6GCHF 1O3CA 3O8RA 1ZTJA 1W13U 2ZFRH 5FPYA 3UQOA 1O3BA 2VWMA 4MVNA 3A8DA 1MTVA 2ULLA 1GI7B 4ABAA 1IOEA 1BQYA 1P0SH 1EQ9A 1VZQH 2WPMS 1W3CA 3MNBA 5J4SA 3P92A 1NRRH 5EQRA 2QCYA 4P02A 3ZYEA 3OYPA 2TGDA 1HAVA 2AGIX 3PO1C 3UR9A 8GCHF 3KGPA 1SGDE 3F2HA 3I78A 4U01A 5BPEA 1J16A 1ZTKA 3U8RH 3SV9A 1OWKA 3M3TA 1AO5A 2XCNA 2GJGA 3BF6H 4RT1A 1FY1A 4B75A 1C5VA 5IYTA 1SHHB 3F68H 1C9PA 4X6MA 1CU1A 2NWNA 5F8XA 3SHCH 3SO3A 2HLDD 1O2LA 2WSSD 3GICB 1MH0A 2GVFA 2VIWA 2QF0A 3VB4A 5HKKD 2LNCA 5DP5A 1W7GH 3A8CA 2QC2A 2RDEA 3BIVH 2Q6DA 3JZ1B 3F9GA 5DPAA 1O2TA 4P00A 1NBMD 4AG2A 3PLPA 1YY3A 4CRBA 3BTEE 2ANWA 3UPEA 1MKWK 5KECA 2ZECA 3IWMA 3VB6A 5A8YA 4BXSA 2CF9H 3QLPH 1O3EA 5ETXA 1GBDA 2M2AA 1FAXA 1HJAB 1HAYB 2AMQA 4A1XA 1J9CH 1A3BH 3A85A 3PTNA 1MD7A 1FY5A 5LPFA 3RXEA 3MFJA 1INCA 1EPTC 1GBFA 2P8OB 1GMCF 4XD7D 3RXBA 2FS8A 2XBVA 2ZGJA 3NWUA 1O2PA 1WSSH 4AFSA 4DIIH 1JMOH 4A7IB 4ZXXH 3F2GA 2QV1A 1C1TA 3A7TA 3A88A 1YGCH 1HNEE 4X1QU 4JCNA 4ACAA 1C2MA 1KLTA 2CXVA 2G51A 1YC0A 1GBCA 1ZPZA 2ZU5A 1KXDA 1TMBH 1ELTA 5HM2A 2EY4C 3PV2A 3BG4B 2B0FA 3S9BA 3N7OA 1SC8U 1XUFA 2SNVA 1ZOMA 2ILNA 3EYDA 3GOVB 5E8EH 2FOFA 3PLBA 3WWFA 4CR9A 4IS5A 1SGTA 1TA6A 3M36A 1C1WH 1QQUA 3ZZ4A 2ZHDA 3ZZBA 4DOQA 2Q1JA 2KAIA 3SNDA 1SBWA 3O8DA 4UONA 1H8DH 2WUBA 1C5RA 1O2IA 4O9VA 2WYGA 2R0LA 3SJKA 1Y5AT 4TSFD 2J97A 3DCLA 1YM0A 4CRGA 1GVKB 5EW1H 1LPKB 2BD9A 3OEED 5F03A 1O32A 2YMSB 1ID5H 1BJUA 4HGCA 3UTUH 5C5OA 1TX6A 2PGQB 1E36B 1EAXA 1AE8H 5L2ZH 2EA3A 3A7VA 1UMAH 1UK4A 3OU0A 2G52A 2O8WA 3BTHE 1WYKA 1ELFA 4INKA 1KDQA 2FOBA 3GCOA 3QTOH 3MO9A 1Q31A 1A3EH 2PSXA 3UAIC 1P8VC 1C1RA 5CHAB 2Y5HA 2VIPA 2XXLA 3GY3A 3Q00A 5DGJA 3T62A 4FUIA 4OS2A 4GSOA 3T29A 2ZGBH 5AFZH 5C1UA 2WPJS 1UTKA 3EE0B 1QRWA 1YPLH 2A5KA 1P06A 2PHBA 5K0HA 3C27B 3RXGA 3T25A 1CGHA 4B6EA 3TGIE 3M3SA 2W3KA 4K1SA 1QBOA 3ITIA 4FUCA 4JYUH 6GCHG 1C2EA 4RKOB 1GJ5H 2CGAA 2FI4E 1OP8A 4Z0KA 3ZVDA 4FOUC 1A0LA 1TABE 1CHGA 3ATMA 1HBTH 4Y8ZA 3PO1B 2HRVA 1Y3VA 1D3PB 4DURA 2YNBA 4ZH8A 1O5GH 2J98B 1O3DA 1Z8RA 3TITA 2W7UA 2QYIA 3GDUA 1EAIA 1PPCE 3P6ZB 4NSVA 3ZZ7A 1QHRB 4K1EA 1V2PT 1QZ8A 1O3NA 1UVUH 2F9PA 3FANA 1LTOA 4K5ZA 2O9QA 2J92A 3F0OA 4K60A 5L6NH 3VFEA 2CN0H 1SLWB 2VVUA 2ZDLA 1OWHA 3K6ZA 3VG8A 1GHVH 1F5RA 3F1SB 3G01A 4X2YA 1DANH 1GJ7B 3DHKH 3MH4A 5ESTE 2FLBH 3ESTA 1CA0B 2JJ1D 1C1VH 2C8YB 2VWNA 5FX5A 2PV9B 5EQSA 3OFND 3PMBB 4I32A 1H4WA 2QGRA 2L6OA 4OS6A 1IQHA 2F9VA 2BLQA 4XDEA 4ZUHA 2QA9E 5A09A 1BT7A 1EJAA 5IDKA 3OSYA 1UHBB 2OC0A 1TB6H 2KZ4A 3BTKE 3RXLA 2IPHA 2A31A 1HXFH 1ELGA 4FUHA 2BMGB 2ZCLP 1P2IA 3KHVA 1H9IE 1O2MA 3LJOA 4D9QA 4OS4A 2A7HA 1QY6A 1GMDG 3LU9B 3UWJH 2FXRA 4ASHA 3SU3A 4YT7H 2QXJA 2FYQA 5H4IB 2W6ID 1P03A 2C8XB 1LHDH 1LHEH 4CR5A 3LJJA 3RMOH 2AGGX 2PKSB 1P3CA 4Y6DA 4NIXA 3P70B 2XRCA 1TNIA 1VITF 1XM1A 4D76A 2WZQA 3ZVAA 1WV7H 1JWTA 2NU3E 1U6QA 4DW2U 1EP5A 2D26C 3PLKA 4KKDA 2AH4X 2B8OH 1DE7H 4AZ2B 2FMJA 5DP6A 1SB1H 1WQVH 4NG9H 3RMMH 1DM4B 4UDWH 1TRNA 5LPEA 1AKSB 1ZHRA 3R0FA 1XUJA 5F53A 2OLGA 4IMQA 1NY22 1Y5BT 2Z3CA 2XNDD 1DXPA 3MU4A 2FI3E 4F48B 2F91A 2GV7A 5C2ZA 4AC9A 1ANBA 1GG6B 1O2XA 2HVYB 1LVBA 4ZKRU 2KCPA 4ABBA 3A7ZA 5EQQA 2A4RA 2Z9KA 1QL8A 3RXTA 1UTOA 5CMXH 1SG8B 2O8LA 2RDLA 1UK3A 3SGAE 3RU4T 1FZZA 3NXPA 4TPIZ 1WUNH 4MPUA 1GBIA 3MWIU 3HKIB 4U2WA 1O2VA 2FP7B 2BD4A 4ABDA 3D23A 4J1YA 1O3JA 2ZF0H 3TGJE 4OM9A 1OYTH 1TIOA 4KTCA 5B6LA 5GXPA 1DWEH 2XW9A 3ZZ3A 4JZDH 1V2JT 1FNIA 3RXFA 4UFDH 2W26A 3MQKC 2F3CE 3E6PH 1MBMA 2XC5A 3RM0H 1MKXK 3GYLB 3KCGH 1H1BA 1HGTH 4ISLA 1G37A 1T31A 2NU1E 1ZRBA 2OUAA 1RTKA 5FPSA 2VIOA 1ACBE 1Z8GA 4NA7A 1TNLA 2V6NA 2ALPA 2TBSA 1A4WH 2G4UA 4DY7B 1MAXA 1SLVB 2BX3A 1ESAA 3UOPA 1C5PA 1COWD 1DLEA 4H6TA 3TPIZ 1UTMA 3QZQA 5EPNA 4B2AA 4YOGA 1E1QD 3A81A 4SGBE 1H9LB 1E38B 1SGFG 1GI3A 1E35B 2NU4E 1DS2E 1P12E 1O34A 1V6DA 1TONA 1EPTA 1EX3A 5EJ1A 5KEDA 1AB9C 1KLIH 5JB8S 3W94A 1QURH 1TPAE 1YKTA 4F49A 1S81A 2TPIZ 2CV3A 3RXIA 4X8TH 1NRNH 1GI0A 2FOHA 2RA3A 2BD8A 2H9HA 3E1XB 1OWEA 2FOEA 1IQIA 1H8IH 3OX7U 4JZ1A 4I86A 1C2IA 3SHAH 2FDAA 1AQ7A 4TY6A 3SGQE 2KAIB 2Q6FA 3L33A 1Y8TA 3FFGA 4I8HA 2ALVA 1OYQA 2Y6TA 1MTNC 4THNH 5C1YA 5LGOA 5F8ZA 1IQEA 3KYFA 1QL9A 3S7KB 1J8AA 2PLXA 1G2MA 2BY5X 1NRQH 1ETSH 1PPBH 3U28C 2HNTC 4WXVA 3CS7A 4WJG2 1SQTA 3M7QA 3V12A 5C94A 2A0QB 2ZPQA 1FX0B 2W3IA 2YOLA 1O3HA 2HNTF 2PR3A 3GY7A 1G3CA 4WXIA 2ESTE 4FETA 2VWLA 3VB3A 5LH8A 2ZDVH 1GI5A 1THPB 3TVJB 3SUDA 1NFYA 2ZU3A 2P95A 1PPEE 3HATH 2WUCA 1NFUA 4BAOB 2PKAA 4ZXYH 3OEHD 1FDPA 3Q77A 2BXTH 5FCRA 2ODPA 3E0NB 3V13A 3PRDA 1RXPA 1TALA 5AHGH 1GI2A 1P2OA 2BZAA 4U30A 1QBVH 2WYJA 4YM9A 1SGYE 1O5FH 2WV5A 1XXDA 2Y80A 1J14A 1MKWH 2O8UA 1N6XA 4XRNA 4H42U 1HJ9A 1MBQA 1Q2WA 2BDCA 1GHBF 2W5EA 3A7YA 1VJAU 3U8OH 3M37A 5E0GA 1GL1A 1NFXA 1A2CH 1Z6EA 2AMDA 3SU0A 4KGAA 2BLOA 1D3DB 2KX4A 1F5KU 2JIZD 1ZSLA 1EFRD 3RXCA 4Q4LA 1CA0C 1E79D 1BTUA 1UVTH 4ISNA 4YO9A 3AK5A 1V2VT 1AFEH 4X1NU 4MNVA 1NU7B 1C4Y2 3T26A 1YBWA 2CHAB 2V35A 4FUBA 3PTBA 2V0BA 1QCPA 5E0HA 2JH6D 4X2WA 1AE5A 1IQKA 3N99A 1AWHB 1EUFA 3ZZ9A 1C1QA 3MU0A 4RI0A 1P9SA 2OQ5A 5C1XA 4ABIA 3LH1A 4I7YH 1Y3YA 2Z6BD 1WQSA 3F3BA 3TIUA 1K2I1 2J5UA 1LVMA 2ZP0H 3KL6A 1QJ7B 4FU9A 1GJAB 1ESTA 3SGBE 3E0PB 3SNEA 1KYNA 1ANCA 2JJ2D 1LKBA 1IQLA 1LHFH 2JH0D 1GBHA 3UNSA 1VCPA 1AMHA 1OWDA 5GJ4B 1SI5H 3MH6A 4I8KA 2QIQA 1VKYA 2CMYA 1GHAG 3A89A 5GCHF 4MNYA 2RFKC 1GGDB 4IBLH 4B1TA 3ZV9A 2VBCA 3A7WA 3NK8A 2RCEA 1O3OA 3F9HA 1DY8A 5EG4A 3RU4E 2BQ7B 1SMFE 4AGKA 8ESTE 2F9OA 5JPMH 2KM0A 2DUCA 1AKSA 1ZJKA 1F2SE 1HAXB 3GY6A 1V2OT 1TNGA 2Y5FA 1P2KA 1MCVA 2FWWA 1JOUB 4UFEH 1CHOG 3OY5U 3SZNA 3VXFH 4B2CA 1KDQB 1MTNB 1NFWA 2VVVA 1UCYH 2ZDMA 2ZGCA 3ZVBA 4LOYH 3Q3XA 5E0JA 1O3PB 3P17H 1QRZA 1BITA 5C17A 1YPMH 4TY7A 4H4FA 1GHYH 3KYGA 2HNTE 1GI4A 5GNDA 5EXMA 1UCYE 4ABFA 2QAAA 1AU8A 3LGUA 2Z9IA 3LT3A 5A8XA 4YT6H 4R0IA 7GCHG 1C5UA 3MO3A 2GV6A 3KQCA 1ABIH 1RGQA 4XBBA 3SU4A 2EEKA 3ZZCA 1YLDA 4I33A 3P8OA 6CHAB 4MQAA 1SPJA 1FXYA 4TWYA 5C67A 2J95A 5JB9S 2PWXA 2ZKSA 3STIA 1CT2E 1HAHH 1GVZA 4Q7YA 5EXNA 3RXVA 1UHBA 3NRLA 2O8MA 2O8TA 4D9RA 1GDQA 2Y5GA 1K1OA 1VGCC 3FOAA 3SOSA 4IW4E 3UFAA 4YXWD 1OP0A 3RXKA 1QGFA 5DKMA 1UJ1A 2SGAA 4X1SU 4B6FA 3KN2A 2XBYA 4FUJA 1SGNE 1Y5UT 4ISOA 2XBXA 2ZPRA 4CRCA 4JK6A 2AIQA 2GT7A 2XC0A 3SBKA 1QA7A 3BEIB 4AFZA 1HJAC 2FESH 2J9NA 2Y7ZA 3WW7A 2R2MB 3SV8A 4UE7H 1OWIA 1TMTH 2UUKB 2ZTXA 3RXQA 4K8BA 1H9HE 1SL3A 3BTWE 4ZHMU 1O3LA 1G2LA 1P10A 1O2ZA 3BTME 3WWBA 3FO8D 3LGYA 5JDUB 1RRKA 1W2KH 2STAE 4A92A 1SSXA 4Y7BA 1XUKA 1T8MA 4OGYA 5HXFA 2J4IA 1O5BB 3ATWA 1O37A 2IJOB 1Z1JA 1PPHE 3GCHB 3RM2H 3BTDE 2FEQH 5GCHG 1HIAB 1MU8B 8GCHG 2QF3A 3AW1A 4BAHB 3SV2H 5DN6D 3SN8A 1NRSH 1YPGH 1F0RA 1EATA 1F5LA 3E90B 2FZZA 2L74A 3P8FA 2ANMH 3B9FH 3LGIA 2BDIA 3UIRA 4ABGA 3IG6B 2XNIA 3RMNH 2BB4A 2G55A 1V3XA 1EAUA 1Y3UA 4Q7ZA 3PV5A 1ZZZA 1O2YA 3UNRA 1TAWA 1FY8E 1VITG 1BTWA 1N1LA 3GCNA 4K69A 1TGCA 2Q6GA 3PMAB 4M7GA 1ANDA 2SFAA 1LMWB 1ZPBA 5AFYH 1BB0B 2A2QH 1AGJA 1FQ3A 1PQ5A 2HVXA 4O3UA 1FPCH 1BMMH 3ELAH 2VGCC 2G81E 4I31A 1AUJA 1A46H 1BRCE 3MTYA 3E3TA 2BD5A 3NPSA 5CHBA 1TOCB 3LGWA 2Z9JA 4LK4A 3RLWH 3H09A 1CVWH 4PROA 1BTXA 1KLJH 3A86A 3D49H 3U9AH 3K65B 1WCZA 2KFWA 2OBOA 1TNKA 4DT4A 3F9EA 1PQ8A 2I6QA 3FN8A 5K7RA 2A5AA 3UREA 3ZVFA 2ZIQH 4XOJA 1YPKH 1W7XH 2XTTB 3RXJA 2V3HH 3F9FA 1DVAH 1C5SA 7LPRA 1WDIA 2BOKA 3TH3H 1ELDE 1O3IA 3QUMP 2J2UA 3FZZA 4YLUA 1UW7A 1P2JA 3GY8A 2JH5D 3ENSB 2TGPZ 3SJ9A 3C1KA 4GPGA 2B5TB 2THFB 1XXFA 4SGAE 2TGAA 4YOIA 1S6LA 3U69H 4JK5A 1RIWB 5C20A 3IITA 3E91A 2FTLE 1GHWH 3OTJE 1MABB 5GWZA 2A2XH 2F83A 2D2DA 4ZAEA 4O3TA 2A45B 1MKXH 2WINI 2ZFTA 1EOLA 2GCHG 4IN1A 3AVZA 3ATLA 2H6MA 1HPGA 1GG6C 1Z7KA 1BUIA 1L2EA 3BTGE 4ABEA 2QE7D 1F0TA 4NIWA 4X2VA 5A0CA 1SGEE 2BZ6H 1KXEA 2Y82A 2FPZA 4RKJB 1EP6A 1DOJA 1AIXH 5HIYA 2ZHFH 1BOQA 2SGPE 1UK2A 3SQEE 1GBJA 5TJXA 4J2YB 1HAGE 5DP4A 1DITH 2ZNKH 3RXAA 1J17T 1C1OA 3UY9A 2KCOA 7ESTE 4BANB 3EDXB 1IQGA 1O36A 1LQDB 1HYLA 2ZTYA 3UNQA 3LONA 4GLYA 1C2KA 3GY2A 2AEIH 4AX9H 1GBLA 1SQOA 2ZHEH 4Q7XA 4X0WU 1OPHB 4IC5A 1TOMH 2VJ1A 1C5WB 3MHWU 1O3MA 3SORA 1S83A 3DD2H 1JXPA 3PYHA 4X6NA 4AN7A 1W8BH 3URDA 2H9EH 2C90B 4UD9H 3FKSD 2F43B 3W95A 2DE9A 4I8GA 5DSFA 2JETB 2VIQA 3AAUA 4MPVA 3S7HB 1L0ZA 3ZZ6A 2QXHA 4Z6AH 4NCYA 2UWPA 2BQWB 2PKSC 2YMSD 3TJUA 2JDID 3RXHA 1LPZB 2BTCE 3SU6A 2AMPA 2EI7A 1FJSA 5E2OA 3VGCB 1HAVB 1DLKB 2ZHQH 5EOKA 4UEHH 1OOKB 1NN6A 1K28D 4E06H 1TX8A 1E0FD 3DT0H 2BDHA 1ZTLA 4F4OC 3RXOA 4NA8A 1O5AB 1C5TA 3SI3H 1FY4A 1MTSA 4IGDA 3A7XA 1H8ED 3M61U 2BDYA 1O5CB 3ATKA 3B8JA 4TYDA 4HG6A 2ZWLH 2P94A 1QTFA 5FBEA 1OWJA 2BDGA 3LIWA 5F6MA 1BA8B 4NWLA 1FONA 1SR5C 5KGOA 2EQNA 3H7OA 3LC3A 1C2LA 3MO6A 1L1NA 1ABJH 2P3FH 3BG4C 2GZ7A 1NO9H 4Y0ZE 2FOAA 1IQFA 3ODDA 1D3QB 1P9UA 1QB6A 3M7TA 3I77A 1ZJDA 1GMCG 3RXMA 4MNWA 2KR7A 1DWBH 1BTHH 5JBBS 1C5YB 3PMHB 1LO6A 1ANEA 1HIAA 4HTCH 3VB5A 1C2HA 2D1JA 2UUYA 3MNCA 2OC8A 1LHGH 3GCHC 1QR3E 3SUEA 2OC1A 1GBMA 1ZHPA 2OBQA 2D8WA 2KCAA 4BNRA 4I8JA 1THSH 5E2PA 1K1MA 1IHTH 1ZGIA 1TE0A 2A7CA 1DPOA 2GKVE 2HPPH 5L30H 4DIHH 3H7TA 1TGNA 2H9TH 2PTCE 2GDDA 1GJ4H 1WOFA 1TGTA 2GMTB 2AS9A 2FOGA 1UVOA 5EPYA 3TH2H 2ZFSA 1GMDF 2VNTA 4GCHF 3M7UA 7KMEH 1TQ7B 1EZUC 5FCKA 1G3DA 3V0XA 2V3MA 1HJ8A 1O3FA 4Y76A 1F0UA 1QBNA 4XE4A 4AOQA 3V7TA 2VH0A 5FPTA 5C5NA 3BSQA 1WAYB 2G00A 4ZMAH 5DJ7A 1EZXC 4IN2A 2BD7A 2ZU1A 4WH8A 2OCVB 1TA2A 1GBEA 1O2NA 1W0ZU 1T8OA 1MMJN 5FX6A 1TYNA 1D6WA 3TK6A 3SZEA 5ABWA 4Y0YE 4YESB 4BAKB 5I25A 1HRTH 2FX4A 4HZHA 2A32A 1AB9B 1K1PA 3TJOA 1QQ4A 1ELVA 2C93B 1ZYOA 1S82A 1OP2A 1XX9A 3WY8A 1O39A 1TPSA 2K1QA 1L4ZA 4GCHG 4O03A 1C5ZB 1SHYA 2OD3B 4BTIB 1L4DA 1NTPA 1P02A 3A82A 4VGCC 1HAOH 5DK1A 1DY9A 1GWAA 2WPHS 2Z9LA 3A84A 4GAWA 3EQ0H 3MNSA 1O2QA 1D9IA 4TWWA 3SNAA 4A6LA 4FUGA 1MUEB 2PTNA 3AAVA 1ZRKA 1BTPA 4AB8A 3QK1A 4IC6A 2A4OA 1ZMLA 2OXSA 3H5CB 1NROH 2F9NA 1EXFA 1OKXA 3F0PA 1EZQA 4X1PU 2BVXH 3A8AA 3ZIAD 5EW2H 1TNJA 5EXLA 4KTUA 1DXWA 4MLFB 1W0JD 2YNAA 4F55A 5JBAS 3B23B 3JZ2B 1O2WA 2QF5A 4HFPB 3AASA 2IPQX 2OQUA 4NGAH 3MOCA 4DT7B 3ODFA 1P2NA 1PFXC 3A80A 4JZIA 2ZGXH 4ZKOU 1DICA 4AFQA 2ZG0H 3ZV8A 3PB1E 5A2MH 1P04A 1UVSH 3MYWA 3CP7A 1EKBB 3KQEA 4Y8XA 3RXDA 3Q76A 1JBUH 1EOJA 1W12U 4K8YA 3SJIA 3KQBA 3GY4A 4YTAA 3BEUA 1GDUA 4HI3A 3M5LA 2BHGA 3DFJA 4WMFA 2V3OH 5FXLA 4YOJA 1HAPH 1GMHF 1C5QA 1WTGH 5EJLA
chains in the Genus database with same CATH topology
1BMAA 3Q3YA 5EU8A 3ZYDA 1KTSB 3FVFB 3ZZ5A 2VIDA 1DWDH 5T6GA 1D3TB 2EI6A 3UR6A 2WV4A 3BG8A 4OS5A 1LVOA 1P01A 4E7RG 2OC7A 4NA9H 3NUMA 1LCYA 1GDNA 2PUQH 2ZZUH 4RSPA 5I46H 4ISIH 6CHAC 1BBRK 1GI8B 1EB2A 2XYAA 1XVMA 5A0BA 1W0YH 3LH3A 4INLA 1GCTC 3SNCA 1C4V2 3MU8A 4QT8C 3AW0A 3A83A 5C3NA 1PJPA 1PPGE 1OSSA 1UCYK 1TQ0B 3T27A 2CF8H 2FODA 1S0RA 2XCFA 3HGPA 1TGBA 1QB9A 2ZI2H 1BZXE 1A1RA 1LKAA 3O8BA 1DUEA 1TX7A 2FOMB 5TCAA 3MU1A 3RXRA 1QJ1B 4CRFA 1EZSC 1GI6A 3U1IB 3MNXA 2GCTB 2RG3A 2ZEBA 3VEQB 3MMGA 3E8LA 4IMZA 1C1NA 3RXPA 1GBAA 1K9OE 1T8LA 5FBIA 4ESTE 4YLQH 5L2YH 2LPRA 1C5LH 2BLWA 4AB9A 3MI4A 1HAZB 1KXFA 1HAIH 1C5XB 1ELBA 1TFXA 4A1TA 1K21H 2ASUB 1PPZA 1BRBE 1AD8H 3QDZB 6ESTA 1W11U 3ZZDA 4UFGH 4LZ4B 4AG1A 3PROA 1Z6JH 1VJ9U 5HM9A 1DUAA 2QY0B 5DP8A 3GDVA 1OXGA 2Z3DA 3FP8E 5GPIB 3LC5A 4B73A 2AGEX 1LVYA 1CT0E 3K6YA 1Z1IA 1GHBG 1KXCA 4XBCA 3U1JB 1XUIA 1YCPK 1ZR0A 4K1TA 1ZSKA 3R3GB 4JMYA 3HKJB 2F9UA 3FZDA 4LZ1H 4E7NA 1AI8H 1KY9A 1W14U 3ATIA 4NIVA 4RN6A 1Z8IB 3K9XB 1TBZH 2BOHB 4ISHH 2PSYA 2Y7XA 2P59A 3GCTG 5PTPA 5JBTA 2IOTA 8KME2 1M9UA 4ZKNU 1MD8A 2XC4A 1S0QA 2GZ8A 1S85A 1ZGVA 2W7SA 1O2RA 1VCWA 2OINA 3SW2B 3TLOA 1F92A 2GTBA 2VINA 2G4TA 3A87A 9ESTA 2QXGA 1UTJA 1V2LT 1IQMA 3TNTA 1W10U 2R2WU 1XMNB 4NWKA 5JYIA 3FP6E 1AVGH 1A5HA 1O5DH 3PV4A 2HPQH 4NZLA 3URCA 2FO9A 1NT1A 4FUEA 4TPYA 1N8OC 1OS8A 2BY8X 2M5TA 2Z7FE 1FMGA 3S9CA 3QGNB 2FTMA 1C2DA 1VR1H 2P16A 2FS9A 4GVUA 1FV9A 3BTQE 1SOTA 2ZDAH 2ZU2A 1ELEE 2SGQE 1QB1A 4Y7AA 3QGJA 1L1GA 3V3MA 3T5FH 2HLCA 4BOHA 5GIBA 4Y11E 1P2MA 2GD4B 1JRTA 1UTQA 1V2QT 2UWLA 3OY6U 1BTYA 1XKAC 1BDAA 5DP3A 2ZQ2A 3UWIA 5LPRA 3BV9B 1HUTH 1A7SA 1DX5M 1G36A 5HMAA 3ZZAA 5DG6A 1V2NT 1QA0A 1RS0A 1O2JA 3U98H 1DFPA 1S5SA 1RD3B 1YPJH 1RTFB 1TBQH 1HB0B 1GL0E 4WMDA 2HALA 1EB1H 3UQVA 1YLCA 1X7AC 1XUGA 1IQJA 1QIXB 1GBKA 1FN6A 1F7ZA 2TRMA 1BMNH 4K2YA 1IAUA 1LPGB 2UUJB 3TK9A 3MH5A 1V2UT 3RU4D 2BD3A 4UFFH 2NU0E 4A1VA 1NZQH 1TGSZ 2ANKH 1GJ6A 4GUXA 1CGJE 4I8LA 1EAWA 1O0DH 4AORA 1K1NA 2FOCA 1IQNA 4B74A 1SVPA 4MPXA 1DDJA 4ZROA 1FLEE 2G5VA 1GPZA 1NS3A 1TNHA 1FI8A 5AVDA 3SU2A 3VGCC 2J94A 3TNSA 2C8WB 1V2KT 1ELAA 1GJBB 1MCTA 1V2MT 1YYY1 1DSTA 2ZA5A 4KELA 4Y71A 3A8BA 3E16B 4INHA 3TJNA 2VU8E 2FYRA 4XBDA 2WPKS 3ZZ8A 5T6FA 1HCGA 1P2QA 1O35A 2TGTA 2BQ6B 3EA9A 1FY3A 1BRUP 3EA8A 2Z3EA 1YPEH 4A5TS 1T4UH 1YPHC 5DP7A 1C5OH 4CBOA 1SGRE 3SJ8A 2GT8A 4MNXA 3SI4H 1CBWB 1AVWA 1T8NA 1NU9A 5G4BA 1NRPH 1MZDA 2P3UB 2JETC 1FN8A 5T6DA 1WBGB 3T28A 1TPOA 3LGTA 3SUGA 5EGMA 3HK3B 4MTBA 2R3UA 5J4QA 3P8NA 1NPMA 3RC5A 2PFEA 2A1DB 2BY6X 2FLRH 2RA0A 3HPTB 1G30B 2ZDNA 1GI9B 1ETTH 2VH6A 1TPPA 4K3JA 5AF9H 2FM2A 3ZVGA 2ZU4A 2FX6A 1G3EA 1O33A 2Z9GA 1BCUH 2ANYA 1AFQC 2GMTC 1V2TT 3PM3A 1O2UA 1SLUB 3LGVA 1O2HA 1A61H 2VIVA 5F8TA 1P57B 1P05A 1UTPA 3FP7E 3EA7A 1THRH 3S69A 1HLTH 3M5OA 1O38A 1Q3XA 1G32B 1GHXH 1MU6B 2OTVA 1ARCA 4FU7A 2EI8A 4OS1A 3EAJA 2AIPA 1ZMJA 4ZHAA 1C9TA 1HDTH 1O3GA 2A4QA 2R9PA 2BY7X 4MPWA 4AGJA 1ESBA 5SGAE 5DO4H 2ZPSA 3BN9A 2EC9H 3QWCH 2R3YA 1JIRA 4X8VH 2B7DH 1UVPA 1FIWA 1O2KA 1O2OA 3TU7H 3TJVA 4ABHA 8LPRA 1C2FA 1WTHD 1PYTC 1K1IA 1RTLA 2F9BH 1SGFA 3LDXH 1SGQE 1UTLM 5CHAC 4FVBA 1P3EA 3PWBA 3QX5H 4CH8B 2STBE 3K2UA 1SGIB 2XWAA 4O97A 2GCHF 3DFLA 1G3BA 1AY6H 2XWBI 1XUHA 2BXUH 1BRAA 1T4VH 3LKWA 1EASA 3SV7A 3TGKE 1C1SA 2XBWA 1J15A 2I6SA 1VGCB 1GI1A 4B71A 2Z94A 2H1UA 4CRAA 5CE1A 2AYWA 1MQ6A 2ODYB 3Q3KA 1C2JA 3QN7A 4BAQB 2J38A 3QTVH 3RC4A 1V2WT 3BEFB 4H6SB 4CHAB 2ZHWH 1CGIE 1MQ5A 2TIOA 4NFEA 2BDAA 1G9IE 1MAYA 1QNJA 3NZIA 3BTTE 4LXBH 3L3TA 4JYTA 1VITH 3VPKA 1BHXB 2BVSH 2ZQ1A 2H5CA 1T32A 1GGDC 1DT2A 1SOZA 9LPRA 1L1JA 2JKHA 4R8TB 1AUTC 4CBNA 1YCPH 2ZFFH 4WMEA 1IHSH 1ZLRA 1SFQB 1GJDB 2A5IA 4Y79A 3CENA 2GX4A 1BTZA 4JYVH 4WWYA 4BTUB 3RDZA 2GDEH 1CBWC 3T2NA 3SV6A 2WPLS 5FHTA 3RMLH 5A0AE 1TMUH 2BM2A 3GISB 1EJMA 1GJ9B 1Y59T 1V2RT 4OS7A 4XSKU 3MU5A 3NKKA 1B7XB 4Q80A 4AYVB 1AHTH 4WF8A 1GVLA 1GCDA 1NM6A 1WU1A 1BJVA 3GYMA 3ZVCA 2FIRH 2ZFQH 2BX4A 2ZFPH 1FUJA 2QXIA 2VVCA 4BTTB 1SFIA 1CT4E 3PMJA 4AYYB 1E37B 1RJXB 4X2XA 3SU1A 3D62A 1OX1A 1JRSA 1DWCH 1GCTB 4X8UH 2C8ZB 2SGEE 2SGDE 1GJ8B 5BRRE 3NCLA 3BIUH 4DCDA 1TBRH 2BYAX 1KSNA 1SQAA 3M35A 1C1MA 3S0NA 1B5GH 2BY9X 2Y81A 5JBCS 4DJZB 3KIDU 1N6YA 3M3VA 4FU8A 1F0SA 2CJIA 1GBTA 1FPHH 3BTFE 1CO7E 3ZVEA 3GY5A 3RLYH 1QRXA 1KXAA 3QO6A 4NIYA 2BD2A 4Q2KA 1BBRH 1ZPCA 4DGJA 2GCTC 1P09A 3VB7A 1FAKH 3UUZA 2OP9A 2HWLB 1K1LA 1AZ8A 3SQHE 1CSOE 3QZRA 1AFQB 4KP0A 4JZFH 1HXEH 4WY3A 1SGPE 1ARBA 2P8OC 3SNBA 1LHCH 2G5NA 3CS0A 2A7JA 1O2SA 4YZUA 2G8TA 2PUXB 2P3TB 3DA9B 1S6HA 1CA8B 4XFQA 3MH7A 4DVAU 4FXGH 3HK6B 3S9AA 3KQDA 2ODQA 3F6UH 5GDSH 1S6FA 1Y3WA 2BVRH 1Z8JB 2GZ9A 1ZHMA 3TK5A 1O5EH 2SNWA 4VGCB 2H5DA 2DE8A 2A4GA 1YPHE 2IN2A 2R0KA 2ZCKP 4D7GA 2GP9B 1V2ST 4X6OA 3RUOA 4CHAC 1A0JA 4CH2B 4D7FA 4BAMB 1K22H 2PKAB 1AN1E 4CRDA 1C5MD 2NU2E 1D4PB 2PW8H 4E05H 2PGBB 2FI5E 3TH4H 1PPFE 3RC6A 3SUFA 1CQQA 2BLVA 1QJ6B 1BHXF 2C4FH 4FVDA 3SJOA 4X8SH 1ELCA 1P11E 2QN5T 2VB0A 5FAHA 3GDSA 3I29A 1C2GA 2ZC9H 2BDBA 1E34B 3U8TH 3EGKH 3STJA 1UO6A 1XKBC 1EJNA 1NESE 3SU5A 2P93A 1YP9A 1ETRH 3M5MA 4MG3A 1PQ7A 1ZSJA 3D65E 4JZEH 4GHTA 2VWOA 3RXSA 4FUFA 3L6PA 4BXWA 1GMHG 1C5NH 1C1UH 1ZMNA 4NFFA 1BIOA 4AFUA 2ZO3H 3O8CA 3KF2A 4B2BA 1PYTD 2VGCB 1Z71A 4X1RU 3P8GA 3P95A 3VXEH 1RIWC 1KTTB 1B0EA 1D6RA 1JIMA 1SGCA 1QL7A 3KEEA 4KTSA 1HV7A 1NC6A 1C4U2 3RP2A 1Y3XA 2UUFB 1FIZA 4Y10E 2CHAC 1B0FA 1AWFH 4Y8YA 1KXBA 1YCPM 1GBBA 1MTUA 1EPTB 1QFKH 7GCHF 1XVOA 1GHAF 1AZZA 1CE5A 4CREA 1TLDA 1BBRE 1O2GH 2AERH 2ZCHP 3DUXH 3LOXA 3PWCA 5A8ZA 2SGFE 4D8NA 6LPRA 1DSUA 4B76A 1PQAA 2J34A 1A5GH 5ESBA 1YF4A 1K1JA 3FAOA 1UTNA 2ZDKA 1A0HB 1O3AA 5EODA 1RFNA 1VCQA 4U32A 4DG4A 2HOBA 1BMLA 2GGVB 1T7CA 4X6PA 1C1PA 4FUDA 4ZKSU 2WPIS 1O30A 5HYOA 1MZAA 1CHOF 1GHZA 5T3HA 1ORFA 4MDSA 1AVXA 1S84A 5TCCA 1TRMA 5DP9A 3HGNA 4NSYA 1TRYA 2HGTH 1LDTT 2C3SA 3GCTF 3KNXA 3M5NA 2UWOA 5HGGA 2AFQB 4ABJA 2ZGHA 2B9LA 1KIGH 1N8OB 4WH6A 2H2ZA 1O3KA 4WVPE 4OGXA 1MTWA 1O31A 1TWXB 3RXUA 1HFDA 3UOUA 2ZTZA 5B6OA 1LQEA 4NZQA 4ZHLU 3LPRA 1SLXB 1A5IA 4GHQA 1GJCB 6GCHF 1O3CA 3O8RA 1ZTJA 1W13U 2ZFRH 5FPYA 3UQOA 1O3BA 2VWMA 4MVNA 3A8DA 1MTVA 2ULLA 1GI7B 4ABAA 1IOEA 1BQYA 1P0SH 1EQ9A 1VZQH 2WPMS 1W3CA 3MNBA 5J4SA 3P92A 1NRRH 5EQRA 2QCYA 3ZYEA 3OYPA 2TGDA 1HAVA 2AGIX 3PO1C 3UR9A 8GCHF 3KGPA 1SGDE 3I78A 4U01A 5BPEA 1J16A 1ZTKA 3U8RH 3SV9A 1OWKA 3M3TA 1AO5A 2XCNA 3BF6H 1FY1A 4B75A 1C5VA 5IYTA 1SHHB 3F68H 1C9PA 4X6MA 1CU1A 2NWNA 5F8XA 3SHCH 3SO3A 1O2LA 3GICB 1MH0A 2GVFA 2VIWA 2QF0A 3VB4A 2LNCA 5DP5A 1W7GH 3A8CA 2QC2A 3BIVH 2Q6DA 3JZ1B 3F9GA 5DPAA 1O2TA 4AG2A 3PLPA 4CRBA 3BTEE 2ANWA 3UPEA 1MKWK 2ZECA 3IWMA 3VB6A 5A8YA 4BXSA 2CF9H 3QLPH 1O3EA 5ETXA 1GBDA 1FAXA 1HJAB 1HAYB 2AMQA 4A1XA 1J9CH 1A3BH 3A85A 3PTNA 1MD7A 1FY5A 5LPFA 3RXEA 3MFJA 1INCA 1EPTC 1GBFA 2P8OB 1GMCF 3RXBA 2FS8A 2XBVA 2ZGJA 3NWUA 1O2PA 1WSSH 4AFSA 4DIIH 1JMOH 4A7IB 4ZXXH 2QV1A 1C1TA 3A7TA 3A88A 1YGCH 1HNEE 4X1QU 4JCNA 1C2MA 1KLTA 2CXVA 2G51A 1YC0A 1GBCA 1ZPZA 2ZU5A 1KXDA 1TMBH 1ELTA 5HM2A 3BG4B 2B0FA 3S9BA 3N7OA 1SC8U 1XUFA 2SNVA 1ZOMA 2ILNA 3EYDA 3GOVB 5E8EH 2FOFA 3PLBA 4CR9A 4IS5A 1SGTA 1TA6A 3M36A 1C1WH 1QQUA 3ZZ4A 2ZHDA 3ZZBA 4DOQA 2Q1JA 2KAIA 3SNDA 1SBWA 3O8DA 4UONA 1H8DH 2WUBA 1C5RA 1O2IA 4O9VA 2WYGA 2R0LA 3SJKA 1Y5AT 1YM0A 4CRGA 1GVKB 5EW1H 1LPKB 2BD9A 5F03A 1O32A 1ID5H 1BJUA 4HGCA 3UTUH 5C5OA 1TX6A 2PGQB 1E36B 1EAXA 1AE8H 5L2ZH 2EA3A 3A7VA 1UMAH 1UK4A 3OU0A 2G52A 2O8WA 3BTHE 1WYKA 1ELFA 4INKA 1KDQA 2FOBA 3GCOA 3QTOH 3MO9A 1Q31A 1A3EH 2PSXA 1P8VC 1C1RA 5CHAB 2Y5HA 2VIPA 2XXLA 3GY3A 3Q00A 5DGJA 3T62A 4FUIA 4OS2A 4GSOA 3T29A 2ZGBH 5AFZH 5C1UA 2WPJS 1UTKA 3EE0B 1QRWA 1YPLH 2A5KA 1P06A 2PHBA 5K0HA 3C27B 3RXGA 3T25A 1CGHA 3TGIE 3M3SA 2W3KA 4K1SA 1QBOA 3ITIA 4FUCA 4JYUH 6GCHG 1C2EA 4RKOB 1GJ5H 2CGAA 2FI4E 1OP8A 4Z0KA 3ZVDA 1A0LA 1TABE 1CHGA 3ATMA 1HBTH 4Y8ZA 3PO1B 2HRVA 1Y3VA 1D3PB 4DURA 2YNBA 4ZH8A 1O5GH 1O3DA 1Z8RA 3TITA 2W7UA 2QYIA 3GDUA 1EAIA