1ANCA

Anionic trypsin mutant with ser 214 replaced by lys
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVKWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
publication title Perturbing the polar environment of Asp102 in trypsin: consequences of replacing conserved Ser214.
pubmed doi rcsb
source organism Rattus rattus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ancA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ancA02
4B2CA 1BTWA 5TCCA 2LPRA 1DWCH 4K5ZA 3TU7H 2GVFA 3SHAH 1AE5A 1HNEE 2H9HA 2ZHFH 1QQ4A 2SGPE 5C1YA 3FVFB 3ZZCA 2C4FH 1GHZA 3Q76A 4FUGA 4GCHG 3HGPA 4WH6A 4B71A 2THFB 1QQUA 1RIWB 1AWFH 1ID5H 4DT7B 1O37A 3E6PH 3ZZ3A 3RP2A 1ELCA 1H9HE 4LK4A 1CHGA 1GHWH 1NO9H 1MQ6A 4YESB 1GI9B 1HV7A 4XDEA 1THSH 1AI8H 2Y7ZA 2A5IA 1O2YA 1J8AA 4RKJB 5T6GA 1YF4A 3BSQA 2Z9JA 4UE7H 1D3TB 1HUTH 1O2JA 5FXLA 1J17T 3RXEA 2ZTZA 2F9PA 3FANA 3T25A 1K1NA 4WF8A 4YLUA 4DIIH 2QXIA 1WSSH 1W11U 1BBRH 1SGTA 2QN5T 4X6PA 2BM2A 1TNIA 2JETB 1NT1A 5FBIA 4CRGA 1OWJA 3SO3A 3A8BA 1ETRH 1TX8A 1JMOH 3U1JB 1JRSA 3TGJE 3TH2H 4Q2KA 3ZVEA 3T5FH 2BVXH 3MH5A 4SGAE 1HPGA 2VNTA 3E8LA 2QGRA 1KLIH 1RJXB 3RXJA 2BMGB 3HK3B 5JBBS 1TPSA 4INHA 1A61H 4OGYA 1G36A 1DXWA 1A4WH 1TX7A 2GMTC 3WY8A 2HNTF 3R3GB 2VVUA 4F49A 5JPMH 1OP0A 1IQMA 4TWYA 2WPJS 1FPHH 5DP8A 1LVMA 1QGFA 3M3SA 3EDXB 2WINI 1AHTH 1CBWC 1HXEH 4MVNA 4ISOA 1YPEH 3QX5H 4ISHH 3FZZA 1UVSH 3M36A 2AH4X 1GJ7B 5E2PA 1DLKB 1GG6B 2Q6FA 1EZQA 1O3FA 2EA3A 2Z94A 2XRCA 3SZNA 1SLWB 3SGQE 2ZGCA 4JZ1A 4X2YA 4X1NU 1GI6A 2QCYA 1SI5H 3GY4A 3ZZ9A 4DCDA 5LPEA 2SNVA 1MKXH 1FY3A 5DP7A 3GISB 1MTUA 1KTTB 1VCQA 3BIVH 5EW1H 4Q7ZA 1OP8A 4DVAU 2GV6A 1Z8JB 4RSPA 3I77A 5GIBA 2F3CE 2FOHA 1BHXF 1O3LA 2A0QB 1MD8A 1DUEA 1FMGA 5CHAC 3RC4A 1GMHF 1PJPA 1DLEA 2G8TA 1T8OA 2ZHQH 1ZSJA 2I6QA 2VVVA 2VWMA 3Q77A 4JZFH 1MCTA 1UK2A 1G3CA 1YLCA 1JXPA 2Q6DA 1ZPBA 2ZDLA 3P8NA 3SN8A 1ARCA 1QL7A 2BDIA 2RCEA 1MQ5A 3F9HA 4ZXYH 1IOEA 1ETTH 3UPEA 2Y7XA 1FONA 1LVBA 1OS8A 1YM0A 2NU3E 3SNDA 1D3PB 1PPGE 1GBJA 1Z7KA 5JYIA 3MH7A 1LKBA 4Y6DA 1IQJA 5E0HA 4YOGA 3RXLA 5GDSH 2XNIA 2GDEH 3NK8A 4JZIA 2HWLB 2F9BH 1A3EH 2FYRA 1QURH 2TGPZ 3MU4A 3KF2A 1H8DH 1C5TA 1BCUH 3GY5A 2XBWA 3UQOA 4H6SB 3LGTA 4NIVA 1GMDG 4X6MA 4I8LA 3IG6B 1NTPA 1GI5A 2BLOA 3AASA 5EODA 4IS5A 2GCTC 3CS0A 4TPYA 1P2MA 1V2LT 1TGNA 3E90B 4XBBA 1P2KA 1DM4B 1ZMJA 3RC6A 4TY7A 3BEIB 1HJAC 1OWDA 1ZGIA 1S0QA 3SORA 1QA7A 3LGIA 2PW8H 1FN6A 5H4IB 4B76A 1VITG 3UREA 1NC6A 3RUOA 1X7AC 3QZRA 2XBYA 1O36A 4UDWH 4BXSA 2Z6BD 5BRRE 1AVXA 1YCPH 3GY6A 1XX9A 3MNXA 1AGJA 2LNCA 2SFAA 2GP9B 1C5QA 1ANDA 2D1JA 3FZDA 1PQAA 1ZHRA 2QV1A 3FP8E 4BXWA 3ZYDA 4B75A 1C1OA 2O8WA 2G4TA 2R0LA 4ABDA 1HAXB 3A7WA 5TJXA 1GMDF 4DURA 5AF9H 3MI4A 4GHQA 4KKDA 4A1VA 4JK6A 2O9QA 1PQ8A 2AIPA 1EZXC 3RDZA 2AIQA 4ABJA 1NRNH 2H1UA 2WPMS 1T31A 3SUFA 3OYPA 3LGVA 5SGAE 1S83A 4BAQB 2PKAB 4WVPE 2C8WB 1FZZA 3UY9A 4CBOA 3DFJA 3K6YA 1V2JT 3JZ1B 1NFXA 1O2XA 1GL1A 2BLVA 1BT7A 1KXBA 5HM9A 5AVDA 1IQHA 2ILNA 2BTCE 3ZVBA 2ZDAH 1CSOE 1EZSC 2J2UA 1MAYA 5FX5A 3F68H 1AB9B 3M37A 2RA0A 3IITA 4I31A 1AU8A 1G3BA 2OINA 2BDYA 3S69A 4IGDA 5DGJA 3SNAA 2ZTYA 1C2IA 1NS3A 4B1TA 3BTTE 4FUBA 2PUQH 1SGQE 2GCHG 2STBE 2A4OA 1Y59T 4INKA 3VXEH 2BVSH 3T62A 4BAOB 3UWJH 1BTYA 1K22H 2ZGJA 1K1LA 4K60A 4BAMB 2F9NA 1MUEB 4NSYA 3ZZAA 5JB8S 2CJIA 2G5NA 3EE0B 2Y81A 2ALPA 1V2VT 2FLRH 1DE7H 2QXJA 3D49H 2AS9A 4BTUB 3MU0A 3A7TA 1W13U 1WV7H 1Q2WA 1YKTA 3M7QA 1ZHPA 2A5AA 4A7IB 1G9IE 2Q6GA 1W7XH 1NRRH 1TRYA 3H7TA 1K1IA 4BTIB 3QZQA 3KQBA 3A82A 3TNSA 3ZZBA 1OOKB 2WPHS 2Y6TA 4I8HA 1FI8A 2ZP0H 2FM2A 3PTNA 5F8TA 4X8UH 3JZ2B 3PLKA 2XW9A 2BD8A 1HIAB 2O8TA 5DKMA 2Z7FE 2VWLA 1VJAU 3QTVH 1DUAA 4NFFA 1YBWA 2TGAA 3LGUA 3P92A 3UQVA 1FY8E 1Y3UA 2WPIS 4AG1A 1C5YB 5FBEA 2HPQH 1EJNA 3LH1A 1EASA 4X2XA 3PO1B 4JMYA 4H4FA 1Z1JA 1RIWC 2AMQA 2PLXA 3AAUA 2PSYA 3TJNA 3D23A 1BTZA 1GJ9B 1P3EA 4B2BA 3UTUH 1A0JA 2BVRH 3MHWU 1P10A 4AN7A 1P02A 3ATMA 1EJMA 4Y8XA 5HM2A 3VB6A 4ABGA 1S6HA 2K1QA 4DG4A 2V3HH 3ZVFA 1T4VH 2WYJA 1TONA 1DS2E 4KGAA 1GHAF 1K2I1 4DW2U 2ZDVH 3VXFH 3VGCB 4DJZB 3MO9A 3CS7A 3RMMH 3QK1A 1TPAE 3K2UA 2IPHA 3DT0H 1C1VH 2A7HA 3SOSA 2FI3E 2JETC 2P59A 2BY6X 2OBOA 2C90B 2Y5FA 4UD9H 3DFLA 1G2LA 4U30A 1TRNA 2A32A 2AMPA 1ZTLA 1ZGVA 2TGTA 2W5EA 3SI3H 1ZOMA 1QBVH 3RXRA 4A1TA 1F92A 2OQ5A 1VR1H 5FPSA 1PPCE 1XXFA 1TALA 1UVOA 2J34A 2ZCHP 2BD9A 1TNLA 3RXUA 3M61U 3SBKA 5EXNA 2QYIA 1ZZZA 2VWOA 2CGAA 1CA0B 1SOTA 1GWAA 1WYKA 1O3HA 1TPPA 2ZDNA 1AZ8A 1FIZA 3KQEA 4BOHA 3SJ8A 1IQLA 2O8MA 1O5GH 1PQ7A 1ELGA 1F5KU 1NFUA 2ZPQA 1P01A 1DOJA 3M5LA 1EAUA 3MYWA 3LH3A 1QCPA 1ZR0A 1UVPA 3RXIA 4O97A 1GG6C 7LPRA 2BDGA 1PPBH 3ZVCA 4IC5A 1K28D 3B9FH 2ZFQH 4H6TA 2W3IA 3RU4T 1AIXH 4WJG2 5DP9A 1S5SA 4IC6A 3UNSA 1F2SE 2ZGXH 1H8IH 5C5NA 3T27A 1W12U 1T8MA 3SHCH 1BTUA 2SGAA 2ZU1A 1SFQB 1BJVA 3ZVDA 3M3VA 2BDAA 2VINA 1ETSH 2JH5D 1W3CA 6LPRA 3E16B 4YT7H 2VVCA 1SMFE 1BIOA 3RLWH 1IQGA 2BZ6H 3RMLH 1AQ7A 2HOBA 4CR5A 1F0RA 4Y76A 1O3MA 4HZHA 4Z0KA 3PMBB 1JIMA 2KAIB 1C2JA 1DSTA 1O2LA 1LHDH 1V2WT 3RXVA 1GPZA 4GSOA 1OYTH 4X8SH 5E0JA 1SQTA 5C3NA 1AUTC 4UFGH 3UUZA 1UVTH 1P3CA 2BY9X 1TA6A 2P3UB 3SU2A 4THNH 3E1XB 3P8OA 2TIOA 1GDUA 1WQSA 1D9IA 2ZHEH 1GBTA 1ELFA 1GHYH 3QGJA 5F6MA 1MKWK 1FAXA 4J2YB 1NFYA 2R9PA 1GJBB 1NU7B 4NZLA 5DP6A 3V3MA 3GDUA 1GDNA 1ABJH 1A0HB 1TNHA 2ZWLH 1D3DB 1GBFA 1S84A 2GDDA 3TJOA 4FUJA 1DY8A 1Z71A 5HGGA 1UCYK 2ZCKP 2J95A 3A7ZA 1ELEE 5IYTA 3LPRA 4FUIA 3TK6A 1P11E 1O5BB 1QL8A 4ZKOU 4CBNA 3K9XB 2Z9KA 1TQ0B 3QO6A 2FLBH 1BTHH 1QY6A 4IMZA 1ORFA 1EJAA 1AKSA 1LPGB 6GCHG 1A5IA 1P0SH 3GY7A 4B2AA 2ODQA 2ZFTA 2ZPRA 3HPTB 3ZZ6A 4MPXA 2QXGA 2CN0H 3QDZB 4D7GA 1P06A 1TX6A 1O3BA 5J4QA 1PYTD 3D65E 2OXSA 3QGNB 1KDQB 5CE1A 2FYQA 3BF6H 1SLUB 4I8GA 1Z6EA 1KIGH 5J4SA 3TITA 1C9PA 4AGKA 2PSXA 1P09A 4INLA 1OKXA 3SU6A 1V2KT 1GHVH 3FFGA 1O2RA 1TNKA 1XVMA 2ANWA 3A83A 2EI7A 1QFKH 2UWOA 1C1SA 2BD7A 4IMQA 5ABWA 2JKHA 3SJKA 3A7VA 4O3UA 3S9BA 2A4RA 4I8KA 5EQQA 3BTGE 1NRQH 1TABE 2BOHB 4YT6H 1LPKB 1N6YA 2G55A 1AB9C 4MNXA 4TY6A 5DG6A 1A3BH 1KXFA 4B74A 1TMTH 3BV9B 1BUIA 4GCHF 1CE5A 4ABFA 2FI4E 2CF9H 1GGDB 1RGQA 3HATH 2R0KA 1WQVH 1HXFH 1DX5M 1GVLA 2W3KA 1NROH 3MNSA 1O39A 5C20A 3SV2H 1UTPA 3UR6A 1TIOA 3M35A 1A7SA 1KXAA 1KY9A 3L33A 3DD2H 1HAGE 1V2OT 1E0FD 3EYDA 1TOCB 2G4UA 3OU0A 4MQAA 4Y79A 4ISLA 2O8LA 1OX1A 1O5FH 1LHEH 1P8VC 1J15A 4LXBH 1C5SA 1QJ1B 1UCYE 1FAKH 2YNBA 2NWNA 4D8NA 1YGCH 3E3TA 1Z6JH 1G37A 1TB6H 3B23B 3GCHB 3M3TA 2Z9LA 4TYDA 2H9EH 2ZC9H 1BMAA 2J4IA 3SJIA 4NCYA 3LKWA 1P2QA 1Y3XA 2G52A 1SGIB 1O2HA 1Q3XA 8ESTE 2NU4E 3A89A 2AGIX 3MOCA 1C2FA 3ODDA 1BITA 2ZFSA 1BTXA 5I46H 1NRSH 1C2LA 2FOGA 4WY3A 1V2ST 5FAHA 4AYVB 3BTKE 3TVJB 4MDSA 1LVOA 1O31A 3SQHE 1L4ZA 2IOTA 2Y80A 1NU9A 2ZTXA 1O34A 4D7FA 1XUKA 2W7UA 1TA2A 3PO1C 2ZG0H 1O2WA 1ZYOA 4ZHMU 1GBMA 1EB1H 1KSNA 1NESE 4WMEA 3O8BA 2OTVA 2NU2E 5JBTA 1BMLA 2YNAA 2R2MB 2JH6D 4ZMAH 1LHGH 1O35A 1HAPH 4AGJA 2GKVE 1SGRE 1ESTA 1GBCA 4Z6AH 4WMDA 5DP4A 1O2QA 1HLTH 2AYWA 2B8OH 3P6ZB 1UHBB 3DUXH 1SBWA 1AUJA 1C5PA 1FUJA 1SL3A 3LU9B 2W26A 3GICB 3OX7U 2ZCLP 1XXDA 2VIVA 3PYHA 1YPLH 1LKAA 4NA7A 3VB3A 3EQ0H 1W0YH 3NZIA 3TK9A 3VGCC 1C4U2 3RMNH 1C1MA 1O2NA 1JIRA 1CA8B 5F03A 4DGJA 4ZKSU 2HLCA 1ZSLA 3ATWA 2XXLA 4AYYB 1ELTA 5LGOA 3GDVA 3ZV8A 3LC5A 2GX4A 2Y5GA 3FP7E 1U6QA 3F6UH 3TNTA 5FCKA 2BLWA 4X8VH 1G3DA 1G3EA 3LDXH 5I25A 2I6SA 3CENA 1EX3A 3SNEA 3U69H 4ABAA 3EAJA 2STAE 1DICA 1W10U 1BOQA 1UTOA 1UTMA 3RXMA 1GBAA 1SR5C 1CA0C 5F8XA 1N8OB 2PGQB 1VZQH 3F9EA 2SGQE 8KME2 1E37B 1OWEA 3A8AA 4WMFA 3M5OA 2BQ6B 4ESTE 1K21H 2ZIQH 2C3SA 3GOVB 5GCHG 1A0LA 4LOYH 3PB1E 4U01A 1TMBH 5ESTE 4A92A 3KN2A 4GPGA 3ENSB 4FXGH 5EXMA 3TJVA 1B0EA 3GCTG 3PLPA 3V13A 5L30H 1Y3YA 1VCWA 3SV9A 1DSUA 1OSSA 4FVBA 1GJAB 1MD7A 3EA9A 4ABHA 2W7SA 3TJUA 1LTOA 2FMJA 4FUFA 1V2MT 2TRMA 3HKJB 3RXGA 2BD4A 3E91A 4NA9H 2FWWA 4WXVA 4VGCB 1AE8H 1J16A 2ANMH 3KIDU 2P93A 3AW1A 1JRTA 2BQWB 1D6WA 1IQNA 1AFEH 1DWDH 2PGBB 1GI4A 1XUGA 3SGBE 1VITF 2OD3B 5A0BA 2ESTE 3D62A 3A80A 2YOLA 1GJ5H 1CVWH 1O2SA 4Q80A 1PFXC 2WPLS 1YLDA 1GBEA 2EI6A 5FPYA 1V2QT 5DO4H 4TWWA 1TGTA 1HAIH 2PKAA 1BRUP 3RLYH 1XKBC 1EATA 2Z9IA 3RM0H 1C5LH 3O8CA 3K65B 1FY1A 3SGAE 2ULLA 1DT2A 1P2OA 2R3UA 1C2KA 1FJSA 2BDBA 3MWIU 3MFJA 2IN2A 5IDKA 3QTOH 2Z3EA 3ITIA 3MU8A 4AZ2B 2PUXB 4CH2B 2BD5A 4IN2A 1H9LB 5GWZA 1IHTH 4OS2A 1ZJDA 2WUBA 3SV6A 3MO3A 7GCHG 2DE8A 3ODFA 1GI3A 4K2YA 4HTCH 1DXPA 4ZKNU 1AFQB 1GHBG 1O3JA 3LIWA 8LPRA 3MU5A 4X6NA 5JBCS 1EPTB 4IN1A 3SU3A 2A1DB 1DPOA 1ELVA 3BTEE 2D2DA 3T28A 1V2PT 2VIPA 1ZSKA 3M7UA 5C5OA 2ZGBH 4WH8A 5DP5A 3NWUA 3UFAA 1O2VA 5AFYH 3VFEA 1EPTA 3W94A 5T6FA 2ANKH 1F0TA 2G81E 1L1GA 3SV8A 4CH8B 1KTSB 1WOFA 4JZDH 1UTQA 1FIWA 3GDSA 1NM6A 2OQUA 2BX3A 2ZF0H 3BG4B 1CHOG 1UMAH 1RS0A 4Y0YE 1CGJE 1W7GH 1CT4E 1OWHA 2ASUB 4UONA 5A0AE 2GCHF 3MMGA 5TCAA 5E0GA 4WXIA 1UTKA 1S82A 4J1YA 3UOUA 7GCHF 1O3GA 1CBWB 3GCOA 1ANCA 4CHAB 2FZZA 2V3OH 4Y71A 1EZUC 1CGHA 1LPZB 5FHTA 1TNGA 1QR3E 2ALVA 3I29A 1ANBA 2A45B 1HIAA 2RA3A 4AFSA 2BYAX 2C8YB 3T26A 4ABEA 3ZZ8A 2EC9H 1C5ZB 2FP7B 3TGKE 2FTLE 5A0CA 2B0FA 1GHXH 1O2TA 4NIWA 1H9IE 1XUFA 4X1PU 1YPHE 4CREA 2SNWA 1GJ4H 2F83A 1C5NH 1WCZA 2H6MA 5CHAB 3LJOA 1E36B 1GJ6A 4HFPB 4Y10E 1LMWB 2BD3A 3P8FA 1C5WB 2V6NA 3FP6E 1O3DA 4AX9H 1N6XA 1QTFA 1TOMH 2AGEX 2PV9B 2FS9A 3FAOA 4RN6A 2HVXA 1GGDC 2ZQ1A 2F9VA 1TNJA 1P9UA 2A5KA 2Z3CA 1T7CA 3KQCA 1KYNA 1ELDE 1BBRK 2FEQH 2QAAA 4E7NA 3RXTA 3ZYEA 5JBAS 1LDTT 1C5RA 4FU7A 4NZQA 2BDCA 3C27B 2JH0D 2OLGA 5T3HA 1B0FA 2FXRA 3U9AH 3BTME 1C5MD 3RXOA 1FLEE 1TE0A 1V2UT 7ESTE 4ZHAA 2WYGA 4HI3A 1Y8TA 1AMHA 4JK5A 1AN1E 3NKKA 3QWCH 1SGFA 3GCHC 1KLTA 1KXEA 5FX6A 1MBMA 1HJAB 1VITH 2C93B 1BMMH 1MTVA 5EPNA 3F9GA 2ZU5A 1V3XA 5A09A 1GMCG 2OC8A 3SNBA 3SW2B 1G2MA 4XSKU 1SGPE 1VGCB 2ANYA 1UJ1A 1Q31A 1P9SA 5JDUB 3F9FA 4FU9A 1ESBA 4PROA 4UEHH 4IW4E 2VB0A 2TGDA 3BTQE 1YCPM 4K3JA 1CQQA 3SUEA 2GZ7A 2BXTH 2BXUH 3LC3A 2XWBI 5K0HA 3SV7A 1Y5UT 1QIXB 1IAUA 4YM9A 2SGDE 1C2DA 2WV4A 1KLJH 1INCA 1YC0A 1FNIA 1MKXK 3S7HB 3GY2A 3VPKA 2ODYB 1K1OA 1YPHC 4K1EA 4MPUA 1O5CB 3BIUH 4K1TA 5A8YA 1MTSA 1GBIA 2TPIZ 4XBCA 3U8OH 3OTJE 4D76A 3ATIA 2O8UA 1Z8GA 3KGPA 3PTBA 4MTBA 8GCHG 1ARBA 1CT0E 1TMUH 5L6NH 2P16A 1QA0A 3QUMP 5EOKA 2CHAB 1FY5A 3LT3A 4X1RU 2OC1A 1D3QB 5LH8A 2Q1JA 2ZFPH 1BMNH 1TBQH 3P17H 3Q3KA 3PROA 2ZECA 1O2IA 3LONA 4CRAA 3F1SB 1ZHMA 2FPZA 4Y7AA 1NFWA 4XBDA 3O8RA 1ZMLA 1AD8H 2ZZUH 6CHAB 2KAIA 2QA9E 1BBRE 5LPRA 1C1WH 2XCNA 2XTTB 1O3PB 3RXBA 2EEKA 4I32A 2BY8X 1OWKA 1E35B 4JYUH 5GPIB 2ZI2H 2VIDA 1EKBB 2VGCB 1D6RA 4K8YA 1GI2A 1RD3B 4NWLA 4AFZA 3PMHB 5FPTA 3SJ9A 1SGFG 1W0ZU 3T2NA 3BTFE 5B6OA 8GCHF 3UNQA 1J9CH 1TPOA 1MMJN 1IQEA 2CV3A 3E0NB 3L6PA 1UTLM 1TGCA 1BHXB 4F4OC 2FIRH 1N8OC 4OS1A 4FUCA 2XCFA 1RTFB 1C9TA 3A88A 3Q3YA 1A5GH 2AGGX 2GT8A 1C1NA 4Q7XA 5T6DA 3MTYA 1AVWA 1J14A 1DWEH 3EA7A 4U32A 3KL6A 5EU8A 4ZROA 2PHBA 3P70B 4BTTB 2D26C 2OC7A 1P2IA 4O03A 1BB0B 3KCGH 1YCPK 1MTNB 2BZAA 1YP9A 3VB7A 1NN6A 2GZ9A 4TPIZ 1SQAA 3TH3H 4WWYA 4CRFA 4K8BA 2F91A 3BN9A 2HPPH 3MNCA 3N7OA 4DOQA 1TQ7B 2B9LA 2C8XB 3NXPA 1GBLA 1P12E 4MPWA 2BD2A 1HAYB 4UFEH 4VGCC 1C2HA 1GJ8B 1A5HA 3KEEA 1KXDA 1V2RT 1TGSZ 2NU1E 2H5DA 1KDQA 4MLFB 1HAZB 1TRMA 2XBXA 1O2OA 5C1UA 3S7KB 4MPVA 1O2PA 1QRXA 4GLYA 4KELA 4ISIH 1HYLA 1LCYA 1XUJA 3PWCA 4NA8A 1C1RA 3RXDA 3A84A 3V12A 1C1PA 2A7CA 2P94A 4I7YH 1TBRH 1FDPA 1PQ5A 6GCHF 4ZAEA 2PR3A 1K1JA 2PTNA 1XKAC 1C5XB 1TWXB 5DJ7A 1L4DA 5AFZH 4ZH8A 3A86A 1SHHB 4BAHB 1P2JA 1PPEE 4D9RA 1ELBA 4MNVA 1P04A 1W2KH 2FOEA 2HRVA 3PM3A 1UTNA 2F9UA 4Y11E 3ZZ5A 1ANEA 2BOKA 1HDTH 1JOUB 2AFQB 4GHTA 3O8DA 3Q00A 3CP7A 3TLOA 1DANH 1ZTJA 2J9NA 1TAWA 1MH0A 1MAXA 3RU4D 3STJA 1E38B 1AFQC 3TGIE 3GY3A 1SGYE 1QHRB 1EPTC 2GZ8A 5BPEA 1BQYA 2PFEA 5CMXH 1GCDA 3PWBA 1F7ZA 3RXCA 3M7TA 1Y3VA 4KTUA 1ZTKA 3TIUA 1O3AA 4A1XA 1Z8IB 3U1IB 1O30A 4KTSA 1TFXA 1BDAA 1F0UA 4IBLH 1EB2A 4ABIA 5A2MH 3U8TH 3E0PB 1EP5A 2XC4A 2PKSB 5GXPA 3SUDA 2ZHDA 2AEIH 3HGNA 3BG4C 1DDJA 2VH0A 1TBZH 2F9OA 4NIXA 1GMHG 2BX4A 2ZO3H 2VIOA 1WUNH 2OP9A 2J92A 1O2KA 3C1KA 1WTHD 2FODA 3MO6A 4CHAC 2XWAA 2OCVB 1FN8A 1SGEE 2UWPA 3AW0A 1O2ZA 1GCTB 1K1MA 1O3IA 3Q3XA 4NGAH 1O3NA 1ELAA 2FESH 2BY5X 1HFDA 2CXVA 1LHCH 1EOJA 3UIRA 5GJ4B 3T29A 1RXPA 1BTPA 2QXHA 5EXLA 3RMOH 1O5EH 1N1LA 1G32B 3SI4H 1ZLRA 4MNWA 5A8ZA 1S85A 1ZRKA 3URCA 1MZDA 3L3TA 3SQEE 1HJ9A 4X1QU 2VJ1A 2ZPSA 1EAXA 3MH4A 1WTGH 2FOBA 2H2ZA 2UUYA 2ZU4A 2P8OB 1P05A 4JZEH 4ASHA 1FV9A 4K1SA 4E7RG 5PTPA 2ZHWH 1GI8B 1EQ9A 3KQDA 1UTJA 1GVKB 4NIYA 3ESTA 3U98H 3R0FA 2HNTE 1WAYB 1UHBA 4A5TS 1SGNE 3TK5A 1MCVA 2D8WA 4BNRA 1P03A 1NPMA 2H5CA 1FQ3A 2ZDKA 3RXAA 2OBQA 3LOXA 1TLDA 1IHSH 1SOZA 3BTWE 1MU8B 2C8ZB 1Z8RA 2VWNA 4GAWA 1O2MA 1V2TT 3NPSA 1GI7B 4OS7A 1G30B 1MKWH 2FI5E 4DY7B 4ISNA 5EGMA 1AVGH 3UOPA 1UO6A 3S9CA 1W8BH 1SC8U 3LGYA 1EP6A 1CO7E 1UCYH 1DVAH 1SG8B 5K7RA 1B7XB 1BRAA 2H9TH 2UUKB 1SVPA 1T8LA 1C2MA 1O2UA 2DUCA 1QJ6B 1VCPA 2AERH 1QBOA 1UK4A 1OWIA 2FO9A 4NWKA 1LHFH 3SUGA 3U8RH 2B7DH 4AG2A 3SU4A 4BAKB 3GYLB 1HCGA 4AFQA 1DITH 1XM1A 3SU5A 2WV5A 4BANB 3SU1A 1VGCC 1AWHB 1JWTA 3GY8A 3ZZDA 3H7OA 1O3CA 3AVZA 1B5GH 2XYAA 1WBGB 4NFEA 1O32A 4MG3A 1EAIA 2ZNKH 1D4PB 4E05H 1CT2E 3K6ZA 4OS5A 3A7XA 5E2OA 2NU0E 3EA8A 4JYVH 1C2GA 1GDQA 4X6OA 4CR9A 1TGBA 4Y7BA 2V35A 1Z1IA 1GBBA 1PPFE 3VB5A 3RXQA 1RTKA 4X2WA 3ATLA 4AOQA 2ZU3A 1C1QA 3MNBA 1SSXA 2BY7X 1W14U 2VU8E 2ZEBA 2BLQA 2G51A 1OYQA 2GV7A 2OUAA 2P95A 4RKOB 4YOIA 5GCHF 4YLQH 2CHAC 4H42U 4X0WU 2FS8A 1F5LA 2CMYA 3TPIZ 4FU8A 2QF0A 5HYOA 4U2WA 3GCTF 2HNTC 2RDLA 2FOAA 1L2EA 1QRZA 3P8GA 1O5DH 3B8JA 1QNJA 3DA9B 4K69A 4Y8ZA 3PMJA 1ZRBA 1C5UA 2QF3A 3ZVAA 9LPRA 1S81A 1ZPZA 1QL9A 4FUHA 3PLBA 1TYNA 4ZHLU 2AMDA 1C5OH 3OY6U 6CHAC 1GBKA 2TBSA 1LO6A 3BG8A 1SQOA 4Q7YA 4GVUA 1EAWA 3M5NA 1S6FA 3UWIA 1QJ7B 1HAOH 2ZFFH 2VGCC 4R8TB 4UFFH 3HK6B 1DFPA 3QN7A 1C4Y2 2GGVB 4YTAA 1V2NT 2VIWA 3V0XA 1S0RA 2BQ7B 3PV4A 5C67A 5EW2H 3RXKA 2VIQA 2XC5A 3MH6A 1UK3A 1LQDB 1HRTH 2XC0A 3OY5U 3KNXA 3ZV9A 1BRBE 3SU0A 3ZZ7A 1XUHA 1SLVB 1YYY1 5DP3A 5F8ZA 1AY6H 5L2ZH 2GMTB 2SGFE 2PWXA 2A2XH 2FX6A 4HGCA 2QY0B 4CRBA 3VB4A 4UFDH 2A7JA 5HXFA 1DWBH 3ZVGA 2DE9A 1RRKA 2A4GA 4AORA 2Y82A 5FCRA 1OP2A 2R2WU 4YO9A 1ZJKA 4Y0ZE 4B73A 4O9VA 3I78A 1GHBF 1MTNC 1PPHE 3HKIB 4D9QA 2CF8H 2M5TA 4X2VA 2ZGHA 3EGKH 1FY4A 2ZU2A 1O2GH 1PPZA 5G4BA 1EXFA 1SGDE 1YPMH 1GHAG 1RFNA 3RM2H 1C1UH 1GVZA 1GJDB 4ABBA 2A31A 1YPGH 1A46H 1SFIA 5EQRA 1QRWA 3M5MA 3OSYA 1ZMNA 2VH6A 1F5RA 3A8CA 1VJ9U 3TH4H 1GJCB 1OXGA 2IJOB 1DY9A 1L1JA 2B5TB 4DIHH 2FTMA 1EOLA 1K9OE 1ABIH 1CHOF 1GI1A 4OS6A 1K1PA 1YPJH 1IQKA 6ESTA 5L2YH 1HAHH 1QBNA 2RG3A 1GBDA 1O3EA 2OC0A 1O3KA 1SLXB 1UVUH 4M7GA 5DK1A 2QIQA 1BJUA 1MBQA 9ESTA 3BEFB 2A2QH 5EPYA 3RXFA 3V7TA 4NG9H 1YPKH 1LVYA 1FPCH 3A85A 1IQFA 4NSVA 1NRPH 1Y5AT 2BHGA 1HJ8A 1IQIA 4I33A 4AB8A 4FVDA 1NZQH 4FUDA 1C5VA 1Y5BT 1E34B 1WU1A 5ESBA 1H4WA 3G01A 1C1TA 4SGBE 4MNYA 1JBUH 4Y8YA 1THRH 2GCTB 2PTCE 4GUXA 2P3FH 3URDA 1O0DH 1AO5A 4CRCA 1T4UH 1SB1H 1OPHB 1C2EA 1CGIE 2FOMB 4LZ4B 1Y3WA 2HALA 2PKSC 1C4V2 3QLPH 3LGWA 1KXCA 1HGTH 1HB0B 5A8XA 5HMAA 1ACBE 4R0IA 1XMNB 4X1SU 1ESAA 4FUEA 3W95A 4A6LA 3GCNA 1M9UA 1F0SA 3MU1A 3DHKH 4CRDA 2XBVA 1MTWA 1H1BA 1MU6B 2FDAA 1EUFA 1RTLA 2GT7A 3RU4E 1V6DA 1GCTC 1XVOA 1A1RA 1P57B 2HGTH 3ELAH 1GI0A 1XUIA 2Z9GA 2UUJB 4KP0A 3BEUA 2QC2A 4E06H 4LZ1H 2G5VA 1O5AB 2WUCA 3NCLA 4XOJA 1A2CH 3RXPA 3P95A 3A7YA 1SGCA 1P2NA 3ZZ4A 4JYTA 3STIA 4XFQA 5C1XA 4YOJA 2ZDMA 2FX4A 5JB9S 1BRCE 1GMCF 3RXSA 4AFUA 1ZPCA 1T8NA 2Y5HA 1GL0E 4O3TA 4XE4A 7KMEH 1LQEA 1PYTC 2Z3DA 5EG4A 2GD4B 2P8OC 2J38A 2ZA5A 1BA8B 1AZZA 2R3YA 3BTDE 3KHVA 1O38A 3RC5A 2GTBA 3NUMA 1GBHA 2UWLA 2WPKS 1L1NA 5DPAA 4ZUHA 4JCNA 3GYMA 3LJJA 2FOFA 1FXYA 4OS4A 4I8JA 1BZXE 2BB4A 3SNCA 2SGEE 3H5CB 4OGXA 4AB9A 2J94A 5ETXA 1NY22 1THPB 1SHYA 2P3TB 1HAVB 1HBTH 5C2ZA 1SPJA 5LPFA 3UNRA 1MZAA 5E8EH 4KTCA 1QB1A 2ZKSA 1QB6A 2UUFB 3S9AA 3PMAB 1L0ZA 4X8TH 2A4QA 3RXHA 3S0NA 3A8DA 3A87A 3UR9A 2BDHA 2FOCA 1O3OA 3A81A 1AKSB 3IWMA 5EQSA 3BTHE 4QT8C 1HAVA 1CU1A 3AAVA 2ZFRH 2EI8A 2ZQ2A 1QB9A 2G00A 3SJOA 3VEQB 1T32A 2ODPA 3ATKA 1O33A 2V0BA 5AHGH 4ZKRU 4YZUA 4ZXXH
chains in the Genus database with same CATH superfamily
4B2CA 1BTWA 5TCCA 2LPRA 1DWCH 4K5ZA 3TU7H 2GVFA 3SHAH 3PRDA 1AE5A 1HNEE 2H9HA 2ZHFH 1QQ4A 2SGPE 5C1YA 3FVFB 3ZZCA 2C4FH 1GHZA 3Q76A 4FUGA 4GCHG 3HGPA 4WH6A 4B71A 3GS9A 2THFB 1QQUA 3F3BA 1RIWB 1AWFH 1ID5H 4DT7B 1O37A 3E6PH 3ZZ3A 3OE7D 3RP2A 1ELCA 1H9HE 4LK4A 1CHGA 1GHWH 1NO9H 2V7QD 1MQ6A 4YESB 1GI9B 1HV7A 3FO8D 4XDEA 1THSH 1AI8H 2Y7ZA 2A5IA 1O2YA 1J8AA 3KQ5A 2PP6A 4RKJB 5T6GA 1YF4A 3BSQA 2Z9JA 4UE7H 1D3TB 1HUTH 1O2JA 5FXLA 1J17T 3RXEA 2ZTZA 1WXRA 5HIYA 2F9PA 3FANA 3T25A 1K1NA 4WF8A 4YLUA 4DIIH 2QXIA 1WSSH 1W11U 1BBRH 1SGTA 2QN5T 4X6PA 2BM2A 1TNIA 2JETB 1NT1A 5FBIA 4CRGA 1OWJA 3SO3A 3A8BA 2KCAA 1ETRH 1TX8A 1JMOH 3U1JB 1JRSA 3TGJE 3TH2H 4Q2KA 3ZVEA 3T5FH 2BVXH 3MH5A 4SGAE 1HPGA 2VNTA 3E8LA 2QGRA 1KLIH 1RJXB 3RXJA 2BMGB 3HK3B 5JBBS 1TPSA 2KX4A 4INHA 1A61H 4OGYA 1G36A 1DXWA 1A4WH 1TX7A 2GMTC 3F2HA 3WY8A 2HNTF 3R3GB 2VVUA 4F49A 5JPMH 1OP0A 1IQMA 4TWYA 2WPJS 1FPHH 5DP8A 1LVMA 1QGFA 3M3SA 3EDXB 2WINI 1AHTH 1CBWC 1HXEH 4MVNA 4ISOA 1YPEH 3QX5H 4ISHH 3FZZA 1UVSH 3M36A 2AH4X 1GJ7B 5E2PA 1DLKB 1GG6B 2Q6FA 2V3MA 1EZQA 1O3FA 2EA3A 2Z94A 2XRCA 4DT4A 3SZNA 1SLWB 3SGQE 2ZGCA 4JZ1A 4X2YA 4X1NU 1GI6A 2QCYA 1SI5H 3GY4A 3ZZ9A 4DCDA 5LPEA 2SNVA 1MKXH 1FY3A 5DP7A 3GISB 1MTUA 1KTTB 1VCQA 3BIVH 5EW1H 4Q7ZA 1OP8A 4DVAU 2GV6A 1Z8JB 4RSPA 3I77A 5GIBA 2F3CE 2FOHA 1BHXF 1O3LA 2A0QB 5EJZA 1MD8A 3SZEA 1DUEA 1FMGA 5CHAC 3RC4A 2YMSB 1GMHF 1PJPA 1DLEA 2G8TA 1T8OA 2ZHQH 1ZSJA 2I6QA 2VVVA 2VWMA 3Q77A 4JZFH 1MCTA 4F55A 1UK2A 1G3CA 1YLCA 1JXPA 2Q6DA 1ZPBA 2ZDLA 3P8NA 3SN8A 1ARCA 1QL7A 2BDIA 2RCEA 1MQ5A 3F9HA 4ZXYH 1IOEA 1ETTH 3UPEA 2Y7XA 1FONA 1LVBA 1OS8A 1YM0A 2NU3E 3SNDA 1D3PB 1PPGE 1GBJA 1Z7KA 5JYIA 3MH7A 1LKBA 4Y6DA 1IQJA 5E0HA 4YOGA 3RXLA 5GDSH 2XNIA 2GDEH 3NK8A 4JZIA 2HWLB 2F9BH 1A3EH 2FYRA 2W6ID 1K0HA 1QURH 2TGPZ 3MU4A 3KF2A 1H8DH 1C5TA 1BCUH 3GY5A 2XBWA 3UQOA 4H6SB 3LGTA 4NIVA 1GMDG 4Q4LA 4X6MA 3F0PA 3IG6B 1NTPA 4I8LA 1GI5A 2BLOA 5DSFA 3AASA 5EODA 4IS5A 2GCTC 3CS0A 1FX0B 4TPYA 1BMFD 1P2MA 1V2LT 2JJ2D 5T1VA 1TGNA 3E90B 4XBBA 1P2KA 1DM4B 1ZMJA 3RC6A 4TY7A 3BEIB 1HJAC 1OWDA 5EIYA 2WV9A 1ZGIA 1S0QA 3SORA 1QA7A 3LGIA 2PW8H 1FN6A 5H4IB 4B76A 1VITG 3UREA 1NC6A 3RUOA 1X7AC 3QZRA 2XBYA 5FL7D 1O36A 4UDWH 4BXSA 2Z6BD 5BRRE 1AVXA 1YCPH 3GY6A 1W0KD 1XX9A 3MNXA 1AGJA 5HIZA 2LNCA 2SFAA 2GP9B 1C5QA 1ANDA 2D1JA 3FZDA 1PQAA 1ZHRA 2QV1A 3FP8E 4BXWA 3ZYDA 4B75A 1C1OA 2O8WA 2G4TA 2R0LA 4ABDA 1HAXB 3A7WA 5TJXA 1GMDF 4DURA 5AF9H 3MI4A 4GHQA 4KKDA 4A1VA 4JK6A 2O9QA 1PQ8A 2AIPA 1EZXC 3RDZA 2AIQA 4ABJA 1NRNH 2H1UA 2WPMS 1T31A 3SUFA 3OYPA 3LGVA 5SGAE 1S83A 4BAQB 2PKAB 4TSFD 1S6LA 4WVPE 2C8WB 1FZZA 3UY9A 4CBOA 3DFJA 3K6YA 1V2JT 3JZ1B 1NFXA 1O2XA 1GL1A 2BLVA 1BT7A 1KXBA 5HM9A 5AVDA 1IQHA 2ILNA 2BTCE 3ZVBA 2ZDAH 1CSOE 1EZSC 2J2UA 1MAYA 5FX5A 3F68H 1AB9B 3M37A 1W0JD 2RA0A 3IITA 1AU8A 4I31A 1G3BA 2OINA 2BDYA 3S69A 4IGDA 5DGJA 3SNAA 2ZTYA 1C2IA 1NS3A 4B1TA 3BTTE 4FUBA 2PUQH 1SGQE 2GCHG 2STBE 2A4OA 1Y59T 4INKA 3VXEH 2BVSH 3T62A 4BAOB 3UWJH 1BTYA 1K22H 2ZGJA 1K1LA 4K60A 3KYFA 4BAMB 2F9NA 3PV2A 1MUEB 4NSYA 3ZZAA 5JB8S 2CJIA 2G5NA 3EE0B 2Y81A 2ALPA 1V2VT 2FLRH 1DE7H 2WSSD 2QXJA 3D49H 2VBCA 2AS9A 4BTUB 3MU0A 3A7TA 1W13U 1WV7H 1Q2WA 1YKTA 3M7QA 1ZHPA 2A5AA 4A7IB 3U28C 5C0UA 1G9IE 2Q6GA 1W7XH 1NRRH 1TRYA 3H7TA 1K1IA 4BTIB 3QZQA 3KQBA 3A82A 3TNSA 3ZZBA 1OOKB 2WPHS 2Y6TA 4I8HA 1FI8A 2ZP0H 2FM2A 3PTNA 5F8TA 4X8UH 3JZ2B 3PLKA 2XW9A 2BD8A 1HIAB 2O8TA 5DKMA 2Z7FE 2VWLA 1VJAU 3QTVH 1DUAA 4NFFA 1YBWA 2TGAA 3LGUA 3P92A 3UQVA 1FY8E 1Y3UA 2WPIS 4AG1A 1C5YB 5FBEA 2HPQH 1EJNA 3LH1A 4Z1MD 1EASA 4X2XA 3PO1B 4JMYA 4H4FA 1Z1JA 1RIWC 2AMQA 2PLXA 3AAUA 2PSYA 3N7EA 3TJNA 3D23A 1BTZA 1GJ9B 1P3EA 4B2BA 3UTUH 1A0JA 2BVRH 3MHWU 1P10A 4AN7A 1P02A 3ATMA 1EJMA 1YLNA 4Y8XA 5HM2A 3VB6A 5HKKD 4ABGA 1S6HA 2K1QA 4DG4A 2V3HH 3ZVFA 1T4VH 4ZCNA 2WYJA 1TONA 1DS2E 1H8HD 3N99A 4KGAA 1GHAF 1K2I1 4DW2U 2ZDVH 2KR7A 3VXFH 3VGCB 4DJZB 3MO9A 3CS7A 3RMMH 3QK1A 1TPAE 3K2UA 2IPHA 3DT0H 1C1VH 2A7HA 3SOSA 2FI3E 2JETC 2P59A 2BY6X 2OBOA 2C90B 2Y5FA 2LELA 4UD9H 3DFLA 1G2LA 4U30A 1TRNA 2A32A 2WZQA 2AMPA 1ZTLA 1ZGVA 2TGTA 2W5EA 3SI3H 1ZOMA 1QBVH 3RXRA 1E1RD 1F92A 4A1TA 2OQ5A 1VR1H 5FPSA 1PPCE 1XXFA 1TALA 1UVOA 2J34A 2ZCHP 2BD9A 1TNLA 3RXUA 3M61U 4RT0A 3SBKA 5EXNA 2QYIA 1ZZZA 2VWOA 2CGAA 1CA0B 4F48B 1SOTA 1GWAA 1WYKA 1O3HA 1TPPA 2ZDNA 1AZ8A 1FIZA 2W6JD 3KQEA 4BOHA 3SJ8A 1IQLA 2O8MA 1O5GH 1PQ7A 1ELGA 1F5KU 1NFUA 2ZPQA 1P01A 1DOJA 3M5LA 1EAUA 3MYWA 3LH3A 1QCPA 1ZR0A 1UVPA 3RXIA 4O97A 1GG6C 2CK3D 7LPRA 2BDGA 1PPBH 3ZVCA 4IC5A 1K28D 3B9FH 2ZFQH 4H6TA 2W3IA 3RU4T 1AIXH 4WJG2 5DP9A 1S5SA 1OHHD 4IC6A 2JIZD 3UNSA 1F2SE 2ZGXH 1H8IH 5C5NA 3T27A 1W12U 1T8MA 3SHCH 1BTUA 2SGAA 1WDIA 2ZU1A 1SFQB 1BJVA 3ZVDA 2M2AA 3M3VA 2BDAA 2VINA 1ETSH 2YMSC 2JH5D 1W3CA 6LPRA 3E16B 4YT7H 2VVCA 1SMFE 1BIOA 3RLWH 1IQGA 2BZ6H 3RMLH 1AQ7A 2HOBA 4CR5A 1F0RA 4Y76A 1O3MA 4HZHA 4Z0KA 1H8ED 3PMBB 1JIMA 2KAIB 1C2JA 1DSTA 1O2LA 1LHDH 2KCYA 1V2WT 3RXVA 1GPZA 4GSOA 1OYTH 4X8SH 5E0JA 1SQTA 5C3NA 1AUTC 4UFGH 3UUZA 1UVTH 1P3CA 2K8IA 2BY9X 1TA6A 2P3UB 3SU2A 4THNH 3E1XB 3P8OA 2TIOA 1GDUA 1WQSA 1D9IA 2WPDD 2ZHEH 1GBTA 1ELFA 1GHYH 3QGJA 5F6MA 1MKWK 1FAXA 4J2YB 1NFYA 2R9PA 1GJBB 1NU7B 4NZLA 5DP6A 3V3MA 3GDUA 1GDNA 1ABJH 1A0HB 1TNHA 2ZWLH 1D3DB 1GBFA 1S84A 2GDDA 3TJOA 4FUJA 1DY8A 1Z71A 5HGGA 3OEHD 1UCYK 1VKYA 2ZCKP 2J95A 3A7ZA 1ELEE 5IYTA 3VG8A 3LPRA 4FUIA 3TK6A 1P11E 1O5BB 1QL8A 4ZKOU 4CBNA 3K9XB 2Z9KA 1TQ0B 3QO6A 2FLBH 1BTHH 1QY6A 4IMZA 4TT3D 1ORFA 1EFRD 1AKSA 1EJAA 1LPGB 6GCHG 1A5IA 1P0SH 3GY7A 4B2AA 2ODQA 2ZFTA 2ZPRA 3HPTB 3ZZ6A 4MPXA 3DCLA 2QXGA 2CN0H 3QDZB 4D7GA 4RI0A 1P06A 1TX6A 1O3BA 5J4QA 1PYTD 3D65E 2OXSA 3QGNB 1KDQB 5CE1A 2FYQA 3BF6H 1SLUB 4I8GA 1Z6EA 1KIGH 5J4SA 3TITA 1C9PA 4AGKA 2PSXA 1P09A 4INLA 2IPQX 1OKXA 3SU6A 1V2KT 1GHVH 3FFGA 1O2RA 1TNKA 1XVMA 2ANWA 3A83A 3UAIC 2EI7A 1QFKH 2UWOA 1C1SA 2BD7A 4IMQA 5ABWA 2JKHA 3SJKA 3WWBA 5C94A 3A7VA 4O3UA 3S9BA 2A4RA 4I8KA 5EQQA 3BTGE 1NRQH 1TABE 2BOHB 4YT6H 1LPKB 1N6YA 2G55A 1AB9C 4MNXA 4TY6A 5DG6A 3OEED 1A3BH 1KXFA 4B74A 3WW7A 1TMTH 3BV9B 1BUIA 4GCHF 1CE5A 4ABFA 2FI4E 2CF9H 1GGDB 1RGQA 3HATH 2R0KA 1WQVH 1HXFH 1DX5M 1GVLA 2W3KA 1NROH 3MNSA 1O39A 5C20A 3SV2H 1UTPA 3UR6A 1TIOA 3M35A 1A7SA 1KXAA 3NRLA 1KY9A 3L33A 3DD2H 1HAGE 1V2OT 1E0FD 3EYDA 1TOCB 2G4UA 3OU0A 4MQAA 4Y79A 4ISLA 2O8LA 1OX1A 1O5FH 1LHEH 1P8VC 1J15A 4LXBH 1C5SA 1QJ1B 1UCYE 1FAKH 2YNBA 2NWNA 4D8NA 1YGCH 3E3TA 1Z6JH 1G37A 1TB6H 3B23B 3GCHB 3M3TA 2Z9LA 4TYDA 2H9EH 2ZC9H 1BMAA 2J4IA 3SJIA 4NCYA 3LKWA 1P2QA 1Y3XA 2G52A 1SGIB 1O2HA 1Q3XA 8ESTE 2NU4E 3A89A 3KYGA 2AGIX 3MOCA 1C2FA 3ODDA 1COWD 1BITA 2ZFSA 1BTXA 5I46H 1NRSH 1C2LA 2FOGA 4WY3A 1V2ST 5FAHA 5KGOA 4AYVB 2EY4C 3BTKE 3TVJB 4MDSA 1LVOA 1O31A 3SQHE 1L4ZA 2IOTA 2Y80A 1NU9A 2ZTXA 1O34A 4D7FA 1XUKA 2K0QA 2W7UA 1TA2A 3PO1C 2ZG0H 1O2WA 1ZYOA 4ZHMU 1GBMA 1EB1H 1KSNA 1NESE 4WMEA 3O8BA 2OTVA 2NU2E 5JBTA 1BMLA 2YNAA 2R2MB 2JH6D 4ZMAH 1LHGH 1O35A 1HAPH 4AGJA 2GKVE 1SGRE 1ESTA 1GBCA 4Z6AH 4WMDA 5DP4A 1O2QA 1HLTH 2AYWA 2B8OH 3P6ZB 1UHBB 3DUXH 4ACBA 1SBWA 1AUJA 1C5PA 1FUJA 1SL3A 3LU9B 2W26A 3GICB 3OTPA 1SKYE 3OX7U 2ZCLP 1XXDA 2VIVA 3PYHA 1YPLH 1LKAA 4NA7A 3VB3A 3EQ0H 1W0YH 3NZIA 3TK9A 4HG6A 3VGCC 1C4U2 3RMNH 1C1MA 1O2NA 1JIRA 1CA8B 5F03A 4DGJA 4ZKSU 2HLCA 1ZSLA 3ATWA 2XXLA 4AYYB 1ELTA 2IJD1 5LGOA 3GDVA 3ZV8A 3LC5A 2GX4A 2Y5GA 3FP7E 1U6QA 3F6UH 3WWFA 3TNTA 5FCKA 2BLWA 4X8VH 1G3DA 1G3EA 3LDXH 5I25A 2I6SA 3CENA 1EX3A 2EQNA 3SNEA 3U69H 4ABAA 3EAJA 2STAE 1DICA 1W10U 1BOQA 1UTOA 1UTMA 3RXMA 1GBAA 1SR5C 1CA0C 5F8XA 1N8OB 2PGQB 1VZQH 3F9EA 3F2FA 2SGQE 8KME2 1E37B 1OWEA 3A8AA 4WMFA 3M5OA 2BQ6B 4ESTE 1K21H 2ZIQH 2C3SA 3GOVB 5GCHG 1A0LA 4LOYH 3PB1E 4U01A 1TMBH 5ESTE 4A92A 3KN2A 4M9FA 4GPGA 3ENSB 4FXGH 5EXMA 3TJVA 1B0EA 3GCTG 2F43B 3OAAD 3PLPA 3V13A 5L30H 1Y3YA 1VCWA 3SV9A 1DSUA 1OSSA 4FVBA 1GJAB 1MD7A 3EA9A 4ABHA 2W7SA 3TJUA 1LTOA 2FMJA 4FUFA 1V2MT 2TRMA 3HKJB 3RXGA 2BD4A 3E91A 4NA9H 2FWWA 4WXVA 4VGCB 1AE8H 1J16A 2ANMH 3FN8A 3KIDU 2P93A 3AW1A 1JRTA 2BQWB 1D6WA 1IQNA 5KECA 1AFEH 1DWDH 2PGBB 1GI4A 1XUGA 3SGBE 1VITF 2OD3B 5A0BA 2ESTE 3D62A 3A80A 3DSGA 2YOLA 1GJ5H 1CVWH 1O2SA 4Q80A 1NBMD 1PFXC 2WPLS 1YLDA 1GBEA 2EI6A 5FPYA 1V2QT 5DO4H 4TWWA 1TGTA 1HAIH 1E79D 2PKAA 1BRUP 3RLYH 1XKBC 1EATA 2Z9IA 3RM0H 3SYJA 1C5LH 3O8CA 3K65B 1FY1A 3SGAE 2ULLA 1DT2A 1YY3A 1P2OA 2R3UA 1C2KA 1FJSA 2BDBA 3MWIU 3MFJA 2IN2A 5IDKA 3QTOH 2Z3EA 3ITIA 3MU8A 4AZ2B 2PUXB 3MQKC 4CH2B 2BD5A 2LP6A 1H9LB 4IN2A 5GWZA 1IHTH 4OS2A 1ZJDA 2WUBA 3SV6A 3MO3A 7GCHG 2DE8A 3ODFA 1GI3A 4K2YA 2XNDD 4HTCH 1DXPA 4ZKNU 1AFQB 1GHBG 2KCOA 1O3JA 2GJGA 3LIWA 8LPRA 3MU5A 4X6NA 5JBCS 1EPTB 4IN1A 3SU3A 2A1DB 1DPOA 1ELVA 3BTEE 2D2DA 3T28A 1V2PT 3DSOA 4OM9A 2VIPA 1ZSKA 3M7UA 5C5OA 2ZGBH 4WH8A 5DP5A 3NWUA 3UFAA 1O2VA 5AFYH 3VFEA 1EPTA 3W94A 5T6FA 2ANKH 1F0TA 2G81E 1L1GA 3SV8A 4CH8B 1KTSB 1WOFA 4JZDH 3DSPA 1UTQA 1FIWA 3GDSA 1NM6A 2OQUA 2BX3A 2ZF0H 3BG4B 1CHOG 1UMAH 1RS0A 4Y0YE 1CGJE 1W7GH 1CT4E 1OWHA 2ASUB 4UONA 5A0AE 2GCHF 3MMGA 5TCAA 5E0GA 4WXIA 1UTKA 1S82A 4J1YA 3UOUA 7GCHF 1O3GA 1CBWB 3GCOA 1ANCA 4CHAB 2FZZA 2V3OH 4Y71A 1EZUC 1CGHA 1LPZB 5FHTA 1TNGA 1QR3E 4XD7D 2ALVA 1MABB 3I29A 1ANBA 2A45B 1HIAA 2RA3A 4AFSA 2BYAX 2C8YB 3T26A 4ABEA 3ZZ8A 2EC9H 1C5ZB 2FP7B 3TGKE 2FTLE 5A0CA 2B0FA 1GHXH 1O2TA 4NIWA 1H9IE 1XUFA 4X1PU 1YPHE 4CREA 2SNWA 3AK5A 1GJ4H 2J98B 2F83A 1C5NH 1WCZA 2H6MA 5CHAB 3LJOA 1E36B 1GJ6A 2L74A 4HFPB 4Y10E 1LMWB 2BD3A 3P8FA 1C5WB 2V6NA 3FP6E 1O3DA 4AX9H 1N6XA 1QTFA 1TOMH 5DN6D 2AGEX 2PV9B 2FS9A 3FAOA 4RN6A 2HVXA 1GGDC 2J98A 2ZQ1A 2F9VA 1TNJA 1P9UA 2A5KA 2Z3CA 1T7CA 3KQCA 1KYNA 1ELDE 1BBRK 2FEQH 2QAAA 4E7NA 3RXTA 3ZYEA 5JBAS 1LDTT 1C5RA 4FU7A 4NZQA 2BDCA 3C27B 2JH0D 2OLGA 5T3HA 1B0FA 2FXRA 3U9AH 3BTME 1C5MD 3RXOA 1FLEE 1TE0A 1V2UT 7ESTE 4ZHAA 2WYGA 4HI3A 2RFKC 4B6FA 1Y8TA 1AMHA 4JK5A 1AN1E 3NKKA 3QWCH 1SGFA 2RDEA 3GCHC 1KLTA 1KXEA 5FX6A 1MBMA 1HJAB 1VITH 2C93B 1BMMH 1MTVA 5EPNA 3F9GA 2ZU5A 1V3XA 5A09A 1GMCG 2OC8A 3SNBA 3SW2B 1G2MA 4XSKU 1SGPE 1VGCB 2ANYA 1UJ1A 1Q31A 1P9SA 5JDUB 3F9FA 4FU9A 1ESBA 4PROA 4UEHH 4IW4E 2VB0A 2TGDA 3BTQE 1YCPM 4K3JA 1CQQA 3SUEA 2GZ7A 2BXTH 2BXUH 3LC3A 2XWBI 5K0HA 3SV7A 1Y5UT 1QIXB 1IAUA 4YM9A 2SGDE 1C2DA 2WV4A 1KLJH 5CDFE 1INCA 1YC0A 1FNIA 1MKXK 3S7HB 3GY2A 3VPKA 2ODYB 1K1OA 1YPHC 4K1EA 4MPUA 1O5CB 3BIUH 4AC9A 4K1TA 5A8YA 1MTSA 1GBIA 2TPIZ 4XBCA 3U8OH 3OTJE 4D76A 3ATIA 2O8UA 1Z8GA 3KGPA 3PTBA 4MTBA 8GCHG 1ARBA 1CT0E 1TMUH 5L6NH 2P16A 1QA0A 3QUMP 5EOKA 2CHAB 1FY5A 3LT3A 4X1RU 2OC1A 1D3QB 1UW7A 5LH8A 2Q1JA 5GNDA 2ZFPH 1BMNH 1TBQH 3P17H 3Q3KA 3PROA 2ZECA 1O2IA 2F4LA 3LONA 4CRAA 3F1SB 1ZHMA 2FPZA 4Y7AA 1NFWA 4XBDA 3O8RA 1ZMLA 1AD8H 2ZZUH 6CHAB 2KAIA 2QA9E 1BBRE 5LPRA 1C1WH 2XCNA 2XTTB 1O3PB 3RXBA 2EEKA 4I32A 2BY8X 1OWKA 1E35B 4JYUH 5GPIB 2ZI2H 2L6OA 1EKBB 2VIDA 2VGCB 1D6RA 4K8YA 1GI2A 1RD3B 4NWLA 4AFZA 4ASUD 3PMHB 5FPTA 3SJ9A 1SGFG 1W0ZU 3T2NA 3BTFE 4FOUC 5B6OA 1QZ8A 8GCHF 2AHME 3UNQA 1J9CH 1TPOA 1MMJN 1IQEA 2CV3A 3E0NB 3L6PA 1UTLM 1TGCA 1BHXB 4F4OC 2FIRH 1N8OC 4OS1A 4FUCA 2XCFA 1RTFB 1C9TA 3A88A 3Q3YA 1A5GH 2AGGX 2GT8A 1C1NA 4Q7XA 5T6DA 3MTYA 1AVWA 1J14A 1DWEH 3EA7A 4U32A 3KL6A 5EU8A 4ZROA 2PHBA 3P70B 4BTTB 2D26C 2OC7A 1P2IA 4O03A 1BB0B 3KCGH 1YCPK 1MTNB 2BZAA 1YP9A 3VB7A 1NN6A 2GZ9A 4TPIZ 1SQAA 3TH3H 4WWYA 4CRFA 4K8BA 2F91A 3BN9A 2HPPH 3MNCA 3N7OA 4DOQA 1TQ7B 2B9LA 2C8XB 3NXPA 1GBLA 1P12E 4MPWA 2BD2A 1HAYB 4UFEH 4VGCC 1C2HA 1GJ8B 1A5HA 3KEEA 1KXDA 2JJ1D 1V2RT 1TGSZ 2NU1E 2H5DA 1KDQA 4MLFB 4ACAA 1HAZB 1TRMA 2XBXA 1O2OA 5C1UA 5B6LA 3S7KB 4MPVA 1O2PA 1QRXA 4GLYA 4KELA 4ISIH 1HYLA 1LCYA 1XUJA 3PWCA 4NA8A 1C1RA 3RXDA 3A84A 3V12A 1C1PA 2A7CA 2P94A 4I7YH 1TBRH 1FDPA 1PQ5A 6GCHF 4ZAEA 2PR3A 2OK5A 1K1JA 2PTNA 1XKAC 1C5XB 1TWXB 5DJ7A 1L4DA 5AFZH 2QE7D 4ZH8A 3A86A 1SHHB 4BAHB 1YWUA 1P2JA 1PPEE 4D9RA 1ELBA 4MNVA 1P04A 1W2KH 2FOEA 2HRVA 3PM3A 1UTNA 2F9UA 4Y11E 3ZZ5A 3CNRA 1ANEA 2BOKA 1HDTH 1JOUB 2AFQB 4GHTA 4Q63A 3O8DA 3Q00A 3CP7A 3TLOA 1DANH 1ZTJA 2J9NA 1TAWA 1MH0A 1MAXA 3RU4D 3STJA 1E38B 1AFQC 3TGIE 3GY3A 1SGYE 5F53A 1QHRB 1EPTC 2GZ8A 5BPEA 1BQYA 2PFEA 5EJLA 5CMXH 1GCDA 3PWBA 1F7ZA 3RXCA 3M7TA 1Y3VA 4KTUA 1ZTKA 3TIUA 1O3AA 4A1XA 1Z8IB 3U1IB 1O30A 1NBME 4KTSA 1TFXA 1BDAA 1F0UA 4IBLH 1EB2A 4ABIA 5A2MH 3U8TH 3E0PB 1EP5A 2XOKD 2XC4A 2PKSB 5GXPA 3SUDA 2ZHDA 2AEIH 3HGNA 3BG4C 1DDJA 2VH0A 1TBZH 2F9OA 4NIXA 1GMHG 2BX4A 2ZO3H 2VIOA 1WUNH 2OP9A 2J92A 1O2KA 3C1KA 1WTHD 2FODA 3MO6A 4CHAC 2XWAA 2OCVB 1FN8A 1SGEE 2UWPA 3AW0A 1O2ZA 1GCTB 1K1MA 1O3IA 3Q3XA 4XRNA 4NGAH 2HLDD 1O3NA 1ELAA 2FESH 2BY5X 1HFDA 2CXVA 1LHCH 1EOJA 3UIRA 5GJ4B 3T29A 1RXPA 1BTPA 2QXHA 5EXLA 3RMOH 1O5EH 1N1LA 1G32B 3SI4H 1ZLRA 4MNWA 5A8ZA 1S85A 1ZRKA 2KZ4A 3URCA 1MZDA 3L3TA 3SQEE 1HJ9A 4X1QU 2VJ1A 2ZPSA 1EAXA 3MH4A 1WTGH 3FKSD 2FOBA 3N7DA 2H2ZA 2UUYA 2ZU4A 2P8OB 1P05A 4JZEH 4RT1A 4ASHA 1FV9A 4K1SA 4E7RG 5PTPA 2ZHWH 1GI8B 1EQ9A 3KQDA 1UTJA 1GVKB 4NIYA 3ESTA 3U98H 3R0FA 2HNTE 1WAYB 1UHBA 4A5TS 1SGNE 3TK5A 1MCVA 2D8WA 4BNRA 1P03A 1NPMA 2H5CA 1FQ3A 2ZDKA 3RXAA 2OBQA 3LOXA 1TLDA 1IHSH 1SOZA 3BTWE 1MU8B 2C8ZB 1Z8RA 2VWNA 4GAWA 1O2MA 1V2TT 3NPSA 1GI7B 4OS7A 1G30B 1MKWH 2FI5E 4DY7B 4ISNA 5EGMA 2KCPA 1AVGH 3UOPA 1UO6A 3S9CA 1W8BH 1SC8U 3LGYA 1EP6A 1CO7E 1UCYH 1DVAH 1SG8B 5K7RA 1B7XB 1BRAA 2H9TH 2UUKB 1SVPA 1T8LA 1C2MA 1O2UA 2DUCA 1QJ6B 1VCPA 4P02A 2AERH 1QBOA 1UK4A 1OWIA 2FO9A 4NWKA 1LHFH 3SUGA 3U8RH 5IK2D 2B7DH 4AG2A 3SU4A 4BAKB 3GYLB 1HCGA 4AFQA 1DITH 1XM1A 3SU5A 2WV5A 4BANB 3SU1A 1VGCC 1AWHB 1JWTA 3GY8A 2WHXA 3ZZDA 3H7OA 1O3CA 3AVZA 1B5GH 2XYAA 1WBGB 4NFEA 1O32A 4MG3A 1EAIA 2ZNKH 1D4PB 4E05H 1CT2E 3K6ZA 4OS5A 3A7XA 5E2OA 2NU0E 3EA8A 4JYVH 1C2GA 1GDQA 4X6OA 4CR9A 1TGBA 4Y7BA 5C0TA 2V35A 1Z1IA 1GBBA 1PPFE 3VB5A 3UB0A 3RXQA 1RTKA 4X2WA 3ATLA 4AOQA 2ZU3A 1C1QA 3MNBA 1SSXA 2BY7X 1W14U 2VU8E 2ZEBA 2BLQA 2G51A 1OYQA 2GV7A 2OUAA 2P95A 4RKOB 4YOIA 5GCHF 4YLQH 2CHAC 4H42U 4X0WU 2FS8A 1F5LA 2CMYA 3TPIZ 4FU8A 2J5UA 2QF0A 5HYOA 4U2WA 3GCTF 2HNTC 2RDLA 2FOAA 1L2EA 1QRZA 3P8GA 1O5DH 3B8JA 1QNJA 2KM0A 3DA9B 4K69A 4Y8ZA 3PMJA 1ZRBA 1C5UA 2QF3A 3F0OA 3ZVAA 9LPRA 1S81A 1ZPZA 1QL9A 4FUHA 3PLBA 1TYNA 4ZHLU 2AMDA 1C5OH 3OY6U 6CHAC 1GBKA 1SQRA 2TBSA 1LO6A 3BG8A 1SQOA 4Q7YA 4GVUA 1EAWA 3M5NA 1S6FA 3UWIA 1QJ7B 1HAOH 2ZFFH 2VGCC 4R8TB 4UFFH 3HK6B 1DFPA 3QN7A 2J97A 1C4Y2 2GGVB 4YTAA 1V2NT 2VIWA 3V0XA 1S0RA 2BQ7B 3PV4A 5C67A 5EW2H 3RXKA 2VIQA 2XC5A 3MH6A 1UK3A 1LQDB 1HRTH 2XC0A 3OY5U 3KNXA 3ZV9A 1BRBE 2QF4A 3SU0A 3ZZ7A 5C17A 1XUHA 1SLVB 1YYY1 5DP3A 5F8ZA 1AY6H 5L2ZH 2GMTB 2SGFE 2PWXA 2A2XH 2FX6A 4HGCA 2QY0B 4CRBA 3VB4A 4UFDH 2A7JA 5HXFA 1DWBH 3ZVGA 2DE9A 1RRKA 2A4GA 4AORA 2Y82A 5FCRA 1OP2A 2R2WU 4YO9A 1ZJKA 4Y0ZE 4B73A 4O9VA 3I78A 1GHBF 1MTNC 1PPHE 3HKIB 4D9QA 2CF8H 2M5TA 4X2VA 2ZGHA 3EGKH 1FY4A 2ZU2A 1O2GH 1PPZA 5G4BA 3PRBA 1EXFA 1SGDE 1YPMH 1GHAG 1RFNA 3RM2H 1C1UH 1GVZA 1GJDB 4ABBA 2A31A 1YPGH 1A46H 1SFIA 5EQRA 1QRWA 3M5MA 3OSYA 1ZMNA 2VH6A 1F5RA 3A8CA 1VJ9U 3TH4H 1GJCB 1OXGA 2IJOB 1DY9A 1E1QD 1L1JA 2B5TB 4DIHH 2FTMA 1EOLA 1K9OE 1ABIH 1CHOF 1GI1A 4OS6A 1K1PA 1YPJH 1IQKA 6ESTA 5L2YH 1HAHH 1QBNA 2RG3A 1GBDA 1O3EA 2OC0A 1O3KA 1SLXB 1UVUH 4M7GA 5DK1A 2QIQA 1BJUA 1MBQA 9ESTA 3BEFB 2A2QH 5EPYA 3RXFA 3V7TA 4NG9H 1YPKH 1LVYA 1FPCH 3A85A 1IQFA 4NSVA 1NRPH 1Y5AT 2BHGA 1HJ8A 1IQIA 4I33A 4AB8A 4FVDA 3ZIAD 1NZQH 4FUDA 1C5VA 1Y5BT 1E34B 1WU1A 5ESBA 1H4WA 3G01A 1C1TA 4SGBE 4MNYA 1JBUH 4Y8YA 1THRH 2GCTB 2PTCE 4GUXA 2P3FH 3URDA 1O0DH 1AO5A 4CRCA 1T4UH 4YXWD 3OFND 1SB1H 1OPHB 1C2EA 1CGIE 2FOMB 4LZ4B 1Y3WA 2HALA 2PKSC 1C4V2 3QLPH 3LGWA 1KXCA 1HGTH 1HB0B 5A8XA 5HMAA 1ACBE 4R0IA 2JDID 1XMNB 4X1SU 1ESAA 4FUEA 3H09A 3W95A 4A6LA 3GCNA 1M9UA 1F0SA 3MU1A 3DHKH 3FOAA 4CRDA 2XBVA 1MTWA 1H1BA 5EJ1A 1MU6B 2FDAA 5KEDA 1EUFA 1RTLA 2GT7A 3RU4E 1V6DA 1GCTC 1XVOA 1A1RA 1P57B 2HGTH 4B6EA 3ELAH 1GI0A 1XUIA 2Z9GA 2UUJB 4KP0A 3BEUA 2QC2A 4E06H 4LZ1H 2G5VA 1O5AB 2WUCA 3NCLA 4XOJA 1A2CH 3RXPA 3F2GA 3P95A 3A7YA 1SGCA 1P2NA 3ZZ4A 4JYTA 3STIA 4XFQA 5C1XA 4YOJA 2ZDMA 2FX4A 3EE7A 5JB9S 1BRCE 1GMCF 2KFWA 3RXSA 4AFUA 1ZPCA 1T8NA 2Y5HA 1GL0E 4O3TA 4XE4A 7KMEH 1LQEA 1PYTC 2Z3DA 5EG4A 2GD4B 2P8OC 2J38A 2ZA5A 1BA8B 1AZZA 2R3YA 3BTDE 3KHVA 1O38A 3RC5A 2QF5A 2GTBA 3NUMA 1GBHA 2UWLA 2WPKS 1L1NA 5CHBA 5DPAA 4ZUHA 4JCNA 3GYMA 3LJJA 2FOFA 1FXYA 4OS4A 4I8JA 2HVYB 1BZXE 2BB4A 3SNCA 2SGEE 3H5CB 4OGXA 4AB9A 4P00A 2J94A 5ETXA 1NY22 1THPB 1SHYA 2P3TB 1HAVB 1HBTH 5C2ZA 1SPJA 5LPFA 3UNRA 1MZAA 5E8EH 4KTCA 1QB1A 2ZKSA 1QB6A 4I86A 2UUFB 3S9AA 3PV5A 3PMAB 1L0ZA 4X8TH 2A4QA 3RXHA 3S0NA 3A8DA 3A87A 4FETA 3UR9A 2BDHA 2FOCA 1O3OA 3A81A 1AKSB 3IWMA 5EQSA 3BTHE 4QT8C 1HAVA 1CU1A 3AAVA 3W1EA 2ZFRH 2EI8A 2ZQ2A 1QB9A 2G00A 3SJOA 2YMSD 3VEQB 1T32A 2ODPA 3ATKA 1O33A 2V0BA 1KMHB 5AHGH 4ZKRU 4YZUA 4ZXXH
chains in the Genus database with same CATH topology
4B2CA 1BTWA 5TCCA 2LPRA 1DWCH 4K5ZA 3TU7H 2GVFA 3SHAH 1AE5A 1HNEE 2H9HA 2ZHFH 1QQ4A 2SGPE 5C1YA 3FVFB 3ZZCA 2C4FH 1GHZA 3Q76A 4FUGA 4GCHG 3HGPA 4WH6A 4B71A 2THFB 1QQUA 1RIWB 1AWFH 1ID5H 4DT7B 1O37A 3E6PH 3ZZ3A 3RP2A 1ELCA 1H9HE 4LK4A 1CHGA 1GHWH 1NO9H 1MQ6A 4YESB 1GI9B 1HV7A 4XDEA 1THSH 1AI8H 2Y7ZA 2A5IA 1O2YA 1J8AA 4RKJB 5T6GA 1YF4A 3BSQA 2Z9JA 4UE7H 1D3TB 1HUTH 1O2JA 5FXLA 1J17T 3RXEA 2ZTZA 2F9PA 3FANA 3T25A 1K1NA 4WF8A 4YLUA 4DIIH 2QXIA 1WSSH 1W11U 1BBRH 1SGTA 2QN5T 4X6PA 2BM2A 1TNIA 2JETB 1NT1A 5FBIA 4CRGA 1OWJA 3SO3A 3A8BA 1ETRH 1TX8A 1JMOH 3U1JB 1JRSA 3TGJE 3TH2H 4Q2KA 3ZVEA 3T5FH 2BVXH 3MH5A 4SGAE 1HPGA 2VNTA 3E8LA 2QGRA 1KLIH 1RJXB 3RXJA 2BMGB 3HK3B 5JBBS 1TPSA 4INHA 1A61H 4OGYA 1G36A 1DXWA 1A4WH 1TX7A 2GMTC 3WY8A 2HNTF 3R3GB 2VVUA 4F49A 5JPMH 1OP0A 1IQMA 4TWYA 2WPJS 1FPHH 5DP8A 1LVMA 1QGFA 3M3SA 3EDXB 2WINI 1AHTH 1CBWC 1HXEH 4MVNA 4ISOA 1YPEH 3QX5H 4ISHH 3FZZA 1UVSH 3M36A 2AH4X 1GJ7B 5E2PA 1DLKB 1GG6B 2Q6FA 1EZQA 1O3FA 2EA3A 2Z94A 2XRCA 3SZNA 1SLWB 3SGQE 2ZGCA 4JZ1A 4X2YA 4X1NU 1GI6A 2QCYA 1SI5H 3GY4A 3ZZ9A 4DCDA 5LPEA 2SNVA 1MKXH 1FY3A 5DP7A 3GISB 1MTUA 1KTTB 1VCQA 3BIVH 5EW1H 4Q7ZA 1OP8A 4DVAU 2GV6A 1Z8JB 4RSPA 3I77A 5GIBA 2F3CE 2FOHA 1BHXF 1O3LA 2A0QB 1MD8A 1DUEA 1FMGA 5CHAC 3RC4A 1GMHF 1PJPA 1DLEA 2G8TA 1T8OA 2ZHQH 1ZSJA 2I6QA 2VVVA 2VWMA 3Q77A 4JZFH 1MCTA 1UK2A 1G3CA 1YLCA 1JXPA 2Q6DA 1ZPBA 2ZDLA 3P8NA 3SN8A 1ARCA 1QL7A 2BDIA 2RCEA 1MQ5A 3F9HA 4ZXYH 1IOEA 1ETTH 3UPEA 2Y7XA 1FONA 1LVBA 1OS8A 1YM0A 2NU3E 3SNDA 1D3PB 1PPGE 1GBJA 1Z7KA 5JYIA 3MH7A 1LKBA 4Y6DA 1IQJA 5E0HA 4YOGA 3RXLA 5GDSH 2XNIA 2GDEH 3NK8A 4JZIA 2HWLB 2F9BH 1A3EH 2FYRA 1QURH 2TGPZ 3MU4A 3KF2A 1H8DH 1C5TA 1BCUH 3GY5A 2XBWA 3UQOA 4H6SB 3LGTA 4NIVA 1GMDG 4X6MA 4I8LA 3IG6B 1NTPA 1GI5A 2BLOA 3AASA 5EODA 4IS5A 2GCTC 3CS0A 4TPYA 1P2MA 1V2LT 1TGNA 3E90B 4XBBA 1P2KA 1DM4B 1ZMJA 3RC6A 4TY7A 3BEIB 1HJAC 1OWDA 1ZGIA 1S0QA 3SORA 1QA7A 3LGIA 2PW8H 1FN6A 5H4IB 4B76A 1VITG 3UREA 1NC6A 3RUOA 1X7AC 3QZRA 2XBYA 1O36A 4UDWH 4BXSA 2Z6BD 5BRRE 1AVXA 1YCPH 3GY6A 1XX9A 3MNXA 1AGJA 2LNCA 2SFAA 2GP9B 1C5QA 1ANDA 2D1JA 3FZDA 1PQAA 1ZHRA 2QV1A 3FP8E 4BXWA 3ZYDA 4B75A 1C1OA 2O8WA 2G4TA 2R0LA 4ABDA 1HAXB 3A7WA 5TJXA 1GMDF 4DURA 5AF9H 3MI4A 4GHQA 4KKDA 4A1VA 4JK6A 2O9QA 1PQ8A 2AIPA 1EZXC 3RDZA 2AIQA 4ABJA 1NRNH 2H1UA 2WPMS 1T31A 3SUFA 3OYPA 3LGVA 5SGAE 1S83A 4BAQB 2PKAB 4WVPE 2C8WB 1FZZA 3UY9A 4CBOA 3DFJA 3K6YA 1V2JT 3JZ1B 1NFXA 1O2XA 1GL1A 2BLVA 1BT7A 1KXBA 5HM9A 5AVDA 1IQHA 2ILNA 2BTCE 3ZVBA 2ZDAH 1CSOE 1EZSC 2J2UA 1MAYA 5FX5A 3F68H 1AB9B 3M37A 2RA0A 3IITA 4I31A 1AU8A 1G3BA 2OINA 2BDYA 3S69A 4IGDA 5DGJA 3SNAA 2ZTYA 1C2IA 1NS3A 4B1TA 3BTTE 4FUBA 2PUQH 1SGQE 2GCHG 2STBE 2A4OA 1Y59T 4INKA 3VXEH 2BVSH 3T62A 4BAOB 3UWJH 1BTYA 1K22H 2ZGJA 1K1LA 4K60A 4BAMB 2F9NA 1MUEB 4NSYA 3ZZAA 5JB8S 2CJIA 2G5NA 3EE0B 2Y81A 2ALPA 1V2VT 2FLRH 1DE7H 2QXJA 3D49H 2AS9A 4BTUB 3MU0A 3A7TA 1W13U 1WV7H 1Q2WA 1YKTA 3M7QA 1ZHPA 2A5AA 4A7IB 1G9IE 2Q6GA 1W7XH 1NRRH 1TRYA 3H7TA 1K1IA 4BTIB 3QZQA 3KQBA 3A82A 3TNSA 3ZZBA 1OOKB 2WPHS 2Y6TA 4I8HA 1FI8A 2ZP0H 2FM2A 3PTNA 5F8TA 4X8UH 3JZ2B 3PLKA 2XW9A 2BD8A 1HIAB 2O8TA 5DKMA 2Z7FE 2VWLA 1VJAU 3QTVH 1DUAA 4NFFA 1YBWA 2TGAA 3LGUA 3P92A 3UQVA 1FY8E 1Y3UA 2WPIS 4AG1A 1C5YB 5FBEA 2HPQH 1EJNA 3LH1A 1EASA 4X2XA 3PO1B 4JMYA 4H4FA 1Z1JA 1RIWC 2AMQA 2PLXA 3AAUA 2PSYA 3TJNA 3D23A 1BTZA 1GJ9B 1P3EA 4B2BA 3UTUH 1A0JA 2BVRH 3MHWU 1P10A 4AN7A 1P02A 3ATMA 1EJMA 4Y8XA 5HM2A 3VB6A 4ABGA 1S6HA 2K1QA 4DG4A 2V3HH 3ZVFA 1T4VH 2WYJA 1TONA 1DS2E 4KGAA 1GHAF 1K2I1 4DW2U 2ZDVH 3VXFH 3VGCB 4DJZB 3MO9A 3CS7A 3RMMH 3QK1A 1TPAE 3K2UA 2IPHA 3DT0H 1C1VH 2A7HA 3SOSA 2FI3E 2JETC 2P59A 2BY6X 2OBOA 2C90B 2Y5FA 4UD9H 3DFLA 1G2LA 4U30A 1TRNA 2A32A 2AMPA 1ZTLA 1ZGVA 2TGTA 2W5EA 3SI3H 1ZOMA 1QBVH 3RXRA 4A1TA 1F92A 2OQ5A 1VR1H 5FPSA 1PPCE 1XXFA 1TALA 1UVOA 2J34A 2ZCHP 2BD9A 1TNLA 3RXUA 3M61U 3SBKA 5EXNA 2QYIA 1ZZZA 2VWOA 2CGAA 1CA0B 1SOTA 1GWAA 1WYKA 1O3HA 1TPPA 2ZDNA 1AZ8A 1FIZA 3KQEA 4BOHA 3SJ8A 1IQLA 2O8MA 1O5GH 1PQ7A 1ELGA 1F5KU 1NFUA 2ZPQA 1P01A 1DOJA 3M5LA 1EAUA 3MYWA 3LH3A 1QCPA 1ZR0A 1UVPA 3RXIA 4O97A 1GG6C 7LPRA 2BDGA 1PPBH 3ZVCA 4IC5A 1K28D 3B9FH 2ZFQH 4H6TA 2W3IA 3RU4T 1AIXH 4WJG2 5DP9A 1S5SA 4IC6A 3UNSA 1F2SE 2ZGXH 1H8IH 5C5NA 3T27A 1W12U 1T8MA 3SHCH 1BTUA 2SGAA 2ZU1A 1SFQB 1BJVA 3ZVDA 3M3VA 2BDAA 2VINA 1ETSH 2JH5D 1W3CA 6LPRA 3E16B 4YT7H 2VVCA 1SMFE 1BIOA 3RLWH 1IQGA 2BZ6H 3RMLH 1AQ7A 2HOBA 4CR5A 1F0RA 4Y76A 1O3MA 4HZHA 4Z0KA 3PMBB 1JIMA 2KAIB 1C2JA 1DSTA 1O2LA 1LHDH 1V2WT 3RXVA 1GPZA 4GSOA 1OYTH 4X8SH 5E0JA 1SQTA 5C3NA 1AUTC 4UFGH 3UUZA 1UVTH 1P3CA 2BY9X 1TA6A 2P3UB 3SU2A 4THNH 3E1XB 3P8OA 2TIOA 1GDUA 1WQSA 1D9IA 2ZHEH 1GBTA 1ELFA 1GHYH 3QGJA 5F6MA 1MKWK 1FAXA 4J2YB 1NFYA 2R9PA 1GJBB 1NU7B 4NZLA 5DP6A 3V3MA 3GDUA 1GDNA 1ABJH 1A0HB 1TNHA 2ZWLH 1D3DB 1GBFA 1S84A 2GDDA 3TJOA 4FUJA 1DY8A 1Z71A 5HGGA 1UCYK 2ZCKP 2J95A 3A7ZA 1ELEE 5IYTA 3LPRA 4FUIA 3TK6A 1P11E 1O5BB 1QL8A 4ZKOU 4CBNA 3K9XB 2Z9KA 1TQ0B 3QO6A 2FLBH 1BTHH 1QY6A 4IMZA 1ORFA 1EJAA 1AKSA 1LPGB 6GCHG 1A5IA 1P0SH 3GY7A 4B2AA 2ODQA 2ZFTA 2ZPRA 3HPTB 3ZZ6A 4MPXA 2QXGA 2CN0H 3QDZB 4D7GA 1P06A 1TX6A 1O3BA 5J4QA 1PYTD 3D65E 2OXSA 3QGNB 1KDQB 5CE1A 2FYQA 3BF6H 1SLUB 4I8GA 1Z6EA 1KIGH 5J4SA 3TITA 1C9PA 4AGKA 2PSXA 1P09A 4INLA 1OKXA 3SU6A 1V2KT 1GHVH 3FFGA 1O2RA 1TNKA 1XVMA 2ANWA 3A83A 2EI7A 1QFKH 2UWOA 1C1SA 2BD7A 4IMQA 5ABWA 2JKHA 3SJKA 3A7VA 4O3UA 3S9BA 2A4RA 4I8KA 5EQQA 3BTGE 1NRQH 1TABE 2BOHB 4YT6H 1LPKB 1N6YA 2G55A 1AB9C 4MNXA 4TY6A 5DG6A 1A3BH 1KXFA 4B74A 1TMTH 3BV9B 1BUIA 4GCHF 1CE5A 4ABFA 2FI4E 2CF9H 1GGDB 1RGQA 3HATH 2R0KA 1WQVH 1HXFH 1DX5M 1GVLA 2W3KA 1NROH 3MNSA 1O39A 5C20A 3SV2H 1UTPA 3UR6A 1TIOA 3M35A 1A7SA 1KXAA 1KY9A 3L33A 3DD2H 1HAGE 1V2OT 1E0FD 3EYDA 1TOCB 2G4UA 3OU0A 4MQAA 4Y79A 4ISLA 2O8LA 1OX1A 1O5FH 1LHEH 1P8VC 1J15A 4LXBH 1C5SA 1QJ1B 1UCYE 1FAKH 2YNBA 2NWNA 4D8NA 1YGCH 3E3TA 1Z6JH 1G37A 1TB6H 3B23B 3GCHB 3M3TA 2Z9LA 4TYDA 2H9EH 2ZC9H 1BMAA 2J4IA 3SJIA 4NCYA 3LKWA 1P2QA 1Y3XA 2G52A 1SGIB 1O2HA 1Q3XA 8ESTE 2NU4E 3A89A 2AGIX 3MOCA 1C2FA 3ODDA 1BITA 2ZFSA 1BTXA 5I46H 1NRSH 1C2LA 2FOGA 4WY3A 1V2ST 5FAHA 4AYVB 3BTKE 3TVJB 4MDSA 1LVOA 1O31A 3SQHE 1L4ZA 2IOTA 2Y80A 1NU9A 2ZTXA 1O34A 4D7FA 1XUKA 2W7UA 1TA2A 3PO1C 2ZG0H 1O2WA 1ZYOA 4ZHMU 1GBMA 1EB1H 1KSNA 1NESE 4WMEA 3O8BA 2OTVA 2NU2E 5JBTA 1BMLA 2YNAA 2R2MB 2JH6D 4ZMAH 1LHGH 1O35A 1HAPH 4AGJA 2GKVE 1SGRE 1ESTA 1GBCA 4Z6AH 4WMDA 5DP4A 1O2QA 1HLTH 2AYWA 2B8OH 3P6ZB 1UHBB 3DUXH 1SBWA 1AUJA 1C5PA 1FUJA 1SL3A 3LU9B 2W26A 3GICB 3OX7U 2ZCLP 1XXDA 2VIVA 3PYHA 1YPLH 1LKAA 4NA7A 3VB3A 3EQ0H 1W0YH 3NZIA 3TK9A 3VGCC 1C4U2 3RMNH 1C1MA 1O2NA 1JIRA 1CA8B 5F03A 4DGJA 4ZKSU 2HLCA 1ZSLA 3ATWA 2XXLA 4AYYB 1ELTA 5LGOA 3GDVA 3ZV8A 3LC5A 2GX4A 2Y5GA 3FP7E 1U6QA 3F6UH 3TNTA 5FCKA 2BLWA 4X8VH 1G3DA 1G3EA 3LDXH 5I25A 2I6SA 3CENA 1EX3A 3SNEA 3U69H 4ABAA 3EAJA 2STAE 1DICA 1W10U 1BOQA 1UTOA 1UTMA 3RXMA 1GBAA 1SR5C 1CA0C 5F8XA 1N8OB 2PGQB 1VZQH 3F9EA 2SGQE 8KME2 1E37B 1OWEA 3A8AA 4WMFA 3M5OA 2BQ6B 4ESTE 1K21H 2ZIQH 2C3SA 3GOVB 5GCHG 1A0LA 4LOYH 3PB1E 4U01A 1TMBH 5ESTE 4A92A 3KN2A 4GPGA 3ENSB 4FXGH 5EXMA 3TJVA 1B0EA 3GCTG 3PLPA 3V13A 5L30H 1Y3YA 1VCWA 3SV9A 1DSUA 1OSSA 4FVBA 1GJAB 1MD7A 3EA9A 4ABHA 2W7SA 3TJUA 1LTOA 2FMJA 4FUFA 1V2MT 2TRMA 3HKJB 3RXGA 2BD4A 3E91A 4NA9H 2FWWA 4WXVA 4VGCB 1AE8H 1J16A 2ANMH 3KIDU 2P93A 3AW1A 1JRTA 2BQWB 1D6WA 1IQNA 1AFEH 1DWDH 2PGBB 1GI4A 1XUGA 3SGBE 1VITF 2OD3B 5A0BA 2ESTE 3D62A 3A80A 2YOLA 1GJ5H 1CVWH 1O2SA 4Q80A 1PFXC 2WPLS 1YLDA 1GBEA 2EI6A 5FPYA 1V2QT 5DO4H 4TWWA 1TGTA 1HAIH 2PKAA 1BRUP 3RLYH 1XKBC 1EATA 2Z9IA 3RM0H 1C5LH 3O8CA 3K65B 1FY1A 3SGAE 2ULLA 1DT2A 1P2OA 2R3UA 1C2KA 1FJSA 2BDBA 3MWIU 3MFJA 2IN2A 5IDKA 3QTOH 2Z3EA 3ITIA 3MU8A 4AZ2B 2PUXB 4CH2B 2BD5A 4IN2A 1H9LB 5GWZA 1IHTH 4OS2A 1ZJDA 2WUBA 3SV6A 3MO3A 7GCHG 2DE8A 3ODFA 1GI3A 4K2YA 4HTCH 1DXPA 4ZKNU 1AFQB 1GHBG 1O3JA 3LIWA 8LPRA 3MU5A 4X6NA 5JBCS</