1UTMA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN I
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA02
4Y7BA 1B0EA 1G3BA 1ZSJA 5JYIA 4ZKSU 2Z9JA 1C1WH 1W14U 3ZZ3A 2FI3E 5E2OA 3E8LA 1MU6B 1NFWA 1ELCA 1DXWA 1LPZB 2ZFRH 1O5CB 1DSUA 4INHA 1A3EH 5T6DA 2UWOA 4RN6A 4RKJB 1ARBA 3SNDA 2WPJS 5C1UA 5FBIA 1ZRKA 5C5OA 4D7GA 2WV4A 3E6PH 3A8BA 1L4DA 4VGCC 1WTHD 3V0XA 1BTYA 2FODA 6ESTA 1QL9A 2OUAA 1XUJA 3DT0H 1HAYB 1AFQC 1HIAB 2UUJB 3A7TA 4DW2U 1UTPA 3P8NA 1UK3A 3RXVA 3RXJA 3RXQA 3EYDA 3S7KB 1UTKA 2R2WU 1SGYE 1DITH 3SQEE 2BD5A 2IOTA 1YPJH 4NA7A 1BTZA 1ESAA 4X8SH 4CREA 2A5AA 1WCZA 4UFDH 5LGOA 1C5XB 1MAXA 3F1SB 3ZVCA 3RXGA 2OXSA 2H9EH 4IMQA 1G32B 2OINA 1SB1H 6CHAC 3T2NA 4Y71A 1XVMA 5J4QA 3U8TH 5GXPA 2QY0B 1F2SE 2SNWA 4CRAA 3SU0A 3WY8A 1MTSA 4B71A 1TGSZ 1A5HA 2V0BA 2ODQA 3BTEE 4JMYA 1ZJKA 1UTLM 1QBNA 1CO7E 3P8FA 2HNTC 1QJ7B 2GCHG 1F7ZA 2WPKS 5T3HA 1J15A 1P2IA 1XX9A 3GY8A 2VIQA 4Y11E 1UVOA 4SGBE 1UJ1A 3VXEH 2H9HA 2G4UA 3A87A 3KEEA 2XBYA 1P10A 4JCNA 4THNH 3A81A 2F91A 1TOMH 1K1IA 2A45B 2V3OH 2QC2A 1O5FH 3S9BA 3VB5A 2HWLB 4E05H 2TPIZ 3SV8A 3M5MA 1GHBF 1IAUA 1CT0E 1Z8JB 1HYLA 1ANEA 3PMAB 5L6NH 1O3BA 1SL3A 2Y5GA 1W8BH 4U2WA 2BD9A 1GGDB 4KP0A 3ATIA 1DX5M 2ZA5A 3Q76A 3FVFB 1SFQB 3SUGA 3RXOA 4UDWH 1VJ9U 3ZZAA 1DM4B 1K9OE 1VJAU 1G2MA 1T8LA 1Y5AT 3T29A 2ZZUH 4X8UH 5L2YH 1SSXA 2O8TA 1SGNE 3KCGH 1XM1A 3MH7A 1TA6A 4NIWA 5A09A 1S82A 3UY9A 5DP7A 4A5TS 1YGCH 1BMNH 4LK4A 1O5EH 1ELEE 1HAVB 3ITIA 4TWYA 5L2ZH 3SU3A 1HAHH 1UK4A 1V3XA 1DY8A 1IHTH 3OY6U 2BX4A 1RTKA 2F9BH 2UWLA 3KN2A 4MTBA 8GCHG 3A8CA 1KXAA 2VVCA 1EZQA 1QY6A 1RXPA 3LGUA 1QURH 1SGQE 3MTYA 4SGAE 4KKDA 1VITH 2HRVA 3HGNA 1GI7B 3RXTA 1O2OA 2UUFB 1AU8A 3S9AA 1C4U2 1WQSA 1AE8H 1ARCA 3SI4H 1NM6A 4X1NU 1LHCH 1Y8TA 2ZPSA 1FIZA 2A7JA 2CHAC 1UVSH 2CF8H 4FUBA 1QQ4A 1W12U 4Z6AH 5FCKA 1QRXA 3IWMA 3OX7U 1BTWA 1THPB 2OQUA 3TJVA 2C93B 4WMEA 3V7TA 4Y7AA 3HK6B 1K22H 1E36B 1Y3YA 1UTQA 3URDA 2ZTYA 1MKWH 3RC5A 4ZROA 3L3TA 3T28A 3ELAH 2FOBA 4GPGA 1HAIH 1KYNA 2ZWLH 3P95A 3LGWA 1P11E 1XXDA 2C4FH 3NCLA 1YP9A 4BXWA 3LOXA 1SVPA 4INLA 1NFYA 1NESE 2P93A 4GLYA 5DP5A 1ZHPA 1V2MT 3PM3A 1GI6A 4Y0YE 4FUIA 2AEIH 2AIQA 3L33A 4MVNA 3TPIZ 1EX3A 3O8RA 2BDGA 4GSOA 8GCHF 1BTXA 1GWAA 3TGKE 1AHTH 2RG3A 1AMHA 2ANKH 2VWLA 2VWOA 1BITA 1SI5H 3ZZ8A 2FEQH 3LONA 3MMGA 2ZO3H 3TJNA 3U1JB 2FO9A 5GJ4B 1S84A 1J16A 1C9TA 4BAQB 1NT1A 1GL0E 2R0KA 1C1MA 3CS7A 1OYTH 1P3CA 1GBEA 1P57B 4FU9A 1IOEA 4LZ1H 1PPGE 2FLRH 3SN8A 1QL7A 1BDAA 2EI7A 3PB1E 2PLXA 3F6UH 2AMQA 3SU2A 2QAAA 2P16A 2ZIQH 1TMUH 1JWTA 4AB8A 2OC0A 1PPHE 4GUXA 1BOQA 1LO6A 1KXBA 4KGAA 1BA8B 5FCRA 1C5UA 4LZ4B 1RRKA 1HFDA 2GX4A 4NIXA 4LXBH 3S69A 3VB4A 3SJKA 4O97A 1Z1JA 4HTCH 5HM9A 1ACBE 1SLWB 2M5TA 2G52A 4BAMB 1C5TA 1H9IE 1X7AC 1EP6A 1TNIA 3VB7A 3BTME 1MQ6A 3MNXA 1QRWA 3ATMA 4AN7A 2ZFFH 5K7RA 1C5NH 2Z94A 1Y5UT 1PPZA 1FXYA 3RM0H 1G9IE 1FZZA 1T8OA 1GHZA 1S81A 2CXVA 3ZZDA 1GJ4H 1O3PB 2Z7FE 2ZHQH 1GBLA 2QF3A 3MOCA 3FAOA 4ABIA 1ETSH 2QXIA 4CRGA 2Z9LA 1GJ6A 1O2YA 3PMHB 6GCHG 3QZQA 4UFGH 1QB6A 2PW8H 4WXIA 2BVSH 2B5TB 2WUBA 4I8LA 1GI8B 1S6HA 2A2XH 1P2KA 4MLFB 1Z71A 5E8EH 2ZDVH 1W3CA 1MKXH 3MYWA 1OWHA 1C4V2 3ATWA 1UCYE 2I6QA 1FY5A 1AZZA 1TABE 2FI4E 2O9QA 3NPSA 2J94A 3S0NA 2Y81A 1HAOH 2V6NA 1C1VH 4H6TA 3ZZ9A 2A2QH 1TONA 3K6YA 1YM0A 4BTIB 1T31A 4IGDA 1TNLA 1AQ7A 1CA0B 4IN2A 1DY9A 1RS0A 4NG9H 1SMFE 4MPUA 5F8TA 2BD3A 3PLPA 1EB2A 1DS2E 3RMMH 1J8AA 3M3VA 1CA0C 1TMTH 1O32A 1GI5A 1M9UA 1ANBA 1PPBH 1T4UH 1O3OA 1UO6A 1LTOA 1GI9B 1FLEE 1WOFA 1GVLA 2P59A 1O2LA 2QYIA 5FPTA 2BDHA 2FS9A 4I8HA 3M61U 1C5ZB 2A1DB 1C5VA 3K9XB 1YPKH 1EZXC 1S85A 1UVTH 4O3UA 3NWUA 2G5NA 2BDCA 1TA2A 1AWHB 3F9FA 1XUHA 1BTHH 1QHRB 2FX4A 2V3HH 1G3EA 1YYY1 3M37A 3ZVGA 1T8MA 2GCTC 3E3TA 1H8DH 2PTCE 1Y59T 1TPPA 4ISNA 1F5LA 2PTNA 3S9CA 4I33A 4H42U 1CT4E 4JZIA 2WYJA 4B2AA 5JB9S 1D6RA 2BQ7B 1F0SA 3PO1B 4A92A 1VGCC 1IHSH 2F9UA 3AAVA 4K8BA 2ZHFH 1PPCE 2NWNA 1C2LA 5HM2A 1F5RA 2ODYB 2C8ZB 4DURA 1QB1A 1RFNA 2BQWB 1JRTA 4Y10E 2IN2A 2Z6BD 1B0FA 5DJ7A 3RLYH 1P06A 2P3FH 4MNVA 1G36A 1TB6H 2QXGA 3T26A 3LGTA 5IYTA 1K21H 2VIWA 3M5NA 2J2UA 1DICA 4ISIH 4CRDA 1W7XH 3UWIA 1KTSB 3A7VA 1L1JA 1AKSA 1MBMA 1VITF 1A1RA 4YOGA 5I46H 4OS6A 3TH4H 4I7YH 1BTPA 1EPTA 5FHTA 3BG8A 7ESTE 4I8GA 1GDQA 2STAE 3U1IB 1YC0A 2FP7B 1QGFA 1SR5C 3VPKA 2LNCA 2WINI 5CMXH 2PHBA 2ZCLP 4JK6A 2AYWA 3M7UA 1P0SH 2SGDE 3BTGE 3FZZA 2ZGJA 4D9RA 2AMDA 1XUKA 1HIAA 1AVXA 1LDTT 1NTPA 2XW9A 1V2OT 1UTNA 5EQRA 1ESBA 1EJAA 1QR3E 4E7RG 1C5RA 3GOVB 1BZXE 2IJOB 3TJOA 4X2VA 4Y76A 1IQEA 4MG3A 3SHCH 4NZLA 1SGFG 2VH0A 3TIUA 1GCTB 2XBWA 4BXSA 7GCHF 3C27B 1KXCA 1CE5A 3ZVBA 1GBFA 2EA3A 3PTBA 4IC6A 3SW2B 4OS4A 1A61H 3OSYA 1IQNA 5EU8A 1J14A 4CH2B 3QDZB 1ZHRA 2BYAX 2FOFA 1O3JA 2GDEH 1TWXB 3LC5A 1YPHC 1TNHA 2A4GA 1ZZZA 3ZZ5A 1BJUA 4PROA 4CRFA 5ESTE 2TRMA 2UWPA 3SJ9A 3RU4D 1LQEA 3E1XB 2ZCKP 1O3KA 1CBWC 4OS5A 1GMHF 4A1TA 5HGGA 2G5VA 2EI6A 3ESTA 1EZSC 1AUTC 2AMPA 4BTTB 1MKWK 2BX3A 1KDQB 2FI5E 4H4FA 1V2JT 5G4BA 1UHBB 2FOMB 4FUEA 2K1QA 3PO1C 1H4WA 2QF0A 4MPXA 2R3YA 3PV4A 2THFB 1C2JA 1L2EA 3RXAA 3A88A 4M7GA 1BUIA 3F9HA 1T7CA 1V2ST 1O5AB 2PR3A 3RMOH 4UE7H 4NFFA 2PUXB 4JZ1A 5JBAS 2TGTA 4Q7YA 1GBBA 2PKSB 5F6MA 1LVMA 1DUAA 2FTLE 3GCNA 1KSNA 4FVDA 3RXBA 2CHAB 1TQ0B 1GBHA 3F68H 4KELA 1OSSA 2H6MA 4IC5A 4DCDA 3GCTG 1CSOE 1EATA 2XC0A 1YCPK 3ENSB 3SNCA 3TITA 1VITG 1YCPM 1D3TB 1SGCA 1MTWA 1O3HA 1ZHMA 2FWWA 1A7SA 2ODPA 1TPSA 4ZKRU 2FESH 1U6QA 1A0HB 2FX6A 1O37A 4ZH8A 1K1NA 1CGIE 3ZZ4A 1V2QT 3QGJA 3EA7A 3G01A 1TX7A 4ABAA 1HRTH 4ZHMU 2JH0D 3LH1A 2OBQA 1GBMA 1H9LB 1QCPA 2VJ1A 3GCTF 3UR9A 1JOUB 1GBIA 3BTKE 2GVFA 3RXSA 1ESTA 2R9PA 4VGCB 4AFQA 2OLGA 1BRBE 1C1RA 2NU0E 2VVUA 3AW1A 1GVKB 1RD3B 4OS7A 1ID5H 5C5NA 2DE8A 2GZ8A 1Z6JH 3LU9B 3UUZA 4MPWA 1LKAA 3W94A 1PQ8A 3E0NB 2FOHA 1Q3XA 2P8OC 3SBKA 5DP6A 3GCHC 1Y3WA 2PSYA 1SFIA 1C2IA 2QIQA 1CGJE 3VXFH 1AY6H 1O2WA 3AAUA 2OQ5A 1C2DA 1DFPA 3QN7A 1A0LA 1VCQA 1V2WT 3ZVAA 2HPQH 1V2NT 1FONA 1O3IA 2G51A 1JIMA 1D4PB 3BSQA 2TGAA 4YLUA 1C2FA 3GY4A 1P09A 1FY3A 1VCWA 2O8UA 2ZNKH 3TH3H 1DVAH 4B2BA 4NSVA 4O03A 1O3LA 1O3EA 2J92A 4AG2A 2V35A 3ZVDA 1A2CH 1QB9A 1NFUA 2TGPZ 2Y80A 1TBZH 1B7XB 1O3CA 3STIA 3QGNB 3GCOA 2GCTB 2RA3A 2ALVA 2NU4E 1L1NA 1TNGA 1TGNA 5C1XA 4IBLH 2P94A 4RSPA 4OS1A 1OP0A 4ZXYH 2ANMH 1TMBH 1VGCB 3QX5H 1KLJH 1H1BA 4JZFH 4AX9H 1GHBG 1EAWA 3DHKH 3V13A 1A0JA 1O34A 1NRPH 1O2QA 2NU2E 3MU1A 3MI4A 2ZGBH 1PYTD 5A0CA 3JZ2B 5JBBS 4CRBA 2GDDA 5AVDA 3TU7H 1HBTH 4FVBA 5I25A 1W13U 2Y7ZA 2ESTE 1GJBB 1AI8H 1TGCA 1FY8E 1P8VC 3DFJA 1O3FA 3BTFE 1D9IA 1INCA 5AFZH 1GDNA 2STBE 2ANWA 4JZEH 3BEUA 2ULLA 2ZQ1A 5EODA 4ABJA 1F0UA 2OTVA 1EQ9A 1EXFA 1CU1A 1V2PT 1ZTJA 3UTUH 2ZPQA 9LPRA 2HLCA 1O38A 1UTOA 1UVUH 4ASHA 2F83A 4E06H 4ABEA 3BF6H 2ZHWH 1S5SA 3RXUA 2AGEX 2FOAA 3TNSA 1K1JA 1NU7B 1F92A 2ZDMA 5A8YA 2CGAA 4YOJA 3SNEA 3ATLA 3LH3A 1GJCB 2B7DH 1KLIH 1MD7A 4DIHH 1GI1A 4GCHG 2VIVA 1QA7A 5LPRA 5AFYH 2Y5HA 1TRMA 1C5WB 3H7TA 2ZU2A 1EP5A 4ZKNU 2AGIX 3BIVH 4MPVA 1AB9B 1MTNC 1O2KA 1SLUB 3FZDA 4Q7ZA 4WY3A 1E0FD 2XC4A 2F9PA 3QTOH 4HZHA 1BRAA 2ZU3A 4O3TA 3MH5A 4Q80A 3NK8A 3HPTB 2FYQA 1JRSA 3BV9B 1HAXB 4K2YA 1O30A 3KGPA 4ABGA 1GJDB 2J9NA 5GWZA 2F9VA 2FOCA 1ELFA 4JZDH 4K8YA 4WWYA 5A0AE 1Z8GA 2QA9E 2GGVB 1GI0A 3U8OH 3ODDA 3MHWU 1K1OA 5TJXA 4JYTA 5DG6A 3M5OA 1O3AA 1GG6B 5CE1A 4AFSA 1EPTC 1HJ9A 4YESB 1C2MA 3LDXH 1BB0B 4ZHLU 1GHAF 2BY7X 1UCYK 4WMFA 3ZV9A 1HCGA 2GZ7A 1AD8H 2SGPE 3RXDA 3RLWH 2WYGA 4BOHA 4UFEH 1FPHH 2JKHA 1GCTC 1UHBA 1ELAA 1N1LA 2ZECA 1GBDA 2J38A 3MH4A 1BT7A 1SGTA 1O35A 2KAIA 5DPAA 3EA9A 4OGXA 2HPPH 2P95A 3RDZA 5IDKA 4ABDA 2XTTB 2YNAA 3RXCA 4IW4E 1UVPA 6CHAB 4UONA 2OC1A 1HV7A 1DANH 3C1KA 3U69H 1Y3XA 1C1TA 5BPEA 2VIDA 1ELGA 4DY7B 2A4QA 2A4RA 3D65E 4XBBA 2H2ZA 1RGQA 4B74A 3M7TA 4K1SA 3E0PB 4AYYB 1KDQA 2ZU5A 4O9VA 1MZAA 2QCYA 4JYVH 5EPNA 1BRUP 1VR1H 1GJ7B 1ELVA 5F8ZA 4OGYA 1FY1A 6GCHF 2BLQA 6LPRA 4AG1A 3EGKH 3ZZ6A 5K0HA 2ZDKA 2ZEBA 2BLWA 1FY4A 5C2ZA 1C1OA 2WUCA 4I32A 4A1XA 1HAPH 2TIOA 1MUEB 1ZMJA 5DO4H 1GJ5H 2NU3E 1O3MA 1GBCA 4Y0ZE 1P04A 4J2YB 1EAIA 1SGEE 4WXVA 2VB0A 2D1JA 3MU0A 3HK3B 4WJG2 4YT6H 3GCHB 4HGCA 1LMWB 1OYQA 1P9SA 3HKIB 2P3UB 4TY6A 1GHXH 1WSSH 4AGKA 2FOGA 4ZMAH 4CHAC 3UQOA 1GGDC 3UNSA 5C20A 2HVXA 4IS5A 3M5LA 2PFEA 1Z6EA 2ZFSA 4X2WA 1T4VH 1BJVA 1E38B 4TPIZ 1PQ7A 3B8JA 1F0RA 1MQ5A 4FUHA 3SV2H 4WH6A 3P8OA 1PFXC 1IQGA 2VINA 1ZGVA 3VB3A 1C1SA 1P3EA 3AASA 5E2PA 1OWJA 3VGCB 2VGCC 3JZ1B 1G3CA 1KLTA 1XUGA 1BCUH 5DKMA 2RCEA 5AHGH 5DP4A 3RXKA 5HXFA 2BY9X 3OYPA 4CR5A 3ZV8A 8LPRA 1GBAA 1DT2A 2VU8E 4DIIH 1Y3UA 4ABHA 1ORFA 4ESTE 1GG6C 2A5KA 3URCA 1MZDA 1OKXA 2OD3B 3P92A 4ISOA 3UIRA 3LT3A 1BHXB 3RXFA 2ZP0H 2W3IA 3PWCA 2BD2A 3KQEA 3PYHA 1FNIA 1ZPCA 4IN1A 5E0JA 2JETB 2Z3DA 5ABWA 1Y5BT 4NIVA 1RTFB 4Y79A 5TCAA 1G3DA 1Z7KA 2BB4A 2QV1A 2BY6X 1V6DA 3KQBA 4I31A 2XBXA 1LVYA 1ELTA 2DE9A 1QNJA 1KY9A 2BDIA 1K1PA 4K1TA 3TK5A 4MNYA 4YO9A 1YPLH 4Q7XA 2FTMA 3OTJE 4CRCA 4X1PU 4A1VA 1O2IA 2VIOA 2XBVA 2XYAA 1ZSLA 3LGVA 4FUGA 2HALA 1FI8A 3RXMA 4BTUB 1ZGIA 1C1UH 4NA8A 2RA0A 5EQSA 1CA8B 1SGRE 2XNIA 1MMJN 1A3BH 4GCHF 3VGCC 1HXFH 1S0QA 5GIBA 1XXFA 3MO6A 4FUJA 2C3SA 1L4ZA 3SV6A 1G2LA 2BD8A 2GV7A 1DDJA 1GBKA 3QLPH 1OS8A 3BG4C 1W7GH 2Z9GA 1W11U 4XBDA 1EASA 2ZGXH 3TGJE 2Z9IA 3BG4B 3A84A 2H1UA 5HMAA 7KMEH 1W0ZU 1NY22 5JDUB 1TGBA 2BDYA 2SGEE 1ZPBA 4AORA 1HAZB 1NN6A 1NZQH 1SOZA 1C2HA 4ZHAA 1DE7H 3EA8A 4H6SB 1N8OB 3DD2H 1EJMA 1BMLA 1SGDE 3MNSA 3NKKA 1GI3A 1PPFE 1EB1H 4D76A 2JH6D 2ZGHA 2B8OH 3TK9A 1UMAH 1ZPZA 1YPEH 3L6PA 1E37B 5FPYA 1TGTA 3D23A 1C5PA 3EAJA 1TRYA 3FP8E 1QRZA 5JPMH 1W0YH 5ESBA 3ZZBA 4A6LA 1V2RT 4MQAA 3FP6E 2UUKB 5EPYA 1S6FA 2SNVA 2P8OB 1HJ8A 2XCFA 3A86A 1TQ7B 2ZF0H 2AIPA 1CBWB 1LHEH 1TE0A 1Z8IB 2F9NA 4BAOB 3LPRA 1GDUA 1GHWH 1FIWA 1HDTH 4K5ZA 1O2SA 1GMCF 3AW0A 3PROA 3T27A 1IQJA 1C2GA 2BY8X 2Y6TA 2A7CA 2W7UA 1SPJA 2TBSA 1GHVH 1OWKA 1NRSH 5FAHA 2HOBA 3Q3YA 1QBVH 3P70B 4X8TH 2WPMS 4WVPE 4CH8B 1V2VT 3SHAH 1O36A 1JXPA 1V2TT 5AF9H 1P2OA 4CR9A 1XKBC 3QZRA 2BD7A 1WYKA 2SGAA 1A4WH 1T8NA 1GJ8B 4I8KA 3F9GA 3SNAA 3P8GA 1GI2A 4IMZA 1JIRA 2BTCE 2C8XB 4X1SU 1FJSA 3H5CB 1Z8RA 4YOIA 2BM2A 2BLOA 1O5DH 1SQOA 4RKOB 3TVJB 4WF8A 3K2UA 1C2EA 1WAYB 2AGGX 4XOJA 4ZKOU 1AFEH 2FIRH 1QJ6B 1YPHE 4Z0KA 1ABJH 3S7HB 2OBOA 1C2KA 3M35A 2ZGCA 1O31A 3RC6A 1WBGB 2OC7A 4FU8A 3UREA 3GY2A 3O8DA 2J34A 1GMCG 1SOTA 1DXPA 3FP7E 1OWDA 1A5IA 3SQHE 3M3SA 4DG4A 2ZI2H 4DGJA 1P05A 4NGAH 3MH6A 1CQQA 3BEIB 3STJA 2ZFTA 2QGRA 2BDAA 3I77A 1K1MA 2GT7A 4UEHH 3PLKA 1TOCB 4D7FA 4BAKB 5DGJA 3UFAA 1P01A 2VNTA 2W7SA 1HNEE 1O3GA 2ZQ2A 1THSH 1P2NA 1HAGE 2BD4A 4ABBA 1AKSB 4X2XA 3F9EA 8KME2 5EOKA 4NA9H 1N8OC 1EOJA 3B9FH 4DVAU 1ELDE 1YPGH 1GHYH 1HUTH 3HGPA 2XXLA 2ZU1A 2GD4B 3T5FH 1C5QA 5EGMA 1BBRK 1FDPA 4YLQH 1C1QA 1BTUA 2F9OA 1O2VA 4FUDA 1Q31A 1O2PA 1LPGB 4GHTA 1VZQH 3DFLA 2D2DA 1T32A 2Y5FA 1ETRH 2C8WB 4ZAEA 1MKXK 1S0RA 2G81E 3EE0B 3KQDA 3A83A 4TWWA 3KNXA 3MU5A 1IQFA 3SJIA 1FQ3A 5BRRE 1SHYA 2A0QB 1DOJA 5DP3A 4UD9H 1V2KT 1ZYOA 2QXHA 5C3NA 1P2JA 5ETXA 4Y8YA 4X1QU 3RU4E 2ZC9H 1WU1A 1L0ZA 5TCCA 1VCPA 4NCYA 1NRNH 2G8TA 1ZSKA 1UTJA 4R8TB 4OS2A 4X8VH 5H4IB 2A31A 3ZVFA 1ZLRA 7LPRA 1G37A 4J1YA 4ZUHA 2GP9B 2GKVE 3KIDU 3UOPA 2D26C 4HFPB 4NSYA 3BTTE 1K28D 1LVBA 4B73A 2ZDLA 1AUJA 3IITA 4CHAB 1IQKA 5C67A 3GY7A 1OXGA 3SO3A 2BHGA 2JH5D 2WPLS 4XFQA 4DJZB 5A8ZA 1V2LT 1BQYA 1SBWA 3MO9A 1QFKH 3SOSA 3UNRA 4A7IB 1RJXB 3PMBB 3EQ0H 1SGPE 2GT8A 1FAXA 3RMLH 5LPFA 2FDAA 2PGQB 2ZCHP 3MWIU 3CP7A 4BNRA 1L1GA 2HGTH 3D62A 3GICB 3I29A 4FUFA 1OP2A 4Y8ZA 2EC9H 1AWFH 3GYMA 2PWXA 4YZUA 5GDSH 3FANA 2Q1JA 1WQVH 2UUYA 2FXRA 1RIWC 5A8XA 1ZMLA 3QUMP 1FV9A 1DWCH 1EPTB 3GY5A 1QTFA 4GAWA 3QK1A 3ZYEA 4K60A 1O3NA 1K1LA 2Q6GA 1ZTKA 1KXFA 1Q2WA 1O2XA 2H9TH 2PKAA 3TJUA 3U8RH 2B0FA 4R0IA 2EEKA 1NRRH 2CV3A 3TNTA 1ANCA 2O8LA 3NUMA 1HPGA 3U9AH 2G00A 3A8AA 1YLCA 2LPRA 1GI4A 1O2HA 4QT8C 4D9QA 1E34B 1JMOH 3GDVA 3I78A 3R0FA 4YTAA 4AOQA 3LC3A 2Y82A 1DPOA 5FX5A 2GMTB 2I6SA 4AB9A 2W26A 2GTBA 2FMJA 1AB9C 1MTNB 2Z9KA 1TALA 3SU1A 3SV9A 2FOEA 1DLKB 1XKAC 2VWNA 1NS3A 3SU6A 4XE4A 5EG4A 4AFZA 2AS9A 2P3TB 1SC8U 1ZR0A 1O2UA 1FMGA 1LCYA 1THRH 4Q2KA 1GVZA 2BMGB 4GVUA 4ZXXH 4CBNA 2ZKSA 3OU0A 3MU8A 5EQQA 3TLOA 1EAUA 4X2YA 3T25A 2ZFPH 2VIPA 4TPYA 1EJNA 1SQAA 2GV6A 1BMAA 1C1PA 1GHAG 1KTTB 3SNBA 1MU8B 3LKWA 1ZTLA 3ZZCA 2CMYA 3BTWE 1AFQB 1O2MA 5CHAC 1LHGH 1LKBA 3PTNA 1Y3VA 5F03A 1BBRE 1J9CH 2FLBH 2NU1E 4MDSA 1P2MA 1MBQA 1HGTH 1SQTA 3BTDE 1EUFA 1P12E 2PKSC 3ZZ7A 1SLVB 1BMMH 1HXEH 1WUNH 2GCHF 2BZ6H 2A4OA 5JBTA 3SJOA 1HJAB 3E91A 2ZTZA 3TGIE 4YT7H 4JK5A 5LH8A 3GYLB 1DWDH 5A0BA 1OPHB 2ZTXA 1DWEH 3BTQE 2VH6A 1QBOA 1WTGH 2ASUB 2VWMA 3KHVA 1TX8A 1BIOA 3UOUA 4E7NA 3FFGA 1MCTA 1TBRH 1ABIH 1YF4A 1G30B 1TX6A 3KL6A 3U98H 3B23B 4NFEA 1BRCE 1TFXA 1W2KH 3QWCH 3RXPA 3A7WA 2SFAA 2ILNA 2PKAB 3SUEA 1TLDA 1EOLA 3Q3XA 3GY6A 1UK2A 1XUFA 3SGBE 1PPEE 1TNKA 3K6ZA 1BHXF 2DUCA 1O2ZA 5FBEA 3P6ZB 1O2NA 2ZHEH 3KF2A 3SZNA 1OP8A 1SGIB 1MAYA 1XUIA 2XCNA 3Q3KA 4U30A 4KTUA 2WPIS 3SJ8A 4U32A 4YM9A 1TYNA 1SLXB 2FYRA 1EKBB 1MCVA 3RXIA 3A85A 4XSKU 1F5KU 3E16B 1LQDB 1OOKB 3H7OA 1MTVA 2SGFE 5J4SA 3RU4T 2D8WA 1QIXB 2CJIA 4AGJA 1MTUA 3UQVA 4I8JA 3A8DA 1O5BB 4B1TA 4K1EA 4F4OC 2O8WA 3ODFA 4B75A 1CHGA 5JB8S 1GMDF 2ZG0H 2YOLA 1QA0A 1CT2E 1NC6A 4TY7A 2C8YB 4F49A 1N6XA 1GCDA 1NU9A 1P03A 2BVRH 1O33A 3MNBA 3RXRA 1DUEA 2BY5X 1D3QB 4D8NA 1XMNB 2W3KA 1H9HE 5E0GA 5B6OA 3CENA 2J95A 3SORA 2VVVA 2HNTE 1SHHB 3NZIA 5EXNA 2ZDAH 3DA9B 1YCPH 4K69A 2FZZA 3TK6A 4X6OA 1FAKH 1RIWB 1ZMNA 1DWBH 3CS0A 4BANB 1TPOA 2C90B 1JBUH 2Q6DA 4ISHH 3SV7A 5EW1H 4UFFH 2OC8A 4NZQA 3K65B 4MNWA 1GBTA 1K2I1 1GMDG 1GJ9B 4TYDA 5CHAB 3GDUA 3MU4A 3PLBA 1SGFA 2OP9A 1OX1A 2QN5T 5PTPA 1B5GH 1GBJA 1BBRH 2BLVA 3TH2H 4B2CA 2QXJA 3RXHA 3A80A 5GPIB 3SUFA 1O3DA 1O39A 3MO3A 1D6WA 4DOQA 3R3GB 5EXLA 3AVZA 2CN0H 4X6PA 3RXLA 1PQ5A 1QQUA 1P2QA 3A82A 4FU7A 1IQMA 2PV9B 1KXEA 3BEFB 3RP2A 3ATKA 2AH4X 1XVOA 8ESTE 3O8CA 1PQAA 3PMJA 1NPMA 2XRCA 2TGDA 4JYUH 5EW2H 3RM2H 1ZOMA 1A46H 2R3UA 2ZFQH 1D3DB 3UWJH 1DLEA 3GISB 5SGAE 4DT7B 2GMTC 3DUXH 3SGQE 1LVOA 5DP9A 3OY5U 2A32A 5FXLA 3O8BA 1V2UT 1A5GH 3LIWA 2Y7XA 1CHOG 1UTMA 5GCHG 4FUCA 3QO6A 5DP8A 2BZAA 1TRNA 4WMDA 2BQ6B 3VB6A 1GJAB 1KIGH 5JBCS 2XC5A 1W10U 3M3TA 4K3JA 1AVGH 1P9UA 2A5IA 1GPZA 1AIXH 2B9LA 2KAIB 1N6YA 2XWAA 3T62A 2EI8A 2WPHS 3MNCA 1AN1E 5GCHF 4INKA 4CBOA 1LHFH 3RC4A 3P17H 1NRQH 1IQLA 5HYOA 1CVWH 1YBWA 1TPAE 4Y8XA 1AE5A 2FM2A 1CGHA 5EXMA 1ZJDA 1OWIA 2FPZA 4WH8A 4MNXA 2YNBA 1ZRBA 1OWEA 2H5DA 3GY3A 1RTLA 1ELBA 1O2RA 2F3CE 1AO5A 3HATH 2XWBI 2ZU4A 3A7ZA 4NWKA 4X6NA 4KTCA 4XBCA 3SI3H 5LPEA 1NO9H 1QL8A 2O8MA 3RXEA 3VFEA 5C1YA 4FXGH 1F0TA 3A89A 2SGQE 5T6GA 1FN8A 4Y6DA 2BOHB 1C5MD 2G55A 4NIYA 1EAXA 5FX6A 3UNQA 1TAWA 2GZ9A 1C5SA 3D49H 1S83A 3GDSA 1C9PA 5A2MH 1QJ1B 2PUQH 2ALPA 3W95A 1HB0B 3BTHE 4ISLA 4X6MA 3VEQB 1IQIA 1YPMH 3PWBA 2H5CA 3V3MA 4B76A 2WV5A 2Q6FA 1YLDA 3BN9A 5T6FA 3M36A 1SG8B 1LPKB 1C5YB 4KTSA 2PSXA 1NROH 4AYVB 1MD8A 3LGIA 1ANDA 2ZDNA 3QTVH 1AVWA 1CHOF 4HI3A 2BXUH 3Q77A 5FPSA 2R0LA 4LOYH 1YKTA 2JETC 2Z3CA 4U01A 1HAVA 3Q00A 2OCVB 2CF9H 1IQHA 1GMHG 1FUJA 1Z1IA 2HNTF 1UCYH 2ZPRA 3N7OA 3LGYA 9ESTA 2RDLA 3SGAE 3SU4A 4AFUA 1NFXA 3RUOA 2A7HA 4AZ2B 4GHQA 1EZUC 2ZHDA 1C5LH 3E90B 1FN6A 4BAHB 5F8XA 1AGJA 1KXDA 1TNJA 1C4Y2 1GL1A 3ZYDA 3M7QA 2IPHA 2Z3EA 1O5GH 1HJAC 1TBQH 3RMNH 1PJPA 1FPCH 3HKJB 1O2GH 1DSTA 1MH0A 1O0DH 3SU5A 3A7XA 1E35B 2FS8A 7GCHG 4X0WU 1TIOA 3SUDA 1J17T 2BVXH 2BOKA 1C1NA 1C5OH 2BXTH 5E0HA 2PGBB 3MFJA 5L30H 4X1RU 5DK1A 3LJOA 2W5EA 1AZ8A 1O2TA 1H8IH 1O2JA 3LJJA 1D3PB 3UPEA 2AERH 4NWLA 3V12A 3UR6A 2G4TA 1WV7H 4XDEA 2AFQB 2ANYA 3IG6B 1HLTH 1LHDH 1PYTC 3KQCA 4ABFA 2R2MB 2J4IA 2VGCB 2BDBA 3NXPA 3EDXB 1ETTH 1P02A 3ZVEA 3A7YA 3BIUH
chains in the Genus database with same CATH superfamily
3ZIAD 4Y7BA 1B0EA 1G3BA 1ZSJA 5JYIA 4ZKSU 2Z9JA 1C1WH 1W14U 3ZZ3A 2FI3E 5E2OA 3E8LA 4Z1MD 1MU6B 1NFWA 1ELCA 1DXWA 1LPZB 2ZFRH 1O5CB 1DSUA 4INHA 1A3EH 5T6DA 2UWOA 4RN6A 4RKJB 1ARBA 3SNDA 2WPJS 5C1UA 5FBIA 3KYFA 1ZRKA 5C5OA 1YWUA 4D7GA 2WV4A 3E6PH 3A8BA 1L4DA 4VGCC 1WTHD 3V0XA 1BTYA 2FODA 6ESTA 1QL9A 2OUAA 1XUJA 3DT0H 1HAYB 1AFQC 1HIAB 2UUJB 3A7TA 4DW2U 1UTPA 3P8NA 1UK3A 3RXVA 2WV9A 3RXJA 4RI0A 3RXQA 3EYDA 3S7KB 1UTKA 2R2WU 3WWBA 1SGYE 1DITH 3SQEE 2BD5A 2IOTA 1YPJH 4NA7A 1BTZA 1ESAA 4X8SH 4CREA 5KGOA 2A5AA 5T1VA 1WCZA 4UFDH 5LGOA 1C5XB 1MAXA 3F1SB 3ZVCA 3RXGA 2OXSA 2H9EH 4IMQA 1YY3A 1G32B 2OINA 1SB1H 6CHAC 3T2NA 4M9FA 4Y71A 1XVMA 5J4QA 3U8TH 5GXPA 2QY0B 1F2SE 2SNWA 3W1EA 4CRAA 3SU0A 3WY8A 1MTSA 4B71A 1TGSZ 1A5HA 2V0BA 2ODQA 3BTEE 4JMYA 1ZJKA 1UTLM 1QBNA 1CO7E 3P8FA 2HNTC 1QJ7B 2GCHG 1F7ZA 2WPKS 5T3HA 2KFWA 1J15A 1P2IA 1XX9A 3GY8A 2VIQA 4Y11E 1UVOA 4SGBE 1UJ1A 3VXEH 2H9HA 2G4UA 3A87A 3KEEA 2XBYA 1P10A 4JCNA 4THNH 2CK3D 3A81A 1WDIA 2F91A 1TOMH 1K1IA 2A45B 2KCAA 2L6OA 2V3OH 3DCLA 2QC2A 1O5FH 3S9BA 3VB5A 2HWLB 4E05H 2TPIZ 3SV8A 3M5MA 1GHBF 1IAUA 1CT0E 1Z8JB 1HYLA 1ANEA 3PMAB 5L6NH 1O3BA 1SL3A 2Y5GA 1W8BH 4U2WA 2BD9A 1GGDB 4KP0A 3ATIA 1DX5M 2ZA5A 3Q76A 3FVFB 1SFQB 3SUGA 3RXOA 3FO8D 4UDWH 1VJ9U 3ZZAA 1DM4B 5EJLA 1K9OE 1VJAU 1G2MA 1T8LA 1Y5AT 3T29A 2ZZUH 4X8UH 5L2YH 4B6FA 1SSXA 2J98A 2O8TA 1SGNE 3KCGH 1XM1A 3MH7A 1TA6A 4NIWA 5A09A 1S82A 3UY9A 5DP7A 4A5TS 1YGCH 1BMNH 4LK4A 1O5EH 1ELEE 1HAVB 3ITIA 4TWYA 5L2ZH 3SU3A 1HAHH 1UK4A 1V3XA 1DY8A 1IHTH 3OY6U 2BX4A 1RTKA 2F9BH 2UWLA 3KN2A 2KCPA 4MTBA 8GCHG 3A8CA 1KXAA 2VVCA 1EZQA 1QY6A 1RXPA 3LGUA 1QURH 1SGQE 3MTYA 4SGAE 4KKDA 1VITH 2HRVA 3HGNA 1GI7B 3RXTA 1O2OA 2UUFB 1AU8A 1H8HD 3S9AA 1C4U2 1WQSA 1AE8H 1ARCA 3SI4H 1NM6A 4X1NU 1LHCH 1Y8TA 2ZPSA 1FIZA 2A7JA 2CHAC 1UVSH 2CF8H 4FUBA 1QQ4A 1W12U 4Z6AH 5FCKA 1QRXA 3IWMA 3OX7U 1BTWA 1THPB 2OQUA 1E79D 3TJVA 2C93B 4WMEA 3V7TA 4Y7AA 3HK6B 1K22H 1E36B 1Y3YA 1UTQA 3URDA 2ZTYA 1MABB 1MKWH 3RC5A 4ZROA 3L3TA 3T28A 4RT0A 3ELAH 2FOBA 4GPGA 1HAIH 1KYNA 2ZWLH 3P95A 3LGWA 1P11E 1XXDA 2C4FH 3NCLA 1YP9A 4BXWA 3LOXA 1SVPA 4INLA 1NFYA 1NESE 2P93A 4GLYA 5DP5A 1ZHPA 1V2MT 3PM3A 1GI6A 4Y0YE 4FUIA 2AIQA 2AEIH 3L33A 4MVNA 3TPIZ 1EX3A 3O8RA 2BDGA 3OFND 4GSOA 8GCHF 1BTXA 3WW7A 1GWAA 2M2AA 3TGKE 1AHTH 2RG3A 1AMHA 2ANKH 2VWLA 2VWOA 1BITA 1SI5H 3ZZ8A 2FEQH 3LONA 3MMGA 2ZO3H 3TJNA 2YMSB 5CDFE 3U1JB 2FO9A 5GJ4B 1S84A 1J16A 1C9TA 4BAQB 1NT1A 1QZ8A 1GL0E 2R0KA 1C1MA 3CS7A 1OYTH 1P3CA 1GBEA 1P57B 4FU9A 1IOEA 4LZ1H 1PPGE 5DN6D 2FLRH 3SN8A 1QL7A 1BDAA 2EI7A 3PB1E 2PLXA 3F6UH 2AMQA 3SU2A 2QAAA 2P16A 2ZIQH 1TMUH 1JWTA 4AB8A 2OC0A 1PPHE 4GUXA 1BOQA 1LO6A 1KXBA 4KGAA 1BA8B 5FCRA 1C5UA 4LZ4B 1RRKA 1HFDA 2GX4A 4NIXA 4LXBH 3S69A 3VB4A 3SJKA 4O97A 1Z1JA 4HTCH 5HM9A 1ACBE 1SLWB 2M5TA 2G52A 4BAMB 1C5TA 1H9IE 1X7AC 1EP6A 1TNIA 3VB7A 3BTME 1MQ6A 3MNXA 1QRWA 3ATMA 4AN7A 2ZFFH 5K7RA 1C5NH 2Z94A 1Y5UT 1PPZA 1FXYA 3RM0H 1G9IE 1FZZA 1T8OA 1GHZA 1S81A 2CXVA 3ZZDA 3DSPA 1GJ4H 1O3PB 2Z7FE 2ZHQH 1GBLA 2QF3A 3MOCA 3FAOA 4ABIA 1ETSH 2QXIA 4CRGA 2Z9LA 1GJ6A 1O2YA 3PMHB 6GCHG 3QZQA 4UFGH 1QB6A 2PW8H 4WXIA 2BVSH 2B5TB 2WUBA 4I8LA 1GI8B 1S6HA 2A2XH 1P2KA 4MLFB 1Z71A 5E8EH 2ZDVH 3OEED 1W3CA 1MKXH 3MYWA 1OWHA 1C4V2 3ATWA 1UCYE 2I6QA 1FY5A 1AZZA 1TABE 2FI4E 2O9QA 3NPSA 3UB0A 2J94A 3S0NA 2Y81A 1HAOH 2V6NA 1C1VH 4H6TA 3ZZ9A 2A2QH 1TONA 3K6YA 1YM0A 4BTIB 1T31A 5C17A 4IGDA 1TNLA 1AQ7A 1CA0B 3AK5A 3VG8A 4IN2A 1DY9A 1RS0A 4NG9H 1SMFE 4MPUA 5F8TA 2BD3A 3PLPA 1EB2A 1DS2E 3RMMH 1J8AA 3M3VA 1CA0C 1TMTH 1O32A 1GI5A 1M9UA 1ANBA 1PPBH 1T4UH 1O3OA 1UO6A 1LTOA 3F2HA 1GI9B 1FLEE 1WOFA 1GVLA 2P59A 1O2LA 2QYIA 5FPTA 2BDHA 2FS9A 4I8HA 3M61U 1C5ZB 2A1DB 1C5VA 5EJ1A 3K9XB 1YPKH 1EZXC 1S85A 1UVTH 4O3UA 3NWUA 2G5NA 2XNDD 2BDCA 1TA2A 1AWHB 3F9FA 1XUHA 4OM9A 1BTHH 1QHRB 2FX4A 2V3HH 1G3EA 1YYY1 4ZCNA 3M37A 5GNDA 3ZVGA 1T8MA 2GCTC 3E3TA 1H8DH 2PTCE 1Y59T 1TPPA 4ISNA 1F5LA 2PTNA 3S9CA 4I33A 4H42U 1CT4E 4JZIA 2WYJA 4B2AA 5JB9S 1D6RA 2BQ7B 1F0SA 4YXWD 3PO1B 4A92A 1VGCC 1IHSH 2F9UA 3AAVA 4K8BA 2ZHFH 1PPCE 2NWNA 1C2LA 5HM2A 1F5RA 2ODYB 2C8ZB 4DURA 1QB1A 1RFNA 2BQWB 1JRTA 4Y10E 2IN2A 2Z6BD 1B0FA 5DJ7A 3RLYH 1P06A 2P3FH 4MNVA 1G36A 1TB6H 5KECA 2QXGA 3T26A 3LGTA 5IYTA 1K21H 2VIWA 3M5NA 5EJZA 2J2UA 1DICA 4ISIH 4CRDA 1W7XH 3UWIA 1KTSB 3A7VA 1L1JA 4XD7D 1AKSA 1MBMA 5HIZA 1VITF 1A1RA 4YOGA 5I46H 4OS6A 3TH4H 4I7YH 1BTPA 1EPTA 5FHTA 3BG8A 7ESTE 4I8GA 1GDQA 2STAE 3U1IB 1YC0A 2FP7B 1QGFA 1SR5C 3VPKA 2LNCA 2WINI 5CMXH 2PHBA 2ZCLP 4JK6A 2AYWA 3M7UA 1P0SH 2SGDE 3BTGE 3FZZA 2ZGJA 4D9RA 2AMDA 1XUKA 1HIAA 3OEHD 1AVXA 1LDTT 1NTPA 2XW9A 1V2OT 1UTNA 5EQRA 1ESBA 1EJAA 1QR3E 4E7RG 1C5RA 3GOVB 1BZXE 2IJOB 3TJOA 4X2VA 4Y76A 1IQEA 4MG3A 3SHCH 4NZLA 1SGFG 2VH0A 3PV2A 3TIUA 1GCTB 2XBWA 4BXSA 7GCHF 3C27B 1KXCA 1CE5A 3ZVBA 1GBFA 2EA3A 3FKSD 3PTBA 4IC6A 3SW2B 4OS4A 1A61H 3OSYA 1IQNA 5EU8A 1J14A 4CH2B 3QDZB 1ZHRA 2BYAX 2FOFA 1O3JA 2GDEH 1TWXB 3LC5A 1YPHC 1TNHA 2A4GA 1ZZZA 3ZZ5A 1BJUA 4PROA 4CRFA 5ESTE 2TRMA 2UWPA 2PP6A 3SJ9A 3RU4D 1LQEA 3E1XB 2ZCKP 1O3KA 4ASUD 1CBWC 4OS5A 1GMHF 4A1TA 5HGGA 2G5VA 2EI6A 3ESTA 1EZSC 1AUTC 2AMPA 4BTTB 1MKWK 2BX3A 1KDQB 2FI5E 4H4FA 1V2JT 5G4BA 1UHBB 2FOMB 4FUEA 2AHME 2K1QA 3PO1C 1H4WA 2QF0A 3F0OA 4MPXA 2R3YA 3PV4A 2THFB 1C2JA 1L2EA 3RXAA 3A88A 4M7GA 1BUIA 3F9HA 1T7CA 1V2ST 1O5AB 2PR3A 3RMOH 4UE7H 4NFFA 2PUXB 4JZ1A 5JBAS 2TGTA 4Q7YA 1GBBA 2PKSB 5F6MA 1LVMA 2YMSC 1DUAA 2FTLE 3GCNA 1KSNA 4FVDA 3RXBA 2CHAB 1EFRD 1TQ0B 1GBHA 3F68H 4KELA 1OSSA 2H6MA 2KX4A 4IC5A 4DCDA 3GCTG 1CSOE 1EATA 2XC0A 1YCPK 3ENSB 3SNCA 3TITA 1VITG 2W6JD 1YCPM 4DT4A 1D3TB 1SGCA 1MTWA 1O3HA 1ZHMA 2FWWA 2ODPA 1A7SA 1TPSA 4ZKRU 1H8ED 2FESH 1U6QA 1A0HB 2FX6A 1O37A 4ZH8A 1K1NA 1CGIE 3ZZ4A 4B6EA 1V2QT 3QGJA 3DSGA 3EA7A 3G01A 1TX7A 4ABAA 1HRTH 4ZHMU 4F55A 2JH0D 3LH1A 2OBQA 1GBMA 1H9LB 1QCPA 1E1QD 2VJ1A 3GCTF 3UR9A 1JOUB 1GBIA 3BTKE 2GVFA 3RXSA 1ESTA 2R9PA 4VGCB 4AFQA 2OLGA 1BRBE 1C1RA 2NU0E 2VVUA 3AW1A 1GVKB 1RD3B 4OS7A 1ID5H 5C5NA 2DE8A 2GZ8A 1Z6JH 3LU9B 3UUZA 4MPWA 1LKAA 3W94A 1PQ8A 3E0NB 2FOHA 1Q3XA 2P8OC 5C94A 3SBKA 5DP6A 3GCHC 1Y3WA 2PSYA 1SFIA 1C2IA 2QIQA 1CGJE 3VXFH 1AY6H 1O2WA 3AAUA 2OQ5A 1C2DA 1DFPA 3QN7A 1A0LA 1VCQA 1V2WT 3ZVAA 2HPQH 1V2NT 1FONA 1O3IA 2G51A 1JIMA 1D4PB 1W0KD 3BSQA 2RFKC 2TGAA 4YLUA 1C2FA 3GY4A 1P09A 1FY3A 1VCWA 2O8UA 2ZNKH 3TH3H 1KMHB 1DVAH 4B2BA 4NSVA 4O03A 1O3LA 1O3EA 2J92A 4AG2A 2V35A 3ZVDA 1A2CH 1QB9A 1NFUA 2TGPZ 2Y80A 1TBZH 1B7XB 1O3CA 3STIA 3QGNB 3GCOA 2GCTB 2VBCA 2RA3A 2ALVA 2NU4E 1TNGA 1L1NA 1E1RD 1TGNA 5C1XA 4IBLH 2P94A 4RSPA 4OS1A 1OP0A 2WPDD 4ZXYH 2ANMH 1TMBH 1VGCB 3QX5H 1KLJH 1H1BA 4JZFH 4AX9H 1GHBG 1EAWA 3DHKH 3V13A 4I86A 1A0JA 1O34A 1NRPH 1O2QA 2NU2E 3MU1A 3MI4A 2ZGBH 1PYTD 5A0CA 3JZ2B 5JBBS 4CRBA 2GDDA 5AVDA 3TU7H 1HBTH 4FVBA 5I25A 1W13U 2Y7ZA 2ESTE 1GJBB 1AI8H 1TGCA 1FY8E 1P8VC 3DFJA 1O3FA 3BTFE 1D9IA 1INCA 4AC9A 5AFZH 1GDNA 2STBE 2ANWA 4JZEH 3BEUA 2ULLA 2ZQ1A 5EODA 4ABJA 1F0UA 2OTVA 1EQ9A 1EXFA 1CU1A 1V2PT 1ZTJA 3UTUH 2EQNA 5IK2D 3DSOA 2ZPQA 9LPRA 2HLCA 2WZQA 3N7EA 1O38A 1UTOA 1UVUH 2HLDD 4ASHA 2F83A 4E06H 4ABEA 3BF6H 2ZHWH 1S5SA 3RXUA 2AGEX 2FOAA 3TNSA 1K1JA 1NU7B 1F92A 2ZDMA 5A8YA 2CGAA 4YOJA 3SNEA 2K8IA 3ATLA 3LH3A 1GJCB 2B7DH 1KLIH 1MD7A 4DIHH 1GI1A 4GCHG 2VIVA 1QA7A 5LPRA 5AFYH 2Y5HA 1TRMA 1C5WB 3H7TA 2ZU2A 3KQ5A 1EP5A 4ZKNU 2AGIX 3GS9A 3BIVH 4MPVA 1AB9B 1MTNC 1O2KA 1SLUB 3FZDA 4Q7ZA 4WY3A 1E0FD 2XC4A 2F9PA 3QTOH 4HZHA 4TT3D 1BRAA 2ZU3A 3F2FA 4O3TA 3MH5A 4Q80A 3NK8A 3HPTB 2FYQA 1JRSA 1SKYE 3BV9B 1HAXB 4K2YA 1O30A 3KGPA 4ABGA 1GJDB 2J9NA 5GWZA 2F9VA 2FOCA 1ELFA 4JZDH 4K8YA 4WWYA 5A0AE 1Z8GA 2QA9E 2GGVB 1GI0A 3U8OH 3ODDA 3MHWU 3F0PA 1K1OA 5TJXA 4JYTA 5DG6A 3M5OA 1O3AA 5C0UA 1GG6B 5CE1A 4AFSA 1EPTC 1HJ9A 4YESB 1C2MA 3LDXH 1BB0B 4ZHLU 1GHAF 2BY7X 1UCYK 4WMFA 3ZV9A 1HCGA 2GZ7A 1AD8H 2SGPE 3RXDA 3RLWH 2WYGA 4BOHA 4UFEH 1FPHH 2JKHA 1GCTC 1UHBA 1ELAA 1N1LA 2V3MA 1GBDA 2J38A 2ZECA 3MH4A 1BT7A 1SGTA 1O35A 2KAIA 5DPAA 3EA9A 4OGXA 2HPPH 2P95A 3RDZA 5IDKA 4ABDA 2XTTB 2YNAA 3RXCA 4IW4E 1UVPA 6CHAB 4UONA 2OC1A 1HV7A 3WWFA 1DANH 3C1KA 3U69H 2KCYA 1Y3XA 1C1TA 5BPEA 2VIDA 1ELGA 4DY7B 2A4QA 2A4RA 3D65E 4XBBA 2H2ZA 1RGQA 4B74A 3M7TA 4K1SA 3E0PB 2J98B 4AYYB 1KDQA 2ZU5A 4O9VA 1MZAA 2QCYA 4JYVH 5EPNA 1BRUP 1VR1H 1GJ7B 1ELVA 5CHBA 4OGYA 5F8ZA 1FY1A 6GCHF 2BLQA 6LPRA 4AG1A 3EGKH 3ZZ6A 2IJD1 5K0HA 2ZDKA 2ZEBA 2BLWA 1FY4A 5C2ZA 1C1OA 2WUCA 4I32A 4A1XA 1HAPH 2TIOA 1MUEB 1ZMJA 5DO4H 1GJ5H 2NU3E 3N99A 3EE7A 1O3MA 1GBCA 4Y0ZE 3KYGA 1P04A 4J2YB 1EAIA 1SGEE 4WXVA 2VB0A 2D1JA 3MU0A 3HK3B 4WJG2 4YT6H 3GCHB 4HGCA 1LMWB 1OYQA 1P9SA 1K0HA 3HKIB 2P3UB 5HKKD 4TY6A 1GHXH 1WSSH 4AGKA 2FOGA 4ZMAH 4CHAC 3UQOA 1GGDC 3UNSA 5C20A 2HVXA 4IS5A 3M5LA 2PFEA 1Z6EA 2ZFSA 4X2WA 1T4VH 1BJVA 1E38B 4TPIZ 1PQ7A 3B8JA 1F0RA 1MQ5A 4FUHA 3SV2H 4WH6A 3P8OA 1PFXC 1IQGA 2JDID 2VINA 1ZGVA 3VB3A 1C1SA 1P3EA 2OK5A 3AASA 3OAAD 5E2PA 1OWJA 3VGCB 2VGCC 3JZ1B 1G3CA 1KLTA 1XUGA 1BCUH 5DKMA 2RCEA 2V7QD 5AHGH 5DP4A 3RXKA 2KZ4A 5HXFA 2BY9X 3OYPA 4CR5A 3ZV8A 8LPRA 1GBAA 1DT2A 2VU8E 4FOUC 4DIIH 1Y3UA 4ABHA 1ORFA 4ESTE 1GG6C 2A5KA 3CNRA 3URCA 1MZDA 1OKXA 2OD3B 3P92A 2KR7A 4ISOA 3UIRA 3LT3A 1BHXB 3RXFA 2ZP0H 2W3IA 3PWCA 2BD2A 4F48B 3KQEA 3PYHA 2L74A 1FNIA 1ZPCA 3F3BA 4IN1A 5E0JA 2JETB 2Z3DA 5ABWA 1Y5BT 4NIVA 1RTFB 4Y79A 5TCAA 1G3DA 1Z7KA 2BB4A 2QV1A 2BY6X 1V6DA 3KQBA 4I31A 2XBXA 1LVYA 1ELTA 2DE9A 1QNJA 1KY9A 2BDIA 1K1PA 4K1TA 3TK5A 4MNYA 4YO9A 1YPLH 4Q7XA 2FTMA 3OTJE 4CRCA 4X1PU 4A1VA 1O2IA 2VIOA 2XBVA 2XYAA 1ZSLA 3LGVA 4FUGA 2HALA 1FI8A 2LP6A 3RXMA 4BTUB 1ZGIA 1C1UH 4NA8A 2RA0A 5EQSA 1CA8B 1SGRE 2XNIA 1MMJN 1A3BH 4GCHF 3VGCC 1HXFH 1S0QA 5GIBA 1XXFA 3MO6A 4FUJA 2C3SA 1L4ZA 1COWD 3SV6A 1G2LA 2BD8A 2GV7A 1DDJA 1GBKA 3QLPH 1OS8A 3BG4C 1W7GH 2Z9GA 1W11U 4XBDA 1EASA 2ZGXH 3TGJE 2Z9IA 3BG4B 3A84A 2H1UA 5HMAA 7KMEH 1W0ZU 1NY22 5JDUB 1TGBA 2BDYA 2SGEE 1ZPBA 4AORA 1HAZB 1NN6A 1NZQH 1SOZA 1C2HA 4ZHAA 1DE7H 5FL7D 3EA8A 4H6SB 1N8OB 3DD2H 1EJMA 1BMLA 1SGDE 3MNSA 3NKKA 1GI3A 1PPFE 1EB1H 3OE7D 4D76A 2JH6D 2ZGHA 3H09A 2B8OH 3TK9A 1UMAH 1ZPZA 1YPEH 3L6PA 1E37B 5FPYA 1TGTA 3D23A 1C5PA 3EAJA 1TRYA 3FP8E 1QRZA 5JPMH 1W0YH 5ESBA 3ZZBA 4A6LA 1V2RT 4MQAA 3FP6E 2UUKB 2HVYB 5EPYA 1S6FA 2SNVA 2P8OB 1HJ8A 2XCFA 3A86A 1TQ7B 2ZF0H 2AIPA 1CBWB 1LHEH 1TE0A 1Z8IB 2F9NA 4BAOB 3LPRA 1GDUA 1GHWH 1FIWA 1HDTH 4K5ZA 1O2SA 1GMCF 3AW0A 3PROA 3T27A 1IQJA 1BMFD 1C2GA 2BY8X 2Y6TA 2A7CA 2W7UA 1SPJA 2TBSA 1GHVH 1OWKA 1NRSH 5FAHA 2HOBA 3PV5A 3Q3YA 1QBVH 3P70B 4X8TH 2WPMS 4WVPE 4CH8B 1V2VT 3SHAH 1O36A 1JXPA 1V2TT 5AF9H 1P2OA 4FETA 4CR9A 1XKBC 3QZRA 2BD7A 1WYKA 2SGAA 1A4WH 1T8NA 1GJ8B 4I8KA 3F9GA 3SNAA 3P8GA 1GI2A 4IMZA 1JIRA 2BTCE 2C8XB 4X1SU 1FJSA 3H5CB 1Z8RA 4YOIA 2BM2A 2BLOA 1O5DH 1S6LA 1SQOA 4RKOB 3TVJB 4WF8A 3K2UA 1C2EA 1WAYB 2AGGX 2YMSD 4XOJA 4ZKOU 1AFEH 2FIRH 1QJ6B 1YPHE 4Z0KA 1ABJH 2RDEA 3S7HB 2OBOA 1C2KA 3M35A 2ZGCA 3PRDA 1O31A 5HIYA 3RC6A 2F43B 4TSFD 1WBGB 2OC7A 4FU8A 3UREA 3GY2A 3O8DA 2J34A 1GMCG 1SOTA 1DXPA 3FP7E 1OWDA 1A5IA 3SQHE 3M3SA 4DG4A 2ZI2H 4DGJA 1P05A 4NGAH 3MH6A 1CQQA 3BEIB 3STJA 2ZFTA 2QGRA 2BDAA 3I77A 1K1MA 2GT7A 4UEHH 5F53A 3PLKA 1TOCB 4D7FA 4BAKB 5DGJA 3UFAA 1P01A 2VNTA 2W7SA 1HNEE 1O3GA 2ZQ2A 1THSH 1P2NA 1HAGE 2BD4A 4ABBA 1AKSB 4X2XA 3F9EA 8KME2 5EOKA 4NA9H 2EY4C 1N8OC 1EOJA 3B9FH 4DVAU 1ELDE 1YPGH 1GHYH 1HUTH 3HGPA 2XXLA 2ZU1A 4RT1A 2GD4B 3T5FH 1C5QA 5EGMA 1BBRK 1FDPA 4YLQH 1C1QA 1BTUA 2F9OA 1O2VA 4FUDA 1Q31A 1O2PA 1LPGB 1W0JD 4GHTA 1VZQH 3DFLA 2D2DA 1T32A 2Y5FA 1ETRH 2C8WB 3MQKC 4ZAEA 1MKXK 1S0RA 2G81E 3EE0B 3KQDA 3A83A 4TWWA 3KNXA 3MU5A 3U28C 1IQFA 3SJIA 1FQ3A 5BRRE 1SHYA 2A0QB 1DOJA 5DP3A 4UD9H 1V2KT 1ZYOA 2QXHA 5C3NA 1P2JA 5ETXA 4Y8YA 4X1QU 3RU4E 2JIZD 2ZC9H 5B6LA 1WU1A 1L0ZA 5TCCA 1VCPA 4NCYA 1NRNH 2G8TA 1ZSKA 1UTJA 4R8TB 4OS2A 4X8VH 5H4IB 4ACBA 2A31A 3ZVFA 1ZLRA 7LPRA 1G37A 4J1YA 4ZUHA 2GP9B 2GKVE 3KIDU 3UOPA 2D26C 4HFPB 2XOKD 4NSYA 3BTTE 1K28D 1LVBA 4B73A 2ZDLA 1AUJA 3IITA 4CHAB 1IQKA 5C67A 3GY7A 1OXGA 3SO3A 2BHGA 4ACAA 2JH5D 2WPLS 4XFQA 4DJZB 5A8ZA 1V2LT 1BQYA 1SBWA 3MO9A 4Q63A 1QFKH 3SOSA 3UNRA 4A7IB 1RJXB 3PMBB 2QF4A 1SGPE 2GT8A 1FAXA 3EQ0H 3RMLH 5LPFA 2FDAA 2PGQB 2ZCHP 3MWIU 3CP7A 1WXRA 4BNRA 1L1GA 2HGTH 2JJ1D 3D62A 3GICB 3I29A 4FUFA 1OP2A 4Y8ZA 2EC9H 1AWFH 3GYMA 2PWXA 4YZUA 5GDSH 3FANA 2Q1JA 1WQVH 2UUYA 2FXRA 1RIWC 5A8XA 1ZMLA 3QUMP 1FV9A 1DWCH 1EPTB 3GY5A 1QTFA 4GAWA 3QK1A 3ZYEA 4K60A 3SYJA 1O3NA 1K1LA 2Q6GA 1ZTKA 3UAIC 1KXFA 1NBME 1Q2WA 4Q4LA 1O2XA 2H9TH 2PKAA 3TJUA 3U8RH 2B0FA 4R0IA 2WHXA 2EEKA 1NRRH 2CV3A 3TNTA 1ANCA 2O8LA 3NUMA 1HPGA 3U9AH 2G00A 3A8AA 1YLCA 2LPRA 1GI4A 1O2HA 4QT8C 4D9QA 1E34B 1JMOH 3GDVA 3I78A 3R0FA 4YTAA 4AOQA 3LC3A 2Y82A 1DPOA 5FX5A 2GMTB 2I6SA 4AB9A 2W26A 2GTBA 2FMJA 1AB9C 1MTNB 2Z9KA 1TALA 4HG6A 3SU1A 3SV9A 2FOEA 1DLKB 1XKAC 2VWNA 1NS3A 3SU6A 4XE4A 2LELA 5EG4A 4AFZA 2AS9A 2P3TB 1SC8U 1ZR0A 1O2UA 1FMGA 3OTPA 1LCYA 1THRH 4Q2KA 1GVZA 2BMGB 4GVUA 4ZXXH 4CBNA 2ZKSA 3OU0A 3MU8A 5EQQA 3TLOA 1EAUA 4X2YA 3T25A 2ZFPH 2VIPA 4TPYA 1EJNA 1SQAA 2GV6A 2J5UA 1BMAA 1C1PA 1GHAG 1KTTB 3SNBA 1MU8B 3LKWA 1ZTLA 3ZZCA 2CMYA 3BTWE 1AFQB 1O2MA 5CHAC 1OHHD 1LHGH 1LKBA 3PTNA 1Y3VA 5F03A 1BBRE 1J9CH 2FLBH 2NU1E 4MDSA 1P2MA 1MBQA 1HGTH 1SQTA 3BTDE 1EUFA 1P12E 2PKSC 3ZZ7A 1SLVB 1BMMH 2W6ID 1HXEH 1WUNH 2GCHF 2BZ6H 3SZEA 2A4OA 5JBTA 3SJOA 1HJAB 3E91A 2ZTZA 3TGIE 4YT7H 4JK5A 5LH8A 3GYLB 1DWDH 5A0BA 1OPHB 2ZTXA 1DWEH 3BTQE 2VH6A 1QBOA 1WTGH 2ASUB 2VWMA 1SQRA 3KHVA 1TX8A 1BIOA 3UOUA 4E7NA 3FFGA 1MCTA 1TBRH 1ABIH 1YF4A 1G30B 1TX6A 3KL6A 3U98H 3B23B 4NFEA 1BRCE 1TFXA 1W2KH 3QWCH 2F4LA 3A7WA 3RXPA 2SFAA 2ILNA 2PKAB 3SUEA 1TLDA 1EOLA 3Q3XA 1NBMD 3GY6A 1UK2A 1XUFA 3SGBE 1PPEE 1TNKA 3K6ZA 1BHXF 2DUCA 1O2ZA 5FBEA 3P6ZB 1O2NA 2ZHEH 3KF2A 3SZNA 1OP8A 1SGIB 1MAYA 1XUIA 2XCNA 3Q3KA 4U30A 4KTUA 2WPIS 3SJ8A 4U32A 4YM9A 1TYNA 5EIYA 1SLXB 2FYRA 1EKBB 1MCVA 3RXIA 3A85A 4XSKU 1F5KU 3E16B 1LQDB 1OOKB 3H7OA 1MTVA 2SGFE 5J4SA 3RU4T 2D8WA 1QIXB 2CJIA 4AGJA 1MTUA 3UQVA 4I8JA 3A8DA 1O5BB 4B1TA 4K1EA 4F4OC 2O8WA 3ODFA 4B75A 1CHGA 5JB8S 1GMDF 2ZG0H 2YOLA 1QA0A 1CT2E 1NC6A 2K0QA 2C8YB 4TY7A 4F49A 1N6XA 1GCDA 1NU9A 1P03A 2BVRH 1O33A 3MNBA 3RXRA 1DUEA 2BY5X 1D3QB 4D8NA 1XMNB 2W3KA 1FX0B 1H9HE 5E0GA 5B6OA 3CENA 2J95A 3SORA 2VVVA 2HNTE 1SHHB 3NZIA 5EXNA 2ZDAH 3DA9B 1YCPH 4K69A 2FZZA 3TK6A 4X6OA 1FAKH 1RIWB 1ZMNA 1DWBH 3CS0A 4BANB 1TPOA 2C90B 1JBUH 2Q6DA 4ISHH 3SV7A 5EW1H 4UFFH 2OC8A 4NZQA 3K65B 4MNWA 1GBTA 1K2I1 1GMDG 1GJ9B 4TYDA 5CHAB 3GDUA 3MU4A 3PLBA 1SGFA 2OP9A 1OX1A 2QN5T 5PTPA 1B5GH 1GBJA 1BBRH 2BLVA 3TH2H 4B2CA 2QXJA 3RXHA 3A80A 5GPIB 3SUFA 1O3DA 1O39A 3FOAA 3MO3A 1D6WA 3FN8A 3R3GB 2QF5A 5EXLA 4DOQA 3AVZA 2CN0H 4X6PA 3RXLA 1PQ5A 2GJGA 1QQUA 1P2QA 3A82A 4FU7A 1IQMA 2PV9B 1KXEA 3BEFB 3RP2A 3ATKA 2AH4X 1XVOA 8ESTE 3O8CA 1PQAA 3N7DA 1NPMA 3PMJA 2XRCA 2TGDA 1YLNA 4JYUH 5EW2H 3RM2H 1ZOMA 1A46H 2J97A 2R3UA 2ZFQH 1D3DB 3UWJH 1DLEA 3GISB 5SGAE 4DT7B 2GMTC 3DUXH 3SGQE 1LVOA 5DP9A 3OY5U 2A32A 5FXLA 3O8BA 1V2UT 1A5GH 3LIWA 2Y7XA 1CHOG 1UTMA 5GCHG 4FUCA 3QO6A 5DP8A 2BZAA 1TRNA 4WMDA 2BQ6B 3VB6A 1GJAB 1KIGH 5JBCS 2XC5A 1W10U 3M3TA 4K3JA 1AVGH 1P9UA 2A5IA 1GPZA 1AIXH 2B9LA 2KAIB 1N6YA 2XWAA 3T62A 2EI8A 2WPHS 3MNCA 1AN1E 5GCHF 4INKA 4CBOA 1LHFH 3RC4A 3P17H 1NRQH 1IQLA 5HYOA 1CVWH 1YBWA 1TPAE 4Y8XA 1AE5A 2FM2A 1CGHA 5EXMA 5DSFA 1ZJDA 2QE7D 1OWIA 2FPZA 4WH8A 4MNXA 2YNBA 1ZRBA 1OWEA 2H5DA 3GY3A 1RTLA 1ELBA 1O2RA 2F3CE 2IPQX 1AO5A 3HATH 2XWBI 2ZU4A 3A7ZA 4NWKA 4P00A 4KTCA 4X6NA 4XBCA 3SI3H 5LPEA 1NO9H 1QL8A 2O8MA 3RXEA 3VFEA 5C1YA 4FXGH 1F0TA 3A89A 2SGQE 5T6GA 1FN8A 2KCOA 2BOHB 4Y6DA 1C5MD 2G55A 3NRLA 4NIYA 1EAXA 5FX6A 3UNQA 1TAWA 2GZ9A 1C5SA 3D49H 1S83A 3GDSA 1C9PA 5A2MH 1QJ1B 2PUQH 2ALPA 3W95A 1HB0B 3BTHE 4ISLA 4X6MA 3VEQB 1IQIA 1YPMH 3PWBA 2H5CA 3V3MA 4B76A 2WV5A 2Q6FA 1YLDA 3BN9A 5T6FA 3M36A 1SG8B 1LPKB 1C5YB 4KTSA 2PSXA 1NROH 4AYVB 1MD8A 3LGIA 1ANDA 2ZDNA 3QTVH 3F2GA 1AVWA 1CHOF 4HI3A 2BXUH 3Q77A 5FPSA 4XRNA 2R0LA 4LOYH 1YKTA 2JETC 2KM0A 2Z3CA 4U01A 1HAVA 3Q00A 2OCVB 2CF9H 1IQHA 1GMHG 1FUJA 1Z1IA 2HNTF 1UCYH 2ZPRA 3N7OA 3LGYA 9ESTA 2RDLA 3SGAE 3SU4A 4AFUA 1NFXA 3RUOA 2A7HA 4AZ2B 1UW7A 4GHQA 1EZUC 2ZHDA 1C5LH 5KEDA 3E90B 1FN6A 4BAHB 5F8XA 1AGJA 1KXDA 1TNJA 1C4Y2 1GL1A 3ZYDA 3M7QA 2IPHA 1VKYA 2Z3EA 1O5GH 1HJAC 1TBQH 3RMNH 1PJPA 1FPCH 3HKJB 1O2GH 1DSTA 1MH0A 5C0TA 4P02A 1O0DH 3SU5A 3A7XA 1E35B 2FS8A 7GCHG 4X0WU 1TIOA 3SUDA 1J17T 2BVXH 2BOKA 2JJ2D 1C1NA 1C5OH 2BXTH 5E0HA 2PGBB 3MFJA 5L30H 4X1RU 5DK1A 3LJOA 2W5EA 1AZ8A 1O2TA 1H8IH 1O2JA 3LJJA 1D3PB 3PRBA 3UPEA 2AERH 4NWLA 3V12A 3UR6A 2G4TA 1WV7H 4XDEA 2AFQB 2ANYA 3IG6B 1HLTH 1LHDH 2WSSD 1PYTC 3KQCA 4ABFA 2R2MB 2J4IA 2VGCB 2BDBA 3NXPA 3EDXB 1ETTH 1P02A 3ZVEA 3A7YA 3BIUH
chains in the Genus database with same CATH topology
4Y7BA 1B0EA 1G3BA 1ZSJA 5JYIA 4ZKSU 2Z9JA 1C1WH 1W14U 3ZZ3A 2FI3E 5E2OA 3E8LA 1MU6B 1NFWA 1ELCA 1DXWA 1LPZB 2ZFRH 1O5CB 1DSUA 4INHA 1A3EH 5T6DA 2UWOA 4RN6A 4RKJB 1ARBA 3SNDA 2WPJS 5C1UA 5FBIA 1ZRKA 5C5OA 4D7GA 2WV4A 3E6PH 3A8BA 1L4DA 4VGCC 1WTHD 3V0XA 1BTYA 2FODA 6ESTA 1QL9A 2OUAA 1XUJA 3DT0H 1HAYB 1AFQC 1HIAB 2UUJB 3A7TA 4DW2U 1UTPA 3P8NA 1UK3A 3RXVA 3RXJA 3RXQA 3EYDA 3S7KB 1UTKA 2R2WU 1SGYE 1DITH 3SQEE 2BD5A 2IOTA 1YPJH 4NA7A 1BTZA 1ESAA 4X8SH 4CREA 2A5AA 1WCZA 4UFDH 5LGOA 1C5XB 1MAXA 3F1SB 3ZVCA 3RXGA 2OXSA 2H9EH 4IMQA 1G32B 2OINA 1SB1H 6CHAC 3T2NA 4Y71A 1XVMA 5J4QA 3U8TH 5GXPA 2QY0B 1F2SE 2SNWA 4CRAA 3SU0A 3WY8A 1MTSA 4B71A 1TGSZ 1A5HA 2V0BA 2ODQA 3BTEE 4JMYA 1ZJKA 1UTLM 1QBNA 1CO7E 3P8FA 2HNTC 1QJ7B 2GCHG 1F7ZA 2WPKS 5T3HA 1J15A 1P2IA 1XX9A 3GY8A 2VIQA 4Y11E 1UVOA 4SGBE 1UJ1A 3VXEH 2H9HA 2G4UA 3A87A 3KEEA 2XBYA 1P10A 4JCNA 4THNH 3A81A 2F91A 1TOMH 1K1IA 2A45B 2V3OH 2QC2A 1O5FH 3S9BA 3VB5A 2HWLB 4E05H 2TPIZ 3SV8A 3M5MA 1GHBF 1IAUA 1CT0E 1Z8JB 1HYLA 1ANEA 3PMAB 5L6NH 1O3BA 1SL3A 2Y5GA 1W8BH 4U2WA 2BD9A 1GGDB 4KP0A 3ATIA 1DX5M 2ZA5A 3Q76A 3FVFB 1SFQB 3SUGA 3RXOA 4UDWH 1VJ9U 3ZZAA 1DM4B 1K9OE 1VJAU 1G2MA 1T8LA 1Y5AT 3T29A 2ZZUH 4X8UH 5L2YH 1SSXA 2O8TA 1SGNE 3KCGH 1XM1A 3MH7A 1TA6A 4NIWA 5A09A 1S82A 3UY9A 5DP7A 4A5TS 1YGCH 1BMNH 4LK4A 1O5EH 1ELEE 1HAVB 3ITIA 4TWYA 5L2ZH 3SU3A 1HAHH 1UK4A 1V3XA 1DY8A 1IHTH 3OY6U 2BX4A 1RTKA 2F9BH 2UWLA 3KN2A 4MTBA 8GCHG 3A8CA 1KXAA 2VVCA 1EZQA 1QY6A 1RXPA 3LGUA 1QURH 1SGQE 3MTYA 4SGAE 4KKDA 1VITH 2HRVA 3HGNA 1GI7B 3RXTA 1O2OA 2UUFB 1AU8A 3S9AA 1C4U2 1WQSA 1AE8H 1ARCA 3SI4H 1NM6A 4X1NU 1LHCH 1Y8TA 2ZPSA 1FIZA 2A7JA 2CHAC 1UVSH 2CF8H 4FUBA 1QQ4A 1W12U 4Z6AH 5FCKA 1QRXA 3IWMA 3OX7U 1BTWA 1THPB 2OQUA 3TJVA 2C93B 4WMEA 3V7TA 4Y7AA 3HK6B 1K22H 1E36B 1Y3YA 1UTQA 3URDA 2ZTYA 1MKWH 3RC5A 4ZROA 3L3TA 3T28A 3ELAH 2FOBA 4GPGA 1HAIH 1KYNA 2ZWLH 3P95A 3LGWA 1P11E 1XXDA 2C4FH 3NCLA 1YP9A 4BXWA 3LOXA 1SVPA 4INLA 1NFYA 1NESE 2P93A 4GLYA 5DP5A 1ZHPA 1V2MT 3PM3A 1GI6A 4Y0YE 4FUIA 2AEIH 2AIQA 3L33A 4MVNA 3TPIZ 1EX3A 3O8RA 2BDGA 4GSOA 8GCHF 1BTXA 1GWAA 3TGKE 1AHTH 2RG3A 1AMHA 2ANKH 2VWLA 2VWOA 1BITA 1SI5H 3ZZ8A 2FEQH 3LONA 3MMGA 2ZO3H 3TJNA 3U1JB 2FO9A 5GJ4B 1S84A 1J16A 1C9TA 4BAQB 1NT1A 1GL0E 2R0KA 1C1MA 3CS7A 1OYTH 1P3CA 1GBEA 1P57B 4FU9A 1IOEA 4LZ1H 1PPGE 2FLRH 3SN8A 1QL7A 1BDAA 2EI7A 3PB1E 2PLXA 3F6UH 2AMQA 3SU2A 2QAAA 2P16A 2ZIQH 1TMUH 1JWTA 4AB8A 2OC0A 1PPHE 4GUXA 1BOQA 1LO6A 1KXBA 4KGAA 1BA8B 5FCRA 1C5UA 4LZ4B 1RRKA 1HFDA 2GX4A 4NIXA 4LXBH 3S69A 3VB4A 3SJKA 4O97A 1Z1JA 4HTCH 5HM9A 1ACBE 1SLWB 2M5TA 2G52A 4BAMB 1C5TA 1H9IE 1X7AC 1EP6A 1TNIA 3VB7A 3BTME 1MQ6A 3MNXA 1QRWA 3ATMA 4AN7A 2ZFFH 5K7RA 1C5NH 2Z94A 1Y5UT 1PPZA 1FXYA 3RM0H 1G9IE 1FZZA 1T8OA 1GHZA 1S81A 2CXVA 3ZZDA 1GJ4H 1O3PB 2Z7FE 2ZHQH 1GBLA 2QF3A 3MOCA 3FAOA 4ABIA 1ETSH 2QXIA 4CRGA 2Z9LA 1GJ6A 1O2YA 3PMHB 6GCHG 3QZQA 4UFGH 1QB6A 2PW8H 4WXIA 2BVSH 2B5TB 2WUBA 4I8LA 1GI8B 1S6HA 2A2XH 1P2KA 4MLFB 1Z71A 5E8EH 2ZDVH 1W3CA 1MKXH 3MYWA 1OWHA 1C4V2 3ATWA 1UCYE 2I6QA 1FY5A 1AZZA 1TABE 2FI4E 2O9QA 3NPSA 2J94A 3S0NA 2Y81A 1HAOH 2V6NA 1C1VH 4H6TA 3ZZ9A 2A2QH 1TONA 3K6YA 1YM0A 4BTIB 1T31A 4IGDA 1TNLA 1AQ7A 1CA0B 4IN2A 1DY9A 1RS0A 4NG9H 1SMFE 4MPUA 5F8TA 2BD3A 3PLPA 1EB2A 1DS2E 3RMMH 1J8AA 3M3VA 1CA0C 1TMTH 1O32A 1GI5A 1M9UA 1ANBA 1PPBH 1T4UH 1O3OA 1UO6A 1LTOA 1GI9B 1FLEE 1WOFA 1GVLA 2P59A 1O2LA 2QYIA 5FPTA 2BDHA 2FS9A 4I8HA 3M61U 1C5ZB 2A1DB 1C5VA 3K9XB 1YPKH 1EZXC 1S85A 1UVTH 4O3UA 3NWUA 2G5NA 2BDCA 1TA2A 1AWHB 3F9FA 1XUHA 1BTHH 1QHRB 2FX4A 2V3HH 1G3EA 1YYY1 3M37A 3ZVGA 1T8MA 2GCTC 3E3TA 1H8DH 2PTCE 1Y59T 1TPPA 4ISNA 1F5LA 2PTNA 3S9CA 4I33A 4H42U 1CT4E 4JZIA 2WYJA 4B2AA 5JB9S 1D6RA 2BQ7B 1F0SA 3PO1B 4A92A 1VGCC 1IHSH 2F9UA 3AAVA 4K8BA 2ZHFH 1PPCE 2NWNA 1C2LA 5HM2A 1F5RA 2ODYB 2C8ZB 4DURA 1QB1A 1RFNA 2BQWB 1JRTA 4Y10E 2IN2A 2Z6BD 1B0FA 5DJ7A 3RLYH 1P06A 2P3FH 4MNVA 1G36A 1TB6H 2QXGA 3T26A 3LGTA 5IYTA 1K21H 2VIWA 3M5NA 2J2UA 1DICA 4ISIH 4CRDA 1W7XH 3UWIA 1KTSB 3A7VA 1L1JA 1AKSA 1MBMA 1VITF 1A1RA 4YOGA 5I46H 4OS6A 3TH4H 4I7YH 1BTPA 1EPTA 5FHTA 3BG8A 7ESTE 4I8GA 1GDQA 2STAE 3U1IB 1YC0A 2FP7B 1QGFA 1SR5C 3VPKA 2LNCA 2WINI 5CMXH 2PHBA 2ZCLP 4JK6A 2AYWA 3M7UA 1P0SH 2SGDE 3BTGE 3FZZA 2ZGJA 4D9RA 2AMDA 1XUKA 1HIAA 1AVXA 1LDTT 1NTPA 2XW9A 1V2OT 1UTNA 5EQRA 1ESBA 1EJAA 1QR3E 4E7RG 1C5RA 3GOVB 1BZXE 2IJOB 3TJOA 4X2VA 4Y76A 1IQEA 4MG3A 3SHCH 4NZLA 1SGFG 2VH0A 3TIUA 1GCTB 2XBWA 4BXSA 7GCHF 3C27B 1KXCA 1CE5A 3ZVBA 1GBFA 2EA3A 3PTBA 4IC6A 3SW2B 4OS4A 1A61H 3OSYA 1IQNA 5EU8A 1J14A 4CH2B 3QDZB 1ZHRA 2BYAX 2FOFA 1O3JA 2GDEH 1TWXB 3LC5A 1YPHC 1TNHA 2A4GA 1ZZZA 3ZZ5A 1BJUA 4PROA 4CRFA 5ESTE 2TRMA 2UWPA 3SJ9A 3RU4D 1LQEA 3E1XB 2ZCKP 1O3KA 1CBWC 4OS5A 1GMHF 4A1TA 5HGGA 2G5VA 2EI6A 3ESTA 1EZSC 1AUTC 2AMPA 4BTTB 1MKWK 2BX3A 1KDQB 2FI5E 4H4FA 1V2JT 5G4BA 1UHBB 2FOMB 4FUEA 2K1QA 3PO1C 1H4WA 2QF0A 4MPXA 2R3YA 3PV4A 2THFB 1C2JA 1L2EA 3RXAA 3A88A 4M7GA 1BUIA 3F9HA 1T7CA 1V2ST 1O5AB 2PR3A 3RMOH 4UE7H 4NFFA 2PUXB 4JZ1A 5JBAS 2TGTA 4Q7YA 1GBBA 2PKSB 5F6MA 1LVMA 1DUAA 2FTLE 3GCNA 1KSNA 4FVDA 3RXBA 2CHAB 1TQ0B 1GBHA 3F68H 4KELA 1OSSA 2H6MA 4IC5A 4DCDA 3GCTG 1CSOE 1EATA 2XC0A 1YCPK 3ENSB 3SNCA 3TITA 1VITG 1YCPM 1D3TB 1SGCA 1MTWA 1O3HA 1ZHMA 2FWWA 1A7SA 2ODPA 1TPSA 4ZKRU 2FESH 1U6QA 1A0HB 2FX6A 1O37A 4ZH8A 1K1NA 1CGIE 3ZZ4A 1V2QT 3QGJA 3EA7A 3G01A 1TX7A 4ABAA 1HRTH 4ZHMU 2JH0D 3LH1A 2OBQA 1GBMA 1H9LB 1QCPA 2VJ1A 3GCTF 3UR9A 1JOUB 1GBIA 3BTKE 2GVFA 3RXSA 1ESTA 2R9PA 4VGCB 4AFQA 2OLGA 1BRBE 1C1RA 2NU0E 2VVUA 3AW1A 1GVKB 1RD3B 4OS7A 1ID5H 5C5NA 2DE8A 2GZ8A 1Z6JH 3LU9B 3UUZA 4MPWA 1LKAA 3W94A 1PQ8A 3E0NB 2FOHA 1Q3XA 2P8OC 3SBKA 5DP6A 3GCHC 1Y3WA 2PSYA 1SFIA 1C2IA 2QIQA 1CGJE 3VXFH 1AY6H 1O2WA 3AAUA 2OQ5A 1C2DA 1DFPA 3QN7A 1A0LA 1VCQA 1V2WT 3ZVAA 2HPQH 1V2NT 1FONA 1O3IA 2G51A 1JIMA 1D4PB 3BSQA 2TGAA 4YLUA 1C2FA 3GY4A 1P09A 1FY3A 1VCWA 2O8UA 2ZNKH 3TH3H 1DVAH 4B2BA 4NSVA 4O03A 1O3LA 1O3EA 2J92A 4AG2A 2V35A 3ZVDA 1A2CH 1QB9A 1NFUA 2TGPZ 2Y80A 1TBZH 1B7XB 1O3CA 3STIA 3QGNB 3GCOA 2GCTB 2RA3A 2ALVA 2NU4E 1L1NA 1TNGA 1TGNA 5C1XA 4IBLH 2P94A 4RSPA 4OS1A 1OP0A 4ZXYH 2ANMH 1TMBH 1VGCB 3QX5H 1KLJH 1H1BA 4JZFH 4AX9H 1GHBG 1EAWA 3DHKH 3V13A 1A0JA 1O34A 1NRPH 1O2QA 2NU2E 3MU1A 3MI4A 2ZGBH 1PYTD 5A0CA 3JZ2B 5JBBS 4CRBA 2GDDA 5AVDA 3TU7H 1HBTH 4FVBA 5I25A 1W13U 2Y7ZA 2ESTE 1GJBB 1AI8H 1TGCA 1FY8E 1P8VC 3DFJA 1O3FA 3BTFE 1D9IA 1INCA 5AFZH 1GDNA 2STBE 2ANWA 4JZEH 3BEUA 2ULLA 2ZQ1A 5EODA 4ABJA 1F0UA 2OTVA 1EQ9A 1EXFA 1CU1A 1V2PT 1ZTJA 3UTUH 2ZPQA 9LPRA 2HLCA 1O38A 1UTOA 1UVUH 4ASHA 2F83A 4E06H 4ABEA 3BF6H 2ZHWH 1S5SA 3RXUA 2AGEX 2FOAA 3TNSA 1K1JA 1NU7B 1F92A 2ZDMA 5A8YA 2CGAA 4YOJA 3SNEA 3ATLA 3LH3A 1GJCB 2B7DH 1KLIH 1MD7A 4DIHH 1GI1A 4GCHG 2VIVA 1QA7A 5LPRA 5AFYH 2Y5HA 1TRMA 1C5WB 3H7TA 2ZU2A 1EP5A 4ZKNU 2AGIX 3BIVH 4MPVA 1AB9B 1MTNC 1O2KA 1SLUB 3FZDA 4Q7ZA 4WY3A 1E0FD 2XC4A 2F9PA 3QTOH 4HZHA 1BRAA 2ZU3A 4O3TA 3MH5A 4Q80A 3NK8A 3HPTB 2FYQA 1JRSA 3BV9B 1HAXB 4K2YA 1O30A 3KGPA 4ABGA 1GJDB 2J9NA 5GWZA 2F9VA 2FOCA 1ELFA 4JZDH 4K8YA 4WWYA 5A0AE 1Z8GA 2QA9E 2GGVB 1GI0A 3U8OH 3ODDA 3MHWU 1K1OA 5TJXA 4JYTA 5DG6A 3M5OA 1O3AA 1GG6B 5CE1A 4AFSA 1EPTC 1HJ9A 4YESB 1C2MA 3LDXH 1BB0B 4ZHLU 1GHAF 2BY7X 1UCYK 4WMFA 3ZV9A 1HCGA 2GZ7A 1AD8H 2SGPE 3RXDA 3RLWH 2WYGA 4BOHA 4UFEH 1FPHH 2JKHA 1GCTC 1UHBA 1ELAA 1N1LA 2ZECA 1GBDA 2J38A 3MH4A 1BT7A 1SGTA 1O35A 2KAIA 5DPAA 3EA9A 4OGXA 2HPPH 2P95A 3RDZA 5IDKA 4ABDA 2XTTB 2YNAA 3RXCA 4IW4E 1UVPA 6CHAB 4UONA 2OC1A 1HV7A 1DANH 3C1KA 3U69H 1Y3XA 1C1TA 5BPEA 2VIDA 1ELGA 4DY7B 2A4QA 2A4RA 3D65E 4XBBA 2H2ZA 1RGQA 4B74A 3M7TA 4K1SA 3E0PB 4AYYB 1KDQA 2ZU5A 4O9VA 1MZAA 2QCYA 4JYVH 5EPNA 1BRUP 1VR1H 1GJ7B 1ELVA 5F8ZA 4OGYA 1FY1A 6GCHF 2BLQA 6LPRA 4AG1A 3EGKH 3ZZ6A 5K0HA 2ZDKA 2ZEBA 2BLWA 1FY4A 5C2ZA 1C1OA 2WUCA 4I32A 4A1XA 1HAPH 2TIOA 1MUEB 1ZMJA 5DO4H 1GJ5H 2NU3E 1O3MA 1GBCA 4Y0ZE 1P04A 4J2YB 1EAIA 1SGEE 4WXVA 2VB0A 2D1JA 3MU0A 3HK3B 4WJG2 4YT6H