1UTMA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA02
5ETXA 1ANDA 2EA3A 2AH4X 1WU1A 2BLQA 1C5ZB 2GT7A 1TRYA 1FXYA 1FY5A 4NWKA 3RMMH 2Z94A 4ABDA 1YCPM 2AIPA 1A5IA 3BTKE 1MAXA 2GT8A 2ZU5A 1EZQA 2SGAA 1TX6A 2ALPA 4GCHF 2ANYA 1DVAH 1WUNH 4K1EA 1C5OH 3SU6A 3GOVB 2Z9GA 3RC5A 2CHAB 1AE8H 2O8TA 4I7YH 2FS9A 2FYQA 4O3UA 4JK5A 2R2WU 3JZ1B 1FQ3A 2Y81A 2THFB 4K3JA 1BHXB 2QXGA 2ODPA 1KYNA 1TMUH 5E0JA 1P3CA 3T25A 3A7TA 2P93A 2IJOB 1EJNA 1MZDA 1LTOA 1OWIA 1FONA 5GXPA 3EA8A 1BIOA 4X6MA 1TX7A 5GDSH 1GDUA 5EQQA 2XC0A 2P8OB 4DGJA 5AF9H 3BEUA 5EGMA 3ZVFA 2ZQ1A 4BAMB 1Q3XA 1TNJA 1S84A 2SGQE 2WV4A 1CT2E 1TAWA 4X1SU 1ANEA 1UTLM 2XCNA 1ZGVA 4WH8A 1HYLA 4ZKSU 3MNSA 1ELEE 2J94A 2ZI2H 4BAOB 1EOLA 1XUJA 1EX3A 2ZCKP 2GKVE 5F6MA 3QLPH 3MU4A 1TGNA 2Z9LA 1GDNA 2GZ8A 3KQDA 4MNWA 1XX9A 1DX5M 5SGAE 1AD8H 1G3BA 4NSYA 1VJAU 4B75A 1G3DA 1Z1IA 1KXEA 3WY8A 1DICA 4I31A 1B7XB 1W0ZU 1A4WH 3BIVH 3E6PH 4ISNA 3K65B 1YBWA 3KCGH 1E36B 2BQ6B 2F9VA 1H1BA 2W3KA 3KIDU 3F9FA 1GJAB 4I8KA 5EW2H 3TK6A 1T8LA 3SV8A 1OWKA 1ZGIA 5FPTA 1PPZA 1O2PA 1NRPH 3CP7A 2CV3A 4IMZA 1IHSH 1UVTH 4YO9A 1CVWH 2HNTC 5LH8A 2CGAA 3M7UA 3ATKA 1O3CA 1RFNA 2H9TH 4A5TS 1O2WA 1OXGA 1Y3YA 1MTSA 3SJOA 3P70B 4KKDA 4FXGH 1BDAA 1KXBA 3RMOH 1S0RA 1X7AC 1Z6JH 3KQCA 3TH4H 2FO9A 1O39A 3CS7A 1C1PA 4ESTE 4Y7BA 1S6HA 1ELAA 1C5LH 1NU9A 1PPGE 4AGJA 1O3OA 5JBBS 4AN7A 3BF6H 3SJIA 4I8LA 4KTSA 2PGQB 4ZKNU 3UQOA 3M5OA 2P3FH 1GG6C 2A1DB 3RXVA 3V13A 2PKAB 3R0FA 4Q80A 1WAYB 2G5NA 1T32A 1NC6A 4IN1A 1GBEA 4AB9A 3BG8A 2GCHG 1G2LA 3VXFH 1Y8TA 3A7ZA 2YOLA 3F9EA 2ZTXA 2BY6X 3RP2A 3ZZCA 2XBXA 2AGGX 4HFPB 1S82A 3GY3A 4RSPA 4J1YA 5LPFA 2D1JA 2H9EH 3HK6B 4CH8B 5DGJA 2RA3A 3ZVAA 1GI4A 1MD8A 5EOKA 2QCYA 1GHWH 1S6FA 3U1JB 3JZ2B 1W8BH 2H5DA 5HMAA 1IOEA 1GHVH 1H9LB 1WCZA 1AKSB 1DUAA 1FV9A 5EODA 1XKAC 1BUIA 1GL0E 3L3TA 1GL1A 5FAHA 2VVVA 4A6LA 3P8GA 3M7QA 2EI8A 4E7NA 2BXUH 1BITA 2CF8H 2V3OH 1W12U 4CH2B 1FZZA 3M3TA 4ASHA 1GBTA 1T8NA 1C5QA 5E0HA 4X2WA 3UNSA 1TRMA 1NESE 1ORFA 4U32A 1O2IA 3OSYA 4NA9H 2XW9A 4X2YA 3VB4A 3GCHB 3UFAA 4SGBE 2KAIA 5EG4A 4A92A 2BHGA 2WPMS 2STBE 1VZQH 1DM4B 3HATH 4GHTA 1FJSA 1N6XA 1UCYE 3TGIE 1J17T 4ZMAH 2BD5A 5DP6A 1BTUA 5FPSA 1HV7A 3PMAB 4H4FA 2BD2A 1O5BB 5DP7A 4X0WU 1GI8B 1XUFA 1XUKA 4Y0ZE 2OD3B 2AERH 1Y5BT 3BTQE 4D9RA 5BRRE 1G3CA 2SNWA 3D65E 1UTJA 2Q6DA 4WVPE 3UY9A 2VGCB 1GHBG 4BTIB 1GBKA 3ODDA 2PTNA 5DKMA 1O3KA 1KLIH 3TJUA 2HPQH 1LQEA 1LDTT 2G51A 1YPLH 5IDKA 4XBCA 1WTHD 2Q6FA 4YT7H 3RXIA 2QYIA 1IAUA 2A0QB 3ZVGA 3RUOA 2UWLA 3H7OA 1ABJH 4JMYA 5E2PA 4Z0KA 3RXKA 1BZXE 2BY8X 2H6MA 2VIWA 1VGCC 1NTPA 3SJ9A 3ZZ3A 3F68H 2ZU4A 4X6OA 3P95A 1Y3VA 2ZFPH 2FYRA 5GCHF 1W10U 2FDAA 1A3EH 1DANH 4XFQA 1GGDB 1LHGH 4ZXXH 3DT0H 2ZPSA 1O0DH 2P94A 1VITF 1O2ZA 2GVFA 1GI5A 1IQGA 1O2GH 1O37A 2WUBA 1CHGA 4GHQA 1FPCH 2A5KA 4MPUA 2BTCE 1HIAA 2ZDKA 1DWDH 2A4OA 1CT0E 1Y5UT 1O2TA 2P95A 4BXSA 3KQEA 2I6SA 2FEQH 1ZTLA 5ESTE 2A5IA 1DSUA 2VVCA 1MTUA 1LKAA 1RRKA 4FUDA 4LZ1H 1P09A 3P8OA 5FX6A 2IPHA 1JWTA 3FVFB 3BTME 3NK8A 4UFDH 1O2VA 3PMHB 1BRAA 2BD4A 3V0XA 4DOQA 3S7KB 5E8EH 3GY6A 1L1GA 1DITH 2BY7X 1GJBB 1QQUA 1S5SA 1V2JT 3EYDA 3ZVBA 2VINA 2ANKH 5ABWA 4ZH8A 5AFZH 2BX4A 1AZ8A 1C5WB 1ZR0A 1IQEA 1UVSH 2XBYA 1O3LA 1EAIA 1NM6A 2PUXB 1V2WT 2AS9A 3BTEE 1MQ6A 4NA7A 1W14U 2QXHA 1GI6A 1A5HA 4RN6A 3SQHE 3RXPA 5T3HA 3BTTE 4NZQA 1P01A 3MYWA 1F0TA 3C1KA 1VCWA 1YC0A 4R0IA 3GY7A 5EQRA 3PO1C 1D3DB 4IGDA 1TLDA 2A4RA 4XSKU 2PGBB 1DE7H 2OC0A 3A80A 3ATMA 3SN8A 1TNLA 1MKWH 2J95A 1EPTC 3GY4A 2OTVA 3K6ZA 5L30H 2GX4A 2GMTC 2ODQA 3A82A 3ZZ7A 1A5GH 1O3EA 5K0HA 4UFGH 1PJPA 2ZU3A 1KLJH 1MTVA 1ZMLA 3T62A 2ZZUH 4R8TB 4MPXA 1GJ9B 5EW1H 4QT8C 4NIWA 2Z9KA 3MFJA 3GCTF 1YLCA 1QRWA 3EA9A 3CENA 3M5NA 1EB2A 1P0SH 2FS8A 4DVAU 1GMHF 2JKHA 2QV1A 1K21H 1SPJA 2NU0E 1UMAH 3QGJA 4IS5A 1MKXH 3ZZ8A 1PQ5A 1IQLA 1UJ1A 1SB1H 2ZIQH 3MO9A 1N6YA 2ULLA 1Y3XA 3IITA 3PV4A 2BQ7B 1MTNC 3MMGA 2JETB 4FUJA 3TITA 4VGCB 1RIWC 1GBLA 2PSYA 3PTNA 1SBWA 4CR9A 3FZZA 4B2CA 3QZQA 2ZDMA 4J2YB 3F9GA 4FUEA 1DFPA 2Y6TA 1GBCA 3BIUH 2QF0A 2HVXA 2V35A 1B5GH 3SHCH 3U98H 3UWJH 2G52A 3TJVA 3Q3KA 1MD7A 5A09A 2PFEA 1IQKA 1FN6A 2H5CA 2R3YA 1D4PB 1G30B 4WF8A 3VB6A 1C5RA 1EOJA 2VIQA 4ABAA 4X2XA 1RJXB 5DG6A 2D26C 1J9CH 3NXPA 2AMPA 1KXFA 1DLEA 1Q2WA 3F6UH 1CA0C 1MBQA 2ZU2A 3VFEA 1GHXH 4A1VA 1IQJA 3P92A 5DP5A 4B73A 1YYY1 2ZGCA 2G4UA 6LPRA 4B2AA 1LO6A 2FLRH 3A85A 3RXAA 1LKBA 3KQBA 1SR5C 2UWPA 2ZQ2A 3SGBE 1HAOH 1BMAA 1FY3A 4E7RG 5ESBA 1DWBH 1HAYB 4XBBA 2JETC 2A7JA 5EXMA 1TBZH 4O3TA 5A8XA 1O3PB 2ZTYA 1HNEE 2WPJS 4O03A 2R0LA 4CRAA 1C5XB 3RXQA 1AZZA 2O8WA 1SC8U 2ZGXH 4ABEA 3URDA 2BOHB 1YPEH 2ZNKH 2PR3A 2G4TA 6ESTA 4K8YA 3MHWU 4JYUH 1F5LA 1A61H 1O2KA 1QQ4A 2TGPZ 4UE7H 3LH3A 5CE1A 1K22H 1UTPA 2FPZA 1QA7A 1RXPA 2GV6A 3LT3A 4TPYA 3SV7A 1MKWK 1C5NH 1QJ7B 2PTCE 5LPRA 1HAVA 1EZSC 1ELBA 4GCHG 4YM9A 2ZFTA 1AUJA 1O30A 2A32A 1GHYH 3S9AA 4NFFA 3EAJA 1C5PA 1M9UA 3MWIU 4AYVB 4MPVA 4U30A 1YF4A 4PROA 2GD4B 3QTVH 4JCNA 1ZSKA 5FXLA 2J92A 1ELVA 1RS0A 2Z6BD 4U01A 4BANB 4GPGA 3UTUH 3M3VA 3MO3A 1YGCH 3E91A 1CO7E 3UUZA 1SI5H 1H8IH 3M3SA 2FOCA 1GVZA 2W3IA 3M61U 1HPGA 1O2RA 1C2GA 2BVRH 2V0BA 3O8RA 5FX5A 2SGFE 1ZTJA 2FLBH 1EAXA 3AAVA 4ABGA 1YPJH 1NT1A 4ISIH 5T6GA 1TNGA 2ZF0H 1NO9H 2BY5X 3E16B 1L1NA 1O2NA 5G4BA 3RU4D 2BD3A 1TOCB 3ZVEA 1C1UH 1O2XA 2ILNA 1BRUP 3LGVA 3A8AA 3BTDE 4TWYA 6CHAC 2FXRA 1B0FA 2XTTB 5JBAS 1UVPA 5A0BA 4X1NU 3RXFA 1IHTH 1XVMA 3LGWA 5GIBA 1P8VC 4INKA 4DW2U 4AGKA 4FU7A 5J4QA 1SGFG 1XXDA 5C3NA 3GYLB 4DJZB 4A7IB 1EJAA 1OWDA 4Q2KA 4XE4A 1C2EA 3RXDA 3BN9A 2A5AA 5EXNA 2BDGA 1ZPZA 3NCLA 1PPHE 3SV6A 4Y0YE 1O5GH 1Z8JB 4NIYA 1G36A 1C2MA 1JMOH 5H4IB 2BDCA 1QURH 2FOBA 4AFQA 2PKSC 4D76A 1ZRKA 5JBCS 1O5AB 1UVOA 1ABIH 1C5MD 1BQYA 2IN2A 1LVYA 4A1XA 2HPPH 1GJCB 2BMGB 1N1LA 1P9SA 3OY6U 2BDBA 4KGAA 1V2QT 1BRCE 3ZV9A 4FUHA 3TLOA 5DP8A 1F5RA 3SHAH 1GG6B 1KTSB 1TA6A 3U8RH 1A7SA 1O2YA 3D23A 3RXUA 2PLXA 3SI4H 3NKKA 1L4DA 2B0FA 1GMCF 3I77A 3HKJB 1SVPA 2A45B 1QR3E 2ZC9H 4BTUB 4Y8XA 1IQHA 4O9VA 3DFLA 2F9NA 3UQVA 1C1NA 1GI1A 1O3DA 3KL6A 4F49A 3LU9B 1JRSA 3L33A 2VIDA 3TU7H 1GHAG 3AW0A 3M5LA 1Z6EA 2A31A 4JZEH 3SGAE 4B76A 2BX3A 1TPPA 1AY6H 3HKIB 1SGQE 4ABHA 5JB9S 1GBJA 2PKAA 1OP8A 1NFXA 1Y3WA 3SU5A 3A8DA 2XNIA 4D8NA 4HGCA 4JZIA 3Q3YA 1C2HA 1GJ8B 1SGCA 2QC2A 3UR9A 2YNBA 3T29A 2ODYB 4I32A 1SLUB 1V2ST 2FOFA 2OBOA 2NWNA 2JH5D 3S9BA 1MCVA 1J14A 3C27B 3B8JA 3I78A 3VB7A 5F03A 4GSOA 4Y8YA 1AFQC 1TMTH 3TNTA 5FHTA 3MNXA 1Q31A 3VPKA 1EB1H 4X8UH 4KTUA 2FMJA 2ZGBH 1T8OA 2ZPRA 1AKSA 1QCPA 1DOJA 1ELCA 1G3EA 1K9OE 2HWLB 5FCKA 3LOXA 4ISLA 3SNBA 1C1RA 4H42U 1Y59T 1YPMH 1CQQA 1TOMH 3LGTA 3O8BA 3T27A 1UHBB 1SGEE 1ELGA 2XWAA 3RMNH 2LPRA 3OYPA 4NG9H 1QB1A 2CMYA 1TIOA 2OQ5A 1NU7B 2P16A 5T6DA 2A4QA 3ITIA 5JPMH 1V3XA 2BD7A 1AWHB 2HRVA 1W2KH 1HCGA 3BEFB 4YOIA 2VIVA 1D6WA 1XMNB 4B2BA 2OP9A 4NSVA 4B71A 1THPB 4BOHA 2UUFB 4BAHB 4JZDH 1V2TT 3SU0A 1L1JA 3NZIA 5CMXH 4UD9H 1TGBA 3FZDA 1C2FA 1TBRH 5TCAA 3FP6E 2NU4E 4FU9A 2ZU1A 1AQ7A 4SGAE 3PROA 2TRMA 2ZHWH 3K2UA 1A1RA 2O8UA 1EAWA 2ZTZA 1VGCB 3EA7A 1VJ9U 3M5MA 5E0GA 7GCHF 2BZ6H 3A84A 1SQOA 2C8WB 3RXSA 2BY9X 1TNKA 4DIHH 3ATWA 2BOKA 1NS3A 4XOJA 8GCHF 1CBWB 2TGAA 3A88A 1K1PA 1OP2A 4JYTA 2CF9H 1UK4A 5GCHG 2OXSA 2WYJA 2SGPE 5CHAB 4BAQB 4BTTB 1BHXF 1ZMNA 2GCTC 1HAHH 1O2UA 1VITG 1ESBA 1T4UH 1CGJE 2TPIZ 4I8GA 1TX8A 3ZZ5A 2RDLA 3TNSA 3STJA 3LH1A 1LHDH 4IC6A 3M7TA 4YOGA 3SU4A 4ABBA 3SNCA 3KHVA 1UTOA 2Y5FA 3S7HB 2HNTF 5FBIA 1AVGH 1TABE 1G37A 4ZUHA 2OLGA 3T26A 4Z6AH 2O8LA 1BCUH 2GZ7A 4X2VA 1DWCH 2VJ1A 3SUFA 3AVZA 1V2OT 1QNJA 2QN5T 1NRNH 4JZFH 1O34A 4CRCA 3RM0H 4YTAA 1SLVB 1GI0A 1JIMA 2QA9E 1MMJN 1K28D 1ETTH 1AFEH 2Z3CA 1AGJA 3KF2A 1AWFH 1BRBE 2ZKSA 1C1VH 1KLTA 3LIWA 3UOPA 2SGEE 3DD2H 1CBWC 4NFEA 1EATA 1INCA 2A2QH 3AW1A 4ABIA 1HAZB 4RKOB 1GBMA 4YOJA 1AU8A 5CHAC 1P2OA 2BDAA 4Q7YA 3RXLA 1ANBA 4MTBA 1P12E 5AFYH 1MU6B 4LOYH 1QY6A 1MCTA 3PO1B 3TVJB 4AG2A 1ANCA 1C9TA 1C9PA 1PPFE 1TWXB 2BLOA 3ZZ6A 1FMGA 4K5ZA 3RXTA 3SNEA 1CGIE 4DIIH 1EPTB 4OS6A 1NFYA 4MG3A 1O36A 2XC4A 2FWWA 2ZDLA 4ZHLU 3BTGE 5L6NH 1TNIA 2Y7XA 1ZRBA 2GMTB 1O38A 4UEHH 1QIXB 2VIPA 1UTKA 4E05H 2WINI 5HGGA 2FOEA 4UONA 4INHA 4CR5A 3QO6A 3E3TA 2OCVB 4Q7ZA 2AYWA 1NRSH 4MPWA 3SU3A 3ZV8A 3VB3A 2ANWA 1YCPH 4X1RU 1KXAA 1QTFA 1JRTA 2SFAA 3W94A 4WWYA 1HAPH 2BDHA 2BD8A 2G00A 3RM2H 1WSSH 3G01A 4GAWA 1QL7A 2XWBI 1QL8A 1HUTH 5TCCA 2STAE 2D8WA 2FTLE 1VCPA 3FANA 1BBRE 1F92A 3LGUA 4IMQA 2C3SA 1A0LA 1PYTD 1EP6A 2ZG0H 1AVXA 3GCTG 1P03A 2H1UA 1MTNB 5HYOA 1AE5A 4Q7XA 4KTCA 1GMHG 3ELAH 1PPEE 1QRXA 1RIWB 3ENSB 1ELFA 1YLDA 2XCFA 1NY22 4I33A 2Y7ZA 2ZDVH 1H8DH 1PQAA 2ZCHP 3GDUA 5IYTA 8LPRA 3SUDA 3ZZ9A 2VH0A 1SHYA 1O5DH 3SJ8A 2AFQB 1EZUC 1NZQH 1Z71A 1TPAE 1OP0A 3HK3B 3BTWE 5FBEA 3Q00A 5I46H 1MQ5A 1C2LA 4JZ1A 2VWMA 4X6PA 2FI5E 3K6YA 2J34A 1C4U2 4IW4E 1CA0B 6GCHG 3E8LA 1D3TB 1GJ6A 3MOCA 5A2MH 4HZHA 2ESTE 2SNVA 1QJ6B 1FUJA 3OX7U 4D7GA 4X6NA 1V2PT 3D49H 3RXOA 3PMBB 4K69A 1N8OB 1SFIA 4MDSA 1HB0B 3SI3H 1O3FA 1UO6A 2TGTA 1ZHRA 4B1TA 1J8AA 4FVDA 3SNAA 1P04A 2ZP0H 1SHHB 1O3BA 3TH2H 2ZWLH 3NUMA 2Z9JA 2ZDAH 3SORA 4XBDA 3RLYH 3RXRA 3LKWA 3GICB 1ZLRA 1XUGA 5DO4H 1ZHMA 1EXFA 2EC9H 1O2LA 1AMHA 1O3GA 4Y10E 5A8YA 3BV9B 1KIGH 4NIXA 5B6OA 1ZPBA 3M36A 1C5VA 1P9UA 3KGPA 1YPKH 2VNTA 1GJ4H 2PV9B 1NFWA 1S81A 1T4VH 1T8MA 5HM2A 1GMDG 3FAOA 5HM9A 1UTQA 9LPRA 1KDQB 2ZPQA 5C1XA 2ANMH 1OS8A 7LPRA 2A7HA 1FY4A 3DHKH 4ABFA 2SGDE 2C8YB 1Z8IB 3GYMA 2V6NA 3Q3XA 1ETRH 1YCPK 3GY8A 1N8OC 3P6ZB 2DE8A 2GP9B 4I8HA 4D9QA 1RTLA 3MU8A 2Y82A 2VIOA 2ZHEH 4X8TH 5K7RA 3EQ0H 1LVMA 1HJ8A 1BJUA 2J4IA 2OBQA 1WV7H 5FPYA 4Y7AA 2H9HA 1C2DA 3TPIZ 1HJAC 3ODFA 2ZCLP 1ARBA 3MH6A 3UOUA 4K1TA 2GZ9A 1GJ7B 4CRDA 3EDXB 1E34B 2H2ZA 3F9HA 3RXHA 1FIWA 7KMEH 3LPRA 4AYYB 1K2I1 2XXLA 1AB9C 1Y3UA 4I8JA 1EKBB 1DY8A 1GI9B 1HFDA 4U2WA 1GCDA 3SQEE 1W0YH 1O3AA 5AVDA 1VR1H 3RXEA 2WV5A 4TYDA 3A7XA 4IN2A 1C1MA 1IQIA 3PWCA 7ESTE 2P3TB 3RXGA 3VEQB 6CHAB 4CHAC 4BNRA 1O3NA 1PQ7A 2J38A 4YESB 1GDQA 3PWBA 5EXLA 2AMQA 3DUXH 5BPEA 1THSH 1O5CB 1GCTB 1TGCA 1UCYH 2BB4A 3SO3A 3IWMA 1ESAA 2FX6A 1DUEA 3A8CA 1GJDB 1PPCE 2ZFQH 4WMDA 1OWEA 4DCDA 1OSSA 5JB8S 1GI2A 3A8BA 5C5NA 1SQTA 1G32B 1CHOF 1OKXA 1C1SA 1MKXK 3KNXA 4BAKB 3IG6B 3FFGA 3SNDA 3VGCC 1D9IA 4WXVA 1EASA 1C4V2 2ZFSA 1DT2A 2QGRA 3OY5U 1IQMA 2PKSB 1DLKB 4D7FA 1SFQB 1BB0B 1P2QA 1V2RT 1GI7B 5DP3A 4NIVA 1K1LA 1LMWB 1TB6H 1CGHA 1F0RA 4AG1A 5L2YH 3RC6A 3A86A 3BTFE 5EPNA 1GPZA 1LPKB 4UFEH 2FP7B 4WH6A 2TBSA 1LPGB 1DDJA 3S69A 1OOKB 4H6SB 2ZO3H 4MLFB 3U8OH 2ASUB 3ZZDA 2BLWA 4X1QU 4AZ2B 1H9HE 1T31A 3RXCA 1ZPCA 3GCOA 2BDYA 3P8NA 5DP9A 3RDZA 1ID5H 9ESTA 4YLQH 2TIOA 1GCTC 3LC3A 1C2JA 2PUQH 2W26A 4ZXYH 1AO5A 2VWOA 2J2UA 2QAAA 1QFKH 1GMCG 1SQAA 4ABJA 5I25A 2RG3A 1ELTA 3GDVA 1NRRH 2Y5GA 1L4ZA 2C93B 5C67A 4H6TA 2FOGA 1F5KU 3BEIB 1OWHA 1DXPA 2XC5A 4MNXA 4X8SH 5EPYA 1A0JA 2LNCA 1CSOE 2B8OH 3BSQA 3MI4A 3PTBA 1EZXC 1QL9A 4FU8A 1HJ9A 1BMNH 1ZZZA 1EP5A 1JXPA 4AFZA 2C8XB 1P57B 5JYIA 3S9CA 1RTKA 4CREA 1SLXB 3TIUA 4X8VH 1GVLA 1O35A 1HAGE 3RC4A 1XVOA 1SGTA 3U1IB 5GPIB 4CRFA 3AASA 3SOSA 2QIQA 4OS4A 5LPEA 1V2NT 1PYTC 1ZSLA 2FOMB 4MQAA 1FNIA 1DPOA 3STIA 1AFQB 3TK5A 4O97A 1YKTA 2A2XH 1XUIA 5C5OA 3S0NA 2QF3A 1GBFA 1V2LT 2VB0A 2BXTH 1TMBH 1V6DA 1QBNA 3L6PA 5F8TA 3SUGA 3PMJA 1NFUA 1O2HA 4CRBA 1ZOMA 1BBRH 1KXCA 1V2MT 2CXVA 1S83A 4LXBH 1UTNA 1UCYK 3TH3H 1QGFA 2CHAC 1CA8B 1V2UT 2FOHA 3P8FA 3CS0A 1YM0A 1FN8A 4NZLA 3ZZAA 3N7OA 2TGDA 1TQ0B 1YPGH 4FUCA 3URCA 3A7YA 2B5TB 1W7GH 4TWWA 1TE0A 1MAYA 3LONA 1C5TA 4FUGA 4NA8A 1W7XH 4FUFA 1BTHH 1P10A 2B7DH 3Q76A 3QK1A 4CBNA 4JYVH 1C2KA 4Y11E 1VITH 2P8OC 3SV9A 1HRTH 2C8ZB 4AX9H 5A0CA 1WBGB 2ZGHA 1TALA 1LQDB 3OU0A 1A46H 2Z3DA 1FAXA 1K1MA 1BT7A 1UHBA 2UWOA 2VWLA 3A7WA 4Y71A 2AEIH 3DFJA 1W11U 4YZUA 3U8TH 4TPIZ 2F9UA 1WYKA 2XBVA 1BMLA 2F9PA 4IBLH 1IQFA 2BVSH 2W5EA 1MBMA 3RXJA 5DP4A 4TY6A 1QHRB 3HGNA 3LGYA 4NWLA 7GCHG 3MU5A 3QZRA 3QX5H 3O8CA 2GDEH 3A81A 4MVNA 1BTPA 3PM3A 1O3IA 3FP7E 4LK4A 3T28A 2RA0A 2PW8H 4B74A 1GHAF 8GCHG 3GY2A 2AGEX 3ZVCA 1LVBA 4AFSA 1P02A 2GCTB 1TQ7B 3ESTA 1OPHB 2WPHS 4Y6DA 4AFUA 1MZAA 1TGTA 1GBIA 2FESH 2HLCA 2WPIS 1OYQA 3QUMP 4ISHH 3SW2B 1NROH 1Y5AT 2ZFRH 1Z1JA 1FDPA 1ZJKA 4THNH 1D6RA 2VWNA 2ZECA 1HXFH 4ZKOU 1C2IA 1G2MA 1AVWA 3ATLA 1GI3A 2W7SA 3EGKH 1ACBE 2G8TA 1O33A 3MNCA 2ZHQH 1SOZA 2O8MA 4YLUA 5A8ZA 2VVUA 5EU8A 1DY9A 1BTXA 4NCYA 2FX4A 2Q6GA 1K1OA 2GDDA 3TGKE 2EEKA 1KSNA 3RXMA 3UNRA 2GV7A 2XRCA 1S85A 2GCHF 2PSXA 3UREA 2PHBA 2W7UA 3RU4T 3SGQE 1KTTB 3GISB 1XM1A 2Q1JA 1K1IA 3PLPA 4F4OC 1BBRK 1SGPE 3K9XB 1ZJDA 1AUTC 3LGIA 1MUEB 3MH5A 3ZZ4A 1C1TA 1FI8A 2B9LA 5JDUB 3GY5A 3FP8E 1HDTH 1V2VT 1QA0A 2BZAA 2BLVA 3P17H 3E0PB 1P06A 3M37A 5EQSA 2O9QA 1HBTH 3TJNA 4HI3A 1C1QA 3PLKA 1NRQH 1FAKH 1AI8H 1C1WH 1TPSA 2R3UA 1LHCH 1F0UA 1ARCA 2FOAA 5DPAA 5E2OA 5C1YA 2KAIB 3F1SB 4XDEA 3T2NA 3RXBA 2RCEA 2DE9A 2J9NA 1UTMA 3U69H 1F7ZA 5TJXA 1DSTA 1GHZA 4K1SA 1KY9A 2JH0D 2ZFFH 4ZHAA 1UK3A 2ZHFH 4Y8ZA 1HAXB 2V3HH 5JBTA 4MNVA 2AMDA 2Y5HA 4WXIA 3TK9A 5HXFA 1XUHA 4FVBA 2Z9IA 1PPBH 2C90B 2EI7A 1JIRA 1UVUH 1EPTA 1P2NA 1O2MA 3GCHC 2OC7A 3QWCH 3R3GB 4YT6H 2JH6D 1P05A 5C20A 4TY7A 1E35B 2A7CA 2F3CE 1WQVH 3BTHE 1RTFB 1BTWA 1YP9A 3H7TA 1O32A 1TRNA 2ZA5A 3UR6A 3NWUA 4A1TA 4BXWA 5T6FA 1K1NA 2R2MB 3TGJE 2FI4E 1SLWB 5A0AE 1GHBF 4JK6A 2R9PA 1SGDE 1OWJA 4OS7A 1C4Y2 1EQ9A 3KN2A 2CN0H 2NU3E 1YPHC 1BOQA 1WTGH 2UUYA 3MH7A 1G9IE 1EUFA 3NPSA 4MNYA 1EJMA 1SL3A 3V3MA 3UIRA 1F2SE 2QY0B 2VGCC 1TA2A 2OC1A 8KME2 2K1QA 2A4GA 2BM2A 3QN7A 1SGRE 1MU8B 1UK2A 3PLBA 2HOBA 3RMLH 1L0ZA 4X1PU 2FM2A 1BTZA 1O2JA 1GVKB 4RKJB 1HIAB 1QB6A 3Q77A 1ELDE 1ZSJA 1SOTA 1VCQA 2HNTE 4K2YA 2CJIA 2BDIA 1FPHH 4INLA 3D62A 2Z3EA 1GBDA 2VU8E 1QBOA 2OINA 1P3EA 2M5TA 4WJG2 4NGAH 2VH6A 2F91A 3A83A 1JBUH 1GJ5H 1S0QA 4OS2A 5F8XA 1MTWA 2YNAA 1CE5A 1GGDC 1D3PB 1MH0A 5AHGH 4ZROA 3BG4B 1HAIH 1SGNE 1B0EA 1THRH 3OTJE 3V7TA 2C4FH 4FUIA 5FCRA 1O5FH 3KEEA 1W13U 1O3JA 1HXEH 1OYTH 2AIQA 3GCNA 3H5CB 1AN1E 4ZKRU 1LHEH 1SGIB 3ZVDA 4DY7B 1P2IA 1TGSZ 1QBVH 1TFXA 3TJOA 3ZYEA 1QB9A 1ETSH 2HALA 4WY3A 1DWEH 3MU0A 3MTYA 1L2EA 3QDZB 2QXJA 1C5YB 3SU2A 1SSXA 4GVUA 3LJJA 4E06H 3HGPA 4CRGA 1EAUA 3E1XB 1AHTH 2F83A 5LGOA 1O3MA 1TYNA 2G81E 3SJKA 4DT7B 1SGFA 2G55A 1HJAB 5J4SA 1J16A 5F8ZA 4UDWH 1RD3B 1JOUB 4OS1A 1O3HA 1KDQA 3B23B 1C5SA 1P2JA 5PTPA 2UUKB 3PYHA 4K8BA 1QJ1B 2Y80A 1AB9B 4OGYA 2NU2E 1F0SA 3BG4C 3E90B 3M35A 5DK1A 1LCYA 1FLEE 3MO6A 2XBWA 1ZTKA 5C2ZA 4UFFH 3U9AH 5DJ7A 2WPLS 3SZNA 1O2SA 1ESTA 8ESTE 2FZZA 1CT4E 4ISOA 1O2QA 4LZ4B 3GDSA 4KELA 1NPMA 1ZMJA 3W95A 4CHAB 4OGXA 1IQNA 1SG8B 2ZGJA 2BD9A 2BQWB 3LJOA 3A89A 4K60A 4GLYA 2WYGA 5GWZA 1CU1A 1K1JA 1ZHPA 1ZYOA 3ATIA 2QXIA 1SGYE 6GCHF 1O2OA 1FY1A 2OC8A 3MH4A 2UUJB 1LHFH 1BA8B 1A2CH 3A7VA 2ZDNA 1HLTH 3MU1A 1E38B 1WOFA 3ZZBA 1O31A 1QRZA 3T5FH 1OX1A 2F9BH 5C1UA 2ZEBA 1FIZA 4M7GA 4WMFA 4ZHMU 2ZHDA 1C1OA 3VGCB 3A87A 1BMMH 1P2KA 1DXWA 1H9IE 3UWIA 2OQUA 3UNQA 3VXEH 4AORA 1J15A 1Z7KA 5L2ZH 1CHOG 4OS5A 1TBQH 4HTCH 4IC5A 2BYAX 1Z8RA 1WQSA 2OUAA 1TONA 2R0KA 1NN6A 1LPZB 1GBHA 3V12A 2PWXA 2GTBA 4VGCC 3AAUA 1BTYA 1Z8GA 2G5VA 1E37B 1A0HB 1LVOA 3B9FH 3MNBA 4GUXA 1RGQA 1XXFA 2DUCA 3QGNB 2FIRH 1W3CA 1H4WA 1E0FD 2FTMA 3SU1A 4CBOA 1TNHA 1D3QB 1GWAA 2F9OA 1DS2E 3O8DA 1GMDF 1AIXH 3VB5A 3LDXH 1KXDA 2NU1E 2AGIX 1P11E 1TPOA 1PFXC 1XKBC 1C5UA 1GBAA 2ALVA 2P3UB 1SMFE 3QTOH 3SUEA 2BVXH 4Y79A 2HGTH 1A3BH 4DG4A 2WUCA 3SV2H 1YPHE 3RU4E 3E0NB 2P59A 3UPEA 1HGTH 4DURA 2IOTA 3ZYDA 2Z7FE 4Y76A 3PB1E 1PQ8A 3SBKA 3DA9B 4WMEA 1V2KT 3HPTB 1GBBA 3LC5A 4ZAEA 1BJVA 4FUBA 3I29A 2EI6A 1FY8E 2I6QA 2XYAA 1U6QA 1HAVB 1P2MA 1T7CA 5GJ4B 2FODA 4KP0A 4AOQA 1O5EH 2FI3E 2WPKS 3RLWH 2GGVB 4AB8A 3EE0B 2D2DA
chains in the Genus database with same CATH superfamily
5ETXA 1ANDA 2EA3A 2AH4X 1WU1A 2BLQA 1C5ZB 2GT7A 1TRYA 1FXYA 1FY5A 3WWFA 4NWKA 3RMMH 2Z94A 4ABDA 1YCPM 1NBME 2AIPA 1A5IA 1YY3A 3BTKE 1MAXA 2GT8A 2ZU5A 1EZQA 2SGAA 1TX6A 2ALPA 4GCHF 2ANYA 1DVAH 1WUNH 4K1EA 1C5OH 3SU6A 3GOVB 2Z9GA 3RC5A 2CHAB 1AE8H 2O8TA 4I7YH 2FS9A 1UW7A 2FYQA 4JK5A 4O3UA 2R2WU 3JZ1B 1FQ3A 2Y81A 2THFB 4K3JA 1BHXB 2QXGA 5KECA 2ODPA 1KYNA 1TMUH 5E0JA 1P3CA 3T25A 3A7TA 2P93A 2IJOB 1EJNA 1MZDA 1LTOA 1OWIA 1FONA 1MABB 5GXPA 3EA8A 1BIOA 4X6MA 1TX7A 5GDSH 1GDUA 5EQQA 2EY4C 2XC0A 4ASUD 2P8OB 4DGJA 5AF9H 3BEUA 5EGMA 3ZVFA 2ZQ1A 4BAMB 1Q3XA 1TNJA 1S84A 2SGQE 2WV4A 1CT2E 1TAWA 1NBMD 4X1SU 1ANEA 1UTLM 5C94A 2XCNA 1ZGVA 4WH8A 1HYLA 4ZKSU 3MNSA 1ELEE 2J94A 2ZI2H 4BAOB 1EOLA 1XUJA 2WPDD 1EX3A 1VKYA 2ZCKP 2GKVE 5F6MA 3QLPH 3DSOA 3MU4A 1TGNA 2Z9LA 1GDNA 2GZ8A 3KQDA 4MNWA 1XX9A 1DX5M 5SGAE 4F48B 1AD8H 1G3BA 4NSYA 1VJAU 4B75A 1G3DA 1Z1IA 1KXEA 3WY8A 1DICA 4I31A 1B7XB 1W0ZU 1A4WH 3BIVH 3E6PH 4ISNA 3K65B 1YBWA 3KCGH 1E36B 2BQ6B 2F9VA 1H1BA 2W3KA 2YMSB 3F9FA 3KIDU 1GJAB 4I8KA 5EW2H 3TK6A 1T8LA 3SV8A 1W0JD 1OWKA 1ZGIA 5FPTA 1PPZA 1O2PA 1NRPH 3CP7A 2CV3A 4IMZA 3AK5A 1IHSH 1UVTH 5EJZA 4YO9A 1CVWH 2HNTC 5LH8A 2CGAA 3M7UA 3ATKA 1O3CA 1RFNA 2H9TH 4A5TS 1O2WA 1OXGA 1Y3YA 1MTSA 3SJOA 3P70B 4KKDA 4FXGH 1BDAA 1KXBA 3SYJA 3RMOH 1S0RA 1X7AC 1Z6JH 3KQCA 3TH4H 2FO9A 1O39A 3CS7A 1C1PA 4ESTE 4Y7BA 1S6HA 1ELAA 1C5LH 1NU9A 1PPGE 3F3BA 4AGJA 1O3OA 5JBBS 4AN7A 3BF6H 3SJIA 4I8LA 4KTSA 2PGQB 4ZKNU 3UQOA 3M5OA 2P3FH 1GG6C 2A1DB 3RXVA 3V13A 2PKAB 3R0FA 4Q80A 1WAYB 2G5NA 1T32A 1NC6A 4IN1A 1GBEA 4AB9A 3BG8A 2GCHG 1G2LA 3VXFH 1Y8TA 3A7ZA 2YOLA 3F9EA 2ZTXA 2BY6X 3RP2A 3ZZCA 2XBXA 2AGGX 4HFPB 1S82A 3GY3A 4RSPA 4J1YA 5LPFA 2D1JA 2H9EH 3HK6B 4CH8B 5DGJA 2RA3A 3ZVAA 1GI4A 1MD8A 5EOKA 2QCYA 1GHWH 1S6FA 3U1JB 3JZ2B 1W8BH 2H5DA 5HMAA 4DT4A 1IOEA 1GHVH 1H9LB 1WCZA 5DN6D 1AKSB 1DUAA 1FV9A 5EODA 1XKAC 1BUIA 5CHBA 1GL0E 3L3TA 1GL1A 5FAHA 2VVVA 4A6LA 3P8GA 3M7QA 2EI8A 4E7NA 2BXUH 1BITA 2CF8H 2V3OH 3PV5A 1W12U 4CH2B 1FZZA 3M3TA 4ASHA 1GBTA 1T8NA 1C5QA 5E0HA 4X2WA 3UNSA 1TRMA 2JJ1D 1NESE 1ORFA 4U32A 1O2IA 3OSYA 4NA9H 2XW9A 4B6FA 4X2YA 3VB4A 3GCHB 3UFAA 4SGBE 2KAIA 5EG4A 4A92A 2BHGA 2WPMS 2STBE 1VZQH 1DM4B 3HATH 4GHTA 1FJSA 1N6XA 1UCYE 3TGIE 1J17T 3U28C 4ZMAH 2BD5A 5DP6A 1BTUA 5FPSA 1HV7A 3PMAB 4H4FA 2BD2A 1O5BB 5DP7A 4X0WU 1GI8B 1XUFA 1XUKA 4Y0ZE 2OD3B 2AERH 1Y5BT 3BTQE 4D9RA 5C17A 5BRRE 5GNDA 1G3CA 2SNWA 3D65E 1UTJA 2Q6DA 4WVPE 3UY9A 2VGCB 1GHBG 4BTIB 1GBKA 3ODDA 2PTNA 5DKMA 1O3KA 1KLIH 3TJUA 2HPQH 1LQEA 1LDTT 2W6ID 2G51A 1YPLH 5IDKA 2OK5A 4XBCA 1WTHD 2Q6FA 4YT7H 3RXIA 2QYIA 1IAUA 2A0QB 3ZVGA 3RUOA 2UWLA 3H7OA 1ABJH 2K0QA 4JMYA 5E2PA 4Z0KA 3RXKA 1BZXE 2BY8X 2H6MA 2VIWA 1VGCC 1NTPA 3SJ9A 3ZZ3A 3F68H 2ZU4A 4X6OA 3P95A 4XD7D 1Y3VA 2ZFPH 2FYRA 5GCHF 4YXWD 1W10U 2FDAA 1A3EH 1DANH 2EQNA 4XFQA 1GGDB 1LHGH 4ZXXH 3DT0H 2ZPSA 1O0DH 2P94A 1VITF 1O2ZA 2GVFA 1GI5A 1IQGA 1O2GH 1O37A 2WUBA 1CHGA 4GHQA 1FPCH 2A5KA 4MPUA 2BTCE 1HIAA 2ZDKA 1DWDH 2A4OA 1CT0E 1Y5UT 1O2TA 2P95A 4BXSA 3KQEA 2I6SA 2FEQH 1ZTLA 5ESTE 2A5IA 1DSUA 2VVCA 1MTUA 1LKAA 1RRKA 4FUDA 4LZ1H 1P09A 3P8OA 5FX6A 3DSPA 2IPHA 1JWTA 3FVFB 3BTME 3NK8A 4UFDH 2WV9A 1O2VA 3PMHB 1BRAA 2BD4A 3V0XA 2KR7A 3S7KB 4DOQA 5E8EH 3GY6A 1L1GA 1DITH 1QZ8A 2BY7X 1GJBB 1QQUA 1S5SA 1V2JT 3EYDA 3ZVBA 2VINA 2ANKH 5ABWA 4ZH8A 5AFZH 2BX4A 1AZ8A 1C5WB 1ZR0A 1IQEA 1YWUA 1UVSH 2XBYA 1O3LA 1EAIA 1NM6A 2PUXB 1V2WT 2AS9A 3BTEE 1MQ6A 4NA7A 1W14U 2QXHA 1GI6A 1A5HA 3KQ5A 3H09A 4RN6A 3SQHE 3RXPA 5T3HA 3BTTE 4NZQA 1P01A 3MYWA 1F0TA 3C1KA 1VCWA 1YC0A 4R0IA 3GY7A 5EQRA 3PO1C 1D3DB 4IGDA 1TLDA 2A4RA 3PRBA 4XSKU 2PGBB 1DE7H 2OC0A 3A80A 3ATMA 3SN8A 1TNLA 1MKWH 2J95A 1EPTC 3GY4A 2OTVA 3K6ZA 4RT1A 5L30H 2GX4A 4Z1MD 2GMTC 2ODQA 3EE7A 3A82A 3ZZ7A 1A5GH 1O3EA 5K0HA 4UFGH 1PJPA 2ZU3A 1KLJH 1MTVA 1ZMLA 3T62A 2ZZUH 4R8TB 2QF5A 4MPXA 1GJ9B 5EW1H 4QT8C 4NIWA 2Z9KA 3MFJA 3GCTF 1YLCA 1QRWA 3EA9A 3CENA 3M5NA 1EB2A 1P0SH 2FS8A 4B6EA 4DVAU 1GMHF 2JKHA 2QV1A 1K21H 1SPJA 1UMAH 2NU0E 3QGJA 4IS5A 1MKXH 3ZZ8A 1PQ5A 1IQLA 1UJ1A 1SB1H 2ZIQH 3MO9A 1N6YA 2ULLA 1Y3XA 3IITA 3PV4A 2BQ7B 1MTNC 3MMGA 2JETB 4FUJA 3TITA 4VGCB 1RIWC 1GBLA 2PSYA 3PTNA 1SBWA 3OEHD 4CR9A 3FZZA 4B2CA 3QZQA 2ZDMA 4J2YB 3F9GA 4FUEA 1DFPA 2Y6TA 1GBCA 3BIUH 2QF0A 2HVXA 2V35A 1B5GH 3SHCH 3U98H 3UWJH 2G52A 3W1EA 3TJVA 3Q3KA 1MD7A 5A09A 2PFEA 1IQKA 1FN6A 2W6JD 2H5CA 2R3YA 1D4PB 1G30B 4WF8A 3VB6A 1C5RA 1EOJA 2VIQA 4ABAA 4X2XA 1RJXB 4P00A 5DG6A 2D26C 1J9CH 3NXPA 2AMPA 1E1RD 1KXFA 1DLEA 1Q2WA 3F6UH 1CA0C 1MBQA 2ZU2A 3VFEA 1GHXH 4A1VA 1IQJA 3P92A 5DP5A 4B73A 1YYY1 2ZGCA 2G4UA 6LPRA 4B2AA 1LO6A 2FLRH 2KCAA 3A85A 3RXAA 5KEDA 1LKBA 3KQBA 1SR5C 2UWPA 2ZQ2A 3SGBE 1HAOH 2HVYB 1BMAA 1FY3A 4E7RG 5ESBA 1DWBH 1HAYB 4XBBA 2JETC 2A7JA 5EXMA 1TBZH 4O3TA 5A8XA 1O3PB 2ZTYA 1HNEE 2F43B 2WPJS 4O03A 2R0LA 4CRAA 1C5XB 3RXQA 1AZZA 2O8WA 1SC8U 3N7EA 2ZGXH 4ABEA 3URDA 2BOHB 1YPEH 2ZNKH 2PR3A 2G4TA 6ESTA 4K8YA 3MHWU 4JYUH 1F5LA 1A61H 1O2KA 1QQ4A 2TGPZ 4UE7H 3LH3A 5CE1A 1K22H 1UTPA 2FPZA 1QA7A 1RXPA 2GV6A 1FX0B 3LT3A 4TPYA 3SV7A 2KFWA 1MKWK 1C5NH 1QJ7B 2PTCE 5LPRA 1HAVA 1EZSC 1ELBA 4GCHG 1WXRA 4YM9A 1H8HD 2ZFTA 1AUJA 1O30A 2A32A 1GHYH 3OTPA 3S9AA 4NFFA 3EAJA 1C5PA 3UB0A 1M9UA 3MWIU 4AYVB 4MPVA 4U30A 1YF4A 4Q4LA 4PROA 5KGOA 2GD4B 3QTVH 4JCNA 1ZSKA 5FXLA 2J92A 1ELVA 1RS0A 2Z6BD 4U01A 4BANB 4GPGA 3UTUH 3M3VA 3MO3A 1YGCH 3E91A 1CO7E 3UUZA 1SI5H 1H8IH 3M3SA 2FOCA 1GVZA 2W3IA 3M61U 1HPGA 1O2RA 1C2GA 2BVRH 2V0BA 3O8RA 5FX5A 2SGFE 1ZTJA 2FLBH 1EAXA 3AAVA 4ABGA 1YPJH 1NT1A 4ISIH 5T6GA 1TNGA 2ZF0H 1NO9H 2BY5X 3E16B 1L1NA 1O2NA 5G4BA 3RU4D 2BD3A 1TOCB 3ZVEA 1C1UH 1O2XA 2ILNA 1BRUP 3LGVA 3A8AA 3BTDE 4TWYA 6CHAC 2FXRA 1B0FA 2XTTB 5JBAS 1UVPA 5A0BA 4X1NU 3RXFA 1IHTH 1XVMA 3LGWA 5GIBA 1P8VC 4INKA 3FO8D 4DW2U 4AGKA 3F2HA 4FU7A 5J4QA 1SGFG 1XXDA 5C3NA 3GYLB 4DJZB 4A7IB 1EJAA 1OWDA 4Q2KA 4XE4A 1C2EA 3RXDA 3BN9A 2A5AA 5EXNA 2BDGA 1ZPZA 3NCLA 1W0KD 1PPHE 3SV6A 4Y0YE 1O5GH 1Z8JB 1KMHB 4NIYA 1G36A 4F55A 3OE7D 1C2MA 1JMOH 5H4IB 2BDCA 1QURH 2FOBA 4AFQA 2PKSC 4D76A 1ZRKA 5JBCS 1O5AB 1UVOA 1ABIH 1C5MD 1BQYA 2IN2A 1LVYA 4A1XA 2HPPH 1GJCB 2BMGB 1N1LA 1P9SA 3OY6U 2BDBA 4KGAA 2KCYA 1V2QT 1BRCE 3ZV9A 4FUHA 3TLOA 5DP8A 4I86A 1F5RA 3SHAH 1GG6B 1KTSB 1TA6A 3U8RH 1A7SA 1O2YA 3D23A 3RXUA 2PLXA 3SI4H 3NKKA 1L4DA 2B0FA 1GMCF 3I77A 3HKJB 1SVPA 2A45B 1QR3E 2ZC9H 4BTUB 2IPQX 4Y8XA 1IQHA 4O9VA 3DFLA 2F9NA 3UQVA 1C1NA 1GI1A 1O3DA 3KL6A 4F49A 3LU9B 1JRSA 3L33A 2VIDA 3TU7H 1GHAG 3AW0A 3M5LA 4FETA 1Z6EA 2A31A 4JZEH 3SGAE 4B76A 2BX3A 1TPPA 1AY6H 2L6OA 3HKIB 1SGQE 4ABHA 1BMFD 5JB9S 3F2FA 1GBJA 2PKAA 1OP8A 1NFXA 1Y3WA 3SU5A 3A8DA 2XNIA 4D8NA 4HGCA 4JZIA 3Q3YA 1C2HA 4RI0A 1GJ8B 1SGCA 2QC2A 3UR9A 2YNBA 3T29A 2ODYB 4I32A 1SLUB 1V2ST 2FOFA 2OBOA 2NWNA 2JH5D 3S9BA 1MCVA 1J14A 3C27B 3B8JA 3I78A 3VB7A 5F03A 4GSOA 4Y8YA 1AFQC 1TMTH 3TNTA 5FHTA 3MNXA 1Q31A 3VPKA 1EB1H 4X8UH 4KTUA 2FMJA 2ZGBH 1T8OA 2ZPRA 1AKSA 1QCPA 1DOJA 1ELCA 1G3EA 1K9OE 2HWLB 5FCKA 3LOXA 4ISLA 3SNBA 1C1RA 4H42U 1Y59T 1YPMH 1CQQA 1TOMH 3LGTA 3O8BA 3T27A 1UHBB 1SGEE 1ELGA 2XWAA 3RMNH 2LPRA 3OYPA 4NG9H 1QB1A 2CMYA 1TIOA 2OQ5A 1NU7B 2P16A 3F0PA 5T6DA 2A4QA 3ITIA 5JPMH 1V3XA 2BD7A 1AWHB 2HRVA 1W2KH 1HCGA 3BEFB 4TT3D 4YOIA 2VIVA 1D6WA 1XMNB 4B2BA 2OP9A 4NSVA 4B71A 1THPB 5CDFE 4BOHA 2KCPA 2UUFB 4BAHB 4JZDH 1V2TT 2QE7D 3SU0A 1L1JA 3NZIA 5CMXH 4UD9H 1TGBA 2K8IA 5C0TA 3FZDA 1C2FA 1TBRH 5TCAA 3FP6E 2NU4E 4FU9A 2ZU1A 1AQ7A 4SGAE 3PROA 2TRMA 2ZHWH 3K2UA 1A1RA 1S6LA 2O8UA 1EAWA 2ZTZA 1VGCB 3EA7A 1VJ9U 3M5MA 5E0GA 7GCHF 2BZ6H 3A84A 1SQOA 2F4LA 2C8WB 3RXSA 2BY9X 1TNKA 4DIHH 3ATWA 2BOKA 1NS3A 4XOJA 8GCHF 1CBWB 2TGAA 2RFKC 3A88A 1K1PA 1OP2A 4JYTA 2CF9H 1UK4A 5GCHG 2OXSA 2WYJA 2SGPE 3NRLA 5CHAB 4BAQB 4BTTB 1BHXF 1ZMNA 3PRDA 2GCTC 1HAHH 1O2UA 1VITG 1ESBA 1T4UH 1CGJE 2TPIZ 3UAIC 4I8GA 1TX8A 3ZZ5A 2RDLA 3TNSA 3STJA 3LH1A 1LHDH 4IC6A 3M7TA 4YOGA 3SU4A 4ABBA 3SNCA 3KHVA 1UTOA 3CNRA 2Y5FA 3S7HB 2HNTF 5FBIA 1AVGH 1TABE 1G37A 4ZUHA 2OLGA 3T26A 4Z6AH 2O8LA 1BCUH 2GZ7A 4X2VA 1DWCH 2VJ1A 3SUFA 3ZIAD 3AVZA 1V2OT 1QNJA 2QN5T 1NRNH 3FOAA 1O34A 4JZFH 4CRCA 3RM0H 4YTAA 1SLVB 1GI0A 1JIMA 2QA9E 1SKYE 1MMJN 1K28D 1ETTH 1AFEH 2Z3CA 1AGJA 3KF2A 1AWFH 1BRBE 3N7DA 2ZKSA 1C1VH 4ZCNA 1KLTA 3LIWA 3UOPA 2SGEE 3DD2H 1CBWC 4NFEA 1EATA 1INCA 2A2QH 3AW1A 4ABIA 1HAZB 4RKOB 1GBMA 4YOJA 1AU8A 2JIZD 3OAAD 5CHAC 1P2OA 2BDAA 4Q7YA 3RXLA 1ANBA 4MTBA 1P12E 5AFYH 1MU6B 4LOYH 1QY6A 1MCTA 3PO1B 3TVJB 4AG2A 1OHHD 1ANCA 1C9TA 1C9PA 1PPFE 1TWXB 2BLOA 3ZZ6A 1FMGA 5IK2D 4K5ZA 3RXTA 3SNEA 1CGIE 4DIIH 1EPTB 4OS6A 1NFYA 4MG3A 1O36A 2XC4A 2FWWA 2ZDLA 4ZHLU 3BTGE 5L6NH 1TNIA 2Y7XA 1ZRBA 2GMTB 1O38A 4UEHH 1SQRA 1QIXB 2VIPA 1UTKA 4E05H 2WINI 5HGGA 2FOEA 4UONA 4INHA 4CR5A 3FKSD 3QO6A 3E3TA 2OCVB 4Q7ZA 2AYWA 1NRSH 4MPWA 3SU3A 3ZV8A 3VB3A 2ANWA 1YCPH 4X1RU 1KXAA 1QTFA 1JRTA 2SFAA 3W94A 4WWYA 2JDID 1HAPH 2BDHA 2BD8A 2G00A 3RM2H 1WSSH 3G01A 4GAWA 1QL7A 2XWBI 1QL8A 1HUTH 5TCCA 2STAE 2D8WA 2FTLE 1VCPA 3FANA 1BBRE 1F92A 3LGUA 4IMQA 2C3SA 1A0LA 1PYTD 1EP6A 2ZG0H 1AVXA 3GCTG 1P03A 2H1UA 1MTNB 1WDIA 5EJ1A 5HYOA 1AE5A 4Q7XA 4KTCA 1GMHG 3ELAH 1PPEE 1QRXA 1RIWB 3ENSB 1ELFA 3F0OA 1YLDA 2XCFA 1NY22 4I33A 2Y7ZA 2ZDVH 1H8DH 1PQAA 2ZCHP 3GDUA 5IYTA 8LPRA 3SUDA 3ZZ9A 2VH0A 2XNDD 3GS9A 1SHYA 1O5DH 3SJ8A 2KCOA 2AFQB 1EZUC 1NZQH 1Z71A 1TPAE 1OP0A 3HK3B 3BTWE 5FBEA 3Q00A 5I46H 1MQ5A 1C2LA 1YLNA 4JZ1A 2VWMA 4X6PA 2FI5E 3K6YA 2J34A 1C4U2 4IW4E 1CA0B 6GCHG 3E8LA 1D3TB 1GJ6A 3MOCA 5A2MH 4HZHA 2ESTE 2PP6A 2SNVA 1QJ6B 1FUJA 3OX7U 4D7GA 4X6NA 1V2PT 3D49H 3RXOA 3PMBB 4K69A 1N8OB 1SFIA 4MDSA 1HB0B 3SI3H 1O3FA 1UO6A 2TGTA 1ZHRA 3N99A 4B1TA 1J8AA 4FVDA 3SNAA 1P04A 4HG6A 2ZP0H 1SHHB 1O3BA 3TH2H 2ZWLH 3NUMA 2Z9JA 2ZDAH 3SORA 4XBDA 3RLYH 3RXRA 3LKWA 3GICB 1ZLRA 2LELA 1XUGA 5DO4H 1ZHMA 1EXFA 2EC9H 1O2LA 1AMHA 1O3GA 4Y10E 5A8YA 3BV9B 1KIGH 4NIXA 4P02A 5B6OA 1ZPBA 3M36A 1C5VA 1P9UA 3KGPA 1YPKH 2VNTA 1GJ4H 2PV9B 1NFWA 1S81A 1T4VH 1T8MA 5HM2A 3SZEA 1GMDG 3FAOA 5HM9A 1UTQA 9LPRA 1KDQB 2ZPQA 5EJLA 5C1XA 2ANMH 1OS8A 7LPRA 2A7HA 1FY4A 3DHKH 4ABFA 2SGDE 2C8YB 1EFRD 1Z8IB 3GYMA 2V6NA 3Q3XA 1ETRH 1YCPK 3GY8A 1N8OC 3P6ZB 2DE8A 1H8ED 2GP9B 4I8HA 4D9QA 1RTLA 3MU8A 2Y82A 2VIOA 2ZHEH 4X8TH 5K7RA 3EQ0H 1LVMA 1HJ8A 1BJUA 2J4IA 2OBQA 1WV7H 3KYGA 5FPYA 4Y7AA 2H9HA 1C2DA 3TPIZ 1HJAC 3ODFA 2ZCLP 1ARBA 3MH6A 3UOUA 4K1TA 2GZ9A 2J98B 1GJ7B 4CRDA 3EDXB 1E34B 2H2ZA 3F9HA 3RXHA 1FIWA 7KMEH 3LPRA 2V3MA 4AYYB 1K2I1 2XXLA 1AB9C 1Y3UA 4I8JA 1EKBB 1DY8A 1GI9B 1HFDA 4U2WA 1GCDA 3SQEE 1W0YH 1O3AA 5AVDA 1VR1H 3RXEA 2WV5A 4TYDA 4ACBA 3A7XA 4IN2A 1C1MA 1IQIA 3PWCA 7ESTE 2P3TB 3RXGA 3VEQB 6CHAB 4CHAC 4BNRA 1O3NA 1PQ7A 2J38A 4YESB 1GDQA 3PWBA 5EXLA 2AMQA 3DUXH 1E1QD 5BPEA 1THSH 1O5CB 2AHME 1GCTB 1TGCA 1UCYH 2BB4A 3SO3A 3KYFA 3IWMA 1ESAA 2FX6A 1DUEA 3A8CA 1GJDB 3VG8A 5EIYA 1PPCE 2ZFQH 4WMDA 1OWEA 4DCDA 1OSSA 5JB8S 1GI2A 3A8BA 5C5NA 2CK3D 1SQTA 1G32B 1CHOF 1OKXA 3OFND 1C1SA 1MKXK 3KNXA 4BAKB 3IG6B 3FFGA 3SNDA 3VGCC 1D9IA 4WXVA 1EASA 1C4V2 2ZFSA 1DT2A 2QGRA 3OY5U 1IQMA 2PKSB 1DLKB 4D7FA 1SFQB 1BB0B 1P2QA 1V2RT 1GI7B 5DP3A 4NIVA 2GJGA 1K1LA 1LMWB 1TB6H 1CGHA 1F0RA 4AG1A 5L2YH 3RC6A 3A86A 3BTFE 5EPNA 1GPZA 1LPKB 4UFEH 2HLDD 2FP7B 4WH6A 2TBSA 1LPGB 1DDJA 3S69A 1OOKB 4H6SB 2ZO3H 5F53A 4MLFB 3U8OH 2ASUB 3ZZDA 2BLWA 4X1QU 4AZ2B 1H9HE 1T31A 3RXCA 1ZPCA 3GCOA 2BDYA 3P8NA 5DP9A 3RDZA 1ID5H 9ESTA 4FOUC 4YLQH 2TIOA 1GCTC 3LC3A 1C2JA 2PUQH 2W26A 4ZXYH 1AO5A 2VWOA 2J2UA 2QAAA 1QFKH 1GMCG 1SQAA 4ABJA 5I25A 2RG3A 1ELTA 3WW7A 3GDVA 1NRRH 2Y5GA 1L4ZA 2C93B 5C67A 4H6TA 2FOGA 1F5KU 3BEIB 1OWHA 5C0UA 1DXPA 2XC5A 4MNXA 4X8SH 5EPYA 1A0JA 2LNCA 1CSOE 2B8OH 3BSQA 3MI4A 3PTBA 1EZXC 1QL9A 3FN8A 4FU8A 1HJ9A 1BMNH 1ZZZA 1EP5A 1JXPA 4AFZA 2C8XB 1P57B 5JYIA 3S9CA 1RTKA 2IJD1 4CREA 1SLXB 3TIUA 4X8VH 1GVLA 1O35A 1HAGE 3RC4A 1XVOA 1SGTA 3U1IB 5GPIB 4CRFA 3AASA 3SOSA 2QIQA 4OS4A 5LPEA 3DCLA 1V2NT 1PYTC 1ZSLA 2FOMB 4MQAA 1FNIA 1DPOA 3STIA 1AFQB 3TK5A 4O97A 5T1VA 1YKTA 2A2XH 1XUIA 5C5OA 3S0NA 2QF3A 1GBFA 1V2LT 2VB0A 2BXTH 1TMBH 1V6DA 1QBNA 3L6PA 5F8TA 3SUGA 3PMJA 1NFUA 1O2HA 4CRBA 1ZOMA 1BBRH 1KXCA 1V2MT 2CXVA 1S83A 4LXBH 1UTNA 1UCYK 3TH3H 1QGFA 2CHAC 2QF4A 1CA8B 1V2UT 2FOHA 3P8FA 3CS0A 1YM0A 1FN8A 4NZLA 3ZZAA 3N7OA 2TGDA 1TQ0B 1YPGH 4FUCA 3URCA 3A7YA 2B5TB 1W7GH 4TWWA 1TE0A 1MAYA 3LONA 1C5TA 4FUGA 4NA8A 1W7XH 4FUFA 1BTHH 1P10A 2B7DH 3Q76A 3QK1A 4CBNA 4JYVH 1C2KA 4Y11E 1VITH 2P8OC 3SV9A 1HRTH 2C8ZB 4AX9H 5A0CA 1WBGB 2ZGHA 1TALA 1LQDB 3OU0A 1A46H 2Z3DA 1FAXA 1K1MA 1BT7A 1UHBA 2UWOA 2VWLA 3A7WA 4Y71A 2AEIH 3DFJA 1W11U 5FL7D 4YZUA 3U8TH 4TPIZ 2F9UA 2J5UA 1WYKA 2XBVA 1BMLA 3OEED 2F9PA 4IBLH 1IQFA 2BVSH 2W5EA 1MBMA 3RXJA 5DP4A 4TY6A 1QHRB 3HGNA 3LGYA 4NWLA 7GCHG 3MU5A 3QZRA 3QX5H 3O8CA 2GDEH 3WWBA 3A81A 4MVNA 1BTPA 3PM3A 1O3IA 3FP7E 4LK4A 3T28A 2RA0A 2PW8H 4B74A 1GHAF 8GCHG 3GY2A 2AGEX 3ZVCA 1LVBA 4AFSA 1P02A 2GCTB 2YMSC 1TQ7B 3ESTA 1OPHB 2WPHS 4Y6DA 4AFUA 1MZAA 1TGTA 1GBIA 2FESH 2HLCA 2KZ4A 1OYQA 2WPIS 3QUMP 4ISHH 3SW2B 1NROH 1Y5AT 2ZFRH 1Z1JA 1FDPA 1ZJKA 4THNH 1D6RA 2VWNA 2ZECA 1HXFH 4ZKOU 3DSGA 1C2IA 1G2MA 1AVWA 3ATLA 1GI3A 2W7SA 3EGKH 1ACBE 2G8TA 1O33A 3MNCA 2ZHQH 1SOZA 2O8MA 2XOKD 4YLUA 5A8ZA 2VVUA 5EU8A 1DY9A 1BTXA 4NCYA 2FX4A 2Q6GA 1K1OA 2GDDA 3TGKE 3PV2A 2EEKA 1KSNA 3RXMA 3UNRA 2GV7A 2XRCA 1S85A 2GCHF 2PSXA 3UREA 2PHBA 2W7UA 3RU4T 3SGQE 1KTTB 3GISB 1XM1A 2Q1JA 1K1IA 3PLPA 4F4OC 1BBRK 1SGPE 3K9XB 1ZJDA 1AUTC 3LGIA 1MUEB 3MH5A 3ZZ4A 1C1TA 1FI8A 2B9LA 5JDUB 3GY5A 3FP8E 1HDTH 1V2VT 1QA0A 2BZAA 2BLVA 3P17H 3E0PB 1P06A 3M37A 5EQSA 2O9QA 1HBTH 3TJNA 4HI3A 1C1QA 3PLKA 1NRQH 1FAKH 1AI8H 1C1WH 1TPSA 2R3UA 1LHCH 1F0UA 1ARCA 2FOAA 5DPAA 5E2OA 5C1YA 2KAIB 3F1SB 4XDEA 3T2NA 3RXBA 2RCEA 2DE9A 2J9NA 1UTMA 3U69H 1F7ZA 5TJXA 1DSTA 1GHZA 4K1SA 1KY9A 2JH0D 2ZFFH 4ZHAA 1UK3A 2ZHFH 4Y8ZA 1HAXB 2V3HH 5JBTA 4MNVA 2AMDA 2JJ2D 2Y5HA 4WXIA 3TK9A 5HXFA 1XUHA 4FVBA 2Z9IA 1PPBH 2C90B 2EI7A 2LP6A 1JIRA 1UVUH 1EPTA 1P2NA 1O2MA 2V7QD 2OC7A 3GCHC 5HKKD 3QWCH 3R3GB 4YT6H 2JH6D 1P05A 5C20A 4TY7A 1E35B 2A7CA 2F3CE 1WQVH 3BTHE 1RTFB 1BTWA 1YP9A 3H7TA 1O32A 1TRNA 2ZA5A 3UR6A 3NWUA 4A1TA 4BXWA 5T6FA 1K1NA 2R2MB 3TGJE 2FI4E 4ACAA 1SLWB 5A0AE 1GHBF 4JK6A 2R9PA 1SGDE 1OWJA 4OS7A 1C4Y2 1EQ9A 3KN2A 2CN0H 2NU3E 1YPHC 1BOQA 1WTGH 2UUYA 3MH7A 1G9IE 1EUFA 3NPSA 4MNYA 1EJMA 1SL3A 3V3MA 3UIRA 1F2SE 2QY0B 2VGCC 1TA2A 2OC1A 8KME2 2K1QA 2A4GA 2BM2A 3QN7A 1SGRE 1MU8B 1UK2A 3PLBA 2HOBA 3RMLH 1L0ZA 4X1PU 2FM2A 1BTZA 1O2JA 1GVKB 4RKJB 1HIAB 1QB6A 2RDEA 1COWD 1ELDE 3Q77A 1ZSJA 2WSSD 1SOTA 1VCQA 2HNTE 4K2YA 2CJIA 2BDIA 1FPHH 4INLA 3D62A 3MQKC 2Z3EA 1GBDA 2VU8E 1QBOA 2OINA 1P3EA 2WZQA 2M5TA 4WJG2 2KM0A 4NGAH 2VH6A 2VBCA 2F91A 3A83A 1JBUH 1GJ5H 1S0QA 4OS2A 5F8XA 1MTWA 2YNAA 1CE5A 1GGDC 1D3PB 4Q63A 1MH0A 5AHGH 4ZROA 3BG4B 1HAIH 1SGNE 2J97A 1B0EA 1THRH 3OTJE 3V7TA 2C4FH 4RT0A 4FUIA 5FCRA 1O5FH 3KEEA 1W13U 5B6LA 1O3JA 1HXEH 1OYTH 2AIQA 3GCNA 3H5CB 1AN1E 4ZKRU 1LHEH 1SGIB 3ZVDA 4DY7B 1P2IA 1TGSZ 1QBVH 1TFXA 3TJOA 3ZYEA 1QB9A 1ETSH 2M2AA 2HALA 4WY3A 1DWEH 3MU0A 1K0HA 3MTYA 1L2EA 3QDZB 2QXJA 1C5YB 3SU2A 1SSXA 4M9FA 4GVUA 3LJJA 4E06H 4TSFD 3HGPA 4CRGA 1EAUA 3E1XB 1AHTH 2F83A 5LGOA 1O3MA 1TYNA 2G81E 3SJKA 4DT7B 1SGFA 2G55A 1HJAB 5J4SA 2L74A 1J16A 5F8ZA 4UDWH 1RD3B 1JOUB 4OS1A 1O3HA 1KDQA 3B23B 1C5SA 1P2JA 5PTPA 2UUKB 3PYHA 4K8BA 1QJ1B 2Y80A 1AB9B 4OGYA 2NU2E 1F0SA 3BG4C 3E90B 3M35A 5DK1A 1LCYA 1FLEE 3MO6A 2XBWA 1ZTKA 5C2ZA 4UFFH 3U9AH 5DJ7A 2WPLS 3SZNA 1O2SA 1ESTA 8ESTE 2FZZA 5DSFA 1CT4E 2YMSD 1O2QA 4ISOA 4LZ4B 3GDSA 4KELA 1NPMA 1ZMJA 3W95A 4CHAB 4OGXA 3F2GA 1IQNA 1SG8B 2ZGJA 2BD9A 2BQWB 3LJOA 3A89A 4K60A 4GLYA 2WYGA 5GWZA 1CU1A 1K1JA 1ZHPA 1ZYOA 3ATIA 2QXIA 1SGYE 2J98A 6GCHF 1O2OA 1FY1A 2OC8A 3MH4A 2UUJB 1LHFH 1BA8B 1A2CH 3A7VA 2ZDNA 1HLTH 3MU1A 1E38B 1WOFA 3ZZBA 1O31A 1QRZA 3T5FH 1OX1A 2F9BH 5C1UA 2ZEBA 1FIZA 4M7GA 4WMFA 4ZHMU 2ZHDA 1C1OA 3VGCB 3A87A 1BMMH 1P2KA 1DXWA 1H9IE 3UWIA 2OQUA 3UNQA 3VXEH 4AORA 1J15A 1Z7KA 5L2ZH 1CHOG 4OS5A 1TBQH 4HTCH 4IC5A 2BYAX 1Z8RA 1WQSA 2OUAA 1TONA 2WHXA 2R0KA 1NN6A 1LPZB 5HIYA 1GBHA 3V12A 2PWXA 2GTBA 4VGCC 3AAUA 4XRNA 1BTYA 1Z8GA 2G5VA 1E37B 1A0HB 1LVOA 3B9FH 3MNBA 4GUXA 1RGQA 1XXFA 2DUCA 3QGNB 2FIRH 1W3CA 1H4WA 1E0FD 2FTMA 3SU1A 4CBOA 2KX4A 1TNHA 1D3QB 1GWAA 2F9OA 1DS2E 3O8DA 1GMDF 1AIXH 3VB5A 3LDXH 1KXDA 2NU1E 2AGIX 1P11E 1TPOA 1PFXC 1XKBC 1C5UA 1GBAA 2ALVA 2P3UB 1SMFE 3QTOH 3SUEA 2BVXH 4Y79A 2HGTH 1A3BH 4DG4A 2WUCA 4AC9A 3SV2H 1YPHE 3RU4E 5HIZA 4OM9A 1E79D 2P59A 3E0NB 3UPEA 1HGTH 4DURA 2IOTA 3ZYDA 2Z7FE 4Y76A 3PB1E 1PQ8A 3SBKA 3DA9B 4WMEA 1V2KT 3HPTB 1GBBA 3LC5A 4ZAEA 1BJVA 4FUBA 3I29A 2EI6A 1FY8E 2I6QA 2XYAA 1U6QA 1HAVB 1P2MA 1T7CA 5GJ4B 2FODA 4KP0A 4AOQA 1O5EH 2FI3E 2WPKS 3RLWH 2GGVB 4AB8A 3EE0B 2D2DA
chains in the Genus database with same CATH topology
5ETXA 1ANDA 2EA3A 2AH4X 1WU1A 2BLQA 1C5ZB 2GT7A 1TRYA 1FXYA 1FY5A 4NWKA 3RMMH 2Z94A 4ABDA 1YCPM 2AIPA 1A5IA 3BTKE 1MAXA 2GT8A 2ZU5A 1EZQA 2SGAA 1TX6A 2ALPA 4GCHF 2ANYA 1DVAH 1WUNH 4K1EA 1C5OH 3SU6A 3GOVB 2Z9GA 3RC5A 2CHAB 1AE8H 2O8TA 4I7YH 2FS9A 2FYQA 4O3UA 4JK5A 2R2WU 3JZ1B 1FQ3A 2Y81A 2THFB 4K3JA 1BHXB 2QXGA 2ODPA 1KYNA 1TMUH 5E0JA 1P3CA 3T25A 3A7TA 2P93A 2IJOB 1EJNA 1MZDA 1LTOA 1OWIA 1FONA 5GXPA 3EA8A 1BIOA 4X6MA 1TX7A 5GDSH 1GDUA 5EQQA 2XC0A 2P8OB 4DGJA 5AF9H 3BEUA 5EGMA 3ZVFA 2ZQ1A 4BAMB 1Q3XA 1TNJA 1S84A 2SGQE 2WV4A 1CT2E 1TAWA 4X1SU 1ANEA 1UTLM 2XCNA 1ZGVA 4WH8A 1HYLA 4ZKSU 3MNSA 1ELEE 2J94A 2ZI2H 4BAOB 1EOLA 1XUJA 1EX3A 2ZCKP 2GKVE 5F6MA 3QLPH 3MU4A 1TGNA 2Z9LA 1GDNA 2GZ8A 3KQDA 4MNWA 1XX9A 1DX5M 5SGAE 1AD8H 1G3BA 4NSYA 1VJAU 4B75A 1G3DA 1Z1IA 1KXEA 3WY8A 1DICA 4I31A 1B7XB 1W0ZU 1A4WH 3BIVH 3E6PH 4ISNA 3K65B 1YBWA 3KCGH 1E36B 2BQ6B 2F9VA 1H1BA 2W3KA 3KIDU 3F9FA 1GJAB 4I8KA 5EW2H 3TK6A 1T8LA 3SV8A 1OWKA 1ZGIA 5FPTA 1PPZA 1O2PA 1NRPH 3CP7A 2CV3A 4IMZA 1IHSH 1UVTH 4YO9A 1CVWH 2HNTC 5LH8A 2CGAA 3M7UA 3ATKA 1O3CA 1RFNA 2H9TH 4A5TS 1O2WA 1OXGA 1Y3YA 1MTSA 3SJOA 3P70B 4KKDA 4FXGH 1BDAA 1KXBA 3RMOH 1S0RA 1X7AC 1Z6JH 3KQCA 3TH4H 2FO9A 1O39A 3CS7A 1C1PA 4ESTE 4Y7BA 1S6HA 1ELAA 1C5LH 1NU9A 1PPGE 4AGJA 1O3OA 5JBBS 4AN7A 3BF6H 3SJIA 4I8LA 4KTSA 2PGQB 4ZKNU 3UQOA 3M5OA 2P3FH 1GG6C 2A1DB 3RXVA 3V13A 2PKAB 3R0FA 4Q80A 1WAYB 2G5NA 1T32A 1NC6A 4IN1A 1GBEA 4AB9A 3BG8A 2GCHG 1G2LA 3VXFH 1Y8TA 3A7ZA 2YOLA 3F9EA 2ZTXA 2BY6X 3RP2A 3ZZCA 2XBXA 2AGGX 4HFPB 1S82A 3GY3A 4RSPA 4J1YA 5LPFA 2D1JA 2H9EH 3HK6B 4CH8B 5DGJA 2RA3A 3ZVAA 1GI4A 1MD8A 5EOKA 2QCYA 1GHWH 1S6FA 3U1JB 3JZ2B 1W8BH 2H5DA 5HMAA 1IOEA 1GHVH 1H9LB 1WCZA 1AKSB 1DUAA 1FV9A 5EODA 1XKAC 1BUIA 1GL0E 3L3TA 1GL1A 5FAHA 2VVVA 4A6LA 3P8GA 3M7QA 2EI8A 4E7NA 2BXUH 1BITA 2CF8H 2V3OH 1W12U 4CH2B 1FZZA 3M3TA 4ASHA 1GBTA 1T8NA 1C5QA 5E0HA 4X2WA 3UNSA 1TRMA 1NESE 1ORFA 4U32A 1O2IA 3OSYA 4NA9H 2XW9A 4X2YA 3VB4A 3GCHB 3UFAA 4SGBE 2KAIA 5EG4A 4A92A 2BHGA 2WPMS 2STBE 1VZQH 1DM4B 3HATH 4GHTA 1FJSA 1N6XA 1UCYE 3TGIE 1J17T 4ZMAH 2BD5A 5DP6A 1BTUA 5FPSA 1HV7A 3PMAB 4H4FA 2BD2A 1O5BB 5DP7A 4X0WU 1GI8B 1XUFA 1XUKA 4Y0ZE 2OD3B 2AERH 1Y5BT 3BTQE 4D9RA 5BRRE 1G3CA 2SNWA 3D65E 1UTJA 2Q6DA 4WVPE 3UY9A 2VGCB 1GHBG 4BTIB 1GBKA 3ODDA 2PTNA 5DKMA 1O3KA 1KLIH 3TJUA 2HPQH 1LQEA 1LDTT 2G51A 1YPLH 5IDKA 4XBCA 1WTHD 2Q6FA 4YT7H 3RXIA 2QYIA 1IAUA 2A0QB 3ZVGA 3RUOA 2UWLA 3H7OA 1ABJH 4JMYA 5E2PA 4Z0KA 3RXKA 1BZXE 2BY8X 2H6MA 2VIWA 1VGCC 1NTPA 3SJ9A 3ZZ3A 3F68H 2ZU4A 4X6OA 3P95A 1Y3VA 2ZFPH 2FYRA 5GCHF 1W10U 2FDAA 1A3EH 1DANH 4XFQA 1GGDB 1LHGH 4ZXXH 3DT0H 2ZPSA 1O0DH 2P94A 1VITF 1O2ZA 2GVFA 1GI5A 1IQGA 1O2GH 1O37A 2WUBA 1CHGA 4GHQA 1FPCH 2A5KA 4MPUA 2BTCE 1HIAA 2ZDKA 1DWDH 2A4OA 1CT0E 1Y5UT 1O2TA 2P95A 4BXSA 3KQEA 2I6SA 2FEQH 1ZTLA 5ESTE 2A5IA 1DSUA 2VVCA 1MTUA 1LKAA 1RRKA 4FUDA 4LZ1H 1P09A 3P8OA 5FX6A 2IPHA 1JWTA 3FVFB 3BTME 3NK8A 4UFDH 1O2VA 3PMHB 1BRAA 2BD4A 3V0XA 4DOQA 3S7KB 5E8EH 3GY6A 1L1GA 1DITH 2BY7X 1GJBB 1QQUA 1S5SA 1V2JT 3EYDA 3ZVBA 2VINA 2ANKH 5ABWA 4ZH8A 5AFZH 2BX4A 1AZ8A 1C5WB 1ZR0A 1IQEA 1UVSH 2XBYA 1O3LA 1EAIA 1NM6A 2PUXB 1V2WT 2AS9A 3BTEE 1MQ6A 4NA7A 1W14U 2QXHA 1GI6A 1A5HA 4RN6A 3SQHE 3RXPA 5T3HA 3BTTE 4NZQA 1P01A 3MYWA 1F0TA 3C1KA 1VCWA 1YC0A 4R0IA 3GY7A 5EQRA 3PO1C 1D3DB 4IGDA 1TLDA 2A4RA 4XSKU 2PGBB 1DE7H 2OC0A 3A80A 3ATMA 3SN8A 1TNLA 1MKWH 2J95A 1EPTC 3GY4A 2OTVA 3K6ZA 5L30H 2GX4A 2GMTC 2ODQA 3A82A 3ZZ7A 1A5GH 1O3EA 5K0HA 4UFGH 1PJPA 2ZU3A 1KLJH 1MTVA 1ZMLA 3T62A 2ZZUH 4R8TB 4MPXA 1GJ9B 5EW1H 4QT8C 4NIWA 2Z9KA 3MFJA 3GCTF 1YLCA 1QRWA 3EA9A 3CENA 3M5NA 1EB2A 1P0SH 2FS8A 4DVAU 1GMHF 2JKHA 2QV1A 1K21H 1SPJA 2NU0E 1UMAH 3QGJA 4IS5A 1MKXH 3ZZ8A 1PQ5A 1IQLA 1UJ1A 1SB1H 2ZIQH 3MO9A 1N6YA 2ULLA 1Y3XA 3IITA 3PV4A 2BQ7B 1MTNC 3MMGA 2JETB 4FUJA 3TITA 4VGCB 1RIWC 1GBLA 2PSYA 3PTNA 1SBWA 4CR9A 3FZZA 4B2CA 3QZQA 2ZDMA 4J2YB 3F9GA 4FUEA 1DFPA 2Y6TA 1GBCA 3BIUH 2QF0A 2HVXA 2V35A 1B5GH 3SHCH 3U98H 3UWJH 2G52A 3TJVA 3Q3KA 1MD7A 5A09A 2PFEA 1IQKA 1FN6A 2H5CA 2R3YA 1D4PB 1G30B 4WF8A 3VB6A 1C5RA 1EOJA 2VIQA 4ABAA 4X2XA 1RJXB 5DG6A 2D26C 1J9CH 3NXPA 2AMPA 1KXFA 1DLEA 1Q2WA 3F6UH 1CA0C 1MBQA 2ZU2A 3VFEA 1GHXH 4A1VA 1IQJA 3P92A 5DP5A 4B73A 1YYY1 2ZGCA 2G4UA 6LPRA 4B2AA 1LO6A 2FLRH 3A85A 3RXAA 1LKBA 3KQBA 1SR5C 2UWPA 2ZQ2A 3SGBE 1HAOH 1BMAA 1FY3A 4E7RG 5ESBA 1DWBH 1HAYB 4XBBA 2JETC 2A7JA 5EXMA 1TBZH 4O3TA 5A8XA 1O3PB 2ZTYA 1HNEE 2WPJS 4O03A 2R0LA 4CRAA 1C5XB 3RXQA 1AZZA 2O8WA 1SC8U 2ZGXH 4ABEA 3URDA 2BOHB 1YPEH 2ZNKH 2PR3A 2G4TA 6ESTA 4K8YA 3MHWU 4JYUH 1F5LA 1A61H 1O2KA 1QQ4A 2TGPZ 4UE7H 3LH3A 5CE1A 1K22H 1UTPA 2FPZA 1QA7A 1RXPA 2GV6A 3LT3A 4TPYA 3SV7A 1MKWK 1C5NH 1QJ7B 2PTCE 5LPRA 1HAVA 1EZSC 1ELBA 4GCHG 4YM9A 2ZFTA 1AUJA 1O30A 2A32A 1GHYH 3S9AA 4NFFA 3EAJA 1C5PA 1M9UA 3MWIU 4AYVB 4MPVA 4U30A 1YF4A 4PROA 2GD4B 3QTVH 4JCNA 1ZSKA 5FXLA 2J92A 1ELVA 1RS0A 2Z6BD 4U01A 4BANB 4GPGA 3UTUH 3M3VA 3MO3A 1YGCH 3E91A 1CO7E 3UUZA 1SI5H 1H8IH 3M3SA 2FOCA 1GVZA 2W3IA 3M61U 1HPGA 1O2RA 1C2GA 2BVRH 2V0BA 3O8RA 5FX5A 2SGFE 1ZTJA 2FLBH 1EAXA 3AAVA 4ABGA 1YPJH 1NT1A 4ISIH 5T6GA 1TNGA 2ZF0H 1NO9H 2BY5X 3E16B 1L1NA 1O2NA 5G4BA 3RU4D 2BD3A 1TOCB 3ZVEA 1C1UH 1O2XA 2ILNA 1BRUP 3LGVA 3A8AA 3BTDE 4TWYA 6CHAC 2FXRA 1B0FA 2XTTB 5JBAS 1UVPA 5A0BA 4X1NU 3RXFA 1IHTH 1XVMA 3LGWA 5GIBA 1P8VC 4INKA 4DW2U 4AGKA 4FU7A 5J4QA 1SGFG 1XXDA 5C3NA 3GYLB 4DJZB 4A7IB 1EJAA 1OWDA 4Q2KA 4XE4A 1C2EA 3RXDA 3BN9A 2A5AA 5EXNA 2BDGA 1ZPZA 3NCLA 1PPHE 3SV6A 4Y0YE 1O5GH 1Z8JB 4NIYA 1G36A 1C2MA 1JMOH 5H4IB 2BDCA 1QURH 2FOBA 4AFQA 2PKSC 4D76A 1ZRKA 5JBCS 1O5AB 1UVOA 1ABIH 1C5MD 1BQYA 2IN2A 1LVYA 4A1XA 2HPPH 1GJCB 2BMGB 1N1LA 1P9SA 3OY6U 2BDBA 4KGAA 1V2QT 1BRCE 3ZV9A 4FUHA 3TLOA 5DP8A 1F5RA 3SHAH 1GG6B 1KTSB 1TA6A 3U8RH 1A7SA 1O2YA 3D23A 3RXUA 2PLXA 3SI4H 3NKKA 1L4DA 2B0FA 1GMCF 3I77A 3HKJB 1SVPA 2A45B 1QR3E 2ZC9H 4BTUB 4Y8XA 1IQHA 4O9VA 3DFLA 2F9NA 3UQVA 1C1NA 1GI1A 1O3DA 3KL6A 4F49A 3LU9B 1JRSA 3L33A 2VIDA 3TU7H 1GHAG 3AW0A 3M5LA 1Z6EA 2A31A 4JZEH 3SGAE 4B76A 2BX3A 1TPPA 1AY6H 3HKIB 1SGQE 4ABHA 5JB9S 1GBJA 2PKAA 1OP8A 1NFXA 1Y3WA 3SU5A 3A8DA 2XNIA 4D8NA 4HGCA 4JZIA 3Q3YA 1C2HA 1GJ8B 1SGCA 2QC2A 3UR9A 2YNBA 3T29A 2ODYB 4I32A 1SLUB 1V2ST 2FOFA 2OBOA 2NWNA 2JH5D 3S9BA 1MCVA 1J14A 3C27B 3B8JA 3I78A 3VB7A 5F03A 4GSOA 4Y8YA 1AFQC 1TMTH 3TNTA 5FHTA 3MNXA 1Q31A 3VPKA 1EB1H 4X8UH 4KTUA 2FMJA 2ZGBH 1T8OA 2ZPRA 1AKSA 1QCPA 1DOJA 1ELCA 1G3EA 1K9OE 2HWLB 5FCKA 3LOXA 4ISLA 3SNBA 1C1RA 4H42U 1Y59T 1YPMH 1CQQA 1TOMH 3LGTA 3O8BA 3T27A 1UHBB 1SGEE 1ELGA 2XWAA 3RMNH 2LPRA 3OYPA 4NG9H 1QB1A 2CMYA 1TIOA 2OQ5A 1NU7B 2P16A 5T6DA 2A4QA 3ITIA 5JPMH 1V3XA 2BD7A 1AWHB 2HRVA 1W2KH 1HCGA 3BEFB 4YOIA 2VIVA 1D6WA 1XMNB 4B2BA 2OP9A 4NSVA 4B71A 1THPB 4BOHA 2UUFB 4BAHB 4JZDH 1V2TT 3SU0A 1L1JA 3NZIA 5CMXH 4UD9H 1TGBA 3FZDA 1C2FA 1TBRH 5TCAA 3FP6E 2NU4E 4FU9A 2ZU1A 1AQ7A 4SGAE 3PROA 2TRMA 2ZHWH 3K2UA 1A1RA 2O8UA 1EAWA 2ZTZA 1VGCB 3EA7A 1VJ9U 3M5MA 5E0GA 7GCHF 2BZ6H 3A84A 1SQOA 2C8WB 3RXSA 2BY9X 1TNKA 4DIHH 3ATWA 2BOKA 1NS3A 4XOJA 8GCHF 1CBWB 2TGAA 3A88A 1K1PA 1OP2A 4JYTA 2CF9H 1UK4A 5GCHG 2OXSA 2WYJA 2SGPE 5CHAB 4BAQB 4BTTB 1BHXF 1ZMNA 2GCTC 1HAHH 1O2UA 1VITG 1ESBA 1T4UH 1CGJE 2TPIZ 4I8GA 1TX8A 3ZZ5A 2RDLA 3TNSA 3STJA 3LH1A 1LHDH 4IC6A 3M7TA 4YOGA 3SU4A 4ABBA 3SNCA 3KHVA 1UTOA 2Y5FA 3S7HB 2HNTF 5FBIA 1AVGH 1TABE 1G37A 4ZUHA 2OLGA 3T26A 4Z6AH 2O8LA 1BCUH 2GZ7A 4X2VA 1DWCH 2VJ1A 3SUFA 3AVZA 1V2OT 1QNJA 2QN5T 1NRNH 4JZFH 1O34A 4CRCA 3RM0H 4YTAA 1SLVB 1GI0A 1JIMA 2QA9E 1MMJN 1K28D 1ETTH 1AFEH 2Z3CA 1AGJA 3KF2A 1AWFH 1BRBE 2ZKSA 1C1VH 1KLTA 3LIWA 3UOPA 2SGEE 3DD2H 1CBWC 4NFEA 1EATA 1INCA 2A2QH 3AW1A 4ABIA 1HAZB 4RKOB 1GBMA 4YOJA 1AU8A 5CHAC 1P2OA 2BDAA 4Q7YA 3RXLA 1ANBA 4MTBA 1P12E 5AFYH 1MU6B 4LOYH 1QY6A 1MCTA 3PO1B 3TVJB 4AG2A 1ANCA 1C9TA 1C9PA 1PPFE 1TWXB 2BLOA 3ZZ6A 1FMGA 4K5ZA 3RXTA 3SNEA 1CGIE 4DIIH 1EPTB 4OS6A 1NFYA 4MG3A 1O36A 2XC4A 2FWWA 2ZDLA 4ZHLU