1UTMA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA02
5FX6A 2GX4A 3ZV9A 1RIWC 1FUJA 4YM9A 1W7GH 4Z6AH 1KLJH 2QXGA 2WPKS 1P05A 3A8AA 3KNXA 1BMAA 4UONA 4X1NU 2XW9A 1DSUA 1GBMA 5C67A 1EP5A 2EI8A 1SQAA 1MKXH 1DWBH 2I6QA 2ZKSA 2V3OH 4TY6A 3BTGE 4U01A 1DWDH 2PFEA 3LONA 3ZZDA 1C1QA 2FZZA 2ZHEH 4CRFA 1O2HA 1Z1IA 3P8OA 3RMNH 1UVUH 1CGHA 3V12A 2AERH 1O2JA 3PYHA 2PGQB 1PQ8A 1PPFE 4FUDA 3Q00A 5CHAB 2G81E 3U8OH 1GJ6A 1EKBB 5G4BA 2W7UA 2PLXA 2J94A 1NN6A 1O35A 8ESTE 1O36A 4WF8A 1LKBA 3PB1E 2A0QB 1WUNH 2V35A 4I31A 1JIRA 2GP9B 4MNYA 1LHEH 3H7OA 3GDVA 3A7TA 3BG8A 1TNJA 3L33A 1TMUH 1ABIH 1G3BA 2OUAA 1P11E 1O3HA 4B73A 2GCTC 5E0JA 1CGIE 1QTFA 4U32A 1O3MA 4GHQA 4E7NA 4NIWA 3MI4A 1GBDA 1C5MD 1O2ZA 4Y76A 4IBLH 3SU4A 4CRBA 3W95A 2ZFPH 1UK4A 5E0HA 4DG4A 4R8TB 2WPHS 1K2I1 3AAVA 5DGJA 3W94A 3VXEH 1K22H 4KTSA 2C8YB 2Q1JA 4Y71A 4QT8C 1W0ZU 2OD3B 1SL3A 1F0TA 2BVXH 2AIPA 1C2JA 6LPRA 1P03A 1C2IA 1F5RA 3DT0H 3SUEA 2QCYA 3A7XA 3ENSB 2J34A 1XVMA 1T4VH 2BX3A 2BDGA 2P3TB 1K1OA 1OYQA 5F8ZA 1T8OA 1V2MT 3RXPA 4MNWA 1AQ7A 3SGQE 4YZUA 3MO9A 1ZGVA 1VR1H 3LPRA 5ESBA 1TBQH 3RXGA 2G5NA 4WJG2 2R3YA 3QDZB 2VWMA 4UFFH 1HAOH 4MLFB 5GIBA 2VIDA 1MD8A 3MMGA 3OSYA 1SB1H 4X1SU 2WPLS 4NG9H 1C1TA 1O3EA 2ZHFH 2Y7XA 1V2NT 2ZZUH 1ETTH 1GBKA 4DIIH 1AHTH 1TPPA 4WXVA 4SGBE 3BTTE 2TRMA 3U69H 3I77A 5HM9A 2GV6A 2PR3A 2ZPQA 1LVBA 3RM0H 5A2MH 8GCHF 5T3HA 1BHXF 3T25A 3UNQA 5EODA 1ZR0A 4NA9H 4SGAE 1J15A 1SGRE 1SI5H 1TRNA 3LH3A 1O5BB 1V2OT 5GDSH 2TGDA 3LKWA 3PWCA 4NFEA 1EZQA 1C5XB 1CHOF 1S85A 3RC6A 1HAHH 1BZXE 1MU6B 2XWAA 1LQDB 1F5LA 1BIOA 1ELTA 1ETRH 2TBSA 3SNBA 3NXPA 3DHKH 4YLUA 3SNDA 2F9OA 3SUGA 4FXGH 3M5NA 1T32A 4X8VH 2FMJA 3GY2A 1TPOA 2G4TA 1FAKH 1H4WA 2Z7FE 3B9FH 1KDQB 4Y0YE 1FDPA 2XCFA 3JZ1B 1ZRKA 1BTWA 5GJ4B 5K0HA 1OP8A 1TX8A 4ZAEA 1F7ZA 2BYAX 3RXQA 1W3CA 4FU9A 1L0ZA 1QRXA 3ATMA 1YKTA 1G9IE 1H1BA 1CHOG 1O2UA 2BDAA 4U30A 5EOKA 2XBXA 3IWMA 1UHBB 2QC2A 3EGKH 2IJOB 2FWWA 4WVPE 5EXMA 3SJ8A 3HPTB 3ZZBA 3FZZA 2H6MA 1UTOA 2FIRH 1QQ4A 3QN7A 5FBIA 4DOQA 2QIQA 1UTLM 1Y3WA 2ZCKP 4AORA 4ZKRU 1NO9H 7LPRA 3EAJA 1SGTA 1G3DA 2OBOA 2YNAA 5PTPA 2A5KA 3ZZ9A 1SSXA 1N6YA 3RXVA 2PTCE 1K1LA 3ESTA 4KTUA 5F03A 1OOKB 1H8DH 2CF9H 2ZGCA 3PV4A 3ZVGA 1XXFA 2F83A 1CBWB 1CU1A 1EJNA 1L2EA 2XWBI 1WYKA 4CBOA 3MU1A 4A7IB 4WH8A 3KQBA 4HTCH 1O2NA 3OTJE 1C5RA 3A88A 3I29A 2GDEH 1YC0A 4BAHB 3BSQA 1WTHD 2ZNKH 2OC7A 1QJ7B 3O8DA 5EGMA 5L2ZH 1G3EA 5DP4A 4Y6DA 1NS3A 2ZPSA 3PMHB 4FUBA 5FPYA 1K1PA 4INKA 4BNRA 1O2OA 4AN7A 3RU4T 3O8RA 1BOQA 1V2QT 2UWPA 3UY9A 1C5QA 1HUTH 3SBKA 4TWYA 2JKHA 5JDUB 1BTPA 1EZUC 3ZVEA 1P8VC 1Z6JH 4KP0A 3SORA 3TJNA 1FNIA 1C5SA 1AKSA 1Y8TA 1Y59T 1DY8A 1MTNC 1HAIH 4OS7A 1C9PA 4VGCB 5GXPA 1EOLA 5JBAS 2BLWA 1FPCH 1YBWA 1EASA 1NU9A 3UWIA 1VZQH 3TH3H 1ZSKA 1W0YH 1G32B 3RXKA 2GD4B 4BTUB 1WAYB 4ZH8A 1MZDA 1S0QA 1EPTC 1LHCH 1QB9A 1O33A 2CF8H 3M7UA 1O3AA 3GDSA 1SLVB 2XTTB 3ZVBA 1MTNB 1V2JT 4A92A 1UK2A 1XUHA 3DD2H 1BMMH 3BF6H 3DUXH 4IC5A 3FZDA 1O3CA 2ODYB 3G01A 2A4OA 5EXLA 4D76A 4BTTB 2FOHA 3GY5A 4Y8ZA 1YPLH 2ZTXA 3RXHA 4K2YA 1EAIA 1GHAF 5JB8S 1O2MA 1C2GA 9ESTA 3RMOH 1XKBC 1JOUB 4K8YA 1YPHE 2WYGA 1WSSH 4I8KA 3UR9A 1GHYH 2FDAA 3QWCH 3E16B 1C1NA 3ZZ4A 2DE9A 5E8EH 1ID5H 1RRKA 2UWLA 2Z9IA 4NSVA 1AWFH 1NFWA 2STBE 3L6PA 1GL1A 1CA8B 1A5GH 1VCPA 4ABGA 2FS9A 1BT7A 3TH4H 5JBTA 1SQTA 1MMJN 1WQVH 5LPFA 2BY7X 2ZU5A 1GWAA 5FHTA 4ABHA 1RS0A 5AFYH 5C1UA 1A7SA 1P57B 1N8OB 1HJ9A 1GHAG 4INHA 3MU5A 4FU7A 1LPZB 4BANB 1DX5M 1L1GA 1LMWB 1DSTA 4KELA 1E37B 1IOEA 1S5SA 1FY8E 2B5TB 3B23B 2ALPA 1C5LH 1DLEA 1Y3VA 3S9AA 1C1SA 2A4GA 4H6TA 1A4WH 3A83A 1PPEE 3IG6B 2P8OC 1KXDA 1C5VA 1O3KA 1WV7H 3N7OA 2PKAA 3F9EA 1TE0A 1YCPM 2Y5FA 5H4IB 3SHCH 5JBBS 3EQ0H 3U8RH 3LGWA 3MU8A 3SJIA 2WPMS 5I46H 3A7VA 1C2DA 2BD7A 1PPCE 1O37A 2C8WB 1GGDB 2FLRH 4YLQH 1ELGA 3E0PB 4GAWA 4DCDA 4AFZA 1ZMNA 2FX6A 1J14A 1HXFH 2Q6GA 2BXUH 1KXCA 1W14U 2NU4E 5A0BA 1BJUA 4B71A 2OP9A 2OC8A 4XE4A 2WINI 4I32A 3ELAH 3PO1C 3SJKA 3TJOA 1TNIA 1GI5A 1SPJA 3MO3A 5J4SA 5SGAE 1KY9A 1YCPH 1ZSJA 2J92A 1C4U2 2PKSB 4BOHA 1WQSA 1Y3YA 2ZU3A 2R0KA 5FAHA 3BIVH 3Q3XA 3RLWH 4IMQA 5E2PA 4A6LA 2AGEX 1TRMA 1YLDA 3UQOA 1C1VH 3TGKE 1F0SA 1LVOA 3ODFA 2P3UB 1J16A 2VNTA 2ZGJA 3RU4E 3Q76A 3V3MA 2ZDNA 1VITH 2THFB 2VGCC 3LOXA 3MO6A 3GY8A 3BTFE 3PMBB 1OPHB 4UFDH 1IQEA 3F6UH 3WY8A 2BDHA 4NA8A 2F9UA 1O3LA 2FOCA 4A1TA 3BG4B 1NRSH 1B0FA 5EXNA 1IHSH 4Y11E 3SV2H 2TGTA 1V2RT 1AZZA 2BY8X 3QO6A 2H5CA 3AW0A 1LTOA 3RXAA 1FAXA 2XCNA 5L30H 1BRAA 1XUGA 2SFAA 1TONA 1O5GH 3QX5H 2OC0A 3GISB 4ISIH 4MQAA 3RXEA 3V0XA 3MH5A 3TNTA 2V3HH 4H42U 2BDCA 1OWEA 1HJ8A 3PLBA 1TAWA 3F68H 4AGJA 3OY5U 1O2LA 2BD8A 2J9NA 2FI3E 2A7CA 2VIPA 2XBVA 3MH6A 5I25A 4ISHH 2ZFQH 1ZPBA 1INCA 2O8WA 1SMFE 2Y82A 1Z8JB 2ZFFH 3GCTG 1C5NH 2QGRA 4ZXXH 2JH6D 1AFEH 1NESE 1O2RA 1UMAH 1TNHA 1DXPA 1GBBA 1EP6A 1T4UH 1ZZZA 1QBNA 1RTFB 4RKOB 1ZTLA 3UPEA 4YOIA 3CENA 2BZAA 5FPSA 1Q2WA 3SNAA 2O9QA 1GBAA 1CA0C 2Z9JA 2ZG0H 3Q3KA 1AY6H 2AYWA 1NRPH 2UUKB 3RXLA 1GJ4H 3LGYA 4CBNA 4D9RA 3SI3H 1OXGA 1P9SA 2FTMA 1JXPA 5CHAC 1AB9C 1RGQA 1S0RA 1QCPA 3A7YA 1BJVA 4YOJA 1FV9A 1SGQE 1E35B 1MTUA 1XMNB 1ESAA 4FUJA 5DK1A 2AGIX 1JBUH 2ZDVH 4BAKB 1MKXK 3HK3B 5DP9A 4ZHMU 4X6MA 1MCTA 4K1TA 3U1IB 6CHAC 1CSOE 1CA0B 3BTWE 2WUCA 2VIVA 1IQIA 2CHAB 1ZMLA 4X1RU 2KAIA 3GYMA 5FPTA 3UREA 1SLXB 4X2XA 2BD4A 4F49A 2AS9A 4JZ1A 1LVYA 4BAOB 2FOAA 1HIAA 2EA3A 5LPEA 1W10U 3D23A 1V2VT 2ODQA 4NZQA 2OQ5A 1AB9B 1GMCG 1ZHMA 2HLCA 4I7YH 2PHBA 2FYRA 4AGKA 1MBMA 3LC5A 2P94A 3UQVA 2W5EA 2R9PA 1ZTJA 2C4FH 1TBRH 1S6HA 1KXAA 1A46H 3B8JA 1AGJA 5CE1A 1F92A 2ZQ2A 3SGAE 6CHAB 1SGDE 3E3TA 4ZMAH 1NFUA 2C8ZB 4K69A 1GMHF 1CT2E 1T7CA 6GCHF 7KMEH 1ZMJA 1XVOA 2EC9H 1AKSB 3QLPH 3MU0A 1GJBB 2ZDKA 4HI3A 4LOYH 3VFEA 2A32A 1SGEE 3SJOA 3STJA 1P09A 1B7XB 3JZ2B 1UTNA 3ZVAA 2Z6BD 1K1MA 1Y3XA 3QUMP 1DY9A 1GBFA 1MAYA 4FUFA 1P9UA 3KF2A 1ZOMA 1GDNA 3UFAA 2C90B 5E2OA 3BTME 1A1RA 1EJAA 4K60A 3UOUA 4LXBH 1L4ZA 1GMHG 3ZYEA 1AZ8A 2ASUB 6GCHG 3TPIZ 1MTVA 2HNTC 2BY9X 1KLTA 3BEFB 4UE7H 1NU7B 2NWNA 1IQHA 1GBLA 3UOPA 1FIWA 3QGJA 3A85A 1ELCA 1V6DA 4X2YA 3V13A 3SW2B 1C2KA 2A2QH 3KGPA 1B5GH 2IN2A 2PTNA 1O0DH 1A3EH 2BQ7B 1LPGB 1F5KU 1CO7E 1TNLA 1D6RA 1S84A 1DM4B 2ZHDA 3E8LA 2R2WU 3O8BA 5BRRE 1BRCE 1QQUA 1Y3UA 2F9VA 4MDSA 1XUIA 1O5EH 1YPKH 2ZGXH 1YPHC 2BZ6H 1FN8A 1C1PA 2OLGA 1O2KA 1DUAA 1SHYA 2B0FA 1F2SE 1C5YB 1TGCA 3M35A 4AFQA 1SGPE 1YPJH 2SGFE 1PYTD 1X7AC 2ZTZA 1UTKA 3KQCA 9LPRA 2G5VA 3GY3A 1CHGA 2FI4E 2ZA5A 3NCLA 2PUXB 1GI9B 3EE0B 1F0UA 2G00A 3U1JB 2ANKH 1A0LA 1K21H 1THSH 3RMLH 1SG8B 2FOGA 4AYVB 2CV3A 1LVMA 1QBVH 1ABJH 4X6OA 4NIXA 4CH8B 1TBZH 1HV7A 3URCA 2XC4A 5FX5A 1NZQH 1ZJDA 3AVZA 2CMYA 2PWXA 1G36A 3RMMH 5DP7A 1SGFG 2GCHG 3TH2H 2H9TH 4Y8XA 2BDBA 1RTLA 5ABWA 1H9HE 2HGTH 4UEHH 1GL0E 2V6NA 1RFNA 1FN6A 2FOBA 2ILNA 3DFLA 2VWNA 1O3JA 1T8LA 1W13U 3LGVA 4Y7BA 1HJAB 2WV4A 4ZKNU 4JZFH 2BOHB 1VCWA 3MNCA 1CBWC 3QZQA 1FY3A 4AB9A 1AVXA 2VH6A 1YYY1 1C1OA 2PKAB 4UFEH 4I8JA 4JZEH 1HBTH 3LT3A 2QXIA 1HAVA 4HZHA 4YT7H 4DURA 5J4QA 2ZPRA 1BTUA 5T6DA 4JK6A 3KL6A 3AW1A 3PM3A 1HB0B 1OP0A 1TQ0B 2BDYA 2YNBA 1DFPA 1SOTA 3LIWA 3M37A 3P70B 1PPGE 5DO4H 2G51A 2RDLA 4O97A 3MHWU 3K2UA 2W3KA 5BPEA 1Q3XA 2FS8A 2ZFTA 2XBWA 4Y0ZE 1HYLA 2GGVB 3P6ZB 1NFYA 2VIWA 2BXTH 1V3XA 1AFQB 3BIUH 4YO9A 5AF9H 1FIZA 1HAPH 1RJXB 3A8CA 2K1QA 2SGAA 4OS6A 2R0LA 4F4OC 3ZZ3A 4ZUHA 1O3GA 2WPJS 4XSKU 1JRTA 1ZHRA 1C5WB 2Y5GA 4I8GA 3SN8A 5EPYA 2FOFA 2ZDMA 1UVTH 3SV6A 3VEQB 1C2EA 4VGCC 4MNXA 1C5PA 1P06A 1QL8A 5JYIA 5EW1H 1UO6A 2BVRH 1ZGIA 1TIOA 3KIDU 2XXLA 1W2KH 4ABIA 1N1LA 3TVJB 2F91A 2A4RA 1UK3A 4CRGA 1GI3A 3GCHB 1MBQA 3LC3A 4MG3A 3RLYH 1FPHH 2BD9A 2D26C 2VJ1A 3VGCB 1EJMA 2D2DA 1QRZA 4INLA 5AHGH 1DVAH 3M7QA 4FVDA 5A8ZA 1A5IA 1ELBA 4IMZA 3SNCA 1VJAU 3LGIA 2QY0B 2ZCLP 3GY4A 4D9QA 5EQQA 3U98H 5C3NA 2NU1E 2EEKA 1W11U 1ZPZA 1FY1A 1TGNA 1UCYK 5GPIB 1QURH 3M36A 1ANEA 1UCYH 1BRUP 4K1SA 2SGDE 3T27A 1GHXH 2HNTF 2ZHQH 1AUTC 3SV8A 1NPMA 1N6XA 1SFIA 1DDJA 1ANBA 1C4Y2 1FQ3A 1MQ5A 4THNH 1THRH 4HFPB 3S69A 1GJ8B 4Z0KA 3HK6B 3ATLA 3BN9A 3I78A 4NZLA 3TITA 1YPMH 2W26A 4LZ1H 1O2YA 3UNRA 2CJIA 4B1TA 3T28A 3T26A 1QY6A 1QL7A 2GMTC 2HNTE 1P2QA 5B6OA 1BTZA 1K1NA 2O8TA 2A4QA 1BDAA 3SUFA 4X6NA 1Z8IB 1VCQA 1SGCA 3TJVA 1SBWA 1E38B 2O8LA 1IQFA 1QFKH 2BY5X 1GG6B 1CT0E 5TCAA 4ESTE 1DPOA 3MH4A 3QK1A 3ITIA 1H8IH 3D65E 1OYTH 2BMGB 3VB7A 1N8OC 4MPWA 1ETSH 2UWOA 1YPEH 4FUIA 4K5ZA 5EU8A 2QV1A 2PGBB 4WXIA 1DT2A 3UWJH 1XKAC 5F6MA 2V0BA 4MPXA 2FPZA 2FTLE 2ESTE 3KQEA 2FX4A 3SU6A 1SFQB 2GMTB 2BD5A 2G55A 3KHVA 3P8GA 4OS5A 2AIQA 1HGTH 2A31A 3SOSA 2W3IA 3GY6A 1J8AA 1C5ZB 4WMFA 5L2YH 4D8NA 2KAIB 2P95A 3RXMA 3V7TA 1EUFA 1JMOH 5GCHF 1MAXA 4IW4E 1P2MA 1PFXC 4WMEA 4AYYB 1GGDC 1NFXA 2JH0D 1CT4E 3FANA 3RDZA 1ORFA 3A87A 3M3VA 4WH6A 3RU4D 1D9IA 1GJDB 3RUOA 5LH8A 1ZSLA 3BTHE 8KME2 2PSXA 1QRWA 1HAXB 3RXRA 3R3GB 1DANH 2H2ZA 4ZXYH 1EAUA 2B8OH 3TGJE 1MU8B 2FXRA 4X8TH 3HKIB 4Q7YA 3NKKA 1C2FA 3TK5A 5DP5A 2H9HA 1GBIA 1TMBH 2J38A 1PPHE 5E0GA 2PKSC 3NK8A 4FUHA 3S0NA 1XUKA 1S6FA 4B74A 1GBHA 2ANWA 1JWTA 4ISOA 2A7JA 1DITH 1GHBF 5IYTA 1ELFA 5GCHG 2GV7A 1AVGH 2BTCE 1IQGA 2SNWA 5AFZH 1O31A 2J2UA 2Z9GA 1TMTH 2JETC 4TPYA 1WU1A 4ABJA 2F9NA 3C27B 2Z3DA 2QF3A 3UTUH 4ABAA 4X6PA 1BBRH 1C1RA 3ZVCA 5C20A 2GZ7A 1BTXA 1EQ9A 1D4PB 2EI6A 1G37A 1GJCB 1HCGA 1AN1E 1P2KA 3RXJA 1W7XH 2VU8E 1YCPK 2HOBA 4WWYA 4B75A 4GPGA 3BTEE 1G30B 2PV9B 1GI4A 4NIVA 3BG4C 1PQ7A 1O2IA 3Q77A 3EDXB 3SU2A 1GHBG 4DT7B 1P2IA 4OS2A 4CRDA 3T5FH 1O39A 1ESTA 4JCNA 1QA0A 4CR9A 2JETB 2OINA 1P12E 1VITG 2BLQA 3A80A 1P01A 1IAUA 1V2KT 1ZPCA 2A45B 2HPQH 3SGBE 1NT1A 4TWWA 2F9BH 2AH4X 3MFJA 4IS5A 3SQHE 4X0WU 2D1JA 3FVFB 3E90B 1NC6A 1O2PA 1GDQA 4X2VA 1ZYOA 2VH0A 4UFGH 1JRSA 3GCTF 2NU0E 1QR3E 4Y79A 1V2TT 2BB4A 4IGDA 1Y5AT 1K1IA 1LKAA 2BLOA 3ZZAA 1YP9A 3P17H 3ATKA 4XOJA 3KN2A 1DWCH 3HGPA 3KCGH 4NGAH 3ZZ5A 2FLBH 2VINA 1F0RA 2XRCA 2QN5T 1C2HA 3MYWA 4FUEA 3VB4A 5C5NA 4BTIB 2XBYA 4TY7A 3SNEA 1KIGH 4AFUA 1AUJA 4KGAA 1XUJA 1NTPA 1EOJA 2AMPA 1XUFA 3ZZ7A 4IN1A 5A8XA 2BHGA 5FXLA 3NWUA 1TRYA 2DUCA 2ZGHA 2BVSH 1MKWH 4ISLA 2ZFSA 1LPKB 5A8YA 3L3TA 3ZZ8A 2ZF0H 1ZHPA 1TWXB 2BD2A 3NUMA 3RXBA 3GY7A 1LDTT 3M3SA 2ZECA 5C1XA 3GICB 2CHAC 1SHHB 2ZIQH 4RKJB 1KLIH 2W7SA 4E7RG 1MTWA 1HAVB 5JPMH 2PUQH 1GHVH 4D7FA 2WPIS 1C1UH 1GMCF 1TPAE 1BTYA 1HXEH 1AO5A 1T8MA 1ESBA 1AD8H 2OQUA 2HPPH 4JZIA 1LHDH 1BHXB 2G4UA 1EB2A 4ZROA 1D6WA 1C9TA 1OX1A 2HVXA 5A09A 1O3FA 1O5DH 1EPTA 5CMXH 4CHAB 2OCVB 2BQ6B 3P8NA 1O5FH 1YPGH 3CP7A 3VPKA 2Y81A 4CREA 1PPZA 2A5AA 3T62A 2JH5D 1OKXA 3ZZCA 2ZQ1A 3BEIB 3T2NA 3TK6A 5FBEA 3GDUA 2DE8A 2Y7ZA 4BAQB 1O5CB 1MUEB 4IC6A 2QA9E 5GWZA 2BM2A 2P59A 3K9XB 2A5IA 1OWKA 2HWLB 3OY6U 3F9FA 2H5DA 3UR6A 2FESH 4DGJA 2NU3E 1P2NA 2Z94A 3M3TA 1ANDA 2VWOA 1XM1A 1W8BH 5HM2A 2IPHA 5A0CA 3UUZA 1P2JA 1DE7H 1C1MA 2FODA 3T29A 5EW2H 1H9LB 4Q80A 3RXCA 1GVZA 1NY22 3U8TH 2C3SA 1UVOA 1GI1A 5ESTE 1P04A 2Q6DA 1SC8U 3PTNA 1B0EA 3LJJA 3ODDA 1E0FD 3A86A 1RIWB 1TNKA 4NCYA 4DY7B 1C2MA 4JZDH 3ZVFA 3CS7A 1IHTH 1BCUH 3RXFA 1GI6A 1O3BA 3HATH 1QHRB 2VWLA 1HNEE 2WYJA 1NRNH 1C5UA 2WUBA 2AEIH 4WMDA 1UTPA 2R3UA 1P02A 3BTQE 1EAXA 2ZTYA 3S9BA 3U9AH 1ELAA 3F1SB 3STIA 4ABEA 2J95A 3PMJA 2ANYA 2VVVA 3OX7U 1BMNH 1GDUA 2GT8A 1A3BH 2BD3A 1P3CA 1ZLRA 3F9HA 4JYVH 4ZKSU 3TNSA 1AE8H 3EA8A 2ZGBH 2Y6TA 2Z9LA 1SLUB 1L1NA 1DWEH 4X8SH 2BY6X 1MZAA 1EZSC 1O2XA 1TYNA 1O2SA 3EA7A 2RA3A 3P95A 2M5TA 3SUDA 1LCYA 1WTGH 2FO9A 3FFGA 3E91A 1A61H 1WOFA 2TGPZ 3E6PH 1TA2A 2XNIA 1TB6H 4I8HA 3SI4H 1BUIA 1HLTH 3RXOA 1O3NA 4NIYA 5L6NH 1Z8RA 4B2AA 2P93A 1GVLA 3S7KB 2GCTB 2RCEA 3QGNB 2SGQE 1AE5A 1OWHA 4X8UH 5C1YA 3OYPA 1OWJA 2QXHA 3GCNA 1ELVA 2GCHF 3D49H 2STAE 2ZEBA 1H9IE 1GBJA 1SVPA 5LGOA 1IQMA 2LNCA 2ZWLH 4X1QU 2RA0A 1EZXC 1UVPA 1KXEA 2QAAA 1BMLA 5DJ7A 6ESTA 2XC5A 1M9UA 4YESB 2ZDLA 1ACBE 3VB5A 1SR5C 2P16A 4A1VA 4CRCA 4NWKA 1HDTH 4X2WA 1S81A 1HJAC 1T8NA 4O9VA 4HGCA 1O3OA 4GCHF 1ANCA 2BOKA 2UUYA 4ZHLU 1AU8A 1UJ1A 3RXIA 5IDKA 1JIMA 1QNJA 4B2CA 1TX6A 3A81A 3VB3A 1THPB 1MH0A 2CN0H 4NWLA 3M5LA 1P3EA 5EQRA 1GI8B 4FUGA 4D7GA 2EI7A 3P92A 3RXDA 2SGEE 1OSSA 3KEEA 3LDXH 3M7TA 1HFDA 2PSYA 1V2UT 5DP3A 1SGYE 2IOTA 3R0FA 1C1WH 1NM6A 3TGIE 1PQ5A 1FJSA 1HAZB 1O2QA 1EXFA 2BLVA 4ABFA 4ZKOU 4XFQA 5EQSA 1IQJA 1P0SH 1DOJA 2BQWB 3A84A 1NROH 2ZC9H 5DPAA 1AFQC 4GCHG 4YTAA 4TYDA 4YT6H 2OXSA 4TPIZ 1HPGA 1RXPA 3ZYDA 1GVKB 1FMGA 1GCTC 1QIXB 4I8LA 1YM0A 4B2BA 2F3CE 3QZRA 2CGAA 8GCHG 1SGFA 1MQ6A 2FYQA 4XDEA 1QL9A 1A2CH 1ZTKA 3ZVDA 5DP6A 1TOMH 5K7RA 4ASHA 1KSNA 3MOCA 2TPIZ 8LPRA 1TGBA 1NRRH 3M5OA 1AWHB 1ZJKA 2SNVA 1TABE 4KKDA 4MPUA 2ZU2A 3TK9A 1W12U 3E0NB 2VVCA 3PWBA 3C1KA 1YF4A 1E34B 2Q6FA 1ELDE 4MNVA 3GCHC 3FP8E 2R2MB 4YOGA 3IITA 3VGCC 3TU7H 4E05H 4R0IA 4E06H 4B76A 5F8TA 2GZ9A 4A1XA 1C5OH 3A89A 3SU0A 1GCTB 1XX9A 1D3DB 1IQKA 2BDIA 3TIUA 3A8BA 4GHTA 2O8UA 3LJOA 1ELEE 1TPSA 1P10A 1QJ6B 5EPNA 2AGGX 2GZ8A 4JK5A 4BAMB 4XBDA 3LU9B 4A5TS 4OS4A 2P3FH 1O2GH 3K6YA 4K3JA 5DKMA 3H5CB 5LPRA 2FEQH 4LZ4B 3S7HB 1QJ1B 1PJPA 1C5TA 1O38A 1TGSZ 3S9CA 1KXBA 1Z1JA 3ATWA 5HGGA 5JB9S 1P2OA 1DS2E 2GTBA 1V2ST 1BB0B 1E36B 3BTDE 3RM2H 4FVBA 4Q7XA 4ABDA 1Z6EA 1LHGH 1FONA 1UCYE 1T31A 3E1XB 2ZHWH 1GBTA 4OGYA 4CH2B 1QA7A 4GSOA 3TJUA 1YGCH 2GDDA 5FCRA 2ZU4A 4UD9H 4IN2A 7ESTE 2QF0A 1G3CA 1KTSB 3ZV8A 1OWDA 1S83A 1GG6C 1FY5A 7GCHF 1WBGB 1SGIB 1AI8H 1ARBA 3PTBA 3ZZ6A 1WCZA 1A5HA 4GLYA 1EX3A 4GUXA 4KTCA 5DG6A 2FI5E 1TALA 2XC0A 3PMAB 5ETXA 4RSPA 1BRBE 3BV9B 2G52A 1D3TB 4AFSA 3F9GA 4X1PU 3BEUA 4FU8A 1GPZA 3MH7A 4BXSA 2VIOA 1Q31A 2F9PA 3GOVB 1BQYA 1O2WA 1S82A 1TGTA 7GCHG 1TNGA 1LQEA 1GI0A 4JYTA 2ZDAH 4NFFA 2FP7B 4AX9H 1O5AB 2FM2A 4H6SB 3SU5A 3MNSA 2OC1A 2ZO3H 1K1JA 5C5OA 1AIXH 2H1UA 5HMAA 4MVNA 3OU0A 4K1EA 1UTJA 3Q3YA 4CRAA 2D8WA 4AG1A 2A1DB 3K65B 2Z3EA 1NRQH 3LGUA 1L1JA 1TX7A 1Z71A 1GJ7B 3FP6E 1XXDA 3HKJB 1EPTB 2PW8H 2ZP0H 2QYIA 1MD7A 3PROA 1O2TA 3RC4A 3MU4A 1TLDA 1DLKB 3FP7E 2OTVA 2VIQA 1GI2A 4WY3A 4O3UA 1BA8B 2WV5A 1HIAB 3A8DA 1KTTB 1AMHA 2ZU1A 5HXFA 4ISNA 2OBQA 4O03A 4PROA 4LK4A 4AG2A 3RC5A 2GT7A 2SGPE 1DXWA 2Y5HA 3HGNA 3RXTA 4DIHH 4OS1A 1QB6A 1PPBH 3RXUA 4RN6A 2H9EH 1O32A 2ALVA 3A7WA 1TQ7B 3GCOA 3FAOA 1DICA 1GMDF 1KDQA 4XBBA 1VGCC 1GBCA 1FY4A 1PQAA 4JYUH 1BTHH 1A0HB 1O2VA 2HRVA 1CGJE 2Y80A 4M7GA 2O8MA 5A0AE 2C93B 1BBRE 1O3IA 1K28D 4DW2U 1BITA 1V2PT 4H4FA 3MNBA 1SLWB 3PLPA 1BBRK 1UTQA 3KQDA 2B7DH 4NA7A 3SZNA 1TA6A 1VITF 1UHBA 1O34A 2B9LA 1IQLA 4AOQA 3AASA 2C8XB 2ZFRH 3TLOA 3GYLB 1VJ9U 2ODPA 3EA9A 3SO3A 5T6GA 2AMQA 1CVWH 4ZHAA 4O3TA 5HYOA 3A7ZA 1DUEA 1GMDG 5JBCS 3RP2A 1GJ5H 2GKVE 1U6QA 4OGXA 2AMDA 1G2LA 1VGCB 1GCDA 1O3DA 4J2YB 3SU3A 1FLEE 2XYAA 1J9CH 1GJAB 1TOCB 2TGAA 2J4IA 3LH1A 3D62A 1EB1H 4Y10E 1D3PB 2CXVA 3NZIA 1SQOA 1LO6A 4CR5A 3ATIA 3SU1A 1V2LT 2ULLA 1SGNE 4BXWA 2P8OB 1TFXA 1V2WT 5FCKA 4UDWH 1RD3B 2A2XH 2AFQB 3VXFH 1AVWA 3PLKA 5TCCA 2I6SA 4MTBA 1OWIA 1K9OE 3M61U 4U2WA 1O30A 2YOLA 4FUCA 3BTKE 1HAGE 3SV7A 2G8TA 1EATA 1OS8A 3A82A 4J1YA 5AVDA 1J17T 2ZI2H 4GVUA 4Y8YA 1Z7KA 5TJXA 3MTYA 3MWIU 2RG3A 1HRTH 1QGFA 5EG4A 2QXJA 1RTKA 1KYNA 2LPRA 3SJ9A 4Q7ZA 1FI8A 2FOMB 3PO1B 1QB1A 1C4V2 1MCVA 1SOZA 4AZ2B 3K6ZA 1GHWH 1FXYA 5F8XA 3QTVH 3P8FA 4ABBA 1YLCA 3H7TA 3QTOH 2Z9KA 1EAWA 1GJ9B 3AAUA 1HAYB 4Q2KA 4K8BA 1Y5BT 1CE5A 1UVSH 1G2MA 3NPSA 3UIRA 1KXFA 3MNXA 4XBCA 2HALA 3LGTA 3RXSA 4DJZB 2TIOA 2ZCHP 2VGCB 4Y7AA 1IQNA 1MKWK 1GI7B 1LHFH 1D3QB 3SHAH 5T6FA 1Z8GA 1CQQA 3O8CA 1O3PB 3UNSA 3SQEE 1ZRBA 4CHAC 1Y5UT 3EYDA 2VVUA 3DFJA 4AB8A 4I33A 3URDA 3SV9A 3M5MA 3VB6A 2FOEA 2A7HA 1MTSA 4JMYA 3CS0A 4DVAU 4NSYA 2ANMH 2NU2E 2UUFB 1ARCA 3DA9B 1A0JA 1GHZA 2VB0A 4MPVA 1C2LA 1FZZA 1PYTC 1L4DA 2GVFA 1QBOA 2UUJB 2Z3CA 1OP2A 5DP8A 1UTMA 1GBEA 2BX4A 5C2ZA
chains in the Genus database with same CATH superfamily
1FX0B 5FX6A 2GX4A 3ZV9A 1RIWC 1FUJA 4YM9A 1W7GH 4Z6AH 1KLJH 2QXGA 2WPKS 1P05A 3A8AA 3KNXA 1BMAA 4UONA 4X1NU 2XW9A 1DSUA 1GBMA 5C67A 1EP5A 2EI8A 1SQAA 1MKXH 1DWBH 2I6QA 2ZKSA 2V3OH 4TY6A 3BTGE 4U01A 1DWDH 2PFEA 3LONA 3ZZDA 1C1QA 2FZZA 2ZHEH 4CRFA 1O2HA 1Z1IA 3P8OA 3RMNH 3SYJA 1UVUH 1CGHA 3V12A 2AERH 1O2JA 3PYHA 2PGQB 1PQ8A 1PPFE 4FUDA 3Q00A 5CHAB 2G81E 3U8OH 2WZQA 1GJ6A 1EKBB 5G4BA 2W7UA 1E79D 2PLXA 2J94A 1NN6A 1O35A 8ESTE 1O36A 4XD7D 4WF8A 1LKBA 3PB1E 2A0QB 1WUNH 2V35A 4I31A 1JIRA 2GP9B 4MNYA 1LHEH 3H7OA 3GDVA 3A7TA 3BG8A 1TNJA 3L33A 2JDID 1TMUH 1ABIH 1G3BA 2OUAA 1P11E 1O3HA 4B73A 2GCTC 5E0JA 4Q4LA 1CGIE 1QTFA 4U32A 1O3MA 4GHQA 4E7NA 4NIWA 3SZEA 3MI4A 1GBDA 1C5MD 1O2ZA 4Y76A 4IBLH 3SU4A 4CRBA 3W95A 2ZFPH 1UK4A 5E0HA 4DG4A 4R8TB 2WPHS 1K2I1 3AAVA 5DGJA 3W94A 3VXEH 1K22H 4KTSA 2C8YB 2Q1JA 4Y71A 4QT8C 1W0ZU 2OD3B 1SL3A 1F0TA 2BVXH 2AIPA 1C2JA 6LPRA 1P03A 1C2IA 1F5RA 3DT0H 4DT4A 3SUEA 2QCYA 3A7XA 3ENSB 2KX4A 2J34A 1XVMA 1T4VH 2BX3A 2BDGA 2P3TB 1K1OA 1OYQA 5F8ZA 1T8OA 1V2MT 3RXPA 4MNWA 1AQ7A 3SGQE 4YZUA 3MO9A 1ZGVA 1VR1H 3LPRA 5ESBA 1TBQH 3RXGA 2G5NA 2RDEA 4WJG2 2R3YA 3QDZB 2VWMA 4UFFH 1HAOH 4MLFB 5GIBA 2VIDA 1MD8A 3MMGA 3OSYA 1SB1H 4X1SU 2WPLS 4NG9H 1C1TA 1O3EA 2ZHFH 2KM0A 1V2NT 2Y7XA 2ZZUH 1ETTH 1GBKA 4ACAA 4DIIH 1AHTH 1TPPA 4WXVA 4SGBE 3BTTE 2TRMA 3U69H 3I77A 5HM9A 2GV6A 2PR3A 2YMSC 2ZPQA 1LVBA 3RM0H 5A2MH 8GCHF 5T3HA 1BHXF 3T25A 3UNQA 5EODA 5EJ1A 1ZR0A 4NA9H 3F0OA 4SGAE 1J15A 1SGRE 1SI5H 1TRNA 3LH3A 1O5BB 1V2OT 5GDSH 2TGDA 3LKWA 3PWCA 2L6OA 1EZQA 4NFEA 1C5XB 1CHOF 1S85A 3RC6A 1HAHH 1BZXE 1MU6B 2XWAA 1LQDB 4XRNA 1F5LA 1BIOA 1ELTA 1ETRH 2TBSA 3SNBA 3NXPA 3DHKH 4YLUA 3SNDA 2F9OA 3SUGA 4FXGH 3M5NA 1T32A 4X8VH 2FMJA 3GY2A 1TPOA 2G4TA 3WWFA 1FAKH 1H4WA 2Z7FE 3OFND 3B9FH 1KDQB 4Y0YE 1FDPA 2XCFA 3JZ1B 1ZRKA 3VG8A 1BTWA 5GJ4B 5K0HA 1OP8A 1TX8A 4ZAEA 1F7ZA 2BYAX 3RXQA 1W3CA 4P00A 4FU9A 1L0ZA 1QRXA 3ATMA 1YKTA 1G9IE 1H1BA 1CHOG 1O2UA 2BDAA 4U30A 5EOKA 2XBXA 2EQNA 3IWMA 1UHBB 2QC2A 3EGKH 2IJOB 2FWWA 2OK5A 4WVPE 5EXMA 3SJ8A 3HPTB 3ZZBA 3FZZA 2H6MA 1UTOA 2FIRH 1QQ4A 3QN7A 3F2FA 5FBIA 4DOQA 2QIQA 1UTLM 1Y3WA 2ZCKP 4AORA 4ZKRU 1NO9H 7LPRA 3EAJA 1SGTA 1G3DA 2OBOA 2YNAA 5PTPA 2A5KA 3ZZ9A 1SSXA 1N6YA 4ASUD 3RXVA 2PTCE 1K1LA 3ESTA 4KTUA 5F03A 3WWBA 1OOKB 1H8DH 2CF9H 2ZGCA 3PV4A 3ZVGA 1XXFA 2F83A 1CBWB 1CU1A 1EJNA 1L2EA 2XWBI 1WYKA 4CBOA 3MU1A 4A7IB 4WH8A 3KQBA 4HTCH 1O2NA 3OTJE 4FETA 2CK3D 1C5RA 3A88A 3I29A 2GDEH 1YC0A 4BAHB 3BSQA 1WTHD 2ZNKH 2OC7A 1QJ7B 3O8DA 5EGMA 5C94A 1G3EA 5DP4A 5L2ZH 4Y6DA 1NS3A 3NRLA 2ZPSA 3PMHB 4FUBA 5FPYA 1K1PA 4INKA 4BNRA 1O2OA 4AN7A 3RU4T 3O8RA 1BOQA 1V2QT 2UWPA 3UY9A 1C5QA 1HUTH 3SBKA 4TWYA 2JKHA 5JDUB 1BTPA 1EZUC 3ZVEA 1P8VC 1Z6JH 4KP0A 3SORA 3TJNA 1FNIA 1C5SA 1AKSA 1Y8TA 1Y59T 1DY8A 1MTNC 1HAIH 4OS7A 1C9PA 4VGCB 5GXPA 1EOLA 5JBAS 4F55A 2BLWA 4RT1A 1FPCH 1YBWA 1EASA 1NU9A 3UWIA 1VZQH 3TH3H 1ZSKA 1W0YH 1G32B 2KCPA 3RXKA 2GD4B 4BTUB 1WAYB 4ZH8A 1MZDA 1S0QA 1EPTC 1LHCH 1QB9A 1O33A 2CF8H 3M7UA 1O3AA 3GDSA 3PRBA 1SLVB 2XTTB 3ZVBA 1MTNB 1V2JT 4A92A 1UK2A 1XUHA 3DD2H 2HLDD 1BMMH 3BF6H 3DUXH 4IC5A 3FZDA 1O3CA 2ODYB 3G01A 2A4OA 5EXLA 4D76A 4BTTB 2FOHA 3GY5A 4Y8ZA 1YPLH 2ZTXA 3RXHA 1WXRA 4K2YA 1EAIA 1GHAF 3FN8A 5JB8S 1O2MA 1C2GA 9ESTA 3RMOH 1XKBC 1JOUB 5KEDA 4K8YA 1YPHE 2WYGA 2J98A 1WSSH 4I8KA 3UR9A 4B6EA 1GHYH 2FDAA 3QWCH 3E16B 1C1NA 3ZZ4A 2DE9A 5E8EH 1ID5H 1RRKA 2UWLA 2Z9IA 4NSVA 1AWFH 3UB0A 1NFWA 2STBE 3L6PA 1GL1A 1CA8B 1A5GH 1VCPA 4ABGA 2FS9A 1BT7A 3TH4H 5JBTA 1SQTA 1MMJN 1WQVH 5LPFA 2BY7X 2ZU5A 1GWAA 5FHTA 4ABHA 3FKSD 1RS0A 5AFYH 5C1UA 1A7SA 1P57B 1N8OB 1HJ9A 1GHAG 4INHA 3MU5A 4FU7A 1LPZB 4BANB 1DX5M 1L1GA 1LMWB 1DSTA 4KELA 1E37B 1IOEA 1S5SA 1FY8E 2B5TB 3B23B 2ALPA 1C5LH 1DLEA 1Y3VA 3S9AA 1C1SA 2A4GA 4H6TA 1A4WH 3A83A 1PPEE 3IG6B 2P8OC 1KXDA 1C5VA 1O3KA 1WV7H 2PP6A 3N7OA 2PKAA 3F9EA 1TE0A 1YCPM 2Y5FA 5H4IB 3SHCH 5JBBS 3EQ0H 3U8RH 3LGWA 3MU8A 3SJIA 2WPMS 5I46H 3A7VA 1C2DA 2BD7A 1PPCE 1O37A 2C8WB 1GGDB 2FLRH 4YLQH 1ELGA 1H8ED 3E0PB 4GAWA 4DCDA 4AFZA 1ZMNA 2FX6A 1J14A 1HXFH 2Q6GA 2BXUH 1KXCA 1W14U 2NU4E 5A0BA 1BJUA 4B71A 2OP9A 1WDIA 2OC8A 2WINI 4XE4A 4I32A 3ELAH 3PO1C 3SJKA 3TJOA 1TNIA 1GI5A 1SPJA 3MO3A 5J4SA 5SGAE 1KY9A 1YCPH 1ZSJA 2J92A 5HIYA 1C4U2 2PKSB 4BOHA 1WQSA 1Y3YA 2ZU3A 2R0KA 5FAHA 3BIVH 3Q3XA 3RLWH 4IMQA 5E2PA 4A6LA 2AGEX 1TRMA 1YLDA 2QF5A 3UQOA 1C1VH 5EIYA 3TGKE 2J97A 1F0SA 1LVOA 3ODFA 2P3UB 1J16A 2VNTA 2ZGJA 3RU4E 3Q76A 3V3MA 2ZDNA 1VITH 2THFB 2VGCC 3LOXA 3FOAA 3MO6A 3GY8A 3BTFE 3PMBB 1OPHB 4UFDH 1IQEA 3F6UH 3WY8A 2BDHA 4NA8A 1NBME 2F9UA 1O3LA 2FOCA 4A1TA 3BG4B 1NRSH 1B0FA 5EXNA 1IHSH 4Y11E 3SV2H 2TGTA 1V2RT 1AZZA 5GNDA 2BY8X 3QO6A 2H5CA 3AW0A 1LTOA 3RXAA 3OTPA 1FAXA 2XCNA 5L30H 1BRAA 1XUGA 2SFAA 1TONA 1O5GH 3QX5H 2OC0A 3GISB 4ISIH 4MQAA 3RXEA 3V0XA 3MH5A 3TNTA 2V3HH 4H42U 2BDCA 1OWEA 1HJ8A 5C0UA 3PLBA 1TAWA 3F68H 4AGJA 3OY5U 1O2LA 2BD8A 2J9NA 2FI3E 2A7CA 2VIPA 3WW7A 2XBVA 3MH6A 5I25A 4ISHH 2ZFQH 1ZPBA 1INCA 2O8WA 1SMFE 2Y82A 1Z8JB 2ZFFH 3GCTG 1C5NH 2QGRA 4ZXXH 2JH6D 1AFEH 1NESE 1O2RA 1UMAH 1TNHA 1DXPA 1GBBA 1EP6A 1T4UH 1ZZZA 1QBNA 1RTFB 4RKOB 1ZTLA 3UPEA 4YOIA 3CENA 2BZAA 5FPSA 1Q2WA 3SNAA 2O9QA 1GBAA 1CA0C 2Z9JA 2ZG0H 3Q3KA 1AY6H 2AYWA 1NRPH 2UUKB 3RXLA 1GJ4H 3LGYA 4CBNA 4D9RA 3SI3H 1OXGA 1P9SA 1K0HA 2FTMA 1JXPA 5CHAC 1AB9C 1RGQA 1S0RA 1QCPA 3A7YA 1BJVA 4YOJA 1FV9A 1SGQE 1E35B 1MTUA 1XMNB 1ESAA 4FUJA 5DK1A 1YY3A 2AGIX 1JBUH 2ZDVH 4BAKB 1MKXK 3HK3B 5DP9A 4ZHMU 4X6MA 1E1RD 1MCTA 4K1TA 3U1IB 6CHAC 1CSOE 1CA0B 3BTWE 2WUCA 2VIVA 1IQIA 2CHAB 1ZMLA 4X1RU 2KAIA 3GYMA 5FPTA 3UREA 1SLXB 4X2XA 2BD4A 4F49A 2AS9A 4JZ1A 4YXWD 1LVYA 4BAOB 2FOAA 1HIAA 2EA3A 5LPEA 1W10U 3D23A 1V2VT 2ODQA 4NZQA 2OQ5A 1AB9B 1GMCG 1ZHMA 2HLCA 4I7YH 2PHBA 2FYRA 4AGKA 1MBMA 3LC5A 2P94A 3UQVA 2W5EA 2R9PA 2V3MA 1ZTJA 1H8HD 2C4FH 1TBRH 1S6HA 1KXAA 4F48B 1A46H 3B8JA 1AGJA 5CE1A 1F92A 2JIZD 2ZQ2A 3SGAE 6CHAB 1SGDE 3E3TA 4ZMAH 1NFUA 2C8ZB 4K69A 1GMHF 1CT2E 1T7CA 6GCHF 7KMEH 1ZMJA 1XVOA 2EC9H 1AKSB 3QLPH 3MU0A 1GJBB 2ZDKA 4HI3A 4LOYH 3VFEA 2A32A 1SGEE 3SJOA 3STJA 1P09A 1B7XB 3JZ2B 1UTNA 3ZVAA 1S6LA 2Z6BD 1K1MA 1Y3XA 2K0QA 3QUMP 1DY9A 1GBFA 1MAYA 4FUFA 1P9UA 3KF2A 1ZOMA 1GDNA 3UFAA 2C90B 5E2OA 3BTME 1A1RA 1EJAA 4K60A 3UOUA 4LXBH 1L4ZA 1GMHG 3ZYEA 5DSFA 1QZ8A 1AZ8A 2ASUB 6GCHG 3TPIZ 1MTVA 2HNTC 2AHME 2BY9X 1KLTA 3BEFB 4UE7H 1NU7B 2NWNA 1IQHA 1GBLA 3UOPA 1FIWA 3QGJA 3A85A 5HKKD 1ELCA 1V6DA 5KGOA 4X2YA 3V13A 3SW2B 1C2KA 2A2QH 3KGPA 1B5GH 2IN2A 2PTNA 1O0DH 1A3EH 2BQ7B 1LPGB 1F5KU 1CO7E 1TNLA 1D6RA 1S84A 1DM4B 2ZHDA 3E8LA 2R2WU 3O8BA 5BRRE 1BRCE 1QQUA 1Y3UA 2F9VA 4MDSA 1XUIA 1O5EH 1YPKH 2ZGXH 1YPHC 2BZ6H 3W1EA 1FN8A 1C1PA 1O2KA 2B0FA 1DUAA 1SHYA 2OLGA 1F2SE 1C5YB 1TGCA 3M35A 4AFQA 1SGPE 1YPJH 2SGFE 1PYTD 1X7AC 2ZTZA 1UTKA 3KQCA 9LPRA 2G5VA 3GY3A 1CHGA 2FI4E 2ZA5A 3NCLA 2PUXB 1GI9B 3EE0B 1F0UA 2G00A 3U1JB 2ANKH 1A0LA 1K21H 5KECA 1THSH 3RMLH 1SG8B 2FOGA 4AYVB 2J98B 2CV3A 1LVMA 1QBVH 1ABJH 4X6OA 4NIXA 4CH8B 1TBZH 1HV7A 3URCA 2XC4A 5FX5A 1NZQH 1ZJDA 3AVZA 2CMYA 2PWXA 1G36A 3RMMH 5DP7A 1SGFG 2GCHG 3TH2H 2XNDD 2K8IA 2H9TH 4Y8XA 2BDBA 1RTLA 5ABWA 1H9HE 2HGTH 4UEHH 1GL0E 2V6NA 1RFNA 1FN6A 2FOBA 2ILNA 3DFLA 2VWNA 1O3JA 1T8LA 1W13U 3LGVA 4Y7BA 1HJAB 1W0KD 2WV4A 4ZKNU 4JZFH 2BOHB 1VCWA 3MNCA 1CBWC 3QZQA 2KCAA 1FY3A 4AB9A 1AVXA 2VH6A 4B6FA 1YYY1 1C1OA 2PKAB 4UFEH 4I8JA 4JZEH 1HBTH 3LT3A 2LELA 1HAVA 2QXIA 4HZHA 4YT7H 4DURA 5J4QA 2ZPRA 1BTUA 5T6DA 4JK6A 3KL6A 3AW1A 3PM3A 1HB0B 1OP0A 1TQ0B 2BDYA 2YNBA 1YLNA 1DFPA 1SOTA 3LIWA 3M37A 3P70B 1PPGE 5DO4H 2G51A 2RDLA 4O97A 3MHWU 3K2UA 2W3KA 5BPEA 1Q3XA 2FS8A 2ZFTA 2XBWA 4Y0ZE 1HYLA 2GGVB 3P6ZB 1NFYA 2VIWA 2BXTH 1V3XA 1AFQB 3BIUH 4YO9A 1SKYE 5AF9H 1FIZA 1HAPH 1RJXB 3A8CA 2K1QA 2SGAA 4OS6A 2R0LA 4F4OC 3ZZ3A 4ZUHA 1O3GA 2WPJS 4XSKU 1JRTA 1ZHRA 1C5WB 2Y5GA 4I8GA 3SN8A 5EPYA 2FOFA 2ZDMA 1UVTH 3SV6A 3VEQB 1C2EA 4VGCC 4MNXA 1C5PA 3N7EA 1P06A 1QL8A 5JYIA 5EW1H 1UO6A 2BVRH 1ZGIA 1TIOA 3KIDU 2XXLA 4TSFD 1W2KH 3PRDA 4ABIA 3MQKC 1N1LA 3TVJB 2F91A 2A4RA 1UK3A 4CRGA 3CNRA 1GI3A 3GCHB 1MBQA 3LC3A 4MG3A 3RLYH 1FPHH 2BD9A 2D26C 2VJ1A 3VGCB 1EJMA 2D2DA 1QRZA 4INLA 5AHGH 1DVAH 3M7QA 4FVDA 5A8ZA 1A5IA 1ELBA 4IMZA 3SNCA 1VJAU 3LGIA 2QY0B 2ZCLP 3GY4A 4D9QA 5EQQA 3U98H 5C3NA 2NU1E 2EEKA 1W11U 1ZPZA 1FY1A 2IJD1 1TGNA 1UCYK 5GPIB 1KMHB 1QURH 1ANEA 3M36A 1UCYH 3F2GA 1BRUP 4K1SA 2SGDE 3T27A 1GHXH 2HNTF 3DSPA 2YMSD 5IK2D 2ZHQH 1AUTC 2F43B 3SV8A 1NPMA 1N6XA 1SFIA 1DDJA 1ANBA 1C4Y2 1FQ3A 1MQ5A 4THNH 1THRH 4HFPB 3S69A 1GJ8B 4Z0KA 3HK6B 3ATLA 3BN9A 3I78A 4NZLA 3TITA 1YPMH 2W26A 4LZ1H 2LP6A 1O2YA 3UNRA 2CJIA 4B1TA 4TT3D 3T28A 3T26A 1QY6A 1QL7A 2GMTC 2HNTE 1P2QA 5B6OA 5C0TA 1BTZA 1K1NA 2O8TA 2A4QA 3OE7D 1BDAA 3SUFA 4X6NA 1Z8IB 1VCQA 1SGCA 3TJVA 1SBWA 1E38B 2O8LA 1IQFA 1QFKH 2BY5X 1GG6B 1CT0E 3KQ5A 5TCAA 1OHHD 4ESTE 2RFKC 1DPOA 3MH4A 3QK1A 3ITIA 1H8IH 3D65E 1OYTH 2BMGB 3VB7A 1N8OC 4MPWA 1ETSH 2UWOA 1YPEH 4FUIA 4K5ZA 5EU8A 2QV1A 2PGBB 4WXIA 1DT2A 3UWJH 1XKAC 5F6MA 2V0BA 4MPXA 2FPZA 2FTLE 2ESTE 3KQEA 2FX4A 3SU6A 1SFQB 2GMTB 2BD5A 2G55A 3KHVA 3P8GA 4OS5A 2AIQA 1HGTH 2A31A 3SOSA 2W3IA 3GY6A 1J8AA 1C5ZB 4WMFA 5L2YH 4D8NA 2KAIB 2P95A 3RXMA 3V7TA 1EUFA 1JMOH 3OEED 5GCHF 1MAXA 4IW4E 1P2MA 1PFXC 4WMEA 4AYYB 1GGDC 1NFXA 2JH0D 1CT4E 3FANA 3RDZA 1ORFA 3A87A 3M3VA 4WH6A 3RU4D 1D9IA 1GJDB 3RUOA 5LH8A 1ZSLA 3BTHE 8KME2 2PSXA 1QRWA 1HAXB 3RXRA 3R3GB 1DANH 2H2ZA 4ZXYH 1EAUA 2B8OH 3N7DA 3TGJE 5CDFE 1MU8B 2FXRA 4X8TH 3HKIB 4Q7YA 3NKKA 1C2FA 3TK5A 5DP5A 2H9HA 1GBIA 1TMBH 2J38A 1PPHE 5E0GA 1NBMD 2PKSC 3NK8A 4FUHA 3S0NA 1XUKA 1S6FA 4B74A 4P02A 2J5UA 1GBHA 2ANWA 1JWTA 4ISOA 2A7JA 1DITH 1GHBF 2GJGA 5IYTA 1ELFA 5GCHG 2GV7A 1AVGH 2BTCE 1IQGA 2SNWA 5AFZH 1O31A 2J2UA 2Z9GA 1TMTH 2JETC 4TPYA 1WU1A 4ABJA 2F9NA 3C27B 2Z3DA 2QF3A 3UTUH 4ABAA 4X6PA 1BBRH 1C1RA 3ZVCA 2JJ1D 5C20A 2GZ7A 3DSGA 1BTXA 1EQ9A 1D4PB 2EI6A 1G37A 1GJCB 1HCGA 1AN1E 1P2KA 3RXJA 1W7XH 2M2AA 2VU8E 5HIZA 1YCPK 2HOBA 4WWYA 4B75A 4GPGA 3BTEE 1G30B 2PV9B 3U28C 1GI4A 4NIVA 3BG4C 1PQ7A 1O2IA 3Q77A 3FO8D 3KYGA 3EDXB 3SU2A 1GHBG 4DT7B 1P2IA 4OS2A 4CRDA 3T5FH 1O39A 1ESTA 4JCNA 1QA0A 4CR9A 2JETB 2OINA 1P12E 1VITG 2BLQA 2KCOA 3A80A 1P01A 1IAUA 1V2KT 1ZPCA 2A45B 2HPQH 3SGBE 1NT1A 4TWWA 2F9BH 2AH4X 3MFJA 4IS5A 3SQHE 4X0WU 4FOUC 2D1JA 3FVFB 3E90B 1NC6A 1O2PA 1GDQA 4X2VA 1ZYOA 2VH0A 4UFGH 1JRSA 3GCTF 2NU0E 4ZCNA 5F53A 1QR3E 4Y79A 1V2TT 2BB4A 4IGDA 1Y5AT 1K1IA 1LKAA 2BLOA 3ZZAA 1YP9A 3P17H 3ATKA 4XOJA 3KN2A 3EE7A 4OM9A 1DWCH 3HGPA 3KCGH 4NGAH 3ZZ5A 2FLBH 2VINA 1F0RA 2XRCA 2QN5T 1C2HA 5EJLA 3MYWA 4FUEA 3VB4A 5C5NA 4BTIB 2XBYA 4Q63A 4TY7A 4ACBA 3SNEA 1KIGH 4AFUA 1AUJA 4KGAA 3UAIC 1XUJA 1NTPA 1EOJA 2AMPA 1XUFA 3ZZ7A 4IN1A 5A8XA 2BHGA 5FXLA 3NWUA 1TRYA 2DUCA 2ZGHA 2BVSH 1MKWH 4ISLA 2ZFSA 1LPKB 5C17A 5A8YA 3L3TA 3ZZ8A 2ZF0H 1ZHPA 1TWXB 2W6JD 2BD2A 3NUMA 3RXBA 3GY7A 1LDTT 3M3SA 2ZECA 5C1XA 3GICB 2CHAC 1SHHB 2ZIQH 4RKJB 1KLIH 2W7SA 4E7RG 1MTWA 1HAVB 5JPMH 2PUQH 1GHVH 4D7FA 2WPIS 1C1UH 1GMCF 1TPAE 1BTYA 1HXEH 1AO5A 1T8MA 1ESBA 1AD8H 2OQUA 2HPPH 4JZIA 1LHDH 1BHXB 2G4UA 1EB2A 4ZROA 1D6WA 1C9TA 1OX1A 2HVXA 5A09A 1O3FA 1O5DH 1VKYA 1EPTA 5CMXH 4CHAB 2OCVB 2BQ6B 3P8NA 1O5FH 1YPGH 3CP7A 3VPKA 2Y81A 4CREA 1PPZA 2A5AA 3T62A 2JH5D 1OKXA 3ZZCA 2ZQ1A 3BEIB 4HG6A 3T2NA 5FBEA 3GDUA 2DE8A 2Y7ZA 3TK6A 1O5CB 4BAQB 1MUEB 4IC6A 2QA9E 5GWZA 2BM2A 2P59A 3K9XB 2A5IA 1OWKA 2HWLB 3OY6U 3F9FA 2H5DA 3UR6A 2FESH 4DGJA 2NU3E 1P2NA 2Z94A 3M3TA 1ANDA 2VWOA 1XM1A 2IPQX 1W8BH 5HM2A 2IPHA 5A0CA 3UUZA 1EFRD 1P2JA 1DE7H 1C1MA 2FODA 3T29A 5EW2H 1H9LB 4Q80A 3RXCA 1GVZA 1NY22 3U8TH 4Z1MD 2C3SA 1UVOA 1GI1A 2KFWA 5ESTE 1P04A 2Q6DA 1SC8U 3PTNA 1B0EA 3LJJA 3ODDA 1E0FD 3A86A 1RIWB 1TNKA 4NCYA 4DY7B 2HVYB 1C2MA 4JZDH 3ZVFA 3CS7A 1IHTH 1BCUH 3RXFA 1GI6A 1O3BA 2QE7D 3HATH 1QHRB 2VWLA 1HNEE 2WYJA 1NRNH 1C5UA 2WUBA 2AEIH 4WMDA 1UTPA 2R3UA 1P02A 3BTQE 1EAXA 2ZTYA 3S9BA 3PV2A 3U9AH 1ELAA 3F1SB 3STIA 4ABEA 2J95A 3PMJA 2ANYA 2VVVA 3OX7U 1BMNH 1GDUA 2GT8A 1A3BH 2BD3A 1P3CA 1ZLRA 3F9HA 4JYVH 4ZKSU 3TNSA 1AE8H 3EA8A 2ZGBH 2Y6TA 2Z9LA 1SLUB 1L1NA 1DWEH 2WPDD 4X8SH 2BY6X 3F3BA 1MZAA 1EZSC 1O2XA 1TYNA 1O2SA 3EA7A 2RA3A 2JJ2D 3P95A 2M5TA 3SUDA 1LCYA 1WTGH 2FO9A 3FFGA 3E91A 1A61H 1WOFA 2TGPZ 3E6PH 1TA2A 2XNIA 1TB6H 4I8HA 1BMFD 1BUIA 3SI4H 1HLTH 3RXOA 1O3NA 4NIYA 5L6NH 1Z8RA 4B2AA 2P93A 1GVLA 3S7KB 2GCTB 2RCEA 3QGNB 2SGQE 1AE5A 1OWHA 4X8UH 5C1YA 3OYPA 1OWJA 2QXHA 3GCNA 1ELVA 2EY4C 2GCHF 3D49H 2STAE 2ZEBA 1H9IE 1GBJA 1SVPA 5LGOA 1IQMA 2LNCA 2ZWLH 4X1QU 2RA0A 1EZXC 1UVPA 1KXEA 2QAAA 1YWUA 1BMLA 1UW7A 5DJ7A 6ESTA 2XC5A 1M9UA 4YESB 2ZDLA 1ACBE 3VB5A 1SR5C 2P16A 4A1VA 4CRCA 4NWKA 1HDTH 4X2WA 1S81A 1HJAC 5DN6D 1T8NA 4O9VA 4HGCA 1O3OA 4GCHF 1ANCA 2BOKA 2UUYA 4ZHLU 1AU8A 1UJ1A 3RXIA 2V7QD 2WHXA 5IDKA 1JIMA 1QNJA 4B2CA 1TX6A 3A81A 3VB3A 1THPB 1MH0A 2CN0H 4NWLA 3M5LA 1P3EA 3OAAD 5EQRA 1GI8B 4FUGA 4D7GA 2EI7A 3P92A 3RXDA 2SGEE 1OSSA 3KEEA 3LDXH 3M7TA 1HFDA 2PSYA 1V2UT 5DP3A 1SGYE 2IOTA 3R0FA 1C1WH 1NM6A 3TGIE 1PQ5A 1FJSA 1HAZB 1O2QA 1EXFA 2BLVA 5FL7D 4ABFA 4ZKOU 4XFQA 5EQSA 1IQJA 1P0SH 1DOJA 2BQWB 5T1VA 3A84A 1NROH 2ZC9H 5DPAA 1AFQC 4GCHG 4YTAA 4TYDA 4YT6H 2OXSA 4TPIZ 3OEHD 1HPGA 1RXPA 3ZYDA 1GVKB 1FMGA 1GCTC 1QIXB 4I8LA 1YM0A 4B2BA 2F3CE 3QZRA 2CGAA 2YMSB 8GCHG 1SGFA 1MQ6A 2FYQA 4XDEA 1QL9A 1A2CH 1ZTKA 3ZVDA 5DP6A 1TOMH 5K7RA 4ASHA 1KSNA 3MOCA 2TPIZ 8LPRA 1TGBA 1NRRH 3M5OA 1AWHB 1ZJKA 2SNVA 1TABE 4KKDA 4MPUA 2KCYA 2ZU2A 3TK9A 1W12U 3E0NB 2VVCA 2W6ID 3C1KA 3PWBA 1YF4A 1E34B 2Q6FA 1ELDE 4MNVA 2L74A 3GCHC 3FP8E 2R2MB 4YOGA 3IITA 3VGCC 3TU7H 4E05H 4R0IA 4E06H 4B76A 5F8TA 2GZ9A 4A1XA 1C5OH 3A89A 3SU0A 1GCTB 1XX9A 1D3DB 1IQKA 2BDIA 3TIUA 3DCLA 3A8BA 1SQRA 4GHTA 2O8UA 3LJOA 1ELEE 1TPSA 1P10A 1QJ6B 5EPNA 2AGGX 2GZ8A 3F2HA 4JK5A 4BAMB 4XBDA 3LU9B 4A5TS 4OS4A 2P3FH 1O2GH 3K6YA 4K3JA 5DKMA 3H5CB 5LPRA 2FEQH 4LZ4B 3S7HB 1QJ1B 1PJPA 1C5TA 1O38A 1TGSZ 3S9CA 1KXBA 1Z1JA 3ATWA 5HGGA 5JB9S 1P2OA 1DS2E 2GTBA 1V2ST 1BB0B 1E36B 3BTDE 3RM2H 4FVBA 4Q7XA 4ABDA 1Z6EA 1LHGH 1FONA 1UCYE 1W0JD 1T31A 3AK5A 3E1XB 2ZHWH 1GBTA 4OGYA 4CH2B 1QA7A 4GSOA 3TJUA 1YGCH 2GDDA 5FCRA 2WSSD 2ZU4A 4UD9H 4IN2A 7ESTE 2QF0A 1G3CA 1KTSB 3ZV8A 1OWDA 1S83A 1GG6C 1FY5A 7GCHF 1WBGB 1SGIB 1AI8H 1ARBA 3PTBA 3ZZ6A 1WCZA 3PV5A 1A5HA 4GLYA 1EX3A 4GUXA 4KTCA 5DG6A 2FI5E 1TALA 2XC0A 3PMAB 5ETXA 4RSPA 1BRBE 2WV9A 3BV9B 2G52A 1D3TB 4AFSA 3F9GA 4X1PU 3BEUA 4FU8A 1GPZA 3MH7A 4BXSA 2VIOA 1MABB 1Q31A 2F9PA 3GOVB 1BQYA 1O2WA 1S82A 1TGTA 7GCHG 1TNGA 1LQEA 1GI0A 4JYTA 2ZDAH 4NFFA 2FP7B 4AX9H 1O5AB 2FM2A 4H6SB 3SU5A 3F0PA 3MNSA 2OC1A 2ZO3H 1COWD 1K1JA 5C5OA 1AIXH 2H1UA 5HMAA 4MVNA 3DSOA 3OU0A 4K1EA 1UTJA 3Q3YA 4CRAA 2D8WA 4AG1A 2VBCA 2A1DB 3K65B 2Z3EA 1NRQH 3LGUA 1L1JA 1TX7A 1Z71A 1GJ7B 3FP6E 1XXDA 3HKJB 1EPTB 2PW8H 2ZP0H 2QYIA 1MD7A 3PROA 1O2TA 4I86A 3RC4A 3MU4A 1TLDA 1DLKB 3FP7E 2OTVA 2VIQA 1GI2A 4WY3A 4O3UA 1BA8B 2WV5A 1HIAB 3A8DA 1KTTB 1AMHA 2ZU1A 5HXFA 4ISNA 2OBQA 4O03A 4PROA 4LK4A 4AG2A 3RC5A 2GT7A 2SGPE 1DXWA 2Y5HA 3HGNA 3RXTA 4DIHH 4OS1A 1QB6A 1PPBH 3RXUA 4RN6A 2H9EH 1O32A 2ALVA 3A7WA 1TQ7B 3GCOA 3FAOA 1DICA 1GMDF 1KDQA 4XBBA 1VGCC 1GBCA 1FY4A 1PQAA 4JYUH 1BTHH 1A0HB 1O2VA 2HRVA 1CGJE 2Y80A 4M7GA 2O8MA 5A0AE 2C93B 1BBRE 1O3IA 1K28D 4DW2U 1BITA 1V2PT 4H4FA 3MNBA 1SLWB 3PLPA 1BBRK 1UTQA 3KQDA 2B7DH 4NA7A 3SZNA 1TA6A 1VITF 1UHBA 1O34A 2B9LA 1IQLA 4AOQA 3AASA 2C8XB 2ZFRH 3TLOA 3GYLB 3N99A 1VJ9U 2ODPA 3EA9A 1E1QD 4AC9A 3SO3A 5T6GA 2AMQA 1CVWH 4ZHAA 4O3TA 5HYOA 3A7ZA 1DUEA 1GMDG 5JBCS 3RP2A 1GJ5H 2GKVE 1U6QA 4OGXA 2AMDA 1G2LA 1VGCB 1GCDA 1O3DA 4J2YB 3SU3A 1FLEE 2XYAA 1J9CH 1GJAB 1TOCB 2F4LA 2TGAA 2J4IA 3LH1A 3D62A 1EB1H 4Y10E 1D3PB 2CXVA 3NZIA 1SQOA 1LO6A 4CR5A 3ATIA 3SU1A 2XOKD 1V2LT 2ULLA 1SGNE 4BXWA 2P8OB 1TFXA 1V2WT 5FCKA 4UDWH 1RD3B 2A2XH 2AFQB 2QF4A 3VXFH 1AVWA 3PLKA 5TCCA 2I6SA 4M9FA 4MTBA 1OWIA 1K9OE 3M61U 4U2WA 1O30A 2YOLA 4FUCA 3BTKE 1HAGE 3SV7A 2G8TA 1EATA 1OS8A 3A82A 4J1YA 5CHBA 1J17T 2ZI2H 5AVDA 3ZIAD 4GVUA 4Y8YA 1Z7KA 5TJXA 3MTYA 3MWIU 2RG3A 4RT0A 1HRTH 1QGFA 5EG4A 2QXJA 1RTKA 1KYNA 2LPRA 3SJ9A 4Q7ZA 1FI8A 2FOMB 3PO1B 1QB1A 1C4V2 1MCVA 2KZ4A 1SOZA 4AZ2B 3K6ZA 1GHWH 1FXYA 5F8XA 3QTVH 3P8FA 4ABBA 1YLCA 3H7TA 3QTOH 5EJZA 2Z9KA 1EAWA 1GJ9B 5B6LA 3AAUA 1HAYB 4RI0A 4Q2KA 4K8BA 1Y5BT 1CE5A 2KR7A 1UVSH 1G2MA 3NPSA 3UIRA 1KXFA 3MNXA 4XBCA 2HALA 3LGTA 3RXSA 4DJZB 2TIOA 2ZCHP 2VGCB 4Y7AA 1IQNA 1MKWK 3H09A 1GI7B 1LHFH 1D3QB 3SHAH 5T6FA 1Z8GA 1CQQA 3O8CA 1O3PB 3UNSA 3KYFA 3SQEE 1ZRBA 4CHAC 1Y5UT 3EYDA 2VVUA 3DFJA 4AB8A 4I33A 3URDA 3SV9A 3M5MA 3VB6A 2FOEA 2A7HA 1MTSA 4JMYA 3CS0A 4DVAU 4NSYA 2ANMH 2NU2E 2UUFB 1ARCA 3DA9B 1A0JA 1GHZA 2VB0A 4MPVA 1C2LA 1FZZA 1PYTC 1L4DA 2GVFA 1QBOA 2UUJB 2Z3CA 1OP2A 5DP8A 1UTMA 3GS9A 1GBEA 2BX4A 5C2ZA
chains in the Genus database with same CATH topology
5FX6A 2GX4A 3ZV9A 1RIWC 1FUJA 4YM9A 1W7GH 4Z6AH 1KLJH 2QXGA 2WPKS 1P05A 3A8AA 3KNXA 1BMAA 4UONA 4X1NU 2XW9A 1DSUA 1GBMA 5C67A 1EP5A 2EI8A 1SQAA 1MKXH 1DWBH 2I6QA 2ZKSA 2V3OH 4TY6A 3BTGE 4U01A 1DWDH 2PFEA 3LONA 3ZZDA 1C1QA 2FZZA 2ZHEH 4CRFA 1O2HA 1Z1IA 3P8OA 3RMNH 1UVUH 1CGHA 3V12A 2AERH 1O2JA 3PYHA 2PGQB 1PQ8A 1PPFE 4FUDA 3Q00A 5CHAB 2G81E 3U8OH 1GJ6A 1EKBB 5G4BA 2W7UA 2PLXA 2J94A 1NN6A 1O35A 8ESTE 1O36A 4WF8A 1LKBA 3PB1E 2A0QB 1WUNH 2V35A 4I31A 1JIRA 2GP9B 4MNYA 1LHEH 3H7OA 3GDVA 3A7TA 3BG8A 1TNJA 3L33A 1TMUH 1ABIH 1G3BA 2OUAA 1P11E 1O3HA 4B73A 2GCTC 5E0JA 1CGIE 1QTFA 4U32A 1O3MA 4GHQA 4E7NA 4NIWA 3MI4A 1GBDA 1C5MD 1O2ZA 4Y76A 4IBLH 3SU4A 4CRBA 3W95A 2ZFPH 1UK4A 5E0HA 4DG4A 4R8TB 2WPHS 1K2I1 3AAVA 5DGJA 3W94A 3VXEH 1K22H 4KTSA 2C8YB 2Q1JA 4Y71A 4QT8C 1W0ZU 2OD3B 1SL3A 1F0TA 2BVXH 2AIPA 1C2JA 6LPRA 1P03A 1C2IA 1F5RA 3DT0H 3SUEA 2QCYA 3A7XA 3ENSB 2J34A 1XVMA 1T4VH 2BX3A 2BDGA 2P3TB 1K1OA 1OYQA 5F8ZA 1T8OA 1V2MT 3RXPA 4MNWA 1AQ7A 3SGQE 4YZUA 3MO9A 1ZGVA 1VR1H 3LPRA 5ESBA 1TBQH 3RXGA 2G5NA 4WJG2 2R3YA 3QDZB 2VWMA 4UFFH 1HAOH 4MLFB 5GIBA 2VIDA 1MD8A 3MMGA 3OSYA 1SB1H 4X1SU 2WPLS 4NG9H 1C1TA 1O3EA 2ZHFH 2Y7XA 1V2NT 2ZZUH 1ETTH 1GBKA 4DIIH 1AHTH 1TPPA 4WXVA 4SGBE 3BTTE 2TRMA 3U69H 3I77A 5HM9A 2GV6A 2PR3A 2ZPQA 1LVBA 3RM0H 5A2MH 8GCHF 5T3HA 1BHXF 3T25A 3UNQA 5EODA 1ZR0A 4NA9H 4SGAE 1J15A 1SGRE 1SI5H 1TRNA 3LH3A 1O5BB 1V2OT 5GDSH 2TGDA 3LKWA 3PWCA 4NFEA 1EZQA 1C5XB 1CHOF 1S85A 3RC6A 1HAHH 1BZXE 1MU6B 2XWAA 1LQDB 1F5LA 1BIOA 1ELTA 1ETRH 2TBSA 3SNBA 3NXPA 3DHKH 4YLUA 3SNDA 2F9OA 3SUGA 4FXGH 3M5NA 1T32A 4X8VH 2FMJA 3GY2A 1TPOA 2G4TA 1FAKH 1H4WA 2Z7FE 3B9FH 1KDQB 4Y0YE 1FDPA 2XCFA 3JZ1B 1ZRKA 1BTWA 5GJ4B 5K0HA 1OP8A 1TX8A 4ZAEA 1F7ZA 2BYAX 3RXQA 1W3CA 4FU9A 1L0ZA 1QRXA 3ATMA 1YKTA 1G9IE 1H1BA 1CHOG 1O2UA 2BDAA 4U30A 5EOKA 2XBXA 3IWMA 1UHBB 2QC2A 3EGKH 2IJOB 2FWWA 4WVPE 5EXMA 3SJ8A 3HPTB 3ZZBA 3FZZA 2H6MA 1UTOA 2FIRH 1QQ4A 3QN7A 5FBIA 4DOQA 2QIQA 1UTLM 1Y3WA 2ZCKP 4AORA 4ZKRU 1NO9H 7LPRA 3EAJA 1SGTA 1G3DA 2OBOA 2YNAA 5PTPA 2A5KA 3ZZ9A 1SSXA 1N6YA 3RXVA 2PTCE 1K1LA 3ESTA 4KTUA 5F03A 1OOKB 1H8DH 2CF9H 2ZGCA 3PV4A 3ZVGA 1XXFA 2F83A 1CBWB 1CU1A 1EJNA 1L2EA 2XWBI 1WYKA 4CBOA 3MU1A 4A7IB 4WH8A 3KQBA 4HTCH 1O2NA 3OTJE 1C5RA 3A88A 3I29A 2GDEH 1YC0A 4BAHB 3BSQA 1WTHD 2ZNKH 2OC7A 1QJ7B 3O8DA 5EGMA 5L2ZH 1G3EA 5DP4A 4Y6DA 1NS3A 2ZPSA 3PMHB 4FUBA 5FPYA 1K1PA 4INKA 4BNRA 1O2OA 4AN7A 3RU4T 3O8RA 1BOQA 1V2QT 2UWPA 3UY9A 1C5QA 1HUTH 3SBKA 4TWYA 2JKHA 5JDUB 1BTPA 1EZUC 3ZVEA 1P8VC 1Z6JH 4KP0A 3SORA 3TJNA 1FNIA 1C5SA 1AKSA 1Y8TA 1Y59T 1DY8A 1MTNC 1HAIH 4OS7A 1C9PA 4VGCB 5GXPA 1EOLA 5JBAS 2BLWA 1FPCH 1YBWA 1EASA 1NU9A 3UWIA 1VZQH 3TH3H 1ZSKA 1W0YH 1G32B 3RXKA 2GD4B 4BTUB 1WAYB 4ZH8A 1MZDA 1S0QA 1EPTC 1LHCH 1QB9A 1O33A 2CF8H 3M7UA 1O3AA 3GDSA 1SLVB 2XTTB 3ZVBA 1MTNB 1V2JT 4A92A 1UK2A 1XUHA 3DD2H 1BMMH 3BF6H 3DUXH 4IC5A 3FZDA 1O3CA 2ODYB 3G01A 2A4OA 5EXLA 4D76A 4BTTB 2FOHA 3GY5A 4Y8ZA 1YPLH 2ZTXA 3RXHA 4K2YA 1EAIA 1GHAF 5JB8S 1O2MA 1C2GA 9ESTA 3RMOH 1XKBC 1JOUB 4K8YA 1YPHE 2WYGA 1WSSH 4I8KA 3UR9A 1GHYH 2FDAA 3QWCH 3E16B 1C1NA 3ZZ4A 2DE9A 5E8EH 1ID5H 1RRKA 2UWLA 2Z9IA 4NSVA 1AWFH 1NFWA 2STBE 3L6PA 1GL1A 1CA8B 1A5GH 1VCPA 4ABGA 2FS9A 1BT7A 3TH4H 5JBTA 1SQTA 1MMJN 1WQVH 5LPFA 2BY7X 2ZU5A 1GWAA 5FHTA 4ABHA 1RS0A 5AFYH 5C1UA 1A7SA 1P57B 1N8OB 1HJ9A 1GHAG 4INHA 3MU5A 4FU7A 1LPZB 4BANB 1DX5M 1L1GA 1LMWB 1DSTA 4KELA 1E37B 1IOEA 1S5SA 1FY8E 2B5TB 3B23B 2ALPA 1C5LH 1DLEA 1Y3VA 3S9AA 1C1SA 2A4GA 4H6TA 1A4WH 3A83A 1PPEE 3IG6B 2P8OC 1KXDA 1C5VA 1O3KA 1WV7H 3N7OA 2PKAA 3F9EA 1TE0A 1YCPM 2Y5FA 5H4IB 3SHCH 5JBBS 3EQ0H 3U8RH 3LGWA 3MU8A 3SJIA 2WPMS 5I46H 3A7VA 1C2DA 2BD7A 1PPCE 1O37A 2C8WB 1GGDB 2FLRH 4YLQH 1ELGA 3E0PB 4GAWA 4DCDA 4AFZA 1ZMNA 2FX6A 1J14A 1HXFH 2Q6GA 2BXUH 1KXCA 1W14U 2NU4E 5A0BA 1BJUA 4B71A 2OP9A 2OC8A 4XE4A 2WINI 4I32A 3ELAH 3PO1C 3SJKA 3TJOA 1TNIA 1GI5A 1SPJA 3MO3A 5J4SA 5SGAE 1KY9A 1YCPH 1ZSJA 2J92A 1C4U2 2PKSB 4BOHA 1WQSA 1Y3YA 2ZU3A 2R0KA 5FAHA 3BIVH 3Q3XA 3RLWH 4IMQA 5E2PA 4A6LA 2AGEX 1TRMA 1YLDA 3UQOA 1C1VH 3TGKE 1F0SA 1LVOA 3ODFA 2P3UB 1J16A 2VNTA 2ZGJA 3RU4E 3Q76A 3V3MA 2ZDNA 1VITH 2THFB 2VGCC 3LOXA 3MO6A 3GY8A 3BTFE 3PMBB 1OPHB 4UFDH 1IQEA 3F6UH 3WY8A 2BDHA 4NA8A 2F9UA 1O3LA 2FOCA 4A1TA 3BG4B 1NRSH 1B0FA 5EXNA 1IHSH 4Y11E 3SV2H 2TGTA 1V2RT 1AZZA 2BY8X 3QO6A 2H5CA 3AW0A 1LTOA 3RXAA 1FAXA 2XCNA 5L30H 1BRAA 1XUGA 2SFAA 1TONA 1O5GH 3QX5H 2OC0A 3GISB 4ISIH 4MQAA 3RXEA 3V0XA 3MH5A 3TNTA 2V3HH 4H42U 2BDCA 1OWEA 1HJ8A 3PLBA 1TAWA 3F68H 4AGJA 3OY5U 1O2LA 2BD8A 2J9NA 2FI3E 2A7CA 2VIPA 2XBVA 3MH6A 5I25A 4ISHH 2ZFQH 1ZPBA 1INCA 2O8WA 1SMFE 2Y82A 1Z8JB 2ZFFH 3GCTG 1C5NH 2QGRA 4ZXXH 2JH6D 1AFEH 1NESE 1O2RA 1UMAH 1TNHA 1DXPA 1GBBA 1EP6A 1T4UH 1ZZZA 1QBNA 1RTFB 4RKOB 1ZTLA 3UPEA 4YOIA 3CENA 2BZAA 5FPSA 1Q2WA 3SNAA 2O9QA 1GBAA 1CA0C 2Z9JA 2ZG0H 3Q3KA 1AY6H 2AYWA 1NRPH 2UUKB 3RXLA 1GJ4H 3LGYA 4CBNA 4D9RA 3SI3H 1OXGA 1P9SA 2FTMA 1JXPA 5CHAC 1AB9C 1RGQA 1S0RA 1QCPA 3A7YA 1BJVA 4YOJA 1FV9A 1SGQE 1E35B 1MTUA 1XMNB 1ESAA 4FUJA 5DK1A 2AGIX 1JBUH 2ZDVH 4BAKB 1MKXK 3HK3B 5DP9A 4ZHMU 4X6MA 1MCTA 4K1TA 3U1IB 6CHAC 1CSOE 1CA0B 3BTWE 2WUCA 2VIVA 1IQIA 2CHAB 1ZMLA 4X1RU 2KAIA 3GYMA 5FPTA 3UREA 1SLXB 4X2XA 2BD4A 4F49A 2AS9A 4JZ1A 1LVYA 4BAOB 2FOAA 1HIAA 2EA3A 5LPEA 1W10U 3D23A 1V2VT 2ODQA 4NZQA 2OQ5A 1AB9B 1GMCG 1ZHMA 2HLCA 4I7YH 2PHBA 2FYRA 4AGKA 1MBMA 3LC5A 2P94A 3UQVA 2W5EA 2R9PA 1ZTJA 2C4FH 1TBRH 1S6HA 1KXAA 1A46H 3B8JA 1AGJA 5CE1A 1F92A 2ZQ2A 3SGAE 6CHAB 1SGDE 3E3TA 4ZMAH 1NFUA 2C8ZB 4K69A 1GMHF 1CT2E 1T7CA 6GCHF 7KMEH 1ZMJA 1XVOA 2EC9H 1AKSB 3QLPH 3MU0A 1GJBB 2ZDKA 4HI3A 4LOYH 3VFEA 2A32A 1SGEE 3SJOA 3STJA 1P09A 1B7XB 3JZ2B 1UTNA 3ZVAA 2Z6BD 1K1MA 1Y3XA 3QUMP 1DY9A 1GBFA 1MAYA 4FUFA 1P9UA 3KF2A 1ZOMA 1GDNA 3UFAA 2C90B 5E2OA 3BTME 1A1RA 1EJAA 4K60A 3UOUA 4LXBH 1L4ZA 1GMHG 3ZYEA 1AZ8A 2ASUB 6GCHG 3TPIZ 1MTVA 2HNTC 2BY9X 1KLTA 3BEFB 4UE7H 1NU7B 2NWNA 1IQHA 1GBLA 3UOPA 1FIWA 3QGJA 3A85A 1ELCA 1V6DA 4X2YA 3V13A 3SW2B 1C2KA 2A2QH 3KGPA 1B5GH 2IN2A 2PTNA 1O0DH 1A3EH 2BQ7B 1LPGB 1F5KU 1CO7E 1TNLA 1D6RA 1S84A 1DM4B 2ZHDA 3E8LA 2R2WU 3O8BA 5BRRE 1BRCE 1QQUA 1Y3UA 2F9VA 4MDSA 1XUIA 1O5EH 1YPKH 2ZGXH 1YPHC 2BZ6H 1FN8A 1C1PA 2OLGA 1O2KA 1DUAA 1SHYA 2B0FA 1F2SE 1C5YB 1TGCA 3M35A 4AFQA 1SGPE 1YPJH 2SGFE 1PYTD 1X7AC 2ZTZA 1UTKA 3KQCA 9LPRA 2G5VA 3GY3A 1CHGA 2FI4E 2ZA5A 3NCLA 2PUXB 1GI9B 3EE0B 1F0UA 2G00A 3U1JB 2ANKH 1A0LA 1K21H 1THSH 3RMLH 1SG8B 2FOGA 4AYVB 2CV3A 1LVMA 1QBVH 1ABJH 4X6OA 4NIXA 4CH8B 1TBZH 1HV7A 3URCA 2XC4A 5FX5A 1NZQH 1ZJDA 3AVZA 2CMYA 2PWXA 1G36A 3RMMH 5DP7A 1SGFG 2GCHG 3TH2H 2H9TH 4Y8XA 2BDBA 1RTLA 5ABWA 1H9HE 2HGTH 4UEHH 1GL0E 2V6NA 1RFNA 1FN6A 2FOBA 2ILNA 3DFLA 2VWNA 1O3JA 1T8LA 1W13U 3LGVA 4Y7BA 1HJAB 2WV4A 4ZKNU 4JZFH 2BOHB 1VCWA 3MNCA 1CBWC 3QZQA 1FY3A 4AB9A 1AVXA 2VH6A 1YYY1 1C1OA 2PKAB 4UFEH 4I8JA 4JZEH 1HBTH 3LT3A 2QXIA 1HAVA 4HZHA 4YT7H 4DURA 5J4QA 2ZPRA 1BTUA 5T6DA 4JK6A 3KL6A 3AW1A 3PM3A 1HB0B 1OP0A 1TQ0B 2BDYA 2YNBA 1DFPA 1SOTA 3LIWA 3M37A 3P70B 1PPGE 5DO4H 2G51A 2RDLA 4O97A 3MHWU 3K2UA 2W3KA 5BPEA 1Q3XA 2FS8A 2ZFTA 2XBWA 4Y0ZE 1HYLA 2GGVB 3P6ZB 1NFYA 2VIWA 2BXTH 1V3XA 1AFQB 3BIUH 4YO9A 5AF9H 1FIZA 1HAPH 1RJXB 3A8CA 2K1QA 2SGAA 4OS6A 2R0LA 4F4OC 3ZZ3A 4ZUHA 1O3GA 2WPJS 4XSKU 1JRTA 1ZHRA 1C5WB 2Y5GA 4I8GA 3SN8A 5EPYA 2FOFA 2ZDMA 1UVTH 3SV6A 3VEQB 1C2EA 4VGCC 4MNXA 1C5PA 1P06A 1QL8A 5JYIA 5EW1H 1UO6A 2BVRH 1ZGIA 1TIOA 3KIDU 2XXLA 1W2KH 4ABIA 1N1LA 3TVJB 2F91A 2A4RA 1UK3A 4CRGA 1GI3A 3GCHB 1MBQA 3LC3A 4MG3A 3RLYH 1FPHH 2BD9A 2D26C 2VJ1A 3VGCB 1EJMA 2D2DA 1QRZA 4INLA 5AHGH 1DVAH 3M7QA 4FVDA 5A8ZA 1A5IA 1ELBA 4IMZA 3SNCA 1VJAU 3LGIA 2QY0B 2ZCLP 3GY4A 4D9QA 5EQQA 3U98H 5C3NA 2NU1E 2EEKA 1W11U 1ZPZA 1FY1A 1TGNA 1UCYK 5GPIB 1QURH 3M36A 1ANEA 1UCYH 1BRUP 4K1SA 2SGDE 3T27A 1GHXH 2HNTF 2ZHQH 1AUTC 3SV8A 1NPMA 1N6XA 1SFIA 1DDJA 1ANBA 1C4Y2 1FQ3A 1MQ5A 4THNH 1THRH 4HFPB 3S69A 1GJ8B 4Z0KA 3HK6B 3ATLA 3BN9A 3I78A