1UTMA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
b'IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utmA02
1H4WA 2VWLA 4KTCA 2HOBA 2FO9A 1DUAA 3M3TA 1AMHA 2ZGHA 1A5GH 1EZXC 1T32A 1EOJA 1A46H 1V2WT 1C5OH 1QB1A 3FAOA 3TJVA 1TMBH 1OSSA 4OS4A 3RMLH 1CT2E 2HNTE 1AWHB 1MD7A 1NTPA 3PLBA 4NA9H 1CT4E 3S9CA 3GDSA 3OYPA 3AAUA 1AU8A 3B8JA 1ZLRA 1P9UA 3MU5A 4YLQH 1O5FH 2BDCA 4ABIA 3GCOA 1XUFA 1PPCE 4BAQB 9LPRA 1RRKA 1QRWA 2RDLA 2C4FH 1NFXA 1T8OA 5FAHA 1MBMA 1XM1A 1XX9A 3QK1A 3VB4A 1RS0A 1A1RA 4B71A 4RKJB 1FN6A 3SO3A 1DITH 4CHAB 5C5NA 2R3YA 1GHZA 3U69H 2FOAA 3F9FA 1ESBA 1D3QB 2HPPH 2ZTXA 2OTVA 1BTZA 1YPLH 1DANH 2VB0A 1SG8B 3MHWU 1GBJA 3VGCC 1F5KU 2EI7A 4CRAA 1SPJA 5FCRA 3UREA 2XXLA 4FVBA 4IC6A 1NFYA 3DD2H 1P2IA 2Q6DA 4ZKSU 4BTIB 2ODPA 4MPUA 4MQAA 3MU0A 3D65E 4XOJA 4TPYA 4YT7H 1JIMA 2GTBA 2A7CA 1L4DA 1Y8TA 1T31A 1Y5AT 4OS1A 4X6MA 4FXGH 4NSYA 4F4OC 4A1XA 2OQUA 4Z6AH 1EB2A 3MNCA 4TWWA 4WF8A 3RMMH 1GG6C 1QA0A 3QX5H 5DP7A 3F9GA 5E0JA 1C5MD 2QN5T 4HI3A 1ELDE 3SU5A 1ZHRA 1A3EH 1VITH 3PMAB 2J9NA 2ALPA 1W13U 4JYUH 1L0ZA 4NIVA 4A5TS 1JRTA 3BV9B 5E0GA 2XTTB 1NM6A 2ANWA 1GBEA 1LHFH 1MTWA 2CV3A 2BVRH 4JCNA 3BG4B 4X6NA 3ATIA 4K8YA 4ABBA 4FUGA 3KQEA 2OC8A 1O3OA 1ABJH 3STJA 1C2MA 5AF9H 1FLEE 1P2NA 3FZZA 7GCHF 3ESTA 6GCHG 1FJSA 3RXEA 5HMAA 1O2ZA 1OYTH 1PPBH 2B0FA 3ENSB 1GL0E 3M7QA 2OC7A 4B73A 3D62A 2GT8A 2A4OA 2VJ1A 3EDXB 2VIPA 2XBYA 2QA9E 1ID5H 1C2EA 3VFEA 2ZU4A 1W11U 1AN1E 4ZHAA 1KXAA 3RXVA 1ZMNA 1P8VC 4Y6DA 1O5GH 4ZMAH 1S5SA 2Q6GA 1CA8B 2ZDVH 1ELGA 3KQCA 3PM3A 3MYWA 2Y82A 1MTNC 1BRBE 4Y8ZA 2PUXB 1GJBB 1ZRKA 6CHAC 2Y5GA 1LHDH 4GUXA 1HAHH 1IHSH 4Y7BA 3SU3A 1Y3UA 1O2KA 4A1TA 3M3VA 4IW4E 2C8WB 1E0FD 2UWLA 2J38A 4GHTA 3T25A 1TOMH 3M61U 1LPGB 1ZSKA 3ZVAA 2AFQB 2GVFA 2ZDLA 2I6SA 5EQQA 2PKAB 4SGAE 4UFFH 3RXOA 5TCCA 1SQOA 4AX9H 4H6TA 1LCYA 8GCHF 4DVAU 4ABDA 3SU4A 2TBSA 3R0FA 1P04A 1TGNA 3AAVA 5JYIA 1G3CA 5DK1A 4YOGA 1QR3E 5JBCS 2WPJS 3OY6U 1LHCH 1O2QA 4X2YA 1UTOA 1YPHC 2SGPE 5HM9A 3RM0H 3VB5A 2BY6X 3TGJE 3KN2A 2FOMB 1TMUH 3S7KB 3OSYA 8LPRA 1SOZA 2BYAX 4HZHA 3UR9A 1PJPA 4U01A 1TNKA 1TRMA 3U8RH 2BLVA 3LU9B 2FLRH 3SHCH 2GX4A 4KTUA 1JXPA 2AMPA 1ZJKA 2OUAA 1CGJE 1C2DA 2ZPSA 3UOPA 3RXMA 1GJ5H 2O9QA 2R9PA 4INLA 1BMAA 1H9HE 3LJJA 2GV7A 1O37A 2QXHA 1RIWB 1SGNE 1YBWA 1U6QA 3RXRA 1NZQH 1IQHA 4GHQA 3AW0A 2ULLA 3LGTA 1D6RA 7ESTE 2TRMA 3KHVA 1GHAG 3SHAH 4A1VA 1GJAB 4O9VA 1GI8B 4XBDA 1QL7A 3BTQE 4KKDA 1YYY1 3K6ZA 3ZZ6A 3LH3A 4CHAC 1S84A 1P3EA 1NRNH 1O0DH 2BHGA 2AEIH 3IG6B 2ZCHP 3TH4H 3P17H 3SN8A 5FPSA 2R2WU 4JZ1A 1G36A 1O39A 1HAVB 1V2LT 4K1EA 2D26C 4ISHH 4HTCH 1Z8IB 3B23B 1YC0A 2ZC9H 2PGQB 1IAUA 1O3CA 5K7RA 3U9AH 1ANEA 3FVFB 5HXFA 1EP5A 1SGQE 2BQWB 1O31A 2A1DB 3QLPH 1T4VH 3ZZDA 3Q76A 2ZFFH 8ESTE 2VGCB 4BANB 1PPEE 5L30H 4AN7A 3RXCA 2XCNA 1TYNA 1O36A 2NU0E 1GVZA 4B2BA 3I29A 3GICB 2B5TB 1SGDE 1EPTA 3KNXA 4ISIH 3TK6A 4DIHH 1GDNA 4FUIA 1P2MA 2ZHFH 2BQ6B 3VB3A 1XUKA 3DFJA 1OWJA 3SV8A 3F68H 1ANBA 1B5GH 3LT3A 1TB6H 4D8NA 4XBCA 1LO6A 1SOTA 2NU3E 2BY9X 1AKSB 4FUCA 3A7XA 1LVBA 1HV7A 3ATKA 1TPSA 2F9BH 2UWPA 4ASHA 3SUGA 4TWYA 2OC1A 5CMXH 1T8MA 3O8BA 1KTSB 2ZFTA 1GHBF 3ZVDA 2AYWA 1ANCA 2VU8E 1GL1A 2WV4A 3U8TH 1ACBE 3BG4C 1MQ6A 3EE0B 1JOUB 1K9OE 2FX4A 2ZWLH 1K21H 2WPLS 4XBBA 3LC3A 3QDZB 1ELCA 1GMCF 2O8UA 3A83A 1T4UH 1EZQA 1YPJH 2ZDKA 2ASUB 4BAHB 2QV1A 1SGPE 1FZZA 2BDHA 4ISOA 1DWCH 1HIAA 4JZEH 1V3XA 2IJOB 1XUIA 3SJ8A 1P01A 2PW8H 1ARCA 2OD3B 2Z9IA 3A86A 4NFEA 2ODYB 1UTKA 4YOIA 1DXWA 2GCTB 3ZZ7A 1SGYE 3MMGA 1MTSA 1MUEB 1TQ0B 1MTVA 3N7OA 3SJ9A 4JYTA 3SUEA 5EPNA 1KTTB 3RXPA 1CO7E 1FUJA 3T5FH 2O8TA 2H5DA 4WXVA 4AGJA 1ZSLA 2FOBA 1P02A 1Q2WA 1JIRA 4TYDA 3T27A 3A89A 4RN6A 3QWCH 3SNAA 2A7HA 2J95A 4VGCB 1GHWH 2C8YB 4H4FA 2ZF0H 1UVUH 2HGTH 1UMAH 4XSKU 1JBUH 1ZYOA 3V12A 3ZVEA 1SFQB 4BTUB 4DURA 3MTYA 3NCLA 2FTMA 3P8OA 1HLTH 3P70B 2BVXH 3O8RA 1LQDB 3ZYDA 1DM4B 1C5SA 2XRCA 1QNJA 3ZVGA 3OTJE 1D9IA 5TCAA 1AUTC 1KXDA 1O2RA 4FU9A 4AB9A 3VEQB 2ZU1A 3BN9A 3I78A 1W0YH 2ANKH 1TNLA 2W7UA 1V2UT 2VH6A 4GCHG 5EODA 1YM0A 4K1SA 4JZFH 1O5DH 1O3AA 2OBQA 3MO3A 1BBRK 5A0CA 2GCHG 2H6MA 4I7YH 2BB4A 2F91A 3SU1A 1GHYH 1O5BB 1E35B 1V2VT 2FPZA 2FOCA 1C2GA 4WMEA 4D9QA 2W3IA 3MNBA 3QN7A 3VB7A 1C1OA 1IQLA 3OY5U 1TPOA 2XNIA 5TJXA 1O2NA 4Y79A 1XXDA 4UEHH 5L6NH 1OXGA 1QA7A 1AE5A 3F1SB 2A2QH 4X1PU 1UVOA 4IBLH 3ATMA 4BXWA 1UHBB 5FCKA 1SGRE 4AG2A 1LVOA 5C67A 2C8XB 4CBOA 1GWAA 4Q7YA 1AI8H 1UVTH 1ELAA 1THPB 1FAKH 1KXCA 1O2HA 1T7CA 2PLXA 1H9IE 2FESH 1O5AB 3TJUA 1GCDA 1YP9A 1RIWC 5T6DA 1O2PA 4ZUHA 1DUEA 2KAIB 1TRYA 4X1NU 1Q31A 4DGJA 1RXPA 3KEEA 1BT7A 2OLGA 3GY7A 3KL6A 2EI8A 2XYAA 4E06H 2QCYA 3SJIA 1THSH 1BRCE 1T8NA 1Z1JA 2FOHA 3MH6A 1A4WH 4A92A 5A2MH 3TGIE 1WUNH 1F0SA 2OC0A 3RXQA 3RC5A 4UE7H 1G3DA 1P9SA 2BOHB 4AG1A 3DA9B 3M5LA 1IOEA 1Y3YA 5F03A 2J34A 3A7VA 2M5TA 1AZ8A 2WUCA 1DX5M 4DW2U 1FDPA 1DWEH 3K6YA 2FOFA 4OS5A 4JK6A 4JMYA 3V0XA 3UWIA 9ESTA 2GT7A 4X1RU 1O34A 2CJIA 3PV4A 2OINA 2BY8X 3EA9A 2BD2A 2R0KA 2VIOA 3GCTF 2ZHQH 1BCUH 3H5CB 4B76A 3HK6B 1TBQH 1TNJA 1NFUA 4FUEA 3T2NA 2VGCC 2WV5A 1EJMA 1ZHPA 2SGDE 1BTYA 1O2JA 3QTVH 2BVSH 1GMDG 1TFXA 3EGKH 1P2JA 3RXFA 1LKAA 1AGJA 2ZQ2A 3BEUA 4WH6A 4K1TA 4ABHA 4ISLA 3RXAA 4JZDH 3MWIU 1F92A 4ZKOU 1BB0B 2VWNA 1BHXF 1XKAC 2VINA 2ZHWH 2RA3A 1QL9A 2Z3EA 2CGAA 1O3BA 1G37A 2G51A 3W95A 1JRSA 1VJ9U 2WYJA 2J92A 4TY7A 2ZHEH 1C1TA 1THRH 1D3DB 2PGBB 2NU4E 1AVXA 2BDBA 2ZFQH 3FP8E 1SHYA 1QCPA 3LPRA 4ZHMU 3E90B 3EYDA 4Y10E 2SGAA 1BMMH 1BBRE 1W3CA 2K1QA 3LGIA 1A7SA 1UVPA 3SUDA 1BJUA 4AOQA 4CH2B 3RM2H 3KIDU 4SGBE 3DT0H 3M3SA 1DY9A 5C1XA 4GLYA 1AIXH 1MTUA 2P59A 4WWYA 2D2DA 3E16B 2JETB 1XVOA 1ANDA 3I77A 2GCTC 3U1IB 2PSYA 2FODA 1FV9A 2AS9A 1P10A 4I33A 4IS5A 4U2WA 4X0WU 5IYTA 2PHBA 2P8OB 1GI3A 1X7AC 2GZ8A 2Y6TA 3LDXH 3MI4A 1NESE 1PQAA 1WOFA 3MNSA 1A3BH 4ZHLU 4Y8XA 1PPGE 3MH4A 1HGTH 1NRQH 1S85A 5FX5A 4VGCC 3Q3KA 1IQJA 1BA8B 1FIWA 2ZPRA 3JZ1B 2SFAA 3A7TA 5T3HA 2XC4A 5PTPA 2GMTB 1CE5A 5B6OA 1K1MA 1DLEA 4AFQA 4X2XA 1S6FA 1KLJH 1ZPCA 1A5IA 1FMGA 4D9RA 5FBIA 4X6PA 1GVKB 2ZHDA 1K1LA 3SQHE 3VXFH 3VXEH 1K1JA 3ODFA 3A87A 3C27B 4B1TA 1UK4A 1C4Y2 2BZ6H 2TGTA 7LPRA 1S6HA 1BHXB 1VCWA 1C5LH 1EKBB 1K2I1 1SGFG 3E0PB 4X2VA 5GCHG 1P0SH 3GY2A 1VR1H 2BQ7B 3G01A 1CA0B 4AFUA 1LHGH 3ZZ8A 1O2GH 2Y7ZA 4DY7B 4DOQA 2FWWA 4OGXA 1O2IA 1HAOH 3RP2A 2ANMH 1GJ4H 3ODDA 5JPMH 1NROH 2FI5E 2OP9A 3KCGH 2GKVE 1HUTH 1YGCH 1MBQA 1GJ8B 1C5YB 2J2UA 1MAXA 4I8JA 3UY9A 3DUXH 5LPFA 1KDQB 3SQEE 1DWDH 3V13A 2Y81A 1XVMA 1XXFA 1ABIH 2VIDA 2VH0A 1ZTLA 1HAYB 2BD7A 2YNBA 1Y5BT 1W14U 2GV6A 4MLFB 4I8KA 4FVDA 4LXBH 3STIA 2Z3DA 2QF3A 1TGCA 3L3TA 2LNCA 4NWLA 3LIWA 3A8BA 1ZR0A 3RU4T 5BPEA 1C1SA 1FONA 4KP0A 4FUBA 3GDVA 1BDAA 1PQ7A 2A4GA 3ATWA 1V2RT 3CENA 3KGPA 3MH7A 2F9NA 3JZ2B 2WPMS 3A88A 1LQEA 4U30A 3MU4A 1INCA 1L1GA 1F2SE 2H9HA 4Q7XA 2BX4A 1FY1A 1WBGB 2CXVA 2RCEA 2VIWA 4ABGA 1O2LA 1QGFA 5EOKA 4X2WA 2FOGA 3PMHB 1GCTB 3ZZ9A 2QYIA 2R0LA 1EAWA 4O3TA 3A7WA 4Z0KA 4NCYA 2BM2A 1HPGA 1DWBH 1QBVH 3RXUA 3SUFA 2H2ZA 1AUJA 5LGOA 5I46H 1RTKA 1A5HA 2PFEA 3FFGA 2V3OH 3HPTB 1MZAA 1YPHE 2BXTH 8GCHG 1SR5C 3NXPA 1FN8A 4K69A 1LPZB 2Y80A 2FP7B 1CSOE 3TK9A 3PROA 3E91A 1H9LB 3K9XB 1HAGE 2AGEX 1B0FA 1C1QA 3IITA 1ELEE 1UTQA 5JDUB 4Y8YA 2A5AA 4DJZB 1WQSA 1P2OA 2QC2A 2J4IA 1PQ5A 2GD4B 2QF0A 3BIUH 4XE4A 2EC9H 1C2IA 4XFQA 5JB9S 1TALA 1AO5A 5DP9A 4CR9A 5ABWA 4ABAA 1RD3B 3F6UH 1QHRB 4E7RG 1NU9A 4A7IB 4YESB 3ZVFA 1CT0E 2VVVA 3E0NB 1QURH 4Y7AA 4E05H 5EPYA 4ZKNU 4CREA 1A0LA 4JZIA 1DLKB 1ZPZA 2BD4A 2ZTYA 3CP7A 3RXJA 4IN2A 2VVUA 4MTBA 3EA7A 2BD9A 1CGIE 1TNIA 5GIBA 2QXGA 1LMWB 3GY5A 1E37B 1SMFE 3ZZCA 3RXGA 1GBBA 2HNTF 3GY6A 2FEQH 1IHTH 2GDEH 2ZCKP 4WJG2 4YOJA 3P95A 5F6MA 3T29A 1V2NT 2XW9A 4FUDA 5DO4H 2STBE 1DOJA 1Y3XA 2P16A 1EJNA 1Z71A 3A85A 3E3TA 3W94A 4ABJA 4LK4A 1TABE 5FBEA 2JETC 1ESAA 1F0TA 2CMYA 1C5NH 1TONA 1O2XA 1A61H 1UCYH 1O2SA 4K60A 1F5RA 3A8CA 3SI3H 2HALA 1UTNA 4JYVH 2BLQA 3E1XB 2P8OC 4IC5A 1GHAF 1L1NA 4ZXYH 1QTFA 1SBWA 1TGTA 1YCPH 1FXYA 1ESTA 1O2TA 2G5NA 1O2MA 3GY8A 3P8FA 4OS7A 1TPAE 2G4UA 3BTTE 2ZG0H 4U32A 3RXKA 1WSSH 3DFLA 1BRAA 3RMOH 1WCZA 1P06A 4GPGA 3BTGE 2THFB 1MKXH 4MPXA 3TITA 1V2KT 2PV9B 2GMTC 1WV7H 2JKHA 1SLWB 3RU4E 3GY3A 5EXNA 1J9CH 4O03A 1TGBA 1QIXB 3ZVBA 4AYVB 1QJ1B 1O3HA 3V3MA 1YPKH 3HGNA 2AERH 4YTAA 1V2QT 3FP7E 4AB8A 1IQKA 2HPQH 1G30B 1DT2A 1GHBG 2BD3A 5J4SA 3LC5A 3D23A 1OWDA 3BTHE 1N6XA 4MPVA 5AVDA 3HK3B 5DPAA 5E2PA 1FY8E 1ZTJA 1GMCG 2AIPA 2GZ7A 2HRVA 3M5OA 1GI4A 2ESTE 1CHOG 1CA0C 4BAKB 1EAIA 2PKAA 1HFDA 3O8CA 3FZDA 1FY5A 3RMNH 2I6QA 4O3UA 4LZ4B 5CE1A 4KGAA 3NKKA 1WYKA 5GWZA 3NUMA 2ZP0H 1T8LA 1C5ZB 4TY6A 4X1QU 1HJAB 5F8TA 1QBOA 2D8WA 4I32A 1HB0B 1HXEH 3LGYA 1ZHMA 5J4QA 3U1JB 1Z6EA 3SNEA 4FUJA 1UK3A 1GI1A 4Y76A 1LVYA 2AGIX 1SGFA 1HDTH 2P93A 1MMJN 3PWBA 3M7TA 1TQ7B 3FANA 1UJ1A 1L4ZA 1EUFA 2ILNA 1QFKH 1P2KA 2D1JA 4AFSA 2EA3A 4ZKRU 1W8BH 1C1WH 4Q7ZA 2PSXA 2OCVB 1BITA 1FQ3A 1C1VH 1AZZA 1OPHB 5AFZH 3ATLA 1GBHA 1QQUA 1C2LA 2VIQA 2UUYA 3P8NA 1RFNA 3MNXA 3HKJB 2PR3A 2FYRA 1QB9A 3T28A 1C5XB 4AGKA 2SGFE 3Q00A 2ANYA 1ZZZA 1GMHF 2JH5D 4MNVA 1Y3VA 5C3NA 3M5NA 4JK5A 1HAIH 2RA0A 1AE8H 1OWEA 3UNRA 1GCTC 3VB6A 1XUGA 1W7GH 3QGJA 2SGEE 1PYTD 4FU7A 1ZGIA 1GDUA 1O2YA 5FPYA 3SV6A 1Z6JH 2W5EA 4H42U 4LOYH 4CR5A 1C2FA 1MKWH 1IQNA 1BTUA 1EZSC 3UUZA 1EOLA 1C5RA 1ZOMA 1ZJDA 3PYHA 4CH8B 1AY6H 1HAVA 1NO9H 1VJAU 1YLCA 2TIOA 5T6GA 5H4IB 1MU6B 2O8WA 1CQQA 1G2MA 1OX1A 2ZDNA 4NWKA 5E0HA 2PTNA 1SVPA 4ABEA 1MZDA 3OU0A 2QAAA 4ZH8A 1KXEA 1RTFB 1NFWA 2BZAA 1SSXA 1S0RA 1GGDB 1O3KA 1SLXB 1JMOH 1ZPBA 2ZECA 1ARBA 1DPOA 1GPZA 2XC0A 3SNDA 3S9AA 4WXIA 4X8SH 4GCHF 1BOQA 1P3CA 2W3KA 2GDDA 2ZU2A 1DICA 1Y59T 2GZ9A 4BTTB 1E36B 2Z9GA 3U8OH 1GHXH 2CHAB 4UONA 3IWMA 1AHTH 2P3TB 1QB6A 2AIQA 2TGPZ 1TA2A 1OWHA 5ESBA 1P12E 3QZQA 3B9FH 2ZFSA 1F0RA 1LDTT 4NG9H 3SNBA 1SI5H 3TGKE 1AKSA 2LPRA 5FPTA 2ZEBA 3T62A 2CF8H 3M7UA 1KYNA 4MNXA 5IDKA 1J16A 4FUHA 3S7HB 4TPIZ 1WU1A 5C1YA 1QJ7B 1O33A 5EXMA 1RTLA 2A4QA 1C9TA 5A0BA 4X8UH 2V3HH 1BMNH 1HXFH 1O3NA 1O2VA 5GXPA 5T6FA 1AVGH 2VIVA 4O97A 5E8EH 2ZGXH 1KIGH 3LGWA 3TJOA 1VZQH 1FNIA 1Z8GA 2ZU5A 4LZ1H 3F9HA 5L2YH 4WMDA 4AZ2B 4FUFA 1C1NA 3PMBB 2V6NA 4YM9A 1V2TT 5F8XA 1A0HB 3GCTG 1ETTH 4THNH 1DXPA 1C5VA 6ESTA 1GBIA 1UVSH 1Z8JB 1GJ6A 5DP3A 1H8DH 1TX8A 1GHVH 1N6YA 2AMDA 1SC8U 4CRFA 1VITG 1ZMLA 5FX6A 2YOLA 1C4U2 1TLDA 4BNRA 2BXUH 2WUBA 1TA6A 4NZQA 1LHEH 4CBNA 1BMLA 2FZZA 3BTEE 5DJ7A 2BLOA 1ZRBA 1IQGA 3BTFE 1XKBC 5ETXA 1DSUA 3BTDE 1OP0A 1SLVB 2G4TA 1QBNA 3RXDA 3ZZ5A 1CHGA 2OQ5A 3PTBA 1K1IA 4UFDH 1DDJA 3RXTA 4X6OA 2C90B 3TNTA 3HATH 2UWOA 1IQEA 4FU8A 1Z7KA 3SGBE 3VPKA 3PB1E 1TE0A 2O8LA 1YLDA 3O8DA 1DY8A 3BTME 3GY4A 4R8TB 2FI3E 4D7FA 3Q3YA 1CGHA 3UTUH 5EQSA 3UNSA 1AFQB 4X1SU 4ABFA 1EX3A 2QXJA 2BDIA 1W10U 4NIYA 3RXIA 1TX6A 1SGTA 1O2UA 2WYGA 1KSNA 3NWUA 3SU6A 4Y0ZE 1Y5UT 1SHHB 5GJ4B 2DE9A 3MU8A 4B2CA 1ELTA 2B7DH 3RC4A 4IMQA 2ZDAH 4A6LA 2EEKA 5DP6A 1GI6A 2BOKA 2V0BA 2ZI2H 1AWFH 1TMTH 3SZNA 1AB9B 1HJAC 1BRUP 1KY9A 2XBXA 1SB1H 3URDA 2HNTC 5FXLA 5DP5A 1C2JA 2NWNA 5AFYH 1BTWA 3ZV8A 4X8TH 1HYLA 3MOCA 3PO1B 2UUFB 3CS7A 1G3BA 1PPZA 5CHAB 3SGAE 3A7YA 4BOHA 1UHBA 1S81A 1O3FA 3GCNA 1L2EA 1OYQA 2C93B 1FIZA 2CN0H 3ZZ4A 5SGAE 3M5MA 1IQFA 2PKSB 1TBRH 4WMFA 2H5CA 2BDYA 4B74A 2JH0D 3S69A 4DG4A 4I31A 2BY5X 1GI5A 3UQVA 2KAIA 1O2OA 3TU7H 5EG4A 4NA7A 1QRZA 1C1MA 3H7TA 5DKMA 5JBAS 1SGCA 1TIOA 3ZVCA 1J8AA 5L2ZH 5A8YA 5EXLA 1ELBA 1K1NA 3UWJH 2QIQA 5A0AE 3QGNB 1GBAA 3MU1A 2ZCLP 3E8LA 5C5OA 3P8GA 7KMEH 2A32A 1V2MT 1M9UA 2YNAA 4ESTE 4ZXXH 2OBOA 1NS3A 1C2KA 1PPHE 1NN6A 1C1UH 2F3CE 3T26A 4ISNA 4BAMB 1FAXA 1DSTA 3BG8A 3QZRA 3A8DA 5LPRA 4NFFA 5JBTA 1MAYA 2AGGX 2BMGB 1V2OT 7GCHG 1O3PB 1HAPH 1AVWA 4K5ZA 1GGDC 2XCFA 5GPIB 1C5TA 3HGPA 4XDEA 2BDGA 1B0EA 1HBTH 1GDQA 1UTJA 1FI8A 4R0IA 1OP2A 4MNYA 1P03A 3P92A 3FP6E 1IQIA 5GCHF 2ZGJA 3M36A 4Y11E 1C5PA 3MH5A 1BUIA 2CHAC 2Z9LA 1VCPA 3QUMP 2DE8A 3ZYEA 1HAXB 2ZFRH 1O30A 5F8ZA 4K8BA 2OXSA 1CU1A 6GCHF 3PWCA 3TPIZ 1ELFA 1MCTA 2FTLE 1GBDA 2ZDMA 1C2HA 2XWBI 2WPHS 1S0QA 4AYYB 3EAJA 2VWOA 2BD8A 3MO9A 1PQ8A 2FMJA 1C4V2 4DIIH 2UUJB 5A09A 2BD5A 1EPTB 2C8ZB 4UFGH 1CBWB 2ZZUH 3M35A 2SNWA 3RLWH 4Q2KA 2O8MA 3SI4H 3RC6A 1EAXA 3SNCA 3EQ0H 2Z6BD 2AMQA 1ETRH 1ELVA 1QY6A 1S83A 4PROA 3OX7U 1GBTA 4CRBA 2F9PA 1GBFA 1GVLA 3A8AA 3PTNA 2BTCE 1NRSH 1W7XH 1MCVA 3UNQA 1A0JA 1AQ7A 1GI9B 2PTCE 3TH3H 2BY7X 2ZGCA 4IGDA 2ZQ1A 2STAE 1J15A 1J14A 1TPPA 5LH8A 1G2LA 1AD8H 3SOSA 1O3JA 1PYTC 4MG3A 1K22H 3LONA 3TH2H 1SQTA 1YCPM 1UTMA 1P09A 2P95A 3K2UA 4DCDA 1HIAB 2ZTZA 1EATA 1OWKA 2A31A 2WPKS 4NA8A 1MU8B 4MPWA 1KXBA 1MD8A 8KME2 1SGIB 1TAWA 1QL8A 1HNEE 2NU2E 3KF2A 5DP8A 1G32B 2W26A 3KQDA 1OWIA 3MO6A 2PUQH 4H6SB 1EB1H 3V7TA 2HWLB 2VWMA 3R3GB 1QRXA 2JH6D 1J17T 4OS6A 3AVZA 5EW1H 1G9IE 2Y5FA 3TVJB 2W7SA 5C1UA 1RGQA 3SJKA 4E7NA 2G52A 1WTGH 1AFQC 2G8TA 1H1BA 2G55A 2TPIZ 5G4BA 4BXSA 1XUHA 3SW2B 1NC6A 4CRDA 1P11E 1V2PT 3P6ZB 5I25A 2H9EH 3S0NA 2ZNKH 2QY0B 2ZPQA 2GP9B 5C2ZA 3RUOA 3QTOH 2F9UA 2FS9A 3UOUA 4NZLA 4KELA 1C1RA 4X8VH 3A80A 6LPRA 1GJDB 1C9PA 2FM2A 1EXFA 4AORA 1NPMA 1HAZB 2BDAA 4WH8A 1VCQA 1AB9C 2IN2A 4ZAEA 1ZGVA 2C3SA 1O3DA 1TBZH 1MH0A 1DE7H 1C1PA 3PO1C 2H1UA 2FLBH 5CHAC 2IPHA 1KDQA 3M37A 4MNWA 3ELAH 5ESTE 1O35A 1NT1A 1BQYA 1S82A 2A5KA 5GDSH 3CS0A 5FHTA 3A82A 3U98H 1UO6A 3GCHB 1K28D 2AH4X 4HGCA 2XBVA 3GYLB 2PKSC 3BIVH 2XC5A 1EP6A 2GGVB 4MVNA 3SU2A 3SGQE 1DS2E 3TIUA 1DFPA 3ZZAA 4ZROA 3UIRA 5EU8A 3D49H 4YLUA 2SGQE 3TJNA 2V35A 3UR6A 2Z7FE 3A81A 1A2CH 2PWXA 2FIRH 3RXLA 4RKOB 1VGCB 2A4RA 2IOTA 1N8OB 2Z3CA 1LKBA 1OP8A 2CF9H 1JWTA 4I8LA 1GBCA 3URCA 2ZKSA 1XUJA 1O38A 4B75A 1LTOA 3NZIA 2FYQA 1O32A 5EQRA 2Z9KA 1UCYK 4NSVA 3SV2H 4Q80A 3NPSA 3PLPA 3LGUA 3HKIB 2ALVA 2A0QB 4J2YB 3LH1A 1EJAA 1GJ7B 2QXIA 4HFPB 1YCPK 1AFEH 4BAOB 1F0UA 1O2WA 2XBWA 1FY4A 1TRNA 4WVPE 3PMJA 1TGSZ 1TNHA 5LPEA 1LVMA 3C1KA 2TGDA 1MQ5A 4GVUA 4Y0YE 2QGRA 1D6WA 4F49A 3BSQA 5DG6A 1MKXK 1CHOF 1V2JT 3AW1A 1O3MA 1TX7A 3RXSA 5EGMA 2P94A 2FI4E 1KXFA 1O3EA 1O5CB 1N1LA 1YPMH 5A8XA 2XWAA 2G5VA 3GISB 3SU0A 1C5WB 1TNGA 1BTHH 2ZGBH 1BBRH 1W12U 2ZIQH 3VGCB 5K0HA 3AASA 3F9EA 1NY22 2HVXA 3KQBA 5AHGH 1O5EH 2BLWA 2F83A 4CRGA 1GMHG 5JB8S 1QQ4A 1K1OA 1Q3XA 5HM2A 1Y3WA 3LOXA 3TK5A 3TNSA 1BTPA 4J1YA 1O3IA 2P3UB 1NU7B 3GYMA 1EPTC 3Q3XA 1KLTA 1L1JA 1CBWC 1DVAH 1GI0A 5EW2H 1C5QA 1WQVH 1TWXB 1E38B 4DT7B 5C20A 3BEFB 2DUCA 2WPIS 1GI2A 1FPHH 1YPGH 3RXBA 1OKXA 3E6PH 2FDAA 1BZXE 1B7XB 1SGEE 2UUKB 1GG6B 1HRTH 4CRCA 1BTXA 1YKTA 2A45B 1EAUA 3LGVA 4NGAH 3S9BA 1SFIA 5HYOA 3SJOA 1CVWH 1ZSJA 2ZO3H 1HJ9A 3RLYH 1OOKB 3A7ZA 3A84A 3ZZBA 4KTSA 1WTHD 3SV7A 3QO6A 2B9LA 1D3TB 1P05A 1UK2A 4UDWH 1YF4A 2ODQA 1K1PA 3DHKH 1BJVA 1GJCB 4YO9A 1Z8RA 3SORA 4D76A 4D7GA 3BF6H 1W0ZU 1ZTKA 4INHA 1BIOA 4I8HA 4YZUA 2J94A 2P3FH 1GBKA 5A8ZA 1NRPH 2GCHF 3Q77A 2BX3A 5DGJA 5HGGA 1NRRH 1PFXC 1EQ9A 1IQMA 1D4PB 2F9OA 4AFZA 4QT8C 1SLUB 1YPEH 2VNTA 2A2XH 4OGYA 1XMNB 3RXHA 4IMZA 2R2MB 3ITIA 3BEIB 1QJ6B 3ZZ3A 1UCYE 3WY8A 4IN1A 1O3GA 1PPFE 4NIXA 4WY3A 1V6DA 2A7JA 1MKWK 1P2QA 2WINI 1D3PB 1EZUC 1H8IH 2ZFPH 2A5IA 3UFAA 4MDSA 3LKWA 3H7OA 3BTKE 2FOEA 4UFEH 3MFJA 1SL3A 1ZMJA 2Y5HA 1C5UA 1UTPA 5BRRE 3L6PA 2EI6A 1G3EA 1V2ST 4Y71A 4I8GA 2Z9JA 3GDUA 1MTNB 3UPEA 2TGAA 1F5LA 1GBLA 6CHAB 1F7ZA 5E2OA 2Y7XA 1FPCH 4B2AA 1P57B 3SBKA 4YT6H 5JBBS 1RJXB 4INKA 1GBMA 4K3JA 3UQOA 1E34B 2R3UA 2VVCA 3GOVB 1ORFA 1TOCB 2G81E 4GSOA 4K2YA 3K65B 1EASA 1SQAA 3GCHC 4UD9H 2Z94A 1ETSH 2Q1JA 1OS8A 4NIWA 1UTLM 2NU1E 1GJ9B 1O3LA 3SV9A 1Z1IA 1KLIH 3BTWE 3NK8A 3ZV9A 2B8OH 1W2KH 2HLCA 3PLKA 2F9VA 2ZU3A 3EA8A 4M7GA 2FXRA 1HCGA 4OS2A 2ZA5A 1WAYB 1VITF 2RG3A 2Q6FA 4RSPA 5DP4A 3RDZA 1GI7B 2FX6A 3TLOA 3RU4D 1FY3A 3L33A 2H9TH 1LPKB 1VGCC 2FS8A 2G00A 1N8OC 4GAWA 2SNVA 1GMDF 1HJ8A 3LJOA
chains in the Genus database with same CATH superfamily
1H4WA 2VWLA 4KTCA 2HOBA 2FO9A 1DUAA 3M3TA 1AMHA 2ZGHA 1A5GH 1EZXC 1T32A 1EOJA 1A46H 1V2WT 1C5OH 1QB1A 3FAOA 3TJVA 1TMBH 1OSSA 4OS4A 3RMLH 1CT2E 2HNTE 1AWHB 1MD7A 1NTPA 3PLBA 4NA9H 1CT4E 3S9CA 3GDSA 3OYPA 3AAUA 1AU8A 3KQ5A 3B8JA 1ZLRA 1P9UA 3MU5A 4YLQH 1O5FH 2BDCA 4ABIA 3GCOA 1XUFA 1PPCE 4BAQB 9LPRA 1RRKA 1QRWA 2RDLA 2C4FH 1NFXA 1T8OA 5FAHA 1MBMA 1XM1A 1XX9A 3QK1A 3VB4A 1RS0A 1A1RA 4B71A 4RKJB 1FN6A 4ZCNA 3SO3A 1DITH 4CHAB 5C5NA 2R3YA 2J98A 1GHZA 3U69H 2FOAA 3F9FA 1ESBA 1D3QB 2HPPH 2ZTXA 2OTVA 1BTZA 1YPLH 1DANH 2VB0A 1SG8B 3MHWU 1GBJA 3VGCC 1F5KU 2EI7A 4CRAA 1SPJA 5FCRA 3UREA 2XXLA 4FVBA 4IC6A 1NFYA 3DD2H 1P2IA 2Q6DA 4ZKSU 4BTIB 2ODPA 4MPUA 4MQAA 2EQNA 3MU0A 3D65E 4XOJA 4TPYA 4YT7H 1JIMA 2GTBA 2JJ2D 2A7CA 1L4DA 1Y8TA 3PRBA 1T31A 1Y5AT 4OS1A 4X6MA 4FXGH 4NSYA 4F4OC 4A1XA 2OQUA 3OEHD 4Z6AH 1EB2A 3MNCA 4TWWA 4WF8A 3RMMH 1GG6C 1QA0A 3QX5H 5DP7A 3F9GA 5E0JA 1C5MD 2QN5T 4HI3A 1ELDE 2JDID 3SU5A 1ZHRA 1A3EH 1VITH 3PMAB 2J97A 2J9NA 2ALPA 3F0OA 1W13U 4JYUH 1L0ZA 4NIVA 4A5TS 1JRTA 3BV9B 5E0GA 2XTTB 1NM6A 2ANWA 1GBEA 1LHFH 1MTWA 2CV3A 2BVRH 3U28C 5KECA 4JCNA 3BG4B 4X6NA 3ATIA 4K8YA 4ABBA 4FUGA 3KQEA 2OC8A 1O3OA 1ABJH 3STJA 1C2MA 5AF9H 1FLEE 1P2NA 3FZZA 7GCHF 3ESTA 6GCHG 1FJSA 3RXEA 5HMAA 1O2ZA 1OYTH 1PPBH 2B0FA 3DCLA 3ENSB 1GL0E 3M7QA 2OC7A 3PV5A 4B73A 3D62A 2GT8A 2A4OA 2VJ1A 3EDXB 2VIPA 2XBYA 2QA9E 1ID5H 1MABB 1C2EA 3VFEA 2ZU4A 1W11U 4ACAA 1AN1E 4ZHAA 1KXAA 3RXVA 1ZMNA 1P8VC 4Y6DA 1O5GH 4ZMAH 1S5SA 2Q6GA 1CA8B 2ZDVH 1ELGA 3KQCA 3PM3A 3MYWA 5C0TA 2Y82A 1MTNC 1BRBE 4Y8ZA 2PUXB 1GJBB 1ZRKA 4TT3D 6CHAC 2Y5GA 1LHDH 4GUXA 1HAHH 1IHSH 4Y7BA 3SU3A 1Y3UA 1O2KA 4A1TA 3M3VA 4IW4E 2C8WB 1E0FD 2UWLA 2J38A 4GHTA 3T25A 1TOMH 3M61U 1LPGB 1ZSKA 3ZVAA 2AFQB 2GVFA 2ZDLA 2I6SA 5EQQA 2PKAB 4SGAE 4UFFH 3RXOA 5TCCA 2F4LA 1SQOA 4AX9H 4H6TA 1LCYA 8GCHF 4DVAU 4ABDA 3SU4A 3FN8A 2TBSA 3R0FA 1P04A 1TGNA 3AAVA 5JYIA 1G3CA 5DK1A 4YOGA 1QR3E 5JBCS 2WPJS 2KFWA 3OY6U 1LHCH 1O2QA 4X2YA 1UTOA 1YPHC 2SGPE 5HM9A 1NBME 3RM0H 3VB5A 2BY6X 3TGJE 3KN2A 2GJGA 2FOMB 1TMUH 3S7KB 3OSYA 8LPRA 1SOZA 2BYAX 1K0HA 4HZHA 3UR9A 1PJPA 4U01A 1TNKA 1TRMA 3U8RH 2BLVA 3LU9B 2FLRH 3SHCH 2GX4A 4KTUA 1JXPA 2AMPA 1ZJKA 2OUAA 1CGJE 1C2DA 2ZPSA 3UOPA 3RXMA 1GJ5H 2O9QA 2R9PA 4INLA 1BMAA 1H9HE 3LJJA 2GV7A 1O37A 2QXHA 1RIWB 1SGNE 1YBWA 1U6QA 3RXRA 1NZQH 1IQHA 4GHQA 3AW0A 2ULLA 3LGTA 1D6RA 7ESTE 2KCYA 2TRMA 3KHVA 1GHAG 3SHAH 2HLDD 4A1VA 1GJAB 4O9VA 1GI8B 4XBDA 1QL7A 3BTQE 4KKDA 1YYY1 3K6ZA 3ZZ6A 3LH3A 4CHAC 1S84A 1P3EA 1NRNH 1O0DH 2BHGA 2AEIH 3IG6B 2ZCHP 3TH4H 3P17H 3SN8A 5FPSA 2R2WU 4JZ1A 1G36A 1O39A 1HAVB 1V2LT 5EIYA 4K1EA 2D26C 4ISHH 4HTCH 1Z8IB 3B23B 1YC0A 2ZC9H 2PGQB 1IAUA 1O3CA 5K7RA 3U9AH 1ANEA 3FVFB 2WV9A 5HXFA 1EP5A 1SGQE 2BQWB 1O31A 2A1DB 3QLPH 1T4VH 3ZZDA 3Q76A 2ZFFH 8ESTE 2VGCB 4BANB 1PPEE 5L30H 4AN7A 3RXCA 2XCNA 1TYNA 1O36A 2NU0E 3OFND 1GVZA 4B2BA 3I29A 3GICB 2B5TB 1SGDE 1EPTA 3KNXA 4ISIH 3TK6A 4DIHH 1GDNA 4FUIA 1P2MA 2ZHFH 2BQ6B 3VB3A 1YWUA 1XUKA 3DFJA 1OWJA 3SV8A 3F68H 1ANBA 1B5GH 3LT3A 1TB6H 4D8NA 4XBCA 1LO6A 1SOTA 2NU3E 2BY9X 1AKSB 4FUCA 3A7XA 1LVBA 1HV7A 3ATKA 1TPSA 4XD7D 2F9BH 2UWPA 4ASHA 3SUGA 4TWYA 2OC1A 5CMXH 1T8MA 3O8BA 1KTSB 2ZFTA 1GHBF 3ZVDA 2AYWA 1ANCA 2VU8E 1GL1A 2WV4A 3U8TH 1ACBE 3BG4C 1MQ6A 3EE0B 1JOUB 1K9OE 2FX4A 2ZWLH 1K21H 2WPLS 4XBBA 3LC3A 3QDZB 1ELCA 1GMCF 2O8UA 3A83A 1T4UH 3AK5A 1EZQA 1YPJH 2QF4A 2ZDKA 2ASUB 4BAHB 2QV1A 1SGPE 1FZZA 2BDHA 4ISOA 1DWCH 1HIAA 4JZEH 1V3XA 2IJOB 1XUIA 3SJ8A 1P01A 2PW8H 1ARCA 2OD3B 2Z9IA 3A86A 3N7EA 4NFEA 4RT1A 2OK5A 2ODYB 1UTKA 4YOIA 1DXWA 2GCTB 3ZZ7A 1SGYE 3MMGA 1MTSA 1MUEB 1TQ0B 1MTVA 3N7OA 3SJ9A 4JYTA 3SUEA 5EPNA 1KTTB 3RXPA 1CO7E 1FUJA 3T5FH 2O8TA 2H5DA 4WXVA 3F2GA 4AGJA 1ZSLA 2FOBA 1P02A 1Q2WA 1JIRA 4TYDA 3T27A 3A89A 4RN6A 3SZEA 3QWCH 3SNAA 2A7HA 2J95A 4VGCB 1GHWH 2C8YB 4H4FA 2ZF0H 4OM9A 1UVUH 2HGTH 1UMAH 4XSKU 1JBUH 1ZYOA 3V12A 3ZVEA 1SFQB 4BTUB 4DURA 3MTYA 3NCLA 2FTMA 3P8OA 1HLTH 3P70B 2BVXH 3O8RA 1LQDB 3ZYDA 1DM4B 1C5SA 2XRCA 1QNJA 3ZVGA 3OTJE 1D9IA 3KYGA 5TCAA 1W0KD 1AUTC 1KXDA 1O2RA 4FU9A 4AB9A 3VEQB 2ZU1A 3BN9A 3I78A 1W0YH 1W0JD 2ANKH 1TNLA 2W7UA 1V2UT 2VH6A 4GCHG 5EODA 1YM0A 4K1SA 4JZFH 1O5DH 1O3AA 2OBQA 3MO3A 1BBRK 5A0CA 2GCHG 2H6MA 2M2AA 4I7YH 2BB4A 2F91A 3SU1A 1GHYH 1O5BB 1E35B 1V2VT 2FPZA 2FOCA 1C2GA 4WMEA 4D9QA 2W3IA 3MNBA 3QN7A 3VB7A 1C1OA 1IQLA 3OY5U 1TPOA 2XNIA 5TJXA 1O2NA 4Y79A 1XXDA 4UEHH 5L6NH 1OXGA 1QA7A 1AE5A 3F1SB 2A2QH 3FO8D 4X1PU 1UVOA 4IBLH 3ATMA 4BXWA 1NBMD 1UHBB 4TSFD 5FCKA 1SGRE 4AG2A 1LVOA 5C67A 2C8XB 4CBOA 1GWAA 4Q7YA 1AI8H 1UVTH 1ELAA 1THPB 1FAKH 1KXCA 1O2HA 1T7CA 2PLXA 1H9IE 2FESH 3ZIAD 1O5AB 3TJUA 1GCDA 1YP9A 1RIWC 5T6DA 1O2PA 4ZUHA 1YLNA 1DUEA 2KAIB 1TRYA 4X1NU 1Q31A 4DGJA 1RXPA 3KEEA 1BT7A 2OLGA 3GY7A 3KL6A 2EI8A 2XYAA 4E06H 2QCYA 3SJIA 1THSH 1BRCE 1T8NA 1Z1JA 2FOHA 3MH6A 1A4WH 4A92A 5A2MH 3TGIE 1WUNH 1F0SA 2OC0A 3RXQA 3RC5A 4UE7H 1G3DA 1P9SA 2BOHB 4AG1A 3DA9B 3M5LA 1IOEA 1Y3YA 5F03A 2J34A 3A7VA 2M5TA 1AZ8A 2WUCA 1DX5M 4DW2U 1FDPA 1DWEH 3K6YA 2FOFA 4OS5A 4JK6A 4JMYA 3V0XA 3UWIA 5HIYA 9ESTA 2GT7A 4X1RU 1O34A 2CJIA 3PV4A 2OINA 2BY8X 3EA9A 2BD2A 2R0KA 2VIOA 3GCTF 2ZHQH 1BCUH 3H5CB 4B76A 3HK6B 1TBQH 1TNJA 1NFUA 4FUEA 3T2NA 2VGCC 2WV5A 1EJMA 1ZHPA 2SGDE 1BTYA 1O2JA 3QTVH 2BVSH 1GMDG 1TFXA 3EGKH 1P2JA 3RXFA 1LKAA 1AGJA 2ZQ2A 3BEUA 4WH6A 4ACBA 4K1TA 4ABHA 4ISLA 3RXAA 4JZDH 3MWIU 1F92A 4XRNA 4ZKOU 1BB0B 2VWNA 1BHXF 1XKAC 2VINA 2ZHWH 2RA3A 1QL9A 2Z3EA 2CGAA 1O3BA 1G37A 2G51A 3W95A 1JRSA 1VJ9U 2WYJA 2J92A 4TY7A 2ZHEH 1C1TA 1THRH 1D3DB 2IPQX 2PGBB 2NU4E 1AVXA 2BDBA 2ZFQH 3FP8E 1SHYA 1QCPA 3LPRA 4ZHMU 3E90B 2VBCA 3EYDA 4Y10E 3NRLA 2SGAA 1BMMH 1BBRE 1W3CA 2K1QA 3LGIA 1A7SA 1H8HD 1UVPA 3SUDA 1BJUA 4AOQA 4CH2B 3RM2H 3KIDU 4SGBE 3DT0H 3M3SA 1DY9A 5C1XA 4GLYA 2V7QD 1AIXH 1MTUA 2P59A 1EFRD 4WWYA 2D2DA 3E16B 2JETB 1XVOA 2JIZD 1ANDA 3I77A 2GCTC 3U1IB 2PSYA 2FODA 1FV9A 2AS9A 1P10A 4I33A 4IS5A 4U2WA 4X0WU 5IYTA 5C0UA 2PHBA 2P8OB 1GI3A 1X7AC 2GZ8A 2Y6TA 3LDXH 5EJ1A 3MI4A 1NESE 1PQAA 1WOFA 3MNSA 1A3BH 4ZHLU 4Y8XA 1PPGE 3MH4A 1HGTH 1NRQH 1S85A 5FX5A 4VGCC 3Q3KA 1IQJA 1BA8B 1FIWA 2ZPRA 3JZ1B 2SFAA 3A7TA 5T3HA 2XC4A 5PTPA 4ASUD 2GMTB 1CE5A 3FOAA 3N7DA 5B6OA 1K1MA 1DLEA 4AFQA 4X2XA 1S6FA 1KLJH 1ZPCA 1A5IA 1FMGA 4D9RA 5FBIA 4X6PA 1GVKB 2ZHDA 2XOKD 1K1LA 3SQHE 3VXFH 3VXEH 1K1JA 3ODFA 3A87A 3C27B 4B1TA 3CNRA 1UK4A 1C4Y2 2BZ6H 2TGTA 5KGOA 7LPRA 1S6HA 1BHXB 1VCWA 1C5LH 1EKBB 1K2I1 1SGFG 3E0PB 4X2VA 5GCHG 1P0SH 3GY2A 1VR1H 2BQ7B 3G01A 4FOUC 1CA0B 4AFUA 1LHGH 3ZZ8A 1O2GH 2Y7ZA 4DY7B 2KR7A 4DOQA 2FWWA 4OGXA 1O2IA 1HAOH 3RP2A 2ANMH 1GJ4H 3ODDA 5JPMH 1NROH 2FI5E 2OP9A 3KCGH 2GKVE 1HUTH 1YGCH 1MBQA 1GJ8B 1C5YB 2J2UA 1MAXA 4I8JA 3UY9A 3DUXH 5LPFA 1KDQB 3SQEE 1DWDH 3V13A 2Y81A 1XVMA 1XXFA 1ABIH 2VIDA 2VH0A 1ZTLA 1HAYB 2BD7A 2YNBA 1Y5BT 1W14U 2GV6A 4MLFB 4F55A 4I8KA 4FVDA 4LXBH 3STIA 2Z3DA 2QF3A 1TGCA 3L3TA 2LNCA 4NWLA 3PV2A 3LIWA 3A8BA 1ZR0A 3RU4T 5BPEA 1C1SA 1FONA 4KP0A 4FUBA 3GDVA 1BDAA 1PQ7A 2A4GA 3ATWA 1V2RT 3CENA 3WWBA 3KGPA 3MH7A 2F9NA 3JZ2B 2WPMS 3A88A 1LQEA 4U30A 3MU4A 1INCA 1L1GA 1F2SE 2H9HA 4Q7XA 2KCOA 2BX4A 1FY1A 1WBGB 2CXVA 2RCEA 2VIWA 4ABGA 1O2LA 1QGFA 5EOKA 4X2WA 2FOGA 4Q63A 3PMHB 1GCTB 3ZZ9A 2QYIA 2R0LA 1EAWA 4O3TA 3A7WA 4Z0KA 4NCYA 2BM2A 4I86A 1HPGA 1DWBH 1QBVH 3RXUA 3SUFA 2H2ZA 1AUJA 5LGOA 5I46H 1RTKA 1A5HA 2PFEA 3FFGA 2V3OH 3HPTB 2RFKC 1MZAA 1YPHE 2BXTH 8GCHG 1SR5C 3NXPA 1FN8A 4K69A 1LPZB 2Y80A 2FP7B 1CSOE 3TK9A 3PROA 3E91A 1H9LB 3K9XB 1HAGE 2AGEX 1B0FA 1C1QA 3IITA 1ELEE 1UTQA 5JDUB 4Y8YA 2A5AA 4DJZB 1WQSA 1P2OA 2QC2A 2J4IA 1PQ5A 2GD4B 2QF0A 3BIUH 4XE4A 2EC9H 1C2IA 2L74A 4XFQA 3OEED 5JB9S 1TALA 1AO5A 5DP9A 1E1RD 4CR9A 5ABWA 4ABAA 1RD3B 3F6UH 1QHRB 4E7RG 1NU9A 4A7IB 4YESB 3ZVFA 1CT0E 2VVVA 3E0NB 1QURH 4Y7AA 4E05H 5EPYA 4ZKNU 4CREA 1A0LA 4JZIA 1DLKB 1ZPZA 2BD4A 2ZTYA 3CP7A 4HG6A 4IN2A 2VVUA 3RXJA 4MTBA 3EA7A 2BD9A 1CGIE 1TNIA 5GIBA 2QXGA 1LMWB 3GY5A 1E37B 1SMFE 3ZZCA 3RXGA 1GBBA 2HNTF 3GY6A 2K0QA 2FEQH 1IHTH 2GDEH 4P00A 2ZCKP 4WJG2 4YOJA 3P95A 5F6MA 3T29A 1V2NT 2XW9A 4FUDA 5DO4H 2STBE 1DOJA 1Y3XA 2P16A 1EJNA 1Z71A 3A85A 3E3TA 3W94A 4ABJA 4LK4A 1TABE 5FBEA 2JETC 1ESAA 1F0TA 2CMYA 1C5NH 1TONA 1O2XA 1A61H 1UCYH 1O2SA 4K60A 1F5RA 3A8CA 3SI3H 2HALA 1UTNA 4JYVH 2BLQA 3E1XB 2P8OC 4IC5A 1GHAF 1L1NA 4ZXYH 1QTFA 1SBWA 1TGTA 1YCPH 1FXYA 1ESTA 1O2TA 1SQRA 2G5NA 1O2MA 3GY8A 3P8FA 4OS7A 1TPAE 2G4UA 3BTTE 2ZG0H 4U32A 3RXKA 1WSSH 3DFLA 1BRAA 3RMOH 5DN6D 1WCZA 1P06A 4GPGA 3BTGE 2THFB 1MKXH 4MPXA 3TITA 1V2KT 2PV9B 2GMTC 1WV7H 2JKHA 1SLWB 3RU4E 3GY3A 5EXNA 1J9CH 4O03A 1TGBA 1QIXB 3ZVBA 4AYVB 1QJ1B 1O3HA 3V3MA 1YPKH 3HGNA 2AERH 4YTAA 1V2QT 3FP7E 4AB8A 1IQKA 4YXWD 2HPQH 1G30B 1DT2A 3OAAD 1GHBG 2BD3A 5J4SA 3LC5A 3D23A 1OWDA 3BTHE 1N6XA 4MPVA 5AVDA 3HK3B 2WSSD 5DPAA 5E2PA 1FY8E 1ZTJA 1GMCG 2AIPA 2GZ7A 2HRVA 3M5OA 1GI4A 2ESTE 1CHOG 1CA0C 4BAKB 1EAIA 2PKAA 1HFDA 3O8CA 3FZDA 1FY5A 3RMNH 2I6QA 4O3UA 4LZ4B 5CE1A 4KGAA 3NKKA 5CHBA 1WYKA 5GWZA 3NUMA 2ZP0H 1T8LA 1C5ZB 4TY6A 4X1QU 1HJAB 5F8TA 1QBOA 2D8WA 4I32A 1HB0B 1HXEH 3LGYA 1ZHMA 5J4QA 3U1JB 1Z6EA 3SNEA 4FUJA 1UK3A 1GI1A 4Y76A 1LVYA 2AGIX 1SGFA 1HDTH 2LP6A 1MMJN 2P93A 3PWBA 3M7TA 3F3BA 1TQ7B 3FANA 1UJ1A 1L4ZA 1EUFA 2ILNA 1QFKH 1P2KA 2D1JA 4AFSA 5KEDA 2EA3A 4ZKRU 1W8BH 1C1WH 4Q7ZA 2PSXA 2OCVB 1BITA 1FQ3A 1C1VH 1AZZA 1OPHB 5AFZH 3ATLA 1GBHA 1QQUA 1C2LA 2VIQA 2UUYA 3P8NA 1RFNA 3MNXA 3HKJB 2PR3A 2FYRA 1QB9A 3T28A 1C5XB 4AGKA 2SGFE 3Q00A 2ANYA 1ZZZA 1GMHF 2JH5D 4MNVA 1Y3VA 5C3NA 5C17A 3M5NA 4JK5A 1HAIH 2RA0A 4Q4LA 1AE8H 1OWEA 3UNRA 4Z1MD 1GCTC 3VB6A 1XUGA 1W7GH 3QGJA 2SGEE 1PYTD 4FU7A 1ZGIA 1GDUA 1O2YA 5FPYA 3FKSD 3SV6A 1Z6JH 2W5EA 4H42U 4LOYH 4CR5A 1C2FA 1MKWH 1IQNA 1BTUA 2AHME 2L6OA 1EZSC 3UUZA 1EOLA 1C5RA 1ZOMA 1ZJDA 3PYHA 4CH8B 1AY6H 1HAVA 1NO9H 1VJAU 1YLCA 2TIOA 5T6GA 5H4IB 1MU6B 2O8WA 1CQQA 1G2MA 1OX1A 2YMSD 2ZDNA 4NWKA 5E0HA 2PTNA 1SVPA 4ABEA 1MZDA 3OU0A 2QAAA 4ZH8A 1KXEA 1RTFB 1NFWA 2BZAA 1SSXA 1S0RA 1GGDB 1O3KA 1SLXB 1JMOH 1ZPBA 2ZECA 1ARBA 1DPOA 1GPZA 2XC0A 3SNDA 3S9AA 4WXIA 4X8SH 2KCAA 4GCHF 1BOQA 1P3CA 2W3KA 2GDDA 2ZU2A 1DICA 1Y59T 2GZ9A 4BTTB 1E36B 2Z9GA 3U8OH 1GHXH 2CHAB 2J98B 4UONA 3IWMA 1AHTH 2P3TB 1QB6A 2AIQA 2TGPZ 1TA2A 1OWHA 5ESBA 1P12E 3QZQA 2JJ1D 3B9FH 2ZFSA 1F0RA 1LDTT 4NG9H 3SNBA 1SI5H 3TGKE 1AKSA 5FL7D 2LPRA 5FPTA 2ZEBA 3T62A 2CF8H 3M7UA 1KYNA 3GS9A 4MNXA 5IDKA 1J16A 4FUHA 3S7HB 4TPIZ 3UB0A 1WU1A 5C1YA 1QJ7B 1O33A 5EXMA 1RTLA 2A4QA 1C9TA 5A0BA 4X8UH 2V3HH 1BMNH 1HXFH 1O3NA 1O2VA 5GXPA 5T6FA 1AVGH 2VIVA 4O97A 5E8EH 2ZGXH 1KIGH 3LGWA 3TJOA 1VZQH 1FNIA 3F0PA 1Z8GA 2ZU5A 4LZ1H 3F9HA 5L2YH 4WMDA 4AZ2B 4FUFA 1C1NA 1WDIA 3PMBB 2V6NA 4YM9A 1V2TT 1VKYA 5F8XA 1A0HB 3GCTG 1ETTH 4THNH 1DXPA 1C5VA 6ESTA 1GBIA 1UVSH 1Z8JB 1WXRA 1GJ6A 5DP3A 1H8DH 1TX8A 1GHVH 1N6YA 2AMDA 1SC8U 4CRFA 1VITG 1ZMLA 5FX6A 2YOLA 1C4U2 1TLDA 4BNRA 2BXUH 5EJZA 2WUBA 1TA6A 1SKYE 4NZQA 1LHEH 2QF5A 4CBNA 1BMLA 2FZZA 3BTEE 5DJ7A 2BLOA 1ZRBA 1IQGA 3BTFE 1XKBC 5ETXA 2HVYB 1DSUA 3BTDE 3WWFA 1OP0A 1SLVB 2G4TA 1QBNA 3RXDA 3ZZ5A 1CHGA 2OQ5A 3PTBA 1FX0B 1K1IA 4UFDH 1DDJA 3RXTA 3DSGA 4X6OA 2C90B 3TNTA 3HATH 2UWOA 1IQEA 4FU8A 1Z7KA 3SGBE 3VPKA 2YMSB 1TE0A 3PB1E 2O8LA 1YLDA 3O8DA 1DY8A 3BTME 3GY4A 4R8TB 2FI3E 4D7FA 3Q3YA 1CGHA 3UTUH 5EQSA 3UNSA 1AFQB 4X1SU 4ABFA 1EX3A 2QXJA 2BDIA 1W10U 4NIYA 3RXIA 1TX6A 1SGTA 1O2UA 2WYGA 1KSNA 3NWUA 3EE7A 3SU6A 4Y0ZE 1Y5UT 3DSPA 1SHHB 5GJ4B 2DE9A 3MU8A 4B2CA 1ELTA 2B7DH 3RC4A 4IMQA 2ZDAH 4A6LA 2EEKA 5DP6A 1GI6A 2BOKA 3N99A 4F48B 2V0BA 2W6ID 2ZI2H 1AWFH 1TMTH 3SZNA 1AB9B 1HJAC 1BRUP 1KY9A 2XBXA 1SB1H 3URDA 2HNTC 5FXLA 5DP5A 2WPDD 1C2JA 2NWNA 5AFYH 1BTWA 3ZV8A 4X8TH 1HYLA 3MOCA 3PO1B 2UUFB 3CS7A 1G3BA 1PPZA 5CHAB 3SGAE 1BMFD 3A7YA 4BOHA 1UHBA 1S81A 1O3FA 3GCNA 1L2EA 1OHHD 1OYQA 2C93B 1FIZA 2CN0H 3ZZ4A 5SGAE 3M5MA 1IQFA 2PKSB 1TBRH 4WMFA 2H5CA 2BDYA 4B74A 2JH0D 3S69A 4DG4A 4I31A 2BY5X 1GI5A 3UQVA 2KAIA 1O2OA 3TU7H 5EG4A 4NA7A 1QRZA 1C1MA 3H7TA 4B6FA 5DKMA 5JBAS 2K8IA 1SGCA 1TIOA 3ZVCA 1J8AA 5L2ZH 5A8YA 5EXLA 1ELBA 1K1NA 3UWJH 2QIQA 5A0AE 3QGNB 1GBAA 3MU1A 2ZCLP 3E8LA 5C5OA 3P8GA 4AC9A 7KMEH 2A32A 1V2MT 1M9UA 2YNAA 4ESTE 4ZXXH 2OBOA 1NS3A 2J5UA 1C2KA 1PPHE 1NN6A 5T1VA 1C1UH 2F3CE 3T26A 4ISNA 4BAMB 1FAXA 1DSTA 3BG8A 3QZRA 3A8DA 5LPRA 4NFFA 5JBTA 1MAYA 2AGGX 2BMGB 1V2OT 7GCHG 1O3PB 1HAPH 1AVWA 4K5ZA 1GGDC 2XCFA 5GPIB 1C5TA 3HGPA 4XDEA 2BDGA 1B0EA 1HBTH 1GDQA 1UTJA 1FI8A 4R0IA 1OP2A 4MNYA 1P03A 3P92A 3FP6E 1IQIA 5GCHF 2ZGJA 3M36A 4Y11E 1C5PA 3MH5A 1BUIA 2CHAC 2Z9LA 1VCPA 3QUMP 2DE8A 5IK2D 5EJLA 3ZYEA 1HAXB 2ZFRH 1O30A 2KZ4A 5F8ZA 4K8BA 2OXSA 1CU1A 6GCHF 1UW7A 3PWCA 3TPIZ 2KX4A 1ELFA 1MCTA 2FTLE 1GBDA 2ZDMA 1C2HA 2XWBI 2WPHS 1S0QA 4AYYB 3EAJA 2VWOA 2BD8A 3MO9A 1PQ8A 2FMJA 1C4V2 4DIIH 2UUJB 5A09A 2BD5A 1EPTB 2C8ZB 4UFGH 5F53A 1CBWB 2ZZUH 3M35A 2IJD1 2SNWA 3RLWH 4Q2KA 2O8MA 3SI4H 3RC6A 1EAXA 3SNCA 3EQ0H 2Z6BD 2AMQA 5B6LA 1ETRH 1ELVA 1QY6A 1S83A 4PROA 3OX7U 1GBTA 4CRBA 2F9PA 2KM0A 1GBFA 1GVLA 3A8AA 3PTNA 2BTCE 1NRSH 1W7XH 1MCVA 3UNQA 1A0JA 1AQ7A 1GI9B 2PTCE 3TH3H 2BY7X 2ZGCA 4IGDA 2ZQ1A 2STAE 1J15A 1J14A 1E1QD 1TPPA 5LH8A 2KCPA 1G2LA 1AD8H 3SOSA 1O3JA 1PYTC 4MG3A 1K22H 3LONA 3TH2H 1SQTA 1YCPM 1UTMA 1P09A 2P95A 3K2UA 4DCDA 1HIAB 2ZTZA 1EATA 1OWKA 2A31A 2WPKS 4NA8A 1MU8B 4MPWA 1KXBA 1MD8A 8KME2 1SGIB 1TAWA 1QL8A 1HNEE 2NU2E 3KF2A 5DP8A 1G32B 2W26A 3KQDA 1OWIA 3MO6A 2PUQH 4H6SB 1EB1H 2YMSC 3V7TA 2HWLB 2VWMA 3R3GB 1QRXA 2JH6D 1J17T 1S6LA 4OS6A 3AVZA 5EW1H 1G9IE 2Y5FA 3TVJB 2W7SA 5C1UA 1RGQA 3SJKA 4E7NA 2G52A 1WTGH 1AFQC 2G8TA 1H1BA 2G55A 2TPIZ 5G4BA 4BXSA 1XUHA 3SW2B 1NC6A 4CRDA 1P11E 1V2PT 3P6ZB 5I25A 2H9EH 3S0NA 2ZNKH 2QY0B 2ZPQA 2GP9B 5C2ZA 3RUOA 3QTOH 2F9UA 2FS9A 3UOUA 4NZLA 4KELA 1C1RA 4X8VH 3A80A 6LPRA 1GJDB 1C9PA 2FM2A 1EXFA 4AORA 1NPMA 1HAZB 2BDAA 4WH8A 1VCQA 1AB9C 2IN2A 4ZAEA 1ZGVA 2C3SA 1O3DA 1TBZH 1MH0A 1DE7H 5HKKD 1C1PA 3PO1C 2H1UA 2FLBH 5CHAC 2IPHA 1KDQA 3M37A 4MNWA 1QZ8A 3ELAH 5ESTE 1O35A 1NT1A 1BQYA 1S82A 2A5KA 5GDSH 3CS0A 5FHTA 3A82A 3U98H 1UO6A 3GCHB 1K28D 2AH4X 4HGCA 2XBVA 2RDEA 3GYLB 2PKSC 3F2FA 3BIVH 2XC5A 1EP6A 2GGVB 4MVNA 3SU2A 5HIZA 3SGQE 1DS2E 5GNDA 3TIUA 1DFPA 3ZZAA 4ZROA 3UIRA 5EU8A 3D49H 4YLUA 2SGQE 3TJNA 2V35A 3UR6A 1COWD 2Z7FE 3A81A 1A2CH 2PWXA 2FIRH 3RXLA 4RKOB 1VGCB 2A4RA 2IOTA 1N8OB 2PP6A 2Z3CA 1LKBA 1OP8A 2CF9H 1JWTA 4I8LA 1GBCA 3URCA 2ZKSA 4FETA 1XUJA 1O38A 5DSFA 4B75A 1LTOA 3NZIA 4B6EA 2FYQA 1O32A 3OTPA 2LELA 5EQRA 2Z9KA 1UCYK 1H8ED 2F43B 4NSVA 3SV2H 4Q80A 3NPSA 3PLPA 3LGUA 3HKIB 2ALVA 2A0QB 4J2YB 3LH1A 1EJAA 1GJ7B 2QXIA 4HFPB 1YCPK 1AFEH 4BAOB 1F0UA 1O2WA 2XBWA 1FY4A 1TRNA 4WVPE 3PMJA 1TGSZ 1TNHA 5LPEA 1LVMA 3C1KA 2TGDA 1MQ5A 4GVUA 4Y0YE 2QGRA 1D6WA 4F49A 3BSQA 5DG6A 1MKXK 2EY4C 1CHOF 1V2JT 3AW1A 1O3MA 1TX7A 3F2HA 3RXSA 5EGMA 2P94A 2FI4E 1KXFA 1O3EA 1O5CB 1N1LA 1YPMH 5A8XA 2XWAA 2G5VA 3GISB 3SU0A 1C5WB 1TNGA 1BTHH 2ZGBH 1BBRH 1YY3A 1W12U 2ZIQH 3VGCB 5K0HA 3AASA 3F9EA 1NY22 2HVXA 3KQBA 5AHGH 1O5EH 2BLWA 2F83A 4CRGA 1GMHG 5JB8S 1QQ4A 1K1OA 1Q3XA 5HM2A 1Y3WA 3LOXA 3TK5A 3TNSA 1BTPA 4J1YA 1O3IA 2P3UB 1NU7B 2QE7D 3GYMA 1EPTC 3Q3XA 3SYJA 1KLTA 1L1JA 4RT0A 1CBWC 1DVAH 1GI0A 5EW2H 1C5QA 1WQVH 1TWXB 1E38B 4DT7B 5C20A 3DSOA 3BEFB 2DUCA 2WPIS 1GI2A 1FPHH 1YPGH 3RXBA 1OKXA 3E6PH 2FDAA 1BZXE 1B7XB 1SGEE 2UUKB 1GG6B 1HRTH 4CRCA 1BTXA 1YKTA 2A45B 1EAUA 3LGVA 4NGAH 3W1EA 3S9BA 1SFIA 5HYOA 3SJOA 1CVWH 1ZSJA 2ZO3H 1HJ9A 3RLYH 3WW7A 1OOKB 3A7ZA 3A84A 3ZZBA 4KTSA 1WTHD 3SV7A 3VG8A 3QO6A 2B9LA 1D3TB 1P05A 3MQKC 4M9FA 1UK2A 4UDWH 1YF4A 1KMHB 2ODQA 1K1PA 3DHKH 1BJVA 1GJCB 4YO9A 1Z8RA 3SORA 2WZQA 4D76A 4D7GA 3BF6H 1W0ZU 3PRDA 1ZTKA 4INHA 1BIOA 4I8HA 4YZUA 2J94A 2P3FH 1GBKA 5A8ZA 2V3MA 1NRPH 2GCHF 3Q77A 2BX3A 5DGJA 5HGGA 1NRRH 1PFXC 1EQ9A 1IQMA 1D4PB 2F9OA 4AFZA 4QT8C 1SLUB 1YPEH 2VNTA 2A2XH 4OGYA 1XMNB 2XNDD 3RXHA 4IMZA 2R2MB 3ITIA 3BEIB 1QJ6B 3ZZ3A 1UCYE 3WY8A 4IN1A 1O3GA 1PPFE 4NIXA 4WY3A 1V6DA 2A7JA 1MKWK 1P2QA 2WINI 1D3PB 1EZUC 1H8IH 2ZFPH 2A5IA 3UFAA 4MDSA 3LKWA 3H7OA 3BTKE 2FOEA 4UFEH 3MFJA 1SL3A 1ZMJA 2Y5HA 1C5UA 1UTPA 5BRRE 5CDFE 3L6PA 2EI6A 1G3EA 1V2ST 4Y71A 4I8GA 2Z9JA 5C94A 3KYFA 3GDUA 1MTNB 3UPEA 2TGAA 1E79D 1F5LA 1GBLA 6CHAB 1F7ZA 5E2OA 2Y7XA 3OE7D 1FPCH 4B2AA 1P57B 4RI0A 3SBKA 4YT6H 4P02A 5JBBS 1RJXB 4INKA 1GBMA 4K3JA 3UQOA 1E34B 2R3UA 2VVCA 3GOVB 1ORFA 1TOCB 2G81E 4GSOA 4K2YA 3K65B 1EASA 1SQAA 3GCHC 4UD9H 2Z94A 1ETSH 2Q1JA 2CK3D 1OS8A 4NIWA 1UTLM 2NU1E 1GJ9B 1O3LA 3SV9A 1Z1IA 1KLIH 3BTWE 3NK8A 3ZV9A 2B8OH 3UAIC 1W2KH 2HLCA 2W6JD 3PLKA 2F9VA 2ZU3A 3EA8A 4M7GA 2FXRA 1HCGA 4OS2A 2ZA5A 1WAYB 1VITF 4DT4A 2RG3A 2Q6FA 4RSPA 5DP4A 3RDZA 1GI7B 2FX6A 3TLOA 3RU4D 1FY3A 3L33A 2H9TH 1LPKB 3H09A 1VGCC 2FS8A 2G00A 1N8OC 4GAWA 2SNVA 1GMDF 2WHXA 1HJ8A 3LJOA
chains in the Genus database with same CATH topology
1H4WA 2VWLA 4KTCA 2HOBA 2FO9A 1DUAA 3M3TA 1AMHA 2ZGHA 1A5GH 1EZXC 1T32A 1EOJA 1A46H 1V2WT 1C5OH 1QB1A 3FAOA 3TJVA 1TMBH 1OSSA 4OS4A 3RMLH 1CT2E 2HNTE 1AWHB 1MD7A 1NTPA 3PLBA 4NA9H 1CT4E 3S9CA 3GDSA 3OYPA 3AAUA 1AU8A 3B8JA 1ZLRA 1P9UA 3MU5A 4YLQH 1O5FH 2BDCA 4ABIA 3GCOA 1XUFA 1PPCE 4BAQB 9LPRA 1RRKA 1QRWA 2RDLA 2C4FH 1NFXA 1T8OA 5FAHA 1MBMA 1XM1A 1XX9A 3QK1A 3VB4A 1RS0A 1A1RA 4B71A 4RKJB 1FN6A 3SO3A 1DITH 4CHAB 5C5NA 2R3YA 1GHZA 3U69H 2FOAA 3F9FA 1ESBA 1D3QB 2HPPH 2ZTXA 2OTVA 1BTZA 1YPLH 1DANH 2VB0A 1SG8B 3MHWU 1GBJA 3VGCC 1F5KU 2EI7A 4CRAA 1SPJA 5FCRA 3UREA 2XXLA 4FVBA 4IC6A 1NFYA 3DD2H 1P2IA 2Q6DA 4ZKSU 4BTIB 2ODPA 4MPUA 4MQAA 3MU0A 3D65E 4XOJA 4TPYA 4YT7H 1JIMA 2GTBA 2A7CA 1L4DA 1Y8TA 1T31A 1Y5AT 4OS1A 4X6MA 4FXGH 4NSYA 4F4OC 4A1XA 2OQUA 4Z6AH 1EB2A 3MNCA 4TWWA 4WF8A 3RMMH 1GG6C 1QA0A 3QX5H 5DP7A 3F9GA 5E0JA 1C5MD 2QN5T 4HI3A 1ELDE 3SU5A 1ZHRA 1A3EH 1VITH 3PMAB 2J9NA 2ALPA 1W13U 4JYUH 1L0ZA 4NIVA 4A5TS 1JRTA 3BV9B 5E0GA 2XTTB 1NM6A 2ANWA 1GBEA 1LHFH 1MTWA 2CV3A 2BVRH 4JCNA 3BG4B 4X6NA 3ATIA 4K8YA 4ABBA 4FUGA 3KQEA 2OC8A 1O3OA 1ABJH 3STJA 1C2MA 5AF9H 1FLEE 1P2NA 3FZZA 7GCHF 3ESTA 6GCHG 1FJSA 3RXEA 5HMAA 1O2ZA 1OYTH 1PPBH 2B0FA 3ENSB 1GL0E 3M7QA 2OC7A 4B73A 3D62A 2GT8A 2A4OA 2VJ1A 3EDXB 2VIPA 2XBYA 2QA9E 1ID5H 1C2EA 3VFEA 2ZU4A 1W11U 1AN1E 4ZHAA 1KXAA 3RXVA 1ZMNA 1P8VC 4Y6DA 1O5GH 4ZMAH 1S5SA 2Q6GA 1CA8B 2ZDVH 1ELGA 3KQCA 3PM3A 3MYWA 2Y82A 1MTNC 1BRBE 4Y8ZA 2PUXB 1GJBB 1ZRKA 6CHAC 2Y5GA 1LHDH 4GUXA 1HAHH 1IHSH 4Y7BA 3SU3A 1Y3UA 1O2KA 4A1TA 3M3VA 4IW4E 2C8WB 1E0FD 2UWLA 2J38A 4GHTA 3T25A 1TOMH 3M61U 1LPGB 1ZSKA 3ZVAA 2AFQB 2GVFA 2ZDLA 2I6SA 5EQQA 2PKAB 4SGAE 4UFFH 3RXOA 5TCCA 1SQOA 4AX9H 4H6TA 1LCYA 8GCHF 4DVAU 4ABDA 3SU4A 2TBSA 3R0FA 1P04A 1TGNA 3AAVA 5JYIA 1G3CA 5DK1A 4YOGA 1QR3E 5JBCS 2WPJS 3OY6U 1LHCH 1O2QA 4X2YA 1UTOA 1YPHC 2SGPE 5HM9A 3RM0H 3VB5A 2BY6X 3TGJE 3KN2A 2FOMB 1TMUH 3S7KB 3OSYA 8LPRA 1SOZA 2BYAX 4HZHA 3UR9A 1PJPA 4U01A 1TNKA 1TRMA 3U8RH 2BLVA 3LU9B 2FLRH 3SHCH 2GX4A 4KTUA 1JXPA 2AMPA 1ZJKA 2OUAA 1CGJE 1C2DA 2ZPSA 3UOPA 3RXMA 1GJ5H 2O9QA 2R9PA 4INLA 1BMAA 1H9HE 3LJJA 2GV7A 1O37A 2QXHA 1RIWB 1SGNE 1YBWA 1U6QA 3RXRA 1NZQH 1IQHA 4GHQA 3AW0A 2ULLA 3LGTA 1D6RA 7ESTE 2TRMA 3KHVA 1GHAG 3SHAH 4A1VA 1GJAB 4O9VA 1GI8B 4XBDA 1QL7A 3BTQE 4KKDA 1YYY1 3K6ZA 3ZZ6A 3LH3A 4CHAC 1S84A 1P3EA 1NRNH 1O0DH 2BHGA 2AEIH 3IG6B 2ZCHP 3TH4H 3P17H 3SN8A 5FPSA 2R2WU 4JZ1A 1G36A 1O39A 1HAVB 1V2LT 4K1EA 2D26C 4ISHH 4HTCH 1Z8IB 3B23B 1YC0A 2ZC9H 2PGQB 1IAUA 1O3CA 5K7RA 3U9AH 1ANEA 3FVFB 5HXFA 1EP5A 1SGQE 2BQWB 1O31A 2A1DB 3QLPH 1T4VH 3ZZDA 3Q76A 2ZFFH 8ESTE 2VGCB 4BANB 1PPEE 5L30H 4AN7A 3RXCA 2XCNA 1TYNA 1O36A 2NU0E 1GVZA 4B2BA 3I29A 3GICB 2B5TB 1SGDE 1EPTA 3KNXA 4ISIH 3TK6A 4DIHH 1GDNA 4FUIA 1P2MA 2ZHFH 2BQ6B 3VB3A 1XUKA 3DFJA 1OWJA 3SV8A 3F68H 1ANBA 1B5GH 3LT3A 1TB6H 4D8NA 4XBCA 1LO6A 1SOTA 2NU3E 2BY9X 1AKSB 4FUCA 3A7XA 1LVBA 1HV7A 3ATKA 1TPSA 2F9BH 2UWPA 4ASHA 3SUGA 4TWYA 2OC1A 5CMXH 1T8MA 3O8BA 1KTSB 2ZFTA 1GHBF 3ZVDA 2AYWA 1ANCA 2VU8E 1GL1A 2WV4A 3U8TH 1ACBE 3BG4C 1MQ6A 3EE0B 1JOUB 1K9OE 2FX4A 2ZWLH 1K21H 2WPLS 4XBBA 3LC3A 3QDZB 1ELCA 1GMCF 2O8UA 3A83A 1T4UH 1EZQA 1YPJH 2ZDKA 2ASUB 4BAHB 2QV1A 1SGPE 1FZZA 2BDHA 4ISOA 1DWCH 1HIAA 4JZEH 1V3XA 2IJOB 1XUIA 3SJ8A 1P01A 2PW8H 1ARCA 2OD3B 2Z9IA 3A86A 4NFEA 2ODYB 1UTKA 4YOIA 1DXWA 2GCTB 3ZZ7A 1SGYE 3MMGA 1MTSA 1MUEB 1TQ0B 1MTVA 3N7OA 3SJ9A 4JYTA 3SUEA 5EPNA 1KTTB 3RXPA 1CO7E 1FUJA 3T5FH 2O8TA 2H5DA 4WXVA 4AGJA 1ZSLA 2FOBA 1P02A 1Q2WA 1JIRA 4TYDA 3T27A 3A89A 4RN6A 3QWCH 3SNAA 2A7HA 2J95A 4VGCB 1GHWH 2C8YB 4H4FA 2ZF0H 1UVUH 2HGTH 1UMAH 4XSKU 1JBUH 1ZYOA 3V12A 3ZVEA 1SFQB 4BTUB 4DURA 3MTYA 3NCLA 2FTMA 3P8OA 1HLTH 3P70B 2BVXH 3O8RA 1LQDB 3ZYDA 1DM4B 1C5SA 2XRCA 1QNJA 3ZVGA 3OTJE 1D9IA 5TCAA 1AUTC 1KXDA 1O2RA 4FU9A 4AB9A 3VEQB 2ZU1A 3BN9A 3I78A 1W0YH 2ANKH 1TNLA 2W7UA 1V2UT 2VH6A 4GCHG 5EODA 1YM0A 4K1SA 4JZFH 1O5DH 1O3AA 2OBQA 3MO3A 1BBRK 5A0CA 2GCHG 2H6MA 4I7YH 2BB4A 2F91A 3SU1A 1GHYH 1O5BB 1E35B 1V2VT 2FPZA 2FOCA 1C2GA 4WMEA 4D9QA 2W3IA 3MNBA 3QN7A 3VB7A 1C1OA 1IQLA 3OY5U 1TPOA 2XNIA 5TJXA 1O2NA 4Y79A 1XXDA 4UEHH 5L6NH 1OXGA 1QA7A 1AE5A 3F1SB 2A2QH 4X1PU 1UVOA 4IBLH 3ATMA 4BXWA 1UHBB 5FCKA 1SGRE 4AG2A 1LVOA 5C67A 2C8XB 4CBOA 1GWAA 4Q7YA 1AI8H 1UVTH 1ELAA 1THPB 1FAKH 1KXCA 1O2HA 1T7CA 2PLXA 1H9IE 2FESH 1O5AB 3TJUA 1GCDA 1YP9A 1RIWC 5T6DA 1O2PA 4ZUHA 1DUEA 2KAIB 1TRYA 4X1NU 1Q31A 4DGJA 1RXPA 3KEEA 1BT7A 2OLGA 3GY7A 3KL6A 2EI8A 2XYAA 4E06H 2QCYA 3SJIA 1THSH 1BRCE 1T8NA 1Z1JA 2FOHA 3MH6A 1A4WH 4A92A 5A2MH 3TGIE 1WUNH 1F0SA 2OC0A 3RXQA 3RC5A 4UE7H 1G3DA 1P9SA 2BOHB 4AG1A 3DA9B 3M5LA 1IOEA 1Y3YA 5F03A 2J34A 3A7VA 2M5TA 1AZ8A 2WUCA 1DX5M 4DW2U 1FDPA 1DWEH 3K6YA 2FOFA 4OS5A 4JK6A 4JMYA 3V0XA 3UWIA 9ESTA 2GT7A 4X1RU 1O34A 2CJIA 3PV4A 2OINA 2BY8X 3EA9A 2BD2A 2R0KA 2VIOA 3GCTF 2ZHQH 1BCUH 3H5CB 4B76A 3HK6B 1TBQH 1TNJA 1NFUA 4FUEA 3T2NA 2VGCC 2WV5A 1EJMA 1ZHPA 2SGDE 1BTYA 1O2JA 3QTVH 2BVSH 1GMDG 1TFXA 3EGKH 1P2JA 3RXFA 1LKAA 1AGJA 2ZQ2A 3BEUA 4WH6A 4K1TA 4ABHA 4ISLA 3RXAA 4JZDH 3MWIU 1F92A 4ZKOU 1BB0B 2VWNA 1BHXF 1XKAC 2VINA 2ZHWH 2RA3A 1QL9A 2Z3EA 2CGAA 1O3BA 1G37A 2G51A 3W95A 1JRSA 1VJ9U 2WYJA 2J92A 4TY7A 2ZHEH 1C1TA 1THRH 1D3DB 2PGBB 2NU4E 1AVXA 2BDBA 2ZFQH 3FP8E 1SHYA 1QCPA 3LPRA 4ZHMU 3E90B 3EYDA 4Y10E 2SGAA 1BMMH 1BBRE 1W3CA 2K1QA 3LGIA 1A7SA 1UVPA 3SUDA 1BJUA 4AOQA 4CH2B 3RM2H 3KIDU 4SGBE 3DT0H 3M3SA 1DY9A 5C1XA 4GLYA 1AIXH 1MTUA 2P59A 4WWYA 2D2DA 3E16B 2JETB 1XVOA 1ANDA 3I77A 2GCTC 3U1IB 2PSYA 2FODA 1FV9A 2AS9A 1P10A 4I33A 4IS5A 4U2WA 4X0WU 5IYTA 2PHBA 2P8OB 1GI3A 1X7AC 2GZ8A 2Y6TA 3LDXH 3MI4A 1NESE 1PQAA 1WOFA 3MNSA 1A3BH 4ZHLU 4Y8XA 1PPGE 3MH4A 1HGTH 1NRQH 1S85A 5FX5A 4VGCC 3Q3KA 1IQJA 1BA8B 1FIWA 2ZPRA 3JZ1B 2SFAA 3A7TA 5T3HA 2XC4A 5PTPA 2GMTB 1CE5A 5B6OA 1K1MA 1DLEA 4AFQA 4X2XA 1S6FA 1KLJH 1ZPCA 1A5IA 1FMGA 4D9RA 5FBIA 4X6PA 1GVKB 2ZHDA 1K1LA 3SQHE 3VXFH 3VXEH 1K1JA 3ODFA 3A87A 3C27B 4B1TA 1UK4A 1C4Y2 2BZ6H 2TGTA 7LPRA 1S6HA 1BHXB 1VCWA 1C5LH 1EKBB 1K2I1 1SGFG 3E0PB 4X2VA 5GCHG 1P0SH 3GY2A 1VR1H 2BQ7B 3G01A 1CA0B 4AFUA 1LHGH 3ZZ8A 1O2GH 2Y7ZA 4DY7B 4DOQA 2FWWA 4OGXA 1O2IA 1HAOH 3RP2A 2ANMH 1GJ4H 3ODDA 5JPMH 1NROH 2FI5E 2OP9A 3KCGH 2GKVE 1HUTH 1YGCH 1MBQA 1GJ8B 1C5YB 2J2UA 1MAXA 4I8JA 3UY9A 3DUXH 5LPFA 1KDQB 3SQEE 1DWDH 3V13A 2Y81A 1XVMA 1XXFA 1ABIH 2VIDA 2VH0A 1ZTLA 1HAYB 2BD7A 2YNBA 1Y5BT 1W14U 2GV6A 4MLFB 4I8KA 4FVDA 4LXBH 3STIA 2Z3DA 2QF3A 1TGCA 3L3TA 2LNCA 4NWLA 3LIWA 3A8BA 1ZR0A 3RU4T 5BPEA 1C1SA 1FONA 4KP0A 4FUBA 3GDVA 1BDAA 1PQ7A 2A4GA 3ATWA 1V2RT 3CENA 3KGPA 3MH7A 2F9NA 3JZ2B 2WPMS 3A88A 1LQEA 4U30A 3MU4A 1INCA 1L1GA 1F2SE 2H9HA 4Q7XA 2BX4A 1FY1A 1WBGB 2CXVA 2RCEA 2VIWA 4ABGA 1O2LA 1QGFA 5EOKA 4X2WA 2FOGA 3PMHB 1GCTB 3ZZ9A 2QYIA 2R0LA 1EAWA 4O3TA 3A7WA 4Z0KA 4NCYA 2BM2A 1HPGA 1DWBH 1QBVH 3RXUA 3SUFA 2H2ZA 1AUJA 5LGOA 5I46H 1RTKA 1A5HA 2PFEA 3FFGA 2V3OH 3HPTB 1MZAA 1YPHE 2BXTH 8GCHG 1SR5C 3NXPA 1FN8A 4K69A 1LPZB 2Y80A 2FP7B 1CSOE 3TK9A 3PROA 3E91A 1H9LB 3K9XB 1HAGE 2AGEX 1B0FA 1C1QA 3IITA 1ELEE 1UTQA 5JDUB 4Y8YA 2A5AA 4DJZB 1WQSA 1P2OA 2QC2A 2J4IA 1PQ5A 2GD4B 2QF0A 3BIUH 4XE4A 2EC9H 1C2IA 4XFQA 5JB9S 1TALA 1AO5A 5DP9A 4CR9A 5ABWA 4ABAA 1RD3B 3F6UH 1QHRB 4E7RG 1NU9A 4A7IB 4YESB 3ZVFA 1CT0E 2VVVA 3E0NB 1QURH 4Y7AA 4E05H 5EPYA 4ZKNU 4CREA 1A0LA 4JZIA 1DLKB 1ZPZA 2BD4A 2ZTYA 3CP7A 3RXJA 4IN2A 2VVUA 4MTBA 3EA7A 2BD9A 1CGIE 1TNIA 5GIBA 2QXGA 1LMWB 3GY5A 1E37B 1SMFE 3ZZCA 3RXGA 1GBBA 2HNTF 3GY6A 2FEQH 1IHTH 2GDEH 2ZCKP 4WJG2 4YOJA 3P95A 5F6MA 3T29A 1V2NT 2XW9A 4FUDA 5DO4H 2STBE 1DOJA 1Y3XA 2P16A 1EJNA 1Z71A 3A85A 3E3TA 3W94A 4ABJA 4LK4A 1TABE 5FBEA 2JETC 1ESAA 1F0TA 2CMYA 1C5NH 1TONA 1O2XA 1A61H 1UCYH 1O2SA 4K60A 1F5RA 3A8CA 3SI3H 2HALA 1UTNA 4JYVH 2BLQA 3E1XB 2P8OC 4IC5A 1GHAF 1L1NA 4ZXYH 1QTFA 1SBWA 1TGTA 1YCPH 1FXYA 1ESTA 1O2TA 2G5NA 1O2MA 3GY8A 3P8FA 4OS7A 1TPAE 2G4UA 3BTTE 2ZG0H 4U32A 3RXKA 1WSSH 3DFLA 1BRAA 3RMOH 1WCZA 1P06A 4GPGA