1O3LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA02
8KME2 3P6ZB 2QAAA 3V3MA 2K1QA 1MU6B 2R9PA 3RXFA 1A4WH 2BM2A 1YPEH 1V2JT 3VXEH 4K8YA 1BQYA 1FAKH 1V2WT 1Z7KA 4FVDA 2HPQH 1O30A 2NU2E 1EAWA 1XUGA 1IQFA 1ESTA 1AD8H 2WPJS 1GHYH 1O3MA 1ZHMA 3QTOH 1IAUA 2R3UA 3SGQE 2ANWA 3ZZAA 4B75A 5E0JA 3U8TH 2FDAA 3A88A 2C8XB 4I8LA 5C1UA 2KAIA 1WU1A 1BRBE 1EPTB 2C8ZB 1RTFB 1GHAG 3SN8A 4K69A 1MTNC 4INLA 5LPEA 1S81A 2FIRH 3KQDA 3A83A 1NY22 3BTGE 3UFAA 4Q7YA 1F0UA 5HXFA 1GPZA 3M7UA 1C1RA 1EASA 1O2MA 1GBLA 2GMTC 2F9PA 3AW0A 3MH4A 2WV4A 1PPEE 2FS9A 5L2YH 2PUQH 1DLEA 4UFFH 1K2I1 1D6WA 4CREA 3TVJB 4MPVA 4NIWA 1ZZZA 1YPMH 4K60A 1NESE 1MKWH 1HLTH 3PROA 1V2NT 3KIDU 1LHCH 3T28A 1E0FD 1KXAA 3FVFB 1TMBH 1O5CB 2PR3A 1KLJH 1P2KA 1MTNB 1TRYA 3V0XA 4XOJA 3B9FH 3CS7A 4FUHA 1KSNA 4WWYA 3MOCA 1F2SE 2ZFFH 1EUFA 1ELTA 2OXSA 1OWHA 2NU4E 2IOTA 3S0NA 4IMZA 2GMTB 2HNTC 3K2UA 2P3UB 1X7AC 4H42U 2P3TB 1PPZA 1INCA 4K8BA 1CT2E 2ZU2A 1D3PB 2Y7XA 1Z8IB 4NIXA 4J1YA 2XCFA 1PQ7A 1HXFH 2OC7A 2TGDA 4JK6A 2G00A 2W3KA 3VGCC 1P02A 1H4WA 1HAOH 1W12U 1O3OA 2BDCA 4UONA 3BEUA 3GYMA 1BTWA 3CENA 3RXQA 1YYY1 2BX3A 3LGUA 4CH2B 5H4IB 1GHAF 3SOSA 3W95A 2DUCA 4NIVA 1MD8A 2BXTH 5PTPA 1TPPA 1WTGH 1Y5BT 4DGJA 4YT7H 2WPLS 3C27B 2F91A 4X6OA 4Y8XA 4RN6A 4QT8C 1SHYA 4WXIA 1O38A 3KQCA 1BOQA 1HAXB 1FAXA 1WAYB 3RU4T 3R3GB 4AX9H 2VB0A 3SU3A 1O3FA 4DT7B 3RDZA 1O3IA 3RXOA 2BDHA 3VGCB 3ZVCA 1CGJE 1K1JA 4H6TA 1BMMH 4YTAA 1AB9C 3LDXH 1GJ8B 1C1OA 1K1IA 4RKJB 3RXVA 1DS2E 4DVAU 3LJOA 1QNJA 2QN5T 2YNBA 1ZJKA 1UTJA 4R8TB 6CHAC 1TX8A 3MU1A 6GCHG 5GCHG 3STJA 2FI3E 1TGCA 4NWKA 1W14U 3R0FA 2ZG0H 2V35A 4YT6H 1ELVA 1G3EA 1VCPA 1DLKB 2W5EA 3SJIA 2JH6D 4GHQA 3SU4A 1P01A 3UNQA 3ZZ6A 2HWLB 2UWOA 2XC5A 2ZFTA 1SB1H 4GLYA 1C2KA 1EOLA 2BD2A 4GVUA 1GI8B 1S6FA 1D3DB 1HNEE 1O0DH 3A7WA 4UDWH 2IJOB 3QTVH 2CXVA 3RU4E 5AFZH 4FUIA 1AB9B 1XUFA 1LHEH 3QDZB 2B7DH 1C5YB 1Z8GA 1VZQH 3Q00A 1TRMA 2VVCA 3JZ2B 1O2GH 3SJOA 1IQEA 1G36A 2FWWA 3OTJE 5F8XA 2BOKA 6CHAB 1YC0A 4WY3A 1DDJA 3KNXA 1JBUH 2O9QA 2F9BH 2FLRH 2QA9E 1QJ6B 2A4QA 3LH1A 1T4VH 1ZRKA 2RCEA 3GY6A 4GCHG 1BTZA 3RXBA 4AFZA 2BQ7B 3QX5H 3ZZCA 1F5LA 1MD7A 1ANCA 2XBYA 1BJVA 1JOUB 3RXMA 3ZZ8A 1FXYA 4MNXA 1YPGH 4Y8YA 1JXPA 3ATMA 4JCNA 4U32A 2BTCE 2TIOA 4H4FA 5GXPA 2O8UA 1NFYA 3SV2H 2V3OH 3A7TA 2BDYA 2AYWA 1E37B 1SGTA 1O36A 4FUCA 1PQ8A 1E35B 1GI1A 1J8AA 1AKSB 1BT7A 1WOFA 1AUTC 1SOZA 1J17T 1EPTA 3A86A 1GI2A 1OWJA 1TGNA 1AGJA 3NUMA 3V12A 6GCHF 4YZUA 5FPTA 2RA0A 5J4SA 1GCTC 5FXLA 1QRWA 1W0YH 1UTQA 1SGQE 2AGEX 1OS8A 4JMYA 4YM9A 1NC6A 2ZGXH 4Q80A 1C1TA 1TRNA 3RXJA 2OQUA 1SG8B 4XDEA 2G4TA 1ZPZA 3A89A 4Y8ZA 1G2LA 1AZ8A 4ZHLU 4FU7A 5FX5A 1AO5A 4D9RA 1FIWA 1MTWA 5I46H 1CBWB 1NRQH 1KXCA 4CBOA 1G32B 3M5OA 3RMLH 4ZH8A 2J2UA 1GCTB 5ABWA 1IHSH 1QJ7B 4GCHF 4Z0KA 5F8TA 4I33A 4K1EA 1TBZH 3SU1A 3GDSA 4ISLA 2EI8A 1GI5A 2BZ6H 2R2WU 3HKIB 1MBQA 1RIWC 2J94A 4BNRA 8ESTE 4WXVA 3GCHC 1GJ5H 1XVOA 2UUJB 2D1JA 1KTSB 3SGAE 3EGKH 1Y59T 1PFXC 4FVBA 1HPGA 3EA8A 4LZ1H 3V13A 2VIVA 1O34A 5CE1A 3GCOA 2AMPA 3SV6A 1UTMA 1NRPH 2TBSA 1O5DH 3KF2A 3PLPA 1SSXA 2D8WA 3T26A 2A5IA 4X6MA 3QLPH 1FY4A 5DP7A 1Y3UA 1C5QA 3PMBB 1ELEE 1THSH 1HAZB 1EAXA 4DIIH 1C1QA 3VFEA 1O2UA 5L2ZH 1GMCF 4X2XA 2B8OH 3RMMH 5JPMH 5FBIA 1RIWB 4O3TA 1AE5A 1KXBA 1TA2A 5TJXA 1K1OA 1RJXB 2GD4B 2WPKS 3BTEE 4WH6A 2A5AA 3BTHE 2XTTB 4OS1A 3RXUA 3TGKE 4Y6DA 3BV9B 3GYLB 3TNSA 3UNRA 1ZGVA 1ZLRA 2V0BA 1IQKA 2LNCA 1Q3XA 1VJ9U 8LPRA 1YP9A 1MTSA 1H9LB 1SGIB 4A7IB 3U9AH 4NWLA 4OS2A 4B74A 1WUNH 2QCYA 3S9BA 2ZDLA 3EDXB 1BRAA 3BG8A 1P57B 1UVOA 1B5GH 1O2HA 3LKWA 1J16A 2STAE 4NSVA 1C5RA 3PMAB 1EOJA 2UUYA 2SGPE 2XXLA 4HFPB 3GDUA 3GOVB 3BTWE 2CN0H 4A1TA 1Q2WA 1TFXA 1GBJA 1SR5C 1MAXA 2NU0E 1SLWB 2QIQA 1P04A 4I8KA 2A7CA 2UUKB 2AH4X 1SLXB 3S9CA 2P94A 2J38A 5F8ZA 3KN2A 1SGRE 1AVGH 4UEHH 1H9IE 1FONA 2AFQB 1GBAA 3T25A 1B0EA 2O8TA 1H8IH 2ZEBA 4GHTA 1D9IA 3RMNH 4ZHMU 5HM9A 3SJ9A 1YPHE 1UJ1A 3NCLA 4D7GA 2A4RA 1GBIA 3QO6A 4JZIA 2ZU3A 3S7HB 1P2JA 3M61U 2A5KA 1O2RA 3Q76A 3F6UH 3F68H 2Y80A 5LPFA 2FTMA 1TGTA 1KIGH 3TJOA 5CHAC 3HK3B 1HXEH 2R2MB 1SHHB 2VIQA 1BJUA 3UWJH 2A4GA 4D9QA 3M37A 4UE7H 4X8UH 2B9LA 1TNIA 3IITA 1AI8H 1AKSA 1Z71A 5BPEA 2J9NA 1XUJA 2G4UA 2VWLA 1P2OA 2D2DA 2Y5GA 1IQMA 1O2QA 1RD3B 1LTOA 2GCTC 2TRMA 2VH0A 5ESTE 5GIBA 3P8OA 3L6PA 1DXWA 2THFB 2G5VA 4KTUA 1PPGE 2QY0B 3SQHE 5CHAB 5HM2A 5EQSA 4H6SB 1QBNA 3H5CB 2OUAA 1L1GA 4MDSA 4O3UA 1DWCH 5CMXH 4ISOA 1C2IA 1OP2A 1F0RA 1QR3E 1OPHB 2JH0D 2BD8A 2WPHS 1TWXB 1HAGE 1ZSKA 2FX6A 3E90B 2FI5E 1TYNA 1SGYE 5K7RA 4XBBA 1OWKA 2GCTB 1GI7B 2J4IA 1BCUH 1NRNH 2BQ6B 2F3CE 2SGAA 2Z9KA 2ZPRA 4TYDA 1O31A 4FUJA 4BXWA 1GHVH 1HAIH 5L30H 1QQ4A 4FXGH 3SUEA 1CT0E 4ABBA 2FI4E 2ZCLP 1DUAA 4R0IA 2EI6A 1NT1A 5F03A 2LPRA 3UNSA 4MNYA 4AB8A 2GP9B 2PKAA 2PV9B 3MMGA 1YF4A 2GZ7A 3RXPA 2ZKSA 3QUMP 4CBNA 4X8SH 4ESTE 7LPRA 5HMAA 2Y6TA 1LHFH 4ISHH 3A8AA 1K9OE 4NA8A 1BRCE 4A92A 3QZQA 5TCAA 3VEQB 2P59A 1SLUB 1KXEA 2UWLA 3GCTG 4FUDA 4RSPA 1TABE 4SGBE 1ZTJA 2QXJA 1N8OC 5DKMA 1W2KH 5FHTA 4BAHB 2XCNA 1DY9A 4FUGA 5EW1H 1PPBH 1PQAA 3EA7A 1UMAH 4FUEA 1LMWB 5HGGA 5EQQA 3QGJA 1LQDB 4THNH 4U01A 3A80A 3HPTB 3F9FA 1EP6A 1A3BH 1TX7A 2W3IA 1ZTKA 1HGTH 2QC2A 2XWAA 1UHBB 3GY4A 5T6DA 1OKXA 1SQOA 3AW1A 3KGPA 4CRGA 3C1KA 2GKVE 3RLYH 2FS8A 1G3CA 1L2EA 1THPB 1P2QA 3KCGH 1GVKB 3SO3A 3LC5A 1Z8RA 4MVNA 1O2XA 3ENSB 1NU7B 4HTCH 3SNBA 4F4OC 6LPRA 1N8OB 3VB3A 4Y7AA 3SQEE 1QCPA 2PUXB 1DANH 2BHGA 1QGFA 2EC9H 1FZZA 5EGMA 1S84A 2SGFE 1T32A 3RXHA 2DE9A 1VITH 3ZVFA 4B73A 5JB8S 3RM2H 2Z9LA 5B6OA 1T31A 1HB0B 1C5XB 1F5RA 1O2YA 1GI0A 1BA8B 1ZYOA 1C1WH 1D3QB 1EZQA 1V2QT 1DITH 1ZSJA 1KLTA 4B1TA 2OINA 2TGAA 3ATKA 1TMTH 2R3YA 4NFEA 2ZPQA 3QGNB 2BDAA 1Y5AT 1BHXB 2QXIA 2ZU4A 3I29A 3GY2A 1LKAA 1NRSH 4MG3A 1UTNA 1GJCB 3GCTF 2Z94A 5ESBA 2BZAA 2FOFA 4AG2A 5JYIA 2VWMA 2BB4A 3UR9A 4WMFA 2O8LA 1YLDA 3PWCA 1SC8U 2ZCHP 4UFDH 5DP4A 3RXRA 4NZQA 2WPMS 3RXKA 2ODYB 1WCZA 4M7GA 2BXUH 3H7OA 2EA3A 3ATLA 5F6MA 1GCDA 2ZNKH 3GY3A 1E34B 3A7ZA 4A5TS 3P8FA 3SV8A 1HJAC 1HRTH 2RG3A 1LPGB 3MH7A 2F9VA 1BITA 1O35A 3RXIA 2FTLE 2BVRH 2BD3A 4ISNA 3M3VA 1F0TA 4D76A 1OOKB 1EXFA 1Z8JB 3SU2A 1FPHH 1DM4B 1GJ7B 1DT2A 1QBVH 2AIQA 2ZDKA 2HPPH 3EQ0H 1P0SH 3TLOA 1UCYE 1IQNA 2SNVA 2ZWLH 5I25A 1HIAA 4YOIA 5AVDA 3DD2H 4OGXA 1P11E 1UCYK 2ANYA 1DFPA 4Y0YE 1OWEA 1FY1A 3LGWA 1SFIA 1P2MA 4CR5A 3ATWA 4BTTB 7ESTE 1U6QA 4IN2A 3SU0A 1EJNA 4TY6A 2ZFPH 1BMNH 4FU8A 4WH8A 5AF9H 4MLFB 3Q3KA 5E2OA 1AVWA 3NZIA 1V2LT 3PV4A 1GDQA 3SV7A 1HJAB 1A5IA 2BD7A 5AFYH 4ZAEA 4FU9A 1JWTA 2A2XH 2ZFRH 8GCHG 3O8CA 3HK6B 1E36B 2VJ1A 3RXCA 2BVXH 1S5SA 1QL7A 3EE0B 3U8OH 4JZFH 2PTNA 4D7FA 5DP5A 2ZHEH 3URCA 1GMHG 1MQ5A 2VVUA 1A5HA 1C5NH 2PTCE 1M9UA 5DP8A 1DE7H 1AUJA 4UFEH 1VGCC 2XYAA 4AYYB 2A45B 2BD5A 4TY7A 4MTBA 1BB0B 3DFJA 2BY7X 3BEFB 1G37A 3MNXA 2BLQA 1CU1A 1W13U 3P70B 1P2NA 1TPSA 5C5NA 3TH3H 4AORA 4NG9H 1C5UA 2DE8A 4X2WA 4X1SU 4AYVB 1OYQA 1ELCA 1CGHA 5GWZA 1N6XA 2FM2A 2C90B 2NU3E 2H9EH 3URDA 1BRUP 2VNTA 4VGCC 4DJZB 2H2ZA 3RLWH 1O3DA 2FOAA 4NFFA 4O9VA 3TK5A 2GV7A 1K28D 1V6DA 3VB6A 4BANB 3RXEA 1P05A 5EW2H 1VGCB 2ZGJA 3ZYDA 3BG4C 3HGPA 4D8NA 2VU8E 3SHAH 2FP7B 1S0QA 5FCKA 1C1VH 3ZZ4A 4B2CA 3T2NA 2B5TB 1YGCH 1QBOA 1UHBA 3TJVA 3TU7H 2VWNA 2PKSC 1IHTH 2Z9IA 2FOMB 1CHGA 3PM3A 1ZMLA 5DK1A 4XBCA 5EPNA 1FI8A 1AE8H 1FIZA 4X1NU 2EEKA 2FYRA 1LQEA 3U1IB 3M7TA 4Q7XA 5C1YA 3UTUH 1W7GH 3CP7A 1G30B 1AFEH 1OSSA 8GCHF 1O2OA 3F1SB 5GCHF 1HUTH 3QWCH 3PMJA 4KKDA 4LK4A 2BY9X 3M36A 5EXLA 1SGCA 4VGCB 1SGNE 3MU4A 1C4V2 1ARCA 1LKBA 1TONA 2G51A 3RC5A 3SHCH 5TCCA 3ZVAA 3LONA 5DO4H 3PMHB 4B76A 3MH5A 2OD3B 3GY7A 2WV5A 1V2ST 1S0RA 1VCQA 2ZP0H 4Q7ZA 1V3XA 1UTKA 3M7QA 1RTLA 4MPXA 1BBRE 3A8BA 4ABEA 3AAVA 4Y10E 3RC6A 3PO1C 2P95A 1BBRK 2A4OA 5EODA 5JBTA 3M5LA 5A0CA 2A31A 1OXGA 2PKSB 2A32A 2GV6A 1UTLM 1LVBA 5GJ4B 2ALVA 1O5EH 6ESTA 2Z3CA 4IC6A 1C1SA 2HNTE 1DXPA 3K6ZA 1WQVH 1O2KA 4XFQA 3ZYEA 4DURA 4CRDA 2YNAA 1A5GH 1O3PB 2Q6DA 2ZDNA 1C2FA 1HAPH 7KMEH 1A61H 4DCDA 1SGDE 1IQGA 2SGQE 4Y7BA 3MHWU 3MYWA 2PHBA 5A0AE 4AN7A 1L4DA 3H7TA 3D49H 5EG4A 1YKTA 3AAUA 1Z1IA 1D4PB 1SFQB 4NA7A 2PKAB 3PO1B 4AOQA 1PPHE 4ABFA 3F9GA 3ZVDA 1ELDE 1W3CA 4B2AA 1G3BA 2HNTF 4TWYA 4KELA 1P09A 4X1QU 3LGVA 4BTUB 1GHBG 3ZVEA 2NWNA 4J2YB 3BIVH 1J9CH 2QXGA 1CE5A 4ABHA 2FYQA 3I77A 4NIYA 1QY6A 1ZOMA 5LH8A 3UOUA 1C2LA 4UFGH 2SGDE 1CHOG 1TALA 2BYAX 4U30A 1AIXH 3GCHB 1O3LA 1O33A 2W7UA 9ESTA 1W7XH 3B8JA 3RXLA 1Y8TA 1UVTH 3ZZDA 3NXPA 3UQVA 5DGJA 4MQAA 2Y5FA 3SJKA 1GBBA 1NN6A 5A09A 4JZEH 3SW2B 3PLBA 2WUBA 1MH0A 1GBCA 3OYPA 4ZXYH 2AERH 4ZKNU 3RXTA 2FOGA 1TNHA 1RXPA 3VB7A 2G8TA 2ANMH 4BAMB 1MKWK 1LHDH 2RDLA 4CRCA 4AG1A 2ZIQH 4Y71A 1DWDH 2G55A 1LHGH 1OX1A 1TLDA 3TPIZ 1GBFA 1GDNA 3A81A 3BIUH 5C2ZA 1QRXA 1OYTH 1C2GA 1K22H 1IQHA 4Y0ZE 1FV9A 1HJ9A 3SNEA 1C5TA 1PYTC 1ELGA 2GDDA 1DY8A 1D3TB 4TPIZ 5A8XA 3NPSA 3ZZBA 2A2QH 1K21H 1JIRA 1GBDA 1O5BB 1MQ6A 4HGCA 1HAVB 4KTCA 1O2TA 4AFQA 3T27A 5E0GA 1GDUA 2CMYA 1ORFA 3A82A 1GJ4H 5FBEA 1Y3WA 1CQQA 1CHOF 3CS0A 3MO9A 2BD9A 1ZGIA 3MNCA 4HI3A 2BDIA 3LGYA 5G4BA 2VH6A 2UUFB 4E7RG 4IMQA 3WY8A 4BAOB 3U1JB 2VWOA 2XBXA 3O8DA 1UK4A 1ZHRA 1NM6A 2FEQH 2C3SA 5E2PA 2AS9A 1XM1A 2ASUB 1A0HB 2WYGA 1GI6A 2ZDAH 1O3NA 4U2WA 5EU8A 1L4ZA 3E91A 3OU0A 1AWHB 2Z9JA 1MKXH 1GHXH 5T6FA 1O2WA 1OP0A 1UVUH 1KLIH 5L6NH 5SGAE 1EZUC 1EP5A 1AY6H 1MMJN 1A3EH 2JETC 3MH6A 1C1NA 1FNIA 4JYVH 3NK8A 1ABIH 1HIAB 5GDSH 3UIRA 4GUXA 1AQ7A 5FAHA 4XE4A 1K1PA 3GDVA 4YO9A 2AIPA 1O2PA 2ZTXA 1BDAA 2ZC9H 1BTPA 1CT4E 3GY5A 1C5OH 5JBAS 1HAYB 2GDEH 3D65E 2ZF0H 3FP7E 5FPYA 4ZUHA 2OTVA 1SGFA 1EQ9A 3IG6B 1IQLA 1W11U 1GBKA 2CHAC 1C2EA 1MU8B 1A0LA 3P17H 4AGKA 3BN9A 1Z1JA 1GL1A 7GCHG 3K65B 1S85A 3ZZ7A 2JETB 1GBTA 1UK2A 2PGQB 2HRVA 2HGTH 3UWIA 1P10A 2G5NA 1BTUA 2J95A 2I6SA 5FX6A 4PROA 3A8CA 4CRBA 1UO6A 2B0FA 1KXFA 2AGGX 1TX6A 3Q3XA 2BX4A 2FOHA 2VIPA 1GJAB 5E0HA 3RM0H 1P12E 3BTFE 1O3KA 1NFXA 4X8TH 2OP9A 1GJBB 1QFKH 3TK6A 3A7XA 1BMAA 1YCPM 1GGDC 4OS6A 1O5AB 5LPRA 2BLOA 3KL6A 2TGPZ 1MTUA 3PYHA 3TJUA 1QURH 1C4U2 2VVVA 2M5TA 1ANEA 3UREA 1JMOH 4ZKOU 1NROH 1O3BA 1RFNA 2BDBA 2GZ9A 1AN1E 3M5NA 1O2NA 1XKAC 5IYTA 3E16B 1GJDB 1TQ0B 1ESBA 4ZMAH 4GAWA 1WTHD 2H6MA 2HVXA 4DY7B 5DG6A 2Q6GA 1F7ZA 4AZ2B 1QL9A 1DSTA 3KEEA 1T7CA 2XWBI 2ZHQH 1MBMA 1QL8A 2ZHFH 1HJ8A 1P3CA 2BY8X 4NCYA 1YBWA 1DUEA 1NPMA 4I8JA 2TGTA 1OWIA 2BMGB 5AHGH 1FUJA 1SLVB 3MU5A 3P8GA 1XVMA 1LVYA 1LVOA 4XSKU 5EXMA 1W8BH 3S7KB 2PLXA 3E8LA 1GGDB 1ANDA 1H1BA 2TPIZ 2ULLA 2ZGBH 1TIOA 4Z6AH 1GL0E 3RXAA 2FPZA 3ESTA 1V2RT 3T29A 4Y79A 1C9PA 3K9XB 4KTSA 2PFEA 5HYOA 1XKBC 1TB6H 1AU8A 3SNCA 1TA6A 2Q6FA 1FPCH 1FLEE 7GCHF 4DOQA 2PSYA 3SU6A 2P3FH 1QB9A 2ZECA 3M35A 3D23A 4MPWA 1SPJA 1SI5H 4X1PU 1C5MD 1MCTA 3SUGA 1ZPCA 1EZSC 2WPIS 4FUBA 2QXHA 1UTPA 1NRRH 3VB5A 1SBWA 3QN7A 1EZXC 1HV7A 1S6HA 3AASA 2VIDA 3GICB 2ZA5A 4BOHA 4E7NA 2D26C 1C1UH 1C5SA 1ZHPA 2ZTYA 2FODA 1O2VA 3KHVA 1O3JA 3A85A 2QYIA 1BTHH 1V2OT 1G3DA 2BQWB 3TH2H 1F92A 1HAVA 1C1MA 3E6PH 3FFGA 2UWPA 3NKKA 1RRKA 2ODQA 4KP0A 2RA3A 1C2DA 1PPCE 1KYNA 1L1JA 1S83A 1O2LA 1NO9H 4ABGA 4TPYA 1V2VT 2BLVA 1AZZA 4X2YA 3FZDA 5E8EH 4UD9H 4CH8B 1HYLA 3QZRA 3SNDA 3P92A 1O3GA 4DW2U 3GISB 4K1SA 3AVZA 3T62A 1C4Y2 2STBE 3TH4H 2A7JA 1FY5A 1Z6EA 1ZJDA 3TNTA 3D62A 1DICA 1WV7H 2R0LA 3IWMA 3L3TA 4Q2KA 5C20A 3FP6E 2ZU1A 3N7OA 1ZR0A 2ZO3H 1S82A 3E1XB 2OQ5A 4X6PA 3A84A 1E38B 1P2IA 5IDKA 4A6LA 2C4FH 1A46H 1IQJA 4CR9A 2Y7ZA 1D6RA 2OC8A 2AEIH 3ODDA 2P16A 3A7VA 4KGAA 1RGQA 4HZHA 1MAYA 2ZDVH 1DVAH 1K1LA 2VIWA 1YM0A 4ZKRU 2Q1JA 1ABJH 2QF0A 1K1MA 3VXFH 4ABDA 1ARBA 3MNSA 3HGNA 1AMHA 3ZVGA 3LPRA 4NSYA 4JYUH 2ZQ2A 3TK9A 1GI3A 1BTYA 2SNWA 4IS5A 3RP2A 3RC4A 3BF6H 1PYTD 2ZDMA 1BTXA 1FMGA 2BVSH 3TJNA 2CJIA 4JYTA 3FZZA 2BY6X 1QA0A 1UVSH 1JRTA 1YCPH 1BIOA 1HBTH 2NU1E 2Y5HA 2H9HA 4IGDA 3DT0H 4DIHH 1LPZB 2ALPA 2FO9A 1RTKA 1TNJA 2ZU5A 4BTIB 1MCVA 3OY5U 2W26A 2CF8H 4IN1A 2QF3A 4ZROA 1YPKH 1WBGB 2Y82A 4F49A 1L1NA 3EA9A 1HAHH 5JDUB 2ESTE 1ANBA 2XNIA 3ATIA 1GBMA 1A2CH 5FCRA 4CRAA 3ELAH 2BY5X 1QIXB 1XXFA 4X0WU 2VINA 2ODPA 1C9TA 1PQ5A 1QB6A 1GVLA 2P93A 3TGIE 1C1PA 1QTFA 4X1RU 1UK3A 1TOCB 4CRFA 3SZNA 2FX4A 2FOCA 1KTTB 1XUKA 1FJSA 1O3AA 1ESAA 5C67A 1TMUH 3MO6A 1QHRB 1KDQB 1NFWA 4NZLA 1JRSA 1O5GH 4LZ4B 2H1UA 2XW9A 1GBHA 3GCNA 5DJ7A 1GMDG 2CF9H 1O2SA 3DA9B 2C8YB 2OBOA 3SI4H 1SQTA 4ZKSU 5K0HA 1MKXK 5DP6A 3FANA 4WMDA 1P3EA 2GTBA 4O03A 3PB1E 1MUEB 1NZQH 1TNLA 4MNWA 4AGJA 1WSSH 3F9EA 3SNAA 1ZRBA 1AVXA 2Z9GA 1O3EA 3OX7U 3SJ8A 4AFUA 4I7YH 1Y5UT 1ETSH 4CHAC 5J4QA 2ZGCA 2OC1A 3MNBA 3HKJB 1Y3VA 1ID5H 1GHZA 3UOPA 4DG4A 1IOEA 1DSUA 1YPHC 1TOMH 2Z3DA 2ZPSA 4WJG2 4ASHA 2AMQA 3LU9B 1UTOA 1GMHF 2OCVB 1CBWC 1QJ1B 1BHXF 2C8WB 1RS0A 3BG4B 2J34A 4OS5A 3KQBA 4X8VH 1P06A 3O8RA 2Z3EA 2ZFQH 4O97A 5FPSA 3NWUA 2HLCA 1SL3A 2PSXA 4I8GA 3V7TA 1GMCG 2JKHA 1VR1H 3TITA 3Q77A 5ETXA 1ZSLA 1CA8B 5EOKA 4CHAB 1SGEE 1ZPBA 2I6QA 2VGCC 3DUXH 5A8YA 1FQ3A 2IN2A 5C1XA 4BAQB 1GJ9B 4YOJA 1XMNB 4OS7A 1BUIA 1KY9A 1CVWH 1LVMA 2F83A 2ZFSA 1N6YA 1QQUA 1JIMA 1GMDF 1W0ZU 2PW8H 3K6YA 3O8BA 3LH3A 3RXGA 4IBLH 2XC4A 3SI3H 1N1LA 3ZVBA 1EB2A 1SQAA 1ELFA 1MZAA 1O39A 2A0QB 1XUIA 1FN6A 1G9IE 3MU0A 3RXSA 1XX9A 3RU4D 2GT7A 2PGBB 4AFSA 1VITG 1TNGA 3JZ1B 1TNKA 1EB1H 1EAIA 2QV1A 3F9HA 4WF8A 3BTQE 2VGCB 2V3HH 1O2ZA 1NU9A 2O8MA 3S9AA 3LT3A 4B71A 2OC0A 3P8NA 1P9UA 1HCGA 3E3TA 1SOTA 2BD4A 4K1TA 4TWWA 4JK5A 1ZMJA 3ZZ5A 4AB9A 3ZZ3A 4BAKB 1P03A 1FY3A 1ZTLA 3B23B 4YLQH 1WQSA 4ABAA 4YLUA 2ANKH 3ODFA 1O5FH 1VJAU 1ELAA 1MZDA 2F9UA 2A1DB 3T5FH 4BXSA 2FZZA 4E06H 4ZXXH 1YPJH 3ITIA 1AHTH 3SV9A 1W10U 2CV3A 2H5CA 2XBVA 4YOGA 1GVZA 4OGYA 3EAJA 2R0KA 1Z6JH 2ZI2H 1EX3A 1K1NA 3UPEA 3MWIU 1HFDA 2F9OA 3SU5A 1IQIA 4ABIA 1YPLH 1GJ6A 4I31A 1VCWA 1PJPA 4FUFA 2G52A 2Z7FE 3M5MA 1O2JA 1GHWH 1TBRH 3DFLA 1ETTH 2F9NA 1H8DH 1MTVA 1TPAE 1Y3YA 2AGIX 4NGAH 1AWFH 1SGFG 1F5KU 3LOXA 3MU8A 1SMFE 2KAIB 1UCYH 5DP9A 3MFJA 5A2MH 1DX5M 2YOLA 4XBDA 2J92A 3RUOA 1BZXE 1C5PA 3FAOA 4X2VA 5LGOA 3TGJE 1TQ7B 2ZHWH 1DWBH 2HOBA 3UUZA 1O32A 1OWDA 3L33A 4JZ1A 1VITF 3QK1A 1LO6A 3PWBA 3UR6A 1TBQH 4LXBH 3BTDE 4I8HA 2O8WA 1KXDA 1AFQC 3RMOH 2P8OC 1F0SA 1T8LA 1CA0C 1GHBF 2GT8A 1KDQA 1BMLA 1V2MT 1TE0A 2WYJA 1EJAA 1QA7A 1GG6C 2EI7A 3OY6U 3BEIB 1V2KT 4IW4E 9LPRA 4WMEA 4WVPE 4Y11E 1J15A 3ZV8A 5A8ZA 1ELBA 1FN8A 1Y3XA 3PTNA 4LOYH 2PWXA 1TAWA 4OS4A 1EAUA 2V6NA 1A0JA 5DP3A 4ABJA 1DWEH 2ZGHA 2A7HA 3MTYA 3VPKA 4ISIH 1C5WB 1NFUA 3A7YA 2BDGA 1EKBB 4ZHAA 4K5ZA 1G2MA 2QGRA 3VB4A 4K3JA 3RXDA 4IC5A 1H9HE 2BLWA 2GCHG 5JBBS 5T6GA 2JH5D 1T8MA 1J14A 4MNVA 5T3HA 2SGEE 3EYDA 1AFQB 2P8OB 3UY9A 4B2BA 1CA0B 1DOJA 3GY8A 3BTTE 1GG6B 2BOHB 4YESB 3M3SA 1GWAA 2FOBA 5DPAA 1A1RA 1CSOE 1SGPE 3LC3A 1P9SA 3G01A 2GVFA 1Q31A 1YCPK 2ZTZA 1B0FA 3U98H 4SGAE 3BTME 3TIUA 5EQRA 2Y81A 5C3NA 3BSQA 4JZDH 1TGSZ 1B7XB 2H5DA 2OLGA 4Y76A 1ETRH 3I78A 2WINI 1V2UT 2FOEA 3P95A 1V2TT 1CO7E 1ZMNA 4MPUA 2SFAA 5JBCS 2VIOA 1NTPA 1C2HA 3E0NB 2FESH 3HATH 3SUFA 1O3HA 1P8VC 1T8NA 2FXRA 1C5ZB 3LIWA 3U8RH 3U69H 2AMDA 2C93B 1L0ZA 2WUCA 4E05H 1V2PT 2GZ8A 2H9TH 3MI4A 2W7SA 1O3CA 1T8OA 2GGVB 3PLKA 5EXNA 3UQOA 2ZHDA 5C5OA 3DHKH 1C5LH 4NA9H 1LCYA 3SUDA 2GX4A 1FDPA 2XC0A 1TGBA 1EATA 1OP8A 2ILNA 3ZZ9A 3PTBA 2HALA 1T4UH 5EPYA 2CGAA 2FLBH 3A87A 3W94A 1BBRH 1DPOA 1LPKB 3ZV9A 4INKA 1GI4A 3SBKA 2GCHF 1PPFE 1XXDA 3SGBE 1YLCA 2CHAB 2FMJA 2G81E 1QB1A 3SORA 4A1VA 3M3TA 4GSOA 4X6NA 1THRH 3OSYA 2OBQA 3Q3YA 4I32A 5GPIB 3BTKE 1NS3A 1C2JA 2XBWA 2Z6BD 1UVPA 1WYKA 5A0BA 1C2MA 4A1XA 4INHA 4GPGA 5JB9S 1FY8E 1A7SA 1SVPA 1QRZA 5BRRE 1TPOA 1ACBE 3STIA 3LGTA 3FP8E 1EPTC 2XRCA 3E0PB 1GBEA 1CGIE 1XUHA 2ZCKP 3A8DA 1LDTT 1O2IA 1EJMA 2ZZUH 4K2YA 3MO3A 1O37A 3LJJA 2IPHA 2ZQ1A 4RKOB 1HDTH 3KQEA 3LGIA 1GI9B 1C5VA 3S69A
chains in the Genus database with same CATH superfamily
8KME2 5T1VA 3P6ZB 2QAAA 4Q4LA 3V3MA 2K1QA 1MU6B 2R9PA 3RXFA 1A4WH 2BM2A 5CDFE 1YPEH 1V2JT 3VXEH 4K8YA 1BQYA 1FAKH 1V2WT 1Z7KA 4FVDA 2HPQH 1O30A 2NU2E 1EAWA 1XUGA 1IQFA 1E1RD 1AD8H 1ESTA 2WPJS 1GHYH 1O3MA 1ZHMA 3QTOH 1IAUA 2R3UA 3SGQE 2ANWA 3ZZAA 4B75A 5E0JA 3U8TH 2FDAA 3A88A 2C8XB 4I8LA 5C1UA 2KAIA 1WU1A 1BRBE 1EPTB 2C8ZB 1RTFB 1GHAG 3SN8A 4K69A 1MTNC 4INLA 2AHME 2HLDD 5LPEA 1S81A 2FIRH 3KQDA 3A83A 1NY22 3BTGE 3UFAA 3PRDA 1F0UA 4Q7YA 5HXFA 1GPZA 3M7UA 1C1RA 1EASA 1O2MA 1GBLA 2GMTC 2F9PA 3AW0A 3MH4A 2WV4A 1PPEE 2FS9A 5L2YH 2PUQH 1DLEA 4UFFH 1K2I1 1D6WA 4CREA 3TVJB 4MPVA 4NIWA 1ZZZA 1YPMH 4K60A 1NESE 1MKWH 1HLTH 3PROA 1V2NT 2YMSC 3KIDU 1LHCH 3T28A 1E0FD 1KXAA 3FVFB 1TMBH 1O5CB 2PR3A 1KLJH 1P2KA 1MTNB 1TRYA 3V0XA 4XOJA 3B9FH 3CS7A 4FUHA 1KSNA 4WWYA 3MOCA 3N7DA 1F2SE 2ZFFH 1EUFA 1ELTA 2OXSA 1OWHA 2NU4E 2IOTA 3S0NA 4IMZA 2GMTB 2HNTC 4XRNA 2M2AA 3K2UA 2P3UB 1X7AC 4H42U 2P3TB 1PPZA 1INCA 4K8BA 1CT2E 2ZU2A 1D3PB 2WV9A 2Y7XA 1Z8IB 4NIXA 4J1YA 2XCFA 1PQ7A 1HXFH 2OC7A 2TGDA 4JK6A 2G00A 2W3KA 2V3MA 3VGCC 1P02A 1H4WA 1HAOH 1W12U 2YMSB 1O3OA 2BDCA 4UONA 3BEUA 3GYMA 1BTWA 3CENA 3RXQA 1YYY1 5CHBA 2BX3A 3LGUA 4CH2B 5H4IB 1GHAF 3SOSA 3W95A 2DUCA 4NIVA 1MD8A 2BXTH 5PTPA 1TPPA 1WTGH 1Y5BT 4DGJA 4YT7H 2WPLS 3C27B 2F91A 4X6OA 4Y8XA 4RN6A 4QT8C 1SHYA 4WXIA 1O38A 3KQCA 3WWFA 1BOQA 1HAXB 1FAXA 1WAYB 3RU4T 3R3GB 4AX9H 2VB0A 3SU3A 2IPQX 1O3FA 4DT7B 3RDZA 1O3IA 3VG8A 3RXOA 2BDHA 3VGCB 3ZVCA 1CGJE 5HKKD 1K1JA 4H6TA 1BMMH 4YTAA 1AB9C 3LDXH 1GJ8B 1C1OA 1K1IA 4RKJB 3RXVA 1DS2E 4DVAU 3LJOA 1QNJA 2QN5T 2YNBA 1ZJKA 1UTJA 4R8TB 6CHAC 1TX8A 3MU1A 6GCHG 5GCHG 3STJA 2FI3E 1TGCA 4NWKA 1W14U 3R0FA 2ZG0H 2V35A 4YT6H 1ELVA 1G3EA 1VCPA 1DLKB 2W5EA 3SJIA 2JH6D 4GHQA 3SU4A 1OHHD 1P01A 3UNQA 3ZZ6A 2HWLB 2UWOA 2XC5A 2ZFTA 1SB1H 4GLYA 1C2KA 1EOLA 2BD2A 4GVUA 1GI8B 1S6FA 1D3DB 1HNEE 1O0DH 3A7WA 4UDWH 2IJOB 3QTVH 2CXVA 3RU4E 5AFZH 4FUIA 1AB9B 1XUFA 1LHEH 3QDZB 2B7DH 1C5YB 1Z8GA 1VZQH 3Q00A 1TRMA 2VVCA 3JZ2B 1O2GH 3SJOA 1IQEA 1G36A 2FWWA 3OTJE 4AC9A 5F8XA 2BOKA 6CHAB 1YC0A 4WY3A 1DDJA 3KNXA 1JBUH 2O9QA 2F9BH 2FLRH 2QA9E 1QJ6B 3PRBA 2A4QA 3LH1A 1T4VH 1ZRKA 2RCEA 3GY6A 4GCHG 1BTZA 3RXBA 4AFZA 2BQ7B 3QX5H 3ZZCA 1F5LA 1MD7A 1ANCA 2XBYA 1BJVA 1JOUB 3RXMA 3ZZ8A 1FXYA 4MNXA 1YPGH 4Y8YA 1JXPA 3ATMA 4JCNA 4U32A 2BTCE 2TIOA 4H4FA 1SQRA 5GXPA 1KMHB 2O8UA 1NFYA 3SV2H 2V3OH 3A7TA 2BDYA 2AYWA 1E37B 1SGTA 1O36A 4FUCA 1PQ8A 1E35B 1GI1A 5B6LA 1J8AA 1AKSB 1BT7A 1WOFA 1AUTC 1SOZA 1J17T 1EPTA 3A86A 1GI2A 1OWJA 1TGNA 1AGJA 3NUMA 3V12A 6GCHF 4YZUA 5FPTA 2RA0A 5J4SA 1GCTC 5FXLA 1QRWA 1W0YH 1QZ8A 2XOKD 1UTQA 1SGQE 2AGEX 1E1QD 1OS8A 4JMYA 4YM9A 1NC6A 2ZGXH 4Q80A 1C1TA 1TRNA 3RXJA 2OQUA 1SG8B 4XDEA 2G4TA 1ZPZA 3A89A 4Y8ZA 1G2LA 1AZ8A 4ZHLU 4FU7A 5FX5A 1AO5A 4D9RA 1FIWA 1MTWA 2KR7A 5I46H 1CBWB 1NRQH 1KXCA 4CBOA 1G32B 3M5OA 3RMLH 4ZH8A 2J2UA 1GCTB 5ABWA 1IHSH 5KEDA 1QJ7B 4GCHF 4Z0KA 5F8TA 4I33A 4K1EA 1TBZH 3SU1A 3GDSA 4ISLA 4YXWD 2EI8A 1GI5A 2BZ6H 2R2WU 3HKIB 1MBQA 1RIWC 2J94A 4BNRA 8ESTE 4WXVA 3GCHC 2J97A 1GJ5H 1XVOA 2UUJB 2D1JA 1KTSB 3SGAE 3EGKH 1Y59T 1PFXC 3F0PA 4FVBA 1HPGA 1W0KD 2QE7D 3EA8A 4LZ1H 3V13A 4XD7D 2VIVA 1O34A 5CE1A 3GCOA 2AMPA 3SV6A 1UTMA 1NRPH 2TBSA 4ACBA 1O5DH 3KF2A 3PLPA 1SSXA 2D8WA 3T26A 2A5IA 4X6MA 3QLPH 1FY4A 5DP7A 1Y3UA 1C5QA 3PMBB 1ELEE 1THSH 1HAZB 2EY4C 1EAXA 4DIIH 1C1QA 3VFEA 1O2UA 5L2ZH 1GMCF 4X2XA 2B8OH 3RMMH 5JPMH 5FBIA 1RIWB 3PV5A 4O3TA 1AE5A 2JIZD 1KXBA 1TA2A 5TJXA 1K1OA 1RJXB 2GD4B 2WPKS 3BTEE 4WH6A 1YLNA 5F53A 2A5AA 3BTHE 2XTTB 4OS1A 3RXUA 3TGKE 4Y6DA 3BV9B 3GYLB 3KQ5A 3TNSA 3UNRA 1ZGVA 1ZLRA 2V0BA 1IQKA 1Q3XA 1VJ9U 2LNCA 8LPRA 1YP9A 1MTSA 1H9LB 1SGIB 4A7IB 3U9AH 4NWLA 4OS2A 4B74A 1WUNH 2KX4A 2QCYA 3S9BA 2ZDLA 3EDXB 1BRAA 3BG8A 1P57B 1UVOA 1B5GH 1O2HA 3LKWA 1J16A 2STAE 4NSVA 1C5RA 3PMAB 1EOJA 2UUYA 2SGPE 2XXLA 4HFPB 3GDUA 3GOVB 3BTWE 2CN0H 4A1TA 1Q2WA 1TFXA 1GBJA 1SR5C 1MAXA 2NU0E 1SLWB 2QIQA 2WHXA 1P04A 4I8KA 2A7CA 2UUKB 2AH4X 4F55A 1SLXB 3S9CA 2P94A 2J38A 5F8ZA 3KN2A 1SGRE 1AVGH 4UEHH 5DN6D 1H9IE 1FONA 2AFQB 1GBAA 3T25A 1B0EA 2O8TA 1H8IH 2ZEBA 4GHTA 1D9IA 3RMNH 4ZHMU 5HM9A 3SJ9A 1YPHE 1UJ1A 3NCLA 4D7GA 2A4RA 1GBIA 3QO6A 4JZIA 2ZU3A 3S7HB 1P2JA 3M61U 2A5KA 1O2RA 3Q76A 3F6UH 3F68H 2Y80A 5LPFA 2FTMA 1TGTA 1KIGH 3TJOA 5CHAC 3HK3B 1HXEH 2R2MB 1SHHB 2VIQA 1BJUA 3UWJH 2A4GA 3SYJA 4D9QA 3M37A 4UE7H 4X8UH 2B9LA 1TNIA 3IITA 1AI8H 1AKSA 1Z71A 5BPEA 2J9NA 1XUJA 2G4UA 2VWLA 1P2OA 2D2DA 4P00A 2Y5GA 1IQMA 1O2QA 1RD3B 1LTOA 2GCTC 2TRMA 2VH0A 5ESTE 5GIBA 3P8OA 3L6PA 1DXWA 2THFB 2G5VA 4KTUA 1PPGE 2QY0B 1YY3A 3SQHE 5CHAB 5HM2A 5EQSA 4H6SB 1QBNA 3H5CB 2OUAA 1L1GA 4MDSA 4O3UA 1DWCH 5CMXH 4ISOA 1C2IA 1OP2A 1F0RA 1QR3E 1OPHB 2JH0D 2BD8A 2WPHS 1TWXB 1HAGE 1ZSKA 2FX6A 3E90B 2FI5E 1TYNA 1SGYE 5K7RA 4XBBA 1OWKA 1SKYE 2GCTB 1GI7B 2J4IA 1BCUH 1NRNH 2BQ6B 2F3CE 2SGAA 2Z9KA 2ZPRA 4TYDA 3SZEA 1O31A 4FUJA 4BXWA 1GHVH 1HAIH 5L30H 1QQ4A 4FXGH 3SUEA 1CT0E 4ABBA 2FI4E 2ZCLP 3UAIC 1DUAA 4R0IA 2EI6A 1NT1A 5F03A 2LPRA 3UNSA 4MNYA 4AB8A 2GP9B 2PKAA 1E79D 2PV9B 3MMGA 1YF4A 2GZ7A 3RXPA 2ZKSA 3QUMP 4CBNA 4X8SH 4ESTE 7LPRA 5HMAA 2Y6TA 1LHFH 4ISHH 3OEHD 3A8AA 1K9OE 4NA8A 1BRCE 4A92A 3QZQA 5TCAA 3VEQB 2P59A 1SLUB 1KXEA 2UWLA 3GCTG 4FUDA 4RSPA 1TABE 3EE7A 4SGBE 1ZTJA 2QXJA 1N8OC 5DKMA 1W2KH 5FHTA 4BAHB 2VBCA 2XCNA 1DY9A 3OTPA 4FUGA 5EW1H 1PPBH 1PQAA 3EA7A 1UMAH 4FUEA 1LMWB 5HGGA 5EQQA 3QGJA 1LQDB 4THNH 4U01A 3A80A 2JDID 3HPTB 3F9FA 1EP6A 3MQKC 1A3BH 1EFRD 1TX7A 2W3IA 1ZTKA 1HGTH 2QC2A 2XWAA 1UHBB 3OAAD 3GY4A 5T6DA 1OKXA 1SQOA 3AW1A 3KGPA 2KFWA 4CRGA 3C1KA 2GKVE 3RLYH 2FS8A 1G3CA 1L2EA 1THPB 1P2QA 3KCGH 1GVKB 3SO3A 3LC5A 1Z8RA 4MVNA 1O2XA 3ENSB 1NU7B 4HTCH 3SNBA 4F4OC 6LPRA 1N8OB 3VB3A 4Y7AA 3SQEE 1QCPA 2PUXB 1DANH 2BHGA 1QGFA 2EC9H 1FZZA 2KCOA 5EGMA 1S84A 2SGFE 1T32A 3RXHA 2DE9A 1VITH 3ZVFA 4B73A 5JB8S 3RM2H 4OM9A 2Z9LA 5B6OA 1T31A 1HB0B 1C5XB 1F5RA 1O2YA 1GI0A 1BA8B 1ZYOA 1C1WH 1D3QB 1EZQA 1V2QT 1DITH 1ZSJA 1KLTA 4B1TA 2OINA 2TGAA 3ATKA 1TMTH 2R3YA 4NFEA 2ZPQA 3QGNB 2BDAA 1Y5AT 2KM0A 1BHXB 3F3BA 2QXIA 2ZU4A 3I29A 3GY2A 1LKAA 1NRSH 4MG3A 1UTNA 2HVYB 1GJCB 3GCTF 2Z94A 5ESBA 2BZAA 2FOFA 4AG2A 5JYIA 2VWMA 2BB4A 3UR9A 4WMFA 2O8LA 1YLDA 3PWCA 1SC8U 2ZCHP 4UFDH 1W0JD 5DP4A 3RXRA 4NZQA 2WPMS 3RXKA 2ODYB 1COWD 1WCZA 4M7GA 2BXUH 3H7OA 2EA3A 3ATLA 5F6MA 1GCDA 4B6EA 2ZNKH 3GY3A 1E34B 3GS9A 3A7ZA 4A5TS 3P8FA 3SV8A 1HJAC 1HRTH 2RG3A 1LPGB 3MH7A 2F9VA 1BITA 1O35A 3RXIA 2FTLE 2BVRH 2BD3A 4ISNA 4Z1MD 3M3VA 1F0TA 4D76A 1OOKB 1EXFA 1Z8JB 3SU2A 1FPHH 1DM4B 1GJ7B 1DT2A 1QBVH 2AIQA 2ZDKA 2HPPH 3EQ0H 1P0SH 3TLOA 1UCYE 1IQNA 2SNVA 2ZWLH 5I25A 1HIAA 4YOIA 5AVDA 3DD2H 4OGXA 1P11E 1UCYK 3UB0A 2ANYA 1DFPA 4Y0YE 1OWEA 1FY1A 1NBME 1SFIA 1P2MA 3LGWA 4CR5A 3ATWA 4BTTB 7ESTE 1U6QA 4IN2A 3SU0A 1EJNA 4TY6A 2ZFPH 1BMNH 4FU8A 4WH8A 5AF9H 4MLFB 3Q3KA 5E2OA 1AVWA 3NZIA 1V2LT 3PV4A 3AK5A 1GDQA 3SV7A 1HJAB 1A5IA 1YWUA 2BD7A 5AFYH 4ZAEA 4FU9A 1JWTA 2W6JD 2A2XH 2ZFRH 8GCHG 3O8CA 3HK6B 1E36B 2VJ1A 3RXCA 2BVXH 1S5SA 1QL7A 3EE0B 3U8OH 4JZFH 2PTNA 4D7FA 5DP5A 2ZHEH 3URCA 1GMHG 1MQ5A 2VVUA 1A5HA 1C5NH 2PTCE 3F2HA 1M9UA 4RT1A 5DP8A 1DE7H 1AUJA 4B6FA 4UFEH 1VGCC 2XYAA 4AYYB 2A45B 2BD5A 4TY7A 4MTBA 1BB0B 3DFJA 2BY7X 3BEFB 1G37A 3MNXA 2BLQA 5C17A 1CU1A 1W13U 3P70B 3OE7D 1P2NA 1TPSA 4TT3D 5C5NA 3TH3H 4AORA 4NG9H 1C5UA 2DE8A 4X2WA 4X1SU 4AYVB 1OYQA 1ELCA 1CGHA 5GWZA 1N6XA 2FM2A 2C90B 2NU3E 2H9EH 3URDA 1BRUP 2VNTA 4VGCC 4DJZB 2H2ZA 3RLWH 1O3DA 2FOAA 4NFFA 4O9VA 3TK5A 2GV7A 1K28D 1V6DA 3VB6A 4BANB 3RXEA 1P05A 5EW2H 1VGCB 2ZGJA 3ZYDA 3BG4C 3HGPA 4D8NA 2VU8E 3SHAH 2FP7B 1S0QA 5FCKA 1C1VH 3ZZ4A 4B2CA 3T2NA 3KYGA 2B5TB 1YGCH 1QBOA 1UHBA 3N7EA 3TJVA 3TU7H 2EQNA 2VWNA 2PKSC 1IHTH 2Z9IA 2FOMB 1CHGA 3PM3A 1ZMLA 5DK1A 4XBCA 5EPNA 1FI8A 1AE8H 1FIZA 4X1NU 2EEKA 2FYRA 1LQEA 3U1IB 3M7TA 4Q7XA 5C1YA 3UTUH 1W7GH 3CP7A 1G30B 1AFEH 1OSSA 8GCHF 1O2OA 3F1SB 5GCHF 1HUTH 3QWCH 3PMJA 4KKDA 4LK4A 2BY9X 3M36A 5EXLA 1SGCA 4VGCB 1SGNE 3MU4A 1C4V2 1ARCA 1LKBA 1TONA 2G51A 3RC5A 3SHCH 5TCCA 3ZVAA 3LONA 5DO4H 3PMHB 4B76A 3MH5A 2OD3B 3GY7A 2WV5A 1V2ST 1S0RA 1VCQA 2ZP0H 4Q7ZA 1V3XA 1UTKA 3M7QA 1RTLA 4ZCNA 3DSOA 4MPXA 1BBRE 3A8BA 4ABEA 3AAVA 4Y10E 3RC6A 3PO1C 2P95A 1BBRK 2A4OA 5EODA 5JBTA 3M5LA 5A0CA 2A31A 1OXGA 2PKSB 2A32A 2GV6A 1UTLM 1LVBA 5GJ4B 2ALVA 1O5EH 6ESTA 2Z3CA 4IC6A 1C1SA 2HNTE 1DXPA 3K6ZA 1WQVH 1O2KA 4XFQA 3ZYEA 4DURA 4CRDA 2YNAA 1A5GH 1O3PB 2Q6DA 5EJ1A 2ZDNA 1C2FA 1HAPH 7KMEH 1A61H 4DCDA 1SGDE 1IQGA 2L6OA 2SGQE 4Y7BA 3MHWU 3MYWA 2PHBA 5A0AE 4AN7A 3KYFA 1L4DA 3H7TA 2F4LA 3D49H 5EG4A 1YKTA 3AAUA 1Z1IA 1D4PB 4TSFD 1SFQB 4NA7A 2PKAB 3PO1B 4AOQA 1PPHE 4ABFA 3F9GA 3ZVDA 1ELDE 4HG6A 1W3CA 4B2AA 1G3BA 2HNTF 4TWYA 4KELA 1P09A 3FO8D 4X1QU 3LGVA 2J98B 3DCLA 4BTUB 1GHBG 3ZVEA 2NWNA 4J2YB 3BIVH 1J9CH 2QXGA 1CE5A 4ABHA 2FYQA 3I77A 4NIYA 1QY6A 1ZOMA 5LH8A 2WPDD 1C2LA 3UOUA 4UFGH 2SGDE 1CHOG 1TALA 2BYAX 4U30A 1AIXH 3GCHB 1O3LA 1O33A 2W7UA 9ESTA 1W7XH 3B8JA 3RXLA 1Y8TA 1UVTH 3ZZDA 3NXPA 3UQVA 5DGJA 4MQAA 2Y5FA 3SJKA 1GBBA 1NN6A 5A09A 4JZEH 3SW2B 3PLBA 2WUBA 5C94A 2JJ1D 1MH0A 4FETA 1GBCA 3OYPA 4ZXYH 2AERH 5C0UA 4ZKNU 3RXTA 2FOGA 1TNHA 1RXPA 3VB7A 2G8TA 2ANMH 4BAMB 1MKWK 1LHDH 2RDLA 4CRCA 4AG1A 3N99A 2ZIQH 4Y71A 1DWDH 2G55A 1LHGH 1OX1A 1TLDA 3TPIZ 1GBFA 1GDNA 3A81A 3BIUH 5C2ZA 1QRXA 1OYTH 1C2GA 1K22H 1IQHA 4Y0ZE 1FV9A 1HJ9A 3SNEA 4F48B 1C5TA 1PYTC 1ELGA 2GDDA 1DY8A 1D3TB 4TPIZ 5A8XA 3NPSA 3ZZBA 2A2QH 1K21H 1JIRA 1GBDA 1O5BB 1MQ6A 4HGCA 1HAVB 4KTCA 1O2TA 4AFQA 3T27A 5E0GA 1GDUA 2CMYA 1ORFA 3A82A 1GJ4H 4I86A 5FBEA 1Y3WA 1CQQA 1CHOF 3CS0A 3MO9A 2BD9A 1ZGIA 3MNCA 4HI3A 2BDIA 3LGYA 5G4BA 2VH6A 2UUFB 4E7RG 4IMQA 3WY8A 4BAOB 3U1JB 2VWOA 2XBXA 3O8DA 1UK4A 1ZHRA 1NM6A 2FEQH 2C3SA 5E2PA 2AS9A 1XM1A 2ASUB 1A0HB 2WYGA 1GI6A 2ZDAH 1O3NA 4U2WA 5EU8A 1L4ZA 3E91A 3OU0A 1AWHB 2Z9JA 1MKXH 2RDEA 1GHXH 5T6FA 1O2WA 1OP0A 1UVUH 1KLIH 3DSGA 4ACAA 5L6NH 5SGAE 1EZUC 1EP5A 1AY6H 1MMJN 1A3EH 2JETC 3MH6A 1C1NA 1FNIA 4JYVH 3NK8A 1ABIH 1HIAB 5GDSH 3UIRA 4GUXA 1AQ7A 5FAHA 4XE4A 1K1PA 3GDVA 4YO9A 2AIPA 1O2PA 2ZTXA 1BDAA 2ZC9H 1BTPA 1CT4E 3GY5A 1C5OH 5JBAS 1HAYB 2GDEH 3D65E 3PV2A 2ZF0H 3FP7E 2L74A 5FPYA 4ZUHA 2OTVA 2OK5A 1SGFA 1EQ9A 3IG6B 1IQLA 1W11U 1GBKA 2PP6A 2CHAC 1C2EA 1MU8B 1A0LA 3P17H 4AGKA 3BN9A 1Z1JA 1GL1A 7GCHG 5EJLA 3K65B 1S85A 3ZZ7A 2JETB 1GBTA 1UK2A 2PGQB 2HRVA 2HGTH 3UWIA 1P10A 2G5NA 1BTUA 2J95A 2I6SA 5FX6A 4PROA 2QF5A 3A8CA 4CRBA 1UO6A 2B0FA 1KXFA 2AGGX 1TX6A 3Q3XA 2BX4A 2FOHA 2VIPA 1GJAB 5E0HA 2XNDD 1P12E 3RM0H 3BTFE 1O3KA 1NFXA 4X8TH 2OP9A 1GJBB 1QFKH 3TK6A 3A7XA 1BMAA 1YCPM 2IJD1 1GGDC 4OS6A 1O5AB 5LPRA 2BLOA 3KL6A 2TGPZ 1MTUA 3PYHA 3TJUA 1QURH 1C4U2 2VVVA 2M5TA 1ANEA 3UREA 1JMOH 4ZKOU 1NROH 1O3BA 1RFNA 2BDBA 2GZ9A 1AN1E 2J98A 3M5NA 1O2NA 1XKAC 2KCAA 5IYTA 3E16B 1GJDB 1TQ0B 1ESBA 4ZMAH 4GAWA 1WTHD 2H6MA 2HVXA 4DY7B 5DG6A 2Q6GA 1F7ZA 4AZ2B 1QL9A 1DSTA 3KEEA 1T7CA 2XWBI 5HIZA 2ZHQH 1MBMA 1QL8A 2ZHFH 1HJ8A 1P3CA 3H09A 2BY8X 1VKYA 4NCYA 1YBWA 1DUEA 1NPMA 4I8JA 2TGTA 1OWIA 2BMGB 5AHGH 1FUJA 1SLVB 3MU5A 5EJZA 2KCYA 4DT4A 3P8GA 1XVMA 1LVYA 1LVOA 4XSKU 5EXMA 1W8BH 3S7KB 2PLXA 3E8LA 1GGDB 1ANDA 1H1BA 2TPIZ 2ULLA 2ZGBH 1TIOA 2GJGA 4Z6AH 3FN8A 1GL0E 3RXAA 2FPZA 3ESTA 1V2RT 2WZQA 3T29A 4Y79A 1C9PA 3K9XB 4KTSA 2PFEA 5HYOA 1XKBC 1TB6H 1AU8A 3SNCA 1TA6A 2Q6FA 1FPCH 1FLEE 7GCHF 4M9FA 4DOQA 2PSYA 3F2GA 3SU6A 2P3FH 1QB9A 2ZECA 3M35A 3D23A 4MPWA 1SPJA 1SI5H 4X1PU 1C5MD 1MCTA 3SUGA 1ZPCA 1EZSC 2WPIS 4FUBA 2QXHA 1UTPA 1NRRH 3VB5A 1SBWA 3QN7A 1EZXC 1HV7A 1S6HA 3AASA 2VIDA 3GICB 2ZA5A 3F0OA 4BOHA 4E7NA 2D26C 1C1UH 1C5SA 1ZHPA 2ZTYA 2FODA 1O2VA 3KHVA 1O3JA 3A85A 2KCPA 2QYIA 1BTHH 1V2OT 1G3DA 2BQWB 3TH2H 1F92A 1HAVA 3WW7A 1C1MA 3E6PH 3FFGA 2UWPA 3NKKA 1RRKA 2ODQA 4KP0A 2RA3A 1C2DA 1PPCE 1KYNA 1L1JA 1S83A 1O2LA 1NO9H 4ABGA 4TPYA 1V2VT 1H8ED 2BLVA 1AZZA 4X2YA 3FZDA 5E8EH 4UD9H 4CH8B 1HYLA 4Q63A 1S6LA 3QZRA 3SNDA 3OFND 1O3GA 3P92A 4DW2U 3U28C 3GISB 4K1SA 3AVZA 3T62A 1C4Y2 2STBE 3TH4H 2A7JA 1FY5A 1Z6EA 1ZJDA 3F2FA 3TNTA 3D62A 1DICA 3CNRA 1WV7H 2R0LA 3IWMA 3L3TA 4Q2KA 5C20A 3FP6E 2ZU1A 3N7OA 1ZR0A 2ZO3H 1S82A 1FX0B 3E1XB 2OQ5A 4X6PA 3A84A 1E38B 1P2IA 5IDKA 4A6LA 2C4FH 1A46H 1IQJA 2LELA 4CR9A 2Y7ZA 4FOUC 1D6RA 2OC8A 2AEIH 3ODDA 2F43B 2P16A 3A7VA 4KGAA 1RGQA 4HZHA 1MAYA 2ZDVH 1DVAH 1K1LA 2VIWA 1YM0A 4ZKRU 2Q1JA 1ABJH 2QF0A 1K1MA 3VXFH 4ABDA 1ARBA 3MNSA 3HGNA 1AMHA 3ZVGA 3LPRA 4NSYA 3ZIAD 4JYUH 2ZQ2A 3TK9A 1GI3A 1BTYA 2SNWA 4IS5A 3RP2A 3RC4A 5KECA 3BF6H 1PYTD 2ZDMA 1BTXA 1FMGA 2BVSH 3TJNA 2CJIA 4JYTA 3FZZA 2BY6X 1QA0A 1UVSH 1JRTA 1YCPH 1BIOA 1HBTH 2NU1E 2Y5HA 2H9HA 4IGDA 3DT0H 4DIHH 1LPZB 2ALPA 2FO9A 1RTKA 5KGOA 1TNJA 2ZU5A 4BTIB 1MCVA 3OY5U 2W26A 2CF8H 4IN1A 2QF3A 3W1EA 4ZROA 1YPKH 1WBGB 2Y82A 4F49A 1L1NA 3EA9A 1HAHH 5JDUB 2ESTE 1ANBA 2XNIA 2JJ2D 3ATIA 1GBMA 1A2CH 5FCRA 4CRAA 3ELAH 2BY5X 1QIXB 1XXFA 4X0WU 2VINA 2ODPA 1C9TA 1PQ5A 1QB6A 1GVLA 2P93A 3TGIE 1K0HA 1C1PA 1QTFA 3DSPA 4X1RU 1UK3A 1TOCB 4CRFA 3SZNA 2FX4A 2FOCA 1KTTB 1XUKA 3FKSD 1FJSA 2K8IA 1O3AA 1ESAA 5C67A 1TMUH 3MO6A 1QHRB 1KDQB 1NFWA 4NZLA 1JRSA 1O5GH 4LZ4B 2H1UA 2XW9A 1GBHA 3GCNA 5DJ7A 1GMDG 2CF9H 1O2SA 3DA9B 2C8YB 2OBOA 3SI4H 1SQTA 4ZKSU 5K0HA 1MABB 1MKXK 5DP6A 3FANA 5C0TA 4WMDA 1P3EA 2GTBA 4O03A 3PB1E 1MUEB 1NZQH 1TNLA 4MNWA 4AGJA 1WSSH 2K0QA 3F9EA 3SNAA 1ZRBA 1AVXA 2Z9GA 1O3EA 3OX7U 3SJ8A 4AFUA 4I7YH 1Y5UT 1ETSH 4CHAC 5J4QA 2ZGCA 2OC1A 3MNBA 3HKJB 1Y3VA 1ID5H 1GHZA 3UOPA 4DG4A 1IOEA 1DSUA 1YPHC 1TOMH 2Z3DA 2ZPSA 4WJG2 4ASHA 2AMQA 3LU9B 1UTOA 1GMHF 2OCVB 1CBWC 1QJ1B 1BHXF 2C8WB 1UW7A 1RS0A 3BG4B 2J34A 4OS5A 3KQBA 4X8VH 1P06A 3O8RA 1NBMD 2Z3EA 2ZFQH 4O97A 5FPSA 3NWUA 2HLCA 1SL3A 2PSXA 4I8GA 3V7TA 1GMCG 2JKHA 1VR1H 3TITA 3Q77A 5ETXA 1ZSLA 1CA8B 5EOKA 4CHAB 1SGEE 1ZPBA 2I6QA 2VGCC 3DUXH 5A8YA 1FQ3A 2IN2A 5C1XA 4BAQB 1GJ9B 5GNDA 4YOJA 1XMNB 4OS7A 1BUIA 1KY9A 1CVWH 1LVMA 2F83A 2ZFSA 4RI0A 1N6YA 1QQUA 1JIMA 1GMDF 1W0ZU 2PW8H 3K6YA 3NRLA 3O8BA 3LH3A 4ASUD 3RXGA 4IBLH 2XC4A 3SI3H 1N1LA 3ZVBA 1EB2A 1SQAA 1ELFA 1MZAA 1O39A 2A0QB 1XUIA 1FN6A 1G9IE 3MU0A 3RXSA 1XX9A 3RU4D 2GT7A 2PGBB 4AFSA 1VITG 1TNGA 3JZ1B 1TNKA 1EB1H 1EAIA 2QV1A 3F9HA 4WF8A 3BTQE 2VGCB 2V3HH 1O2ZA 1NU9A 2O8MA 3S9AA 3LT3A 4B71A 2OC0A 3P8NA 1P9UA 1HCGA 3E3TA 1SOTA 2BD4A 4K1TA 4TWWA 4JK5A 1ZMJA 3ZZ5A 4AB9A 3ZZ3A 4BAKB 1P03A 5IK2D 1FY3A 1ZTLA 3B23B 4YLQH 1WQSA 4ABAA 4YLUA 2ANKH 3ODFA 1O5FH 1VJAU 1ELAA 1MZDA 2F9UA 2A1DB 2LP6A 3T5FH 3OEED 4BXSA 2FZZA 4E06H 4ZXXH 1YPJH 3ITIA 5EIYA 1AHTH 3SV9A 1W10U 2CV3A 2KZ4A 2H5CA 2XBVA 4YOGA 1GVZA 4OGYA 3EAJA 2R0KA 1Z6JH 2ZI2H 1EX3A 1K1NA 3UPEA 3MWIU 1HFDA 2F9OA 3SU5A 1IQIA 4ABIA 1YPLH 1GJ6A 4I31A 1VCWA 3WWBA 1PJPA 4FUFA 2G52A 2Z7FE 3M5MA 2W6ID 1O2JA 1GHWH 1TBRH 3DFLA 1ETTH 2F9NA 1H8DH 1MTVA 1TPAE 1Y3YA 2AGIX 4NGAH 1AWFH 1SGFG 1F5KU 3LOXA 3MU8A 1SMFE 2KAIB 2YMSD 1UCYH 5DP9A 3MFJA 5A2MH 1DX5M 2YOLA 4XBDA 2J92A 3RUOA 1BZXE 1C5PA 3FAOA 4X2VA 5LGOA 3TGJE 1TQ7B 2ZHWH 1DWBH 2HOBA 3UUZA 1O32A 1OWDA 1WDIA 3L33A 4JZ1A 1VITF 3QK1A 1LO6A 3PWBA 3UR6A 1TBQH 4LXBH 3BTDE 4I8HA 2O8WA 1KXDA 1AFQC 3RMOH 1BMFD 2P8OC 1F0SA 1T8LA 1CA0C 1GHBF 2GT8A 1KDQA 1BMLA 1V2MT 1TE0A 2WYJA 1EJAA 1QA7A 1GG6C 2EI7A 3OY6U 3BEIB 1V2KT 4IW4E 4RT0A 4WMEA 9LPRA 4WVPE 4Y11E 1J15A 3ZV8A 5HIYA 5A8ZA 1ELBA 1FN8A 1Y3XA 3PTNA 4LOYH 2PWXA 1TAWA 4OS4A 1EAUA 2V6NA 1A0JA 5DP3A 4ABJA 1DWEH 2ZGHA 2A7HA 2V7QD 3MTYA 3VPKA 4ISIH 1C5WB 1NFUA 2J5UA 3A7YA 2BDGA 1EKBB 4ZHAA 4K5ZA 1G2MA 2QGRA 3VB4A 4K3JA 3RXDA 4IC5A 1H9HE 2BLWA 2GCHG 5JBBS 5T6GA 2JH5D 1T8MA 1J14A 4MNVA 5T3HA 2SGEE 3EYDA 1AFQB 2P8OB 2QF4A 3UY9A 4B2BA 1CA0B 1DOJA 3GY8A 3BTTE 1GG6B 2BOHB 4YESB 3M3SA 1GWAA 2FOBA 5DPAA 1A1RA 1CSOE 1SGPE 3LC3A 1P9SA 3G01A 2GVFA 1Q31A 1YCPK 2ZTZA 1B0FA 3U98H 4SGAE 1WXRA 3BTME 3TIUA 5EQRA 2Y81A 5C3NA 3BSQA 4JZDH 1TGSZ 1B7XB 2H5DA 2OLGA 4Y76A 1ETRH 3I78A 2WINI 1V2UT 2FOEA 3P95A 1V2TT 1CO7E 1ZMNA 4MPUA 2SFAA 2RFKC 5JBCS 2VIOA 1NTPA 1C2HA 3E0NB 2FESH 3HATH 1H8HD 3SUFA 1O3HA 1P8VC 1T8NA 2FXRA 5DSFA 1C5ZB 3LIWA 3U8RH 3U69H 2AMDA 2C93B 1L0ZA 2WUCA 4E05H 1V2PT 2GZ8A 2H9TH 3MI4A 2W7SA 1O3CA 1T8OA 2GGVB 3PLKA 5EXNA 3UQOA 2ZHDA 5C5OA 3DHKH 1C5LH 3FOAA 4NA9H 1LCYA 3SUDA 2GX4A 1FDPA 2XC0A 1TGBA 1EATA 1OP8A 2ILNA 3ZZ9A 3PTBA 2HALA 1T4UH 5EPYA 2CGAA 2FLBH 3A87A 3W94A 1BBRH 1DPOA 1LPKB 3ZV9A 2WSSD 4INKA 1GI4A 3SBKA 2GCHF 1PPFE 1XXDA 3SGBE 1YLCA 2CHAB 2FMJA 2G81E 1QB1A 3SORA 4A1VA 3M3TA 4GSOA 4P02A 4X6NA 1THRH 3OSYA 2OBQA 3Q3YA 4I32A 5GPIB 3BTKE 1NS3A 1C2JA 2XBWA 2Z6BD 1UVPA 5FL7D 1WYKA 5A0BA 1C2MA 4A1XA 4INHA 4GPGA 5JB9S 1FY8E 1A7SA 1SVPA 1QRZA 5BRRE 1TPOA 1ACBE 3STIA 3LGTA 3FP8E 1EPTC 2XRCA 3E0PB 2CK3D 1GBEA 1CGIE 1XUHA 2ZCKP 3A8DA 1LDTT 1O2IA 1EJMA 2ZZUH 4K2YA 3MO3A 1O37A 3LJJA 2IPHA 2ZQ1A 4RKOB 1HDTH 3KQEA 3LGIA 1GI9B 1C5VA 3S69A
chains in the Genus database with same CATH topology
8KME2 3P6ZB 2QAAA 3V3MA 2K1QA 1MU6B 2R9PA 3RXFA 1A4WH 2BM2A 1YPEH 1V2JT 3VXEH 4K8YA 1BQYA 1FAKH 1V2WT 1Z7KA 4FVDA 2HPQH 1O30A 2NU2E 1EAWA 1XUGA 1IQFA 1ESTA 1AD8H 2WPJS 1GHYH 1O3MA 1ZHMA 3QTOH 1IAUA 2R3UA 3SGQE 2ANWA 3ZZAA 4B75A 5E0JA 3U8TH 2FDAA 3A88A 2C8XB 4I8LA 5C1UA 2KAIA 1WU1A 1BRBE 1EPTB 2C8ZB 1RTFB 1GHAG 3SN8A 4K69A 1MTNC 4INLA 5LPEA 1S81A 2FIRH 3KQDA 3A83A 1NY22 3BTGE 3UFAA 4Q7YA 1F0UA 5HXFA 1GPZA 3M7UA 1C1RA 1EASA 1O2MA 1GBLA 2GMTC 2F9PA 3AW0A 3MH4A 2WV4A 1PPEE 2FS9A 5L2YH 2PUQH 1DLEA 4UFFH 1K2I1 1D6WA 4CREA 3TVJB 4MPVA 4NIWA 1ZZZA 1YPMH 4K60A 1NESE 1MKWH 1HLTH 3PROA 1V2NT 3KIDU 1LHCH 3T28A 1E0FD 1KXAA 3FVFB 1TMBH 1O5CB 2PR3A 1KLJH 1P2KA 1MTNB 1TRYA 3V0XA 4XOJA 3B9FH 3CS7A 4FUHA 1KSNA 4WWYA 3MOCA 1F2SE 2ZFFH 1EUFA 1ELTA 2OXSA 1OWHA 2NU4E 2IOTA 3S0NA 4IMZA 2GMTB 2HNTC 3K2UA 2P3UB 1X7AC 4H42U 2P3TB 1PPZA 1INCA 4K8BA 1CT2E 2ZU2A 1D3PB 2Y7XA 1Z8IB 4NIXA 4J1YA 2XCFA 1PQ7A 1HXFH 2OC7A 2TGDA 4JK6A 2G00A 2W3KA 3VGCC 1P02A 1H4WA 1HAOH 1W12U 1O3OA 2BDCA 4UONA 3BEUA 3GYMA 1BTWA 3CENA 3RXQA 1YYY1 2BX3A 3LGUA 4CH2B 5H4IB 1GHAF 3SOSA 3W95A 2DUCA 4NIVA 1MD8A 2BXTH 5PTPA 1TPPA 1WTGH 1Y5BT 4DGJA 4YT7H 2WPLS 3C27B 2F91A 4X6OA 4Y8XA 4RN6A 4QT8C 1SHYA 4WXIA 1O38A 3KQCA 1BOQA 1HAXB 1FAXA 1WAYB 3RU4T 3R3GB 4AX9H 2VB0A 3SU3A 1O3FA 4DT7B 3RDZA 1O3IA 3RXOA 2BDHA 3VGCB 3ZVCA 1CGJE 1K1JA 4H6TA 1BMMH 4YTAA 1AB9C 3LDXH 1GJ8B 1C1OA 1K1IA 4RKJB 3RXVA 1DS2E 4DVAU 3LJOA 1QNJA 2QN5T 2YNBA 1ZJKA 1UTJA 4R8TB 6CHAC 1TX8A 3MU1A 6GCHG 5GCHG 3STJA 2FI3E 1TGCA 4NWKA 1W14U 3R0FA 2ZG0H 2V35A 4YT6H 1ELVA 1G3EA 1VCPA 1DLKB 2W5EA 3SJIA 2JH6D 4GHQA 3SU4A 1P01A 3UNQA 3ZZ6A 2HWLB 2UWOA 2XC5A 2ZFTA 1SB1H 4GLYA 1C2KA 1EOLA 2BD2A 4GVUA 1GI8B 1S6FA 1D3DB 1HNEE 1O0DH 3A7WA 4UDWH 2IJOB 3QTVH 2CXVA 3RU4E 5AFZH 4FUIA 1AB9B 1XUFA 1LHEH 3QDZB 2B7DH 1C5YB 1Z8GA 1VZQH 3Q00A 1TRMA 2VVCA 3JZ2B 1O2GH 3SJOA 1IQEA 1G36A 2FWWA 3OTJE 5F8XA 2BOKA 6CHAB 1YC0A 4WY3A 1DDJA 3KNXA 1JBUH 2O9QA 2F9BH 2FLRH 2QA9E 1QJ6B 2A4QA 3LH1A 1T4VH 1ZRKA 2RCEA 3GY6A 4GCHG 1BTZA 3RXBA 4AFZA 2BQ7B 3QX5H 3ZZCA 1F5LA 1MD7A 1ANCA 2XBYA 1BJVA 1JOUB 3RXMA 3ZZ8A 1FXYA 4MNXA 1YPGH 4Y8YA 1JXPA 3ATMA 4JCNA 4U32A 2BTCE 2TIOA 4H4FA 5GXPA 2O8UA 1NFYA 3SV2H 2V3OH 3A7TA 2BDYA 2AYWA 1E37B 1SGTA 1O36A 4FUCA 1PQ8A 1E35B 1GI1A 1J8AA 1AKSB 1BT7A 1WOFA 1AUTC 1SOZA 1J17T 1EPTA 3A86A 1GI2A 1OWJA 1TGNA 1AGJA 3NUMA 3V12A 6GCHF 4YZUA 5FPTA 2RA0A 5J4SA 1GCTC 5FXLA 1QRWA 1W0YH 1UTQA 1SGQE 2AGEX 1OS8A 4JMYA 4YM9A 1NC6A 2ZGXH 4Q80A 1C1TA 1TRNA 3RXJA 2OQUA 1SG8B 4XDEA 2G4TA 1ZPZA 3A89A 4Y8ZA 1G2LA 1AZ8A 4ZHLU 4FU7A 5FX5A 1AO5A 4D9RA 1FIWA 1MTWA 5I46H 1CBWB 1NRQH 1KXCA 4CBOA 1G32B 3M5OA 3RMLH 4ZH8A 2J2UA 1GCTB 5ABWA 1IHSH 1QJ7B 4GCHF 4Z0KA 5F8TA 4I33A 4K1EA 1TBZH 3SU1A 3GDSA 4ISLA 2EI8A 1GI5A 2BZ6H 2R2WU 3HKIB 1MBQA 1RIWC 2J94A 4BNRA 8ESTE 4WXVA 3GCHC 1GJ5H 1XVOA 2UUJB 2D1JA 1KTSB 3SGAE 3EGKH 1Y59T 1PFXC 4FVBA 1HPGA 3EA8A 4LZ1H 3V13A 2VIVA 1O34A 5CE1A 3GCOA 2AMPA 3SV6A 1UTMA 1NRPH 2TBSA 1O5DH 3KF2A 3PLPA 1SSXA 2D8WA 3T26A 2A5IA 4X6MA 3QLPH 1FY4A 5DP7A 1Y3UA 1C5QA 3PMBB 1ELEE 1THSH 1HAZB 1EAXA 4DIIH 1C1QA 3VFEA 1O2UA 5L2ZH 1GMCF 4X2XA 2B8OH 3RMMH 5JPMH 5FBIA 1RIWB 4O3TA 1AE5A 1KXBA 1TA2A 5TJXA 1K1OA 1RJXB 2GD4B 2WPKS 3BTEE 4WH6A 2A5AA 3BTHE 2XTTB 4OS1A 3RXUA 3TGKE 4Y6DA 3BV9B 3GYLB 3TNSA 3UNRA 1ZGVA 1ZLRA 2V0BA 1IQKA 2LNCA 1Q3XA 1VJ9U 8LPRA 1YP9A 1MTSA 1H9LB 1SGIB 4A7IB 3U9AH 4NWLA 4OS2A 4B74A 1WUNH 2QCYA 3S9BA 2ZDLA 3EDXB 1BRAA 3BG8A 1P57B 1UVOA 1B5GH 1O2HA 3LKWA 1J16A 2STAE 4NSVA 1C5RA 3PMAB 1EOJA 2UUYA 2SGPE 2XXLA 4HFPB 3GDUA 3GOVB 3BTWE 2CN0H 4A1TA 1Q2WA 1TFXA 1GBJA 1SR5C 1MAXA 2NU0E 1SLWB 2QIQA 1P04A 4I8KA 2A7CA 2UUKB 2AH4X 1SLXB 3S9CA 2P94A 2J38A 5F8ZA 3KN2A 1SGRE 1AVGH 4UEHH 1H9IE 1FONA 2AFQB 1GBAA 3T25A 1B0EA 2O8TA 1H8IH 2ZEBA 4GHTA 1D9IA 3RMNH 4ZHMU 5HM9A 3SJ9A 1YPHE 1UJ1A 3NCLA 4D7GA 2A4RA 1GBIA 3QO6A 4JZIA 2ZU3A 3S7HB 1P2JA 3M61U 2A5KA 1O2RA 3Q76A 3F6UH 3F68H 2Y80A 5LPFA 2FTMA 1TGTA 1KIGH 3TJOA 5CHAC 3HK3B 1HXEH 2R2MB 1SHHB 2VIQA 1BJUA 3UWJH 2A4GA 4D9QA 3M37A 4UE7H 4X8UH 2B9LA 1TNIA 3IITA 1AI8H 1AKSA 1Z71A 5BPEA 2J9NA 1XUJA 2G4UA 2VWLA 1P2OA 2D2DA 2Y5GA 1IQMA 1O2QA 1RD3B 1LTOA 2GCTC 2TRMA 2VH0A 5ESTE 5GIBA 3P8OA 3L6PA 1DXWA 2THFB 2G5VA 4KTUA 1PPGE 2QY0B 3SQHE 5CHAB 5HM2A 5EQSA 4H6SB 1QBNA 3H5CB 2OUAA 1L1GA 4MDSA 4O3UA 1DWCH 5CMXH 4ISOA 1C2IA 1OP2A 1F0RA 1QR3E 1OPHB 2JH0D 2BD8A 2WPHS 1TWXB 1HAGE 1ZSKA 2FX6A 3E90B 2FI5E 1TYNA 1SGYE 5K7RA 4XBBA 1OWKA 2GCTB 1GI7B 2J4IA 1BCUH 1NRNH 2BQ6B 2F3CE 2SGAA 2Z9KA 2ZPRA 4TYDA 1O31A 4FUJA 4BXWA 1GHVH 1HAIH 5L30H 1QQ4A 4FXGH 3SUEA 1CT0E 4ABBA 2FI4E 2ZCLP 1DUAA 4R0IA 2EI6A 1NT1A 5F03A 2LPRA 3UNSA 4MNYA 4AB8A 2GP9B 2PKAA 2PV9B 3MMGA 1YF4A 2GZ7A 3RXPA 2ZKSA 3QUMP 4CBNA 4X8SH 4ESTE 7LPRA 5HMAA 2Y6TA 1LHFH 4ISHH 3A8AA 1K9OE 4NA8A 1BRCE 4A92A 3QZQA 5TCAA 3VEQB 2P59A 1SLUB 1KXEA 2UWLA 3GCTG 4FUDA 4RSPA 1TABE 4SGBE 1ZTJA 2QXJA 1N8OC 5DKMA 1W2KH 5FHTA 4BAHB 2XCNA 1DY9A 4FUGA 5EW1H 1PPBH 1PQAA 3EA7A 1UMAH 4FUEA 1LMWB 5HGGA 5EQQA 3QGJA 1LQDB 4THNH 4U01A 3A80A 3HPTB 3F9FA 1EP6A 1A3BH 1TX7A 2W3IA 1ZTKA 1HGTH 2QC2A 2XWAA 1UHBB 3GY4A 5T6DA 1OKXA 1SQOA 3AW1A 3KGPA 4CRGA 3C1KA 2GKVE 3RLYH 2FS8A 1G3CA 1L2EA 1THPB 1P2QA 3KCGH 1GVKB 3SO3A 3LC5A 1Z8RA 4MVNA 1O2XA 3ENSB 1NU7B 4HTCH 3SNBA 4F4OC 6LPRA 1N8OB 3VB3A 4Y7AA 3SQEE 1QCPA 2PUXB 1DANH 2BHGA 1QGFA 2EC9H 1FZZA 5EGMA 1S84A 2SGFE 1T32A 3RXHA 2DE9A 1VITH 3ZVFA 4B73A 5JB8S 3RM2H 2Z9LA 5B6OA 1T31A 1HB0B 1C5XB 1F5RA 1O2YA 1GI0A 1BA8B 1ZYOA 1C1WH 1D3QB 1EZQA 1V2QT 1DITH 1ZSJA 1KLTA 4B1TA 2OINA 2TGAA 3ATKA 1TMTH 2R3YA 4NFEA 2ZPQA 3QGNB 2BDAA 1Y5AT 1BHXB 2QXIA 2ZU4A 3I29A 3GY2A 1LKAA 1NRSH 4MG3A 1UTNA 1GJCB 3GCTF 2Z94A 5ESBA 2BZAA 2FOFA 4AG2A 5JYIA 2VWMA 2BB4A 3UR9A 4WMFA 2O8LA 1YLDA 3PWCA 1SC8U 2ZCHP 4UFDH 5DP4A 3RXRA 4NZQA 2WPMS 3RXKA 2ODYB 1WCZA 4M7GA 2BXUH 3H7OA 2EA3A 3ATLA 5F6MA 1GCDA 2ZNKH 3GY3A 1E34B 3A7ZA 4A5TS 3P8FA 3SV8A 1HJAC 1HRTH 2RG3A 1LPGB 3MH7A 2F9VA 1BITA 1O35A 3RXIA 2FTLE 2BVRH 2BD3A 4ISNA 3M3VA 1F0TA 4D76A 1OOKB 1EXFA 1Z8JB 3SU2A 1FPHH 1DM4B 1GJ7B 1DT2A 1QBVH 2AIQA 2ZDKA 2HPPH 3EQ0H 1P0SH 3TLOA 1UCYE 1IQNA 2SNVA 2ZWLH 5I25A 1HIAA 4YOIA 5AVDA 3DD2H 4OGXA 1P11E 1UCYK 2ANYA 1DFPA 4Y0YE 1OWEA 1FY1A 3LGWA 1SFIA 1P2MA 4CR5A 3ATWA 4BTTB 7ESTE 1U6QA 4IN2A 3SU0A 1EJNA 4TY6A 2ZFPH 1BMNH 4FU8A 4WH8A 5AF9H 4MLFB 3Q3KA 5E2OA 1AVWA 3NZIA 1V2LT 3PV4A 1GDQA 3SV7A 1HJAB 1A5IA 2BD7A 5AFYH 4ZAEA 4FU9A 1JWTA 2A2XH 2ZFRH 8GCHG 3O8CA 3HK6B 1E36B 2VJ1A 3RXCA 2BVXH 1S5SA 1QL7A 3EE0B 3U8OH 4JZFH 2PTNA 4D7FA 5DP5A 2ZHEH 3URCA 1GMHG 1MQ5A 2VVUA 1A5HA 1C5NH 2PTCE 1M9UA 5DP8A 1DE7H 1AUJA 4UFEH 1VGCC 2XYAA 4AYYB 2A45B 2BD5A 4TY7A 4MTBA 1BB0B 3DFJA 2BY7X 3BEFB 1G37A 3MNXA 2BLQA 1CU1A 1W13U 3P70B 1P2NA 1TPSA 5C5NA 3TH3H 4AORA 4NG9H 1C5UA 2DE8A 4X2WA 4X1SU 4AYVB 1OYQA 1ELCA 1CGHA 5GWZA 1N6XA 2FM2A 2C90B 2NU3E 2H9EH 3URDA 1BRUP 2VNTA 4VGCC 4DJZB 2H2ZA 3RLWH 1O3DA 2FOAA 4NFFA 4O9VA 3TK5A 2GV7A 1K28D 1V6DA 3VB6A 4BANB 3RXEA 1P05A 5EW2H 1VGCB 2ZGJA 3ZYDA 3BG4C 3HGPA 4D8NA 2VU8E 3SHAH 2FP7B 1S0QA 5FCKA 1C1VH 3ZZ4A 4B2CA 3T2NA 2B5TB 1YGCH 1QBOA 1UHBA 3TJVA 3TU7H 2VWNA 2PKSC 1IHTH 2Z9IA 2FOMB 1CHGA 3PM3A 1ZMLA 5DK1A 4XBCA 5EPNA 1FI8A 1AE8H 1FIZA 4X1NU 2EEKA 2FYRA 1LQEA 3U1IB 3M7TA 4Q7XA 5C1YA 3UTUH 1W7GH 3CP7A 1G30B 1AFEH 1OSSA 8GCHF 1O2OA 3F1SB 5GCHF 1HUTH 3QWCH 3PMJA 4KKDA 4LK4A 2BY9X 3M36A 5EXLA 1SGCA 4VGCB 1SGNE 3MU4A 1C4V2 1ARCA 1LKBA 1TONA 2G51A 3RC5A 3SHCH 5TCCA 3ZVAA 3LONA 5DO4H 3PMHB 4B76A 3MH5A 2OD3B 3GY7A 2WV5A 1V2ST 1S0RA 1VCQA 2ZP0H 4Q7ZA 1V3XA 1UTKA 3M7QA 1RTLA 4MPXA 1BBRE 3A8BA 4ABEA 3AAVA 4Y10E 3RC6A 3PO1C 2P95A 1BBRK 2A4OA 5EODA 5JBTA 3M5LA 5A0CA 2A31A 1OXGA 2PKSB 2A32A 2GV6A 1UTLM 1LVBA 5GJ4B 2ALVA 1O5EH 6ESTA 2Z3CA 4IC6A 1C1SA 2HNTE 1DXPA 3K6ZA 1WQVH 1O2KA 4XFQA 3ZYEA 4DURA 4CRDA 2YNAA 1A5GH 1O3PB 2Q6DA 2ZDNA 1C2FA 1HAPH 7KMEH 1A61H 4DCDA 1SGDE 1IQGA 2SGQE 4Y7BA 3MHWU 3MYWA 2PHBA 5A0AE 4AN7A 1L4DA 3H7TA 3D49H