1O3LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA02
1O2OA 5T6DA 3U8OH 4UFFH 1EUFA 4U01A 3TK6A 1OX1A 1P3EA 3MO9A 1UO6A 1VGCB 3Q3KA 3WY8A 4GCHG 4BAHB 1T8OA 4X1QU 3GCOA 4FUIA 3P8OA 3GISB 4K5ZA 1TPPA 1GI7B 1ZSLA 2OC1A 1PPFE 1OPHB 2ASUB 1ESTA 1MTNC 3GCHC 1TPAE 2I6QA 3ATMA 1TYNA 4I32A 4MLFB 4O3TA 2RA0A 2QCYA 5HXFA 5C1UA 2SGAA 1SGDE 3ZVDA 1F92A 3HPTB 3O8CA 1YPHC 5HGGA 1N6YA 3KQDA 3SU2A 3B9FH 3BTEE 3RXHA 4DG4A 3F9GA 3LH1A 3SUDA 3E91A 3RMOH 1GPZA 1BQYA 1E38B 3KQCA 3SI3H 1IQKA 1XUIA 5CHAB 3MFJA 1D6RA 1XUHA 4TYDA 3LDXH 2EI8A 3OY6U 2LNCA 4WY3A 2ZU1A 2VGCC 2Y7XA 2AS9A 2GX4A 3ZZ9A 4IS5A 4BAQB 1GDUA 3RLYH 1FY5A 3D23A 2GDEH 3Q3YA 3TVJB 3UWIA 3ZZ7A 1O5CB 2C8YB 5A8YA 1AMHA 2Z6BD 5E2PA 3A7TA 5JBCS 1TAWA 9ESTA 2DE8A 4YOIA 4MDSA 1DFPA 1DVAH 4WMEA 3T25A 1O2RA 1O3KA 1V2TT 2IOTA 2QGRA 3PMBB 5DGJA 3LJOA 3PM3A 2H6MA 4JZEH 3HGPA 2A2QH 3GY5A 3B23B 4YESB 3UTUH 1TBQH 1A46H 3M37A 1NU9A 3B8JA 1ZGVA 4JZIA 4B2AA 1V6DA 3NCLA 4FVBA 4KTCA 2P8OC 1WAYB 3NPSA 1NT1A 1YC0A 1RRKA 1FXYA 4NG9H 3ZZ6A 1A5IA 4IC5A 1HAYB 1O2LA 3RXQA 3ZVGA 2TBSA 5GDSH 2Q6FA 1S0QA 2SGFE 4HTCH 1BRAA 4AYVB 1OP0A 3MNCA 4F49A 2ZQ2A 2KAIA 3G01A 1LO6A 3ZYDA 2B9LA 1LHCH 1RTKA 1XXDA 3ZVAA 3RM2H 1BMLA 1BMAA 2FDAA 4CHAC 1LQEA 4Y8XA 5E2OA 1UTJA 1ZZZA 4ISNA 4FUEA 1QB9A 4TWYA 1TMBH 3BG8A 1KXAA 1O5BB 2G51A 2THFB 4E06H 1IHTH 1WQSA 1C1WH 1GVKB 2VIQA 2CJIA 1O3GA 4INLA 3SZNA 3S9CA 1ZTJA 1FI8A 2BDIA 1HBTH 2VWLA 1C1VH 1ABJH 2AFQB 3MU4A 4Y10E 1P09A 3E8LA 5A09A 1FIZA 1AIXH 3BIVH 2EI7A 1WQVH 4X0WU 5T6FA 2BD7A 2GTBA 4Z0KA 3UR6A 2CHAC 1EPTC 1H9LB 1J14A 1LVMA 1TONA 5K7RA 3RMNH 5DO4H 1EP5A 1TQ7B 1C1QA 1C5QA 2H2ZA 3GDUA 2FX6A 1E36B 8LPRA 1TABE 1FJSA 1MBMA 1MTNB 1HFDA 2P94A 1O2XA 2FYRA 2WV4A 4A7IB 3KF2A 2FS9A 2FOAA 4BXWA 3UPEA 6LPRA 1H9IE 3LH3A 2BQ7B 1SQAA 1YYY1 2WUCA 3Q00A 2HOBA 5AFYH 5DP7A 1YCPH 1KTSB 2ALVA 3ZZ8A 2WYJA 2W3KA 4K1SA 1UK2A 1GMHG 1EOJA 3PB1E 1F5RA 4YLUA 3RU4T 4B76A 2G4TA 2FWWA 1RFNA 3DA9B 4JYVH 4K3JA 3E16B 1DY8A 4YTAA 1NRRH 1XM1A 1TFXA 2ANMH 2ZGHA 3PLKA 4OS6A 1GL1A 5FBEA 2VGCB 2ZU5A 1H1BA 1HAPH 1CGIE 5JBBS 1MQ5A 4DIIH 1QJ1B 1ZPZA 4FU9A 2BHGA 1WBGB 1BB0B 3BTKE 3LC5A 5DPAA 1G3BA 1J15A 1EASA 2STBE 4ZMAH 1A61H 1E34B 2ULLA 3E0PB 1K1LA 1H8IH 1IQGA 2BM2A 4TY6A 4OS7A 5DP3A 1A5HA 4NIWA 1IQFA 1AFQB 3V7TA 5F8TA 1ZPBA 2O8UA 7ESTE 5A0AE 1IQIA 1TNGA 5DG6A 2UUKB 1GG6B 1O3IA 2HRVA 5EQSA 1UTNA 3RXUA 3V12A 4O3UA 4O03A 2ZF0H 2FX4A 1C5SA 4X6PA 1V2OT 1TGNA 2XC5A 8GCHF 3BTWE 3EDXB 1IOEA 3LGWA 1P2QA 1GVZA 2OQ5A 4YZUA 1P2OA 3NXPA 3TGKE 4WH6A 3GYLB 2PV9B 1QHRB 1GHXH 4AYYB 1X7AC 2FI3E 1O0DH 1YKTA 4MPWA 4Y76A 2XC4A 3ZZAA 3M5LA 3PTBA 4ZHLU 5FCRA 5CMXH 3PMAB 2EC9H 4D76A 3UR9A 5C5OA 2ZTXA 1MU8B 5FHTA 4MPUA 1L4DA 1A0LA 1S82A 1ZMNA 1P8VC 2HALA 1PPZA 1EJMA 1CT0E 1KLTA 4YOJA 4ISOA 1VCPA 4X2WA 5FX6A 1H9HE 1XMNB 3KNXA 3MI4A 1SMFE 2OLGA 2XC0A 1SGNE 4KTUA 8KME2 1V2NT 2WPJS 1OWDA 1RTFB 1O3CA 3DFJA 3SUGA 1SOTA 3A89A 1GBLA 4INKA 1W12U 1QGFA 2PSYA 4A6LA 1AVGH 2CF9H 1O2TA 1EKBB 3MU8A 2CHAB 2GMTC 1C1MA 3U9AH 4X8UH 3EAJA 1O3OA 2BY5X 1HJAC 3QZRA 1ARBA 1GBIA 3SHAH 1ZJDA 1HAIH 1HAZB 4AFSA 3A83A 3QUMP 1SB1H 3A86A 1HAOH 1SGPE 2PTNA 3ZZ3A 1QR3E 1NTPA 2ANKH 4K60A 4M7GA 1MKWH 1O5EH 1CVWH 3NWUA 1C5XB 1RD3B 1TNIA 2CF8H 1IQEA 1BRBE 2A4RA 2GGVB 1S83A 1GHBF 4ZKRU 1NU7B 4ABAA 1C1PA 1UTQA 3SORA 4I31A 1OWKA 3ITIA 4RSPA 1NFWA 2FP7B 3RXCA 3MH7A 1UHBA 3AASA 2J95A 2QY0B 5LPEA 3MNBA 4FUHA 1BMMH 2Y5GA 3MNXA 1NO9H 1XVOA 1THSH 3QN7A 2G8TA 4X1NU 3UREA 1P12E 1EZXC 1MZAA 2FOBA 3U8RH 3FZDA 1D6WA 3T5FH 3F68H 4RN6A 1HIAB 2BDCA 1SSXA 3RXOA 3FP7E 4CH8B 1AO5A 1RTLA 1O3FA 1XX9A 3EA7A 3GY2A 2ALPA 4YM9A 1EJNA 1MTSA 3U98H 5GCHG 3M5OA 1TPOA 3HKIB 4ZXXH 2V0BA 1MMJN 1Z8JB 1TGTA 1CT2E 1XVMA 2ZKSA 4GHTA 4X2YA 1KXCA 1P10A 4MNVA 2OTVA 4CRBA 1EAXA 1V2VT 3RXAA 3PYHA 4DCDA 2O9QA 1GJBB 1RIWB 1T32A 3BEFB 1O35A 4LK4A 4KGAA 3MH6A 4HZHA 1GCDA 4ZHAA 1G9IE 3W94A 5F6MA 4Q2KA 4AORA 4JK5A 1SR5C 1HJ8A 4I8LA 3IWMA 1HCGA 1LPGB 3DD2H 5TCCA 1ZHPA 3ATIA 3DT0H 1ABIH 2BY9X 3M5NA 1XUFA 2B7DH 1QJ6B 4AZ2B 1WCZA 1F0TA 3T2NA 3K6ZA 3ZVEA 1O2UA 4YLQH 4UONA 1F0UA 2WPLS 1CA8B 1C5WB 1P0SH 2ZG0H 1RS0A 1CHOG 1GBDA 3W95A 4WXIA 2FOHA 2AEIH 2GMTB 4ZH8A 2TRMA 1QBNA 1HDTH 3SJKA 4FU7A 3OY5U 2XTTB 1C2LA 1E0FD 1NM6A 2FIRH 3PMJA 1O3NA 2BY6X 3A8BA 1V2LT 2M5TA 2YNAA 4IBLH 2OBQA 4CRDA 3E3TA 2PW8H 1UVSH 3DFLA 1GJ4H 5A0CA 3GCTG 1V2ST 4GPGA 1VITG 1N6XA 5GIBA 1C1NA 1V2MT 3FANA 1HJ9A 2BDYA 1QRWA 4FUCA 1GI1A 1ZMLA 1W14U 3A88A 2ZWLH 4X1RU 4WMDA 2XBVA 4ZROA 4B73A 1VZQH 3BIUH 1LHFH 5DJ7A 1NRQH 1PPCE 4ABBA 3SU3A 4A1TA 1T31A 4JK6A 3SOSA 5F8ZA 1MQ6A 4AOQA 1C5VA 3TJUA 1YLCA 3RUOA 1C2GA 2AH4X 2OP9A 3BG4C 3RXPA 1OWIA 3ZZDA 2ZCHP 2BB4A 3VXFH 2VNTA 3F9HA 4BAOB 1TE0A 4XBBA 4U2WA 5EODA 1BTHH 3ATWA 3HATH 4WWYA 3SU0A 3NKKA 2WPHS 2QAAA 4DOQA 1BTUA 2ZC9H 1P57B 1P3CA 1EB1H 3ODFA 4H42U 3ODDA 4ABGA 1T8MA 4D7FA 2BLOA 1QCPA 3RXGA 4X2XA 3M3TA 3ZYEA 1TRMA 5F8XA 5AVDA 4YOGA 4Q7XA 4BAMB 2ZFQH 4WVPE 1ELVA 2ILNA 1OYQA 3RXFA 3SV7A 2A4QA 4B75A 1ORFA 1TNLA 4RKJB 4AN7A 5EG4A 1TBRH 1AGJA 1GI8B 1DXWA 1BBRH 3UOPA 2P93A 5JB8S 1D9IA 3KGPA 4K8BA 4OS1A 2OINA 4D9RA 1BBRE 1L4ZA 1FNIA 3STIA 2WUBA 3AAVA 4UEHH 1ETRH 4ABIA 1TPSA 3KHVA 2ZFTA 1GMDG 4MG3A 4MVNA 2P3TB 1EXFA 3LT3A 3RC6A 1GVLA 1MAXA 1N1LA 1PPBH 2XYAA 3Q3XA 1DSTA 1U6QA 2BZAA 2WPKS 1F0RA 3BEIB 3MU0A 1UHBB 2OQUA 1QFKH 1MTVA 1GHAG 3UIRA 1HNEE 3M7UA 1AE8H 3P95A 4JZDH 1NN6A 4B74A 3PWCA 2HLCA 4WJG2 1NPMA 5T3HA 4ABEA 3M7QA 3GY6A 2XCFA 1ELEE 2GP9B 1SL3A 1C5NH 1SGQE 1KIGH 1MH0A 5EW1H 2BD5A 1VJAU 3H5CB 1B0FA 1LDTT 1DLEA 3PO1B 1J9CH 1W10U 1G30B 2QF3A 2W26A 2WPMS 5A0BA 1BUIA 1QQUA 2TGAA 1DXPA 2P3FH 3RXBA 3BTTE 1AY6H 1KXEA 2HGTH 6CHAC 1V2UT 1N8OC 2PFEA 1BJUA 4NFEA 3HKJB 1J17T 3TJOA 2C3SA 4HGCA 3JZ1B 1V2PT 1NS3A 4ISIH 2QC2A 1SLWB 1W0YH 1BITA 4AGJA 2V35A 2Y82A 2B8OH 5FPYA 2F9PA 1FIWA 1EPTA 1TLDA 4ZXYH 1XUGA 1VR1H 4MNWA 3SUEA 5C3NA 2SFAA 5EU8A 1Z1JA 1CBWB 1GCTC 1LTOA 1VCWA 2ZU3A 3F9FA 3EGKH 4DY7B 2F9NA 5DKMA 4KELA 1TB6H 2RG3A 2SNVA 2Y80A 4O97A 1C2DA 1ELFA 1UTMA 2HPPH 1L1JA 3SQHE 2ZO3H 1Y3XA 3M7TA 1T4VH 1QBVH 2STAE 1C5YB 3S9AA 3PMHB 1DM4B 1SGIB 3URCA 2BMGB 4XFQA 4CREA 1AFEH 2QXIA 5K0HA 1KYNA 1TOMH 3URDA 1EATA 2Y6TA 5TJXA 2OC0A 1P9UA 3TU7H 4IMQA 1EAIA 5C67A 1YPKH 4Q80A 1GI9B 3KCGH 4CRFA 3SNAA 2NU0E 3MOCA 1J8AA 3F1SB 3AW0A 4O9VA 2D8WA 2FEQH 3ZZ4A 2TGPZ 1GGDC 2SNWA 2ZIQH 4VGCC 2F9UA 2UWLA 1FLEE 4DIHH 4UD9H 1HIAA 1FN6A 2H9TH 2QV1A 5DP8A 3GCTF 2PKSC 1AE5A 2R0LA 1UTOA 4X6MA 1P01A 1ANBA 5FXLA 1O2JA 3RXEA 2VVVA 2ZGBH 1BRUP 1FMGA 1HAVA 1LHEH 1TNKA 2FESH 2ZHFH 8ESTE 1ELBA 2D2DA 2VWMA 1MU6B 4HI3A 4IC6A 1O2NA 5DP4A 1AU8A 4A92A 2CGAA 1YPJH 2BY8X 1ZR0A 1F2SE 4HFPB 5GWZA 2TPIZ 3A84A 3A87A 1ACBE 3GCHB 1SLUB 2ZPSA 3CS0A 1CGJE 2BXTH 5E0HA 4R8TB 2GV7A 4I7YH 3SGAE 1HAXB 1DWDH 4U30A 3FP8E 2HWLB 5AF9H 3MHWU 3HK3B 2VINA 2Z3DA 1BHXF 3GY7A 3VB4A 1QL7A 2D1JA 2ZA5A 2W3IA 2D26C 2O8MA 2R0KA 4MQAA 1JBUH 1XKAC 2ZGCA 1V2RT 2PTCE 3BN9A 5I46H 1QRZA 2PGBB 3QX5H 1BTWA 1JIRA 6CHAB 1OYTH 3SV9A 1C5PA 1SC8U 1W8BH 2VH6A 3RC5A 7GCHG 2NWNA 5E0JA 4KKDA 3BV9B 1GJAB 2Z9IA 1O31A 4LOYH 1YPMH 3UOUA 1ZTLA 1THRH 1WOFA 1OWHA 2ANYA 4I8KA 1CGHA 3UFAA 1L1NA 1AVXA 1P2MA 1P02A 3FFGA 2ZPQA 1A4WH 4BOHA 1BA8B 1KTTB 3PWBA 4D8NA 1NESE 3ENSB 1GJ9B 4GSOA 1O2KA 1KY9A 1O3LA 2P3UB 1ZHRA 2G00A 2VIPA 1MD7A 1K9OE 1LHGH 1WV7H 2F9VA 4GCHF 2GZ7A 1A3BH 3SJ9A 1B5GH 1J16A 1G3EA 3GOVB 3U8TH 1GHAF 1GBEA 2P8OB 1GMCG 1O34A 3QDZB 3T26A 2XWAA 2A5AA 1EB2A 1UCYE 4MPVA 1EP6A 5HMAA 3RXSA 3UY9A 2QXGA 2FTMA 1QTFA 1ZJKA 1O37A 3QTOH 3SU5A 3UWJH 3D65E 1AD8H 1NRNH 3LGVA 2F91A 2CXVA 3C27B 4J1YA 5J4QA 2V3OH 1ZSKA 3CS7A 3H7TA 2BDHA 1ELCA 4B1TA 1HB0B 1K28D 2LPRA 3LIWA 1C5UA 2ZEBA 3M61U 4FXGH 4CHAB 2I6SA 1P2IA 2ODYB 2FZZA 1TA6A 1O3JA 2G81E 1C1SA 1WU1A 1YLDA 3L6PA 5EGMA 3GY4A 3SUFA 2GCHG 1GGDB 1K1PA 4VGCB 1VJ9U 2A2XH 1JOUB 3JZ2B 1MKXH 4X1PU 2ZFPH 2FMJA 1A1RA 4BTIB 1ETSH 2BYAX 1D3QB 2GKVE 4Y11E 3K65B 1ELTA 4WMFA 1FZZA 1W2KH 3C1KA 5AHGH 2SGPE 3RDZA 3PLPA 2JETC 1EPTB 2BOHB 1O3EA 1W7XH 1ELGA 1M9UA 4UE7H 1AI8H 4ABJA 3ZV8A 4OS5A 2ZDLA 3KQEA 2A5KA 4A1VA 3R0FA 5G4BA 3TH3H 1TX7A 3ZZBA 2ZHDA 2C4FH 4AB9A 2Q1JA 2ZDNA 4AG1A 4JYUH 1GJ6A 2XWBI 3IG6B 3MH4A 4NSVA 1JMOH 1PQAA 1FPHH 1PPGE 4CRGA 5FAHA 1P11E 1UVTH 5DK1A 1Z71A 2QXJA 3BTDE 1Z8RA 1YP9A 4IW4E 2H5CA 3RXRA 4AFQA 1W11U 2TGDA 2ZPRA 1C5RA 2FI5E 4MPXA 2F9OA 4PROA 5ESTE 3OU0A 4Y8ZA 4NGAH 1ETTH 1NFYA 4ISHH 1NFUA 4K8YA 2BTCE 3A8CA 1Z1IA 2Q6DA 1FV9A 2J92A 2ZFSA 1BTZA 2BX4A 5C1XA 3TK5A 1RJXB 4JZFH 1YCPK 1C2HA 1MBQA 3MTYA 1OXGA 1SLVB 1UK3A 1UVOA 3ELAH 3BF6H 1XUJA 1BTPA 1AHTH 1ZYOA 1LQDB 1GHZA 2F83A 2W7SA 4GHQA 2GZ8A 3LGYA 1LVOA 5A2MH 1UVUH 1S6HA 1PJPA 3U1JB 2Y7ZA 3QWCH 1O5GH 1A5GH 1HAVB 3E6PH 5EPNA 2Z9LA 1PPEE 2J2UA 2VU8E 3LGIA 4GLYA 1LVYA 4H6TA 4B2BA 4WXVA 3M3VA 1Q31A 2GT8A 1Y59T 3AVZA 1HUTH 4BANB 4I8JA 4OGXA 1HV7A 2XNIA 1JRTA 4BTTB 1SGTA 2Z9GA 1CO7E 2A32A 1SPJA 2C8ZB 2PKAA 1O2ZA 3D62A 3DUXH 3VGCC 1OKXA 1S84A 3EA9A 2J4IA 1EOLA 1TX6A 2F3CE 1TGBA 5C20A 1EZSC 3STJA 1A3EH 1CU1A 4JYTA 1GMHF 1O38A 2G4UA 4ZKOU 5EXMA 2GT7A 4MTBA 1GWAA 3RU4E 1HAGE 2BY7X 2BLWA 1Z6JH 1L2EA 1HXFH 3HGNA 2AGIX 1DE7H 1WUNH 1UMAH 1GI0A 1GJ7B 2VH0A 2C8WB 2CN0H 2VB0A 4I33A 1TQ0B 2PGQB 2OD3B 1F5LA 1TOCB 2EI6A 5CE1A 2ZQ1A 2EEKA 1C2MA 1TMUH 4F4OC 3MWIU 2OUAA 2YOLA 2BD8A 2TIOA 5EXLA 7LPRA 1Z7KA 1K21H 1Y8TA 4JZ1A 1DWEH 1UVPA 1XXFA 1CT4E 2ODQA 3P92A 2JETB 4Q7ZA 4AGKA 2YNBA 2G5VA 1UTKA 4NA7A 2ZDAH 4UFDH 5FBIA 1QL8A 1V2WT 1HJAB 1ANCA 2AYWA 1QY6A 1NFXA 1GHVH 4NA8A 1GJ8B 1C1UH 1P9SA 3GDSA 5FCKA 4E05H 1YPGH 2H9EH 1C1OA 4NWKA 1AWHB 5FX5A 3I78A 3SU4A 1GMCF 2ZTZA 3KEEA 2FOEA 3U1IB 1C9PA 3AAUA 4NIXA 2BXUH 3SV8A 1UTLM 1C5OH 2FPZA 3KIDU 1K1JA 3A7YA 3UNSA 5DP9A 1PQ5A 3VXEH 3SNCA 2Z9JA 1GBCA 3BSQA 1MZDA 1QIXB 5CHAC 4AX9H 2FLRH 2HNTF 3OSYA 4OGYA 3PROA 5JBAS 1O32A 1KLIH 3E0NB 3GY8A 3EA8A 2ZNKH 1NROH 1MKWK 1O3HA 2QA9E 2RCEA 4FUJA 1TGSZ 2PUQH 1ANDA 1P2KA 1DANH 2ZDMA 1CE5A 1O2YA 1A0JA 1FY3A 4NCYA 2CMYA 2FM2A 1DWCH 3SU1A 1TA2A 3LOXA 1BJVA 4Y71A 3KQBA 1MUEB 1EJAA 3RXTA 3IITA 3S0NA 4NSYA 1P2NA 1QQ4A 2ZDKA 4NIVA 1TMTH 2Z9KA 1ZMJA 2AGGX 2OC8A 1YPLH 1ESAA 2ZHEH 1FY8E 4SGAE 4AB8A 2QF0A 3SGQE 4ESTE 1DDJA 2ZHWH 1L1GA 3UNRA 2H5DA 3MH5A 1V3XA 1W7GH 3P8GA 1PQ7A 3VB6A 3QO6A 2UWOA 5LH8A 1TX8A 1PYTC 1CA0C 1K1MA 1AKSB 5F03A 2A7CA 4LZ1H 1SG8B 1PPHE 3MMGA 1T8LA 2BVSH 1O36A 2JKHA 4ZKNU 4RKOB 3DHKH 4Y7BA 4A5TS 4XDEA 4XOJA 5JBTA 2BLQA 4INHA 1ESBA 2XBYA 1ZTKA 2NU2E 4GUXA 1C2KA 4WH8A 3NZIA 1SHHB 1QJ7B 2FO9A 4NIYA 1OSSA 2O8WA 1ZGIA 3I29A 4X8VH 6ESTA 2Z3CA 2HVXA 1MD8A 3SW2B 1AZ8A 1AN1E 1OOKB 5SGAE 2NU3E 2V6NA 4X2VA 4ZHMU 1MAYA 1KDQB 1O2SA 2TGTA 1OP8A 1TGCA 3BTFE 1VCQA 3RXIA 2EA3A 3K9XB 4MNYA 3V0XA 1GHYH 2A0QB 3SHCH 8GCHG 4D7GA 5GCHF 3TNSA 1GJCB 2ZTYA 1IQLA 1QB1A 3RMLH 2C93B 3L3TA 1Y3WA 3FVFB 4ZKSU 1S85A 3FP6E 2ZZUH 2DE9A 2PWXA 3MU1A 1FPCH 3V13A 1TNJA 3UQOA 4K69A 3RXDA 4XBDA 3UQVA 1FY4A 2Z3EA 1YCPM 1Y3UA 1LKBA 1P06A 4NA9H 1T8NA 1SHYA 2PKAB 1ID5H 3I77A 5L30H 5TCAA 2O8TA 2PR3A 2FOMB 3MO6A 1EAWA 2A7JA 2G52A 2IJOB 1TNHA 3P8FA 1DSUA 3SI4H 2AGEX 1BDAA 5HM9A 1AZZA 2R9PA 1V2KT 1O5AB 3TGIE 1ZRKA 2Y81A 1QRXA 4Y7AA 4YT6H 3GCNA 2PUXB 3BG4B 1WSSH 1Z8IB 2BOKA 1O3MA 1SFQB 1K22H 2JH5D 3SNDA 3S7HB 1C5TA 2OCVB 1SI5H 1DUAA 1TWXB 1F7ZA 1IQJA 1GBJA 5FPSA 4E7RG 4IMZA 3P17H 4BNRA 4ABFA 2C90B 3RMMH 1O3DA 2VIVA 3T29A 3SQEE 1AB9C 2ZHQH 1WTHD 4B71A 3RLWH 6GCHG 2SGEE 1AFQC 1GDQA 2ZCKP 1QURH 4DT7B 4BXSA 3PV4A 4LXBH 1CHOF 1GG6C 2RDLA 1QA0A 3OTJE 2ZI2H 2P59A 4K2YA 1O2QA 3M3SA 1GI2A 1E37B 5IYTA 4JMYA 1GBMA 4ISLA 3FZZA 3LKWA 5A8XA 1MCVA 1E35B 1O3AA 4IN1A 5EXNA 4TPYA 3TJNA 1LKAA 1YPEH 4MNXA 1O30A 1W0ZU 1DITH 2R3YA 4CR5A 5EOKA 3SU6A 4I8GA 1C5LH 1CA0B 1C4U2 2FI4E 2IPHA 2QN5T 1TALA 3HK6B 4OS4A 1HRTH 1GHBG 4BTUB 2UUJB 3VB3A 2ESTE 1P04A 1GBTA 1NRPH 1VITF 2CV3A 2RA3A 5FPTA 3VFEA 1TRNA 1FUJA 2XBWA 1SGFA 2R2MB 1HLTH 1BBRK 2UUFB 3P8NA 4FVDA 4YT7H 1H4WA 5E0GA 5BPEA 5GJ4B 5HM2A 1OP2A 3QGJA 1KLJH 1G36A 1QA7A 2FOGA 3E90B 1LPKB 4TWWA 3ZVFA 1Y3YA 1SQTA 1A7SA 2AMDA 5C2ZA 1SFIA 1G37A 3SNBA 2XRCA 2OXSA 2BX3A 3NUMA 1B7XB 1OWJA 3A8AA 1O2HA 4ASHA 3EQ0H 3Q76A 2XCNA 1S6FA 3VB7A 1BOQA 1WYKA 2BD9A 1ELAA 2VIOA 3MYWA 4NWLA 3SN8A 3T27A 5LPFA 1DY9A 3FAOA 2FYQA 1HGTH 3ATLA 1NY22 2B5TB 3KN2A 4K1EA 3ESTA 1GI5A 2ODPA 3LONA 3QZQA 4DVAU 3QLPH 3ZZ5A 7KMEH 5L6NH 2DUCA 1N8OB 1EX3A 2GDDA 3CP7A 3LGTA 2BQ6B 1C4Y2 4FUGA 3SO3A 2FXRA 1MTUA 2A7HA 3TJVA 1IQHA 1JIMA 2VJ1A 2BLVA 2P16A 1ANEA 1KSNA 1NC6A 1F0SA 2JH0D 3VEQB 1EZUC 1Q3XA 3A8DA 1C2IA 3SV2H 4ABDA 2OBOA 2ZECA 1GMDF 1K2I1 5ABWA 1D4PB 1BRCE 1YF4A 1TBZH 2J9NA 3GY3A 3BTME 2QXHA 3M35A 5J4SA 1ZPCA 2W7UA 4D9QA 1RGQA 3ZV9A 1W13U 1SGRE 5C5NA 3BTHE 1GCTB 1THPB 4XE4A 3TPIZ 1AUTC 1UCYH 4X8TH 1GI3A 3TH4H 1FN8A 5EW2H 1T4UH 2AMPA 2BDGA 3A82A 4Q7YA 2Y5HA 1PFXC 2W5EA 1O2GH 1AWFH 3A80A 1AB9B 1SOZA 1UJ1A 2ZDVH 3T28A 4CRCA 4KTSA 2H9HA 1F5KU 4Y8YA 1D3TB 5L2ZH 1LVBA 2A1DB 1ZHMA 1GBHA 2BDBA 1D3DB 3RXJA 3SJOA 1C5ZB 2XW9A 4X6OA 4CH2B 1IHSH 1SGEE 2GCTC 2GZ9A 3D49H 3RXLA 3EYDA 1FAXA 1DOJA 1EQ9A 1JRSA 2FODA 3K6YA 1ZRBA 1BMNH 4X8SH 9LPRA 2HPQH 1RIWC 1G3CA 1O33A 4SGBE 1Y5AT 1YBWA 1XKBC 2R3UA 1DX5M 1GJDB 1O5DH 2A45B 2GD4B 2AIQA 2OC7A 1O2VA 5BRRE 2PHBA 1IQNA 2PKSB 3A7ZA 2A4GA 2BQWB 1C4V2 1AVWA 5HYOA 2FS8A 1Z6EA 1P2JA 4NZQA 3TGJE 1S81A 1NZQH 2BZ6H 2QYIA 3P70B 4Y0YE 3QTVH 3RXKA 2WPIS 3OX7U 1DLKB 2QIQA 3LC3A 1FONA 3S9BA 1O2WA 3EE0B 1LHDH 1DUEA 1G2LA 3SNEA 4H6SB 3BEUA 3LGUA 5E8EH 1BZXE 1JXPA 1SGCA 2K1QA 1NRSH 5AFZH 3TITA 3BTGE 4ABHA 1OWEA 4CR9A 2BDAA 2VWOA 1S0RA 1AKSA 2J38A 1OS8A 4CBNA 2V3HH 4U32A 5JDUB 1SVPA 1G2MA 6GCHF 1K1OA 4ZAEA 4LZ4B 2A4OA 1LCYA 2BVRH 5JYIA 1H8DH 5EQRA 3O8DA 5DP5A 3S69A 3VPKA 3TNTA 1Q2WA 3L33A 1GBBA 1P03A 3BTQE 2O8LA 3A7XA 5GXPA 3MNSA 3PLBA 4J2YB 2JH6D 2HNTE 1PQ8A 2VIDA 3NK8A 2BD4A 2VVCA 1Z8GA 5T6GA 4Y79A 1GJ5H 4ZUHA 4JCNA 1O39A 1C9TA 1PYTD 4FUDA 1L0ZA 4UFGH 1O2PA 2KAIB 1C1RA 1BHXB 5I25A 1UK4A 1ARCA 2XXLA 1KDQA 3RC4A 2G5NA 1TIOA 3Q77A 2NU1E 1O2MA 3H7OA 2WYGA 2ZFFH 4UFEH 3RXVA 1MCTA 3SGBE 2AIPA 3K2UA 2ZU2A 2XBXA 1S5SA 3ZVBA 2Y5FA 4DJZB 1Y5UT 5C1YA 1WTGH 1A2CH 1C2JA 1KXFA 1QBOA 1KXDA 1AUJA 1QNJA 3RU4D 2FOCA 1P05A 2J94A 1B0EA 1HYLA 5GPIB 3R3GB 1UCYK 4X6NA 1IQMA 1FQ3A 1GBAA 1GBFA 2AMQA 2GCTB 2P95A 2BVXH 2WV5A 3O8BA 3UNQA 2VWNA 1JWTA 3QGNB 3RXMA 2SGQE 4IGDA 2VIWA 1C2FA 5EQQA 2GVFA 3N7OA 1C2EA 1GL0E 1LPZB 1G32B 3MO3A 1BTYA 4I8HA 4R0IA 4AG2A 1Y3VA 3P6ZB 3MU5A 5B6OA 7GCHF 2G55A 2BD3A 1HPGA 1BIOA 2Q6GA 4E7NA 1SLXB 1GI6A 1VGCC 1KXBA 2H1UA 4NFFA 1FDPA 3AW1A 4DURA 1YM0A 1YPHE 2ZGXH 1V2JT 2UUYA 2FTLE 4XBCA 3ATKA 4THNH 3PTNA 1SBWA 2J34A 2IN2A 1MKXK 3LPRA 3TH2H 4OS2A 3OYPA 2GV6A 1DWBH 1W3CA 4TY7A 1T7CA 3F9EA 5LPRA 2B0FA 1O3BA 4X1SU 1YGCH 4YO9A 1QB6A 3GDVA 1G3DA 3A7WA 2SGDE 1SGYE 1EAUA 1C5MD 4DW2U 2F9BH 1DS2E 4FUBA 4Y0ZE 4KP0A 4UDWH 3ZVCA 3A7VA 3PO1C 5DP6A 4AFZA 1XUKA 1O5FH 1GHWH 4DGJA 1D3PB 4B2CA 2AERH 2VVUA 1CSOE 2PLXA 1DT2A 4XSKU 1A0HB 4GVUA 1BCUH 5ETXA 2ZU4A 3SJ8A 2C8XB 3TLOA 1MTWA 4H4FA 2A5IA 3GICB 4AFUA 1EZQA 1ZOMA 2Z94A 1HXEH 4QT8C 1ZLRA 1V2QT 3LJJA 4BAKB 2PSXA 4WF8A 5L2YH 1O2IA 3GYMA 2GCHF 4GAWA 1UTPA 1CHGA 2UWPA 1FY1A 2FLBH 1AQ7A 2R2WU 5H4IB 4FUFA 2ZFRH 5JB9S 3SBKA 1DPOA 1ELDE 1GI4A 1SQOA 1GBKA 1IAUA 3F6UH 4NZLA 2BD2A 4TPIZ 1ZSJA 1RXPA 2WINI 2HNTC 3VB5A 1Y5BT 5JPMH 1CBWC 1K1NA 5A8ZA 1K1IA 4A1XA 4IN2A 4CRAA 1LMWB 1INCA 3T62A 3CENA 1DICA 2Z7FE 3M36A 4CBOA 1FAKH 2FOFA 2ZCLP 1O3PB 3SJIA 2A31A 3LU9B 5PTPA 3TK9A 5EPYA 3S7KB 4Y6DA 1BT7A 2ZGJA 3VGCB 2NU4E 1BTXA 1TRYA 1SGFG 1GDNA 3A85A 5ESBA 3RP2A 4Z6AH 3V3MA 3RM0H 3QK1A 1HAHH 1CQQA 2ZP0H 1C1TA 3KL6A 3M5MA 2ANWA 3TIUA 3UUZA 4FU8A 1QL9A 3SV6A 5IDKA 1VITH 4K1TA 3E1XB 3U69H 3ZZCA 5LGOA 3A81A 3O8RA
chains in the Genus database with same CATH superfamily
1O2OA 5T6DA 3U8OH 4UFFH 1EUFA 4RI0A 4U01A 3TK6A 1OX1A 1P3EA 3MO9A 1UO6A 2V7QD 1VGCB 3Q3KA 3WY8A 4GCHG 4BAHB 1T8OA 3FO8D 4X1QU 3GCOA 4FUIA 2AHME 3P8OA 3GISB 4K5ZA 1TPPA 1GI7B 1ZSLA 2OC1A 1PPFE 1OPHB 2ASUB 1ESTA 1MTNC 3UAIC 3GCHC 1TPAE 2I6QA 3ATMA 1TYNA 4I32A 4MLFB 4O3TA 2RA0A 2QCYA 5HXFA 5C1UA 2SGAA 1SGDE 3ZVDA 1F92A 3HPTB 3O8CA 3AK5A 1YPHC 5HGGA 1N6YA 3KQDA 4I86A 3B9FH 3BTEE 3RXHA 3SU2A 4DG4A 3F9GA 3LH1A 3OAAD 3SUDA 3E91A 3RMOH 1GPZA 1BQYA 1E38B 3KQCA 5CHBA 3SI3H 1IQKA 1XUIA 5CHAB 3MFJA 1D6RA 1XUHA 4TYDA 2J98A 3LDXH 2EI8A 3OY6U 2LNCA 4WY3A 2ZU1A 3OFND 4ZCNA 2VGCC 2Y7XA 2AS9A 2GX4A 3ZZ9A 4IS5A 4BAQB 1GDUA 3RLYH 1FY5A 3D23A 2GDEH 3Q3YA 3TVJB 3UWIA 3ZZ7A 1O5CB 2C8YB 5A8YA 1AMHA 2Z6BD 5E2PA 3A7TA 5JBCS 1TAWA 9ESTA 2DE8A 4YOIA 4MDSA 1DFPA 1DVAH 4WMEA 3T25A 1O2RA 1O3KA 1QZ8A 1V2TT 2IOTA 2QGRA 3PMBB 5DGJA 3LJOA 3PM3A 2H6MA 4JZEH 3HGPA 2A2QH 3GY5A 3B23B 4YESB 3UTUH 1TBQH 1A46H 3M37A 4OM9A 1NU9A 3B8JA 1ZGVA 4JZIA 4B2AA 1V6DA 3NCLA 2EQNA 4FVBA 4KTCA 2P8OC 5C0TA 1WAYB 3NPSA 1NT1A 1YC0A 1RRKA 1FXYA 4NG9H 3ZZ6A 1A5IA 4IC5A 2V3MA 1HAYB 1O2LA 3RXQA 3ZVGA 2TBSA 5GDSH 1SKYE 2Q6FA 1S0QA 2SGFE 4HTCH 1BRAA 4AYVB 1OP0A 3MNCA 4F49A 2ZQ2A 2KAIA 3G01A 1LO6A 3ZYDA 2B9LA 1LHCH 1RTKA 1XXDA 3ZVAA 3RM2H 1BMLA 1BMAA 2FDAA 4CHAC 1LQEA 4Y8XA 5E2OA 1UTJA 5GNDA 5EJ1A 1ZZZA 4ISNA 4FUEA 1QB9A 4TWYA 1TMBH 2J5UA 3BG8A 1KXAA 1O5BB 2G51A 2THFB 4E06H 1IHTH 1WQSA 1C1WH 1GVKB 2VIQA 2CJIA 1O3GA 4INLA 3SZNA 3S9CA 1ZTJA 1FI8A 2BDIA 1HBTH 2VWLA 1C1VH 1ABJH 2AFQB 3MU4A 4Y10E 1P09A 3E8LA 5A09A 1FIZA 1AIXH 3BIVH 2EI7A 1WQVH 4X0WU 5T6FA 2BD7A 2GTBA 4Z0KA 3UR6A 2CHAC 1EPTC 1H9LB 1J14A 1LVMA 1SQRA 1TONA 3RMNH 5K7RA 1EP5A 5DO4H 1TQ7B 1C1QA 1C5QA 2H2ZA 3GDUA 2FX6A 1E36B 8LPRA 1TABE 1FJSA 1MBMA 1MTNB 1HFDA 2P94A 1O2XA 2FYRA 2WV4A 4A7IB 3KF2A 2FS9A 2FOAA 4BXWA 3UPEA 6LPRA 1H9IE 3FOAA 3LH3A 2BQ7B 4ACBA 1SQAA 1YYY1 2WUCA 3Q00A 2HOBA 5AFYH 4F55A 5DP7A 1YCPH 1KTSB 2ALVA 3ZZ8A 2WYJA 2W3KA 4K1SA 1UK2A 1GMHG 1EOJA 3PB1E 1F5RA 4YLUA 3RU4T 4B76A 3UB0A 2G4TA 2FWWA 1RFNA 3DA9B 4RT1A 4JYVH 4K3JA 2KM0A 3E16B 1DY8A 4YTAA 1NRRH 1XM1A 1TFXA 2ANMH 2ZGHA 3PLKA 4OS6A 1GL1A 5FBEA 2VGCB 2ZU5A 1H1BA 1HAPH 1CGIE 5JBBS 1MQ5A 4DIIH 1QJ1B 1ZPZA 4FU9A 2BHGA 1WBGB 1BB0B 3BTKE 3LC5A 5DPAA 1G3BA 1J15A 1EASA 2STBE 4ZMAH 1A61H 1E34B 2ULLA 3E0PB 1K1LA 1H8IH 1IQGA 2BM2A 4TY6A 4OS7A 5DP3A 1A5HA 4NIWA 1IQFA 1AFQB 3V7TA 5F8TA 1ZPBA 2O8UA 7ESTE 5A0AE 5IK2D 1IQIA 1TNGA 5DG6A 2UUKB 1GG6B 1O3IA 2HRVA 5EQSA 1UTNA 3RXUA 3V12A 4O3UA 4O03A 2ZF0H 2FX4A 1C5SA 4RT0A 4X6PA 1V2OT 1TGNA 2XC5A 8GCHF 3BTWE 3EDXB 1IOEA 3LGWA 1P2QA 1GVZA 2OQ5A 4YZUA 1P2OA 3NXPA 3TGKE 4WH6A 3GYLB 2PV9B 1QHRB 1GHXH 4AYYB 1X7AC 2FI3E 1O0DH 1YKTA 4MPWA 4Y76A 2XC4A 3ZZAA 3M5LA 3PTBA 4ZHLU 5FCRA 5CMXH 3PMAB 2EC9H 4D76A 2F4LA 3UR9A 5C5OA 4P00A 2ZTXA 1MU8B 5FHTA 4MPUA 1L4DA 1A0LA 1S82A 1ZMNA 1WXRA 1P8VC 2HALA 1PPZA 1EJMA 2J98B 1CT0E 1KLTA 4YOJA 4ISOA 1VCPA 3SZEA 4X2WA 5FX6A 1H9HE 1XMNB 3KNXA 4ACAA 3MI4A 1SMFE 2OLGA 2XC0A 1SGNE 4KTUA 2K8IA 8KME2 4P02A 1V2NT 2WPJS 1OWDA 1RTFB 1O3CA 3DFJA 1YLNA 3SUGA 1UW7A 1SOTA 3A89A 1GBLA 4INKA 1W12U 1QGFA 2PSYA 4A6LA 1AVGH 2CF9H 1O2TA 1EKBB 3MU8A 2CHAB 2GMTC 1C1MA 3U9AH 4X8UH 3EAJA 1O3OA 2BY5X 1HJAC 3QZRA 1ARBA 1GBIA 3SHAH 1ZJDA 4ASUD 1HAIH 1HAZB 4AFSA 3A83A 3QUMP 1SB1H 3A86A 1HAOH 1SGPE 2PTNA 5HIYA 3ZZ3A 1QR3E 1NTPA 2ANKH 4K60A 4M7GA 4TSFD 1MKWH 1O5EH 1CVWH 3NWUA 1C5XB 1RD3B 1TNIA 2CF8H 1IQEA 1BRBE 2A4RA 2GGVB 1S83A 1GHBF 4ZKRU 1NU7B 4ABAA 1C1PA 1UTQA 3SORA 4I31A 1OWKA 3ITIA 4RSPA 1NFWA 2FP7B 3RXCA 3MH7A 1UHBA 3AASA 2J95A 2QY0B 5LPEA 3MNBA 4FUHA 1BMMH 2Y5GA 3MNXA 1NO9H 1XVOA 3N7EA 1THSH 3QN7A 2G8TA 4X1NU 3UREA 1P12E 1EZXC 1MZAA 2FOBA 3U8RH 3FZDA 1D6WA 3T5FH 3F68H 4RN6A 1HIAB 2BDCA 1SSXA 3RXOA 3FP7E 4CH8B 1AO5A 1RTLA 1O3FA 1XX9A 3EA7A 3GY2A 2ALPA 4YM9A 1EJNA 1MTSA 3NRLA 3U98H 5GCHG 3M5OA 1TPOA 3HKIB 4ZXXH 2V0BA 1MMJN 1Z8JB 1TGTA 1CT2E 1XVMA 2ZKSA 4GHTA 3U28C 4X2YA 1KXCA 1P10A 4MNVA 2OTVA 4CRBA 1EAXA 1V2VT 3RXAA 3PYHA 4DCDA 2O9QA 1GJBB 1RIWB 1T32A 3BEFB 1O35A 4LK4A 4KGAA 3MH6A 4HZHA 1GCDA 4ZHAA 1G9IE 3W94A 5F6MA 4Q2KA 4AORA 4JK5A 1SR5C 1HJ8A 4I8LA 3IWMA 1HCGA 1LPGB 3DD2H 5TCCA 1ZHPA 3ATIA 3DT0H 1ABIH 2BY9X 3M5NA 1XUFA 2B7DH 2RDEA 1QJ6B 4AZ2B 1WCZA 1F0TA 3T2NA 3K6ZA 3ZVEA 1O2UA 4YLQH 4AC9A 4UONA 1F0UA 2WPLS 1CA8B 1C5WB 1P0SH 2ZG0H 2KZ4A 1RS0A 1CHOG 1GBDA 3W95A 4WXIA 2FOHA 2AEIH 2GMTB 4ZH8A 2TRMA 1QBNA 1HDTH 3SJKA 4FU7A 3OY5U 2XTTB 1C2LA 1E0FD 1NM6A 2FIRH 3PMJA 1O3NA 2BY6X 3A8BA 1V2LT 2M5TA 2YNAA 4IBLH 2OBQA 4CRDA 3E3TA 2PW8H 1UVSH 3MQKC 3DFLA 1GJ4H 5A0CA 3GCTG 1V2ST 4GPGA 1VITG 1N6XA 5GIBA 3GS9A 1C1NA 1V2MT 3FANA 1HJ9A 2BDYA 2YMSC 1QRWA 4FUCA 1GI1A 1ZMLA 1W14U 3A88A 2ZWLH 4X1RU 4WMDA 2XBVA 4ZROA 4B73A 1VZQH 3BIUH 1LHFH 5DJ7A 1NRQH 1PPCE 4ABBA 3SU3A 4A1TA 1T31A 4JK6A 3SOSA 5F8ZA 1MQ6A 4AOQA 1C5VA 3TJUA 1YLCA 3RUOA 1C2GA 2AH4X 2OP9A 3BG4C 3RXPA 1OWIA 3ZZDA 4Q63A 2KX4A 2BB4A 2ZCHP 3VXFH 3PV2A 2VNTA 3F9HA 4BAOB 1TE0A 4XBBA 4U2WA 3W1EA 5EODA 1BTHH 3ATWA 3HATH 4WWYA 3SU0A 3NKKA 3F2GA 2WPHS 2QAAA 4DOQA 1BTUA 2ZC9H 1P57B 1P3CA 1EB1H 3ODFA 4H42U 3F3BA 3ODDA 4ABGA 3F2FA 1T8MA 4D7FA 2BLOA 1QCPA 3RXGA 5HKKD 4X2XA 3M3TA 3ZYEA 1TRMA 5F8XA 5AVDA 4YOGA 4Q7XA 4BAMB 2ZFQH 4WVPE 1ELVA 2ILNA 1OYQA 3RXFA 3SV7A 2A4QA 4B75A 1ORFA 1TNLA 4RKJB 4AN7A 2XOKD 5EG4A 1TBRH 1AGJA 1GI8B 1DXWA 1BBRH 3UOPA 2P93A 5JB8S 1D9IA 3KGPA 4K8BA 2J97A 4OS1A 2OINA 4D9RA 1BBRE 1L4ZA 1FNIA 3STIA 4DT4A 2WUBA 3AAVA 4UEHH 1ETRH 4ABIA 1TPSA 3KHVA 2ZFTA 1GMDG 4MG3A 4MVNA 2P3TB 1EXFA 3LT3A 3RC6A 1GVLA 1MAXA 1N1LA 1PPBH 2XYAA 3Q3XA 1DSTA 4FOUC 1U6QA 2BZAA 2WPKS 1F0RA 1H8HD 3BEIB 3MU0A 3OTPA 1UHBB 2OQUA 1QFKH 1MTVA 1GHAG 3UIRA 1HNEE 2JJ2D 3M7UA 1AE8H 3P95A 4JZDH 1NN6A 4B74A 3OEED 3PWCA 2HLCA 4WJG2 1NPMA 5T3HA 4ABEA 3M7QA 3GY6A 2XCFA 3N7DA 1ELEE 2GP9B 1SL3A 1C5NH 1SGQE 1KIGH 1MH0A 4FETA 5EW1H 2BD5A 1VJAU 3H5CB 1B0FA 1LDTT 1DLEA 3PO1B 1J9CH 1W10U 1G30B 2QF3A 2W26A 2WPMS 5A0BA 1BUIA 1QQUA 2TGAA 1DXPA 2P3FH 3RXBA 3BTTE 1AY6H 1KXEA 2HGTH 6CHAC 5HIZA 1V2UT 1N8OC 2PFEA 1H8ED 2QE7D 1BJUA 4Q4LA 4NFEA 3HKJB 1J17T 3TJOA 2YMSB 2C3SA 4HGCA 3JZ1B 1V2PT 1NS3A 4ISIH 2QC2A 1SLWB 1W0YH 1BITA 4AGJA 2V35A 2Y82A 3DSGA 2B8OH 5FPYA 2F9PA 1FIWA 1EPTA 1TLDA 4ZXYH 1XUGA 1VR1H 4MNWA 3SUEA 5C3NA 2SFAA 5EU8A 1Z1JA 1CBWB 1GCTC 1LTOA 1VCWA 2XNDD 2ZU3A 3F9FA 3EGKH 4DY7B 2F9NA 5DKMA 4KELA 1TB6H 2RG3A 2SNVA 2Y80A 4O97A 1C2DA 1ELFA 1UTMA 2HPPH 1L1JA 3SQHE 2ZO3H 1Y3XA 3M7TA 1T4VH 1QBVH 2STAE 1C5YB 3S9AA 3PMHB 1DM4B 1SGIB 3URCA 3PRBA 2BMGB 4XFQA 4CREA 1AFEH 2QXIA 5K0HA 1KYNA 1TOMH 3URDA 1EATA 2Y6TA 5TJXA 2OC0A 1P9UA 3TU7H 4IMQA 1EAIA 5C67A 1YPKH 4Q80A 1GI9B 3KCGH 4CRFA 3SNAA 2NU0E 3MOCA 1J8AA 3F1SB 3AW0A 4O9VA 2D8WA 2FEQH 3ZZ4A 2TGPZ 1GGDC 2SNWA 2ZIQH 4VGCC 2F9UA 2UWLA 5C0UA 1FLEE 4DIHH 4UD9H 1HIAA 1FN6A 2H9TH 2QV1A 5DP8A 3GCTF 2PKSC 1AE5A 2R0LA 1UTOA 4X6MA 1P01A 1ANBA 5FXLA 1O2JA 3RXEA 2VVVA 2ZGBH 3PV5A 1BRUP 1FMGA 1HAVA 1LHEH 1TNKA 2FESH 2ZHFH 8ESTE 1ELBA 2D2DA 2VWMA 1MU6B 4HI3A 4IC6A 1O2NA 5DP4A 1AU8A 4A92A 2CGAA 1YPJH 2BY8X 1ZR0A 1F2SE 4HFPB 1WDIA 5GWZA 2TPIZ 3A84A 3A87A 1ACBE 3GCHB 1SLUB 2ZPSA 3CS0A 1CGJE 2BXTH 4TT3D 5E0HA 4R8TB 2GV7A 4I7YH 1COWD 3SGAE 1HAXB 1DWDH 4U30A 3FP8E 2HWLB 5AF9H 3MHWU 3HK3B 3H09A 2VINA 2Z3DA 1BHXF 3GY7A 3VB4A 1QL7A 2D1JA 2ZA5A 2W3IA 2D26C 2O8MA 2R0KA 4MQAA 1JBUH 1XKAC 2ZGCA 1V2RT 2PTCE 3BN9A 5I46H 1QRZA 2PGBB 3QX5H 3KYFA 1BTWA 1JIRA 6CHAB 1OYTH 3SV9A 1C5PA 1SC8U 1W8BH 2VH6A 4XRNA 3RC5A 7GCHG 2NWNA 5E0JA 4KKDA 3BV9B 5C94A 1GJAB 2Z9IA 1O31A 4LOYH 1YPMH 3UOUA 1ZTLA 1THRH 1WOFA 1OWHA 2ANYA 4I8KA 1CGHA 3UFAA 1L1NA 1AVXA 1P2MA 1P02A 3FFGA 2ZPQA 1A4WH 4BOHA 1BA8B 1KTTB 3PWBA 4D8NA 1NESE 3ENSB 1GJ9B 4GSOA 1O2KA 1KY9A 1O3LA 2P3UB 1ZHRA 2G00A 2VIPA 1MD7A 1K9OE 1LHGH 1WV7H 2F9VA 4GCHF 2GZ7A 1A3BH 3SJ9A 1B5GH 1J16A 1G3EA 3GOVB 3U8TH 1GHAF 2KCPA 1GBEA 2P8OB 1GMCG 1O34A 3QDZB 3T26A 2XWAA 2A5AA 1EB2A 1EFRD 1UCYE 4MPVA 1EP6A 5HMAA 3RXSA 3UY9A 2QXGA 2FTMA 1QTFA 1ZJKA 1O37A 3QTOH 3SU5A 3UWJH 3D65E 1AD8H 1NRNH 3LGVA 2F91A 2CXVA 3C27B 4J1YA 5J4QA 2V3OH 1ZSKA 3CS7A 5CDFE 3H7TA 2BDHA 1ELCA 4B1TA 1HB0B 1K28D 2LPRA 3LIWA 1C5UA 2ZEBA 3M61U 4FXGH 4CHAB 2I6SA 1P2IA 2ODYB 2FZZA 2W6ID 1TA6A 1O3JA 2G81E 1C1SA 1WU1A 1YLDA 3L6PA 5EGMA 3GY4A 3SUFA 2GCHG 1GGDB 1K1PA 4VGCB 1VJ9U 2A2XH 1JOUB 3JZ2B 1MKXH 4X1PU 2ZFPH 2FMJA 5KEDA 1A1RA 1VKYA 4BTIB 1ETSH 2BYAX 4YXWD 1D3QB 2YMSD 2GKVE 4Y11E 3K65B 1ELTA 4WMFA 1FZZA 1W2KH 3C1KA 5AHGH 2SGPE 3RDZA 3PLPA 2JETC 1EPTB 2BOHB 1O3EA 1W7XH 1ELGA 1M9UA 4UE7H 1AI8H 4ABJA 2KR7A 3ZV8A 4OS5A 2ZDLA 3KQEA 1OHHD 2A5KA 4A1VA 3R0FA 5G4BA 3TH3H 3ZIAD 1TX7A 3ZZBA 2ZHDA 2C4FH 4AB9A 2Q1JA 2ZDNA 4AG1A 4JYUH 1GJ6A 2XWBI 3IG6B 3MH4A 4NSVA 1JMOH 1PQAA 1FPHH 1PPGE 2LP6A 2WV9A 4CRGA 5FAHA 1P11E 1UVTH 5DK1A 1Z71A 2QXJA 3BTDE 1Z8RA 1YP9A 4IW4E 2H5CA 3RXRA 4AFQA 1W11U 2TGDA 2ZPRA 1C5RA 2FI5E 4MPXA 2F9OA 4PROA 5ESTE 5DN6D 3OU0A 4Y8ZA 4NGAH 1ETTH 1NFYA 4ISHH 1NFUA 4K8YA 2BTCE 3A8CA 1Z1IA 2Q6DA 1FV9A 2J92A 2ZFSA 1BTZA 2BX4A 5C1XA 3TK5A 1RJXB 4JZFH 1YCPK 1C2HA 1MBQA 3MTYA 1OXGA 1SLVB 1UK3A 1UVOA 3ELAH 3BF6H 1XUJA 1BTPA 1AHTH 1ZYOA 3OEHD 1LQDB 1GHZA 2F83A 2W7SA 4GHQA 2GZ8A 3LGYA 1LVOA 3F2HA 5A2MH 3WWFA 1UVUH 1S6HA 1PJPA 3U1JB 2Y7ZA 3QWCH 1O5GH 1A5GH 3VG8A 1HAVB 3E6PH 1S6LA 5EPNA 1W0KD 2Z9LA 1PPEE 2J2UA 2VU8E 3LGIA 4GLYA 1LVYA 4H6TA 4B2BA 4WXVA 3M3VA 1Q31A 2GT8A 1Y59T 3AVZA 1HUTH 4BANB 4I8JA 4OGXA 1HV7A 2XNIA 1JRTA 4BTTB 1SGTA 2Z9GA 1CO7E 2A32A 1SPJA 2C8ZB 2PKAA 1O2ZA 3D62A 3DUXH 3VGCC 1OKXA 1S84A 3EA9A 2J4IA 1EOLA 1TX6A 2F3CE 3FKSD 1TGBA 2JDID 5C20A 1EZSC 3STJA 1A3EH 1CU1A 4JYTA 1GMHF 1O38A 2G4UA 4ZKOU 5EXMA 2GT7A 4MTBA 1GWAA 3RU4E 1HAGE 2BY7X 2BLWA 1Z6JH 1L2EA 1HXFH 2HLDD 3F0PA 3HGNA 2AGIX 1DE7H 1WUNH 1UMAH 1GI0A 1GJ7B 2VH0A 2C8WB 2CN0H 2VB0A 4I33A 1TQ0B 2PGQB 2OD3B 1F5LA 1TOCB 2EI6A 5CE1A 2ZQ1A 2EEKA 1C2MA 1TMUH 4F4OC 3MWIU 2OUAA 2YOLA 2BD8A 2TIOA 5EXLA 7LPRA 1Z7KA 1K21H 1Y8TA 4JZ1A 1DWEH 1UVPA 1XXFA 1CT4E 2ODQA 3P92A 2JETB 4Q7ZA 4AGKA 2YNBA 2G5VA 1UTKA 4NA7A 2ZDAH 3N99A 4UFDH 5FBIA 1QL8A 1V2WT 1HJAB 3WWBA 2K0QA 1ANCA 2AYWA 2IJD1 1MABB 1QY6A 1NFXA 1GHVH 4NA8A 1GJ8B 3DSOA 1E1RD 1C1UH 1P9SA 3GDSA 5FCKA 4E05H 1YPGH 2H9EH 1C1OA 4NWKA 1AWHB 5FX5A 3I78A 3SU4A 1GMCF 2ZTZA 3KEEA 2FOEA 3U1IB 5B6LA 1C9PA 3AAUA 4NIXA 2BXUH 3SV8A 1UTLM 1C5OH 2FPZA 3KIDU 1K1JA 3A7YA 3UNSA 5DP9A 1PQ5A 3VXEH 3SNCA 2Z9JA 1GBCA 3BSQA 1MZDA 1QIXB 5CHAC 4AX9H 2FLRH 2HNTF 3OSYA 4OGYA 3PROA 5JBAS 1O32A 1KLIH 3E0NB 3GY8A 2HVYB 3EA8A 1BMFD 2KFWA 2ZNKH 1NROH 1MKWK 1O3HA 2QA9E 2RCEA 4FUJA 1TGSZ 2PUQH 1ANDA 1P2KA 1DANH 2ZDMA 1CE5A 1O2YA 1A0JA 1FY3A 4NCYA 2CMYA 2FM2A 1DWCH 3SU1A 1TA2A 3LOXA 1BJVA 4Y71A 3KQBA 1MUEB 2RFKC 1EJAA 3RXTA 3IITA 3S0NA 4NSYA 1P2NA 1QQ4A 1YY3A 2ZDKA 4NIVA 1TMTH 2Z9KA 1ZMJA 2AGGX 2OC8A 1YPLH 1ESAA 2ZHEH 1FY8E 4SGAE 4AB8A 2QF0A 2W6JD 3SGQE 4ESTE 1DDJA 2ZHWH 1L1GA 3UNRA 2H5DA 3MH5A 1V3XA 1NBME 1W7GH 3P8GA 1PQ7A 5F53A 3VB6A 3QO6A 2UWOA 5LH8A 5DSFA 1TX8A 1PYTC 1CA0C 1K1MA 1AKSB 4HG6A 5F03A 2A7CA 4LZ1H 1SG8B 1PPHE 3MMGA 1T8LA 2BVSH 1O36A 2JKHA 5KECA 4ZKNU 4RKOB 5EJZA 3DHKH 4Y7BA 4A5TS 4XDEA 4F48B 4XOJA 5JBTA 2BLQA 4INHA 1ESBA 2XBYA 1ZTKA 2NU2E 4GUXA 1C2KA 4WH8A 3NZIA 1SHHB 1QJ7B 2FO9A 4NIYA 1OSSA 2O8WA 5KGOA 1ZGIA 3I29A 4X8VH 1E1QD 6ESTA 2Z3CA 2WZQA 2HVXA 1MD8A 3SW2B 1AZ8A 1AN1E 1OOKB 5SGAE 2NU3E 2L74A 2V6NA 4X2VA 4ZHMU 1MAYA 1KDQB 1O2SA 2TGTA 1OP8A 1TGCA 3BTFE 1VCQA 3RXIA 2EA3A 3K9XB 4MNYA 3V0XA 1GHYH 2A0QB 3SHCH 8GCHG 4D7GA 5GCHF 3TNSA 1GJCB 2ZTYA 1IQLA 1QB1A 3RMLH 2C93B 3L3TA 1Y3WA 3FVFB 4ZKSU 1S85A 3FP6E 2ZZUH 2DE9A 2PWXA 3MU1A 1FPCH 3V13A 1TNJA 3UQOA 4K69A 3RXDA 4XBDA 3UQVA 1FY4A 2Z3EA 2F43B 1YCPM 1Y3UA 1LKBA 1P06A 4NA9H 1T8NA 2EY4C 1SHYA 2PKAB 1ID5H 3I77A 5L30H 5TCAA 2O8TA 2PR3A 2FOMB 3MO6A 1EAWA 2A7JA 2G52A 2IJOB 1TNHA 1YWUA 5EIYA 3P8FA 4XD7D 1DSUA 3SI4H 2AGEX 1BDAA 5HM9A 1AZZA 3CNRA 2R9PA 1V2KT 1O5AB 3TGIE 1ZRKA 2Y81A 4Z1MD 1QRXA 4Y7AA 4YT6H 3GCNA 2PUXB 3BG4B 1WSSH 1Z8IB 2BOKA 1O3MA 1SFQB 1K22H 3KYGA 2JH5D 3SNDA 3S7HB 1C5TA 2OCVB 1SI5H 1DUAA 1TWXB 1F7ZA 1IQJA 1GBJA 5FPSA 4E7RG 4IMZA 3P17H 4BNRA 3F0OA 4ABFA 2C90B 3RMMH 1O3DA 2VIVA 3T29A 3SQEE 1AB9C 2ZHQH 1WTHD 4B71A 3RLWH 6GCHG 2SGEE 1AFQC 1GDQA 2ZCKP 1QURH 4DT7B 4BXSA 3PV4A 4LXBH 1CHOF 1GG6C 2RDLA 1QA0A 2KCAA 3OTJE 2ZI2H 2P59A 4K2YA 1O2QA 3M3SA 1GI2A 1E37B 5IYTA 4JMYA 1GBMA 4ISLA 3FZZA 3LKWA 5A8XA 2JIZD 1MCVA 1E35B 1O3AA 4IN1A 5EXNA 4TPYA 3TJNA 1LKAA 1YPEH 4MNXA 1O30A 1W0ZU 1DITH 2R3YA 4CR5A 5EOKA 3SU6A 2OK5A 4I8GA 1C5LH 1CA0B 1C4U2 2FI4E 2IPHA 2QN5T 1TALA 3HK6B 4OS4A 1HRTH 1GHBG 4BTUB 2UUJB 3VB3A 2ESTE 1P04A 1GBTA 1NRPH 1VITF 2CV3A 2RA3A 5FPTA 3VFEA 1TRNA 1FUJA 2XBWA 1SGFA 2R2MB 1HLTH 1BBRK 2UUFB 3P8NA 4FVDA 4YT7H 1H4WA 5E0GA 5BPEA 5GJ4B 5HM2A 1OP2A 3QGJA 1KLJH 1G36A 1QA7A 2FOGA 3E90B 1LPKB 4TWWA 3ZVFA 1Y3YA 1SQTA 1A7SA 2AMDA 5C2ZA 1SFIA 1G37A 2IPQX 3SNBA 2XRCA 2OXSA 2BX3A 3NUMA 1B7XB 1OWJA 3A8AA 1O2HA 2KCOA 4ASHA 3EQ0H 3Q76A 2XCNA 1S6FA 3VB7A 1BOQA 1WYKA 2BD9A 1ELAA 2VIOA 3MYWA 4NWLA 3SN8A 3T27A 5LPFA 1DY9A 3FAOA 2FYQA 1HGTH 3ATLA 1NY22 2B5TB 3KN2A 4K1EA 3ESTA 1GI5A 2ODPA 3LONA 3QZQA 4DVAU 3QLPH 3ZZ5A 7KMEH 5L6NH 2DUCA 1N8OB 2QF5A 1EX3A 2GDDA 3CP7A 3LGTA 2BQ6B 1C4Y2 4FUGA 3SO3A 2FXRA 1MTUA 2A7HA 3TJVA 1IQHA 1JIMA 3WW7A 2VJ1A 2BLVA 2P16A 1ANEA 1KSNA 1NC6A 1F0SA 2JH0D 3VEQB 1EZUC 1Q3XA 3A8DA 1C2IA 3SV2H 4ABDA 2OBOA 2ZECA 1GMDF 1K2I1 5ABWA 1D4PB 1BRCE 1YF4A 1TBZH 2J9NA 3GY3A 3BTME 2QXHA 3M35A 5J4SA 1ZPCA 2W7UA 4D9QA 1RGQA 3ZV9A 1W13U 1SGRE 5C5NA 3BTHE 1GCTB 1THPB 4XE4A 3TPIZ 1AUTC 1UCYH 4X8TH 1GI3A 3TH4H 1FN8A 5EW2H 2JJ1D 4B6FA 1T4UH 2AMPA 2BDGA 3A82A 4Q7YA 2Y5HA 1PFXC 2W5EA 1O2GH 1AWFH 3A80A 1AB9B 1SOZA 1UJ1A 2ZDVH 3T28A 4CRCA 4KTSA 2H9HA 1F5KU 4Y8YA 1D3TB 5L2ZH 1LVBA 2A1DB 1ZHMA 1GBHA 2BDBA 1D3DB 3RXJA 3SJOA 1C5ZB 2XW9A 4X6OA 4CH2B 1IHSH 1SGEE 2GCTC 2GZ9A 3D49H 5EJLA 3RXLA 3EYDA 1FAXA 1DOJA 1EQ9A 1JRSA 2FODA 3K6YA 1ZRBA 1BMNH 4X8SH 9LPRA 2HPQH 1RIWC 1G3CA 1O33A 4SGBE 1Y5AT 1YBWA 1XKBC 2R3UA 3DCLA 1DX5M 1GJDB 1O5DH 2A45B 2GD4B 2AIQA 2OC7A 1O2VA 5BRRE 2PHBA 1IQNA 2PKSB 3A7ZA 2A4GA 2BQWB 1C4V2 1AVWA 5HYOA 2FS8A 1Z6EA 1P2JA 4NZQA 3TGJE 1S81A 1NZQH 2BZ6H 2QYIA 3P70B 1E79D 4Y0YE 3QTVH 3RXKA 2WPIS 3OX7U 1DLKB 2QIQA 3LC3A 1FONA 3S9BA 1O2WA 3EE0B 1LHDH 1DUEA 1G2LA 3SNEA 4H6SB 3BEUA 3LGUA 5E8EH 1BZXE 1JXPA 1SGCA 2K1QA 1NRSH 5AFZH 3TITA 3BTGE 4ABHA 1OWEA 4CR9A 2BDAA 2VWOA 1S0RA 1AKSA 2J38A 1OS8A 4CBNA 2V3HH 4U32A 5JDUB 1SVPA 1G2MA 6GCHF 1K1OA 4ZAEA 4LZ4B 2A4OA 1LCYA 2BVRH 5FL7D 5JYIA 1H8DH 5EQRA 3O8DA 5DP5A 3S69A 3VPKA 3TNTA 1Q2WA 3L33A 1GBBA 1P03A 3BTQE 2O8LA 3A7XA 4M9FA 5GXPA 3MNSA 3PLBA 4J2YB 2JH6D 2CK3D 2HNTE 1PQ8A 2VIDA 3NK8A 2BD4A 2VVCA 1Z8GA 5T6GA 4Y79A 1GJ5H 4ZUHA 4JCNA 1O39A 1C9TA 1PYTD 4FUDA 1L0ZA 4UFGH 1O2PA 2KAIB 1C1RA 3DSPA 1BHXB 5I25A 1UK4A 1ARCA 2XXLA 1KDQA 3RC4A 2G5NA 1TIOA 3Q77A 5C17A 2NU1E 1O2MA 3H7OA 2WYGA 2ZFFH 4UFEH 3PRDA 3RXVA 1MCTA 3SGBE 2AIPA 3K2UA 2L6OA 2ZU2A 2XBXA 1S5SA 3ZVBA 2Y5FA 4DJZB 1Y5UT 5C1YA 1WTGH 1A2CH 1C2JA 1KXFA 1QBOA 1KXDA 1AUJA 1QNJA 3RU4D 2FOCA 1P05A 2J94A 1B0EA 1HYLA 1W0JD 5T1VA 5GPIB 3FN8A 3R3GB 1UCYK 4X6NA 1IQMA 1FQ3A 1GBAA 1GBFA 2AMQA 2GCTB 2P95A 2BVXH 2WV5A 3O8BA 3UNQA 2VWNA 2VBCA 1JWTA 3QGNB 3RXMA 1FX0B 2SGQE 4IGDA 2VIWA 1C2FA 2QF4A 5EQQA 2GVFA 3N7OA 1C2EA 1GL0E 1LPZB 1G32B 3MO3A 1BTYA 4I8HA 4R0IA 4AG2A 1Y3VA 3P6ZB 3MU5A 5B6OA 7GCHF 2G55A 2BD3A 1HPGA 1BIOA 2Q6GA 4E7NA 1SLXB 1GI6A 1VGCC 1KXBA 2H1UA 4NFFA 1FDPA 3AW1A 4DURA 1YM0A 1YPHE 2ZGXH 1V2JT 2UUYA 2FTLE 4XBCA 3ATKA 4THNH 3PTNA 1SBWA 2M2AA 2J34A 2IN2A 1MKXK 3LPRA 3TH2H 4OS2A 3OYPA 2GV6A 1DWBH 1W3CA 4TY7A 1T7CA 3F9EA 5LPRA 2B0FA 3EE7A 1O3BA 2KCYA 4X1SU 1YGCH 4YO9A 1QB6A 3GDVA 1G3DA 3A7WA 2SGDE 1SGYE 1EAUA 1C5MD 4DW2U 2F9BH 2WSSD 1DS2E 4FUBA 4Y0ZE 2LELA 2WHXA 4KP0A 4UDWH 3ZVCA 3A7VA 3PO1C 5DP6A 4AFZA 1XUKA 1O5FH 1GHWH 4DGJA 1D3PB 4B2CA 2AERH 2VVUA 1CSOE 2PLXA 1DT2A 4XSKU 1A0HB 4GVUA 1BCUH 5ETXA 2ZU4A 3SJ8A 2C8XB 3TLOA 2GJGA 1MTWA 4H4FA 2A5IA 3GICB 4AFUA 1EZQA 1ZOMA 2Z94A 1HXEH 4QT8C 1ZLRA 1V2QT 3LJJA 4BAKB 2PSXA 4WF8A 5L2YH 1O2IA 1KMHB 3GYMA 2GCHF 3OE7D 4GAWA 1UTPA 1CHGA 2UWPA 1FY1A 2FLBH 1AQ7A 2R2WU 5H4IB 4FUFA 2ZFRH 5JB9S 4B6EA 3SBKA 1DPOA 1ELDE 1GI4A 1SQOA 2WPDD 1GBKA 1IAUA 3F6UH 4NZLA 2PP6A 2BD2A 4TPIZ 1ZSJA 1RXPA 3SYJA 2WINI 1NBMD 2HNTC 3VB5A 1Y5BT 5JPMH 1CBWC 1K1NA 5A8ZA 1K1IA 4A1XA 4IN2A 4CRAA 1LMWB 1INCA 3T62A 3CENA 1DICA 2Z7FE 3M36A 4CBOA 1FAKH 2FOFA 2ZCLP 1O3PB 3SJIA 2A31A 3LU9B 5PTPA 3TK9A 5EPYA 3S7KB 4Y6DA 1BT7A 2ZGJA 3VGCB 2NU4E 1BTXA 1TRYA 1SGFG 1GDNA 3A85A 5ESBA 3RP2A 4Z6AH 3KQ5A 3RM0H 3V3MA 3QK1A 1HAHH 1CQQA 2ZP0H 1C1TA 3KL6A 3M5MA 2ANWA 3TIUA 3UUZA 4FU8A 1QL9A 3SV6A 5IDKA 1VITH 4K1TA 3E1XB 3U69H 3ZZCA 5LGOA 3A81A 3O8RA 1K0HA
chains in the Genus database with same CATH topology
1O2OA 5T6DA 3U8OH 4UFFH 1EUFA 4U01A 3TK6A 1OX1A 1P3EA 3MO9A 1UO6A 1VGCB 3Q3KA 3WY8A 4GCHG 4BAHB 1T8OA 4X1QU 3GCOA 4FUIA 3P8OA 3GISB 4K5ZA 1TPPA 1GI7B 1ZSLA 2OC1A 1PPFE 1OPHB 2ASUB 1ESTA 1MTNC 3GCHC 1TPAE 2I6QA 3ATMA 1TYNA 4I32A 4MLFB 4O3TA 2RA0A 2QCYA 5HXFA 5C1UA 2SGAA 1SGDE 3ZVDA 1F92A 3HPTB 3O8CA 1YPHC 5HGGA 1N6YA 3KQDA 3SU2A 3B9FH 3BTEE 3RXHA 4DG4A 3F9GA 3LH1A 3SUDA 3E91A 3RMOH 1GPZA 1BQYA 1E38B 3KQCA 3SI3H 1IQKA 1XUIA 5CHAB 3MFJA 1D6RA 1XUHA 4TYDA 3LDXH 2EI8A 3OY6U 2LNCA 4WY3A 2ZU1A 2VGCC 2Y7XA 2AS9A 2GX4A 3ZZ9A 4IS5A 4BAQB 1GDUA 3RLYH 1FY5A 3D23A 2GDEH 3Q3YA 3TVJB 3UWIA 3ZZ7A 1O5CB 2C8YB 5A8YA 1AMHA 2Z6BD 5E2PA 3A7TA 5JBCS 1TAWA 9ESTA 2DE8A 4YOIA 4MDSA 1DFPA 1DVAH 4WMEA 3T25A 1O2RA 1O3KA 1V2TT 2IOTA 2QGRA 3PMBB 5DGJA 3LJOA 3PM3A 2H6MA 4JZEH 3HGPA 2A2QH 3GY5A 3B23B 4YESB 3UTUH 1TBQH 1A46H 3M37A 1NU9A 3B8JA 1ZGVA 4JZIA 4B2AA 1V6DA 3NCLA 4FVBA 4KTCA 2P8OC 1WAYB 3NPSA 1NT1A 1YC0A 1RRKA 1FXYA 4NG9H 3ZZ6A 1A5IA 4IC5A 1HAYB 1O2LA 3RXQA 3ZVGA 2TBSA 5GDSH 2Q6FA 1S0QA 2SGFE 4HTCH 1BRAA 4AYVB 1OP0A 3MNCA 4F49A 2ZQ2A 2KAIA 3G01A 1LO6A 3ZYDA 2B9LA 1LHCH 1RTKA 1XXDA 3ZVAA 3RM2H 1BMLA 1BMAA 2FDAA 4CHAC 1LQEA 4Y8XA 5E2OA 1UTJA 1ZZZA 4ISNA 4FUEA 1QB9A 4TWYA 1TMBH 3BG8A 1KXAA 1O5BB 2G51A 2THFB 4E06H 1IHTH 1WQSA 1C1WH 1GVKB 2VIQA 2CJIA 1O3GA 4INLA 3SZNA 3S9CA 1ZTJA 1FI8A 2BDIA 1HBTH 2VWLA 1C1VH 1ABJH 2AFQB 3MU4A 4Y10E 1P09A 3E8LA 5A09A 1FIZA 1AIXH 3BIVH 2EI7A 1WQVH 4X0WU 5T6FA 2BD7A 2GTBA 4Z0KA 3UR6A 2CHAC 1EPTC 1H9LB 1J14A 1LVMA 1TONA 5K7RA 3RMNH 5DO4H 1EP5A 1TQ7B 1C1QA 1C5QA 2H2ZA 3GDUA 2FX6A 1E36B 8LPRA 1TABE 1FJSA 1MBMA 1MTNB 1HFDA 2P94A 1O2XA 2FYRA 2WV4A 4A7IB 3KF2A 2FS9A 2FOAA 4BXWA 3UPEA 6LPRA 1H9IE 3LH3A 2BQ7B 1SQAA 1YYY1 2WUCA 3Q00A 2HOBA 5AFYH 5DP7A 1YCPH 1KTSB 2ALVA 3ZZ8A 2WYJA 2W3KA 4K1SA 1UK2A 1GMHG 1EOJA 3PB1E 1F5RA 4YLUA 3RU4T 4B76A 2G4TA 2FWWA 1RFNA 3DA9B 4JYVH 4K3JA 3E16B 1DY8A 4YTAA 1NRRH 1XM1A 1TFXA 2ANMH 2ZGHA 3PLKA 4OS6A 1GL1A 5FBEA 2VGCB 2ZU5A 1H1BA 1HAPH 1CGIE 5JBBS 1MQ5A 4DIIH 1QJ1B 1ZPZA 4FU9A 2BHGA 1WBGB 1BB0B 3BTKE 3LC5A 5DPAA 1G3BA 1J15A 1EASA 2STBE 4ZMAH 1A61H 1E34B 2ULLA 3E0PB 1K1LA 1H8IH 1IQGA 2BM2A 4TY6A 4OS7A 5DP3A 1A5HA 4NIWA 1IQFA 1AFQB 3V7TA 5F8TA 1ZPBA 2O8UA 7ESTE 5A0AE 1IQIA 1TNGA 5DG6A 2UUKB 1GG6B 1O3IA 2HRVA 5EQSA 1UTNA 3RXUA 3V12A 4O3UA 4O03A 2ZF0H 2FX4A 1C5SA 4X6PA 1V2OT 1TGNA 2XC5A 8GCHF 3BTWE 3EDXB 1IOEA 3LGWA 1P2QA 1GVZA 2OQ5A 4YZUA 1P2OA 3NXPA 3TGKE 4WH6A 3GYLB 2PV9B 1QHRB 1GHXH 4AYYB 1X7AC 2FI3E 1O0DH 1YKTA 4MPWA 4Y76A 2XC4A 3ZZAA 3M5LA 3PTBA 4ZHLU 5FCRA 5CMXH 3PMAB 2EC9H 4D76A 3UR9A 5C5OA 2ZTXA 1MU8B 5FHTA 4MPUA 1L4DA 1A0LA 1S82A 1ZMNA 1P8VC 2HALA 1PPZA 1EJMA 1CT0E 1KLTA 4YOJA 4ISOA 1VCPA 4X2WA 5FX6A 1H9HE 1XMNB 3KNXA 3MI4A 1SMFE 2OLGA 2XC0A 1SGNE 4KTUA 8KME2 1V2NT 2WPJS 1OWDA 1RTFB 1O3CA 3DFJA 3SUGA 1SOTA 3A89A 1GBLA 4INKA 1W12U 1QGFA 2PSYA 4A6LA 1AVGH 2CF9H 1O2TA 1EKBB 3MU8A 2CHAB 2GMTC 1C1MA 3U9AH 4X8UH 3EAJA 1O3OA 2BY5X 1HJAC 3QZRA 1ARBA 1GBIA 3SHAH 1ZJDA 1HAIH 1HAZB 4AFSA 3A83A 3QUMP 1SB1H 3A86A 1HAOH 1SGPE 2PTNA 3ZZ3A 1QR3E 1NTPA 2ANKH 4K60A 4M7GA 1MKWH 1O5EH 1CVWH 3NWUA 1C5XB 1RD3B 1TNIA 2CF8H 1IQEA 1BRBE 2A4RA 2GGVB 1S83A 1GHBF 4ZKRU 1NU7B 4ABAA 1C1PA 1UTQA 3SORA 4I31A 1OWKA 3ITIA 4RSPA 1NFWA 2FP7B 3RXCA 3MH7A 1UHBA 3AASA 2J95A 2QY0B 5LPEA 3MNBA 4FUHA 1BMMH 2Y5GA 3MNXA 1NO9H 1XVOA 1THSH 3QN7A 2G8TA 4X1NU 3UREA 1P12E 1EZXC 1MZAA 2FOBA 3U8RH 3FZDA 1D6WA 3T5FH 3F68H 4RN6A 1HIAB 2BDCA 1SSXA 3RXOA 3FP7E 4CH8B 1AO5A 1RTLA 1O3FA 1XX9A 3EA7A 3GY2A 2ALPA 4YM9A 1EJNA 1MTSA 3U98H 5GCHG 3M5OA 1TPOA 3HKIB 4ZXXH 2V0BA 1MMJN 1Z8JB 1TGTA 1CT2E 1XVMA 2ZKSA 4GHTA 4X2YA 1KXCA 1P10A 4MNVA 2OTVA 4CRBA 1EAXA 1V2VT 3RXAA 3PYHA 4DCDA 2O9QA 1GJBB 1RIWB 1T32A 3BEFB 1O35A 4LK4A 4KGAA 3MH6A 4HZHA 1GCDA 4ZHAA 1G9IE 3W94A 5F6MA 4Q2KA 4AORA 4JK5A 1SR5C 1HJ8A 4I8LA 3IWMA 1HCGA 1LPGB 3DD2H 5TCCA 1ZHPA 3ATIA 3DT0H 1ABIH 2BY9X 3M5NA 1XUFA 2B7DH 1QJ6B 4AZ2B 1WCZA 1F0TA 3T2NA 3K6ZA 3ZVEA 1O2UA 4YLQH 4UONA 1F0UA 2WPLS 1CA8B 1C5WB 1P0SH 2ZG0H 1RS0A 1CHOG 1GBDA 3W95A 4WXIA 2FOHA 2AEIH 2GMTB 4ZH8A 2TRMA 1QBNA 1HDTH 3SJKA 4FU7A 3OY5U 2XTTB 1C2LA 1E0FD 1NM6A 2FIRH 3PMJA 1O3NA 2BY6X 3A8BA 1V2LT 2M5TA 2YNAA 4IBLH 2OBQA 4CRDA 3E3TA 2PW8H 1UVSH 3DFLA 1GJ4H 5A0CA 3GCTG 1V2ST 4GPGA 1VITG 1N6XA 5GIBA 1C1NA 1V2MT 3FANA 1HJ9A 2BDYA 1QRWA 4FUCA 1GI1A 1ZMLA 1W14U 3A88A 2ZWLH 4X1RU 4WMDA 2XBVA 4ZROA 4B73A 1VZQH 3BIUH 1LHFH 5DJ7A 1NRQH 1PPCE 4ABBA 3SU3A 4A1TA 1T31A 4JK6A 3SOSA 5F8ZA 1MQ6A 4AOQA 1C5VA 3TJUA 1YLCA 3RUOA 1C2GA 2AH4X 2OP9A 3BG4C 3RXPA 1OWIA 3ZZDA 2ZCHP 2BB4A 3VXFH 2VNTA 3F9HA 4BAOB 1TE0A 4XBBA 4U2WA 5EODA 1BTHH 3ATWA 3HATH 4WWYA 3SU0A 3NKKA 2WPHS 2QAAA 4DOQA 1BTUA 2ZC9H 1P57B 1P3CA 1EB1H 3ODFA 4H42U 3ODDA 4ABGA 1T8MA 4D7FA 2BLOA 1QCPA 3RXGA 4X2XA 3M3TA 3ZYEA 1TRMA 5F8XA 5AVDA 4YOGA 4Q7XA 4BAMB 2ZFQH 4WVPE 1ELVA 2ILNA 1OYQA 3RXFA 3SV7A 2A4QA 4B75A 1ORFA 1TNLA 4RKJB 4AN7A 5EG4A 1TBRH 1AGJA 1GI8B 1DXWA 1BBRH 3UOPA 2P93A 5JB8S 1D9IA 3KGPA 4K8BA 4OS1A 2OINA 4D9RA 1BBRE 1L4ZA 1FNIA 3STIA 2WUBA 3AAVA 4UEHH 1ETRH 4ABIA 1TPSA 3KHVA 2ZFTA 1GMDG 4MG3A 4MVNA 2P3TB 1EXFA 3LT3A 3RC6A 1GVLA 1MAXA 1N1LA 1PPBH 2XYAA 3Q3XA 1DSTA 1U6QA 2BZAA 2WPKS 1F0RA 3BEIB 3MU0A 1UHBB 2OQUA 1QFKH 1MTVA 1GHAG 3UIRA 1HNEE 3M7UA 1AE8H 3P95A 4JZDH 1NN6A 4B74A 3PWCA 2HLCA 4WJG2 1NPMA 5T3HA 4ABEA 3M7QA 3GY6A 2XCFA 1ELEE 2GP9B 1SL3A 1C5NH 1SGQE 1KIGH 1MH0A 5EW1H 2BD5A 1VJAU 3H5CB 1B0FA 1LDTT 1DLEA 3PO1B 1J9CH 1W10U 1G30B 2QF3A 2W26A 2WPMS 5A0BA 1BUIA 1QQUA 2TGAA 1DXPA 2P3FH 3RXBA 3BTTE 1AY6H 1KXEA 2HGTH 6CHAC 1V2UT 1N8OC 2PFEA 1BJUA 4NFEA 3HKJB 1J17T 3TJOA 2C3SA 4HGCA 3JZ1B 1V2PT 1NS3A 4ISIH 2QC2A 1SLWB 1W0YH 1BITA 4AGJA 2V35A 2Y82A 2B8OH 5FPYA 2F9PA 1FIWA 1EPTA 1TLDA 4ZXYH 1XUGA 1VR1H 4MNWA 3SUEA 5C3NA 2SFAA 5EU8A 1Z1JA 1CBWB 1GCTC 1LTOA 1VCWA 2ZU3A 3F9FA 3EGKH 4DY7B 2F9NA 5DKMA 4KELA 1TB6H 2RG3A 2SNVA 2Y80A 4O97A 1C2DA 1ELFA 1UTMA 2HPPH 1L1JA 3SQHE 2ZO3H 1Y3XA 3M7TA 1T4VH 1QBVH 2STAE 1C5YB 3S9AA 3PMHB 1DM4B 1SGIB 3URCA 2BMGB 4XFQA 4CREA 1AFEH 2QXIA 5K0HA 1KYNA 1TOMH 3URDA 1EATA 2Y6TA 5TJXA 2OC0A 1P9UA 3TU7H 4IMQA 1EAIA 5C67A 1YPKH 4Q80A 1GI9B 3KCGH 4CRFA 3SNAA 2NU0E 3MOCA 1J8AA 3F1SB 3AW0A 4O9VA 2D8WA 2FEQH 3ZZ4A 2TGPZ 1GGDC 2SNWA 2ZIQH 4VGCC 2F9UA 2UWLA 1FLEE 4DIHH 4UD9H 1HIAA 1FN6A 2H9TH 2QV1A 5DP8A 3GCTF 2PKSC 1AE5A 2R0LA 1UTOA 4X6MA 1P01A 1ANBA 5FXLA 1O2JA 3RXEA 2VVVA 2ZGBH 1BRUP 1FMGA 1HAVA 1LHEH 1TNKA 2FESH 2ZHFH 8ESTE 1ELBA 2D2DA 2VWMA 1MU6B 4HI3A 4IC6A 1O2NA 5DP4A 1AU8A 4A92A 2CGAA 1YPJH 2BY8X 1ZR0A 1F2SE 4HFPB 5GWZA 2TPIZ 3A84A 3A87A 1ACBE 3GCHB 1SLUB 2ZPSA 3CS0A 1CGJE 2BXTH 5E0HA 4R8TB 2GV7A 4I7YH 3SGAE 1HAXB 1DWDH 4U30A 3FP8E 2HWLB 5AF9H 3MHWU 3HK3B 2VINA 2Z3DA 1BHXF 3GY7A 3VB4A 1QL7A 2D1JA 2ZA5A 2W3IA 2D26C 2O8MA 2R0KA 4MQAA 1JBUH 1XKAC 2ZGCA 1V2RT 2PTCE 3BN9A 5I46H 1QRZA 2PGBB 3QX5H 1BTWA 1JIRA 6CHAB 1OYTH 3SV9A 1C5PA 1SC8U 1W8BH 2VH6A 3RC5A 7GCHG 2NWNA 5E0JA 4KKDA 3BV9B 1GJAB 2Z9IA 1O31A 4LOYH 1YPMH 3UOUA 1ZTLA 1THRH 1WOFA 1OWHA 2ANYA 4I8KA 1CGHA 3UFAA 1L1NA 1AVXA 1P2MA 1P02A 3FFGA 2ZPQA 1A4WH 4BOHA 1BA8B 1KTTB 3PWBA 4D8NA 1NESE 3ENSB 1GJ9B 4GSOA 1O2KA 1KY9A 1O3LA 2P3UB 1ZHRA 2G00A 2VIPA 1MD7A 1K9OE 1LHGH 1WV7H 2F9VA 4GCHF 2GZ7A 1A3BH 3SJ9A 1B5GH 1J16A 1G3EA 3GOVB 3U8TH 1GHAF 1GBEA 2P8OB 1GMCG 1O34A 3QDZB 3T26A 2XWAA 2A5AA 1EB2A 1UCYE 4MPVA 1EP6A 5HMAA 3RXSA 3UY9A 2QXGA 2FTMA 1QTFA 1ZJKA 1O37A 3QTOH 3SU5A 3UWJH 3D65E 1AD8H 1NRNH 3LGVA 2F91A 2CXVA 3C27B 4J1YA 5J4QA 2V3OH 1ZSKA 3CS7A 3H7TA 2BDHA 1ELCA 4B1TA 1HB0B 1K28D 2LPRA 3LIWA 1C5UA 2ZEBA 3M61U 4FXGH 4CHAB 2I6SA 1P2IA 2ODYB 2FZZA 1TA6A 1O3JA 2G81E 1C1SA 1WU1A 1YLDA 3L6PA 5EGMA 3GY4A 3SUFA 2GCHG 1GGDB 1K1PA 4VGCB 1VJ9U 2A2XH 1JOUB 3JZ2B 1MKXH 4X1PU 2ZFPH 2FMJA 1A1RA 4BTIB 1ETSH 2BYAX 1D3QB 2GKVE 4Y11E 3K65B 1ELTA 4WMFA 1FZZA 1W2KH 3C1KA 5AHGH 2SGPE 3RDZA 3PLPA 2JETC 1EPTB 2BOHB 1O3EA 1W7XH 1ELGA 1M9UA 4UE7H 1AI8H 4ABJA 3ZV8A 4OS5A 2ZDLA