1O3LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA02
1SGCA 2GD4B 2XBWA 1B0FA 3SV9A 3BTWE 4NFEA 1KXDA 4B76A 1UHBB 2A5AA 3ODFA 4CRDA 3RXSA 1G2MA 3MI4A 2R9PA 4X2WA 1CE5A 1HAOH 1TQ7B 4CH2B 4Q2KA 2XWAA 3BTDE 2A5IA 5EW1H 1V2NT 3ZVBA 1GBBA 2QF3A 3HKJB 4X6OA 3T29A 1QQUA 1NS3A 2BD7A 5DPAA 2OC1A 1MQ6A 3A8CA 1SPJA 1Y3UA 1GMCG 1EZQA 3UPEA 5A8YA 2C3SA 1TABE 5LH8A 4MTBA 3OY5U 3ZYEA 3M5LA 1OP2A 2F9NA 2B0FA 1AFQB 2SGEE 4K8YA 3V7TA 3SQHE 5L6NH 3ZZ8A 4Q7YA 1AHTH 4IN1A 1LQDB 2XRCA 3A81A 1A7SA 2G4TA 1O2NA 1W7GH 2A7CA 4X1RU 3LJJA 1KIGH 2QAAA 6GCHF 1O3LA 1ELTA 1AVXA 1D6RA 3D23A 2A5KA 1GBJA 2ZIQH 2YNBA 4INLA 2OUAA 1OWDA 3Q3YA 1NC6A 3GYMA 3RXPA 3M5MA 2FTMA 2ZCKP 1J17T 2K1QA 4MNVA 2WPIS 1O3IA 4ZXYH 2WINI 4Y8XA 5FXLA 3CS0A 1HAPH 1VZQH 4B2AA 2W7SA 7LPRA 3HGNA 1C9PA 1HXEH 1C1OA 3M61U 4MPXA 3EGKH 4Y7BA 1H8IH 1L0ZA 3AW0A 2H9HA 1DVAH 5FPTA 2FPZA 2BVXH 3GDUA 1K1JA 1O37A 1OX1A 1ARCA 1YYY1 2JH0D 3O8RA 1EJAA 4YOJA 4ASHA 1KSNA 2P59A 2SFAA 1S84A 4WH6A 4ISIH 5LPFA 2C93B 3IG6B 3M5OA 1HB0B 2BMGB 1VCQA 1YP9A 5IDKA 1KXCA 4Z6AH 2G4UA 4MPVA 1V2KT 1VJAU 1AVGH 1MQ5A 2P8OC 1C5PA 3SV6A 3PO1C 4CR9A 2F9UA 5T3HA 1DDJA 1LPKB 1YCPM 1EKBB 1OYTH 2PTNA 4ZAEA 1TRMA 3E90B 2G81E 2ZG0H 3U8TH 3OY6U 1DM4B 4F4OC 1SLVB 4GHTA 1OWHA 3M37A 4TPIZ 2TGTA 3RXUA 2OQUA 4QT8C 5EPNA 1C5YB 1W7XH 2HPQH 2D1JA 3KGPA 4YOGA 3E0NB 1ELGA 3A87A 3SNEA 4ESTE 1XUGA 5LPEA 3PMAB 6LPRA 3A8BA 1GG6C 1P2MA 1NT1A 1MKWH 4ISOA 3M36A 2ZQ1A 1CVWH 1CHOG 2H6MA 2BLOA 3VEQB 4GLYA 3RC4A 3GCOA 3UR9A 3MU5A 4O03A 5JB9S 2UUKB 5ETXA 5LGOA 1HLTH 2PFEA 4RN6A 1ELCA 1O2WA 1IQIA 5EXMA 1O3FA 2H9TH 1N8OB 3TGIE 2Z3DA 1GJCB 1ZR0A 1SQTA 2EA3A 4IBLH 3RXQA 2RA3A 2A32A 2Y81A 4NCYA 3A7ZA 3T5FH 1BTWA 1THPB 1V3XA 1C5TA 1QURH 3UREA 2ZC9H 3SUDA 1T8MA 2BQ6B 5A09A 1MH0A 1T7CA 1G36A 1TFXA 2KAIB 5FPYA 1ZRKA 4ISNA 3ZZ3A 3O8DA 1EATA 2BQWB 2J38A 1DT2A 1SLWB 1P01A 4LK4A 3PTNA 4ABHA 1VITF 1GMDF 3SI3H 3SUGA 5K0HA 1ESBA 4MNWA 3H7TA 2AYWA 1K1PA 3PM3A 2ZTZA 1NFXA 1MD8A 2P3TB 1V2WT 3F9HA 2QXJA 2ZFTA 5L30H 2ANMH 1SGTA 1NTPA 1YC0A 2Q6DA 1HJ9A 1YPGH 2PWXA 4MLFB 3P8NA 4U01A 1HAGE 1V2QT 1DWCH 2ZU1A 2VVUA 2GDEH 3V3MA 4YT7H 1D6WA 1GMDG 3ZVGA 3MH7A 5HMAA 3SJIA 4AFQA 1NO9H 2O8LA 1NRSH 2ZDAH 1O2MA 2ZU2A 1DX5M 3BTTE 3ZVEA 2ZTYA 3O8BA 1ACBE 1BQYA 1C5ZB 3D49H 4RKJB 2OXSA 1GVLA 1OWJA 1Y5AT 3A8AA 3EQ0H 1V2ST 4U32A 4I7YH 4UFDH 1CA0C 1YF4A 5DKMA 1P3EA 2VWLA 5ESTE 3OX7U 3RLYH 4I8JA 1G30B 1AB9C 2BLWA 4KP0A 3QGJA 3SO3A 3GCHC 4YLUA 1EJNA 1WBGB 4FU8A 1EAWA 4AFUA 1PQ7A 2BZ6H 5EW2H 4I32A 4BAKB 3MHWU 1GMHG 4CREA 4OS6A 4UDWH 1DWDH 4O9VA 4A1VA 4CHAC 1W13U 2B7DH 1UK3A 4UD9H 1P2JA 2FESH 1SQAA 1ZJDA 4TWWA 1ZRBA 2WUBA 4BAOB 2TGDA 3K6ZA 3I29A 3MWIU 2J95A 3UNSA 2UWLA 3GCNA 1FAXA 2O9QA 2RA0A 3LOXA 1K22H 3I77A 2ZA5A 3L3TA 1ELDE 3QLPH 3SUFA 4KKDA 4ZKOU 2THFB 5E2PA 4FUDA 5AF9H 5F8ZA 1OP0A 3B23B 3KQEA 8ESTE 1C2JA 1LVMA 1THSH 4Y6DA 3SHCH 4FUGA 2WPMS 2QXIA 3PTBA 5JYIA 2G5NA 5EQRA 3FANA 4UEHH 4HGCA 3PYHA 2V3HH 1E38B 4HTCH 1ZMNA 2O8TA 2AGEX 1SR5C 4NIVA 1AUJA 1QHRB 3GCHB 2XBXA 1HIAB 1MBQA 1O0DH 4TY7A 2QA9E 1EOJA 3ZV9A 3R0FA 2A7HA 2B8OH 4X1SU 1HXFH 1AZ8A 1W14U 4ISLA 3LGIA 1KLJH 1BT7A 1U6QA 3UOPA 1RFNA 1PQ5A 1TNIA 5AFZH 3TJNA 2WV5A 4AB9A 1F5KU 3MYWA 1DY9A 3UNQA 5JBCS 3D62A 8LPRA 1LPZB 3MO3A 3KNXA 3BG4C 1RIWB 5FCKA 1KDQB 1Y59T 2GX4A 1V2PT 4ZHAA 4E06H 1BMMH 1P04A 1TRYA 3LT3A 4X2VA 1DY8A 2W26A 4XDEA 1G3BA 2ZFSA 3M3VA 1RRKA 4AYYB 3LONA 5EODA 1UTOA 1C2FA 3U1IB 1C2KA 1O2SA 4OS4A 5PTPA 1MUEB 4DVAU 5FBIA 1AKSA 3Q3XA 2ALVA 3ITIA 1YPJH 3BG4B 1TPAE 3CENA 3QZQA 2FXRA 5TCAA 1BMAA 1TGNA 2WPKS 3SU2A 3LU9B 1K2I1 4O3UA 5AFYH 3BEUA 2G00A 1O2HA 4DY7B 1K28D 4D9RA 1YBWA 2ZDLA 3VGCC 1C2GA 1ZLRA 1HAHH 1IQHA 1GBLA 1C5MD 1YCPK 1B0EA 2BLQA 1IAUA 2SNVA 1EPTA 1M9UA 4H42U 2VB0A 1DSTA 5EOKA 3AW1A 1MTSA 1UHBA 1TB6H 3P95A 5TCCA 2GCTC 2BDGA 1LKBA 4I8HA 1PQ8A 1GBFA 2FS8A 4X2YA 2UUYA 4GUXA 2ZEBA 1CQQA 3U9AH 1O2TA 1O3OA 5FPSA 3TH2H 2A31A 4H4FA 1HYLA 3OSYA 3KCGH 1MTVA 2G8TA 3ZYDA 2O8MA 3MNCA 2BOHB 4X1QU 1F5RA 3S0NA 1C5OH 4IMQA 2H1UA 2R0KA 3T2NA 2EEKA 3TJOA 1TBRH 4UFGH 3A7WA 3PROA 1Z8GA 1WOFA 4X6NA 3M7TA 1QCPA 2FOFA 4NGAH 1C1SA 1YLCA 3GICB 1EOLA 4CBOA 4ABDA 5AHGH 4GSOA 4X6PA 1PPZA 3W95A 2RDLA 1O2OA 1AB9B 1WU1A 1QQ4A 5EGMA 4FUEA 3F9EA 1H8DH 4Q80A 1KLTA 3LGYA 2ILNA 1QBVH 5IYTA 1GJ9B 1ZSJA 5T6GA 4LZ1H 1BHXB 2GMTB 2OC8A 3A80A 1UTPA 3NXPA 1ELBA 1O36A 3DFLA 2G52A 1ZSKA 3RXLA 2FOBA 1QJ1B 1OXGA 1TNJA 1WCZA 2ZGBH 3P8OA 1P2QA 1Z8JB 2ZHQH 2ZQ2A 1WYKA 1IQFA 4X0WU 1J15A 3S9AA 1RXPA 5C67A 1C2LA 3H5CB 2BD2A 4U30A 5HM9A 1ESAA 1QJ6B 3U8RH 3FP7E 3F6UH 4B74A 1CBWC 1EAIA 2CN0H 1BTXA 3Q00A 1TBZH 2DUCA 2BD3A 1EB1H 1VITG 2CF8H 5ESBA 3ZZDA 2GDDA 1GHWH 1AVWA 3QN7A 1Y5UT 1SGFG 5T6DA 5DP7A 1O2JA 2AGGX 2J94A 1N6YA 2VH0A 4CH8B 2QN5T 5C1YA 8GCHG 1D4PB 1FPCH 3DUXH 3RC5A 1VGCB 3RMMH 1GJ7B 1AY6H 1XM1A 2H2ZA 2NU4E 2WUCA 2XBVA 4CHAB 1NFUA 2GP9B 4NZLA 1ANEA 1F2SE 2Z9LA 4UFFH 1AU8A 1EPTC 2PKAA 1P12E 2ANWA 1GBAA 1TONA 5I25A 1G3DA 4MPWA 1AO5A 3SV8A 3GY3A 3DD2H 3FZZA 2A7JA 4Y10E 4KTUA 1EPTB 1CA8B 3BN9A 3MO6A 2PKSB 2PW8H 1A0JA 3TNTA 5JPMH 3RM2H 1S0QA 5JBTA 1ZMJA 4I8GA 1Z1IA 3WY8A 1RTFB 1GJAB 1EP5A 2NU0E 2J4IA 3OTJE 3MTYA 4LOYH 3EE0B 5GDSH 1O3KA 1LVBA 1DANH 4B75A 1JOUB 3LH1A 1A3EH 4CRCA 1G9IE 1GCDA 4IGDA 3M5NA 2BY6X 1UCYE 1YPHE 1D3TB 1PPFE 1Y3YA 2FI4E 1XUIA 1CHGA 1OKXA 1B5GH 2B5TB 7GCHF 4YOIA 4JK5A 1FAKH 1C5QA 1SGRE 1TX8A 2BZAA 1H9IE 2HNTC 4AOQA 1XMNB 3S9BA 2Q6FA 2GV6A 2XW9A 4OS7A 1O35A 4A5TS 1NM6A 1H9HE 4MG3A 4X8TH 2QIQA 4ZHLU 4NIWA 4K3JA 4Y8YA 1GDUA 1LHDH 1SB1H 4Y7AA 2GT8A 2VIDA 4UONA 4XBBA 1XX9A 3BIUH 3VFEA 1ANDA 1GHZA 2Z9JA 3CP7A 1TPPA 1TX6A 3W94A 1P2NA 3UY9A 1UTJA 2ZDKA 3Q3KA 1O3GA 1AMHA 2ZDMA 3ZZ7A 1ZPBA 1HAYB 1XKBC 4A6LA 1ID5H 2OP9A 3R3GB 3MMGA 3MU8A 2EI8A 4XBCA 1W8BH 4YO9A 2BDIA 2ESTE 3TJVA 2C8WB 3F9FA 1GGDB 2GVFA 1MZDA 5E0JA 3V13A 3JZ1B 1FI8A 1ZTJA 2UWPA 4E05H 2BY8X 1FLEE 1F7ZA 1TNHA 4BTUB 1TPOA 1G32B 3H7OA 1UO6A 1PFXC 2D8WA 1PJPA 1V2LT 3K9XB 4WF8A 2TRMA 1ABIH 2JKHA 3TK9A 1O2IA 3RP2A 4D9QA 5EPYA 3QWCH 2XC5A 2FOCA 1SLUB 2QC2A 1O3AA 3SJ8A 3V12A 3RMOH 1LQEA 4TPYA 1BMNH 2FZZA 1O39A 1BJVA 1DUEA 4WWYA 2VH6A 4MVNA 3LH3A 3Q76A 1KXBA 4AFZA 1G2LA 1UJ1A 3MNSA 5C2ZA 1A4WH 1WSSH 2BDHA 2UUFB 1KYNA 3VB4A 1GHBF 3AASA 2F91A 3QTVH 4YZUA 1DWEH 4FUFA 3SUEA 1JIRA 3QTOH 1UVSH 4JZDH 3ZZBA 3QUMP 2XWBI 2BHGA 1QRXA 2OTVA 1PPCE 4CR5A 3SV2H 1P2KA 1MU8B 4B2BA 1SGQE 3QX5H 3ATLA 1ZMLA 1KXAA 1LMWB 4BAQB 2Y5GA 4A1XA 1W12U 1F0SA 3SV7A 3EYDA 3E91A 1GBTA 1Z71A 4GPGA 2BTCE 1GHXH 3TIUA 4CRAA 4DOQA 3A88A 4K8BA 4K5ZA 1O2PA 1BRAA 1GVZA 2XNIA 4X1NU 1QFKH 1GI5A 4BTIB 1EB2A 3GYLB 2TBSA 4TYDA 3TPIZ 2PGBB 4BAHB 3SNDA 3STIA 3A83A 4ABGA 3VB6A 3RLWH 2GZ8A 2OINA 1MBMA 1AI8H 1O3DA 1Q31A 5FX6A 1FXYA 3A84A 3AAUA 1PPBH 1TWXB 3IITA 5T6FA 1HBTH 1T32A 5I46H 4ZROA 2ODYB 3BTFE 1S81A 3A7XA 5DP8A 3UWIA 2XXLA 5E2OA 2CGAA 1IQLA 1LPGB 1SGDE 3URCA 1QA0A 2EI6A 3SW2B 2BD9A 3I78A 4K1SA 2Y7ZA 2BOKA 1C2MA 1J8AA 4JK6A 1GI3A 1SFIA 2B9LA 2A4OA 1D3QB 1YLDA 5DG6A 3EDXB 2FI5E 2A0QB 1AUTC 1MTUA 2GMTC 1K1OA 1O2UA 4GCHF 1DOJA 5J4SA 1EUFA 2BDBA 1ESTA 1GI4A 3TK5A 3RXEA 2WPJS 1P06A 1IQNA 1QRZA 3K6YA 2FDAA 3JZ2B 2ZFRH 5L2YH 1S82A 1Z8IB 5EXNA 1BRUP 1GJ5H 2SNWA 1YPHC 1AN1E 2XC4A 3STJA 1GBCA 4VGCC 1LHCH 2FOHA 2FOEA 1L1JA 1ETSH 1ZZZA 3GY4A 3HPTB 1QB9A 3LKWA 4OS1A 2VIPA 1SG8B 1C1NA 1CSOE 2A2QH 1WV7H 1YCPH 5B6OA 1FY3A 1C1VH 4B1TA 4DT7B 3TJUA 1E35B 1KXEA 5F03A 1CGHA 3A7TA 2BM2A 4KGAA 1V2JT 2A4QA 2Z7FE 1S6HA 2CHAB 3GCTG 3G01A 5CHAC 1T31A 1C5UA 5ABWA 4AN7A 1HIAA 1D9IA 1EZSC 3EA9A 1W10U 2VU8E 2Y5FA 1WTGH 3AVZA 3QDZB 1XKAC 4BOHA 1C5NH 3B8JA 3ZZCA 5CE1A 1IQMA 1Q2WA 1ZPZA 4BANB 5FAHA 1S85A 1GI7B 1P05A 4DJZB 2ZHDA 1AZZA 3VB5A 1GI9B 4OGXA 2HPPH 1LHEH 1MKXK 4Y76A 5DO4H 1ZYOA 1XUHA 3EA8A 2IJOB 3RMNH 5GWZA 1QY6A 1V2TT 4IW4E 4ZXXH 1E0FD 3A8DA 1MD7A 3HGPA 1SVPA 5H4IB 3TU7H 1XXFA 3VGCB 1V6DA 1C5SA 3HK3B 1C1RA 2CJIA 4ZH8A 3ZVAA 1Y3XA 3ZZ9A 1O5CB 2BYAX 4D76A 1IOEA 4ZKSU 1F92A 5C1XA 1T8LA 4WMFA 4UE7H 3RC6A 4ABFA 1NFYA 4Y8ZA 1C5VA 2FWWA 2D26C 1B7XB 1K1IA 5HM2A 2BDCA 2BQ7B 1G37A 4JZEH 1AD8H 4I8KA 7ESTE 2HVXA 1C1QA 1OOKB 3A85A 1T8OA 3KHVA 1G3EA 2ANKH 1H4WA 3ENSB 2JETC 1QB6A 2Z9GA 1P9SA 1GJ4H 2QYIA 4IS5A 3BV9B 4ABJA 2BD4A 4O3TA 4JCNA 2CMYA 1J9CH 2AH4X 2ZGCA 1Z7KA 1YGCH 1UTKA 1GMHF 3RXGA 1BB0B 2F9PA 2OC0A 3DHKH 2R0LA 2SGFE 4E7RG 1MTWA 3BTME 2I6SA 2CV3A 1FNIA 5TJXA 1YKTA 1AQ7A 1NESE 4WJG2 4O97A 2PKAB 2F9OA 3UR6A 1O38A 1UTNA 4JYTA 4X8VH 3TLOA 2W7UA 4RSPA 3QO6A 2FX4A 1Z6EA 2ZDNA 1C2HA 1YPEH 2FODA 3ATMA 4BAMB 1FY4A 5EQSA 3A82A 3UQOA 1UCYK 3KQCA 2J92A 1O5BB 1OWIA 1WQSA 3PB1E 2Y82A 3SU0A 3LGUA 3HK6B 3TVJB 5FHTA 3P70B 1O2YA 2RG3A 2HRVA 1UCYH 1A0LA 1LCYA 4VGCB 1JIMA 2P3UB 5DP6A 3TH4H 4SGAE 1VCPA 5LPRA 1UVTH 1A46H 4NG9H 1SSXA 2HWLB 2PTCE 1BA8B 1O2RA 3MU4A 3FZDA 1EASA 1P11E 2PGQB 2WPHS 1FDPA 3M7QA 1HRTH 5CMXH 2BD5A 1F0TA 2BD8A 4NA7A 1IQGA 3PO1B 1BIOA 1GBDA 3D65E 2ZO3H 3RXIA 1O30A 6CHAC 1RJXB 1L4ZA 3E6PH 3P17H 3UNRA 1O31A 3DFJA 3URDA 2Y7XA 1Z1JA 2HNTE 5FBEA 3BEIB 1MMJN 4WMDA 1BTUA 2ZFQH 4I31A 5AVDA 3DA9B 1CU1A 1NFWA 1K21H 3T25A 2Y6TA 1KLIH 3OYPA 3RXDA 3SGAE 4A92A 1ZTLA 4INHA 3NPSA 2I6QA 1E37B 2NU2E 1V2OT 1MTNB 5G4BA 3BG8A 2FI3E 4NWKA 1GI6A 1TQ0B 1V2VT 2ZGHA 1PYTC 2STBE 3LGWA 2P93A 1O3JA 3OU0A 1OPHB 1A2CH 1PYTD 1S5SA 4KTSA 1XUKA 1AFEH 1AIXH 2SGDE 2SGAA 1GHBG 4A7IB 2OBOA 1LVOA 1QL8A 2OD3B 2VIWA 1Z6JH 1QB1A 4UFEH 3MNXA 2XTTB 2Z9IA 1EJMA 3PMHB 2FX6A 1PQAA 4WXVA 6GCHG 2EI7A 4FVDA 3SORA 1GJ8B 1HV7A 5GCHF 1RGQA 4ZKRU 9ESTA 2WV4A 1ANBA 1XXDA 1TA6A 1E34B 1OWKA 2A1DB 2G51A 1HFDA 1L4DA 3LGTA 3LC5A 1IQKA 1O3CA 3SHAH 1P8VC 1GMCF 4OS2A 1FY5A 1T4VH 2BXUH 1W3CA 2AEIH 1TGCA 2FP7B 2IPHA 2BVRH 2UWOA 2AMQA 2A45B 1GWAA 1LKAA 4ABIA 1N1LA 4AG2A 1TGTA 2VWOA 1VR1H 2H5CA 1UTMA 4MDSA 3T28A 1BDAA 1TE0A 1P03A 1WUNH 2DE8A 2HOBA 4DIHH 5HXFA 1C1TA 1WQVH 3RDZA 1MZAA 1XUFA 1CGJE 1DXPA 1N6XA 2PLXA 1C4U2 1GBHA 2VIVA 3ZVCA 2C8XB 4NIYA 1HAXB 1XUJA 3NUMA 5C5OA 1SHHB 1ZSLA 1GI0A 1LHGH 2PR3A 1DPOA 2Z94A 2ZZUH 5DP4A 3MH6A 1GCTB 1NZQH 1KTTB 1HAVA 2R3UA 5GCHG 3CS7A 1FY8E 1DUAA 1JMOH 2YOLA 2VVVA 3KEEA 2O8UA 5DP3A 1TALA 2VNTA 2PV9B 3M3TA 1UTLM 1GG6B 1P09A 3A86A 2XBYA 1BTZA 1HJAC 4YT6H 1ZHRA 4I33A 2STAE 2YNAA 3GDVA 3P8FA 5L2ZH 4MQAA 3RMLH 1EAXA 1O3PB 2CF9H 2VIOA 5DK1A 4JZ1A 1HPGA 2TGPZ 2SGQE 1TNGA 1Y3VA 4B2CA 1SLXB 3M7UA 5A8ZA 3BF6H 1C4Y2 4YM9A 3S7HB 3NWUA 4YTAA 1TA2A 2QY0B 1RD3B 3RXRA 5SGAE 1ZGIA 2OBQA 3EAJA 4CBNA 3A89A 2P95A 1BHXF 1QRWA 4FUBA 1C1WH 1F0UA 4HI3A 3RXOA 3MH4A 4FUHA 2ZI2H 2Q6GA 4H6SB 4AORA 2ZFPH 4SGBE 4Y71A 2ZU4A 3PMJA 4JYUH 1T4UH 2AS9A 1UTQA 3RXCA 1D3DB 2P94A 3L33A 1C1MA 3MO9A 3RXBA 1QIXB 3GY8A 2A4RA 3DT0H 4ZUHA 5DGJA 2XYAA 4CRFA 3ATKA 1TMUH 1HAZB 4RKOB 1YPMH 1RTKA 2BY9X 1O3BA 1GCTC 1CT4E 2BB4A 2FOGA 1QNJA 3RXMA 3ATIA 4TWYA 3O8CA 2OLGA 2ZPRA 3E3TA 2TPIZ 2VINA 2V6NA 2J34A 3SU1A 1A3BH 1FY1A 2VIQA 2F9VA 1NRRH 4R0IA 1SOTA 3MH5A 4Q7ZA 3M3SA 1BZXE 1CHOF 1P2OA 2C8YB 3UOUA 2FYRA 4IC6A 3GDSA 2CXVA 3QGNB 5HGGA 3LPRA 1J14A 1O5EH 3GCTF 2Y80A 1HGTH 5C20A 1O2LA 1SGIB 4JZIA 2BDYA 2ZP0H 1TOCB 1RS0A 1CA0B 3HKIB 2FMJA 1EXFA 1FUJA 1QBOA 4FU9A 4INKA 3ZZ5A 1C1UH 2AFQB 3KQDA 2FTLE 3PWBA 1UVOA 3LC3A 3GY5A 3RM0H 2P3FH 3K65B 3VXEH 1L2EA 1IQEA 2ZFFH 1L1GA 2FLRH 1Y5BT 1BMLA 2DE9A 2LPRA 1BTPA 4AZ2B 1SFQB 1K9OE 3MOCA 5DP9A 1AGJA 3RXKA 7KMEH 4ABAA 4NA8A 3RXAA 4XSKU 3SU3A 1FQ3A 1BOQA 1RTLA 3T27A 2AGIX 3C1KA 3TK6A 1Y3WA 1MU6B 2M5TA 1Q3XA 2WYGA 2XC0A 2AIPA 1RIWC 1TIOA 4AYVB 3MFJA 2Z9KA 1D3PB 2R3YA 1BUIA 1NRNH 1J16A 1GVKB 1GJDB 5GJ4B 3N7OA 1QL7A 5EQQA 1O5GH 1A5IA 2QF0A 2ODQA 5F6MA 5EU8A 1K1NA 4DG4A 2PKSC 1O2QA 1JRTA 2C8ZB 6ESTA 1BRBE 2R2WU 3UIRA 1ABJH 3U8OH 4DGJA 3LIWA 1FZZA 1C5XB 1NRQH 4HZHA 2ZHFH 4K69A 4XBDA 5GPIB 1T8NA 2A4GA 3VXFH 4BXWA 2Z3EA 1LDTT 3RXFA 3UWJH 4D8NA 1BTYA 4PROA 3RXHA 1TAWA 1HAVB 1P9UA 3QZRA 1NPMA 2ZTXA 5A0CA 1OWEA 1HAIH 1WAYB 4X2XA 1K1LA 3KQBA 4AB8A 1V2MT 1IQJA 5E0HA 3SJOA 3ATWA 3ESTA 1O2KA 4ZKNU 1TNKA 1AE8H 1AKSB 1HDTH 2J2UA 5BRRE 3TGKE 4JZFH 2ZPSA 5GIBA 1FIZA 2QGRA 3S69A 1INCA 1CBWB 4H6TA 2Q1JA 3PWCA 3SU6A 2BDAA 1UVUH 5GXPA 2GCTB 5A0AE 1ZGVA 2FO9A 5C5NA 2HGTH 1DFPA 3NKKA 1EZUC 1QJ7B 3B9FH 2G55A 4OGYA 3ELAH 1O3EA 4CRBA 1NRPH 2FOMB 1SGNE 1SOZA 2GGVB 4WMEA 2BX3A 2HNTF 1VGCC 1UK2A 4KTCA 1OYQA 1FPHH 1XVMA 3GOVB 3SOSA 4CRGA 2GZ7A 5C3NA 3Q77A 1NROH 1H9LB 4GCHG 1O3HA 2C90B 3UQVA 2BY5X 2ALPA 4OS5A 4Y11E 2OQ5A 3VB3A 4GVUA 3ZVFA 2BLVA 3BEFB 1S6FA 2ODPA 2UUJB 1W0ZU 2ZF0H 1GI1A 1UK4A 3GY6A 3E8LA 5K7RA 1A0HB 1S83A 9LPRA 2R2MB 3BTEE 2FLBH 2OCVB 1DS2E 4X1PU 2BVSH 1X7AC 1SC8U 3PLBA 1ANCA 3MNBA 8KME2 1OP8A 2JH6D 2AMPA 2VGCB 1CT0E 1DSUA 1NU9A 2BX4A 4XE4A 4B71A 1BCUH 4IC5A 2H5DA 5A0BA 2ZWLH 1NU7B 3BSQA 2ZHWH 4X8UH 2ANYA 1GHVH 3QK1A 4ZMAH 4ABBA 4Q7XA 3SU4A 4AFSA 2PHBA 4BNRA 1HNEE 4DW2U 2PUQH 4XFQA 5DJ7A 2FM2A 2F9BH 1O2GH 4FUIA 1V2UT 1IHTH 1DE7H 1KTSB 4ZHMU 3SGQE 2ZKSA 4WY3A 1HJ8A 4MPUA 3PV4A 3ZZ4A 3BTKE 2GZ9A 3ZZ6A 1SI5H 4MNYA 2QV1A 4NWLA 5CHAB 1BRCE 1UMAH 1O34A 3BTQE 1SGPE 1HJAB 1O3NA 4WH8A 2TIOA 5E8EH 4K2YA 1NY22 2TGAA 1EX3A 2GT7A 3P6ZB 4FUJA 1W2KH 2FEQH 1BTHH 2AIQA 3V0XA 5F8TA 1NN6A 3ZZAA 4J1YA 2D2DA 1W11U 4J2YB 2KAIA 3A7YA 1LTOA 2GV7A 1DWBH 1ZHPA 3BTGE 4LXBH 5A2MH 1V2RT 1GI2A 3M35A 3E1XB 2IN2A 5JBBS 3T62A 3UFAA 1KXFA 1GDNA 1JXPA 3AAVA 3FAOA 1SGFA 1AWHB 3KN2A 4NSYA 3SI4H 3FP6E 4F49A 1BBRE 1F0RA 2GCHG 4NFFA 2ZGXH 3F68H 3KF2A 3TH3H 4NA9H 1QTFA 2WYJA 4IN2A 1LVYA 3A7VA 4D7FA 3SQEE 4A1TA 2GKVE 4ISHH 3UUZA 1K1MA 1SHYA 1P02A 3IWMA 3VPKA 2ZU3A 4BXSA 8GCHF 4IMZA 2PSXA 1O32A 2ZHEH 3LGVA 5FX5A 3S7KB 1PPEE 2V35A 5C1UA 1TRNA 2NWNA 1WTHD 1GPZA 1H1BA 2Z3CA 3E16B 4LZ4B 1FIWA 1IHSH 1Y8TA 3S9CA 4DCDA 4K1TA 1ETTH 2RCEA 4Y0ZE 1GBKA 3GY2A 1MAYA 1ZPCA 2GCHF 4MNXA 1TGSZ 4Y0YE 1TOMH 1UVPA 4FVBA 1TMBH 5DP5A 4WXIA 1DXWA 4K60A 1VCWA 1GJ6A 2A2XH 1QGFA 3GY7A 1MKXH 2F83A 3SN8A 1TLDA 1GBMA 1KDQA 1AE5A 3E0PB 2FS9A 1DITH 1ETRH 1SBWA 1GL1A 4FU7A 4FUCA 1TPSA 3SGBE 1TX7A 2Z6BD 2ZNKH 4JMYA 3TITA 3RU4T 1SL3A 3U1JB 1TMTH 3NK8A 1AWFH 3SNAA 1O33A 1C4V2 1ARBA 1O5DH 3RXVA 2ZGJA 3BTHE 1GBEA 1TYNA 3T26A 3RU4E 3SNCA 1BBRH 1ELVA 3LDXH 3TNSA 1MTNC 4WVPE 5EG4A 3F1SB 4AGKA 1GL0E 1SMFE 2ZCHP 1CGIE 2VVCA 2AMDA 2V0BA 1DICA 4DURA 1MCTA 1GI8B 1VITH 3RXTA 1EQ9A 3FP8E 2W3KA 1ELFA 2FYQA 3SJ9A 4YLQH 2G5VA 1QL9A 4JYVH 2JETB 1KY9A 2SGPE 1PPGE 1C5RA 2QXHA 4NIXA 1EZXC 2W5EA 1FONA 1ELAA 3ODDA 1A5GH 3P8GA 4X6MA 3PLKA 1JRSA 1O3MA 2H9EH 1DLKB 2HALA 2ZDVH 3BIVH 4D7GA 1CT2E 1P57B 1OS8A 1L1NA 5A8XA 2ZCLP 2VWNA 1GBIA 2NU1E 1SQOA 1MCVA 1GHYH 1DLEA 1P3CA 3FFGA 4AX9H 1C9TA 3GISB 2VGCC 2J9NA 1EAUA 1F5LA 2F3CE 3UTUH 1TGBA 1E36B 2EC9H 2W3IA 2GTBA 3MU0A 2HLCA 1C5LH 3U98H 3ZVDA 5FCRA 2ZPQA 3SU5A 1LO6A 1C2DA 5JB8S 2Y5HA 3KL6A 1C2EA 4FXGH 3K2UA 2JH5D 2VWMA 1EP6A 1ZTKA 4AGJA 2FIRH 1HUTH 6CHAB 1GGDC 5F8XA 4E7NA 4B73A 4HFPB 1TNLA 1FJSA 1A61H 2V3OH 1GJBB 1YM0A 3VB7A 4NSVA 2ULLA 1ZJKA 4XOJA 1O2XA 1XVOA 3TGJE 1C5WB 5BPEA 1TBQH 1CO7E 1BITA 3SBKA 5JDUB 3NZIA 2P16A 3SZNA 1C2IA 4GAWA 1FN8A 1S0RA 1P10A 1A1RA 1ZHMA 3L6PA 3ZV8A 5HYOA 1JWTA 2FOAA 3RU4D 4YESB 1SGEE 5J4QA 4THNH 4KELA 4ABEA 1O2ZA 4Z0KA 3PLPA 1VJ9U 3U69H 1QR3E 5E0GA 1ELEE 1MAXA 1SGYE 1ORFA 1BJUA 1YPLH 4NZQA 4TY6A 1O2VA 2PSYA 1W0YH 5JBAS 1AFQC 1GHAF 1O5FH 2XCFA 3HATH 3RXJA 1C1PA 3KIDU 2OC7A 3NCLA 5EXLA 1N8OC 4I8LA 4GHQA 1A5HA 1Z8RA 2P8OB 1PPHE 1FN6A 4Y79A 3C27B 2AERH 3FVFB 1LHFH 1ZOMA 2CHAC 4R8TB 2XCNA 1FV9A 1QA7A 2QXGA 3SNBA 2QCYA 1P0SH 2ASUB 1G3CA 2BY7X 1JBUH 1FMGA 1BBRK 2C4FH 2PUXB 2LNCA 4AG1A 1YPKH 1MKWK 2ZU5A 1OSSA 2BXTH 3LJOA 1GDQA 1QBNA 2VJ1A 2O8WA 3MU1A 3F9GA 1P2IA 2NU3E 4U2WA 1HCGA 3SJKA 1THRH 4DIIH 4M7GA 3RUOA 4X8SH 1GHAG 2ZECA 2IOTA 3P92A 1O5AB 4K1EA 3EA7A 2WPLS 3PMBB 4BTTB 7GCHG
chains in the Genus database with same CATH superfamily
1SGCA 2GD4B 2XBWA 1B0FA 3SV9A 3BTWE 4NFEA 1KXDA 4B76A 1UHBB 2A5AA 3ODFA 4CRDA 3RXSA 1G2MA 3MI4A 2R9PA 4X2WA 1CE5A 1HAOH 1TQ7B 4CH2B 4Q2KA 2XWAA 3BTDE 2A5IA 5EW1H 1V2NT 2KM0A 3ZVBA 1YWUA 1GBBA 2QF3A 3HKJB 4X6OA 3T29A 1QQUA 1NS3A 2BD7A 5DPAA 2OC1A 1MQ6A 3A8CA 3KYFA 1SPJA 1Y3UA 1GMCG 1EZQA 3UPEA 5A8YA 2C3SA 1TABE 5LH8A 4MTBA 3OY5U 3ZYEA 3M5LA 1OP2A 2F9NA 2B0FA 1AFQB 2SGEE 4K8YA 3V7TA 3SQHE 2M2AA 5L6NH 3ZZ8A 4Q7YA 1AHTH 4IN1A 1LQDB 2XRCA 3A81A 1A7SA 2G4TA 1O2NA 1W7GH 2A7CA 4X1RU 3LJJA 1KIGH 2QAAA 6GCHF 1O3LA 1ELTA 1AVXA 1D6RA 3KQ5A 3D23A 3EE7A 2AHME 2A5KA 1GBJA 2ZIQH 1BMFD 2YNBA 4I86A 4INLA 2OUAA 1OWDA 3Q3YA 1NC6A 3GYMA 3RXPA 3M5MA 2FTMA 2ZCKP 1J17T 2K1QA 4MNVA 2WPIS 2QE7D 1O3IA 4ZXYH 2WINI 4Y8XA 5FXLA 3CS0A 1HAPH 1VZQH 4B2AA 2W7SA 7LPRA 3HGNA 1C9PA 1HXEH 1C1OA 3M61U 4MPXA 3EGKH 4Y7BA 1H8IH 1L0ZA 3AW0A 2H9HA 1DVAH 5FPTA 2FPZA 2BVXH 3GDUA 1K1JA 1O37A 1OX1A 1ARCA 1YYY1 2JH0D 3O8RA 1EJAA 4YOJA 4ASHA 1KSNA 2P59A 2SFAA 1S84A 4WH6A 4ISIH 5LPFA 2C93B 3IG6B 3M5OA 1HB0B 2BMGB 1VCQA 1YP9A 5IDKA 1KXCA 4Z6AH 2G4UA 4MPVA 1V2KT 1VJAU 1AVGH 1MQ5A 2P8OC 1C5PA 5F53A 3SV6A 3PO1C 4CR9A 2F9UA 2CK3D 5T3HA 1DDJA 1LPKB 1YCPM 1EKBB 1OYTH 2PTNA 4ZAEA 1TRMA 3E90B 2G81E 2ZG0H 3U8TH 3OY6U 1DM4B 4F4OC 1SLVB 4GHTA 1OWHA 3M37A 1WXRA 4TPIZ 2TGTA 3RXUA 2OQUA 4QT8C 5EPNA 1C5YB 1W7XH 2HPQH 2D1JA 3KGPA 4YOGA 5B6LA 3E0NB 1ELGA 3A87A 3SNEA 4ESTE 1XUGA 5LPEA 3PMAB 6LPRA 3A8BA 1GG6C 1P2MA 1NT1A 1MKWH 4ISOA 3M36A 2ZQ1A 1CVWH 1CHOG 2H6MA 2BLOA 3VEQB 4GLYA 3RC4A 3GCOA 3UR9A 3MU5A 4O03A 5JB9S 2UUKB 5ETXA 5LGOA 1HLTH 2PFEA 4RN6A 1ELCA 1O2WA 1IQIA 5EXMA 1O3FA 2H9TH 1N8OB 3TGIE 2Z3DA 4ACAA 1GJCB 1ZR0A 2RDEA 1SQTA 2EA3A 4IBLH 3RXQA 2RA3A 2A32A 2Y81A 4NCYA 3A7ZA 3T5FH 1BTWA 1THPB 1V3XA 1C5TA 1QURH 3UREA 2ZC9H 3SUDA 1T8MA 2BQ6B 5A09A 1MH0A 1T7CA 1G36A 1TFXA 2KAIB 5FPYA 1ZRKA 4ISNA 3ZZ3A 3O8DA 1EATA 2BQWB 2J38A 1DT2A 1SLWB 1P01A 4LK4A 3PTNA 4ABHA 1VITF 1GMDF 3SI3H 3SUGA 5K0HA 1ESBA 4MNWA 3H7TA 2AYWA 1K1PA 3PM3A 2ZTZA 1NFXA 1MD8A 2P3TB 1V2WT 3F9HA 2QXJA 2ZFTA 5L30H 2ANMH 1SGTA 1NTPA 1YC0A 1EFRD 2Q6DA 1HJ9A 1YPGH 2PWXA 4MLFB 3P8NA 4U01A 1HAGE 1V2QT 1DWCH 2ZU1A 2VVUA 2GDEH 3V3MA 4YT7H 1D6WA 1GMDG 3ZVGA 3MH7A 5HMAA 3SJIA 4AFQA 1NO9H 2O8LA 1NRSH 2ZDAH 1O2MA 2ZU2A 1DX5M 3BTTE 1NBMD 3ZVEA 2ZTYA 3O8BA 1ACBE 1BQYA 1C5ZB 3D49H 5FL7D 4RKJB 2OXSA 1GVLA 1OWJA 1Y5AT 2LP6A 3A8AA 3EQ0H 3WW7A 1V2ST 4U32A 4I7YH 4UFDH 1CA0C 1YF4A 5DKMA 1P3EA 2VWLA 5ESTE 3OX7U 3RLYH 3OAAD 1G30B 1AB9C 4I8JA 2BLWA 4KP0A 3QGJA 2HLDD 3SO3A 3GCHC 4YLUA 5IK2D 1EJNA 1WBGB 4FU8A 1EAWA 4AFUA 1PQ7A 2BZ6H 5EW2H 4I32A 4BAKB 3MHWU 1GMHG 4CREA 4OS6A 4UDWH 1DWDH 4O9VA 2EY4C 4A1VA 4CHAC 1W13U 2B7DH 1UK3A 4UD9H 1P2JA 2FESH 1SQAA 1ZJDA 4TWWA 1ZRBA 2WUBA 4BAOB 2TGDA 3K6ZA 3I29A 3MWIU 2J95A 3UNSA 2UWLA 3GCNA 1FAXA 2O9QA 2RA0A 3LOXA 1K22H 3I77A 2ZA5A 3L3TA 1ELDE 3QLPH 3SUFA 4KKDA 4ZKOU 2THFB 5E2PA 4FUDA 5AF9H 5F8ZA 1OP0A 3B23B 3KQEA 8ESTE 1C2JA 1LVMA 1THSH 4Y6DA 3SHCH 4FUGA 2WPMS 2QXIA 3PTBA 5JYIA 2G5NA 5EQRA 3FANA 4UEHH 4HGCA 3PYHA 2V3HH 1E38B 4HTCH 1ZMNA 2O8TA 2AGEX 1SR5C 4NIVA 1AUJA 1QHRB 3GCHB 2XBXA 1HIAB 1MBQA 1O0DH 4TY7A 2QA9E 2VBCA 1EOJA 3ZV9A 3R0FA 2A7HA 2B8OH 4X1SU 1HXFH 4FOUC 1AZ8A 1W14U 4ISLA 3LGIA 1KLJH 1BT7A 1U6QA 3UOPA 1RFNA 1PQ5A 1TNIA 5AFZH 3TJNA 3SYJA 2WV5A 4AB9A 1F5KU 3MYWA 1DY9A 3UNQA 5JBCS 3D62A 8LPRA 5HIZA 1LPZB 3MO3A 3KNXA 3BG4C 1RIWB 5FCKA 1KDQB 1Y59T 2GX4A 1V2PT 4ZHAA 4E06H 1BMMH 1P04A 1TRYA 3LT3A 4X2VA 1DY8A 2W26A 4XDEA 1G3BA 2ZFSA 3M3VA 1RRKA 4AYYB 3LONA 5EODA 1UTOA 1C2FA 2K8IA 3U1IB 1FX0B 1C2KA 1O2SA 4OS4A 5PTPA 1MUEB 4DVAU 5FBIA 1AKSA 3Q3XA 2ALVA 3ITIA 1YPJH 3BG4B 1TPAE 1OHHD 3CENA 2FXRA 3QZQA 5TCAA 1BMAA 1TGNA 2WPKS 3SU2A 3LU9B 1K2I1 4O3UA 5AFYH 3BEUA 2G00A 1O2HA 4DY7B 1K28D 4D9RA 1YBWA 5C0UA 2PP6A 2ZDLA 3VGCC 1C2GA 1ZLRA 1HAHH 1IQHA 1GBLA 1KMHB 1C5MD 1YCPK 1B0EA 2BLQA 1IAUA 2SNVA 1EPTA 1M9UA 4H42U 2VB0A 1DSTA 5EOKA 3AW1A 1MTSA 1UHBA 1MABB 1TB6H 3N7DA 3P95A 2GCTC 5TCCA 2BDGA 1LKBA 5GNDA 4I8HA 1PQ8A 1GBFA 2FS8A 2J98B 4X2YA 2UUYA 4GUXA 2ZEBA 1CQQA 3U9AH 1O2TA 1O3OA 5FPSA 2KR7A 3TH2H 2A31A 4H4FA 1HYLA 2L6OA 3OSYA 3KCGH 1MTVA 2G8TA 3ZYDA 2O8MA 3MNCA 2BOHB 4X1QU 1F5RA 3S0NA 3F0PA 1C5OH 4IMQA 2H1UA 2R0KA 3T2NA 2EEKA 3TJOA 1TBRH 4UFGH 3A7WA 3PROA 1Z8GA 1WOFA 4X6NA 3M7TA 1QCPA 2FOFA 4NGAH 1C1SA 1YLCA 2QF4A 3GICB 1EOLA 4CBOA 4ABDA 5AHGH 4GSOA 4X6PA 4ZCNA 4XRNA 1PPZA 3W95A 2RDLA 1O2OA 1AB9B 1WU1A 1QQ4A 5EGMA 4FUEA 3F9EA 1H8DH 4Q80A 1KLTA 3LGYA 2ILNA 1QBVH 5IYTA 3PRBA 1GJ9B 1ZSJA 5T6GA 4LZ1H 1BHXB 4TSFD 2GMTB 2OC8A 3A80A 1UTPA 3NXPA 1ELBA 1O36A 3DFLA 2G52A 1ZSKA 3RXLA 2FOBA 1QJ1B 1OXGA 1TNJA 1WCZA 2ZGBH 3P8OA 1P2QA 3WWBA 1Z8JB 2ZHQH 2ZQ2A 1WYKA 1IQFA 4X0WU 1J15A 3S9AA 1RXPA 5C67A 1C2LA 3F0OA 3H5CB 2BD2A 4U30A 5HM9A 1ESAA 1QJ6B 3U8RH 3FP7E 3F6UH 4B74A 1CBWC 1EAIA 2CN0H 1BTXA 3Q00A 1TBZH 2DUCA 2BD3A 1EB1H 1VITG 2CF8H 5ESBA 3ZZDA 2GDDA 1GHWH 1AVWA 3QN7A 1Y5UT 1SGFG 5EJLA 5T6DA 5DP7A 1O2JA 2AGGX 2J94A 1N6YA 2VH0A 4CH8B 2QN5T 5C1YA 8GCHG 1D4PB 1FPCH 3DUXH 3RC5A 1VGCB 3RMMH 1GJ7B 1AY6H 1XM1A 2H2ZA 1E1RD 2NU4E 2WUCA 2XBVA 4CHAB 1NFUA 2GP9B 4NZLA 1ANEA 1F2SE 2Z9LA 3PRDA 4UFFH 1AU8A 1EPTC 2PKAA 1P12E 2ANWA 1GBAA 5KECA 1TONA 5I25A 1G3DA 4MPWA 1AO5A 3SV8A 3GY3A 3DD2H 3FZZA 5DSFA 2A7JA 4Y10E 4KTUA 5T1VA 1EPTB 1CA8B 3BN9A 3MO6A 2PKSB 2PW8H 1A0JA 3TNTA 4YXWD 5JPMH 3RM2H 1S0QA 5JBTA 1ZMJA 4I8GA 1Z1IA 3WY8A 1RTFB 1GJAB 1EP5A 2NU0E 3NRLA 2J4IA 3OTJE 3MTYA 4LOYH 3EE0B 5GDSH 1O3KA 1LVBA 1W0JD 1DANH 3ZIAD 4B75A 1JOUB 3LH1A 1A3EH 4CRCA 1G9IE 1GCDA 4IGDA 5KEDA 3M5NA 2BY6X 1UCYE 1YPHE 1D3TB 1PPFE 1Y3YA 2FI4E 1XUIA 1CHGA 1OKXA 1B5GH 2B5TB 7GCHF 4YOIA 4JK5A 1FAKH 1C5QA 1SGRE 1TX8A 2BZAA 1H9IE 2HNTC 4AOQA 1XMNB 3S9BA 2Q6FA 2GV6A 2XW9A 4OS7A 1O35A 4A5TS 1NM6A 1H9HE 4MG3A 4X8TH 2QIQA 4ZHLU 4NIWA 4K3JA 4Y8YA 1GDUA 1LHDH 1SB1H 4Y7AA 2GT8A 2VIDA 4UONA 4XBBA 1XX9A 3BIUH 3VFEA 1ANDA 1GHZA 2Z9JA 3CP7A 1TPPA 1TX6A 3W94A 1P2NA 3UY9A 1UTJA 2ZDKA 3Q3KA 1O3GA 1AMHA 2ZDMA 3ZZ7A 1ZPBA 1HAYB 1XKBC 4A6LA 1ID5H 2OP9A 3R3GB 3MMGA 3MU8A 2EI8A 4XBCA 1W8BH 4YO9A 2BDIA 2ESTE 3TJVA 2C8WB 3F9FA 1GGDB 2GVFA 1MZDA 5E0JA 3V13A 3JZ1B 1FI8A 1ZTJA 2UWPA 4E05H 2BY8X 1FLEE 1F7ZA 1TNHA 5C0TA 4BTUB 1TPOA 1G32B 3H7OA 3MQKC 1UO6A 2WPDD 1PFXC 2D8WA 1PJPA 1V2LT 3K9XB 4WF8A 2TRMA 1ABIH 2JKHA 3TK9A 1O2IA 3RP2A 4D9QA 2GJGA 5EPYA 3QWCH 2XC5A 2FOCA 1SLUB 2QC2A 5EIYA 1O3AA 5HKKD 3SJ8A 3V12A 3RMOH 1LQEA 4TPYA 1BMNH 2FZZA 1O39A 1BJVA 1DUEA 4WWYA 2VH6A 4MVNA 3LH3A 3Q76A 3DCLA 1KXBA 4AFZA 1G2LA 1UJ1A 3MNSA 5C2ZA 1A4WH 1WSSH 2BDHA 2UUFB 1KYNA 3VB4A 5KGOA 1GHBF 3AASA 2F91A 3QTVH 2JIZD 4YZUA 1DWEH 4FUFA 3SUEA 1JIRA 2KX4A 1UVSH 3QTOH 4JZDH 3ZZBA 3QUMP 2XWBI 2BHGA 1QRXA 2OTVA 1PPCE 4CR5A 3SV2H 1P2KA 1MU8B 4TT3D 4B2BA 2LELA 1SGQE 3QX5H 3ATLA 1ZMLA 1KXAA 1LMWB 4BAQB 2Y5GA 3F2FA 4A1XA 1W12U 1F0SA 3SV7A 3EYDA 3E91A 1GBTA 1Z71A 4GPGA 2BTCE 1GHXH 3TIUA 4CRAA 2KFWA 4DOQA 3A88A 4K8BA 4K5ZA 1O2PA 1BRAA 1GVZA 2XNIA 4X1NU 1QFKH 2L74A 1GI5A 4BTIB 1EB2A 3GYLB 2TBSA 4TYDA 3TPIZ 2PGBB 4BAHB 3SNDA 2J98A 3STIA 3A83A 4ABGA 3VB6A 3RLWH 2GZ8A 2OINA 1MBMA 1AI8H 1O3DA 1Q31A 5FX6A 1FXYA 3A84A 3AAUA 1PPBH 1TWXB 3IITA 5T6FA 1HBTH 1T32A 5I46H 4ZROA 2ODYB 1YY3A 1S81A 3BTFE 3A7XA 5DP8A 3UWIA 2XXLA 3VG8A 5E2OA 2CGAA 1IQLA 1LPGB 1SGDE 3URCA 1QA0A 2EI6A 3SW2B 2BD9A 3I78A 4K1SA 3OEED 3F2HA 2Y7ZA 2BOKA 2WZQA 1C2MA 1J8AA 4JK6A 1GI3A 1SFIA 2B9LA 2A4OA 1D3QB 1YLDA 5DG6A 3EDXB 2FI5E 2A0QB 1AUTC 1MTUA 4ACBA 2GMTC 1K1OA 1O2UA 4GCHF 1DOJA 5J4SA 1EUFA 2BDBA 1ESTA 1GI4A 3TK5A 3RXEA 2WPJS 1P06A 1IQNA 1QRZA 3K6YA 2FDAA 2XNDD 3JZ2B 1YLNA 2ZFRH 1S82A 5L2YH 1Z8IB 5EXNA 1BRUP 1GJ5H 2SNWA 1YPHC 1AN1E 2XC4A 3STJA 1GBCA 4VGCC 2WHXA 1LHCH 2FOHA 2FOEA 1L1JA 1ETSH 1ZZZA 3GY4A 3HPTB 1QB9A 3LKWA 4OS1A 2VIPA 1SG8B 1C1NA 1CSOE 2A2QH 1WV7H 1YCPH 5B6OA 1FY3A 1C1VH 4B1TA 4DT7B 3TJUA 1E35B 1KXEA 5F03A 1CGHA 3A7TA 2BM2A 4KGAA 1V2JT 2A4QA 3F3BA 2Z7FE 1S6HA 2CHAB 3GCTG 3DSOA 3G01A 5CHAC 1K0HA 1T31A 1C5UA 5ABWA 4AN7A 1HIAA 1D9IA 1EZSC 3EA9A 1W10U 2VU8E 2Y5FA 1WTGH 3AVZA 3QDZB 1XKAC 4BOHA 1C5NH 3B8JA 3ZZCA 5CE1A 1IQMA 1Q2WA 1ZPZA 4BANB 5FAHA 1S85A 1GI7B 1P05A 4DJZB 2ZHDA 1AZZA 3VB5A 1GI9B 4OGXA 2HPPH 1LHEH 1MKXK 4Y76A 5DO4H 1ZYOA 1XUHA 3EA8A 2IJOB 3RMNH 5GWZA 1QY6A 1V2TT 4IW4E 4ZXXH 1E0FD 3A8DA 1MD7A 3HGPA 1SVPA 5H4IB 3TU7H 1XXFA 3VGCB 1V6DA 1C5SA 3HK3B 1C1RA 2CJIA 4ZH8A 3ZVAA 1Y3XA 3ZZ9A 1O5CB 2BYAX 4D76A 1IOEA 4ZKSU 1F92A 5C1XA 1T8LA 3OEHD 4WMFA 4UE7H 3RC6A 4ABFA 1NFYA 4Y8ZA 1C5VA 2FWWA 2D26C 1B7XB 1K1IA 5HM2A 2BDCA 2BQ7B 1G37A 4JZEH 1AD8H 4I8KA 7ESTE 2HVXA 1C1QA 1OOKB 3A85A 1T8OA 3KHVA 1G3EA 2ANKH 1H4WA 3ENSB 2JETC 3PV5A 1QB6A 2Z9GA 1P9SA 1GJ4H 2QYIA 4IS5A 2YMSD 3BV9B 4ABJA 2BD4A 4O3TA 4JCNA 2CMYA 1J9CH 2AH4X 2ZGCA 1Z7KA 1YGCH 1UTKA 1GMHF 3RXGA 1BB0B 2F9PA 2OC0A 3DHKH 2R0LA 2SGFE 4E7RG 1MTWA 3BTME 2I6SA 2CV3A 1FNIA 5TJXA 1YKTA 1AQ7A 1NESE 4WJG2 4O97A 2PKAB 2F9OA 3UR6A 1O38A 1UTNA 4JYTA 4X8VH 3TLOA 2W7UA 4RSPA 3QO6A 2FX4A 1Z6EA 2ZDNA 1C2HA 1YPEH 2FODA 3ATMA 4BAMB 1FY4A 1SQRA 5EQSA 3A82A 4RT1A 3UQOA 1UCYK 3KQCA 2J92A 1O5BB 1OWIA 1WQSA 3PB1E 2Y82A 3SU0A 3LGUA 3HK6B 3TVJB 5FHTA 3P70B 1O2YA 2RG3A 2HRVA 2OK5A 1UCYH 1A0LA 1LCYA 4VGCB 1JIMA 2P3UB 5DP6A 3TH4H 1COWD 4SGAE 1VCPA 5LPRA 1UVTH 1A46H 4NG9H 1SSXA 4FETA 2HWLB 2PTCE 1BA8B 1O2RA 3MU4A 3FZDA 1EASA 1P11E 2PGQB 2F43B 2WPHS 1FDPA 3M7QA 1HRTH 5CMXH 2BD5A 1F0TA 2BD8A 4NA7A 1IQGA 3PO1B 1BIOA 1GBDA 3D65E 2ZO3H 3RXIA 1O30A 6CHAC 1RJXB 1L4ZA 3E6PH 3P17H 3UNRA 3H09A 1O31A 3DFJA 3URDA 2Y7XA 1Z1JA 2HNTE 5FBEA 3BEIB 5CHBA 1MMJN 4WMDA 4AC9A 1BTUA 2ZFQH 4I31A 5AVDA 3DA9B 2HVYB 1CU1A 1NFWA 1K21H 3T25A 2Y6TA 1KLIH 3OYPA 3RXDA 3SGAE 4A92A 1ZTLA 1VKYA 4INHA 3NPSA 2I6QA 2WSSD 1E37B 2NU2E 1V2OT 1MTNB 5G4BA 3BG8A 2FI3E 4NWKA 1GI6A 1TQ0B 1V2VT 2ZGHA 1PYTC 2STBE 3LGWA 2P93A 1O3JA 3OU0A 1OPHB 3W1EA 1A2CH 1PYTD 1S5SA 4KTSA 1XUKA 1AFEH 1AIXH 2SGDE 2SGAA 1GHBG 4A7IB 2OBOA 1LVOA 1QL8A 2OD3B 2VIWA 1Z6JH 1QB1A 4UFEH 3MNXA 2XTTB 2Z9IA 1EJMA 4ASUD 3PMHB 2FX6A 1PQAA 4WXVA 6GCHG 2EI7A 4FVDA 3SORA 1GJ8B 1HV7A 5GCHF 1RGQA 1H8HD 4ZKRU 9ESTA 2WV4A 1ANBA 2W6ID 1XXDA 1TA6A 1E34B 1OWKA 2A1DB 2G51A 1HFDA 1L4DA 3LGTA 3LC5A 1IQKA 1O3CA 3SHAH 1P8VC 1GMCF 4OS2A 1FY5A 1T4VH 2BXUH 1W3CA 2AEIH 1TGCA 2FP7B 2IPHA 2BVRH 2UWOA 2AMQA 2A45B 1GWAA 1LKAA 4ABIA 1N1LA 4AG2A 1TGTA 2VWOA 1VR1H 3FO8D 2H5CA 1UTMA 4MDSA 3T28A 1BDAA 1TE0A 1P03A 1WUNH 2DE8A 2HOBA 4DIHH 5HXFA 1C1TA 1WQVH 3RDZA 1MZAA 1XUFA 1CGJE 5EJZA 1DXPA 1N6XA 2IPQX 2PLXA 1C4U2 1GBHA 2VIVA 3ZVCA 2C8XB 1SKYE 4NIYA 1HAXB 1XUJA 3NUMA 5C5OA 1SHHB 1ZSLA 1GI0A 1LHGH 2PR3A 2V7QD 1DPOA 2Z94A 2ZZUH 5DP4A 3MH6A 1GCTB 5C94A 1NZQH 1KTTB 1HAVA 2R3UA 5GCHG 3CS7A 1FY8E 1DUAA 1JMOH 2YOLA 2VVVA 3KEEA 2O8UA 5EJ1A 5DP3A 1TALA 2VNTA 2PV9B 3M3TA 1UTLM 1GG6B 1P09A 3A86A 2XBYA 1BTZA 2KCOA 1HJAC 4YT6H 1ZHRA 4I33A 3U28C 2STAE 4XD7D 2YNAA 3GDVA 3P8FA 5L2ZH 4MQAA 3RMLH 1EAXA 1O3PB 2CF9H 2VIOA 5DK1A 3N99A 4JZ1A 1HPGA 2TGPZ 2SGQE 1TNGA 1Y3VA 4B2CA 1SLXB 3M7UA 5A8ZA 3BF6H 1C4Y2 2W6JD 4YM9A 3SZEA 3S7HB 3NWUA 4YTAA 4F48B 1TA2A 2QY0B 1RD3B 3RXRA 5SGAE 1ZGIA 2OBQA 3EAJA 4CBNA 2IJD1 3A89A 2P95A 1BHXF 1QRWA 4FUBA 1C1WH 1F0UA 4HI3A 3RXOA 3MH4A 4FUHA 2ZI2H 2Q6GA 2JJ1D 4H6SB 4AORA 2ZFPH 4SGBE 4Y71A 2ZU4A 2J5UA 3PMJA 4JYUH 1T4UH 2AS9A 1UTQA 3RXCA 1D3DB 2P94A 3L33A 1C1MA 3MO9A 3RXBA 1QIXB 3GY8A 2A4RA 3DT0H 4ZUHA 5DGJA 2XYAA 4CRFA 3ATKA 1TMUH 1HAZB 1NBME 4RKOB 1YPMH 1RTKA 2BY9X 1O3BA 1GCTC 1CT4E 2BB4A 2FOGA 1QNJA 1W0KD 3OTPA 2YMSC 3RXMA 1S6LA 3ATIA 4TWYA 3O8CA 2OLGA 3OFND 2ZPRA 3E3TA 2TPIZ 2VINA 2V6NA 2J34A 3SU1A 1A3BH 1FY1A 2VIQA 2F9VA 1NRRH 4R0IA 1SOTA 3MH5A 4Q7ZA 3M3SA 1BZXE 1CHOF 1P2OA 2C8YB 3UOUA 2FYRA 4IC6A 3GDSA 2CXVA 3QGNB 3UB0A 5HGGA 3LPRA 1J14A 1O5EH 3GCTF 2J97A 1HGTH 2Y80A 5C20A 1O2LA 1SGIB 4JZIA 2BDYA 2ZP0H 1TOCB 2V3MA 1RS0A 1CA0B 3HKIB 2FMJA 1EXFA 1FUJA 1QBOA 4FU9A 4INKA 3ZZ5A 1C1UH 2AFQB 3KQDA 2FTLE 3PWBA 1UVOA 3LC3A 3GY5A 3RM0H 4F55A 2P3FH 3K65B 3VXEH 1L2EA 1IQEA 2ZFFH 1L1GA 2FLRH 1Y5BT 1BMLA 2DE9A 2LPRA 1BTPA 4AZ2B 1SFQB 1K9OE 3MOCA 5DP9A 1AGJA 3RXKA 3N7EA 7KMEH 4RT0A 4ABAA 1H8ED 4NA8A 3RXAA 4XSKU 3SU3A 1FQ3A 1BOQA 1RTLA 3T27A 2AGIX 3C1KA 3TK6A 1Y3WA 1MU6B 2M5TA 1Q3XA 2WYGA 2XC0A 2AIPA 2KZ4A 1RIWC 1TIOA 4AYVB 3MFJA 2Z9KA 1D3PB 2R3YA 1BUIA 1NRNH 1J16A 1GVKB 1GJDB 5GJ4B 3N7OA 1QL7A 5EQQA 1O5GH 1A5IA 2QF0A 2KCAA 2ODQA 5F6MA 5EU8A 1K1NA 4DG4A 2PKSC 1O2QA 1JRTA 2C8ZB 6ESTA 1BRBE 2R2WU 3UIRA 4RI0A 1ABJH 3U8OH 4DGJA 3LIWA 1FZZA 1C5XB 1NRQH 4HZHA 2ZHFH 4K69A 4XBDA 5GPIB 1T8NA 2A4GA 3VXFH 4BXWA 2Z3EA 1LDTT 3RXFA 3UWJH 4D8NA 1BTYA 4PROA 3RXHA 1TAWA 1HAVB 1P9UA 3QZRA 3AK5A 1NPMA 2ZTXA 5A0CA 1OWEA 1HAIH 1WAYB 4X2XA 3UAIC 4P00A 3FOAA 1K1LA 3KQBA 4AB8A 1V2MT 1IQJA 5E0HA 3SJOA 3ATWA 3ESTA 1O2KA 4ZKNU 1TNKA 1AE8H 1AKSB 1HDTH 2J2UA 5BRRE 3TGKE 4JZFH 2ZPSA 5GIBA 1FIZA 2QGRA 3S69A 1INCA 1CBWB 4H6TA 2Q1JA 3PWCA 3SU6A 2BDAA 1UVUH 5GXPA 2GCTB 5A0AE 1ZGVA 2FO9A 5C5NA 5HIYA 2HGTH 1DFPA 3PV2A 3NKKA 1EZUC 1QJ7B 3B9FH 2G55A 4OGYA 3ELAH 1O3EA 4CRBA 1NRPH 2FOMB 1SGNE 1SOZA 2GGVB 4WMEA 2BX3A 2HNTF 1VGCC 2JDID 1UK2A 4KTCA 1OYQA 1FPHH 1XVMA 3GOVB 3SOSA 4CRGA 2GZ7A 5C3NA 3Q77A 1NROH 1H9LB 4GCHG 1O3HA 2C90B 2YMSB 3UQVA 2BY5X 2ALPA 4OS5A 4Y11E 2OQ5A 3VB3A 4GVUA 3ZVFA 2BLVA 3BEFB 1S6FA 2ODPA 2UUJB 1W0ZU 2ZF0H 1GI1A 1UK4A 3GY6A 3E8LA 5K7RA 1A0HB 1S83A 2KCYA 9LPRA 2R2MB 3BTEE 2FLBH 2OCVB 3KYGA 1DS2E 4X1PU 2BVSH 3CNRA 1X7AC 1SC8U 3PLBA 1ANCA 3MNBA 8KME2 1OP8A 2JH6D 2AMPA 2VGCB 1CT0E 1DSUA 1NU9A 2BX4A 4XE4A 2JJ2D 4B71A 1BCUH 4IC5A 2H5DA 5A0BA 2ZWLH 3OE7D 1NU7B 3BSQA 2ZHWH 4X8UH 2ANYA 1GHVH 3QK1A 4ZMAH 4ABBA 4Q7XA 3SU4A 4AFSA 2PHBA 4BNRA 1HNEE 4DW2U 2PUQH 4XFQA 5DJ7A 2FM2A 2F9BH 1O2GH 4FUIA 1V2UT 1IHTH 1DE7H 1KTSB 4ZHMU 3SGQE 2ZKSA 4WY3A 1HJ8A 4MPUA 3PV4A 3ZZ4A 3BTKE 2GZ9A 3ZZ6A 1SI5H 4MNYA 2RFKC 2QV1A 4NWLA 5CHAB 1BRCE 1UMAH 1O34A 3BTQE 1SGPE 1HJAB 1O3NA 4WH8A 2TIOA 4B6FA 5E8EH 4K2YA 1NY22 2TGAA 1EX3A 2GT7A 3P6ZB 4FUJA 1W2KH 2FEQH 1BTHH 2AIQA 3V0XA 5F8TA 1NN6A 5C17A 3ZZAA 4J1YA 2D2DA 1W11U 4J2YB 2KAIA 3FKSD 3A7YA 1LTOA 1E79D 2GV7A 1DWBH 1ZHPA 3BTGE 4LXBH 5A2MH 1V2RT 1GI2A 3M35A 3E1XB 2IN2A 5JBBS 3T62A 3UFAA 1KXFA 1GDNA 1JXPA 5DN6D 3AAVA 3FAOA 1SGFA 1AWHB 3KN2A 4NSYA 3SI4H 3FP6E 4F49A 1BBRE 1F0RA 2GCHG 4NFFA 2ZGXH 3F68H 3KF2A 3TH3H 4NA9H 1QTFA 2WYJA 4IN2A 1LVYA 3A7VA 4D7FA 3SQEE 4A1TA 2GKVE 4ISHH 3UUZA 1K1MA 1SHYA 1P02A 3IWMA 3VPKA 2ZU3A 4BXSA 8GCHF 4IMZA 2PSXA 1O32A 2ZHEH 3LGVA 5FX5A 3S7KB 1PPEE 2V35A 5C1UA 1TRNA 2NWNA 1WTHD 1GPZA 1H1BA 2Z3CA 3E16B 4LZ4B 1FIWA 1IHSH 1Y8TA 3S9CA 4DCDA 4K1TA 1ETTH 2RCEA 4Q4LA 4Y0ZE 2EQNA 1GBKA 3GY2A 2XOKD 3DSGA 1MAYA 1ZPCA 2GCHF 4MNXA 1TGSZ 4Y0YE 1TOMH 1UVPA 4FVBA 1TMBH 5DP5A 4WXIA 1DXWA 4K60A 1VCWA 1GJ6A 2A2XH 1QGFA 3GY7A 1MKXH 2F83A 3SN8A 1TLDA 5CDFE 1GBMA 1KDQA 1AE5A 3E0PB 2FS9A 1DITH 1ETRH 1SBWA 1GL1A 4FU7A 4FUCA 1TPSA 3SGBE 1TX7A 2Z6BD 2ZNKH 4JMYA 3TITA 3RU4T 1SL3A 3U1JB 1TMTH 3NK8A 1AWFH 3SNAA 1O33A 1C4V2 1ARBA 1O5DH 3RXVA 2ZGJA 3BTHE 1GBEA 1TYNA 4Q63A 3T26A 3RU4E 3SNCA 1BBRH 1ELVA 3LDXH 3TNSA 1MTNC 4WVPE 5EG4A 3F1SB 4AGKA 1GL0E 1SMFE 2ZCHP 4HG6A 1CGIE 2VVCA 2AMDA 2V0BA 1DICA 4DURA 1MCTA 1GI8B 1VITH 3RXTA 2KCPA 1EQ9A 3FP8E 1WDIA 2W3KA 1ELFA 2FYQA 3SJ9A 4YLQH 3DSPA 2G5VA 1QL9A 4JYVH 2JETB 1KY9A 2SGPE 1PPGE 1C5RA 2QXHA 4NIXA 1EZXC 2W5EA 4B6EA 1FONA 1ELAA 3ODDA 1A5GH 3P8GA 4X6MA 3PLKA 1JRSA 1O3MA 2H9EH 1DLKB 4Z1MD 2HALA 2ZDVH 3BIVH 4D7GA 1CT2E 1P57B 1OS8A 1L1NA 5A8XA 2ZCLP 3GS9A 2VWNA 3FN8A 1GBIA 2NU1E 1SQOA 1MCVA 1GHYH 1DLEA 1P3CA 3FFGA 4AX9H 1C9TA 3GISB 2VGCC 2J9NA 1EAUA 1F5LA 2F3CE 3UTUH 1TGBA 1E36B 2EC9H 2W3IA 2GTBA 3MU0A 2HLCA 1C5LH 3U98H 3ZVDA 5FCRA 2ZPQA 3SU5A 1LO6A 1C2DA 5JB8S 2Y5HA 4DT4A 3KL6A 1C2EA 4FXGH 3K2UA 2JH5D 2VWMA 1EP6A 1ZTKA 4AGJA 2FIRH 1HUTH 6CHAB 1GGDC 5F8XA 4E7NA 4B73A 4HFPB 1TNLA 1FJSA 1A61H 2V3OH 1GJBB 1YM0A 3VB7A 4NSVA 3F2GA 2ULLA 1ZJKA 4XOJA 1O2XA 1XVOA 3TGJE 1C5WB 5BPEA 1TBQH 1CO7E 1BITA 3SBKA 5JDUB 3NZIA 2P16A 3SZNA 1C2IA 4GAWA 1FN8A 1S0RA 1P10A 1A1RA 1ZHMA 3L6PA 3ZV8A 5HYOA 1JWTA 2FOAA 1QZ8A 3RU4D 2QF5A 4YESB 1SGEE 5J4QA 4THNH 4KELA 4ABEA 1O2ZA 4Z0KA 3WWFA 3PLPA 4M9FA 1VJ9U 3U69H 1QR3E 5E0GA 1ELEE 1MAXA 1SGYE 1ORFA 1BJUA 1YPLH 4NZQA 4TY6A 1O2VA 2PSYA 1W0YH 5JBAS 1AFQC 1GHAF 1O5FH 2XCFA 3HATH 3RXJA 1C1PA 3KIDU 2OC7A 3NCLA 5EXLA 1N8OC 4I8LA 4GHQA 1A5HA 1Z8RA 2P8OB 1PPHE 1FN6A 4Y79A 3C27B 2AERH 3FVFB 1LHFH 1ZOMA 2CHAC 4R8TB 2XCNA 1FV9A 4P02A 2WV9A 1QA7A 2QXGA 4OM9A 3SNBA 2QCYA 1P0SH 2ASUB 1G3CA 2BY7X 1JBUH 1FMGA 1E1QD 1BBRK 2C4FH 2PUXB 2LNCA 4AG1A 1YPKH 1MKWK 2ZU5A 1OSSA 2BXTH 3LJOA 1GDQA 2K0QA 1QBNA 2VJ1A 2O8WA 3MU1A 3F9GA 1P2IA 1UW7A 2NU3E 2F4LA 4U2WA 1HCGA 3SJKA 1THRH 4DIIH 4M7GA 3RUOA 4X8SH 1GHAG 2ZECA 2IOTA 3P92A 1O5AB 4K1EA 3EA7A 2WPLS 3PMBB 4BTTB 7GCHG
chains in the Genus database with same CATH topology
1SGCA 2GD4B 2XBWA 1B0FA 3SV9A 3BTWE 4NFEA 1KXDA 4B76A 1UHBB 2A5AA 3ODFA 4CRDA 3RXSA 1G2MA 3MI4A 2R9PA 4X2WA 1CE5A 1HAOH 1TQ7B 4CH2B 4Q2KA 2XWAA 3BTDE 2A5IA 5EW1H 1V2NT 3ZVBA 1GBBA 2QF3A 3HKJB 4X6OA 3T29A 1QQUA 1NS3A 2BD7A 5DPAA 2OC1A 1MQ6A 3A8CA 1SPJA 1Y3UA 1GMCG 1EZQA 3UPEA 5A8YA 2C3SA 1TABE 5LH8A 4MTBA 3OY5U 3ZYEA 3M5LA 1OP2A 2F9NA 2B0FA 1AFQB 2SGEE 4K8YA 3V7TA 3SQHE 5L6NH 3ZZ8A 4Q7YA 1AHTH 4IN1A 1LQDB 2XRCA 3A81A 1A7SA 2G4TA 1O2NA 1W7GH 2A7CA 4X1RU 3LJJA 1KIGH 2QAAA 6GCHF 1O3LA 1ELTA 1AVXA 1D6RA 3D23A 2A5KA 1GBJA 2ZIQH 2YNBA 4INLA 2OUAA 1OWDA 3Q3YA 1NC6A 3GYMA 3RXPA 3M5MA 2FTMA 2ZCKP 1J17T 2K1QA 4MNVA 2WPIS 1O3IA 4ZXYH 2WINI 4Y8XA 5FXLA 3CS0A 1HAPH 1VZQH 4B2AA 2W7SA 7LPRA 3HGNA 1C9PA 1HXEH 1C1OA 3M61U 4MPXA 3EGKH 4Y7BA 1H8IH 1L0ZA 3AW0A 2H9HA 1DVAH 5FPTA 2FPZA 2BVXH 3GDUA 1K1JA 1O37A 1OX1A 1ARCA 1YYY1 2JH0D 3O8RA 1EJAA 4YOJA 4ASHA 1KSNA 2P59A 2SFAA 1S84A 4WH6A 4ISIH 5LPFA 2C93B 3IG6B 3M5OA 1HB0B 2BMGB 1VCQA 1YP9A 5IDKA 1KXCA 4Z6AH 2G4UA 4MPVA 1V2KT 1VJAU 1AVGH 1MQ5A 2P8OC 1C5PA 3SV6A 3PO1C 4CR9A 2F9UA 5T3HA 1DDJA 1LPKB 1YCPM 1EKBB 1OYTH 2PTNA 4ZAEA 1TRMA 3E90B 2G81E 2ZG0H 3U8TH 3OY6U 1DM4B 4F4OC 1SLVB 4GHTA 1OWHA 3M37A 4TPIZ 2TGTA 3RXUA 2OQUA 4QT8C 5EPNA 1C5YB 1W7XH 2HPQH 2D1JA 3KGPA 4YOGA 3E0NB 1ELGA 3A87A 3SNEA 4ESTE 1XUGA 5LPEA 3PMAB 6LPRA 3A8BA 1GG6C 1P2MA 1NT1A 1MKWH 4ISOA 3M36A 2ZQ1A 1CVWH 1CHOG 2H6MA 2BLOA 3VEQB 4GLYA 3RC4A 3GCOA 3UR9A 3MU5A 4O03A 5JB9S 2UUKB 5ETXA 5LGOA 1HLTH 2PFEA 4RN6A 1ELCA 1O2WA 1IQIA 5EXMA 1O3FA 2H9TH 1N8OB 3TGIE 2Z3DA 1GJCB 1ZR0A 1SQTA 2EA3A 4IBLH 3RXQA 2RA3A 2A32A 2Y81A 4NCYA 3A7ZA 3T5FH 1BTWA 1THPB 1V3XA 1C5TA 1QURH 3UREA 2ZC9H 3SUDA 1T8MA 2BQ6B 5A09A 1MH0A 1T7CA 1G36A 1TFXA 2KAIB 5FPYA 1ZRKA 4ISNA 3ZZ3A 3O8DA 1EATA 2BQWB 2J38A 1DT2A 1SLWB 1P01A 4LK4A 3PTNA 4ABHA 1VITF 1GMDF 3SI3H 3SUGA 5K0HA 1ESBA 4MNWA 3H7TA 2AYWA 1K1PA 3PM3A 2ZTZA 1NFXA 1MD8A 2P3TB 1V2WT 3F9HA 2QXJA 2ZFTA 5L30H 2ANMH 1SGTA 1NTPA 1YC0A 2Q6DA 1HJ9A 1YPGH 2PWXA 4MLFB 3P8NA 4U01A 1HAGE 1V2QT 1DWCH 2ZU1A 2VVUA 2GDEH 3V3MA 4YT7H 1D6WA 1GMDG 3ZVGA 3MH7A 5HMAA 3SJIA 4AFQA 1NO9H 2O8LA 1NRSH 2ZDAH 1O2MA 2ZU2A 1DX5M 3BTTE 3ZVEA 2ZTYA 3O8BA 1ACBE 1BQYA 1C5ZB 3D49H 4RKJB 2OXSA 1GVLA 1OWJA 1Y5AT 3A8AA 3EQ0H 1V2ST 4U32A 4I7YH 4UFDH 1CA0C 1YF4A 5DKMA 1P3EA 2VWLA 5ESTE 3OX7U 3RLYH 4I8JA 1G30B 1AB9C 2BLWA 4KP0A 3QGJA 3SO3A 3GCHC 4YLUA 1EJNA 1WBGB 4FU8A 1EAWA 4AFUA 1PQ7A 2BZ6H 5EW2H 4I32A 4BAKB 3MHWU 1GMHG 4CREA 4OS6A 4UDWH 1DWDH 4O9VA 4A1VA 4CHAC 1W13U 2B7DH 1UK3A 4UD9H 1P2JA 2FESH 1SQAA 1ZJDA 4TWWA 1ZRBA 2WUBA 4BAOB 2TGDA 3K6ZA 3I29A 3MWIU 2J95A 3UNSA 2UWLA 3GCNA 1FAXA 2O9QA 2RA0A 3LOXA 1K22H 3I77A 2ZA5A 3L3TA 1ELDE 3QLPH 3SUFA 4KKDA 4ZKOU 2THFB 5E2PA 4FUDA 5AF9H 5F8ZA 1OP0A 3B23B 3KQEA 8ESTE 1C2JA 1LVMA 1THSH 4Y6DA 3SHCH 4FUGA 2WPMS 2QXIA 3PTBA 5JYIA 2G5NA 5EQRA 3FANA 4UEHH 4HGCA 3PYHA 2V3HH 1E38B 4HTCH 1ZMNA 2O8TA 2AGEX 1SR5C 4NIVA 1AUJA 1QHRB 3GCHB 2XBXA 1HIAB 1MBQA 1O0DH 4TY7A 2QA9E 1EOJA 3ZV9A 3R0FA 2A7HA 2B8OH 4X1SU 1HXFH 1AZ8A 1W14U 4ISLA 3LGIA 1KLJH 1BT7A 1U6QA 3UOPA 1RFNA 1PQ5A 1TNIA 5AFZH 3TJNA 2WV5A 4AB9A 1F5KU 3MYWA 1DY9A 3UNQA 5JBCS 3D62A 8LPRA 1LPZB 3MO3A 3KNXA 3BG4C 1RIWB 5FCKA 1KDQB 1Y59T 2GX4A 1V2PT 4ZHAA 4E06H 1BMMH 1P04A 1TRYA 3LT3A 4X2VA 1DY8A 2W26A 4XDEA 1G3BA 2ZFSA 3M3VA 1RRKA 4AYYB 3LONA 5EODA 1UTOA 1C2FA 3U1IB 1C2KA 1O2SA 4OS4A 5PTPA 1MUEB 4DVAU 5FBIA 1AKSA 3Q3XA 2ALVA 3ITIA 1YPJH 3BG4B 1TPAE 3CENA 3QZQA 2FXRA 5TCAA 1BMAA 1TGNA 2WPKS 3SU2A 3LU9B 1K2I1 4O3UA 5AFYH 3BEUA 2G00A 1O2HA 4DY7B 1K28D 4D9RA 1YBWA 2ZDLA 3VGCC 1C2GA 1ZLRA 1HAHH 1IQHA 1GBLA 1C5MD 1YCPK 1B0EA 2BLQA 1IAUA 2SNVA 1EPTA 1M9UA 4H42U 2VB0A 1DSTA 5EOKA 3AW1A 1MTSA 1UHBA 1TB6H 3P95A 5TCCA 2GCTC 2BDGA 1LKBA 4I8HA 1PQ8A 1GBFA 2FS8A 4X2YA 2UUYA 4GUXA 2ZEBA 1CQQA 3U9AH 1O2TA 1O3OA 5FPSA 3TH2H 2A31A 4H4FA 1HYLA 3OSYA 3KCGH 1MTVA 2G8TA 3ZYDA 2O8MA 3MNCA 2BOHB 4X1QU 1F5RA 3S0NA 1C5OH 4IMQA 2H1UA 2R0KA 3T2NA 2EEKA 3TJOA 1TBRH 4UFGH 3A7WA 3PROA 1Z8GA 1WOFA 4X6NA 3M7TA 1QCPA 2FOFA 4NGAH 1C1SA 1YLCA 3GICB 1EOLA 4CBOA 4ABDA 5AHGH 4GSOA 4X6PA 1PPZA 3W95A 2RDLA 1O2OA 1AB9B 1WU1A 1QQ4A 5EGMA 4FUEA 3F9EA 1H8DH 4Q80A 1KLTA 3LGYA 2ILNA 1QBVH 5IYTA 1GJ9B 1ZSJA 5T6GA 4LZ1H 1BHXB 2GMTB 2OC8A 3A80A 1UTPA 3NXPA 1ELBA 1O36A 3DFLA 2G52A 1ZSKA 3RXLA 2FOBA 1QJ1B 1OXGA 1TNJA 1WCZA 2ZGBH 3P8OA 1P2QA 1Z8JB 2ZHQH 2ZQ2A 1WYKA 1IQFA 4X0WU 1J15A 3S9AA 1RXPA 5C67A 1C2LA 3H5CB 2BD2A 4U30A 5HM9A 1ESAA 1QJ6B 3U8RH 3FP7E 3F6UH 4B74A 1CBWC 1EAIA 2CN0H 1BTXA 3Q00A 1TBZH 2DUCA 2BD3A 1EB1H 1VITG 2CF8H 5ESBA 3ZZDA 2GDDA 1GHWH 1AVWA 3QN7A 1Y5UT 1SGFG 5T6DA 5DP7A 1O2JA 2AGGX 2J94A 1N6YA 2VH0A 4CH8B 2QN5T 5C1YA 8GCHG 1D4PB 1FPCH 3DUXH 3RC5A 1VGCB 3RMMH 1GJ7B 1AY6H 1XM1A 2H2ZA 2NU4E 2WUCA 2XBVA 4CHAB 1NFUA 2GP9B 4NZLA 1ANEA 1F2SE 2Z9LA 4UFFH 1AU8A 1EPTC 2PKAA 1P12E 2ANWA 1GBAA 1TONA 5I25A 1G3DA 4MPWA 1AO5A 3SV8A 3GY3A 3DD2H 3FZZA 2A7JA 4Y10E 4KTUA 1EPTB 1CA8B 3BN9A 3MO6A 2PKSB 2PW8H 1A0JA 3TNTA 5JPMH 3RM2H 1S0QA 5JBTA 1ZMJA 4I8GA 1Z1IA 3WY8A 1RTFB 1GJAB 1EP5A 2NU0E 2J4IA 3OTJE 3MTYA 4LOYH 3EE0B 5GDSH 1O3KA 1LVBA 1DANH 4B75A 1JOUB 3LH1A 1A3EH 4CRCA 1G9IE 1GCDA 4IGDA 3M5NA 2BY6X 1UCYE 1YPHE 1D3TB 1PPFE 1Y3YA 2FI4E 1XUIA 1CHGA 1OKXA 1B5GH 2B5TB 7GCHF 4YOIA 4JK5A 1FAKH 1C5QA 1SGRE 1TX8A 2BZAA 1H9IE 2HNTC 4AOQA 1XMNB 3S9BA 2Q6FA 2GV6A 2XW9A 4OS7A 1O35A 4A5TS 1NM6A 1H9HE 4MG3A 4X8TH 2QIQA 4ZHLU 4NIWA 4K3JA 4Y8YA 1GDUA 1LHDH 1SB1H 4Y7AA 2GT8A 2VIDA 4UONA 4XBBA 1XX9A 3BIUH 3VFEA 1ANDA 1GHZA 2Z9JA 3CP7A 1TPPA 1TX6A 3W94A 1P2NA 3UY9A 1UTJA 2ZDKA 3Q3KA 1O3GA 1AMHA 2ZDMA 3ZZ7A 1ZPBA 1HAYB 1XKBC 4A6LA 1ID5H 2OP9A 3R3GB 3MMGA 3MU8A 2EI8A 4XBCA 1W8BH 4YO9A 2BDIA 2ESTE 3TJVA 2C8WB 3F9FA 1GGDB 2GVFA 1MZDA 5E0JA 3V13A 3JZ1B 1FI8A 1ZTJA 2UWPA 4E05H 2BY8X 1FLEE 1F7ZA 1TNHA 4BTUB 1TPOA 1G32B 3H7OA 1UO6A 1PFXC 2D8WA 1PJPA 1V2LT 3K9XB 4WF8A 2TRMA 1ABIH 2JKHA 3TK9A 1O2IA 3RP2A 4D9QA 5EPYA 3QWCH 2XC5A 2FOCA 1SLUB 2QC2A 1O3AA 3SJ8A 3V12A 3RMOH 1LQEA 4TPYA 1BMNH 2FZZA 1O39A 1BJVA 1DUEA 4WWYA 2VH6A 4MVNA 3LH3A 3Q76A 1KXBA 4AFZA 1G2LA 1UJ1A 3MNSA 5C2ZA 1A4WH 1WSSH 2BDHA 2UUFB 1KYNA 3VB4A 1GHBF 3AASA 2F91A 3QTVH 4YZUA 1DWEH 4FUFA 3SUEA 1JIRA 3QTOH 1UVSH 4JZDH 3ZZBA 3QUMP 2XWBI 2BHGA 1QRXA 2OTVA 1PPCE 4CR5A 3SV2H 1P2KA 1MU8B 4B2BA 1SGQE 3QX5H 3ATLA 1ZMLA 1KXAA 1LMWB 4BAQB 2Y5GA 4A1XA 1W12U 1F0SA 3SV7A 3EYDA 3E91A 1GBTA 1Z71A 4GPGA 2BTCE 1GHXH 3TIUA 4CRAA 4DOQA 3A88A 4K8BA 4K5ZA 1O2PA 1BRAA 1GVZA 2XNIA 4X1NU 1QFKH 1GI5A 4BTIB 1EB2A 3GYLB 2TBSA 4TYDA 3TPIZ 2PGBB 4BAHB 3SNDA 3STIA 3A83A 4ABGA 3VB6A 3RLWH 2GZ8A 2OINA 1MBMA 1AI8H 1O3DA 1Q31A 5FX6A 1FXYA 3A84A 3AAUA 1PPBH 1TWXB 3IITA 5T6FA 1HBTH 1T32A 5I46H 4ZROA 2ODYB 3BTFE 1S81A 3A7XA 5DP8A 3UWIA 2XXLA 5E2OA 2CGAA 1IQLA 1LPGB 1SGDE 3URCA 1QA0A 2EI6A 3SW2B 2BD9A 3I78A 4K1SA 2Y7ZA 2BOKA 1C2MA 1J8AA 4JK6A 1GI3A 1SFIA 2B9LA 2A4OA 1D3QB 1YLDA 5DG6A 3EDXB 2FI5E 2A0QB 1AUTC 1MTUA 2GMTC 1K1OA 1O2UA 4GCHF 1DOJA 5J4SA 1EUFA 2BDBA 1ESTA 1GI4A 3TK5A 3RXEA 2WPJS 1P06A 1IQNA 1QRZA 3K6YA 2FDAA 3JZ2B 2ZFRH 5L2YH 1S82A 1Z8IB 5EXNA 1BRUP 1GJ5H 2SNWA 1YPHC 1AN1E 2XC4A 3STJA 1GBCA 4VGCC 1LHCH 2FOHA 2FOEA 1L1JA 1ETSH 1ZZZA 3GY4A 3HPTB 1QB9A 3LKWA 4OS1A 2VIPA 1SG8B 1C1NA 1CSOE 2A2QH 1WV7H 1YCPH 5B6OA 1FY3A 1C1VH 4B1TA 4DT7B 3TJUA 1E35B 1KXEA 5F03A 1CGHA 3A7TA 2BM2A 4KGAA 1V2JT 2A4QA 2Z7FE 1S6HA 2CHAB 3GCTG 3G01A 5CHAC 1T31A 1C5UA 5ABWA 4AN7A 1HIAA 1D9IA 1EZSC 3EA9A 1W10U 2VU8E 2Y5FA 1WTGH 3AVZA 3QDZB 1XKAC 4BOHA 1C5NH 3B8JA 3ZZCA 5CE1A 1IQMA 1Q2WA 1ZPZA 4BANB 5FAHA 1S85A 1GI7B 1P05A 4DJZB 2ZHDA 1AZZA 3VB5A 1GI9B 4OGXA 2HPPH 1LHEH 1MKXK 4Y76A 5DO4H 1ZYOA 1XUHA 3EA8A 2IJOB 3RMNH 5GWZA 1QY6A 1V2TT 4IW4E 4ZXXH 1E0FD 3A8DA 1MD7A 3HGPA 1SVPA 5H4IB 3TU7H 1XXFA 3VGCB 1V6DA 1C5SA 3HK3B 1C1RA 2CJIA 4ZH8A 3ZVAA 1Y3XA 3ZZ9A 1O5CB 2BYAX 4D76A 1IOEA 4ZKSU 1F92A 5C1XA 1T8LA 4WMFA 4UE7H 3RC6A 4ABFA 1NFYA 4Y8ZA 1C5VA 2FWWA 2D26C 1B7XB 1K1IA 5HM2A 2BDCA 2BQ7B