1O3LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3lA02
1GBBA 1O2JA 1T7CA 4YLUA 2AMPA 1ZGVA 1G9IE 1CT4E 3VGCC 4AB9A 1AHTH 1KXAA 4XSKU 1A7SA 2B9LA 3E0NB 1RXPA 1YPMH 1KXBA 2XC5A 4IC5A 1CA0C 4JZ1A 1DT2A 3ZVGA 5A0BA 1GHVH 1GBJA 1O3PB 4DJZB 1UK4A 1ETSH 4CRAA 3C27B 4MPVA 1GMCF 1C5NH 1WOFA 1HAZB 1UTNA 3IG6B 1MH0A 3TNTA 2DE8A 4I8GA 1XVOA 3TITA 5A8ZA 3UUZA 1QIXB 2KAIA 3MNXA 5TCAA 3SU1A 1O3IA 1O3OA 3Q3XA 1O5BB 2ASUB 2W7SA 1K1MA 1F5KU 3U9AH 1DX5M 1P2IA 3U69H 1Z8JB 1G2LA 2P8OC 1F0UA 1LHFH 1N1LA 4OS1A 1SBWA 1RTFB 4Y11E 3T28A 1P02A 1ESBA 1NO9H 1TBZH 1P8VC 1L2EA 1W11U 2F9BH 1CT0E 3UQVA 2Y5HA 3BTTE 1GBKA 1SFQB 4X2XA 3P8GA 1QB1A 1O5GH 2SNVA 4F4OC 1JXPA 1FMGA 2GTBA 1A0JA 1XVMA 1V6DA 3F9HA 4MG3A 5ABWA 2GCTB 1JIMA 3ZZ9A 1MKXH 3RXRA 1MTSA 3SUFA 1O34A 1VCWA 2F83A 2VWNA 1ETRH 5LPRA 2V35A 2GP9B 3BTFE 4FUDA 2ZGHA 2BD3A 3A8AA 1W8BH 1K1LA 3LH3A 1Y5AT 1GBLA 3P8OA 3BF6H 1GI5A 4HGCA 5GPIB 3SORA 1WQVH 1DM4B 3SUGA 5C20A 1TNIA 4BNRA 1V2ST 3U1JB 3ZYDA 3TH4H 2CGAA 3ZVBA 2R9PA 1AY6H 1BTWA 1ZJDA 5EPNA 2ZHEH 3I77A 3UOPA 1LKBA 1O5DH 4CREA 3SNEA 1KY9A 4Y8XA 1WTHD 3NZIA 2FWWA 3TJUA 3SN8A 1F5RA 1O3AA 4UDWH 2BY8X 4NA9H 3F9EA 3PO1C 1F0RA 2SGPE 2OLGA 4K60A 1C2HA 1HAPH 2PKSB 1K9OE 5A8YA 2WPLS 4CR9A 1ZLRA 2VIOA 1WSSH 2XC0A 2ZHDA 2FESH 1P12E 3U8RH 3V3MA 1VGCC 4Q80A 4HI3A 4WXIA 2QAAA 4IBLH 1GBHA 2BXUH 4FU9A 5HM9A 3HGNA 1BTUA 1ZR0A 1KLIH 2Z9LA 3FFGA 1HJAB 1Y3XA 2STBE 4ASHA 4GAWA 1S84A 1ANCA 4WF8A 2FZZA 7KMEH 5FX6A 1HBTH 5FPYA 4B2CA 3E90B 3S7KB 1F2SE 3MH6A 1GHBF 4HTCH 1FXYA 2BQ7B 4WWYA 1TPOA 4YO9A 2BVRH 1QURH 4ZH8A 1GI3A 2CHAB 2JKHA 1O2PA 1TRNA 4X1SU 1S85A 1AUJA 3H7OA 1ZTKA 2F9PA 1AGJA 1KXFA 3SU3A 2Y80A 3F9GA 3MO9A 1MTVA 5I25A 4ABGA 2Y82A 2BLWA 5I46H 3ATKA 1W14U 2Z3DA 3FAOA 3TJOA 1SVPA 5EODA 3KN2A 3ZVCA 2J2UA 4I32A 2Y6TA 1BTYA 3SNCA 3EE0B 1W2KH 5C5OA 4VGCB 1MZAA 2VWLA 2D1JA 2XBXA 5GCHF 3MO3A 1GI2A 2FYQA 1PPGE 3A80A 1AFQC 1HXFH 4GVUA 5JBTA 3A7XA 4ABAA 2BDIA 3LKWA 2VIQA 2BZAA 2WPIS 1PPBH 1ZTLA 3KQEA 1GI0A 4NWLA 5AHGH 1QL9A 1MTNC 3M3VA 1O37A 3RXGA 5A2MH 1EZUC 1O30A 5EQSA 3RU4E 4B73A 1DY9A 1LKAA 1SB1H 4INHA 2VWOA 4AYVB 1S81A 1SGRE 3KGPA 1BRBE 3SI3H 2QXGA 1A3EH 4ZHMU 1SC8U 3BG8A 3K2UA 4BTTB 5C1XA 1TYNA 2Z3EA 1P10A 1F7ZA 4Z0KA 2TRMA 5LPEA 3RXVA 1P01A 1TPSA 4ZHLU 1IHSH 5GXPA 4AN7A 2LPRA 5EQQA 5GJ4B 3GY3A 1YM0A 3K6ZA 1O3CA 1SMFE 3SJIA 4CH2B 4Y8YA 3TK5A 4IW4E 4BAOB 1PYTC 3BTQE 3RMLH 5F8ZA 1CGJE 3TGIE 1DSTA 2NU1E 1W3CA 1GPZA 1JIRA 3KQDA 1TOMH 3QUMP 2PWXA 1GCTB 1SI5H 1AKSB 2FI3E 1OWDA 1GBAA 3ATLA 2ZFRH 4X0WU 1DFPA 4KKDA 1LVMA 4LXBH 4YOIA 1DLEA 2ANYA 1NFWA 1FDPA 4Z6AH 2PKAB 5FBEA 4FXGH 4NZQA 1ZPCA 2XYAA 1TA6A 4U2WA 4ABBA 8GCHG 2SGFE 1OWIA 2C8WB 4ISLA 3RLWH 3SU4A 1D6WA 1SOZA 1GL0E 3GISB 4JZEH 1GBCA 4AORA 3ITIA 3UNRA 3O8RA 1IQLA 3GOVB 3ZZDA 1SLXB 4X2YA 5T6DA 1N8OC 4D7GA 1AVWA 1BTXA 3EQ0H 4Y71A 4NWKA 4X2WA 3KQCA 1GI7B 2QF3A 1QJ7B 1MBQA 1PQ5A 3M5LA 1AI8H 4ZUHA 2C8XB 1GDNA 4D7FA 7GCHF 1MKWH 1GJ4H 3QZQA 2GZ7A 1AE5A 9LPRA 2ZDNA 3A8DA 4MNWA 3RXFA 3U8OH 2ZCKP 1KXCA 3D65E 4I8LA 3SU2A 2ZO3H 1MD7A 4A7IB 3AAUA 2FI4E 3RXHA 4E06H 4ISOA 1UVOA 3DFJA 1GGDB 3SV6A 1LHGH 4YM9A 1Y5BT 1BJUA 4LZ1H 3MTYA 1P05A 2Z3CA 2QA9E 5G4BA 1MTUA 3FP6E 1AZ8A 2C3SA 2FO9A 3SQEE 2BZ6H 1PJPA 3BEUA 2OQ5A 2WYGA 1RIWB 1WAYB 2WPKS 1H9IE 1LMWB 2HLCA 8KME2 4IMQA 1T4VH 2O8UA 3SW2B 3TK6A 4FVBA 4Y76A 5EQRA 5ESBA 4ZKNU 2W5EA 1AE8H 2BX4A 1NRSH 4GCHF 3RU4T 3UWIA 2F9NA 1SGFA 3HGPA 3KHVA 1QNJA 3SOSA 3E8LA 3GCOA 1EATA 1H8DH 3R0FA 1F0TA 4CH8B 2FOHA 2FDAA 1NZQH 4O97A 1YBWA 1LO6A 2ILNA 1LHEH 1DUAA 3SU6A 4MDSA 3VB5A 7GCHG 1T8OA 1EJNA 1QBNA 1SHHB 3MWIU 1YPGH 1TQ0B 2BD9A 1UTMA 1EASA 3SJ8A 1O3KA 1MQ6A 1V2LT 5C1UA 3A8BA 3STJA 1KYNA 2JH6D 1PPZA 3I78A 1C1QA 1UVTH 1AKSA 3VB6A 2BY6X 3SHAH 3MU8A 1L1JA 2B0FA 2ZG0H 4GLYA 1UVUH 2OUAA 3UOUA 1QJ6B 2GV7A 5L2ZH 1G30B 3N7OA 1QL7A 1A2CH 4XBBA 1OYTH 3PLPA 3M7QA 3V13A 1TX7A 2OINA 2PKAA 4INLA 1GG6C 3VB3A 2VVCA 4GCHG 2HGTH 2OC8A 1TGNA 2A4RA 8LPRA 3LC3A 2AERH 4FUEA 2Z9IA 1LCYA 1SGPE 1TGSZ 2HRVA 3IWMA 3SGQE 1BQYA 4A5TS 2NWNA 1TNLA 1S5SA 4TPIZ 1TPPA 3PLBA 3OSYA 2BDBA 3ELAH 1P2KA 2ZQ1A 4A1TA 5HXFA 4ISNA 4AG1A 3T2NA 2GCHF 5EOKA 1O2RA 2AGIX 3BTME 1YYY1 4YESB 2XBWA 3RMOH 3SZNA 3VXFH 4D9QA 1NRPH 3T5FH 2G81E 3P17H 2OP9A 3URCA 5FPTA 1N6YA 3JZ2B 1QB9A 1TLDA 5DP4A 3A84A 3KEEA 1C5RA 4FUIA 4H6SB 2DUCA 4WMFA 5DP8A 2Q1JA 2Q6FA 3A7YA 2AS9A 2ZFSA 3RC4A 1SGQE 1BCUH 2R0KA 2SGEE 3ZV9A 5E8EH 1FAKH 5C5NA 2PTNA 1C2GA 3RXDA 3GY5A 1UO6A 2F3CE 1MMJN 3D62A 2ULLA 1L0ZA 4SGBE 2C90B 1SLWB 2J92A 1BMNH 1E36B 1C1WH 3BTKE 3EA8A 2PTCE 3MYWA 4H42U 4J1YA 4BTUB 1QBVH 1LTOA 1QTFA 3BSQA 1UTJA 3SO3A 4MTBA 3E6PH 2RA0A 1C5MD 1O2ZA 4NFFA 4B1TA 1AQ7A 1AVXA 4OS2A 4ABIA 1YKTA 3P95A 1C2DA 1P2MA 1LVBA 1O2LA 3VPKA 2GKVE 1Z6EA 2FLBH 2AEIH 3M3TA 3SGAE 5CMXH 1FY3A 1OP0A 3RXQA 1OXGA 1CBWC 4IN2A 1K22H 1C1TA 3HK3B 4X6PA 4K8YA 3EGKH 3UNSA 2BM2A 2GMTC 4DG4A 3PROA 1Y3YA 3A82A 1UCYK 2PSXA 2XXLA 1YCPM 2Z6BD 4FU8A 2GZ8A 2Z9GA 4CHAB 5B6OA 1RTKA 3A83A 1YGCH 2XRCA 1TMUH 4ABJA 4HFPB 3PTNA 1TONA 3RDZA 3SV7A 5HMAA 4ZXYH 3M7UA 2ANWA 1EOJA 1A5IA 3BTDE 1EPTB 1CVWH 1ELTA 5L2YH 2H1UA 2BDCA 1CO7E 1ZSKA 2BDAA 5PTPA 2A45B 2G51A 5DP9A 1P3EA 1T8MA 1CGHA 1DPOA 2WPHS 3BEFB 4IN1A 1G3DA 2YNAA 1BOQA 2ZHWH 1HAYB 3RXJA 1MTWA 1QR3E 2AFQB 5K0HA 5JDUB 3HPTB 3MOCA 3PMBB 4UEHH 3SNAA 4AFZA 2WPJS 1UHBB 1EB2A 2SGQE 2WINI 5J4QA 2O8WA 1C1VH 1EAWA 1NN6A 3SHCH 3ZVDA 4SGAE 4CBOA 1UTLM 2OQUA 2VGCC 2H9HA 4CBNA 3UQOA 1TALA 3FZDA 3Q00A 3SGBE 1BMAA 2BD7A 3S0NA 1FPCH 2O8LA 3CP7A 4ZKSU 4OS7A 1RFNA 2ZU4A 2ZKSA 2QC2A 2A7JA 4OS5A 1O3NA 3QX5H 1BUIA 3A88A 1YP9A 4I8JA 2EC9H 2ODQA 3PMJA 4U30A 4WY3A 3ZZBA 2R2MB 1YPEH 1DWDH 1F5LA 5IDKA 1NRNH 4AGJA 2D26C 1SGTA 1C1NA 2PHBA 1AIXH 1GJDB 2BVSH 4YZUA 3ZVFA 1QRZA 2Z7FE 2BX3A 2FPZA 1HJ8A 4R0IA 1L1NA 1O38A 5TCCA 2OC7A 2SGAA 5C1YA 1ANDA 1P3CA 1HJ9A 4PROA 1N6XA 4FU7A 2BD8A 4DVAU 2ZZUH 2Y5GA 4DT7B 1MCVA 1NC6A 2GZ9A 2GX4A 1B5GH 3TJNA 3L33A 2C8YB 3C1KA 1YPJH 1OWJA 1JMOH 3I29A 2XCNA 3PLKA 1DWCH 4OGYA 2Q6GA 2FM2A 2QF0A 1PPHE 3FZZA 1HCGA 1OWHA 1KTSB 3HK6B 5AFZH 1G3BA 3RXSA 4X8TH 3T26A 4CR5A 4O03A 3ZZCA 1D4PB 3E1XB 1S0QA 1WQSA 3BIVH 1XM1A 1WBGB 4U32A 3K6YA 6CHAB 3UR9A 2WV5A 4K8BA 4B76A 1ELCA 3LGTA 1EJAA 5F6MA 5JBAS 1FZZA 2FS9A 3W95A 2A5KA 4WXVA 1S6FA 4BAHB 3TGKE 3SJ9A 3LU9B 2GDEH 1HV7A 1NS3A 1ZMLA 2ZQ2A 3TPIZ 2GT8A 1RS0A 1EQ9A 1AB9C 2A2QH 3M5NA 5GIBA 3UPEA 1C5YB 1A46H 4NSYA 1SGYE 1G37A 3NXPA 3TJVA 2XC4A 2WPMS 2AIPA 3F9FA 4DY7B 2BDGA 1IHTH 2JETC 2ZPSA 5FBIA 2VB0A 2CXVA 1EZQA 2AH4X 2BXTH 1EPTA 1O31A 2DE9A 3VXEH 5J4SA 1E0FD 1QRWA 2UUKB 3A85A 5BRRE 1D3TB 1FY8E 1S0RA 1YPLH 5LPFA 1P11E 1SLVB 1WCZA 4WH6A 2V3OH 4TYDA 8ESTE 3S9BA 2A4OA 4YOGA 1TPAE 1VITF 3MO6A 4K1SA 2A7HA 4AB8A 4D9RA 1BHXF 1QQ4A 4X6NA 1VITH 2IOTA 1TX8A 1ELFA 3M61U 1O2NA 2CJIA 1M9UA 1YC0A 4BANB 1FPHH 1UHBA 3BG4B 1O32A 4HZHA 1QA0A 1BITA 3LGVA 5CHAB 1OOKB 3GDSA 1Z8RA 3FANA 1G3EA 4YT7H 5JPMH 2XWAA 2OBQA 4IS5A 3GCHB 1QCPA 3T27A 6GCHG 1E35B 1ZOMA 2A7CA 4A6LA 5C67A 3ODFA 1ZHRA 1QBOA 2BMGB 1IQGA 3RM2H 1FIZA 1C2FA 1FQ3A 3AASA 5FX5A 1U6QA 3BTGE 5A0AE 2UUFB 1TAWA 3AW0A 5LH8A 3F68H 2ZCLP 3SNDA 5EU8A 1TNKA 2HPPH 5DK1A 3URDA 1OP2A 1TNGA 2B5TB 2V3HH 4B2BA 5C2ZA 4E7RG 2FODA 4X2VA 3LGUA 4ESTE 1DXPA 4IC6A 1XUFA 1GJCB 1XMNB 3DUXH 5F8TA 8GCHF 1VITG 1NT1A 4MNXA 2ODYB 1NRQH 1QA7A 2PGBB 2V6NA 4Y7BA 1BBRK 3MNSA 2A32A 1O5FH 5A09A 3Q3YA 1HAVB 1ZJKA 1NM6A 4K1TA 1F92A 1P0SH 2HNTC 2FOCA 2BY9X 3HKJB 1NPMA 1TA2A 5F03A 1EP5A 1EAIA 1O2YA 3VGCB 4LZ4B 2BB4A 1ANEA 4INKA 1ARBA 3D23A 1T32A 4OGXA 2CN0H 4NG9H 5T3HA 4Y79A 1NTPA 1IQKA 5TJXA 1CA0B 2Y7ZA 1DXWA 2P59A 3FVFB 4AG2A 2QXHA 1ZMJA 1FIWA 1FNIA 3O8BA 4UFEH 3SUDA 1S6HA 1GJ5H 1LVYA 2P3TB 1DE7H 3AVZA 2R0LA 4D8NA 3RXKA 1TABE 1ZHMA 1RTLA 1YCPH 1J8AA 1UVSH 1K1IA 1V2PT 3CS7A 5JBCS 5H4IB 2B7DH 1GMDF 3KCGH 1RRKA 2FP7B 1GI6A 2NU2E 1GJBB 3LGWA 4JK6A 2ZU5A 1TWXB 1O2WA 2FX4A 5T6FA 3F1SB 2P8OB 2VNTA 2F9VA 1ZTJA 3LH1A 1DUEA 6LPRA 1KTTB 3PWCA 5EW2H 3GYLB 3TIUA 3ZVEA 5ETXA 2QN5T 3DHKH 4AZ2B 4UD9H 3RC5A 4ABEA 3UIRA 1T8LA 5DKMA 1O3BA 1SGCA 2GT7A 2ZFPH 3RXEA 1P2OA 1UTOA 4KTCA 1S82A 3SNBA 4H4FA 2ZGCA 1ARCA 2ZGBH 1DOJA 4MNVA 2NU4E 4DURA 2RDLA 3SV2H 5LGOA 3VEQB 3RXCA 1D3DB 3NKKA 1NFXA 1L1GA 3LOXA 3EA7A 1B7XB 4AOQA 3MNCA 4XDEA 2HNTE 5EW1H 4ABDA 2VWMA 2TIOA 2C8ZB 1AMHA 4TWYA 3OX7U 1GI1A 1XUGA 2UUYA 1IOEA 1T8NA 4LOYH 3LGIA 1GMDG 1OSSA 3AAVA 4CRDA 1PQ7A 4DCDA 2PUXB 3ZZAA 1T31A 1AUTC 1ELGA 4THNH 7LPRA 2EEKA 3K9XB 3VB4A 1IQEA 4YLQH 1XKBC 3B23B 3NK8A 4XBCA 4ZHAA 1GBMA 2FOFA 4ZMAH 1QHRB 2ZTXA 3BTWE 1EB1H 1UCYH 3JZ1B 1G32B 3STIA 3PTBA 1PQ8A 4Y7AA 2QYIA 4B75A 3PO1B 1ABJH 3MMGA 2FTLE 3P6ZB 1ESTA 1EZSC 1Z8GA 3UREA 4X8UH 4UFGH 1TBRH 1Z6JH 1BTPA 3H5CB 4MVNA 1DITH 2I6QA 2TGPZ 2W3IA 3SJOA 2IN2A 1NRRH 1V3XA 2QXJA 4TY7A 1THPB 3RXIA 3E91A 1HAVA 3QN7A 1C5SA 1K1JA 4Y0ZE 1K2I1 1FUJA 1VCPA 4X1RU 3K65B 1H8IH 5FXLA 1VGCB 3PMAB 2QIQA 3Q76A 1AU8A 1XUJA 2BD5A 2VIPA 2OBOA 1VJAU 4K2YA 1MU6B 1FV9A 1GBDA 4JYTA 4FUGA 1C5WB 2GCTC 4XE4A 1Y3WA 1OP8A 3RXLA 1WTGH 1HFDA 3QGJA 4GHQA 2ZF0H 4A92A 1ZZZA 4FVDA 2ALPA 2XWBI 2BOKA 3ZZ6A 1NU9A 1B0EA 1THRH 1C2EA 4NA7A 3QO6A 4CRGA 1P57B 3UFAA 3UR6A 4ISHH 1O5CB 3SUEA 1HAHH 1C5LH 1AFEH 2ANMH 5DP3A 1HB0B 4BAKB 4MPXA 3O8CA 1AO5A 4H6TA 3QK1A 4Q7XA 5DG6A 3U1IB 2J95A 2ALVA 1YCPK 1O2TA 1A5HA 2A4GA 6ESTA 1V2RT 4DIIH 5EXMA 1D3PB 2BD4A 4KTSA 3DT0H 1GDQA 4A1XA 1AFQB 4RN6A 4X8VH 5JYIA 2PFEA 2FEQH 2PR3A 1Y59T 5FCKA 4X1PU 5E0JA 2OC1A 2TBSA 3GICB 1MCTA 1MTNB 2ZWLH 3ZZ8A 1FY5A 2PKSC 1KIGH 5F8XA 1ELEE 1XXDA 1SGDE 2WUBA 4CRBA 1MAYA 3SQHE 4NIVA 1YPHC 1TE0A 2ZDLA 2OCVB 5FHTA 2ZECA 2A31A 3MI4A 1INCA 3KF2A 3ZYEA 1C1SA 3GDVA 1BHXB 1GBFA 1L4ZA 1MQ5A 2RA3A 1RGQA 1P2JA 1IQJA 3LIWA 3WY8A 1DWEH 3T62A 4X1QU 2J94A 1HJAC 2STAE 3UY9A 2BLVA 1IQMA 3QTOH 3CENA 1C5OH 3BV9B 1HUTH 1O0DH 3Q3KA 3RLYH 2ZNKH 3GCTG 1YLDA 2BQ6B 4BAQB 1C5VA 2CHAC 3RM0H 1FLEE 1GMHF 1GWAA 2FX6A 3ZZ7A 1SG8B 1H4WA 2G5NA 3Q77A 1TNJA 4AX9H 2JH5D 1FN6A 1O35A 4Y10E 2CMYA 1ZPBA 1WYKA 2J9NA 2Z94A 3GY7A 1PPCE 5EGMA 2P93A 2ZHQH 1UCYE 3V0XA 1QJ1B 1EP6A 1O3DA 3EAJA 4VGCC 1W12U 1O2HA 3HATH 1TX6A 3QZRA 1ZSLA 3RU4D 4RSPA 1G2MA 3UWJH 4DIHH 1O2UA 1LQEA 4E05H 4M7GA 3E0PB 1XX9A 4JMYA 1V2KT 1KLJH 3IITA 1C4Y2 1C1MA 4X6OA 1GHZA 1SGFG 3ATMA 3W94A 4BXSA 1LDTT 1KXEA 3FP8E 4DOQA 4KTUA 1N8OB 3ZVAA 2H6MA 1B0FA 2WUCA 1T4UH 2ZGXH 1YPHE 3P8NA 3MU1A 5IYTA 4KGAA 2F9OA 2YOLA 2EI7A 1E38B 1GMHG 2VIWA 1H9LB 3S69A 3PB1E 4O9VA 1C5ZB 3OTJE 1HPGA 1OPHB 2PV9B 2HVXA 1E37B 4UE7H 2GV6A 5HM2A 4UFDH 1QGFA 3RC6A 1UK2A 1O2OA 4AFQA 4BTIB 1P9UA 3RXBA 4CRFA 1KSNA 3MU5A 1O5EH 1QQUA 2J38A 2AMQA 3RP2A 1GCTC 3LJOA 1SSXA 1FAXA 4JZDH 1SQOA 1O2IA 1HAXB 2B8OH 3P70B 4JCNA 2M5TA 1GDUA 1Z1JA 1DDJA 3GY4A 4YT6H 1O3JA 3V7TA 1A4WH 5BPEA 1SFIA 3MNBA 1SOTA 1CT2E 3A81A 3RXMA 1TGTA 2OXSA 3SU5A 3RXAA 4I8HA 5DP7A 1O2MA 4FUBA 1GBEA 1JRTA 1P03A 1ID5H 2FLRH 3ATIA 1OWKA 2VIDA 1O5AB 3HKIB 1Z1IA 1BBRH 2D8WA 1BTZA 1EUFA 4WMDA 1CQQA 1O3EA 1AVGH 1V2UT 5GDSH 1JWTA 4TWWA 1ABIH 2P95A 1C5XB 1P09A 4MLFB 1H9HE 1CSOE 2HPQH 3M37A 3RMNH 4QT8C 1J17T 1UK3A 2F91A 2SGDE 4JYUH 2Q6DA 3A89A 5AFYH 2OD3B 1V2MT 2UWLA 3DD2H 1V2JT 4UONA 2C93B 4FUJA 3LPRA 1W13U 5EPYA 1PYTD 1BRAA 1A1RA 1CHOF 5HGGA 3ATWA 2A0QB 1HIAB 1V2QT 2GGVB 1GI9B 2UWOA 3QTVH 1TB6H 4K5ZA 3CS0A 3L3TA 1GMCG 1AD8H 1HRTH 4ZKRU 4RKJB 3EYDA 2ZI2H 5DJ7A 3QWCH 3LGYA 2WYJA 1ELBA 1K1OA 3GDUA 1C1OA 1YPKH 4AGKA 1VZQH 2W26A 1C2MA 1GGDC 1SGNE 4UFFH 1GG6B 2G55A 2CF9H 1GJAB 5A0CA 6GCHF 3B9FH 3S7HB 1Z8IB 3DA9B 1Q3XA 1HXEH 4K1EA 3UNQA 1ZYOA 2C4FH 1RIWC 2SFAA 1HLTH 1O3LA 5JBBS 1MZDA 4I33A 1C1UH 1HAOH 1PPFE 1JRSA 1W10U 3SBKA 3E16B 1K28D 2H9TH 1GI4A 2FOMB 3ZZ3A 2FIRH 1G36A 4TPYA 4XBDA 2PUQH 1OWEA 2UWPA 2FI5E 1TGCA 2P16A 3NUMA 1CHGA 1Y8TA 2VVVA 3TVJB 4Q7YA 1ZHPA 1CHOG 1K1NA 1GVZA 2O8MA 2FS8A 3MU0A 1BDAA 1LQDB 1THSH 1V2TT 5DO4H 1EAXA 1SHYA 1BT7A 3PM3A 1CE5A 1A5GH 1CGIE 1A0HB 3M35A 2HNTF 1QL8A 3MU4A 4GSOA 3M7TA 4Y6DA 1EX3A 4IMZA 1O2KA 1K21H 1LHCH 1VCQA 1SPJA 1VR1H 2AMDA 2ZDVH 1GHYH 3RXUA 1DANH 3MH5A 2QXIA 2BHGA 2ZCHP 4K3JA 4MPWA 4B71A 1V2VT 4KELA 2HWLB 2XTTB 3BIUH 2BY7X 2ZFFH 3GY2A 3NCLA 2ZPQA 1FJSA 2TGAA 2O9QA 3MHWU 1NFYA 1GJ9B 1G3CA 3PWBA 2BVXH 1DS2E 1FY4A 4ABHA 2I6SA 4ZAEA 1O3HA 5GWZA 1YF4A 1BJVA 2BYAX 2NU0E 4K69A 4WVPE 1CBWB 2OTVA 2AGEX 2ZA5A 1TIOA 4X6MA 3LT3A 4I8KA 1O3GA 2GMTB 1TNHA 2CF8H 1GHAF 2IPHA 2H5DA 4U01A 3ZV8A 1C5TA 5E2OA 3V12A 2Z9KA 4I31A 2W3KA 2ZTZA 4ZXXH 1P06A 5T6GA 3TH2H 1J14A 5DP5A 3VFEA 2V0BA 1C9PA 4GHTA 1RD3B 1BBRE 2D2DA 3S9AA 1ELAA 1AWFH 4FUHA 2J34A 4Q7ZA 5DPAA 4D76A 1UMAH 2ZDMA 3LJJA 1XUHA 4ZROA 1W7XH 2H5CA 1C4U2 3OY6U 1DVAH 2ZTYA 4Y0YE 2ZIQH 1IQIA 2BLOA 3A7WA 2HALA 2H9EH 4J2YB 1V2OT 2VVUA 1SGEE 3KQBA 1LVOA 1HIAA 1A0LA 3RMMH 1O2QA 1TBQH 1TFXA 3UTUH 1PFXC 3PYHA 1LPKB 1C2IA 1P04A 3ESTA 1GHBG 4JZFH 3A7TA 3G01A 3T29A 3U8TH 1MKXK 1O2VA 3OU0A 5EXNA 3P92A 1QB6A 1Q2WA 3BEIB 1BB0B 1NY22 1EJMA 2AYWA 1KLTA 5ESTE 2P94A 1ZSJA 4NFEA 1O3MA 1W0ZU 3M5OA 1PQAA 4AYYB 1ANBA 2ZGJA 1K1PA 1GHAG 3TNSA 1ELDE 4NGAH 2OC0A 1Y3UA 4E7NA 1WUNH 2VGCB 2G5VA 2XW9A 1C1RA 1O3FA 5GCHG 1J15A 1RJXB 2A4QA 1JBUH 1D9IA 1UTKA 1GJ7B 4DGJA 3P8FA 3T25A 1SQTA 1C2JA 4NIYA 1O2GH 4CHAC 1ELVA 1GVLA 2ZC9H 1KXDA 2ZP0H 1IQHA 1Z71A 3A86A 1UJ1A 1ZMNA 3O8DA 5E0GA 2A5AA 4AFSA 1BA8B 2WV4A 1ESAA 1GL1A 5SGAE 1ZPZA 4X8SH 2BY5X 4NSVA 2BDHA 2QY0B 1HAGE 4O3UA 2XBYA 1C2LA 1AWHB 1NFUA 1EPTC 2XNIA 3PMHB 2TGTA 4O3TA 4YTAA 1P9SA 3ZZ4A 1FONA 1MBMA 1CA8B 1SL3A 2G4UA 2H2ZA 3ZZ5A 1W7GH 3D49H 2VIVA 1XKAC 1V2NT 3PV4A 1AZZA 1BMMH 5DGJA 1MUEB 2VJ1A 3MH4A 5AF9H 1O39A 1MU8B 1BMLA 7ESTE 1E34B 3KL6A 1X7AC 1XUKA 4FUFA 1ZGIA 1AN1E 4Q2KA 4GUXA 4GPGA 2NU3E 1GBIA 3TH3H 5CE1A 2ODPA 2A2XH 4WH8A 3SJKA 2W7UA 2J4IA 1J16A 1ZRBA 5EG4A 4DW2U 3TGJE 3DFLA 5FCRA 2QCYA 1OKXA 1AB9B 3LONA 2EI6A 3LC5A 3NPSA 5L6NH 1DLKB 3F6UH 4NA8A 1TOCB 1FY1A 1KDQB 3LDXH 4B74A 1GVKB 2RG3A 2Y81A 2UUJB 2SNWA 2JETB 3OYPA 1EKBB 2QGRA 4B2AA 4BOHA 3GY6A 1HYLA 4A1VA 4OS6A 2ZHFH 3KIDU 2BTCE 3M5MA 1Y5UT 2P3UB 3GY8A 1UVPA 2FOGA 3MFJA 2F9UA 2THFB 1XUIA 1C5UA 1GHXH 2EA3A 1WU1A 2IJOB 1F0SA 4ABFA 1A61H 3BTEE 5K7RA 1VJ9U 1QRXA 1IQNA 1IQFA 2ZFTA 3ENSB 1DICA 2GD4B 2FMJA 3AW1A 1GI8B 1BTHH 2FOAA 1NESE 1GCDA 4Y8ZA 1LPGB 4R8TB 3TU7H 1O2XA 4NIWA 1P2NA 3EDXB 1J9CH 1UTPA 2YNBA 1DWBH 1BZXE 1TRMA 5E2PA 5EXLA 1C9TA 4JK5A 4NIXA 3GCTF 1LHDH 3OY5U 3TK9A 2GVFA 2VH0A 1C1PA 1ORFA 5C3NA 3M36A 3U98H 4MQAA 3H7TA 2JH0D 1NU7B 1OYQA 6CHAC 2VH6A 2EI8A 1V2WT 2PLXA 2A5IA 3S9CA 1TMTH 1HGTH 5HYOA 2ZFQH 2GDDA 1IAUA 3RXTA 1HDTH 1TGBA 1BRUP 2FOBA 3A7VA 5FPSA 2Y5FA 2QV1A 1DY8A 2BDYA 1OX1A 2K1QA 4ISIH 4WMEA 3A7ZA 2CV3A 1QY6A 3SV8A 2KAIB 2PGQB 2ZDAH 4YOJA 3A8CA 1Q31A 3QDZB 5DP6A 3NWUA 1L4DA 2BOHB 1ETTH 1A3BH 1Z7KA 2G4TA 3ODDA 1H1BA 4NZLA 4ZKOU 2ANKH 2O8TA 2Y7XA 1EZXC 1GJ6A 2G8TA 2FTMA 2TPIZ 1LPZB 1MD8A 4CRCA 2FYRA 1W0YH 1ZRKA 3M3SA 2XCFA 1S83A 1FN8A 4WJG2 4OS4A 1GJ8B 3MH7A 3SU0A 2ZU1A 1CU1A 1GBTA 1SLUB 2BD2A 5A8XA 2G00A 2ZDKA 1WV7H 1EAUA 1OS8A 2FXRA 3SV9A 2FOEA 4BAMB 2VINA 4LK4A 5E0HA 2R3UA 5L30H 3BG4C 1Y3VA 1C2KA 3BN9A 2Z9JA 3QGNB 1MKWK 2BLQA 1PPEE 5JB9S 1D6RA 5CHAC 1JOUB 3QLPH 4JZIA 1C5QA 3TLOA 3R3GB 2HOBA 1DSUA 1HAIH 2ESTE 1D3QB 3GCHC 4RKOB 4XOJA 4BXWA 1BIOA 1EXFA 4MNYA 2P3FH 1NROH 1P2QA 4IGDA 2XBVA 3VB7A 1QFKH 4XFQA 1SGIB 3BTHE 1HNEE 1KDQA 1C4V2 2ZU2A 1O33A 1XXFA 2ZU3A 2R2WU 4JYVH 1SQAA 4I7YH 2GCHG 2PSYA 3FP7E 1YLCA 4MPUA 3KNXA 1TQ7B 2RCEA 4F49A 5FAHA 1ACBE 3L6PA 2AIQA 3SI4H 1FI8A 2TGDA 1C5PA 2LNCA 3A87A 4KP0A 3GYMA 2R3YA 2AGGX 4AFUA 9ESTA 1O36A 2G52A 2BQWB 4FUCA 1SR5C 1GHWH 4TY6A 1TMBH 3RXOA 1TRYA 2VU8E 5JB8S 2A1DB 1O2SA 3B8JA 3EA9A 1MAXA 3E3TA 3RXPA 2ZEBA 4NCYA 3RUOA 4X1NU 1BRCE 1EOLA 5AVDA 1UTQA 2PW8H 2ZPRA 3GCNA
chains in the Genus database with same CATH superfamily
1GBBA 1O2JA 1T7CA 4YLUA 2AMPA 1ZGVA 1G9IE 1CT4E 3VGCC 4AB9A 1AHTH 4P02A 1KXAA 4XSKU 1A7SA 2B9LA 3E0NB 1RXPA 1YPMH 1KXBA 2XC5A 4IC5A 1CA0C 4JZ1A 1DT2A 3ZVGA 5A0BA 1GHVH 1GBJA 1O3PB 4DJZB 1UK4A 1ETSH 4CRAA 3C27B 4MPVA 1GMCF 1C5NH 1WOFA 1HAZB 1UTNA 3IG6B 1MH0A 3TNTA 2DE8A 2WZQA 4I8GA 1XVOA 3TITA 2KCOA 3UUZA 1QIXB 5A8ZA 2KAIA 3MNXA 5TCAA 3SU1A 1O3IA 1O3OA 3Q3XA 1O5BB 2ASUB 2W7SA 1K1MA 1F5KU 1W0JD 3U9AH 1DX5M 1P2IA 3U69H 1Z8JB 1G2LA 2P8OC 1F0UA 1LHFH 2OK5A 1N1LA 4OS1A 1SBWA 1RTFB 4Y11E 3T28A 1P02A 1ESBA 1NO9H 1TBZH 1P8VC 3PV5A 1L2EA 1W11U 2F9BH 1CT0E 3UQVA 2Y5HA 3BTTE 1GBKA 1SFQB 4X2XA 3P8GA 1E1QD 1QB1A 1O5GH 2SNVA 4F4OC 1JXPA 1FMGA 2GTBA 1H8HD 1A0JA 1XVMA 1V6DA 3F9HA 4MG3A 5ABWA 2GCTB 1JIMA 3ZZ9A 1MKXH 3RXRA 1MTSA 3SUFA 1O34A 1VCWA 2F83A 2VWNA 1ETRH 5LPRA 2V35A 2GP9B 3BTFE 4FUDA 2ZGHA 2BD3A 3A8AA 1W8BH 1K1LA 3LH3A 1Y5AT 1GBLA 3P8OA 2J97A 3BF6H 1GI5A 4HGCA 5GPIB 3SORA 1WQVH 1DM4B 3SUGA 5C20A 1TNIA 4BNRA 1V2ST 3U1JB 3ZYDA 3TH4H 2CGAA 3ZVBA 2R9PA 1AY6H 1BTWA 1ZJDA 5EPNA 5HIYA 2ZHEH 4F55A 3I77A 3PRDA 3UOPA 1LKBA 1O5DH 2L74A 2KCYA 3SNEA 4CREA 1KY9A 4Y8XA 1WTHD 3NZIA 2FWWA 3TJUA 3SN8A 3KYFA 1F5RA 1O3AA 4UDWH 2BY8X 4NA9H 3F9EA 3PO1C 1F0RA 2SGPE 2OLGA 4K60A 1C2HA 1HAPH 2PKSB 1K9OE 4Q4LA 5A8YA 2WPLS 4CR9A 1ZLRA 2VIOA 1WSSH 2XC0A 2ZHDA 2QE7D 2FESH 1P12E 3U8RH 2K8IA 3V3MA 1VGCC 4Q80A 4HI3A 4WXIA 3UB0A 2QAAA 4IBLH 1GBHA 2BXUH 4FU9A 5HM9A 3HGNA 1BTUA 1ZR0A 1KLIH 2Z9LA 3FFGA 1HJAB 1Y3XA 2STBE 4ASHA 4GAWA 1S84A 1ANCA 4WF8A 2FZZA 2EQNA 7KMEH 5FX6A 1HBTH 5FPYA 4B2CA 3E90B 3S7KB 1F2SE 3MH6A 1GHBF 4HTCH 1FXYA 2BQ7B 4WWYA 1TPOA 4YO9A 2BVRH 1QURH 4ZH8A 1GI3A 2CHAB 2JKHA 2LELA 1O2PA 1TRNA 4X1SU 1S85A 1AUJA 3H7OA 1ZTKA 2F9PA 1AGJA 1KXFA 3SU3A 2Y80A 3F9GA 3MO9A 1MTVA 5I25A 4ABGA 2Y82A 2BLWA 5I46H 3ATKA 1W14U 2Z3DA 3FAOA 3TJOA 1SVPA 5EODA 3KN2A 3ZVCA 2J2UA 4I32A 2F4LA 2Y6TA 1BTYA 3SNCA 3EE0B 1W2KH 5C5OA 4VGCB 1MZAA 2VWLA 2D1JA 2XBXA 5GCHF 3MO3A 1GI2A 2FYQA 1PPGE 3A80A 1AFQC 1HXFH 4GVUA 5JBTA 3A7XA 4ABAA 2BDIA 3LKWA 2VIQA 2BZAA 2WPIS 1PPBH 1ZTLA 3KQEA 1GI0A 1NBMD 4NWLA 5AHGH 1QL9A 1MTNC 3M3VA 1O37A 3RXGA 5A2MH 1EZUC 1O30A 5EQSA 2RDEA 3RU4E 4B73A 1DY9A 1LKAA 1SB1H 4INHA 2VWOA 4AYVB 1S81A 1SGRE 3KGPA 1BRBE 3SI3H 2QXGA 1A3EH 4ZHMU 1SC8U 3BG8A 3K2UA 4BTTB 5C1XA 1TYNA 3DSPA 2Z3EA 1P10A 5KECA 1F7ZA 4Z0KA 2TRMA 5LPEA 3RXVA 1P01A 1TPSA 4ZHLU 1IHSH 5GXPA 4AN7A 2LPRA 5EQQA 5GJ4B 2JJ2D 3GY3A 1YM0A 3K6ZA 1O3CA 1SMFE 3SJIA 4CH2B 4Y8YA 3TK5A 4IW4E 4BAOB 1PYTC 3BTQE 3FO8D 3RMLH 5F8ZA 1CGJE 3TGIE 1DSTA 2NU1E 1W3CA 1GPZA 1JIRA 3KQDA 1TOMH 3QUMP 2PWXA 1GCTB 1SI5H 1AKSB 2FI3E 1OWDA 1GBAA 3ATLA 2ZFRH 4X0WU 1DFPA 4KKDA 1LVMA 4LXBH 4YOIA 1DLEA 2ANYA 1NFWA 1FDPA 4Z6AH 2PKAB 5FBEA 5EJ1A 4FXGH 4NZQA 1ZPCA 2XYAA 1TA6A 4U2WA 4ABBA 8GCHG 2SGFE 1OWIA 2C8WB 4ISLA 3RLWH 3SU4A 1D6WA 1SOZA 1GL0E 3GISB 4JZEH 1GBCA 4AORA 3ITIA 3UNRA 3O8RA 1H8ED 1IQLA 3GOVB 3ZZDA 1SLXB 4X2YA 5T6DA 1N8OC 4D7GA 4YXWD 1AVWA 1BTXA 3EQ0H 4Y71A 4NWKA 4X2WA 3KQCA 1GI7B 2QF3A 1QJ7B 1MBQA 1PQ5A 3M5LA 1AI8H 4ZUHA 2C8XB 1GDNA 4D7FA 7GCHF 1MKWH 1GJ4H 3QZQA 2GZ7A 1AE5A 9LPRA 2ZDNA 3A8DA 4MNWA 3RXFA 3U8OH 2ZCKP 1KXCA 3D65E 4I8LA 3SU2A 4RT1A 2ZO3H 1MD7A 4A7IB 3AAUA 2FI4E 3RXHA 4E06H 4ISOA 1UVOA 2EY4C 3DFJA 1GGDB 3SV6A 1LHGH 4YM9A 1Y5BT 2KCAA 1BJUA 4LZ1H 3MTYA 1P05A 2Z3CA 2QA9E 5G4BA 1MTUA 3FP6E 1AZ8A 2C3SA 2FO9A 3SQEE 2BZ6H 1PJPA 3BEUA 2OQ5A 2WYGA 1SQRA 1RIWB 1WAYB 2WPKS 1H9IE 1LMWB 2HLCA 8KME2 2KCPA 4IMQA 1T4VH 2O8UA 3SW2B 3TK6A 4FVBA 4Y76A 5EQRA 5ESBA 4ZKNU 2W5EA 1AE8H 2BX4A 1NRSH 1YWUA 4GCHF 3RU4T 3UWIA 2F9NA 1SGFA 2K0QA 2V3MA 3HGPA 3KHVA 1QNJA 3SOSA 3E8LA 2F43B 3GCOA 1EATA 1H8DH 3R0FA 1F0TA 4CH8B 2FOHA 2W6JD 2FDAA 1NZQH 4O97A 1YBWA 1LO6A 2ILNA 1LHEH 1DUAA 3SU6A 4MDSA 3VB5A 7GCHG 1T8OA 1EJNA 1QBNA 1SHHB 3MWIU 1YPGH 1TQ0B 2BD9A 1UTMA 1EASA 3SJ8A 1O3KA 1WDIA 1MQ6A 1V2LT 5C1UA 3A8BA 3STJA 1KYNA 2JH6D 1PPZA 3I78A 1C1QA 1UVTH 1AKSA 3VB6A 2BY6X 3SHAH 5F53A 3MU8A 1L1JA 2B0FA 2ZG0H 4GLYA 1UVUH 2OUAA 3UOUA 1QJ6B 2GV7A 5L2ZH 1G30B 3N7OA 1QL7A 1A2CH 4XBBA 1OYTH 3PLPA 3M7QA 3V13A 1TX7A 2OINA 1E1RD 1KMHB 2PKAA 4INLA 1GG6C 3VB3A 2VVCA 4GCHG 2HGTH 4FETA 2OC8A 1TGNA 2A4RA 8LPRA 3LC3A 2AERH 4FUEA 4B6EA 2Z9IA 1LCYA 1SGPE 1TGSZ 2HRVA 3IWMA 3SGQE 1BQYA 4A5TS 2NWNA 1TNLA 1S5SA 4TPIZ 1TPPA 3PLBA 3OSYA 2BDBA 3ELAH 1P2KA 2ZQ1A 4A1TA 5HXFA 4ISNA 4AG1A 3T2NA 2GCHF 5EOKA 1O2RA 2AGIX 3BTME 4XRNA 1YYY1 4YESB 2XBWA 1BMFD 3F2GA 3RMOH 3SZNA 3VXFH 4D9QA 1NRPH 3T5FH 2G81E 3P17H 2OP9A 3URCA 5FPTA 1N6YA 3JZ2B 1QB9A 1TLDA 5DP4A 5CHBA 3A84A 3KEEA 1C5RA 4FUIA 4H6SB 2DUCA 4WMFA 5DP8A 2Q1JA 3OEED 2Q6FA 3A7YA 2AS9A 2JDID 2ZFSA 3RC4A 1SGQE 1BCUH 2R0KA 2SGEE 3ZV9A 3N7DA 5E8EH 1FAKH 5C5NA 2PTNA 1C2GA 3RXDA 2WHXA 3GY5A 1UO6A 2F3CE 1MMJN 3D62A 2ULLA 1L0ZA 4SGBE 2C90B 1SLWB 2J92A 1BMNH 1E36B 1C1WH 3BTKE 3EA8A 2PTCE 3MYWA 2LP6A 4H42U 4J1YA 4BTUB 1QBVH 1LTOA 1QTFA 3BSQA 1UTJA 3SO3A 4MTBA 3E6PH 2RA0A 1C5MD 1O2ZA 4NFFA 4B1TA 1AQ7A 1AVXA 4OS2A 4ABIA 1YKTA 3P95A 1C2DA 1P2MA 1LVBA 1O2LA 3VPKA 2GKVE 1Z6EA 2FLBH 2AEIH 3M3TA 3SGAE 5CMXH 1FY3A 1OP0A 3RXQA 1OXGA 1CBWC 4IN2A 1K22H 1C1TA 3HK3B 4X6PA 4K8YA 3EGKH 3UNSA 2BM2A 2GMTC 4DG4A 3OTPA 3PROA 1Y3YA 3A82A 1UCYK 2PSXA 2XXLA 1YCPM 2Z6BD 4FU8A 2GZ8A 2Z9GA 4CHAB 5B6OA 1RTKA 3A83A 1YGCH 2XRCA 1TMUH 1E79D 4ABJA 4HFPB 3PTNA 1TONA 4M9FA 3RDZA 3SV7A 5HMAA 4ZXYH 3M7UA 2ANWA 1EOJA 1A5IA 3BTDE 1EPTB 1CVWH 1ELTA 5L2YH 2H1UA 2BDCA 3F0OA 1CO7E 1ZSKA 2BDAA 5PTPA 2A45B 2G51A 5DP9A 1P3EA 1T8MA 1CGHA 1DPOA 2WPHS 3BEFB 4IN1A 1G3DA 2YNAA 1BOQA 2ZHWH 1HAYB 3RXJA 5C0UA 1MTWA 1QR3E 2AFQB 5K0HA 5JDUB 3HPTB 3MOCA 3PMBB 4UEHH 3SNAA 4AFZA 2WPJS 5B6LA 1UHBB 1EB2A 2SGQE 2WINI 5J4QA 2O8WA 1C1VH 1EAWA 1NN6A 3SHCH 3ZVDA 4SGAE 4CBOA 1UTLM 2OQUA 2VGCC 2H9HA 4CBNA 3UQOA 1TALA 3FZDA 3Q00A 3SGBE 1BMAA 2BD7A 3S0NA 1FPCH 2O8LA 3CP7A 4ZKSU 4OS7A 3OEHD 1RFNA 2ZU4A 2ZKSA 2QC2A 2A7JA 4OS5A 1O3NA 3QX5H 1BUIA 3A88A 1YP9A 4I8JA 2EC9H 2ODQA 3PMJA 4U30A 4WY3A 3ZZBA 2R2MB 1YPEH 1DWDH 3EE7A 1F5LA 5IDKA 1NRNH 4AGJA 2D26C 1SGTA 1C1NA 2PHBA 1AIXH 1GJDB 2BVSH 4YZUA 3ZVFA 1QRZA 2Z7FE 2BX3A 2FPZA 1HJ8A 4R0IA 1L1NA 1O38A 5TCCA 2OC7A 2SGAA 5C1YA 1ANDA 1P3CA 1HJ9A 4PROA 1N6XA 4FU7A 2BD8A 4DVAU 2ZZUH 3H09A 2Y5GA 4DT7B 3FOAA 1MCVA 1NC6A 2GZ9A 4P00A 2GX4A 1B5GH 3TJNA 3L33A 2C8YB 3C1KA 1YPJH 2XOKD 1OWJA 2HVYB 1JMOH 3I29A 2XCNA 3PLKA 1DWCH 4OGYA 2Q6GA 2FM2A 2QF0A 1PPHE 3FZZA 1HCGA 1OWHA 1KTSB 3HK6B 5AFZH 3PV2A 1G3BA 3RXSA 4X8TH 3T26A 4CR5A 4O03A 3ZZCA 1D4PB 3OAAD 3N99A 3E1XB 1S0QA 3MQKC 1WQSA 3BIVH 1XM1A 1WBGB 4U32A 3K6YA 6CHAB 3UR9A 2WV5A 4K8BA 4B76A 1ELCA 3LGTA 1EJAA 5F6MA 5JBAS 1FZZA 2FS9A 3W95A 2A5KA 4WXVA 1S6FA 4BAHB 3TGKE 3SJ9A 5HIZA 3LU9B 2GDEH 2YMSC 1HV7A 1NS3A 1ZMLA 2ZQ2A 3FN8A 3TPIZ 2GT8A 1RS0A 1EQ9A 1AB9C 2A2QH 3M5NA 5GIBA 3UPEA 5KEDA 1C5YB 1A46H 4NSYA 1SGYE 1G37A 3NXPA 3TJVA 2XC4A 2WPMS 2AIPA 3F9FA 4DY7B 2M2AA 2BDGA 1IHTH 2JETC 2ZPSA 5FBIA 2VB0A 2CXVA 1EZQA 2AH4X 2BXTH 1EPTA 1O31A 2DE9A 3VXEH 1OHHD 5J4SA 1E0FD 1QRWA 2UUKB 3A85A 5BRRE 1D3TB 1FY8E 5DSFA 1S0RA 1YPLH 5LPFA 1P11E 1SLVB 1WCZA 4WH6A 2V3OH 4TYDA 8ESTE 3S9BA 2A4OA 4YOGA 1TPAE 1VITF 3MO6A 4K1SA 2A7HA 4AB8A 4D9RA 1BHXF 1QQ4A 4X6NA 1VITH 2IOTA 1TX8A 1ELFA 3M61U 1O2NA 2J98B 2CJIA 1M9UA 1YC0A 4BANB 1FPHH 1UHBA 3BG4B 1O32A 4HZHA 1QA0A 1BITA 3LGVA 2PP6A 5CHAB 1OOKB 3GDSA 1Z8RA 3FANA 1G3EA 4YT7H 5JPMH 2XWAA 2OBQA 4IS5A 3GCHB 1QCPA 3T27A 6GCHG 1E35B 1ZOMA 2A7CA 4A6LA 5C67A 3ODFA 1ZHRA 1QBOA 2BMGB 1IQGA 3RM2H 1FIZA 1C2FA 1FQ3A 3AASA 5FX5A 1U6QA 3BTGE 5A0AE 2UUFB 1TAWA 3AW0A 5LH8A 3F68H 2ZCLP 3SNDA 5EU8A 1TNKA 2HPPH 5DK1A 3URDA 1OP2A 1TNGA 2B5TB 2V3HH 4B2BA 5C2ZA 4XD7D 4E7RG 2FODA 4X2VA 3LGUA 4ESTE 1DXPA 4IC6A 1XUFA 1GJCB 1XMNB 3DUXH 5F8TA 8GCHF 2JIZD 1VITG 1NT1A 4MNXA 2ODYB 1NRQH 1QA7A 2PGBB 2V6NA 4Y7BA 1BBRK 3MNSA 2A32A 1O5FH 4AC9A 5A09A 3Q3YA 1HAVB 1ZJKA 2VBCA 1NM6A 4K1TA 1F92A 1P0SH 2HNTC 2FOCA 2BY9X 3HKJB 1NPMA 1TA2A 5F03A 1EP5A 1EAIA 1O2YA 3VGCB 4LZ4B 2BB4A 1ANEA 4INKA 1ARBA 5EJZA 3D23A 1T32A 4OGXA 2CN0H 4NG9H 5T3HA 4Y79A 1NTPA 1IQKA 5TJXA 1CA0B 2Y7ZA 1DXWA 2P59A 3FVFB 4AG2A 2QXHA 1ZMJA 1FIWA 1FNIA 3O8BA 4UFEH 3SUDA 1S6HA 1GJ5H 1LVYA 2P3TB 1DE7H 3AVZA 2R0LA 4D8NA 3RXKA 1TABE 1ZHMA 1RTLA 1YCPH 1J8AA 1UVSH 1K1IA 1V2PT 3CS7A 5JBCS 5H4IB 2B7DH 3OFND 1GMDF 3KCGH 1RRKA 2FP7B 1GI6A 1GJBB 2NU2E 3LGWA 4JK6A 2ZU5A 1TWXB 1O2WA 2FX4A 5T6FA 3F1SB 2P8OB 2VNTA 2F9VA 1ZTJA 3LH1A 1DUEA 5C94A 6LPRA 1KTTB 3SYJA 3PWCA 5EW2H 3GYLB 3AK5A 3TIUA 3ZVEA 5ETXA 2QN5T 3DHKH 4AZ2B 4UD9H 3RC5A 4ABEA 3UIRA 1T8LA 5DKMA 1O3BA 1SGCA 2GT7A 2ZFPH 3RXEA 1P2OA 1UTOA 4KTCA 1S82A 3SNBA 4H4FA 2ZGCA 1ARCA 2ZGBH 1DOJA 4MNVA 2NU4E 4DURA 2RDLA 3SV2H 2J98A 5LGOA 3VEQB 3RXCA 1D3DB 3NKKA 1NFXA 1L1GA 3LOXA 3FKSD 3EA7A 1B7XB 4HG6A 2KR7A 3MNCA 4AOQA 4XDEA 2HNTE 3PRBA 4ABDA 5EW1H 1SKYE 1S6LA 2VWMA 2TIOA 2C8ZB 1AMHA 4TWYA 3OX7U 4FOUC 1GI1A 1XUGA 2UUYA 1IOEA 1T8NA 4LOYH 3LGIA 1GMDG 1OSSA 3AAVA 4CRDA 1PQ7A 4DCDA 2PUXB 3ZZAA 1T31A 1AUTC 1ELGA 4THNH 2CK3D 7LPRA 2EEKA 3K9XB 3VB4A 1IQEA 4YLQH 2AHME 1XKBC 3B23B 3NK8A 4XBCA 4ZHAA 1GBMA 2FOFA 4ZMAH 1QHRB 2ZTXA 3BTWE 1EB1H 1UCYH 3JZ1B 1G32B 3STIA 3PTBA 1PQ8A 4Y7AA 2QYIA 4B75A 3PO1B 1ABJH 3MMGA 2FTLE 3P6ZB 1ESTA 1EZSC 1Z8GA 3UREA 4X8UH 4UFGH 1TBRH 1Z6JH 1BTPA 3H5CB 4MVNA 1DITH 2I6QA 2TGPZ 2W3IA 5GNDA 3SJOA 2IN2A 1NRRH 1V3XA 2QXJA 4TY7A 1THPB 3RXIA 3E91A 1HAVA 3QN7A 1C5SA 1K1JA 4Y0ZE 1K2I1 1FUJA 1VCPA 4X1RU 3K65B 1H8IH 5FXLA 1VGCB 5EJLA 3PMAB 2QIQA 3Q76A 1AU8A 1XUJA 2RFKC 2BD5A 2VIPA 2OBOA 1VJAU 4K2YA 1MU6B 1FV9A 1GBDA 4JYTA 4FUGA 1C5WB 2GCTC 4XE4A 1Y3WA 1OP8A 3RXLA 1WTGH 1HFDA 3QGJA 4GHQA 2ZF0H 4A92A 1ZZZA 4FVDA 2ALPA 2XWBI 2BOKA 3ZZ6A 1NU9A 1B0EA 1THRH 1C2EA 4NA7A 3QO6A 4RT0A 4CRGA 1P57B 3UFAA 3UR6A 4ISHH 1O5CB 3SUEA 1HAHH 1C5LH 1AFEH 2ANMH 5DP3A 1HB0B 4BAKB 4MPXA 3O8CA 1AO5A 4H6TA 3QK1A 4Q7XA 5DG6A 3U1IB 2J95A 2ALVA 1YCPK 1O2TA 1A5HA 2A4GA 6ESTA 1V2RT 4DIIH 5EXMA 1D3PB 2BD4A 4KTSA 3DT0H 1GDQA 4A1XA 1AFQB 4RN6A 4X8VH 5JYIA 2PFEA 2FEQH 2PR3A 1Y59T 5FCKA 4X1PU 3DSGA 2OC1A 5E0JA 2TBSA 3GICB 1MCTA 1MTNB 2ZWLH 3ZZ8A 1K0HA 1FY5A 2PKSC 1KIGH 5F8XA 3NRLA 1ELEE 1XXDA 1SGDE 2WUBA 4CRBA 1MAYA 2L6OA 4OM9A 3SQHE 4NIVA 1YPHC 1TE0A 2ZDLA 2OCVB 5FHTA 2ZECA 2A31A 1NBME 3MI4A 1INCA 3KF2A 3ZYEA 1C1SA 3GDVA 4Z1MD 1BHXB 1YY3A 1GBFA 1L4ZA 1MQ5A 2RA3A 1RGQA 1P2JA 1IQJA 3LIWA 3WY8A 1DWEH 3T62A 4X1QU 2J94A 3F2HA 4ACAA 1HJAC 2STAE 3UY9A 2BLVA 1IQMA 3QTOH 3CENA 1C5OH 1FX0B 3BV9B 1HUTH 1O0DH 3Q3KA 3RLYH 2ZNKH 3GCTG 1YLDA 2BQ6B 4BAQB 1C5VA 2CHAC 3RM0H 1FLEE 1GMHF 1GWAA 2FX6A 3ZZ7A 1SG8B 1H4WA 2G5NA 3WWBA 4ACBA 3Q77A 1TNJA 4AX9H 2JH5D 1FN6A 1O35A 4Y10E 2CMYA 1ZPBA 1WYKA 2J9NA 2Z94A 3GY7A 1PPCE 5EGMA 2P93A 2ZHQH 1UCYE 3V0XA 1QJ1B 1EP6A 1O3DA 3EAJA 4ASUD 4VGCC 1W12U 1O2HA 3HATH 1TX6A 3QZRA 1ZSLA 3RU4D 4RSPA 1G2MA 4Q63A 3UWJH 4DIHH 1O2UA 1LQEA 4E05H 4M7GA 3E0PB 1XX9A 4JMYA 1V2KT 1KLJH 3IITA 1C4Y2 1C1MA 4X6OA 1GHZA 3DSOA 1SGFG 3ATMA 3W94A 5C0TA 4BXSA 1LDTT 1KXEA 3FP8E 3WWFA 4DOQA 4KTUA 1N8OB 4TSFD 3ZVAA 2H6MA 1B0FA 2WUCA 1T4UH 2ZGXH 1YPHE 3P8NA 3MU1A 5IYTA 4KGAA 2F9OA 2YOLA 2EI7A 1E38B 2KFWA 1GMHG 2VIWA 1H9LB 3S69A 3PB1E 4O9VA 1C5ZB 3OTJE 4I86A 1HPGA 1OPHB 2PV9B 5KGOA 2HVXA 1E37B 4UE7H 2GV6A 5HM2A 4UFDH 1QGFA 3RC6A 2JJ1D 1UK2A 1O2OA 4AFQA 4BTIB 5DN6D 1P9UA 3RXBA 4CRFA 1KSNA 3MU5A 1O5EH 1QQUA 2J38A 2AMQA 3RP2A 1GCTC 3LJOA 1SSXA 1FAXA 4JZDH 1SQOA 1O2IA 1HAXB 2B8OH 3P70B 4JCNA 2M5TA 1GDUA 1Z1JA 1DDJA 3GY4A 4YT6H 1O3JA 3V7TA 1A4WH 5BPEA 1SFIA 3MNBA 1SOTA 1CT2E 2WPDD 3A81A 3RXMA 1TGTA 2OXSA 3SU5A 3RXAA 4I8HA 5DP7A 1O2MA 4FUBA 1GBEA 1JRTA 1P03A 1ID5H 2FLRH 3ATIA 1OWKA 2VIDA 1O5AB 3HKIB 1Z1IA 1BBRH 2D8WA 1BTZA 1EUFA 4WMDA 1CQQA 1O3EA 1AVGH 1V2UT 5GDSH 1JWTA 4TWWA 1YLNA 1ABIH 3W1EA 2P95A 1C5XB 1P09A 4MLFB 1H9HE 1CSOE 2HPQH 3M37A 3RMNH 4QT8C 1J17T 1UK3A 2F91A 2SGDE 4JYUH 2Q6DA 3A89A 5AFYH 2OD3B 1V2MT 2UWLA 3DD2H 1V2JT 4UONA 2C93B 4FUJA 3LPRA 1W13U 5EPYA 1PYTD 1BRAA 1A1RA 1CHOF 5HGGA 3ATWA 2A0QB 1W0KD 1HIAB 1V2QT 2GGVB 1GI9B 2UWOA 3QTVH 1TB6H 4K5ZA 4TT3D 3CS0A 3L3TA 1GMCG 1AD8H 1HRTH 4ZKRU 4RKJB 3EYDA 2ZI2H 5DJ7A 2IPQX 3LGYA 3QWCH 2WYJA 1ELBA 1K1OA 3GDUA 1C1OA 1YPKH 1EFRD 4AGKA 1VZQH 2W26A 1C2MA 2HLDD 1GGDC 1SGNE 4UFFH 1GG6B 2G55A 2CF9H 1GJAB 5A0CA 6GCHF 3B9FH 1UW7A 3S7HB 1Z8IB 3DA9B 1Q3XA 1HXEH 4K1EA 3UNQA 1ZYOA 2C4FH 1RIWC 2SFAA 1HLTH 1O3LA 5JBBS 1MZDA 4I33A 1C1UH 1HAOH 1PPFE 1JRSA 1W10U 3SBKA 3E16B 1K28D 2H9TH 1GI4A 2FOMB 4RI0A 2FIRH 1G36A 3ZZ3A 4TPYA 4XBDA 2PUQH 1OWEA 2UWPA 2FI5E 1TGCA 2P16A 3NUMA 1CHGA 1Y8TA 2VVVA 3TVJB 4Q7YA 1ZHPA 1CHOG 1K1NA 1GVZA 2O8MA 2FS8A 3MU0A 1BDAA 1LQDB 1THSH 1V2TT 5DO4H 1EAXA 1SHYA 1BT7A 3PM3A 1CE5A 1A5GH 1CGIE 1A0HB 3M35A 2HNTF 1QL8A 3MU4A 4B6FA 4GSOA 3M7TA 4Y6DA 1EX3A 4IMZA 1O2KA 1K21H 1LHCH 1VCQA 1SPJA 1VR1H 2AMDA 2ZDVH 1GHYH 3RXUA 1DANH 3MH5A 2QXIA 2BHGA 2ZCHP 4K3JA 4MPWA 4B71A 1V2VT 4KELA 2HWLB 2XTTB 3BIUH 2BY7X 2ZFFH 3GY2A 3NCLA 2ZPQA 1FJSA 2TGAA 2O9QA 3MHWU 1NFYA 1GJ9B 1G3CA 5IK2D 3PWBA 2BVXH 5CDFE 1DS2E 1FY4A 3SZEA 2KX4A 4ABHA 2I6SA 4ZAEA 1O3HA 5GWZA 1YF4A 1BJVA 2BYAX 2NU0E 4K69A 4WVPE 1CBWB 2OTVA 2AGEX 2ZA5A 1TIOA 4X6MA 3LT3A 4I8KA 1O3GA 2GMTB 5HKKD 1TNHA 2CF8H 1GHAF 2IPHA 2H5DA 4U01A 3ZV8A 1C5TA 5E2OA 3V12A 2Z9KA 4I31A 2W3KA 2ZTZA 4ZXXH 1P06A 5T6GA 3TH2H 1J14A 5DP5A 3VFEA 2V0BA 1C9PA 4GHTA 1RD3B 1BBRE 2D2DA 3S9AA 1ELAA 1AWFH 4FUHA 2J34A 4Q7ZA 5DPAA 4D76A 1UMAH 2ZDMA 3LJJA 1XUHA 4ZROA 1W7XH 2H5CA 1C4U2 3OY6U 1DVAH 2ZTYA 4Y0YE 2ZIQH 1IQIA 2BLOA 3A7WA 2HALA 2H9EH 4J2YB 1V2OT 2VVUA 1SGEE 3KQBA 1LVOA 1HIAA 1A0LA 3RMMH 1O2QA 1TBQH 1TFXA 3UTUH 1PFXC 3PYHA 1LPKB 1C2IA 1P04A 3ESTA 1GHBG 4JZFH 3A7TA 3G01A 3T29A 3U8TH 1MKXK 1O2VA 3OU0A 5EXNA 3P92A 1QB6A 1Q2WA 3BEIB 1BB0B 1NY22 1EJMA 3N7EA 2AYWA 1KLTA 5ESTE 2P94A 1ZSJA 4NFEA 1O3MA 1W0ZU 3M5OA 1PQAA 4AYYB 1ANBA 2ZGJA 1K1PA 1GHAG 3F2FA 3TNSA 1ELDE 4NGAH 2OC0A 1Y3UA 4E7NA 1WUNH 2VGCB 2G5VA 2XW9A 1C1RA 1O3FA 5GCHG 1J15A 1RJXB 2GJGA 2A4QA 1JBUH 1D9IA 1UTKA 1GJ7B 4DGJA 3P8FA 3T25A 1SQTA 1C2JA 3ZIAD 4NIYA 1O2GH 4CHAC 1ELVA 1GVLA 2ZC9H 1KXDA 1VKYA 2ZP0H 1IQHA 1Z71A 3A86A 1UJ1A 3DCLA 1ZMNA 3O8DA 5E0GA 2A5AA 4AFSA 2IJD1 1BA8B 2WV4A 1ESAA 1GL1A 5SGAE 1ZPZA 4X8SH 2BY5X 3CNRA 4NSVA 2BDHA 2QY0B 1HAGE 4O3UA 3KYGA 2XBYA 1C2LA 1AWHB 1NFUA 3GS9A 1EPTC 2XNIA 3PMHB 2TGTA 4O3TA 4YTAA 2QF5A 1P9SA 3ZZ4A 1FONA 1MBMA 1CA8B 1SL3A 2G4UA 2H2ZA 3ZZ5A 1W7GH 3D49H 2VIVA 1XKAC 1V2NT 3PV4A 1AZZA 1BMMH 5DGJA 1MUEB 2VJ1A 3MH4A 5AF9H 1O39A 1MU8B 1BMLA 7ESTE 1E34B 3KL6A 1X7AC 1XUKA 4FUFA 1ZGIA 1AN1E 4Q2KA 4GUXA 4GPGA 2NU3E 1GBIA 3TH3H 5CE1A 2ODPA 2A2XH 4WH8A 3SJKA 1WXRA 2W7UA 2J4IA 1J16A 1ZRBA 5EG4A 4DW2U 3TGJE 3DFLA 5FCRA 2YMSB 2QCYA 1OKXA 1AB9B 3LONA 2EI6A 3LC5A 3NPSA 5L6NH 1DLKB 2KM0A 3F6UH 4NA8A 1TOCB 1FY1A 1KDQB 3LDXH 4B74A 1GVKB 2RG3A 2Y81A 2UUJB 2SNWA 2JETB 3OYPA 1EKBB 3WW7A 2QGRA 4B2AA 4BOHA 3GY6A 1HYLA 4A1VA 4DT4A 4OS6A 2ZHFH 3KIDU 2BTCE 3M5MA 1Y5UT 2P3UB 3GY8A 4ZCNA 1UVPA 2FOGA 3MFJA 2WSSD 2F9UA 2THFB 1XUIA 1C5UA 1GHXH 2WV9A 2EA3A 2V7QD 1WU1A 2IJOB 1F0SA 4ABFA 1A61H 3BTEE 5K7RA 1VJ9U 1QRXA 1IQNA 1IQFA 2ZFTA 3ENSB 1DICA 2GD4B 2FMJA 3AW1A 1GI8B 1BTHH 1QZ8A 2FOAA 2J5UA 1NESE 1GCDA 4Y8ZA 1LPGB 4R8TB 3TU7H 1O2XA 4NIWA 1P2NA 3EDXB 1J9CH 1UTPA 2YNBA 1DWBH 1BZXE 1TRMA 5E2PA 2XNDD 5EXLA 1C9TA 4JK5A 4NIXA 3GCTF 1LHDH 3OY5U 3TK9A 2GVFA 2VH0A 1C1PA 1ORFA 5C3NA 3M36A 3U98H 4MQAA 3H7TA 2JH0D 1NU7B 1OYQA 6CHAC 2VH6A 2EI8A 1V2WT 2PLXA 2A5IA 3S9CA 1TMTH 1HGTH 5HYOA 2ZFQH 2GDDA 1IAUA 3RXTA 1HDTH 1TGBA 1BRUP 2FOBA 3A7VA 5FPSA 2Y5FA 2QV1A 1DY8A 2BDYA 1OX1A 2K1QA 3OE7D 4ISIH 4WMEA 4F48B 3A7ZA 2CV3A 1QY6A 3SV8A 2KAIB 2PGQB 5C17A 2ZDAH 4YOJA 3A8CA 1Q31A 3QDZB 5DP6A 3NWUA 1MABB 1L4DA 2BOHB 1ETTH 1A3BH 1Z7KA 2G4TA 3ODDA 1H1BA 4NZLA 4ZKOU 2KZ4A 2ANKH 2O8TA 2Y7XA 1EZXC 1GJ6A 2G8TA 2FTMA 2TPIZ 1LPZB 1MD8A 4CRCA 2FYRA 1W0YH 1ZRKA 3M3SA 2XCFA 3UAIC 1S83A 1FN8A 4WJG2 4OS4A 1GJ8B 3MH7A 3SU0A 2ZU1A 1CU1A 1GBTA 1SLUB 2BD2A 5A8XA 2G00A 2ZDKA 1WV7H 1EAUA 1OS8A 2FXRA 3SV9A 2FOEA 1COWD 4BAMB 2VINA 4LK4A 5E0HA 2W6ID 2R3UA 5L30H 2QF4A 3BG4C 1Y3VA 1C2KA 3BN9A 2Z9JA 3QGNB 1MKWK 2BLQA 1PPEE 5JB9S 1D6RA 5CHAC 1JOUB 3QLPH 4JZIA 1C5QA 3TLOA 3R3GB 2HOBA 1DSUA 1HAIH 2ESTE 2YMSD 1D3QB 3GCHC 4RKOB 4XOJA 4BXWA 1BIOA 1EXFA 4MNYA 2P3FH 1NROH 1P2QA 4IGDA 2XBVA 3VB7A 1QFKH 4XFQA 1SGIB 3BTHE 1HNEE 1KDQA 1C4V2 3U28C 3VG8A 2ZU2A 1O33A 1XXFA 2ZU3A 2R2WU 4JYVH 1SQAA 4I7YH 2GCHG 2PSYA 3FP7E 1YLCA 4MPUA 3KNXA 1TQ7B 2RCEA 4F49A 5FAHA 1ACBE 3L6PA 2AIQA 3SI4H 1FI8A 2TGDA 1C5PA 2LNCA 5T1VA 3A87A 4KP0A 3GYMA 2R3YA 2AGGX 4AFUA 9ESTA 1O36A 2G52A 2BQWB 4FUCA 1SR5C 1GHWH 4TY6A 1TMBH 3RXOA 1TRYA 2VU8E 5JB8S 2A1DB 1O2SA 3F3BA 3B8JA 3EA9A 1MAXA 3E3TA 3RXPA 2ZEBA 5FL7D 4NCYA 3RUOA 4X1NU 1BRCE 3F0PA 1EOLA 5EIYA 5AVDA 1UTQA 3KQ5A 2PW8H 2ZPRA 3GCNA
chains in the Genus database with same CATH topology
1GBBA 1O2JA 1T7CA 4YLUA 2AMPA 1ZGVA 1G9IE 1CT4E 3VGCC 4AB9A 1AHTH 1KXAA 4XSKU 1A7SA 2B9LA 3E0NB 1RXPA 1YPMH 1KXBA 2XC5A 4IC5A 1CA0C 4JZ1A 1DT2A 3ZVGA 5A0BA 1GHVH 1GBJA 1O3PB 4DJZB 1UK4A 1ETSH 4CRAA 3C27B 4MPVA 1GMCF 1C5NH 1WOFA 1HAZB 1UTNA 3IG6B 1MH0A 3TNTA 2DE8A 4I8GA 1XVOA 3TITA 5A8ZA 3UUZA 1QIXB 2KAIA 3MNXA 5TCAA 3SU1A 1O3IA 1O3OA 3Q3XA 1O5BB 2ASUB 2W7SA 1K1MA 1F5KU 3U9AH 1DX5M 1P2IA 3U69H 1Z8JB 1G2LA 2P8OC 1F0UA 1LHFH 1N1LA 4OS1A 1SBWA 1RTFB 4Y11E 3T28A 1P02A 1ESBA 1NO9H 1TBZH 1P8VC 1L2EA 1W11U 2F9BH 1CT0E 3UQVA 2Y5HA 3BTTE 1GBKA 1SFQB 4X2XA 3P8GA 1QB1A 1O5GH 2SNVA 4F4OC 1JXPA 1FMGA 2GTBA 1A0JA 1XVMA 1V6DA 3F9HA 4MG3A 5ABWA 2GCTB 1JIMA 3ZZ9A 1MKXH 3RXRA 1MTSA 3SUFA 1O34A 1VCWA 2F83A 2VWNA 1ETRH 5LPRA 2V35A 2GP9B 3BTFE 4FUDA 2ZGHA 2BD3A 3A8AA 1W8BH 1K1LA 3LH3A 1Y5AT 1GBLA 3P8OA 3BF6H 1GI5A 4HGCA 5GPIB 3SORA 1WQVH 1DM4B 3SUGA 5C20A 1TNIA 4BNRA 1V2ST 3U1JB 3ZYDA 3TH4H 2CGAA 3ZVBA 2R9PA 1AY6H 1BTWA 1ZJDA 5EPNA 2ZHEH 3I77A 3UOPA 1LKBA 1O5DH 4CREA 3SNEA 1KY9A 4Y8XA 1WTHD 3NZIA 2FWWA 3TJUA 3SN8A 1F5RA 1O3AA 4UDWH 2BY8X 4NA9H 3F9EA 3PO1C 1F0RA 2SGPE 2OLGA 4K60A 1C2HA 1HAPH 2PKSB 1K9OE 5A8YA 2WPLS 4CR9A 1ZLRA 2VIOA 1WSSH 2XC0A 2ZHDA 2FESH 1P12E 3U8RH 3V3MA 1VGCC 4Q80A 4HI3A 4WXIA 2QAAA 4IBLH 1GBHA 2BXUH 4FU9A 5HM9A 3HGNA 1BTUA 1ZR0A 1KLIH 2Z9LA 3FFGA 1HJAB 1Y3XA 2STBE 4ASHA 4GAWA 1S84A 1ANCA 4WF8A 2FZZA 7KMEH 5FX6A 1HBTH 5FPYA 4B2CA 3E90B 3S7KB 1F2SE 3MH6A 1GHBF 4HTCH 1FXYA 2BQ7B 4WWYA 1TPOA 4YO9A 2BVRH 1QURH 4ZH8A 1GI3A 2CHAB 2JKHA 1O2PA 1TRNA 4X1SU 1S85A 1AUJA 3H7OA 1ZTKA 2F9PA 1AGJA 1KXFA 3SU3A 2Y80A 3F9GA 3MO9A 1MTVA 5I25A 4ABGA 2Y82A 2BLWA 5I46H 3ATKA 1W14U 2Z3DA 3FAOA 3TJOA 1SVPA 5EODA 3KN2A 3ZVCA 2J2UA 4I32A 2Y6TA 1BTYA 3SNCA 3EE0B 1W2KH 5C5OA 4VGCB 1MZAA 2VWLA 2D1JA 2XBXA 5GCHF 3MO3A 1GI2A 2FYQA 1PPGE 3A80A 1AFQC 1HXFH 4GVUA 5JBTA 3A7XA 4ABAA 2BDIA 3LKWA 2VIQA 2BZAA 2WPIS 1PPBH 1ZTLA 3KQEA 1GI0A 4NWLA 5AHGH 1QL9A 1MTNC 3M3VA 1O37A 3RXGA 5A2MH 1EZUC 1O30A 5EQSA 3RU4E 4B73A 1DY9A 1LKAA 1SB1H 4INHA 2VWOA 4AYVB 1S81A 1SGRE 3KGPA 1BRBE 3SI3H 2QXGA 1A3EH 4ZHMU 1SC8U 3BG8A 3K2UA 4BTTB 5C1XA 1TYNA 2Z3EA 1P10A 1F7ZA 4Z0KA 2TRMA 5LPEA 3RXVA 1P01A 1TPSA 4ZHLU 1IHSH 5GXPA 4AN7A 2LPRA 5EQQA 5GJ4B 3GY3A 1YM0A 3K6ZA 1O3CA 1SMFE 3SJIA 4CH2B 4Y8YA 3TK5A 4IW4E 4BAOB 1PYTC 3BTQE 3RMLH 5F8ZA 1CGJE 3TGIE 1DSTA 2NU1E 1W3CA 1GPZA 1JIRA 3KQDA 1TOMH 3QUMP 2PWXA 1GCTB 1SI5H 1AKSB 2FI3E 1OWDA 1GBAA 3ATLA 2ZFRH 4X0WU 1DFPA 4KKDA 1LVMA 4LXBH 4YOIA 1DLEA 2ANYA 1NFWA 1FDPA 4Z6AH 2PKAB 5FBEA 4FXGH 4NZQA 1ZPCA 2XYAA 1TA6A 4U2WA 4ABBA 8GCHG 2SGFE 1OWIA 2C8WB 4ISLA 3RLWH 3SU4A 1D6WA 1SOZA 1GL0E 3GISB 4JZEH 1GBCA 4AORA 3ITIA 3UNRA 3O8RA 1IQLA 3GOVB 3ZZDA 1SLXB 4X2YA 5T6DA 1N8OC 4D7GA 1AVWA 1BTXA 3EQ0H 4Y71A 4NWKA 4X2WA 3KQCA 1GI7B 2QF3A 1QJ7B 1MBQA 1PQ5A 3M5LA 1AI8H 4ZUHA 2C8XB 1GDNA 4D7FA 7GCHF 1MKWH 1GJ4H 3QZQA 2GZ7A 1AE5A 9LPRA 2ZDNA 3A8DA 4MNWA 3RXFA 3U8OH 2ZCKP 1KXCA 3D65E 4I8LA 3SU2A 2ZO3H 1MD7A 4A7IB 3AAUA 2FI4E 3RXHA 4E06H 4ISOA 1UVOA 3DFJA 1GGDB 3SV6A 1LHGH 4YM9A 1Y5BT 1BJUA 4LZ1H 3MTYA 1P05A 2Z3CA 2QA9E 5G4BA 1MTUA 3FP6E 1AZ8A 2C3SA 2FO9A 3SQEE 2BZ6H 1PJPA 3BEUA 2OQ5A 2WYGA 1RIWB 1WAYB 2WPKS 1H9IE 1LMWB 2HLCA 8KME2 4IMQA 1T4VH 2O8UA 3SW2B 3TK6A 4FVBA 4Y76A 5EQRA 5ESBA 4ZKNU 2W5EA 1AE8H 2BX4A 1NRSH 4GCHF 3RU4T 3UWIA 2F9NA 1SGFA 3HGPA 3KHVA 1QNJA 3SOSA 3E8LA 3GCOA 1EATA 1H8DH 3R0FA 1F0TA 4CH8B 2FOHA 2FDAA 1NZQH 4O97A 1YBWA 1LO6A 2ILNA 1LHEH 1DUAA 3SU6A 4MDSA 3VB5A 7GCHG 1T8OA 1EJNA 1QBNA 1SHHB 3MWIU 1YPGH 1TQ0B 2BD9A 1UTMA 1EASA 3SJ8A 1O3KA 1MQ6A 1V2LT 5C1UA 3A8BA 3STJA 1KYNA 2JH6D 1PPZA 3I78A 1C1QA 1UVTH 1AKSA 3VB6A 2BY6X 3SHAH 3MU8A 1L1JA 2B0FA 2ZG0H 4GLYA 1UVUH 2OUAA 3UOUA 1QJ6B 2GV7A 5L2ZH 1G30B 3N7OA 1QL7A 1A2CH 4XBBA 1OYTH 3PLPA 3M7QA 3V13A 1TX7A 2OINA 2PKAA 4INLA 1GG6C 3VB3A 2VVCA 4GCHG 2HGTH 2OC8A 1TGNA 2A4RA 8LPRA 3LC3A 2AERH 4FUEA 2Z9IA 1LCYA 1SGPE 1TGSZ 2HRVA 3IWMA 3SGQE 1BQYA 4A5TS 2NWNA 1TNLA 1S5SA 4TPIZ 1TPPA 3PLBA 3OSYA 2BDBA 3ELAH 1P2KA 2ZQ1A 4A1TA 5HXFA 4ISNA 4AG1A 3T2NA 2GCHF 5EOKA 1O2RA 2AGIX 3BTME 1YYY1 4YESB 2XBWA 3RMOH 3SZNA 3VXFH 4D9QA 1NRPH 3T5FH 2G81E 3P17H 2OP9A 3URCA 5FPTA 1N6YA 3JZ2B 1QB9A 1TLDA 5DP4A 3A84A 3KEEA 1C5RA 4FUIA 4H6SB 2DUCA 4WMFA 5DP8A 2Q1JA 2Q6FA 3A7YA 2AS9A 2ZFSA 3RC4A 1SGQE 1BCUH 2R0KA 2SGEE 3ZV9A 5E8EH 1FAKH 5C5NA 2PTNA 1C2GA 3RXDA 3GY5A 1UO6A 2F3CE 1MMJN 3D62A 2ULLA 1L0ZA 4SGBE 2C90B 1SLWB 2J92A 1BMNH 1E36B 1C1WH 3BTKE 3EA8A 2PTCE 3MYWA 4H42U 4J1YA 4BTUB 1QBVH 1LTOA 1QTFA 3BSQA 1UTJA 3SO3A 4MTBA 3E6PH 2RA0A 1C5MD 1O2ZA 4NFFA 4B1TA 1AQ7A 1AVXA 4OS2A 4ABIA 1YKTA 3P95A 1C2DA 1P2MA 1LVBA 1O2LA 3VPKA 2GKVE 1Z6EA 2FLBH 2AEIH 3M3TA 3SGAE 5CMXH 1FY3A 1OP0A 3RXQA 1OXGA 1CBWC 4IN2A 1K22H 1C1TA 3HK3B 4X6PA 4K8YA 3EGKH 3UNSA 2BM2A 2GMTC 4DG4A 3PROA 1Y3YA 3A82A 1UCYK 2PSXA 2XXLA 1YCPM 2Z6BD 4FU8A 2GZ8A 2Z9GA 4CHAB 5B6OA 1RTKA 3A83A 1YGCH 2XRCA 1TMUH 4ABJA 4HFPB 3PTNA 1TONA 3RDZA 3SV7A 5HMAA 4ZXYH 3M7UA 2ANWA 1EOJA 1A5IA 3BTDE 1EPTB 1CVWH 1ELTA 5L2YH 2H1UA 2BDCA 1CO7E 1ZSKA 2BDAA 5PTPA 2A45B 2G51A 5DP9A 1P3EA 1T8MA 1CGHA 1DPOA 2WPHS 3BEFB 4IN1A 1G3DA 2YNAA 1BOQA 2ZHWH 1HAYB 3RXJA 1MTWA 1QR3E 2AFQB 5K0HA 5JDUB 3HPTB 3MOCA 3PMBB 4UEHH 3SNAA 4AFZA 2WPJS 1UHBB 1EB2A 2SGQE 2WINI 5J4QA 2O8WA 1C1VH 1EAWA 1NN6A 3SHCH 3ZVDA 4SGAE 4CBOA 1UTLM 2OQUA 2VGCC 2H9HA 4CBNA 3UQOA 1TALA 3FZDA 3Q00A 3SGBE 1BMAA 2BD7A 3S0NA 1FPCH 2O8LA 3CP7A 4ZKSU 4OS7A 1RFNA 2ZU4A 2ZKSA 2QC2A 2A7JA 4OS5A 1O3NA 3QX5H 1BUIA 3A88A 1YP9A 4I8JA 2EC9H 2ODQA 3PMJA 4U30A 4WY3A 3ZZBA 2R2MB 1YPEH 1DWDH 1F5LA 5IDKA 1NRNH 4AGJA 2D26C 1SGTA 1C1NA 2PHBA 1AIXH 1GJDB 2BVSH 4YZUA 3ZVFA 1QRZA 2Z7FE 2BX3A 2FPZA 1HJ8A 4R0IA 1L1NA 1O38A 5TCCA 2OC7A 2SGAA 5C1YA 1ANDA 1P3CA 1HJ9A 4PROA 1N6XA 4FU7A 2BD8A 4DVAU 2ZZUH 2Y5GA 4DT7B 1MCVA 1NC6A 2GZ9A 2GX4A 1B5GH 3TJNA 3L33A 2C8YB 3C1KA 1YPJH 1OWJA 1JMOH 3I29A 2XCNA 3PLKA 1DWCH 4OGYA 2Q6GA 2FM2A 2QF0A 1PPHE 3FZZA 1HCGA 1OWHA 1KTSB 3HK6B 5AFZH 1G3BA 3RXSA 4X8TH 3T26A 4CR5A 4O03A 3ZZCA 1D4PB 3E1XB 1S0QA 1WQSA 3BIVH 1XM1A 1WBGB 4U32A 3K6YA 6CHAB 3UR9A 2WV5A 4K8BA 4B76A 1ELCA 3LGTA 1EJAA 5F6MA 5JBAS 1FZZA 2FS9A 3W95A 2A5KA 4WXVA 1S6FA 4BAHB 3TGKE 3SJ9A 3LU9B 2GDEH 1HV7A 1NS3A 1ZMLA 2ZQ2A 3TPIZ 2GT8A 1RS0A 1EQ9A 1AB9C 2A2QH 3M5NA 5GIBA 3UPEA 1C5YB 1A46H 4NSYA 1SGYE 1G37A 3NXPA 3TJVA 2XC4A 2WPMS 2AIPA 3F9FA 4DY7B 2BDGA 1IHTH 2JETC 2ZPSA 5FBIA 2VB0A 2CXVA 1EZQA 2AH4X 2BXTH 1EPTA 1O31A 2DE9A 3VXEH 5J4SA 1E0FD 1QRWA 2UUKB 3A85A 5BRRE 1D3TB 1FY8E 1S0RA 1YPLH 5LPFA 1P11E 1SLVB 1WCZA 4WH6A 2V3OH 4TYDA 8ESTE 3S9BA 2A4OA 4YOGA 1TPAE 1VITF 3MO6A 4K1SA 2A7HA 4AB8A 4D9RA 1BHXF 1QQ4A 4X6NA 1VITH 2IOTA 1TX8A 1ELFA 3M61U 1O2NA 2CJIA 1M9UA 1YC0A 4BANB 1FPHH 1UHBA 3BG4B 1O32A 4HZHA 1QA0A 1BITA 3LGVA 5CHAB 1OOKB 3GDSA 1Z8RA 3FANA 1G3EA 4YT7H 5JPMH 2XWAA 2OBQA 4IS5A 3GCHB 1QCPA 3T27A 6GCHG 1E35B 1ZOMA 2A7CA 4A6LA 5C67A 3ODFA 1ZHRA 1QBOA 2BMGB 1IQGA 3RM2H 1FIZA 1C2FA 1FQ3A 3AASA 5FX5A 1U6QA 3BTGE 5A0AE 2UUFB 1TAWA 3AW0A 5LH8A 3F68H 2ZCLP 3SNDA 5EU8A 1TNKA 2HPPH 5DK1A 3URDA 1OP2A 1TNGA 2B5TB 2V3HH 4B2BA 5C2ZA 4E7RG 2FODA 4X2VA 3LGUA 4ESTE 1DXPA 4IC6A 1XUFA 1GJCB 1XMNB 3DUXH 5F8TA 8GCHF 1VITG 1NT1A 4MNXA 2ODYB 1NRQH 1QA7A 2PGBB 2V6NA 4Y7BA 1BBRK 3MNSA 2A32A 1O5FH 5A09A 3Q3YA 1HAVB 1ZJKA 1NM6A 4K1TA 1F92A 1P0SH 2HNTC 2FOCA 2BY9X 3HKJB 1NPMA 1TA2A 5F03A 1EP5A 1EAIA 1O2YA 3VGCB 4LZ4B 2BB4A 1ANEA 4INKA 1ARBA 3D23A 1T32A 4OGXA 2CN0H 4NG9H 5T3HA 4Y79A 1NTPA 1IQKA 5TJXA 1CA0B 2Y7ZA 1DXWA 2P59A 3FVFB 4AG2A 2QXHA 1ZMJA 1FIWA 1FNIA 3O8BA 4UFEH 3SUDA 1S6HA 1GJ5H 1LVYA 2P3TB 1DE7H 3AVZA 2R0LA 4D8NA 3RXKA 1TABE 1ZHMA 1RTLA 1YCPH 1J8AA 1UVSH 1K1IA 1V2PT 3CS7A 5JBCS 5H4IB 2B7DH 1GMDF 3KCGH 1RRKA 2FP7B 1GI6A 2NU2E 1GJBB 3LGWA 4JK6A 2ZU5A 1TWXB 1O2WA 2FX4A 5T6FA 3F1SB 2P8OB 2VNTA 2F9VA 1ZTJA 3LH1A 1DUEA 6LPRA 1KTTB 3PWCA 5EW2H 3GYLB 3TIUA 3ZVEA 5ETXA 2QN5T 3DHKH 4AZ2B 4UD9H 3RC5A 4ABEA 3UIRA 1T8LA 5DKMA 1O3BA 1SGCA