1FN6A

Crystal structure of porcine beta trypsin with 0.1% polydocanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A02
1QJ1B 3ZZ9A 1VJAU 3SJKA 4O9VA 4MG3A 1HUTH 1MKWH 2WV5A 1O2IA 1RIWB 3FP6E 1VITG 4F49A 3E3TA 3KQEA 4TPYA 2C3SA 1NRRH 4GHTA 2BY5X 5A8YA 3A7XA 3SJ8A 5DP9A 1WSSH 1F0RA 4J1YA 1Z8JB 5GJ4B 3EQ0H 1GDNA 5GCHF 3A87A 4ZHMU 3VB7A 1CHOG 1GMDF 3H7TA 4J2YB 2GTBA 4MNXA 2PFEA 4HFPB 4I31A 4FUDA 2Z94A 1ELGA 1ZHPA 2OD3B 1NU9A 1N6YA 1C1QA 3ZYEA 1S5SA 1EZXC 3QZRA 1T7CA 2BDIA 1JRTA 2WPKS 3ATIA 5FAHA 1O2LA 4XOJA 1TMTH 1JBUH 1TNIA 5FCKA 4BOHA 3SUDA 2PWXA 1C5QA 3NCLA 1SGTA 2G5NA 1C5LH 3M7QA 1SI5H 3U8RH 4O97A 1UJ1A 4LZ1H 2ZDVH 4Q2KA 3LDXH 3SV6A 4E05H 1NRQH 2YOLA 3H7OA 1KTSB 4X6NA 3UUZA 2H1UA 1AFEH 1IQNA 1DPOA 4Y6DA 3K65B 2BD7A 2FXRA 1YC0A 3AW0A 1GBHA 2BX4A 1WAYB 2ZHDA 3GCOA 1H9LB 2RDLA 1FXYA 1IHSH 3LONA 4H6TA 1PPBH 4AG1A 1Y8TA 1ABIH 1TBZH 3M5LA 5EG4A 1HAYB 4UFDH 1C5YB 3D65E 1QGFA 1GJ6A 1O3JA 4TY7A 2QXIA 1VGCB 2WYJA 1GBCA 2ZPQA 5I25A 1O2RA 2FI3E 1NU7B 1C2EA 1NN6A 5JPMH 1DOJA 1HJ8A 4ISLA 2A5AA 1XVOA 1C2JA 3RXEA 1F5RA 1UTPA 1IHTH 1C5NH 1LPKB 3TJVA 2GV6A 1ELTA 1TRMA 2PTCE 2R3UA 4AFQA 1DVAH 1MTWA 4H4FA 1H9IE 5A0AE 4K2YA 1IQHA 1LKBA 1A7SA 1DANH 4UEHH 4DW2U 1P0SH 3F9EA 2J92A 3F9FA 1TNHA 1HB0B 8GCHG 2SGEE 4I8KA 1U6QA 1GBIA 2BXUH 3AAUA 3TJUA 2G81E 4OS7A 2FOAA 5E8EH 3PLPA 3BTKE 2ASUB 1W8BH 1W0ZU 1OWDA 2HNTC 2B5TB 1HXEH 1NZQH 2BMGB 2BDYA 1EB2A 1GBAA 2I6SA 2XC5A 2ZP0H 2ANKH 1JOUB 2LPRA 3MI4A 5GDSH 4I8JA 3OY5U 9ESTA 5C2ZA 1Y5BT 2XWBI 5T6GA 1CGIE 2BD5A 2ODYB 3A89A 4JZIA 1GJ4H 2BVRH 1GMDG 1ANDA 3P8NA 3LGIA 1O34A 3MNXA 4R8TB 2FODA 4HI3A 2BY6X 1D3QB 4GCHG 1GI7B 3ELAH 3P8FA 4JZDH 4H42U 4E7RG 3SUGA 5A8XA 1YPLH 4UFGH 3GYLB 3BTQE 4AZ2B 3PLKA 2Q6FA 3FZDA 1C2HA 3EA9A 1ESTA 4Y79A 2ZC9H 1O2WA 4AORA 3SOSA 1FAXA 1FLEE 2IJOB 2BX3A 1O5EH 4ZH8A 3IITA 5EQQA 2Z3CA 1J16A 3KIDU 3BEUA 3V7TA 3PMBB 1C4U2 2NU0E 1MTUA 4INKA 1UTMA 1SGDE 1NTPA 4NGAH 3S9AA 1RTFB 1HYLA 1EPTA 1SBWA 4X0WU 3LOXA 1T8OA 3ODDA 3BTHE 2VIPA 4OS1A 3QTOH 2Z3DA 1IQKA 4I8GA 2VIOA 2Y7ZA 1O3BA 4JCNA 4JYTA 5FBEA 2ALPA 1CBWB 1TPPA 1Y3XA 2ZA5A 1PPFE 1G2LA 1PPEE 3ZZAA 3UFAA 3E16B 4ISOA 5ABWA 2GMTB 7GCHF 2BLVA 2A4QA 2BD8A 2PSYA 3NWUA 1TPSA 1GJ7B 2SNWA 4X2VA 1O35A 3O8RA 1WV7H 1MKWK 1TPAE 1Y3YA 3UY9A 1C5XB 5CMXH 1FUJA 1G9IE 3SNBA 1C1VH 2Z7FE 1GCDA 2A45B 1L1GA 3E1XB 1E37B 1UK4A 1BA8B 1AHTH 3Q3YA 1AQ7A 1OWEA 3TLOA 2FESH 1PQ7A 2PR3A 4NWKA 3KQDA 1P2KA 1YYY1 3RC5A 2ZIQH 1NM6A 1YM0A 3LPRA 3E0PB 1SPJA 1Z7KA 3ZVGA 5G4BA 1GGDC 1BBRK 2FOGA 1DLKB 4NA7A 5ESTE 3ZV8A 1IQIA 2VVUA 2UWOA 5BRRE 1XMNB 1C1SA 2BQ6B 1LVOA 3QK1A 3EA8A 2BQWB 3SJ9A 1HPGA 1BUIA 4NIVA 6CHAC 1VCWA 1K2I1 2PKSB 5FPSA 2FS8A 1V2RT 1GCTC 3RC4A 2A0QB 3S9CA 1O3IA 2GX4A 3GYMA 2RG3A 1BQYA 3SU0A 2A2XH 3RXJA 2ODPA 4WJG2 1QHRB 1Q2WA 4NG9H 2FI4E 5FXLA 3SGAE 5JBTA 1SLVB 2ZDNA 4AYYB 1ZTLA 2HWLB 3KCGH 1SC8U 1V3XA 4Y76A 4JZEH 4NCYA 1FJSA 1PPCE 2VVCA 3SU2A 3BTFE 3M5NA 1ANCA 1TNKA 1YPMH 3ZVDA 3A82A 4TWWA 1O2UA 1H1BA 4CBOA 1EX3A 2B7DH 3ZVEA 2F9VA 1GHBF 2AS9A 1C5SA 2WPJS 1GI2A 1UCYH 2F91A 3ZZ7A 5J4QA 2W26A 5T6FA 4Y11E 3UPEA 3T62A 3DUXH 2VH0A 1O2PA 2C8XB 3CP7A 3FFGA 1HJ9A 1G30B 2J38A 1C2GA 1L4ZA 4MNWA 1C2IA 5LPRA 1AI8H 1WUNH 1GJAB 2P94A 3KN2A 1Y3UA 1IQGA 3MWIU 1XM1A 1LKAA 1P2IA 1O3KA 3GDSA 3MHWU 4KTCA 5PTPA 3LH3A 4AN7A 1CE5A 4KTUA 1GMCF 1ZSKA 2GVFA 1K1NA 1W14U 1O2XA 1KXFA 4NSVA 4B1TA 1EAWA 4XBBA 3PROA 1SMFE 1DWBH 3A83A 1P9SA 1EAIA 2FI5E 4FUHA 2AMPA 1LPGB 1NS3A 1FMGA 1GVKB 2HVXA 1S6HA 3V3MA 2BQ7B 1O2TA 3T2NA 2P3FH 1ZRKA 4DGJA 2DE9A 4K60A 1AZZA 1L1JA 1W0YH 1ZOMA 2P3UB 2ZFSA 4YO9A 3ZZ6A 3RXHA 2BDAA 2SGAA 3QDZB 1BTPA 1XUIA 1UTKA 1D3TB 3VXFH 5K0HA 3MOCA 4K5ZA 1ZGIA 4TY6A 2CN0H 2BLQA 2ZI2H 1OP8A 1P12E 1GHWH 1F92A 3ZZ8A 5L6NH 2ZNKH 2VIDA 3S9BA 2FX6A 4TYDA 1ELEE 3E91A 3QO6A 2YNAA 1GBFA 1MKXK 3VB4A 4JMYA 3MNSA 1P3CA 1JIRA 1GVLA 2M5TA 3KHVA 3ZVAA 2Y5HA 1PYTC 4INLA 5TJXA 1LVYA 3ATWA 1F5LA 1OX1A 1BTZA 1C5ZB 2XNIA 2OC7A 2A2QH 3KGPA 4BXWA 1YPHC 2HGTH 2ZDAH 3RXIA 2GDEH 1QB6A 1AB9C 1GDUA 3N7OA 1S6FA 1OYTH 3C27B 2PKAB 1GHVH 3Q00A 2JETC 4IGDA 2FYQA 3RUOA 1INCA 1MBMA 1QY6A 2ZQ2A 3T29A 4K69A 2Y82A 2HPQH 1IQMA 3GY4A 3LC3A 4SGBE 4YT7H 1ELAA 2TIOA 1TGTA 1OSSA 3HGPA 4ZKOU 1P8VC 5CHAC 1QJ7B 1LMWB 1AKSB 4OGXA 1DSTA 1MCVA 2G4UA 2G5VA 1SHYA 4BAQB 3TJNA 1YPEH 3UTUH 3FVFB 3KNXA 1GI3A 3OU0A 1CT0E 2BDBA 4YESB 3TPIZ 1RFNA 2A7HA 1NPMA 1Z1JA 1N1LA 4ZKNU 1X7AC 2EI6A 7GCHG 1MAYA 1S84A 5A2MH 1VZQH 1GMCG 3QTVH 1O5DH 2CF9H 1SQOA 2Z9LA 1C4V2 3LGYA 1AIXH 1DDJA 1EPTC 3VB5A 2CGAA 1L2EA 1DFPA 1GJDB 2GT7A 2PUQH 3DFJA 2PKSC 5DP5A 1SB1H 1NRNH 1S0QA 3ZVCA 3LJOA 1T4UH 4E06H 1NT1A 2EI7A 3K6ZA 1EAXA 2SGQE 2BD9A 3SU6A 1NROH 2BHGA 2ZFRH 3EAJA 1Q3XA 1G3EA 1ELBA 3TGKE 4ZMAH 1V2KT 5SGAE 2NWNA 5AF9H 3LGTA 4FUJA 1C5TA 2ZU2A 1H9HE 1QL9A 3D23A 3A7YA 1AUTC 1D3PB 2ANYA 1SGQE 1Y5AT 1KDQB 2ZEBA 3VFEA 2FP7B 3U9AH 2FO9A 1A1RA 1P2QA 1P03A 2FOMB 1GMHF 3OTJE 3BG8A 2XBWA 1DT2A 2ZDKA 2G8TA 3GICB 2C90B 2D1JA 3S7KB 4KELA 1XUKA 3A7WA 3FANA 1Z6EA 1EKBB 1F7ZA 5GWZA 3GCHC 3SUFA 4JZFH 3WY8A 1SGFA 2BLOA 1EJAA 1F0SA 1UVSH 1VITH 5FPYA 2VB0A 3ZZCA 1EB1H 1YPJH 2ZFTA 1DICA 4FXGH 2PKAA 4YM9A 1GI0A 1G2MA 1BMMH 4A7IB 1FDPA 1ZPCA 2TGPZ 3DA9B 2FTLE 3ZVBA 3NZIA 3EDXB 1YPHE 2G51A 1AN1E 1MCTA 2ZECA 2A4GA 3M35A 5JDUB 4M7GA 1LVBA 1EXFA 1AVWA 2QF3A 3JZ2B 3SJIA 2Y7XA 2GCHG 5EXMA 5E2OA 2HALA 4AFUA 3GCNA 1KXBA 1MTSA 3E6PH 5DP6A 3PV4A 4CH8B 2EC9H 5B6OA 4I8HA 1HLTH 3GY7A 2W7UA 2VH6A 2VWOA 4FUCA 3H5CB 2HPPH 2P93A 1KLIH 1OKXA 4Z6AH 1O3LA 2QY0B 2VJ1A 4A92A 1V2QT 1IQFA 3TIUA 1ETTH 3DHKH 1V2ST 3ESTA 5FCRA 3RXSA 3ZV9A 3P17H 2ZGBH 1JXPA 3RXDA 4CRDA 4NFFA 1XXFA 1UMAH 2NU4E 1VR1H 2H9EH 4NA9H 3UOPA 4DY7B 1FZZA 2R9PA 2TGDA 1QBVH 3A8CA 1OS8A 2V3HH 1THRH 3GY6A 3LGUA 2P8OB 1MAXA 3ZVFA 3CENA 4MNYA 1QB9A 1TRYA 2XTTB 4QT8C 3UIRA 3V12A 1HAOH 3LC5A 3SO3A 4OS5A 4LOYH 2ZHFH 1LQEA 1A5IA 1V2JT 1EJMA 2JH0D 4UFEH 1S82A 2ZU5A 4ZHAA 4CRGA 3ZZBA 1RJXB 2ZU3A 3LKWA 3W95A 1C5PA 3TK9A 4A1TA 3P8GA 4B75A 1T4VH 1O39A 1QCPA 1OP0A 1O3AA 4YT6H 3RM2H 1HAGE 2JETB 3MO9A 1OP2A 1MBQA 1CBWC 5EQRA 2P3TB 3SNCA 1K1LA 2D26C 4ABAA 3RXGA 1O5FH 3ZZ4A 1CHGA 2H2ZA 2PGBB 6GCHG 4X1RU 3MYWA 2PUXB 1ABJH 4GCHF 2PV9B 3T27A 3STIA 4B2BA 2BB4A 1PYTD 2SGDE 2FOFA 2R0LA 5C3NA 2ZFFH 3ITIA 2XXLA 1UVOA 4GHQA 4F4OC 1SSXA 1MUEB 1XVMA 3PB1E 1MZDA 1N8OB 4DIHH 1FAKH 1JRSA 2CF8H 1MD8A 3VB3A 2Z9IA 4MQAA 3P70B 1CA0C 4JK6A 5EW1H 3URCA 4VGCC 4UE7H 4UONA 2GGVB 2QA9E 1YPGH 1EPTB 1T32A 1GI4A 1EZQA 3ATMA 4U32A 5HGGA 3DD2H 1YCPM 2XWAA 2CXVA 1DXWA 1C4Y2 1DX5M 3PTBA 2K1QA 5JYIA 5F03A 1ETRH 2V6NA 1GBBA 1XUHA 6ESTA 2XBYA 5DO4H 2A4OA 1FI8A 3E8LA 3GCTF 1IOEA 3RXRA 3QX5H 1H8DH 1J9CH 1J14A 1BBRE 3MNBA 3SV2H 1SOTA 4ISNA 4MVNA 3SGQE 4D7FA 1AKSA 2ANMH 1FIWA 1T8LA 3SZNA 1SFQB 2B8OH 1SGNE 2ZCLP 1TBQH 2FEQH 5DP7A 1V2PT 3ZZ3A 4MTBA 1O2KA 2GCTC 1LDTT 3P8OA 2ZGCA 1W7XH 3PO1B 1AZ8A 2WYGA 3BTDE 3L3TA 2FTMA 4JZ1A 2KAIB 5EXLA 3RLWH 4ABFA 5FX5A 3HPTB 3C1KA 2KAIA 1OWKA 3SW2B 3SHAH 1NRSH 1UTQA 4NIXA 3B23B 4X8TH 4ABIA 1O5BB 1MH0A 2CMYA 3NXPA 2XBXA 1O2SA 1P06A 2QAAA 3BTTE 4O03A 2F9NA 2JH6D 1UVPA 1WCZA 5JBAS 1ZMLA 3UQVA 2FLRH 1BHXF 5C20A 1BMNH 5F8TA 5LGOA 1UTJA 3A7ZA 3MH7A 1C2FA 1QTFA 2OBQA 1D3DB 3RXCA 4ABJA 5HMAA 5IDKA 6CHAB 1HFDA 1TOMH 1UTOA 3MNCA 4RSPA 4Y0ZE 3O8BA 1WTHD 3K9XB 1BTUA 3W94A 1HIAA 1W10U 2CV3A 3BSQA 3M3VA 4FUGA 5GCHG 2BLWA 3S7HB 2ZDLA 1C1MA 1EAUA 1E38B 1YCPK 4MNVA 1EZSC 1AUJA 2OBOA 1GJCB 1ZYOA 2I6QA 1GJBB 1K1PA 1FN8A 2UUJB 4RKJB 1DY9A 2ZTYA 1E35B 4VGCB 3SV9A 5HXFA 1F2SE 2G00A 1GCTB 2VNTA 1F0TA 1UHBA 2P59A 4AYVB 1GJ8B 1B0EA 3BV9B 3RMLH 1EASA 2AGEX 4D9RA 1SLUB 4X2YA 3S69A 4CH2B 1W11U 1ZJKA 4ABEA 2PTNA 4H6SB 1RGQA 1BJUA 5EPYA 2ZFPH 2R2MB 1MMJN 3AW1A 1J8AA 1PPZA 2J95A 4LZ4B 1BRCE 1DLEA 1DUEA 1O3DA 1NFUA 2ZU4A 1D9IA 4FUBA 2AGGX 1NFWA 3UWIA 4AGJA 4XSKU 1YP9A 5BPEA 1JIMA 1W3CA 2W5EA 1WU1A 2BVXH 1AWFH 1UVTH 2ZPSA 1V2VT 1Z1IA 1O2YA 4WWYA 4CR9A 1LPZB 2GV7A 5E0JA 2ZKSA 1V6DA 1KXDA 3O8DA 1AD8H 2H5CA 4Y8XA 2BDCA 4O3TA 2VWNA 3A84A 2C4FH 4DCDA 1P01A 4U2WA 1A2CH 3GDUA 2F9UA 2WPHS 5LPEA 3E0NB 3A8BA 1LHFH 2W3KA 3EGKH 1V2WT 3A85A 3RXUA 4FVDA 4XBDA 1NC6A 5DJ7A 1ELCA 3BEIB 3LIWA 4BAHB 4BTTB 2A1DB 1RTLA 2GD4B 4ISHH 4OS4A 1GG6C 1FIZA 2O8WA 3HK3B 3UREA 3MFJA 4D9QA 1A0JA 3A86A 1AE8H 1O32A 1CSOE 2QXJA 1JMOH 1GJ5H 1TX7A 2XW9A 4WMDA 2WUCA 1C1NA 3ZYDA 2BZ6H 3K6YA 1A5HA 4Z0KA 1E34B 1TFXA 3SI4H 3RXVA 4MLFB 1QA7A 1TOCB 1CA0B 2C8ZB 2ZCKP 2H9HA 3DFLA 1DSUA 2VIQA 3BTEE 1BBRH 2FOCA 1HJAC 2C93B 5L2ZH 1SGFG 3MO6A 1YPKH 4DJZB 1TONA 2QCYA 3PTNA 1QFKH 1QBOA 1P3EA 5HM9A 1O37A 1DWDH 2B9LA 2A5KA 2J2UA 3D49H 1KXEA 1S81A 4ZKRU 3M7TA 4SGAE 5EU8A 1ARCA 4Y7AA 2H9TH 1ZHMA 2O8UA 3SN8A 4Y8ZA 4ABDA 3GISB 4K1EA 4CRBA 1HGTH 1SQTA 2BDGA 3EYDA 5AVDA 8GCHF 1P04A 2Z9GA 1O3GA 2TGAA 4PROA 1CGJE 5LPFA 2ZHQH 2ZHEH 1BZXE 1IAUA 2HRVA 1MQ6A 2FOEA 3UQOA 2VWLA 3A7TA 1ETSH 1C5WB 1V2MT 3SORA 3B9FH 2FOHA 1MTVA 3IG6B 1M9UA 1AE5A 4INHA 1FONA 2PW8H 1LHCH 1EOJA 2IOTA 1G3BA 1O2ZA 5IYTA 4IC5A 2A5IA 1KYNA 4KGAA 4ZXXH 5JB8S 1G3DA 2ODQA 1XUFA 5ESBA 2GCTB 1UO6A 1MQ5A 1L4DA 2WUBA 3GDVA 3MU4A 3PO1C 1XXDA 2RCEA 4X1SU 4MPUA 5T6DA 1A0LA 3PWBA 2O9QA 1C1TA 1A4WH 1HAVB 4K3JA 1O38A 1QNJA 3RXOA 1O3EA 2ULLA 3TH3H 1GI6A 1BRBE 3HK6B 4LK4A 5FBIA 3CS7A 2ZGHA 2JH5D 1QQ4A 4ESTE 1XKAC 3G01A 3TU7H 1ANBA 3SGBE 2XCNA 7KMEH 1EZUC 3GY8A 3TVJB 1O2HA 2TPIZ 3ATKA 2ILNA 3DT0H 1UCYE 3U1IB 1N6XA 1O5GH 3FP7E 5E2PA 1TNGA 3LU9B 3I77A 5C1UA 4Q7XA 5ETXA 1BOQA 2PGQB 1K1OA 3HGNA 1P10A 1C2KA 5C1YA 5FHTA 3FZZA 2A7JA 1GI8B 1Y3WA 2ZGXH 1QRWA 5DG6A 3I78A 3K2UA 3VXEH 1DM4B 1EP6A 3GCTG 1WQVH 8KME2 1W7GH 1SGCA 3MO3A 1O2QA 1TLDA 1BRUP 1TGSZ 5DP4A 4ASHA 1QL8A 3QWCH 2AERH 4AFZA 3U98H 2A32A 2OC8A 1WTGH 1KDQA 1W13U 3KEEA 2H6MA 4THNH 1MTNC 1KTTB 2WPIS 1MU6B 1UCYK 4DT7B 3U8TH 1TE0A 2J9NA 1GBTA 3UWJH 2QXGA 2ZHWH 2Q6DA 2VGCC 2LNCA 1SGIB 1VCPA 2AGIX 1ZSLA 2C8YB 2FYRA 3RU4D 4A1VA 3UOUA 1ZPZA 1C5VA 1FQ3A 1HAIH 5I46H 5EPNA 1THPB 1ORFA 4ZROA 2XYAA 3F68H 1GHXH 1DS2E 1C1UH 1TGNA 1C5OH 2Y80A 3RU4T 1S0RA 1T8MA 5TCAA 1C9TA 2F83A 1TA6A 3RM0H 4WXVA 1V2TT 4FU9A 1C2DA 4CHAB 2QYIA 3P6ZB 4YZUA 3TGIE 3SJOA 3OSYA 1QIXB 1HAZB 3GCHB 1K28D 2ZF0H 4GSOA 4XBCA 2UWPA 4R0IA 2BOHB 1EOLA 4IN2A 1AWHB 1HBTH 1AFQB 1LHEH 2OC0A 4BAMB 3F9HA 1RXPA 2QGRA 3ZZ5A 4B76A 1GHAG 1AVXA 1EJNA 2ESTE 2FLBH 3F1SB 4K1SA 1GG6B 1J17T 3CS0A 4A5TS 1QURH 3RXPA 1GBEA 2AIPA 3SU5A 1ESBA 1OOKB 1OXGA 3URDA 5FX6A 1TAWA 1C5MD 1QRZA 3NKKA 1V2OT 4NZQA 1WQSA 3V0XA 1ZLRA 3ENSB 1ZMNA 5HM2A 1EQ9A 1CA8B 4OS2A 2JKHA 1QR3E 1V2LT 3RMMH 1L0ZA 2FX4A 1BTXA 1GBKA 4CRFA 2ZZUH 8ESTE 2SGFE 5A09A 4NFEA 2Z3EA 1HJAB 1Y5UT 1O2OA 1N8OC 3LJJA 1Z8RA 2P8OC 1GGDB 4IW4E 1IQLA 2ZTZA 2BM2A 4GAWA 4HGCA 1BDAA 1MD7A 2P95A 3A80A 2RA0A 4Y10E 1WOFA 4WMEA 1AVGH 1DE7H 2UUKB 3PMAB 4GUXA 1GBLA 1YLDA 1H8IH 5C1XA 1LQDB 2TGTA 2ZGJA 2THFB 1GPZA 3SU4A 3UNRA 1KIGH 1DY8A 4GLYA 2C8WB 1K1IA 1ID5H 1K21H 1BMLA 1EATA 4IS5A 1KXCA 1E0FD 2R3YA 2OCVB 3U8OH 2AEIH 2XBVA 1RIWC 2OQUA 5DP3A 1A61H 1LHDH 2ZFQH 1NESE 3BG4C 4A1XA 1D6RA 3TH2H 5DPAA 3PWCA 1DUAA 1HIAB 3F9GA 2HLCA 3RXAA 3RLYH 1PPHE 3VEQB 1A0HB 1B7XB 2BY7X 1NY22 1HNEE 4LXBH 5A0BA 1AB9B 2D2DA 3LT3A 1LHGH 2W7SA 4NZLA 1OWJA 1GL1A 5JBBS 1AU8A 1AY6H 4UFFH 3S0NA 1HCGA 1W2KH 3MU8A 1TPOA 1FPCH 4CRAA 4Q7YA 2V3OH 3VPKA 1HAHH 4YLQH 3MH5A 3MU0A 3RC6A 3SNEA 4YOJA 4ABBA 2DE8A 1O2VA 1K22H 3U1JB 1Z8GA 4B2CA 1VJ9U 2PHBA 2UUYA 2HOBA 4AB8A 4XDEA 8LPRA 1FY8E 3UNQA 1D4PB 4NIWA 3B8JA 1GHAF 4ZHLU 4TWYA 4MPVA 5C5NA 3MTYA 2BY8X 1H4WA 2Y5FA 2A4RA 3L6PA 3LGVA 4ZUHA 3BN9A 3LGWA 1SGEE 2G52A 1G36A 9LPRA 3HKJB 5TCCA 1MTNB 1L1NA 3TNSA 2AIQA 1RS0A 2OINA 2Q6GA 5EQSA 3A88A 3EE0B 1K1JA 5L2YH 1HV7A 2ZTXA 2FS9A 1ZSJA 1VGCC 1P9UA 3OY6U 3BIUH 2R0KA 4AX9H 4BANB 2VGCB 2J94A 1HXFH 1AMHA 3RXMA 1Z6JH 3GY5A 2BOKA 5GXPA 1FV9A 2PLXA 1PQAA 1O3FA 1HAPH 5L30H 5DK1A 2ZU1A 2F9OA 4BXSA 2HNTF 4U30A 1P2NA 1ANEA 1WBGB 3M61U 3NK8A 2Y5GA 2GT8A 2GZ8A 1AO5A 4FVBA 3RDZA 3Q3XA 4X2WA 2A7CA 2VIWA 4CHAC 4Q7ZA 1SLWB 3P92A 3SU3A 3LH1A 5A8ZA 4OS6A 2Z9KA 1TMBH 4NWLA 1V2UT 4YTAA 5AFYH 4MPWA 1A3BH 4K1TA 1CU1A 1S83A 3M3SA 1KY9A 3E90B 1NRPH 1GHYH 2YNBA 2FOBA 5CE1A 3KL6A 3QLPH 4MDSA 3M7UA 3MMGA 4ZXYH 4ZAEA 4WH8A 5AHGH 4Y8YA 1CO7E 3GY3A 1WYKA 1UHBB 3BF6H 1DWCH 1UTNA 1SL3A 1VITF 1SLXB 3SUEA 5T3HA 1GHZA 3SHCH 1HRTH 3TNTA 1OWIA 2VINA 1MU8B 1THSH 3A8AA 3ZZDA 4FUFA 3MH6A 2GZ9A 4ISIH 1HDTH 1O33A 1O3PB 2AMDA 3EA7A 1TALA 2VU8E 5AFZH 4NA8A 3TK5A 1GWAA 3RXLA 1TBRH 1GDQA 1EP5A 4B2AA 1C5RA 3QGNB 4DOQA 1OPHB 3ATLA 5EODA 3AVZA 1NFYA 3T28A 3Q76A 1GI9B 4DURA 1CT2E 1ELFA 1O5AB 4CREA 1ZGVA 5A0CA 4WMFA 4WH6A 5H4IB 2Z6BD 4KP0A 1FN6A 4JYVH 1HAVA 3FP8E 1ZR0A 3BTME 2ZCHP 1MZAA 1EUFA 1PFXC 1PJPA 3KF2A 3V13A 5DP8A 4X8VH 1ESAA 4RKOB 2UUFB 1CGHA 2EI8A 1BHXB 4ABGA 3AAVA 3P95A 1CQQA 4I7YH 2OP9A 1RRKA 4BAKB 3UR6A 4YOIA 2WV4A 1P2OA 4DG4A 3KQCA 2FDAA 4Y7BA 3AASA 7LPRA 1B5GH 4OGYA 4ABHA 2F9PA 1TQ7B 2SNVA 5JBCS 1G37A 4CRCA 3QZQA 3QUMP 2XC4A 3RXQA 1TX8A 2W3IA 1SR5C 1O3CA 1KXAA 4GVUA 3PMHB 2J4IA 3RXFA 2OQ5A 1ZZZA 1YF4A 2GMTC 2QIQA 1BMAA 2ALVA 1O5CB 4IMQA 2VWMA 3I29A 1BTWA 1QL7A 1V2NT 1SHHB 1OYQA 2V0BA 5J4SA 1T8NA 2Z9JA 3O8CA 1LO6A 1O3HA 2IPHA 3HATH 4KKDA 2CJIA 4YLUA 4CR5A 1UTLM 3RXTA 6GCHF 1QBNA 1IQJA 5EOKA 1UK3A 5C67A 4DVAU 4WVPE 1ZHRA 2A31A 3SNAA 1XUGA 2H5DA 3M5MA 3NUMA 1RD3B 1YCPH 4A6LA 4IN1A 4BTIB 1TX6A 1TYNA 3QN7A 5E0HA 4XFQA 1TB6H 4IMZA 1FY1A 3R3GB 4FUIA 7ESTE 1FPHH 1GMHG 3GOVB 2XRCA 2O8TA 3MU5A 3OX7U 4WF8A 1GBDA 1ELVA 1ACBE 2ZPRA 3ODFA 2BXTH 3JZ1B 3OYPA 5F6MA 4NIYA 3VGCB 2EEKA 2BD4A 1GI1A 4IC6A 4YOGA 4B74A 1CHOF 1XX9A 3D62A 2FPZA 3SV7A 4K8BA 1NFXA 3TITA 2CHAB 2OTVA 2XCFA 3BEFB 1C2LA 4B73A 2QN5T 1G32B 2R2WU 4NSYA 3Q77A 1TABE 2D8WA 2V35A 2Q1JA 1FY5A 1BTHH 1ARBA 4JYUH 3VB6A 1O2GH 1OWHA 1UK2A 1Y3VA 2FMJA 2ZQ1A 1GI5A 1PPGE 1F5KU 3SV8A 1SGYE 1XUJA 4IBLH 3UNSA 2PSXA 1ZTKA 4MPXA 1Y59T 3MU1A 4B71A 1UVUH 1O2MA 4E7NA 3FAOA 1KSNA 2RA3A 2AYWA 1SQAA 1GBMA 1O30A 3GY2A 4AOQA 2G4TA 3TJOA 3SU1A 1E36B 3RU4E 4X8SH 3RXBA 1GHBG 1YGCH 1O36A 3SNDA 2ANWA 4I33A 3TH4H 4AGKA 2NU1E 2QXHA 2FZZA 1QJ6B 5EGMA 1HAXB 2OUAA 1KLJH 1TNLA 2F3CE 3NPSA 1BTYA 3BTWE 1SGPE 1O3MA 2B0FA 4Y0YE 1TNJA 4XE4A 2UWLA 3A81A 1SG8B 4I8LA 1B0FA 1O0DH 2HNTE 2NU3E 1GBJA 2WPLS 2Y6TA 3UR9A 1TRNA 2AH4X 2OC1A 3U69H 1C5UA 5GIBA 1C1OA 1C1WH 4AFSA 5F8ZA 2WPMS 3QGJA 3SQEE 4AG2A 3PLBA 1TMUH 2F9BH 1VCQA 2SGPE 3STJA 2FWWA 1Z8IB 1CVWH 1P09A 1DWEH 2QF0A 3L33A 1BT7A 1P2JA 1YLCA 3M36A 1GVZA 1BITA 5GPIB 2IN2A 1K1MA 4X6PA 1TQ0B 2G55A 1C2MA 4CBNA 3A8DA 4HTCH 1D6WA 1F0UA 1PQ5A 1P11E 3A7VA 1BIOA 4ZKSU 2ZDMA 5F8XA 4BAOB 1LTOA 2BVSH 5DGJA 2BZAA 2FIRH 1XKBC 3KQBA 3HKIB 2VVVA 1AGJA 5K7RA 4DIIH 3M5OA 4WY3A 4GPGA 1O2JA 2ZG0H 1ZTJA 3F6UH 3M37A 4HZHA 1TWXB 3SBKA 1NO9H 6LPRA 1P02A 5EW2H 2AFQB 4U01A 1QQUA 2AMQA 3RXKA 1A46H 1P57B 2J34A 4BNRA 1BB0B 3IWMA 2BY9X 1SGRE 4O3UA 2GCHF 4AB9A 1FY4A 4D7GA 1PQ8A 1O31A 1DXPA 2TBSA 4FUEA 3SQHE 3PYHA 1SOZA 3T5FH 1O2NA 1LCYA 4I32A 1QRXA 2QV1A 5CHAB 3BTGE 1AFQC 3T25A 1SVPA 4FU8A 4D8NA 1A3EH 2P16A 3BIVH 2O8LA 2QC2A 3BG4B 2SFAA 4KTSA 1FNIA 2VIVA 1YKTA 1TGBA 1ZRBA 3MH4A 3T26A 2XC0A 1RTKA 4UD9H 3RMOH 2BD3A 2WINI 4FU7A 1BJVA 3Q3KA 1GJ9B 2TRMA 2GZ7A 4Q80A 1KLTA 2GP9B 5E0GA 1O3OA 2DUCA 2ZO3H 1SFIA 5HYOA 2FM2A 1ELDE 1BRAA 4RN6A 2EA3A 4X6MA 1A5GH 4X8UH 1GL0E 1JWTA 1ZPBA 2BTCE 2BD2A 1CT4E 1BCUH 1ZMJA 2ZWLH 3TGJE 1QB1A 3TK6A 2GKVE 1QA0A 4Y71A 1TIOA 2BDHA 1YBWA 3RMNH 3M3TA 5EXNA 4TPIZ 1P05A 1C1PA 4X1PU 1W12U 2Y81A 1FY3A 4UDWH 2BYAX 1DITH 1ZJDA 1C9PA 2O8MA 4K8YA 1IQEA 1C1RA 5JB9S 4BTUB 3VGCC 2STAE 1P2MA 3PMJA 2NU2E 4X1NU 1MKXH 2STBE 1LVMA 4WXIA 1T31A 2CHAC 3SI3H 4X2XA 2OLGA 1Z71A 4X6OA 5C5OA 1J15A 3R0FA 1G3CA 1K9OE 1TGCA 4JK5A 2GDDA 3RP2A 2OXSA 5FPTA 1TA2A 1O3NA 5LH8A 1S85A 4D76A 3PM3A 4X1QU 5DKMA 1Q31A
chains in the Genus database with same CATH superfamily
1QJ1B 1MABB 3ZZ9A 1VJAU 3SJKA 4O9VA 4MG3A 1HUTH 1MKWH 2WV5A 1O2IA 1RIWB 3FP6E 1VITG 4F49A 3E3TA 3KQEA 4TPYA 2C3SA 1NRRH 4GHTA 2BY5X 5A8YA 3A7XA 3SJ8A 5DP9A 1WSSH 1F0RA 4J1YA 1Z8JB 5GJ4B 3EQ0H 1GDNA 2J97A 3DCLA 5GCHF 3A87A 4ZHMU 3VB7A 1CHOG 1GMDF 3H7TA 5CHBA 4J2YB 2GTBA 4MNXA 2PFEA 4HFPB 4I31A 4FUDA 2Z94A 1ELGA 1ZHPA 2OD3B 1NU9A 1N6YA 1C1QA 3ZYEA 5DN6D 1S5SA 1EZXC 3QZRA 1T7CA 2BDIA 1JRTA 2WPKS 3ATIA 5FAHA 1O2LA 4XOJA 2WPDD 1TMTH 2LP6A 3SYJA 1JBUH 1TNIA 5FCKA 3FOAA 4BOHA 3SUDA 2PWXA 1C5QA 3NCLA 1SGTA 2G5NA 1C5LH 3M7QA 1SI5H 3U8RH 4O97A 1UJ1A 4LZ1H 2ZDVH 4Q2KA 3LDXH 3SV6A 4E05H 1NRQH 2YOLA 3H7OA 1KTSB 4X6NA 3UUZA 2H1UA 1AFEH 1IQNA 4RT1A 1DPOA 4Y6DA 3K65B 2BD7A 2FXRA 1YC0A 3AK5A 3AW0A 1GBHA 2BX4A 1WAYB 2ZHDA 3GCOA 1H9LB 2RDLA 1FXYA 1IHSH 3LONA 4H6TA 1PPBH 4AG1A 1Y8TA 1ABIH 1TBZH 3M5LA 5EG4A 1HAYB 4UFDH 1C5YB 3D65E 1QGFA 1GJ6A 1O3JA 4TY7A 2QXIA 1VGCB 2WYJA 1GBCA 4I86A 2ZPQA 5I25A 1O2RA 2FI3E 1NU7B 1C2EA 1NN6A 5JPMH 1DOJA 1HJ8A 4ISLA 5CDFE 2A5AA 1XVOA 1C2JA 3RXEA 1F5RA 1UTPA 1IHTH 3N7EA 1C5NH 1LPKB 3TJVA 2GV6A 1ELTA 1TRMA 5KGOA 2PTCE 2R3UA 4AFQA 1DVAH 1MTWA 4H4FA 1H9IE 5A0AE 4K2YA 1IQHA 1LKBA 1A7SA 3H09A 1DANH 4UEHH 4DW2U 1P0SH 3F9EA 2J92A 3F9FA 1TNHA 1HB0B 8GCHG 2SGEE 4I8KA 1U6QA 1GBIA 2BXUH 3AAUA 2V3MA 3TJUA 2G81E 4OS7A 2FOAA 5E8EH 3PLPA 3BTKE 2ASUB 1W8BH 1W0ZU 1OWDA 2HNTC 1WXRA 2B5TB 1HXEH 1NZQH 2BMGB 2BDYA 1EB2A 1GBAA 2I6SA 2XC5A 2ZP0H 2ANKH 1JOUB 2LPRA 3MI4A 5GDSH 4I8JA 3OY5U 9ESTA 5C2ZA 1Y5BT 2XWBI 5T6GA 1CGIE 2BD5A 2ODYB 3A89A 4JZIA 1GJ4H 2BVRH 1GMDG 1ANDA 3P8NA 3LGIA 1O34A 3MNXA 4R8TB 2FODA 4HI3A 2BY6X 1D3QB 4GCHG 1GI7B 3ELAH 3P8FA 4JZDH 4H42U 4ASUD 4E7RG 3SUGA 5A8XA 3MQKC 1YPLH 4UFGH 3GYLB 3BTQE 4AZ2B 3PLKA 2Q6FA 3FZDA 1C2HA 3EA9A 1ESTA 4Y79A 2ZC9H 1O2WA 4AORA 3SOSA 1FAXA 1FLEE 2IJOB 2BX3A 1O5EH 4ZH8A 3IITA 5EQQA 2Z3CA 1J16A 3KIDU 3BEUA 4Q4LA 3V7TA 3PMBB 1C4U2 2NU0E 1MTUA 5HIYA 4INKA 1UTMA 1SGDE 1NTPA 4NGAH 3S9AA 1RTFB 1HYLA 1EPTA 1SBWA 2JDID 2L6OA 4X0WU 3LOXA 1T8OA 3ODDA 3BTHE 2VIPA 4OS1A 3QTOH 2Z3DA 1IQKA 4I8GA 2VIOA 2Y7ZA 1O3BA 4JCNA 4JYTA 5FBEA 2ALPA 1CBWB 1TPPA 1Y3XA 2ZA5A 1PPFE 1G2LA 1PPEE 3ZZAA 2YMSD 3E16B 3UFAA 4ISOA 5ABWA 2GMTB 7GCHF 2BLVA 2A4QA 2BD8A 2PSYA 1H8ED 3NWUA 1TPSA 1GJ7B 2SNWA 4X2VA 1O35A 1SKYE 3O8RA 1WV7H 1MKWK 1TPAE 1Y3YA 3UY9A 4RT0A 2JJ2D 1C5XB 5CMXH 1FUJA 1G9IE 3SNBA 1C1VH 2Z7FE 1GCDA 2A45B 1L1GA 3E1XB 1E37B 1UK4A 1BA8B 3N99A 1AHTH 3Q3YA 1AQ7A 1OWEA 3TLOA 2FESH 1PQ7A 2PR3A 5EJ1A 4NWKA 3KQDA 1P2KA 1YYY1 3RC5A 2ZIQH 1NM6A 1YM0A 3LPRA 3E0PB 1SPJA 1Z7KA 3ZVGA 5G4BA 1GGDC 1BBRK 2FOGA 1DLKB 4NA7A 5ESTE 3ZV8A 1IQIA 2VVUA 2UWOA 5BRRE 1XMNB 1C1SA 2BQ6B 1LVOA 3UAIC 1FX0B 3QK1A 3EA8A 2BQWB 3SJ9A 1HPGA 1BUIA 4NIVA 6CHAC 1VCWA 1K2I1 2PKSB 5FPSA 2FS8A 1V2RT 1GCTC 3RC4A 2A0QB 3S9CA 1O3IA 2GX4A 3GYMA 2RG3A 1BQYA 3SU0A 2A2XH 3RXJA 2ODPA 4WJG2 1QHRB 1Q2WA 4NG9H 2FI4E 5FXLA 3SGAE 5JBTA 1SLVB 1VKYA 2ZDNA 4AYYB 1ZTLA 2HWLB 3F2GA 3KCGH 1SC8U 1V3XA 3PRBA 4Y76A 4JZEH 4NCYA 1FJSA 1PPCE 2VVCA 3SU2A 3BTFE 3M5NA 1ANCA 1TNKA 1YPMH 3ZVDA 3A82A 4TWWA 1O2UA 1H1BA 4CBOA 1EX3A 2B7DH 3ZVEA 2F9VA 1GHBF 2AS9A 1C5SA 4B6FA 1UCYH 1GI2A 2F91A 2WPJS 3ZZ7A 5J4QA 2W26A 5T6FA 4Y11E 3PRDA 3UPEA 3T62A 3DUXH 2VH0A 1O2PA 2C8XB 3CP7A 3FFGA 1HJ9A 1G30B 2J38A 1C2GA 1L4ZA 4MNWA 1C2IA 5LPRA 1AI8H 1WUNH 1GJAB 2P94A 3KN2A 5C17A 1Y3UA 1IQGA 3MWIU 1XM1A 1LKAA 1P2IA 1O3KA 3F2HA 3GDSA 3MHWU 4KTCA 5PTPA 3LH3A 4AN7A 1CE5A 4KTUA 1GMCF 1ZSKA 2GVFA 1K1NA 1W14U 1O2XA 1KXFA 2M2AA 4NSVA 1EAWA 4B1TA 4XBBA 3PROA 1SMFE 1DWBH 3A83A 1P9SA 1EAIA 2FI5E 4FUHA 2AMPA 1LPGB 1NS3A 1E1QD 4ZCNA 1FMGA 1GVKB 2HVXA 1S6HA 3V3MA 2BQ7B 2KZ4A 1O2TA 3T2NA 2P3FH 1ZRKA 4DGJA 2DE9A 4K60A 1AZZA 1L1JA 1W0YH 1ZOMA 2P3UB 2WV9A 2ZFSA 4YO9A 3ZZ6A 3RXHA 4XRNA 2BDAA 2SGAA 3QDZB 1BTPA 1XUIA 1UTKA 1D3TB 3VXFH 5K0HA 3MOCA 4K5ZA 1ZGIA 4TY6A 2CN0H 2BLQA 2ZI2H 1OP8A 1P12E 1GHWH 1F92A 3ZZ8A 5L6NH 2ZNKH 2VIDA 3S9BA 1K0HA 2FX6A 4TYDA 1ELEE 3E91A 3QO6A 2GJGA 2YNAA 1GBFA 1MKXK 3VB4A 4JMYA 3MNSA 1P3CA 1JIRA 1GVLA 2M5TA 3KHVA 3ZVAA 2Y5HA 1PYTC 4INLA 5TJXA 1LVYA 3ATWA 2KX4A 1F5LA 1OX1A 1BTZA 1C5ZB 2XNIA 2OC7A 2A2QH 3KGPA 4BXWA 1YPHC 2HGTH 2ZDAH 3RXIA 2GDEH 1QB6A 1AB9C 1GDUA 2QE7D 3N7OA 1S6FA 1OYTH 3C27B 2PKAB 1GHVH 3ZIAD 2K8IA 3Q00A 2JETC 4IGDA 1YWUA 2FYQA 3RUOA 1INCA 2YMSC 1MBMA 1QY6A 2ZQ2A 3T29A 4K69A 2Y82A 2HPQH 1IQMA 3GY4A 3LC3A 4SGBE 4YT7H 1ELAA 2TIOA 1TGTA 1OSSA 3HGPA 1YY3A 4ZKOU 1P8VC 5CHAC 1QJ7B 1LMWB 1AKSB 2WSSD 4OGXA 1DSTA 1MCVA 2G4UA 2G5VA 1SHYA 4BAQB 3TJNA 1YPEH 3UTUH 3FVFB 3KNXA 1GI3A 3CNRA 3OU0A 1CT0E 2BDBA 4YESB 3TPIZ 1RFNA 2A7HA 1NPMA 1Z1JA 4P00A 1N1LA 3OEHD 4ZKNU 2VBCA 1X7AC 2EI6A 7GCHG 1MAYA 1S84A 5A2MH 1VZQH 1GMCG 3QTVH 1O5DH 2CF9H 1SQOA 2Z9LA 1C4V2 3LGYA 1AIXH 1DDJA 1EPTC 3VB5A 2CGAA 1L2EA 1DFPA 1GJDB 2GT7A 2PUQH 3DFJA 2PKSC 5DP5A 1SB1H 1NRNH 1S0QA 3ZVCA 3LJOA 1T4UH 4E06H 1NT1A 2EI7A 3K6ZA 1EAXA 2SGQE 2BD9A 3SU6A 1NROH 2BHGA 2ZFRH 3EAJA 1Q3XA 1G3EA 1ELBA 3TGKE 2IJD1 4ZMAH 1V2KT 5SGAE 2NWNA 5AF9H 3LGTA 4FUJA 1C5TA 2ZU2A 1H9HE 1QL9A 3D23A 3A7YA 1AUTC 1D3PB 2ANYA 1SGQE 1Y5AT 1KDQB 2ZEBA 3VFEA 2FP7B 3U9AH 2FO9A 1A1RA 1P2QA 1P03A 2FOMB 1GMHF 3OTJE 3BG8A 2LELA 2XBWA 1DT2A 2ZDKA 2G8TA 3GICB 2C90B 2D1JA 3S7KB 4KELA 1XUKA 3A7WA 3FANA 1Z6EA 1EKBB 1F7ZA 5GWZA 3GCHC 3SUFA 4JZFH 2KCYA 3WY8A 1SGFA 2BLOA 1EJAA 1F0SA 1UVSH 4XD7D 1VITH 2EY4C 5FPYA 4B6EA 2VB0A 3ZZCA 1EB1H 1YPJH 2ZFTA 1DICA 4FXGH 2PKAA 4YM9A 1GI0A 1G2MA 1BMMH 4A7IB 1FDPA 1ZPCA 2TGPZ 3DA9B 2FTLE 3ZVBA 3NZIA 3EDXB 1YPHE 2G51A 1AN1E 1MCTA 2ZECA 2A4GA 3M35A 5JDUB 4M7GA 1LVBA 1EXFA 1AVWA 2QF3A 3JZ2B 3SJIA 2Y7XA 2GCHG 5EXMA 5E2OA 2HALA 4AFUA 3GCNA 1KXBA 1MTSA 3E6PH 5DP6A 3PV4A 4CH8B 2EC9H 5EJZA 5B6OA 2RDEA 4I8HA 1W0JD 1HLTH 3GY7A 2W7UA 2VH6A 2VWOA 4FUCA 3H5CB 1E1RD 2HPPH 2P93A 1KLIH 1OKXA 4Z6AH 1O3LA 2QY0B 2VJ1A 4A92A 1V2QT 1IQFA 3TIUA 1ETTH 3DHKH 1V2ST 3ESTA 5FCRA 3RXSA 3ZV9A 3P17H 2ZGBH 1JXPA 3RXDA 4CRDA 4NFFA 1XXFA 1UMAH 2NU4E 1VR1H 2H9EH 4NA9H 3UOPA 2XNDD 1FZZA 2R9PA 4DY7B 2TGDA 1QBVH 3A8CA 1OS8A 1THRH 2V3HH 3GY6A 3LGUA 2P8OB 1MAXA 3ZVFA 3CENA 4MNYA 1QB9A 1TRYA 2XTTB 4QT8C 3UIRA 3V12A 1HAOH 3LC5A 3SO3A 4OS5A 4LOYH 2ZHFH 1LQEA 1A5IA 1V2JT 1EJMA 2JH0D 4UFEH 1S82A 2ZU5A 4ZHAA 4CRGA 3ZZBA 2JJ1D 1RJXB 2ZU3A 5HIZA 3LKWA 3W95A 1C5PA 3TK9A 3OFND 4A1TA 3P8GA 4B75A 1T4VH 1O39A 1QCPA 1OP0A 1O3AA 4YT6H 3DSGA 1HAGE 3RM2H 2JETB 3MO9A 1OP2A 1MBQA 1CBWC 5EQRA 2P3TB 3SNCA 1K1LA 2D26C 4ABAA 3RXGA 1O5FH 3ZZ4A 1CHGA 2H2ZA 2PGBB 6GCHG 4X1RU 3MYWA 2PUXB 1ABJH 4GCHF 2PV9B 3T27A 3STIA 4B2BA 2BB4A 1PYTD 2SGDE 2FOFA 2R0LA 5C3NA 2ZFFH 3ITIA 2XXLA 1UVOA 4GHQA 4F4OC 1SSXA 1MUEB 1XVMA 3PB1E 1MZDA 1N8OB 4DIHH 1FAKH 1JRSA 2CF8H 1MD8A 3VB3A 2Z9IA 4MQAA 3P70B 1CA0C 4JK6A 5EW1H 3URCA 4VGCC 4UE7H 4DT4A 4UONA 2GGVB 2QA9E 1YPGH 1EPTB 1T32A 1GI4A 1EZQA 3ATMA 4U32A 3WW7A 5HGGA 3DD2H 1YCPM 2XWAA 2CXVA 1DXWA 1C4Y2 1DX5M 3PTBA 2K1QA 5JYIA 5F03A 2IPQX 1ETRH 2V6NA 1GBBA 1XUHA 6ESTA 3UB0A 2XBYA 5DO4H 2A4OA 1FI8A 3E8LA 3GCTF 1IOEA 3RXRA 3QX5H 1H8DH 1J9CH 1J14A 1BBRE 3MNBA 3SV2H 1SOTA 1WDIA 2J98A 4ISNA 4MVNA 3SGQE 4D7FA 1AKSA 2ANMH 1FIWA 1T8LA 3SZNA 1SFQB 2B8OH 1SGNE 2ZCLP 1TBQH 2FEQH 5DP7A 1V2PT 3ZZ3A 4MTBA 1O2KA 2GCTC 1LDTT 3P8OA 2ZGCA 1W7XH 3PO1B 1AZ8A 2WYGA 3BTDE 3L3TA 2FTMA 4JZ1A 2KAIB 5EXLA 3RLWH 4ABFA 5FX5A 3HPTB 3C1KA 2KAIA 1OWKA 3SW2B 5IK2D 3SHAH 1NRSH 1UTQA 2QF4A 3B23B 4NIXA 4X8TH 4ABIA 1O5BB 1MH0A 2CMYA 3NXPA 2XBXA 1O2SA 1P06A 2QAAA 3BTTE 4O03A 2F9NA 2JH6D 1UVPA 1WCZA 5JBAS 1ZMLA 3UQVA 2FLRH 1BHXF 5C20A 2CK3D 1BMNH 5F8TA 5LGOA 1UTJA 3A7ZA 3MH7A 1C2FA 1QTFA 2OBQA 1D3DB 3RXCA 4ABJA 5HKKD 3OAAD 5HMAA 1SQRA 5IDKA 6CHAB 1HFDA 1TOMH 1UTOA 2F4LA 3MNCA 4RSPA 3F0PA 4Y0ZE 3O8BA 1WTHD 3K9XB 1BTUA 3W94A 1HIAA 1W10U 2CV3A 3BSQA 3M3VA 4FUGA 5GCHG 2BLWA 3S7HB 2ZDLA 1C1MA 1EAUA 1E38B 1YCPK 4MNVA 1EZSC 1AUJA 2OBOA 1GJCB 1ZYOA 2I6QA 1GJBB 1K1PA 1FN8A 2UUJB 4RKJB 1DY9A 2ZTYA 1E35B 4VGCB 3SV9A 5HXFA 1F2SE 2G00A 1GCTB 2VNTA 1F0TA 1UHBA 2P59A 4AYVB 1GJ8B 1B0EA 3BV9B 3RMLH 1EASA 2AGEX 4D9RA 1SLUB 4X2YA 3S69A 4CH2B 1W11U 1ZJKA 4ABEA 2PTNA 4H6SB 1RGQA 1BJUA 5EPYA 2ZFPH 2R2MB 1MMJN 3AW1A 1J8AA 1PPZA 2J95A 4LZ4B 1BRCE 1DLEA 1DUEA 1O3DA 3F2FA 1NFUA 2ZU4A 1D9IA 4FUBA 2AGGX 1NFWA 3UWIA 4AGJA 4XSKU 1YP9A 5BPEA 4F48B 1JIMA 4ACAA 1W3CA 2W5EA 1WU1A 2BVXH 2KCAA 1AWFH 1UVTH 2ZPSA 1V2VT 1Z1IA 1O2YA 4WWYA 4CR9A 2RFKC 1LPZB 2GV7A 5E0JA 2ZKSA 1V6DA 1KXDA 3O8DA 1AD8H 2H5CA 4Y8XA 2BDCA 4O3TA 2VWNA 3A84A 2C4FH 4DCDA 1P01A 4U2WA 1A2CH 3GDUA 2F9UA 2WPHS 5LPEA 3E0NB 3A8BA 1LHFH 2W3KA 3EGKH 1V2WT 3A85A 3RXUA 4TSFD 4FVDA 4XBDA 1NC6A 5DJ7A 1ELCA 3BEIB 3LIWA 4BAHB 4BTTB 2A1DB 1RTLA 2GD4B 4ISHH 4OS4A 1GG6C 1FIZA 2O8WA 3HK3B 2KR7A 3KYGA 3UREA 1H8HD 2KCPA 3MFJA 4D9QA 1A0JA 3A86A 1AE8H 3OEED 2W6JD 1O32A 1CSOE 2QXJA 1JMOH 1GJ5H 1TX7A 2XW9A 4WMDA 2WUCA 1C1NA 3ZYDA 2BZ6H 3K6YA 1A5HA 4Z0KA 1E34B 1TFXA 3SI4H 3RXVA 4MLFB 1QA7A 1TOCB 4FOUC 1CA0B 2C8ZB 2ZCKP 2H9HA 3DFLA 1DSUA 2VIQA 3BTEE 1BBRH 2FOCA 1HJAC 2C93B 5L2ZH 1SGFG 3MO6A 1YPKH 4DJZB 1TONA 2QCYA 3PTNA 1QFKH 1QBOA 3DSPA 1P3EA 5HM9A 1O37A 1DWDH 2B9LA 2A5KA 2J2UA 3D49H 1KXEA 1S81A 4ZKRU 3M7TA 4SGAE 5EU8A 1ARCA 2XOKD 4Y7AA 2H9TH 1ZHMA 2O8UA 2PP6A 3SN8A 4Y8ZA 3U28C 4ABDA 3GISB 4K1EA 4CRBA 1HGTH 1SQTA 2BDGA 3EYDA 5AVDA 8GCHF 1P04A 2Z9GA 1O3GA 2TGAA 4PROA 1CGJE 5LPFA 2ZHQH 2ZHEH 1BZXE 1IAUA 2HRVA 1MQ6A 2FOEA 3UQOA 2VWLA 3A7TA 1ETSH 1C5WB 1V2MT 1NBMD 3B9FH 3SORA 3VG8A 2FOHA 1MTVA 3IG6B 1M9UA 1AE5A 4INHA 1FONA 2PW8H 1LHCH 1EOJA 2IOTA 3EE7A 1G3BA 1O2ZA 5IYTA 4IC5A 2A5IA 1KYNA 4KGAA 4ZXXH 5JB8S 5DSFA 1G3DA 2ODQA 1XUFA 5ESBA 2GCTB 1UO6A 1MQ5A 1L4DA 2WUBA 3GDVA 3MU4A 3PO1C 1XXDA 2RCEA 4X1SU 4MPUA 5T6DA 1A0LA 3PWBA 2O9QA 1C1TA 1A4WH 2V7QD 1HAVB 4K3JA 1O38A 5F53A 1E79D 2YMSB 1QNJA 4TT3D 1O3EA 3RXOA 2ULLA 3TH3H 1GI6A 1BRBE 3FKSD 3HK6B 4LK4A 5FBIA 3CS7A 2ZGHA 2JH5D 1QQ4A 4ESTE 1XKAC 3G01A 3TU7H 1ANBA 3SGBE 5C0TA 2XCNA 7KMEH 1EZUC 3GY8A 3TVJB 1O2HA 2TPIZ 3ATKA 2ILNA 3DT0H 1UCYE 3U1IB 1N6XA 1O5GH 3FP7E 5E2PA 1TNGA 3LU9B 3I77A 1BMFD 4Q7XA 5C1UA 5ETXA 1BOQA 2PGQB 1K1OA 3HGNA 1P10A 1C2KA 5C1YA 5FHTA 3FZZA 2A7JA 1GI8B 1Y3WA 2ZGXH 1QRWA 5DG6A 3I78A 3K2UA 3VXEH 1DM4B 1EP6A 3GCTG 1WQVH 5KECA 8KME2 1W7GH 1S6LA 3FN8A 1SGCA 3MO3A 1O2QA 1TLDA 1BRUP 1TGSZ 5DP4A 4ASHA 1QL8A 3QWCH 2AERH 4AFZA 3U98H 2A32A 2OC8A 2KFWA 1WTGH 1KDQA 1W13U 3KEEA 2H6MA 4THNH 5B6LA 1MTNC 1KTTB 2WPIS 1MU6B 1UCYK 4DT7B 3U8TH 1TE0A 2J9NA 1GBTA 3UWJH 2QXGA 2ZHWH 2Q6DA 2VGCC 2LNCA 1SGIB 1VCPA 2AGIX 1ZSLA 2C8YB 2FYRA 3RU4D 4A1VA 3UOUA 1ZPZA 1C5VA 1FQ3A 1HAIH 5I46H 5EPNA 1THPB 1ORFA 4ZROA 2XYAA 1KMHB 3F68H 1GHXH 1DS2E 1C1UH 1TGNA 1C5OH 2Y80A 3RU4T 1S0RA 1T8MA 5TCAA 1C9TA 2F83A 1TA6A 3RM0H 4WXVA 1V2TT 4FU9A 1C2DA 4CHAB 2KM0A 2QYIA 3P6ZB 4YZUA 3TGIE 3SJOA 3OSYA 1QIXB 1HAZB 3GCHB 1K28D 2ZF0H 4GSOA 4XBCA 2UWPA 4R0IA 2BOHB 1EOLA 4IN2A 1AWHB 1HBTH 1AFQB 1LHEH 2OC0A 4BAMB 3F9HA 1RXPA 2QGRA 3ZZ5A 3OE7D 4B76A 1GHAG 1AVXA 1EJNA 2ESTE 2FLBH 3F1SB 4K1SA 1GG6B 1J17T 3CS0A 4A5TS 1QURH 3RXPA 1GBEA 2AIPA 3SU5A 1ESBA 1OOKB 1OXGA 3URDA 5FX6A 1TAWA 1C5MD 1QRZA 2L74A 3NKKA 1V2OT 4NZQA 1WQSA 3V0XA 1ZLRA 3ENSB 1ZMNA 5HM2A 1EQ9A 1CA8B 4OS2A 2JKHA 1QR3E 1V2LT 3RMMH 1L0ZA 2FX4A 1BTXA 1GBKA 4CRFA 5EIYA 2ZZUH 8ESTE 2SGFE 5A09A 4NFEA 2Z3EA 2QF5A 1HJAB 1Y5UT 5KEDA 1O2OA 1N8OC 3LJJA 1Z8RA 2P8OC 1GGDB 4IW4E 1IQLA 2ZTZA 2BM2A 4GAWA 4HGCA 4AC9A 1BDAA 1MD7A 3OTPA 2P95A 3A80A 2RA0A 4Y10E 1WOFA 4WMEA 1AVGH 1DE7H 2UUKB 3PMAB 4GUXA 1GBLA 1QZ8A 1YLDA 1YLNA 1H8IH 5FL7D 5C1XA 1LQDB 2TGTA 2ZGJA 2THFB 1GPZA 3SU4A 3UNRA 1NBME 1KIGH 1DY8A 4M9FA 4GLYA 2C8WB 2K0QA 1K1IA 1ID5H 1K21H 1BMLA 1EATA 4IS5A 1KXCA 1E0FD 2R3YA 2OCVB 3U8OH 2AEIH 2XBVA 1RIWC 2OQUA 5DP3A 1A61H 1LHDH 2ZFQH 3PV2A 1NESE 3BG4C 4A1XA 1D6RA 3TH2H 5DPAA 3PWCA 1DUAA 1HIAB 3F9GA 2HLCA 3RXAA 3RLYH 1PPHE 3VEQB 1A0HB 1B7XB 2BY7X 1NY22 1HNEE 4LXBH 5A0BA 1AB9B 2D2DA 3LT3A 1LHGH 2W7SA 4NZLA 1OWJA 1GL1A 5JBBS 1AU8A 1AY6H 4UFFH 3S0NA 1HCGA 1W2KH 3MU8A 1TPOA 1FPCH 4CRAA 4Q7YA 2V3OH 3VPKA 1HAHH 4YLQH 3MH5A 3MU0A 3RC6A 3SNEA 4YOJA 4ABBA 2DE8A 1O2VA 1K22H 3U1JB 1Z8GA 4B2CA 1VJ9U 2PHBA 2UUYA 2HOBA 3WWBA 4AB8A 4XDEA 8LPRA 1FY8E 3UNQA 1D4PB 4NIWA 3B8JA 1GHAF 4ZHLU 4TWYA 4MPVA 5C5NA 3MTYA 2BY8X 1H4WA 2Y5FA 4FETA 2A4RA 3L6PA 3LGVA 4ZUHA 3BN9A 3LGWA 1SGEE 2G52A 1G36A 9LPRA 3HKJB 4RI0A 1MTNB 5TCCA 1L1NA 3TNSA 2AIQA 1RS0A 2OINA 2Q6GA 5EQSA 3A88A 3EE0B 1K1JA 2AHME 5L2YH 1HV7A 2ZTXA 2FS9A 1ZSJA 1VGCC 1P9UA 3OY6U 3BIUH 2R0KA 4AX9H 4BANB 2VGCB 3SZEA 2J94A 1HXFH 1AMHA 3RXMA 1Z6JH 3GY5A 3WWFA 2BOKA 5GXPA 1FV9A 2PLXA 1UW7A 1PQAA 1O3FA 1HAPH 5L30H 5DK1A 2ZU1A 2F9OA 4BXSA 2HNTF 4U30A 1P2NA 1ANEA 1WBGB 3M61U 3NK8A 2Y5GA 2GT8A 2GZ8A 1AO5A 4FVBA 3RDZA 3Q3XA 4X2WA 2A7CA 2VIWA 4CHAC 4Q7ZA 1SLWB 3P92A 3SU3A 3LH1A 5A8ZA 4OS6A 2Z9KA 1TMBH 4NWLA 1V2UT 4YTAA 5AFYH 4MPWA 1A3BH 4K1TA 1CU1A 1S83A 3M3SA 1KY9A 3E90B 1NRPH 3N7DA 1GHYH 2YNBA 2FOBA 5CE1A 3KL6A 3QLPH 4MDSA 3M7UA 3MMGA 4ZXYH 4ZAEA 4WH8A 5AHGH 4Y8YA 1CO7E 3GY3A 3F0OA 5C0UA 1WYKA 1UHBB 3BF6H 1DWCH 1UTNA 1SL3A 1VITF 1SLXB 3SUEA 5T3HA 1GHZA 3SHCH 1HRTH 3TNTA 1OWIA 2VINA 1MU8B 1THSH 3A8AA 3ZZDA 4FUFA 3MH6A 2GZ9A 4ISIH 1HDTH 1O33A 1O3PB 2AMDA 3EA7A 1TALA 2VU8E 5AFZH 4NA8A 3TK5A 4OM9A 1GWAA 3RXLA 1TBRH 1GDQA 1EP5A 4B2AA 1C5RA 3QGNB 4DOQA 1OPHB 3ATLA 5EODA 1W0KD 1NFYA 3AVZA 3T28A 5GNDA 2OK5A 3Q76A 1GI9B 4DURA 1CT2E 1ELFA 1O5AB 4CREA 1ZGVA 5A0CA 4WMFA 4WH6A 5H4IB 2Z6BD 4KP0A 1FN6A 4JYVH 1HAVA 3FP8E 1ZR0A 3BTME 2ZCHP 1MZAA 1EUFA 1PFXC 1PJPA 3KF2A 3V13A 5DP8A 4X8VH 1ESAA 4RKOB 2UUFB 1CGHA 2EI8A 1BHXB 4ABGA 3AAVA 3P95A 1CQQA 4I7YH 2OP9A 1RRKA 4BAKB 3UR6A 4YOIA 2WV4A 1P2OA 4DG4A 3KQCA 2FDAA 4Y7BA 3AASA 7LPRA 1B5GH 4OGYA 4ABHA 2F9PA 1TQ7B 2SNVA 5JBCS 1G37A 4CRCA 3QZQA 3QUMP 2XC4A 3RXQA 1TX8A 2W3IA 1SR5C 1O3CA 1KXAA 4GVUA 3PMHB 2J4IA 3RXFA 2OQ5A 1ZZZA 1YF4A 2GMTC 2QIQA 1BMAA 2ALVA 1O5CB 4IMQA 4ACBA 2VWMA 3I29A 2WHXA 1BTWA 1QL7A 1V2NT 1SHHB 1OYQA 2V0BA 5J4SA 1T8NA 2KCOA 2Z9JA 3O8CA 1LO6A 1EFRD 1O3HA 2IPHA 3HATH 4KKDA 2CJIA 4YLUA 4CR5A 5T1VA 1UTLM 3RXTA 6GCHF 1QBNA 4P02A 1IQJA 5EOKA 1UK3A 5C67A 4DVAU 4WVPE 1ZHRA 2A31A 3SNAA 1XUGA 2H5DA 3M5MA 3NUMA 1RD3B 1YCPH 4A6LA 4IN1A 4BTIB 1TX6A 1TYNA 3QN7A 5E0HA 4XFQA 1TB6H 4IMZA 2HVYB 1FY1A 3R3GB 4FUIA 7ESTE 1FPHH 1GMHG 3GOVB 2XRCA 2O8TA 3MU5A 3OX7U 4WF8A 1GBDA 1ELVA 1ACBE 2ZPRA 3ODFA 2BXTH 3JZ1B 4Q63A 3OYPA 5F6MA 4NIYA 3VGCB 4Z1MD 2EEKA 3PV5A 2BD4A 1GI1A 4IC6A 3KYFA 4YOGA 4B74A 1CHOF 2WZQA 1XX9A 3D62A 2FPZA 3SV7A 4K8BA 1NFXA 3TITA 2CHAB 2OTVA 2XCFA 3BEFB 1C2LA 3W1EA 4F55A 4B73A 2QN5T 1G32B 2R2WU 4NSYA 4YXWD 3Q77A 1TABE 2D8WA 2V35A 2Q1JA 1FY5A 1BTHH 1ARBA 4JYUH 3VB6A 1O2GH 1OWHA 1UK2A 1Y3VA 2FMJA 2ZQ1A 1GI5A 1PPGE 1F5KU 3SV8A 1SGYE 1XUJA 4IBLH 3UNSA 2PSXA 1ZTKA 4MPXA 1Y59T 3MU1A 4B71A 1UVUH 1O2MA 4E7NA 3FAOA 1KSNA 2RA3A 4HG6A 2AYWA 1SQAA 1GBMA 1O30A 3GY2A 4AOQA 2G4TA 3TJOA 3SU1A 1E36B 3RU4E 4X8SH 3RXBA 1GHBG 1YGCH 1O36A 3SNDA 2ANWA 4I33A 3TH4H 4AGKA 2NU1E 2QXHA 2FZZA 1QJ6B 5EGMA 1HAXB 2OUAA 1KLJH 1TNLA 2F3CE 3NPSA 1BTYA 3BTWE 1SGPE 1O3MA 2B0FA 4Y0YE 1TNJA 4XE4A 2UWLA 3A81A 1SG8B 3NRLA 4I8LA 1B0FA 1O0DH 2HNTE 2NU3E 1GBJA 2WPLS 2Y6TA 3UR9A 1TRNA 2AH4X 2OC1A 3U69H 1C5UA 5GIBA 1C1OA 2J5UA 1C1WH 4AFSA 2EQNA 2WPMS 5F8ZA 3QGJA 3SQEE 4AG2A 3PLBA 1TMUH 1OHHD 2F9BH 1VCQA 2SGPE 3STJA 2FWWA 5EJLA 1Z8IB 1CVWH 1P09A 1DWEH 2QF0A 3L33A 1BT7A 1P2JA 1YLCA 3M36A 1GVZA 1BITA 5GPIB 2IN2A 1K1MA 4X6PA 1TQ0B 2G55A 1C2MA 4CBNA 3A8DA 4HTCH 1D6WA 1F0UA 1PQ5A 1P11E 3A7VA 1BIOA 4ZKSU 2ZDMA 5F8XA 4BAOB 1LTOA 2BVSH 5DGJA 2BZAA 2FIRH 1XKBC 3KQBA 3HKIB 2VVVA 1AGJA 1COWD 3KQ5A 5K7RA 4DIIH 3M5OA 4WY3A 4GPGA 1O2JA 2ZG0H 1ZTJA 3F6UH 3M37A 4HZHA 1TWXB 3DSOA 3SBKA 1NO9H 6LPRA 1P02A 5EW2H 2AFQB 4U01A 1QQUA 2AMQA 3GS9A 3RXKA 1A46H 1P57B 2J34A 4BNRA 1BB0B 2JIZD 3IWMA 2BY9X 1SGRE 4O3UA 2GCHF 4AB9A 1FY4A 4D7GA 1PQ8A 1O31A 1DXPA 2TBSA 4FUEA 3SQHE 3PYHA 1SOZA 2F43B 3T5FH 1O2NA 1LCYA 4I32A 1QRXA 2QV1A 5CHAB 3BTGE 1AFQC 3T25A 1SVPA 4FU8A 4D8NA 1A3EH 2P16A 3BIVH 2O8LA 2QC2A 3BG4B 2SFAA 4KTSA 1FNIA 2VIVA 1YKTA 1TGBA 3F3BA 1ZRBA 3MH4A 3T26A 2XC0A 1RTKA 4UD9H 3RMOH 2BD3A 2WINI 4FU7A 1BJVA 3Q3KA 1GJ9B 2TRMA 2GZ7A 4Q80A 1KLTA 2GP9B 2J98B 5E0GA 1O3OA 2DUCA 2ZO3H 1SFIA 5HYOA 2FM2A 1ELDE 1BRAA 4RN6A 2EA3A 4X6MA 1A5GH 4X8UH 1GL0E 5C94A 1JWTA 1ZPBA 2BTCE 2BD2A 1CT4E 1BCUH 1ZMJA 2ZWLH 3TGJE 1QB1A 3TK6A 2GKVE 1QA0A 4Y71A 1TIOA 2BDHA 1YBWA 3RMNH 3M3TA 5EXNA 4TPIZ 1P05A 1C1PA 4X1PU 1W12U 2Y81A 1FY3A 4UDWH 2BYAX 1DITH 1ZJDA 1C9PA 2O8MA 4K8YA 1IQEA 1C1RA 5JB9S 3FO8D 4BTUB 3VGCC 2STAE 1P2MA 3PMJA 2NU2E 4X1NU 1MKXH 2STBE 1LVMA 4WXIA 1T31A 2CHAC 3SI3H 4X2XA 2OLGA 1Z71A 4X6OA 5C5OA 1J15A 3R0FA 1G3CA 1K9OE 1TGCA 4JK5A 2GDDA 2HLDD 3RP2A 2OXSA 5FPTA 2W6ID 1TA2A 1O3NA 5LH8A 1S85A 4D76A 3PM3A 4X1QU 5DKMA 1Q31A
chains in the Genus database with same CATH topology
1QJ1B 3ZZ9A 1VJAU 3SJKA 4O9VA 4MG3A 1HUTH 1MKWH 2WV5A 1O2IA 1RIWB 3FP6E 1VITG 4F49A 3E3TA 3KQEA 4TPYA 2C3SA 1NRRH 4GHTA 2BY5X 5A8YA 3A7XA 3SJ8A 5DP9A 1WSSH 1F0RA 4J1YA 1Z8JB 5GJ4B 3EQ0H 1GDNA 5GCHF 3A87A 4ZHMU 3VB7A 1CHOG 1GMDF 3H7TA 4J2YB 2GTBA 4MNXA 2PFEA 4HFPB 4I31A 4FUDA 2Z94A 1ELGA 1ZHPA 2OD3B 1NU9A 1N6YA 1C1QA 3ZYEA 1S5SA 1EZXC 3QZRA 1T7CA 2BDIA 1JRTA 2WPKS 3ATIA 5FAHA 1O2LA 4XOJA 1TMTH 1JBUH 1TNIA 5FCKA 4BOHA 3SUDA 2PWXA 1C5QA 3NCLA 1SGTA 2G5NA 1C5LH 3M7QA 1SI5H 3U8RH 4O97A 1UJ1A 4LZ1H 2ZDVH 4Q2KA 3LDXH 3SV6A 4E05H 1NRQH 2YOLA 3H7OA 1KTSB 4X6NA 3UUZA 2H1UA 1AFEH 1IQNA 1DPOA 4Y6DA 3K65B 2BD7A 2FXRA 1YC0A 3AW0A 1GBHA 2BX4A 1WAYB 2ZHDA 3GCOA 1H9LB 2RDLA 1FXYA 1IHSH 3LONA 4H6TA 1PPBH 4AG1A 1Y8TA 1ABIH 1TBZH 3M5LA 5EG4A 1HAYB 4UFDH 1C5YB 3D65E 1QGFA 1GJ6A 1O3JA 4TY7A 2QXIA 1VGCB 2WYJA 1GBCA 2ZPQA 5I25A 1O2RA 2FI3E 1NU7B 1C2EA 1NN6A 5JPMH 1DOJA 1HJ8A 4ISLA 2A5AA 1XVOA 1C2JA 3RXEA 1F5RA 1UTPA 1IHTH 1C5NH 1LPKB 3TJVA 2GV6A 1ELTA 1TRMA 2PTCE 2R3UA 4AFQA 1DVAH 1MTWA 4H4FA 1H9IE 5A0AE 4K2YA 1IQHA 1LKBA 1A7SA 1DANH 4UEHH 4DW2U 1P0SH 3F9EA 2J92A 3F9FA 1TNHA 1HB0B 8GCHG 2SGEE 4I8KA 1U6QA 1GBIA 2BXUH 3AAUA 3TJUA 2G81E 4OS7A 2FOAA 5E8EH 3PLPA 3BTKE 2ASUB 1W8BH 1W0ZU 1OWDA 2HNTC 2B5TB 1HXEH 1NZQH 2BMGB 2BDYA 1EB2A 1GBAA 2I6SA 2XC5A 2ZP0H 2ANKH 1JOUB 2LPRA 3MI4A 5GDSH 4I8JA 3OY5U 9ESTA 5C2ZA 1Y5BT 2XWBI 5T6GA 1CGIE 2BD5A 2ODYB 3A89A 4JZIA 1GJ4H 2BVRH 1GMDG 1ANDA 3P8NA 3LGIA 1O34A 3MNXA 4R8TB 2FODA 4HI3A 2BY6X 1D3QB 4GCHG 1GI7B 3ELAH 3P8FA 4JZDH 4H42U 4E7RG 3SUGA 5A8XA 1YPLH 4UFGH 3GYLB 3BTQE 4AZ2B 3PLKA 2Q6FA 3FZDA 1C2HA 3EA9A 1ESTA 4Y79A 2ZC9H 1O2WA 4AORA 3SOSA 1FAXA 1FLEE 2IJOB 2BX3A 1O5EH 4ZH8A 3IITA 5EQQA 2Z3CA 1J16A 3KIDU 3BEUA 3V7TA 3PMBB 1C4U2 2NU0E 1MTUA 4INKA 1UTMA 1SGDE 1NTPA 4NGAH 3S9AA 1RTFB 1HYLA 1EPTA 1SBWA 4X0WU 3LOXA 1T8OA 3ODDA 3BTHE 2VIPA 4OS1A 3QTOH 2Z3DA 1IQKA 4I8GA 2VIOA 2Y7ZA 1O3BA 4JCNA 4JYTA 5FBEA 2ALPA 1CBWB 1TPPA 1Y3XA 2ZA5A 1PPFE 1G2LA 1PPEE 3ZZAA 3UFAA 3E16B 4ISOA 5ABWA 2GMTB 7GCHF 2BLVA 2A4QA 2BD8A 2PSYA 3NWUA 1TPSA 1GJ7B 2SNWA 4X2VA 1O35A 3O8RA 1WV7H 1MKWK 1TPAE 1Y3YA 3UY9A 1C5XB 5CMXH 1FUJA 1G9IE 3SNBA 1C1VH 2Z7FE 1GCDA 2A45B 1L1GA 3E1XB 1E37B 1UK4A 1BA8B 1AHTH 3Q3YA 1AQ7A 1OWEA 3TLOA 2FESH 1PQ7A 2PR3A 4NWKA 3KQDA 1P2KA 1YYY1 3RC5A 2ZIQH 1NM6A 1YM0A 3LPRA 3E0PB 1SPJA 1Z7KA 3ZVGA 5G4BA 1GGDC 1BBRK 2FOGA 1DLKB 4NA7A 5ESTE 3ZV8A 1IQIA 2VVUA 2UWOA 5BRRE 1XMNB 1C1SA 2BQ6B 1LVOA 3QK1A 3EA8A 2BQWB 3SJ9A 1HPGA 1BUIA 4NIVA 6CHAC 1VCWA 1K2I1 2PKSB 5FPSA 2FS8A 1V2RT 1GCTC 3RC4A 2A0QB 3S9CA 1O3IA 2GX4A 3GYMA 2RG3A 1BQYA 3SU0A 2A2XH 3RXJA 2ODPA 4WJG2 1QHRB 1Q2WA 4NG9H 2FI4E 5FXLA 3SGAE 5JBTA 1SLVB 2ZDNA 4AYYB 1ZTLA 2HWLB 3KCGH 1SC8U 1V3XA 4Y76A 4JZEH 4NCYA 1FJSA 1PPCE 2VVCA 3SU2A 3BTFE 3M5NA 1ANCA 1TNKA 1YPMH 3ZVDA 3A82A 4TWWA 1O2UA 1H1BA 4CBOA 1EX3A 2B7DH 3ZVEA 2F9VA 1GHBF 2AS9A 1C5SA 2WPJS 1GI2A 1UCYH 2F91A 3ZZ7A 5J4QA 2W26A 5T6FA 4Y11E 3UPEA 3T62A 3DUXH 2VH0A 1O2PA 2C8XB 3CP7A 3FFGA 1HJ9A 1G30B 2J38A 1C2GA 1L4ZA 4MNWA 1C2IA 5LPRA 1AI8H 1WUNH 1GJAB 2P94A 3KN2A 1Y3UA 1IQGA 3MWIU 1XM1A 1LKAA 1P2IA 1O3KA 3GDSA 3MHWU 4KTCA 5PTPA 3LH3A 4AN7A 1CE5A 4KTUA 1GMCF 1ZSKA 2GVFA 1K1NA 1W14U 1O2XA 1KXFA 4NSVA 4B1TA 1EAWA 4XBBA 3PROA 1SMFE 1DWBH 3A83A 1P9SA 1EAIA 2FI5E 4FUHA 2AMPA 1LPGB 1NS3A 1FMGA 1GVKB 2HVXA 1S6HA 3V3MA 2BQ7B 1O2TA 3T2NA 2P3FH 1ZRKA 4DGJA 2DE9A 4K60A 1AZZA 1L1JA 1W0YH 1ZOMA 2P3UB 2ZFSA 4YO9A 3ZZ6A 3RXHA 2BDAA 2SGAA 3QDZB 1BTPA 1XUIA 1UTKA 1D3TB 3VXFH 5K0HA 3MOCA 4K5ZA 1ZGIA 4TY6A 2CN0H 2BLQA 2ZI2H 1OP8A 1P12E 1GHWH 1F92A 3ZZ8A 5L6NH 2ZNKH 2VIDA 3S9BA 2FX6A 4TYDA 1ELEE 3E91A 3QO6A 2YNAA 1GBFA 1MKXK 3VB4A 4JMYA 3MNSA 1P3CA 1JIRA 1GVLA 2M5TA 3KHVA 3ZVAA 2Y5HA 1PYTC 4INLA 5TJXA 1LVYA 3ATWA 1F5LA 1OX1A 1BTZA 1C5ZB 2XNIA 2OC7A 2A2QH 3KGPA 4BXWA 1YPHC 2HGTH 2ZDAH 3RXIA 2GDEH 1QB6A 1AB9C 1GDUA 3N7OA 1S6FA 1OYTH 3C27B 2PKAB 1GHVH 3Q00A 2JETC 4IGDA 2FYQA 3RUOA 1INCA 1MBMA 1QY6A 2ZQ2A 3T29A 4K69A 2Y82A 2HPQH 1IQMA 3GY4A 3LC3A 4SGBE 4YT7H 1ELAA 2TIOA 1TGTA 1OSSA 3HGPA 4ZKOU 1P8VC 5CHAC 1QJ7B 1LMWB 1AKSB 4OGXA 1DSTA 1MCVA 2G4UA 2G5VA 1SHYA 4BAQB 3TJNA 1YPEH 3UTUH 3FVFB 3KNXA 1GI3A 3OU0A 1CT0E 2BDBA 4YESB 3TPIZ 1RFNA 2A7HA 1NPMA 1Z1JA 1N1LA 4ZKNU 1X7AC 2EI6A 7GCHG 1MAYA 1S84A 5A2MH 1VZQH 1GMCG 3QTVH 1O5DH 2CF9H 1SQOA 2Z9LA 1C4V2 3LGYA 1AIXH 1DDJA 1EPTC 3VB5A 2CGAA 1L2EA 1DFPA 1GJDB 2GT7A 2PUQH 3DFJA 2PKSC 5DP5A 1SB1H 1NRNH 1S0QA 3ZVCA 3LJOA 1T4UH 4E06H 1NT1A 2EI7A 3K6ZA 1EAXA 2SGQE 2BD9A 3SU6A 1NROH 2BHGA 2ZFRH 3EAJA 1Q3XA 1G3EA 1ELBA 3TGKE 4ZMAH 1V2KT 5SGAE 2NWNA 5AF9H 3LGTA 4FUJA 1C5TA 2ZU2A 1H9HE 1QL9A 3D23A 3A7YA 1AUTC 1D3PB 2ANYA 1SGQE 1Y5AT 1KDQB 2ZEBA 3VFEA 2FP7B 3U9AH 2FO9A 1A1RA 1P2QA 1P03A 2FOMB 1GMHF 3OTJE 3BG8A 2XBWA 1DT2A 2ZDKA 2G8TA 3GICB 2C90B 2D1JA 3S7KB 4KELA 1XUKA 3A7WA 3FANA 1Z6EA 1EKBB 1F7ZA 5GWZA 3GCHC 3SUFA 4JZFH 3WY8A 1SGFA 2BLOA 1EJAA 1F0SA 1UVSH 1VITH 5FPYA 2VB0A 3ZZCA 1EB1H 1YPJH 2ZFTA 1DICA 4FXGH 2PKAA 4YM9A 1GI0A 1G2MA 1BMMH 4A7IB 1FDPA 1ZPCA 2TGPZ 3DA9B 2FTLE 3ZVBA 3NZIA 3EDXB 1YPHE 2G51A 1AN1E 1MCTA 2ZECA 2A4GA 3M35A 5JDUB 4M7GA 1LVBA 1EXFA 1AVWA 2QF3A 3JZ2B 3SJIA 2Y7XA 2GCHG 5EXMA 5E2OA 2HALA 4AFUA 3GCNA 1KXBA 1MTSA 3E6PH 5DP6A 3PV4A 4CH8B 2EC9H 5B6OA 4I8HA 1HLTH 3GY7A 2W7UA 2VH6A 2VWOA 4FUCA 3H5CB 2HPPH 2P93A 1KLIH 1OKXA 4Z6AH 1O3LA 2QY0B 2VJ1A 4A92A 1V2QT 1IQFA 3TIUA 1ETTH 3DHKH 1V2ST 3ESTA 5FCRA 3RXSA 3ZV9A 3P17H 2ZGBH 1JXPA 3RXDA 4CRDA 4NFFA 1XXFA 1UMAH 2NU4E 1VR1H 2H9EH 4NA9H 3UOPA 4DY7B 1FZZA 2R9PA 2TGDA 1QBVH 3A8CA 1OS8A 2V3HH 1THRH 3GY6A 3LGUA 2P8OB 1MAXA 3ZVFA 3CENA 4MNYA 1QB9A 1TRYA 2XTTB 4QT8C 3UIRA 3V12A 1HAOH 3LC5A 3SO3A 4OS5A 4LOYH 2ZHFH 1LQEA 1A5IA 1V2JT 1EJMA 2JH0D 4UFEH 1S82A 2ZU5A 4ZHAA 4CRGA 3ZZBA 1RJXB 2ZU3A 3LKWA 3W95A 1C5PA 3TK9A 4A1TA 3P8GA 4B75A 1T4VH 1O39A 1QCPA 1OP0A 1O3AA 4YT6H 3RM2H 1HAGE 2JETB 3MO9A 1OP2A 1MBQA 1CBWC 5EQRA 2P3TB 3SNCA 1K1LA 2D26C 4ABAA 3RXGA 1O5FH 3ZZ4A 1CHGA 2H2ZA 2PGBB 6GCHG 4X1RU 3MYWA 2PUXB 1ABJH 4GCHF 2PV9B 3T27A 3STIA 4B2BA 2BB4A 1PYTD 2SGDE 2FOFA 2R0LA 5C3NA 2ZFFH 3ITIA 2XXLA 1UVOA 4GHQA 4F4OC 1SSXA 1MUEB 1XVMA 3PB1E 1MZDA 1N8OB 4DIHH 1FAKH 1JRSA 2CF8H 1MD8A 3VB3A 2Z9IA 4MQAA 3P70B 1CA0C 4JK6A 5EW1H 3URCA 4VGCC 4UE7H 4UONA 2GGVB 2QA9E 1YPGH 1EPTB 1T32A 1GI4A 1EZQA 3ATMA 4U32A 5HGGA 3DD2H 1YCPM 2XWAA 2CXVA 1DXWA 1C4Y2 1DX5M 3PTBA 2K1QA 5JYIA 5F03A 1ETRH 2V6NA 1GBBA 1XUHA 6ESTA 2XBYA 5DO4H 2A4OA 1FI8A 3E8LA 3GCTF 1IOEA 3RXRA 3QX5H 1H8DH 1J9CH 1J14A 1BBRE 3MNBA 3SV2H 1SOTA 4ISNA 4MVNA 3SGQE 4D7FA 1AKSA 2ANMH 1FIWA 1T8LA 3SZNA 1SFQB 2B8OH 1SGNE 2ZCLP 1TBQH 2FEQH 5DP7A 1V2PT 3ZZ3A 4MTBA 1O2KA 2GCTC 1LDTT 3P8OA 2ZGCA 1W7XH 3PO1B 1AZ8A 2WYGA 3BTDE 3L3TA 2FTMA 4JZ1A 2KAIB 5EXLA 3RLWH 4ABFA 5FX5A 3HPTB 3C1KA 2KAIA 1OWKA 3SW2B 3SHAH 1NRSH 1UTQA 4NIXA 3B23B 4X8TH 4ABIA 1O5BB 1MH0A 2CMYA 3NXPA 2XBXA 1O2SA 1P06A 2QAAA 3BTTE 4O03A 2F9NA 2JH6D 1UVPA 1WCZA 5JBAS 1ZMLA 3UQVA 2FLRH 1BHXF 5C20A 1BMNH 5F8TA 5LGOA 1UTJA 3A7ZA 3MH7A 1C2FA 1QTFA 2OBQA 1D3DB 3RXCA 4ABJA 5HMAA 5IDKA 6CHAB 1HFDA 1TOMH 1UTOA 3MNCA 4RSPA 4Y0ZE 3O8BA 1WTHD 3K9XB 1BTUA 3W94A 1HIAA 1W10U 2CV3A 3BSQA 3M3VA 4FUGA 5GCHG 2BLWA 3S7HB 2ZDLA 1C1MA 1EAUA 1E38B 1YCPK 4MNVA 1EZSC 1AUJA 2OBOA 1GJCB 1ZYOA 2I6QA 1GJBB 1K1PA 1FN8A 2UUJB 4RKJB 1DY9A 2ZTYA 1E35B 4VGCB 3SV9A 5HXFA 1F2SE 2G00A 1GCTB 2VNTA 1F0TA 1UHBA 2P59A 4AYVB 1GJ8B 1B0EA 3BV9B 3RMLH 1EASA 2AGEX 4D9RA 1SLUB 4X2YA 3S69A 4CH2B 1W11U 1ZJKA 4ABEA 2PTNA 4H6SB 1RGQA 1BJUA 5EPYA 2ZFPH 2R2MB 1MMJN 3AW1A 1J8AA 1PPZA 2J95A 4LZ4B 1BRCE 1DLEA 1DUEA 1O3DA 1NFUA 2ZU4A 1D9IA 4FUBA 2AGGX 1NFWA 3UWIA 4AGJA 4XSKU 1YP9A 5BPEA 1JIMA 1W3CA 2W5EA 1WU1A 2BVXH 1AWFH 1UVTH 2ZPSA 1V2VT 1Z1IA 1O2YA 4WWYA 4CR9A 1LPZB 2GV7A 5E0JA 2ZKSA 1V6DA 1KXDA 3O8DA 1AD8H 2H5CA 4Y8XA 2BDCA 4O3TA 2VWNA 3A84A 2C4FH 4DCDA 1P01A 4U2WA 1A2CH 3GDUA 2F9UA 2WPHS 5LPEA 3E0NB 3A8BA 1LHFH 2W3KA 3EGKH 1V2WT 3A85A 3RXUA 4FVDA 4XBDA