1FN6A

Crystal structure of porcine beta trypsin with 0.1% polydocanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A02
1UVTH 4MPUA 5K0HA 3SI4H 2ZFSA 9LPRA 1XXDA 1O2UA 1HXEH 2CF8H 1XVOA 1VITH 5EQSA 1GI7B 3CS7A 5FCRA 4K2YA 3VB3A 1MZAA 1AMHA 1TPAE 4H6SB 1FONA 2OUAA 1OXGA 2G5VA 1DICA 2Y5GA 2UUFB 4U01A 3LDXH 1GJAB 1GWAA 1QTFA 1UTMA 2F9PA 3EA7A 2ZWLH 4WH8A 1HPGA 3MYWA 1TNIA 3E6PH 2ZDLA 4NGAH 3M3TA 1Z1IA 3TGJE 1P09A 3DD2H 4QT8C 1F0TA 1TPPA 1GHXH 3O8RA 4ABFA 2AS9A 3LC5A 4FUDA 1YF4A 1LQDB 3QTOH 1BBRH 1P2NA 1E0FD 1NFUA 1GHWH 1XM1A 3RDZA 1ARCA 1FN8A 2CN0H 1XUKA 4ZHMU 1RJXB 2R2MB 1HAGE 1O2YA 1UTQA 3K6ZA 3M3VA 2H1UA 4UFGH 1JBUH 1T8NA 5GXPA 3LJJA 3BEUA 2P95A 3QGNB 1THPB 1O39A 1ANEA 3F68H 1V3XA 4Y0ZE 5C2ZA 1ZLRA 1ZSLA 4XSKU 3UQOA 1SGFA 2JETB 2ZIQH 2GKVE 5T6FA 1GBFA 3V7TA 1IHSH 4RN6A 5FBIA 4KKDA 2ODQA 2VIVA 2PFEA 1C2IA 1W0YH 1KDQB 2OINA 1C5QA 2BYAX 1SGRE 6ESTA 3TITA 2PSYA 1NN6A 1RTLA 1SHHB 1NZQH 3FP7E 1ACBE 4Q2KA 3RXCA 1EOJA 3NWUA 1PPZA 2ZCKP 1SR5C 1F0SA 3NPSA 2Q6DA 5F03A 1ELAA 2BDIA 1PYTC 5HGGA 5A09A 2ANYA 3MH7A 4YLUA 3OY6U 5AVDA 1GHBF 2VWLA 3AAVA 4YT7H 3RXMA 3ATMA 1S6HA 5GDSH 4FUEA 5C67A 1HB0B 3KF2A 4X2XA 2JETC 5FCKA 1CGJE 1P06A 2FIRH 3M5LA 4Z6AH 2LPRA 3FVFB 1S0QA 3BTKE 3BN9A 3G01A 4NZLA 1DLKB 3JZ2B 2H5DA 4CRFA 1F2SE 1OYTH 1NU7B 5A0AE 8LPRA 2BY5X 3ZVFA 1SMFE 2VWNA 4NFFA 3RU4E 4X0WU 1GG6C 1W10U 2ZHDA 1YPJH 2GZ9A 3N7OA 1ESBA 1O2HA 2UUYA 3NXPA 2OCVB 2RCEA 5DP9A 1E36B 3BV9B 1Q31A 1TOMH 3QO6A 3KQBA 2H9EH 4AB9A 1P2IA 1RRKA 5DJ7A 2ZHEH 2A5KA 4JYTA 2SGFE 3SUFA 1GDUA 2LNCA 3A80A 4ABIA 1IAUA 1QBOA 4BAMB 3UY9A 4Y76A 1Y3XA 3EGKH 4LOYH 2TIOA 2XWBI 4X6PA 4GHQA 2PKAA 3TK9A 2P3TB 1P9UA 1Y5UT 4A5TS 4ZAEA 2KAIB 1BTHH 1D6WA 3BTHE 1TMBH 1V2TT 1GJCB 1GL1A 4DG4A 2PKSC 5F8XA 3RXRA 3NCLA 2OBOA 4MNXA 2FOFA 3RMNH 1OS8A 1K21H 1YP9A 1OKXA 1V2ST 3EQ0H 4I8GA 2ZGHA 2FODA 1S82A 4K60A 1HDTH 1ZRKA 3BTDE 1SGEE 3SV8A 1L0ZA 7GCHG 3UREA 3PMAB 3STJA 4YT6H 1LDTT 2QY0B 3GYLB 3SU2A 1EZXC 1C9TA 4ZH8A 1TOCB 2C90B 1VJAU 3RXQA 2Z9KA 1S5SA 3M5NA 4X6OA 1TPOA 1DWCH 1SQAA 3MO6A 2J38A 3AAUA 2WYJA 1BTZA 1Q2WA 4BTUB 3SNBA 2HNTC 1PPEE 3BTFE 1MTVA 1ZSJA 1H4WA 1BMNH 1W8BH 1IQIA 2P3UB 4RKJB 1G30B 2SGPE 1C5WB 3SO3A 3LGIA 1EX3A 1RGQA 4HI3A 1AO5A 1GVZA 1SHYA 4CBOA 2AYWA 1C1VH 2VJ1A 1AWHB 4I8HA 2BVXH 3A7YA 1O2MA 4X8VH 5CMXH 3TGIE 1LO6A 3MO9A 4B2AA 2EI7A 1HNEE 2AMQA 1ABIH 3MO3A 1FIWA 1NU9A 1NFYA 1O3CA 2H5CA 3TK6A 2WUBA 1A5IA 2A4RA 4JK5A 2VU8E 1S85A 4IN2A 1O30A 1YPGH 2VNTA 3C1KA 2NU3E 3KQEA 4FUBA 1D6RA 1B0FA 4OS6A 2P16A 6LPRA 2A45B 3ZVCA 1A46H 1O2TA 6GCHG 2GGVB 1O3NA 1K1NA 1Z8GA 3RXHA 1BMLA 3URDA 1V2KT 1WSSH 5B6OA 1GI5A 2WYGA 2SGEE 2OC7A 1TBRH 2STAE 1EKBB 1TX6A 1O36A 4D7FA 1D3DB 1O2RA 4DT7B 4XBBA 1MQ5A 3S7HB 2GV7A 4OGYA 1AE5A 1C5RA 2BLQA 3Q77A 1DX5M 2J9NA 3VB6A 3ZVBA 4O3TA 1O2WA 1QGFA 3DFLA 5FX5A 3RC5A 3H7TA 1VCQA 1AHTH 1GBBA 2Y81A 1GMHF 2OQ5A 1Y3WA 3VGCB 1O3KA 1RXPA 3VEQB 1BOQA 2FPZA 1BB0B 3SUEA 1YBWA 1GJ9B 3T28A 1GBHA 1GMDG 2FEQH 2Q6GA 1FUJA 1TRMA 2VINA 4ZKOU 1C2MA 1GBKA 2GVFA 1NT1A 1SGPE 1W7XH 5HMAA 4X1RU 3RXFA 1QR3E 5HM2A 1GI8B 1NESE 1ANBA 1EXFA 4ZHLU 1Y5AT 1OWDA 3RP2A 4X2VA 4ABBA 5FPYA 4I8KA 4AG1A 3HATH 3PLPA 5E0GA 3RLYH 3P8NA 3MNBA 3R3GB 3ELAH 3VGCC 3RXVA 4WY3A 1D3QB 1C1OA 5GWZA 2F3CE 3NK8A 2P93A 1P03A 1C1PA 3VXFH 2FOBA 1A2CH 2ZDAH 2PGQB 1TGNA 1PQ7A 3H5CB 2QCYA 4RKOB 5EU8A 1TA2A 2P3FH 1C1TA 5FBEA 1A3EH 2BD8A 1AI8H 1N6YA 4J1YA 2RG3A 2BX4A 1V2JT 5CHAB 1BRCE 1OP0A 3VB4A 3OU0A 3LH3A 2C8WB 3F1SB 2PW8H 3ZZ5A 1WBGB 5EGMA 1SL3A 3BTEE 1LHEH 4U30A 2GDDA 1P8VC 2EC9H 5E0JA 1BQYA 1FZZA 1GJ8B 1AWFH 1FMGA 1L4DA 1UVOA 1NY22 1ZGVA 2VVUA 1C5VA 1K28D 5JBTA 5L2ZH 5DK1A 3A87A 3PTNA 1H9HE 2P8OB 1UTNA 1YPLH 3DFJA 2WPJS 3A84A 5DP5A 1UVSH 2BD4A 3F9EA 2ZZUH 3RC6A 1TYNA 4ZMAH 3UTUH 3TH4H 4KGAA 1JWTA 1P2OA 1O3EA 2R3UA 4LZ1H 2FOMB 1AFQB 1BTWA 1Y3VA 3RXIA 3GICB 3ZZ7A 2ANWA 3BEFB 5I25A 1GDQA 2ZGCA 4O03A 5TCAA 2O8LA 3SZNA 3P8FA 2ZHQH 3ZVAA 1LTOA 2QF3A 2ZF0H 1YCPH 3TJVA 1MU6B 1G37A 1SOTA 4FUCA 1TPSA 1HJAB 1FAXA 1C1UH 3K6YA 4AFSA 4TY6A 1ESTA 4A1VA 2P8OC 2M5TA 7KMEH 1MKXH 1Y3UA 4NG9H 4VGCC 3SU4A 4AX9H 4TY7A 2KAIA 3PLKA 1GMCG 2BMGB 1BZXE 3HPTB 3LC3A 4UFFH 5AFYH 3UR9A 4CRAA 1YPMH 1S84A 4FVDA 3SW2B 5JBAS 1AFQC 3R0FA 2J92A 4NFEA 2WPIS 1WQVH 1DPOA 1EAXA 2R0LA 2ZGXH 2SGQE 5J4QA 1P2KA 1MAXA 1YC0A 1C9PA 1O5GH 2OBQA 3EAJA 2QC2A 2C8ZB 1AB9B 2VGCB 2VVVA 3E3TA 3RXTA 2CV3A 3SNDA 3O8CA 3UR6A 2QIQA 2GX4A 4JZFH 1VITF 1HYLA 1HJAC 4WMFA 1A3BH 3P95A 3KQCA 1F0UA 2B8OH 2W3IA 1D3TB 1CO7E 4D9QA 3QZRA 1ESAA 1GBEA 3RXBA 2EEKA 3CP7A 1GHAF 4X1NU 3U69H 1C4U2 4A7IB 4Y8YA 5EOKA 4NIWA 1FN6A 4WVPE 1SLWB 3SV9A 2FI5E 1Z6JH 2ODYB 4E7NA 2QA9E 1O2GH 4DCDA 3T5FH 3GCNA 1GBDA 1O3BA 1O2SA 3LGVA 4FU8A 1DFPA 1O5AB 1S0RA 3ESTA 3AW0A 3V12A 2ZTXA 2SGAA 4CREA 1P3CA 2VGCC 1ELEE 2ZU3A 1BTXA 1C2DA 3IITA 1F7ZA 1OP8A 5EQQA 1HGTH 1ZMJA 3BTQE 1BRUP 1C5XB 4OGXA 1GI2A 1BMMH 1LHGH 3SQEE 1GI9B 2F91A 2A2XH 1C2HA 1XVMA 1VR1H 3MHWU 1EPTB 1TBQH 2SNWA 4ABDA 1GBAA 3SJ8A 2D1JA 3GY7A 1IQFA 4X2WA 2ZHWH 2A5IA 2PUXB 3ZYDA 1PPFE 5DP8A 3HK3B 1H8IH 2W5EA 5A8ZA 3TGKE 1G3EA 1O31A 1KLTA 4ZKSU 5GJ4B 3KNXA 1IQLA 1P02A 4ABHA 1GJ7B 3TU7H 1C5NH 1C5ZB 1DE7H 1ZPZA 2ZFTA 3T27A 5EPNA 1DSUA 2J94A 1SGDE 1OOKB 1QB1A 2ZDNA 4UE7H 1KXBA 3D62A 1GJ5H 1MUEB 1MMJN 2DE9A 5I46H 1EPTC 2Z6BD 2HALA 1A61H 1LPGB 4D8NA 2DE8A 1BCUH 1G9IE 1AZ8A 4ISIH 3UIRA 3SOSA 1YLCA 5T6GA 1OWHA 8GCHG 5FAHA 1WTGH 3A86A 5HXFA 4GCHF 1SGIB 3T29A 1PPCE 2YNBA 4JZDH 3U9AH 1HCGA 4U32A 3FAOA 1CE5A 1KXEA 1O2XA 1UCYK 2D2DA 2RA3A 4XFQA 2EA3A 2FX4A 4B75A 2ZU1A 4TPIZ 1UMAH 1GI0A 1OWIA 5L6NH 2SFAA 1GBJA 5FHTA 3P92A 1TRYA 1DWDH 1LHDH 2TGAA 1T31A 2ZFRH 2ZFPH 1CHGA 4CBNA 4IN1A 4K69A 1GI4A 4BXSA 5ESBA 3LH1A 2HPQH 3HKIB 4MTBA 2AERH 4FU7A 2C3SA 2FESH 1O3PB 3GISB 3TH2H 1IQEA 1BJUA 3E91A 3GY3A 1O2OA 4U2WA 3RXKA 1SBWA 7ESTE 4MDSA 1GCTB 5SGAE 3S9AA 1N6XA 4NSVA 1C5PA 1L1GA 4KTSA 2OTVA 3RXUA 1ELDE 1YGCH 2ILNA 3A7TA 4HFPB 1O5EH 1CVWH 2VWMA 3STIA 1QQ4A 1QRWA 2BD9A 4E05H 4H6TA 1PJPA 2FP7B 1SB1H 2BDCA 2C93B 1T32A 2EI8A 7LPRA 1C2JA 3MOCA 3SNEA 3L6PA 3GYMA 1SLVB 2ZGJA 1G3CA 4NA7A 2BY9X 4JMYA 3BEIB 1YPHC 1CA8B 4IC6A 3TJUA 1CA0C 1GG6B 2Y5HA 2J95A 1RIWB 4Q80A 1ETRH 3MTYA 2ZC9H 3SNCA 3TJOA 1GCTC 4GLYA 4BAHB 2FYRA 4AFZA 3MH6A 2ZTZA 4ZUHA 3DT0H 2Q1JA 1GGDB 1TB6H 2BZAA 2G52A 1TX8A 2WPKS 3I78A 1HRTH 1MTNB 2F9BH 1UTPA 2FS9A 2UUKB 3GOVB 3P8GA 4Y11E 3SJ9A 4Y8XA 1RTFB 5BRRE 1WCZA 1C2EA 1UTLM 4B74A 5AF9H 2BVRH 1BRBE 1MBQA 4NIVA 3SN8A 2ZECA 2NU4E 2BDGA 3U8TH 2P59A 1V2UT 4FU9A 1ZJKA 5FXLA 1Q3XA 1AE8H 1HIAB 2TPIZ 3SJOA 1BTUA 2Y82A 4FUGA 2PKSB 3M7QA 1RIWC 1O2IA 4AORA 1TABE 4IMQA 5EXNA 3F9GA 1GGDC 1NROH 5JBBS 5GIBA 3QGJA 1MTNC 2A4OA 3OTJE 3PROA 4MNWA 4X8SH 1D9IA 5G4BA 2UUJB 3SV2H 1XUGA 3RXOA 3U98H 2VWOA 3M5MA 2G4UA 1EAWA 1XUJA 3KCGH 2R2WU 4K1EA 2A4GA 5LPFA 1WUNH 3SV6A 1WQSA 3BIUH 5HYOA 1O5BB 4X1QU 4KP0A 1UJ1A 5H4IB 1NPMA 1XMNB 4E06H 1G32B 3UFAA 2EI6A 3O8BA 1AQ7A 2ZPQA 2ZCLP 3PB1E 1HUTH 2TGTA 3GCTF 3TPIZ 1T8OA 1MQ6A 1OX1A 2YOLA 1ETSH 1YCPM 4DIIH 1MZDA 1K1PA 3MH5A 4YZUA 1SPJA 3P70B 3QTVH 1QRZA 4BAQB 1AD8H 1LVYA 2HPPH 2Y5FA 3LIWA 4WMDA 4Z0KA 3PLBA 5JBCS 1GVKB 4YLQH 4NSYA 2F9VA 2D26C 6CHAB 3SHAH 1Z1JA 4ASHA 1QHRB 3PMJA 2WINI 2HNTF 1C1MA 1GI3A 1YPKH 1FY4A 3IG6B 2IN2A 2Z9GA 4BTIB 1T7CA 3A7WA 1O2ZA 2W7UA 4R8TB 2AFQB 1ARBA 2FLBH 3VXEH 3LOXA 5A0BA 3EA8A 1BMAA 3GDVA 2QXIA 2VVCA 2B9LA 4UFDH 1TMTH 1BDAA 1UTOA 4J2YB 2ZGBH 1T4VH 1EPTA 2ZQ1A 6CHAC 1YM0A 3MMGA 5EW1H 1AUJA 1C5OH 2BLOA 2VH0A 2CXVA 3MU0A 2FX6A 1J16A 1NRNH 2BDBA 1IQMA 1GHZA 4B73A 4GSOA 3RXPA 2GD4B 4UEHH 1SQOA 1JIMA 3P8OA 1O35A 3BTME 2PTNA 1UVUH 1G36A 2VIPA 4B71A 5DP4A 4INKA 2PGBB 2OP9A 2HRVA 2R0KA 4TWYA 5ABWA 1GHBG 5JDUB 1CGHA 5T6DA 3UUZA 2BD2A 2JKHA 3PV4A 2A5AA 1KLJH 2A7HA 2FTMA 1PQ8A 1KYNA 1WYKA 3GY8A 1FJSA 3PWCA 2PLXA 2PTCE 2V0BA 1WU1A 2IOTA 3A88A 3M37A 5DGJA 5PTPA 1SLXB 4F49A 1TQ7B 2HGTH 1FY3A 1QQUA 2PV9B 3TJNA 4O9VA 4MLFB 3ZZBA 3ZVEA 2BQ6B 3EA9A 1SGCA 1H9IE 1V2QT 1A0LA 1WV7H 3E0NB 3V0XA 1QL8A 1GJ4H 2OXSA 3ITIA 4KTUA 3EYDA 1DVAH 2BHGA 4XDEA 3GCHB 3RXSA 2BDHA 4DW2U 2ZTYA 1EZUC 1LMWB 5A8YA 3ODDA 2XC5A 1TX7A 4X6MA 5E2OA 1RD3B 2Z9LA 1O2JA 3P17H 1HAHH 1F5RA 3K2UA 3EE0B 3LGYA 4JCNA 2A2QH 5EODA 5DG6A 2JH5D 5A2MH 3V3MA 3S0NA 4K8YA 1CGIE 1GJDB 1JIRA 1PPHE 1HAXB 2FOAA 1INCA 1FAKH 1QCPA 1ZPBA 1QURH 1BRAA 1DY8A 1FNIA 1OWKA 3UNRA 1AGJA 3GCTG 5DPAA 1IOEA 1XX9A 2BOKA 4X6NA 3U8OH 3ZZ4A 4ABEA 1KDQA 1C2KA 3E0PB 3CS0A 3GCHC 3BTGE 3QX5H 3TK5A 1ZTJA 4H42U 1FDPA 2AGIX 2BX3A 1T8MA 1CQQA 1TGCA 2BXUH 4JZIA 4O97A 3A83A 3RLWH 4YESB 5GCHF 5F8TA 1A5HA 1V2MT 2FOHA 2AIPA 2PHBA 1EAUA 2TRMA 1J15A 1ZJDA 8ESTE 1MKWH 1GL0E 2ZA5A 1HV7A 4GAWA 1X7AC 1CSOE 1MTSA 3A85A 2BDYA 1H9LB 1BJVA 1EAIA 1XUIA 1IHTH 4LK4A 2K1QA 1C4Y2 1E37B 1MD7A 4I7YH 5ETXA 1ELCA 1V2NT 2BZ6H 4UDWH 5DKMA 2GDEH 4NZQA 1P57B 4VGCB 1HAOH 3MU4A 2ZFFH 1CHOF 4FUIA 1HIAA 1M9UA 5T3HA 1AVWA 2FI4E 1AVXA 1SGQE 3M5OA 1O34A 1MBMA 4WWYA 1KXCA 4YO9A 1TNJA 1K1IA 4PROA 3FANA 1PQ5A 1Z8RA 4JZ1A 4YOGA 1ELBA 1K1MA 4Q7XA 4AYVB 1QRXA 2F9UA 4THNH 4WF8A 1QY6A 4ZXXH 2H9TH 3A8CA 3DA9B 2CMYA 1TIOA 1DANH 1ABJH 1O2PA 1QA0A 1KTSB 3BSQA 2GMTB 3HGPA 1QBVH 3KEEA 2BY7X 1PYTD 5EG4A 1Z8JB 2Z3DA 2ZHFH 5LGOA 2BQ7B 2H9HA 3ENSB 2GV6A 1XUFA 2FDAA 5CE1A 5C1YA 2VH6A 1EJMA 1NTPA 2QYIA 2THFB 1FXYA 3OSYA 1BA8B 4ISNA 5ESTE 2ZDVH 2NU0E 1NC6A 1O5CB 2XXLA 1O2KA 4MPXA 1G2LA 4ABJA 1P05A 4B2BA 1K1JA 1LCYA 2PSXA 1F92A 1HAYB 2ZU2A 3ZZ9A 4Y0YE 1A1RA 1TONA 2DUCA 2HWLB 1EASA 1Z7KA 2SNVA 3A7VA 2GMTC 3SI3H 1HAVB 2Y6TA 4OS2A 2NWNA 1GMHG 1SOZA 1AIXH 1AFEH 3UPEA 4I32A 1U6QA 1ZHMA 3Q3KA 1KXDA 4D9RA 2J2UA 1OP2A 1DY9A 2UWOA 1FY8E 5LH8A 1HAZB 4AN7A 4B2CA 2ANMH 3LGUA 1BITA 1P2QA 1W12U 3S69A 4ZHAA 1BTPA 2HVXA 3E1XB 4RSPA 2TGPZ 2XC4A 3B8JA 1O2LA 2VB0A 1AU8A 1QJ6B 3IWMA 2C8XB 2PWXA 3I29A 2G51A 1SGTA 1V2OT 1KLIH 3UNSA 1LVBA 4HTCH 1P10A 1VGCB 2HLCA 3MNSA 1DUEA 1C1NA 2VIOA 2C4FH 4FVBA 1LQEA 1XUHA 2V6NA 1GJBB 1AN1E 1PFXC 1RS0A 1AY6H 3ODFA 2ODPA 4Y10E 5C3NA 4NWLA 1L4ZA 1ZOMA 2STBE 1EJNA 3MFJA 4CRBA 3KIDU 1LKBA 1FIZA 1FY5A 3S7KB 1O3JA 3ZV8A 2AH4X 2CHAB 4K1SA 2FZZA 3FFGA 4FXGH 3SUGA 4OS4A 1BUIA 2B7DH 1AKSB 1E38B 5AFZH 1GJ6A 4I8LA 3U1IB 1VGCC 5EW2H 2O8UA 3PM3A 4BAOB 1JXPA 1K9OE 3MU1A 2BXTH 5FPSA 2I6QA 1EATA 3RXDA 4BOHA 3WY8A 1EB1H 2AGGX 1SFIA 1SGFG 2QXJA 4I31A 2BVSH 3RM2H 4B76A 2Q6FA 3EDXB 3JZ1B 1AVGH 1PPGE 1W3CA 3LONA 2BB4A 3MU8A 4ABGA 1ZGIA 1TALA 4X2YA 2ZDMA 1CT0E 3RUOA 2FWWA 3FP8E 5FPTA 1UTKA 2BLWA 4F4OC 4ISHH 1EZQA 2OC0A 1P04A 5DP6A 1W11U 1TNHA 3NZIA 3TH3H 2CHAC 1FQ3A 2GT7A 2G4TA 1V2RT 2ZG0H 1DSTA 4HGCA 4CH8B 3C27B 1YCPK 1QL9A 1OSSA 1TWXB 3M7TA 1NFWA 3OY5U 1HAIH 1MKXK 3K9XB 1O37A 2AMDA 2SGDE 3LU9B 3TVJB 1DITH 2FI3E 2H6MA 4DGJA 3QN7A 4INHA 1FLEE 1TNGA 1C5UA 2Z3EA 1E35B 3ZZAA 3ZZ3A 1FI8A 7GCHF 1QIXB 2CF9H 4BANB 1A0HB 3SU6A 1C2GA 1OYQA 2O8MA 1FPCH 4O3UA 4OS1A 2XRCA 2FTLE 1C5LH 1ZTLA 3BG8A 3LGTA 1C5TA 5LPRA 2BD7A 1CA0B 2ULLA 1B7XB 2QGRA 1UHBB 1V2PT 3QUMP 3SU0A 9ESTA 4IC5A 4D7GA 1ANCA 3UQVA 2BQWB 4XBDA 3Q3YA 1O3IA 2BTCE 3QDZB 1OPHB 4DJZB 1IQKA 1CBWB 3QWCH 5C1XA 1MTWA 1C5YB 1D4PB 4MNVA 3SHCH 1O32A 2F9OA 1VITG 1A4WH 4BAKB 4DURA 3LPRA 2Y7ZA 1NRSH 3L3TA 3RM0H 1RTKA 1YPEH 4AB8A 1YLDA 3DHKH 2GZ7A 3OX7U 1GHAG 3A82A 2O9QA 5DO4H 2ZNKH 4UONA 1XKBC 4MG3A 1TRNA 2GZ8A 5DP3A 1WAYB 3QK1A 1Y3YA 3Q3XA 4TPYA 1EB2A 1GBIA 3MH4A 3GY2A 3TLOA 4Y7AA 2QN5T 2ESTE 1O3AA 1CBWC 1THRH 1GBTA 5C5OA 4JK6A 1EZSC 2ASUB 2XBXA 6GCHF 3H7OA 4AOQA 3VB5A 3PTBA 4Y7BA 1SVPA 2ZPSA 1KXFA 1P11E 4CHAB 2AEIH 1CT2E 3A7XA 1ZSKA 5A8XA 1DS2E 4FUJA 1O2VA 1J17T 3ZVDA 2XCNA 3MNXA 4AYYB 4NA8A 4ESTE 1ELGA 4LZ4B 3RU4D 4INLA 1O5DH 1J8AA 3A8AA 3M7UA 1GI1A 1ZHPA 4YOIA 1IQHA 1UCYE 2AIQA 2R9PA 2XNIA 3RC4A 2BLVA 1TNLA 5EQRA 2FM2A 1V6DA 4I33A 2ALPA 1DM4B 2ZDKA 4CR9A 1IQJA 2QAAA 2CGAA 2XTTB 4Y71A 3GCOA 4GHTA 3RMLH 3MNCA 3ZVGA 4NIXA 2R3YA 1N8OB 3GDUA 1SGNE 1L1NA 1HLTH 1N1LA 4ZKRU 1TQ0B 4CHAC 4MQAA 2FOGA 2F83A 3UOUA 1GMDF 1B5GH 4MNYA 4KTCA 1T4UH 3UNQA 5JB9S 2IJOB 3A89A 1LPZB 4FUHA 4E7RG 1ZMLA 1ELTA 1P2JA 3O8DA 3RXJA 4AFQA 2OLGA 1FPHH 1HAVA 1TLDA 1ZYOA 1O3DA 2A0QB 1MAYA 2OD3B 3PO1B 3CENA 3KQDA 4GCHG 4BXWA 2G00A 3SGQE 2A32A 1N8OC 4XOJA 1O3FA 4ABAA 1GHVH 1OWJA 4K8BA 1W0ZU 1BBRK 1QNJA 2JH6D 4A92A 2PUQH 4MPVA 1AUTC 2OQUA 4Y6DA 3SU1A 2CJIA 4X1SU 1ELVA 2Y80A 4M7GA 2F9NA 4YOJA 2TGDA 2GT8A 2W3KA 4IBLH 2D8WA 1LHFH 1QL7A 3P6ZB 5EPYA 3B23B 1BIOA 3T25A 2WPMS 1TE0A 1MCVA 3PO1C 3OYPA 4Q7ZA 1LVOA 1NFXA 1NRPH 1Y5BT 1A7SA 3HKJB 5F8ZA 5TJXA 3GY4A 1S6FA 2G55A 3D65E 3MU5A 4DIHH 4WMEA 3BTWE 4B1TA 3SQHE 1LPKB 3D23A 1UVPA 1Z6EA 1GBMA 4Q7YA 3SJKA 3A8DA 3LJOA 3MI4A 5EXLA 2HOBA 1MTUA 1AKSA 2BY6X 1W7GH 3NUMA 1ZTKA 5JPMH 2OC1A 1IQNA 5IDKA 3RXAA 3A8BA 1ORFA 2FXRA 3T2NA 2V35A 4HZHA 1NRRH 3PWBA 1K2I1 3SBKA 5LPEA 3SU3A 1BTYA 3S9CA 2FOCA 1B0EA 1TGBA 1THSH 4H4FA 3V13A 3F9FA 1O2QA 1SLUB 3L33A 3RU4T 3QZQA 4NA9H 1SFQB 2W7SA 5K7RA 3SV7A 1OWEA 1V2LT 2ALVA 3LGWA 3K65B 1K1OA 2XBVA 5E0HA 2NU2E 1FV9A 3KGPA 3LKWA 1BHXB 2ZQ2A 3BG4B 3VPKA 2IPHA 1ZMNA 1G3DA 1ZHRA 1UK3A 1SGYE 2G8TA 1TA6A 1GMCF 4UFEH 5J4SA 1SC8U 4D76A 1KSNA 3ZV9A 1QBNA 1CT4E 3KHVA 4FUFA 1Y8TA 1W14U 1QJ7B 2VIWA 3ZYEA 1UK2A 4WXIA 1GI6A 1BHXF 1DT2A 1GBLA 4X8TH 1RFNA 3W95A 4CRGA 1NM6A 2BD5A 2H2ZA 2Z9IA 2XC0A 2NU1E 4IGDA 3ATKA 1BBRE 4AGKA 1C5MD 1QB9A 5TCCA 1F5LA 2B5TB 2GCHF 3BIVH 4I8JA 2J34A 5EXMA 1MCTA 1G2MA 1O3HA 3ZZDA 2RA0A 5E2PA 1QJ1B 3BG4C 1VCPA 4AFUA 1H8DH 3QLPH 1UHBA 4GPGA 2ZU4A 2V3HH 2FLRH 2J4IA 2FS8A 3M3SA 3PMHB 1HBTH 3PMBB 3TNSA 2A1DB 3ATIA 3BF6H 8KME2 2ANKH 1NRQH 3RXLA 2JH0D 1GHYH 3TNTA 2WPLS 2AMPA 1EP6A 1HJ8A 2UWLA 5JYIA 1O3LA 2A4QA 1C2FA 1TNKA 2FMJA 2XWAA 1S83A 2I6SA 4X8UH 3VB7A 4MVNA 1YKTA 3AASA 1F5KU 3F6UH 1LKAA 4CRDA 1MU8B 3SORA 1V2WT 1LVMA 2WPHS 2WUCA 4WJG2 2FOEA 2QXHA 3GDSA 3FZDA 5JB8S 4JZEH 3M35A 4DOQA 3T62A 3SGBE 1JMOH 2GTBA 1TGTA 1K22H 3E16B 4BTTB 1MH0A 3M36A 1L2EA 2TBSA 3RMMH 1Z8IB 3DUXH 5BPEA 1EUFA 1O3MA 4NWKA 1P0SH 1J14A 4ISOA 4YM9A 3RXEA 3E8LA 2GCTB 4NIYA 2Y7XA 2G5NA 4KELA 1DUAA 4GVUA 5HM9A 4CRCA 2ZFQH 1XKAC 1D3PB 1TMUH 2ZO3H 2BY8X 3F9HA 3UOPA 2XBYA 1WOFA 2B0FA 2WV4A 3ZZ8A 2GP9B 1PQAA 2O8WA 3Q76A 2XBWA 1UTJA 3GY6A 1C2LA 1T8LA 1KXAA 2A7JA 1E34B 3VFEA 2ZKSA 4R0IA 5CHAC 3SUDA 2BM2A 2GCTC 1GVLA 4TYDA 3URCA 1TGSZ 1WTHD 2Z9JA 8GCHF 1QFKH 1O5FH 2W26A 4XBCA 1DWEH 1S81A 4IMZA 4A6LA 4IW4E 3D49H 3GY5A 3MWIU 1KTTB 2RDLA 4TWWA 1TBZH 1L1JA 2ZP0H 1QB6A 5FX6A 1W13U 2ZEBA 4SGBE 1DWBH 4A1XA 1IQGA 1BT7A 1HFDA 2BDAA 1JOUB 1VJ9U 1YPHE 3AVZA 4DVAU 4Y79A 4WXVA 5AHGH 3B9FH 4ZXYH 3W94A 1O3GA 4A1TA 1UCYH 2O8TA 5F6MA 1C1WH 4AG2A 1JRSA 3KL6A 3I77A 4AGJA 1ELFA 1H1BA 1P2MA 2G81E 5DP7A 1FY1A 1ZPCA 3A81A 1CU1A 3PYHA 4JYVH 1SG8B 2BD3A 3KN2A 1P3EA 1ZRBA 3RXGA 2C8YB 1KY9A 2BOHB 2PKAB 2ZCHP 3HK6B 2A31A 1TAWA 3U1JB 4DY7B 1GCDA 3ZZCA 3FP6E 1F0RA 2FO9A 1DOJA 3S9BA 1QA7A 4ZKNU 3E90B 4X1PU 2Z94A 5C1UA 3SJIA 5A0CA 1JRTA 3SU5A 2GCHG 1V2VT 2AGEX 4K5ZA 4JYUH 3M61U 1DXPA 1A0JA 1ZZZA 2FYQA 4OS7A 4IS5A 1O0DH 3A7ZA 1SSXA 3ATLA 5L2YH 4K1TA 1GBCA 4CR5A 1C1SA 1PPBH 1UO6A 1Z71A 1XXFA 1A5GH 1VZQH 5IYTA 2UWPA 3U8RH 4YTAA 4SGAE 1K1LA 4K3JA 1NS3A 1C4V2 1J9CH 5C20A 4GUXA 1AB9C 2ZPRA 1P12E 3AW1A 1MKWK 1HJ9A 2XCFA 4NCYA 4Y8ZA 3TIUA 1O33A 5L30H 1G3BA 1NO9H 1ID5H 2QF0A 1C5SA 5GPIB 2XYAA 1C1RA 1O38A 1GDNA 1YYY1 3ATWA 5GCHG 2YNAA 1KIGH 4LXBH 1SI5H 1GPZA 2XW9A 1UK4A 1EP5A 3SGAE 4CH2B 2WV5A 4WH6A 1Y59T 1DLEA 3Q00A 4ISLA 1P01A 2V3OH 3T26A 3UWJH 1LHCH 1MD8A 3BTTE 4UD9H 2A7CA 4AZ2B 2QV1A 3HGNA 3LT3A 1EQ9A 2QXGA 2ZI2H 1DDJA 4BNRA 1TFXA 1DXWA 1W2KH 1EOLA 1HAPH 3RMOH 3SNAA 1C1QA 4MPWA 4ZROA 3NKKA 1CHOG 2VIQA 2OC8A 3ZZ6A 1HXFH 2HNTE 1ANDA 5E8EH 1ZR0A 4XE4A 5C5NA 1O2NA 1AZZA 2VIDA 1P9SA 2PR3A 2Z3CA 2P94A 2Z7FE 1SQTA 3FZZA 4OS5A 1ETTH 1EJAA 2ZU5A 1O3OA 1VCWA 3UWIA
chains in the Genus database with same CATH superfamily
1UVTH 4MPUA 5K0HA 3SI4H 2ZFSA 9LPRA 1XXDA 1O2UA 1HXEH 2CF8H 1XVOA 1VITH 5EQSA 1GI7B 3CS7A 5FCRA 4K2YA 5C94A 3VB3A 1MZAA 1AMHA 1TPAE 3N7EA 1FONA 4H6SB 2OUAA 1OXGA 2G5VA 4B6EA 1DICA 2EQNA 2Y5GA 2UUFB 4U01A 2QF5A 3LDXH 1GJAB 1GWAA 1QTFA 1UTMA 2F9PA 2WHXA 3EA7A 2ZWLH 4WH8A 2HVYB 1HPGA 3MYWA 1TNIA 3E6PH 2ZDLA 4NGAH 3M3TA 1Z1IA 2WSSD 3TGJE 1P09A 3DD2H 4QT8C 1F0TA 1TPPA 1GHXH 3O8RA 4ABFA 2AS9A 3LC5A 4FUDA 1YF4A 1LQDB 3QTOH 1BBRH 1P2NA 1E0FD 1NFUA 1GHWH 1XM1A 3RDZA 1ARCA 1FN8A 2CN0H 1XUKA 4ZHMU 1RJXB 2R2MB 1HAGE 1O2YA 1UTQA 3K6ZA 3M3VA 2H1UA 4UFGH 1JBUH 1T8NA 5GXPA 3LJJA 1UW7A 4F55A 3BEUA 2P95A 3QGNB 1THPB 1O39A 1ANEA 3F68H 1V3XA 4Y0ZE 5C2ZA 1ZLRA 1ZSLA 4XSKU 3UQOA 1SGFA 2JETB 2ZIQH 2GKVE 5T6FA 1GBFA 3V7TA 1IHSH 4RN6A 5FBIA 4KKDA 2ODQA 2VIVA 2PFEA 1C2IA 3FKSD 2J5UA 5GNDA 1W0YH 1KDQB 2OINA 1C5QA 2BYAX 1SGRE 6ESTA 3TITA 2PSYA 3SYJA 1NN6A 1RTLA 1SHHB 1NZQH 3FP7E 1ACBE 4Q2KA 3RXCA 1EOJA 3NWUA 1PPZA 2ZCKP 1SR5C 1F0SA 3NPSA 2Q6DA 5F03A 1ELAA 2BDIA 1PYTC 5HGGA 5A09A 2ANYA 3MH7A 4YLUA 3OY6U 5AVDA 1GHBF 2VWLA 3AAVA 4YT7H 3RXMA 3ATMA 1S6HA 5GDSH 4FUEA 5C67A 1HB0B 1YWUA 3KF2A 4X2XA 2JETC 5FCKA 1CGJE 1P06A 4RI0A 2FIRH 3M5LA 4Z6AH 2LPRA 3FVFB 1S0QA 3BTKE 3BN9A 3G01A 4NZLA 1DLKB 1YLNA 3JZ2B 2H5DA 4CRFA 1F2SE 1OYTH 1NU7B 5A0AE 8LPRA 2BY5X 3ZVFA 1SMFE 2VWNA 4NFFA 3RU4E 4X0WU 1GG6C 1W10U 2ZHDA 1YPJH 2GZ9A 3N7OA 1ESBA 1O2HA 2UUYA 3NXPA 2OCVB 2RCEA 5DP9A 1E36B 3BV9B 1Q31A 1TOMH 3QO6A 3KQBA 2H9EH 4AB9A 1P2IA 1RRKA 5DJ7A 2ZHEH 2A5KA 4JYTA 2SGFE 3SUFA 1GDUA 2LNCA 3A80A 4ABIA 1IAUA 1QBOA 4BAMB 3UY9A 4Y76A 1Y3XA 3EGKH 4LOYH 2TIOA 2XWBI 4X6PA 4GHQA 2PKAA 3TK9A 2P3TB 1P9UA 1Y5UT 4A5TS 4ZAEA 2KAIB 1BTHH 1D6WA 2KCAA 3BTHE 1TMBH 1V2TT 1GJCB 1GL1A 4DG4A 2PKSC 5F8XA 3RXRA 3NCLA 2OBOA 4MNXA 2FOFA 3RMNH 1EFRD 1OS8A 1K21H 1YP9A 1OKXA 1V2ST 3EQ0H 4I8GA 2ZGHA 2FODA 4B6FA 1S82A 4K60A 1HDTH 3FO8D 1ZRKA 3BTDE 1SGEE 3SV8A 1L0ZA 7GCHG 3UREA 3PMAB 3STJA 4YT6H 5CDFE 1LDTT 2QY0B 3F3BA 3GYLB 3OEED 3SU2A 1EZXC 2QF4A 1C9TA 4ZH8A 1TOCB 2C90B 1VJAU 3RXQA 2Z9KA 1S5SA 3M5NA 4X6OA 1TPOA 1DWCH 1SQAA 3MO6A 2J38A 3AAUA 2WYJA 1BTZA 1Q2WA 4BTUB 3SNBA 2HNTC 1PPEE 3BTFE 1MTVA 1ZSJA 1H4WA 1BMNH 1W8BH 1IQIA 2P3UB 3CNRA 4RKJB 1G30B 2SGPE 1C5WB 3SO3A 3LGIA 1EX3A 1RGQA 4HI3A 1AO5A 1GVZA 1SHYA 4CBOA 3PV2A 2AYWA 1C1VH 2VJ1A 1AWHB 4I8HA 2BVXH 3A7YA 1O2MA 4X8VH 5CMXH 3TGIE 1LO6A 3MO9A 4B2AA 2EI7A 1HNEE 2AMQA 1ABIH 3MO3A 1FIWA 1NU9A 1NFYA 1O3CA 2H5CA 3TK6A 2WUBA 1A5IA 2A4RA 4JK5A 2VU8E 1S85A 4IN2A 1O30A 1YPGH 2VNTA 3C1KA 2NU3E 3KQEA 4FUBA 1D6RA 1B0FA 4OS6A 2P16A 6LPRA 2A45B 3ZVCA 1A46H 1O2TA 6GCHG 2GGVB 1O3NA 1K1NA 1Z8GA 3RXHA 1BMLA 3URDA 1V2KT 1WSSH 2KFWA 5B6OA 1GI5A 2WYGA 2SGEE 2OC7A 1TBRH 2STAE 1EKBB 1TX6A 1O36A 4D7FA 1D3DB 3N7DA 1O2RA 4DT7B 4XBBA 1MQ5A 3S7HB 2GV7A 4OGYA 1AE5A 1C5RA 2BLQA 3Q77A 1DX5M 2J9NA 3VB6A 3ZVBA 4O3TA 1O2WA 1QGFA 3DFLA 5FX5A 3RC5A 3H7TA 1VCQA 1AHTH 1GBBA 3F2HA 2Y81A 1GMHF 2OQ5A 1Y3WA 3VGCB 1O3KA 1RXPA 3VEQB 1BOQA 2FPZA 1BB0B 3SUEA 1YBWA 1GJ9B 3T28A 1GBHA 1GMDG 2FEQH 2Q6GA 1FUJA 1TRMA 2VINA 4ZKOU 1C2MA 1GBKA 2GVFA 1NT1A 1SGPE 1W7XH 5HMAA 4X1RU 3RXFA 1QR3E 5HM2A 1GI8B 1NESE 1ANBA 1EXFA 4ZHLU 1Y5AT 3OFND 1OWDA 3RP2A 4X2VA 4ABBA 5FPYA 4I8KA 4AG1A 3HATH 3PLPA 5E0GA 3RLYH 3P8NA 3MNBA 3R3GB 3ELAH 2CK3D 3VGCC 3RXVA 4WY3A 1D3QB 1C1OA 5GWZA 2F3CE 3NK8A 2P93A 1P03A 1C1PA 3VXFH 1S6LA 2FOBA 1A2CH 2ZDAH 2PGQB 1TGNA 1PQ7A 4TSFD 3H5CB 2QCYA 4RKOB 5EU8A 1TA2A 2P3FH 1C1TA 5FBEA 1A3EH 4FOUC 2BD8A 1AI8H 1N6YA 4J1YA 2RG3A 2BX4A 1V2JT 5CHAB 1BRCE 1OP0A 3VB4A 3OU0A 3LH3A 2C8WB 3F1SB 2PW8H 3ZZ5A 1WBGB 5EGMA 1SL3A 3BTEE 1LHEH 4U30A 2GDDA 1P8VC 2EC9H 5E0JA 1BQYA 1FZZA 1GJ8B 1AWFH 1FMGA 1L4DA 1UVOA 5B6LA 1NY22 1ZGVA 2VVUA 1C5VA 1K28D 5JBTA 5L2ZH 5DK1A 3A87A 3PTNA 1H9HE 2P8OB 1UTNA 1YPLH 3DFJA 2WPJS 3A84A 5DP5A 1UVSH 2BD4A 3F9EA 2ZZUH 3RC6A 1TYNA 4ZMAH 1WXRA 3UTUH 3SZEA 3TH4H 4KGAA 2IPQX 3W1EA 1JWTA 1P2OA 1O3EA 2R3UA 4LZ1H 2FOMB 1AFQB 1BTWA 1Y3VA 3RXIA 3GICB 3ZZ7A 2ANWA 3BEFB 5I25A 1GDQA 2ZGCA 4O03A 5TCAA 2O8LA 3SZNA 3P8FA 2ZHQH 3ZVAA 1LTOA 2QF3A 2ZF0H 1YCPH 3TJVA 1MU6B 1G37A 1SOTA 4FUCA 1TPSA 1HJAB 1FAXA 1C1UH 3K6YA 4AFSA 4TY6A 1ESTA 4A1VA 2P8OC 2M5TA 7KMEH 1MKXH 1Y3UA 4NG9H 4VGCC 3SU4A 4AX9H 4TY7A 2KAIA 3PLKA 1GMCG 2BMGB 1BZXE 3HPTB 3LC3A 4UFFH 5AFYH 3UR9A 4CRAA 1YPMH 1S84A 4FVDA 3SW2B 5JBAS 1AFQC 3R0FA 2J92A 4NFEA 2WPIS 1WQVH 1DPOA 1EAXA 2R0LA 2ZGXH 2SGQE 5J4QA 1P2KA 1MAXA 1YC0A 1C9PA 1O5GH 2OBQA 3EAJA 2QC2A 2C8ZB 2RDEA 1AB9B 2VGCB 2VVVA 3E3TA 3RXTA 2CV3A 3SNDA 3O8CA 3UR6A 2QIQA 2GX4A 4JZFH 1VITF 1HYLA 1HJAC 4WMFA 1A3BH 3P95A 3KQCA 1F0UA 2B8OH 2W3IA 1D3TB 1CO7E 4D9QA 3QZRA 1ESAA 1GBEA 3RXBA 2EEKA 3CP7A 1GHAF 4X1NU 3U69H 1C4U2 4A7IB 4Y8YA 5EOKA 4NIWA 1FN6A 4WVPE 1SLWB 3SV9A 2FI5E 1Z6JH 2K8IA 2ODYB 4E7NA 4Q4LA 1W0JD 2QA9E 1O2GH 4DCDA 3T5FH 3GCNA 3ZIAD 1GBDA 1O3BA 1O2SA 3LGVA 4FU8A 1DFPA 1O5AB 1S0RA 3ESTA 3AW0A 3V12A 2ZTXA 2SGAA 4CREA 1P3CA 2VGCC 1ELEE 2ZU3A 1BTXA 1C2DA 3IITA 1F7ZA 1OP8A 5EQQA 1HGTH 1ZMJA 3BTQE 1BRUP 1C5XB 4OGXA 1GI2A 1BMMH 1LHGH 3SQEE 1GI9B 2F91A 2A2XH 1C2HA 1XVMA 1VR1H 3MHWU 1EPTB 1TBQH 2SNWA 4ABDA 1GBAA 2XNDD 3SJ8A 2D1JA 3GY7A 1IQFA 4X2WA 2ZHWH 2A5IA 2PUXB 3ZYDA 1PPFE 5DP8A 3HK3B 1H8IH 2W5EA 5A8ZA 3TGKE 1G3EA 1O31A 1KLTA 4ZKSU 2KX4A 5GJ4B 3KNXA 1IQLA 2KCPA 1P02A 4ABHA 1GJ7B 3TU7H 1C5NH 1C5ZB 1DE7H 1ZPZA 2ZFTA 3T27A 5EPNA 1DSUA 2J94A 1SGDE 1OOKB 1QB1A 2ZDNA 4UE7H 1KXBA 3D62A 1GJ5H 1MUEB 1MMJN 2DE9A 5I46H 1EPTC 2Z6BD 4YXWD 2HALA 1A61H 1LPGB 4D8NA 2DE8A 1BCUH 1G9IE 1K0HA 1AZ8A 4ISIH 3UIRA 3SOSA 1YLCA 5T6GA 1OWHA 8GCHG 5FAHA 1WTGH 3A86A 5HXFA 4GCHF 1SGIB 3T29A 1PPCE 2YNBA 4JZDH 3U9AH 1HCGA 4U32A 3FAOA 1CE5A 1KXEA 2W6JD 1O2XA 1UCYK 2D2DA 2PP6A 2RA3A 4XFQA 2EA3A 2FX4A 4B75A 2ZU1A 4TPIZ 1UMAH 4XD7D 1GI0A 1OWIA 5L6NH 2SFAA 1GBJA 5FHTA 3P92A 1TRYA 1DWDH 1LHDH 2TGAA 1T31A 2ZFRH 2ZFPH 1CHGA 4CBNA 4IN1A 4K69A 1GI4A 4BXSA 5ESBA 1QZ8A 3LH1A 2HPQH 3HKIB 4MTBA 2AERH 4FU7A 2C3SA 2FESH 1FX0B 1O3PB 3GISB 3TH2H 1IQEA 1BJUA 3E91A 3GY3A 1O2OA 4U2WA 3RXKA 1SBWA 7ESTE 4MDSA 1GCTB 5SGAE 3S9AA 1N6XA 4NSVA 1C5PA 1L1GA 4KTSA 2OTVA 3RXUA 1ELDE 1YGCH 2ILNA 3A7TA 4HFPB 1O5EH 3F0OA 1CVWH 2VWMA 3STIA 1QQ4A 1QRWA 2BD9A 4E05H 4H6TA 1PJPA 2FP7B 1SB1H 2BDCA 2C93B 1T32A 2EI8A 7LPRA 1C2JA 3MOCA 3SNEA 3L6PA 3GYMA 1SLVB 2ZGJA 1G3CA 3EE7A 4NA7A 2BY9X 2XOKD 4JMYA 3BEIB 1YPHC 5EJLA 1CA8B 4IC6A 3TJUA 1CA0C 1GG6B 2Y5HA 2J95A 1RIWB 4Q80A 1ETRH 3H09A 3MTYA 2ZC9H 3SNCA 3TJOA 1GCTC 4GLYA 4BAHB 2FYRA 4AFZA 3MH6A 2ZTZA 4ZUHA 3DT0H 2Q1JA 1GGDB 1TB6H 2BZAA 2G52A 1TX8A 2WPKS 3I78A 1HRTH 1MTNB 2F9BH 1UTPA 2FS9A 2UUKB 3GOVB 3P8GA 4Y11E 3SJ9A 4Y8XA 1RTFB 5BRRE 1WCZA 1C2EA 1UTLM 4B74A 5AF9H 2BVRH 1BRBE 1MBQA 4NIVA 3SN8A 2ZECA 2NU4E 2BDGA 3U8TH 2P59A 1V2UT 4FU9A 1ZJKA 5FXLA 1Q3XA 1AE8H 1HIAB 2TPIZ 3SJOA 1BTUA 2Y82A 4FUGA 2YMSD 2PKSB 3M7QA 1RIWC 1O2IA 4AORA 1TABE 4IMQA 5EXNA 3F9GA 1GGDC 1NROH 5JBBS 5GIBA 3QGJA 1MTNC 2A4OA 3OTJE 3PROA 4MNWA 4X8SH 1D9IA 5G4BA 2UUJB 2RFKC 3SV2H 1XUGA 3RXOA 3U98H 2VWOA 3M5MA 2G4UA 1EAWA 1XUJA 3KCGH 2R2WU 4K1EA 2A4GA 5LPFA 1WUNH 3SV6A 1WQSA 3BIUH 5HYOA 1O5BB 4X1QU 4KP0A 1UJ1A 4F48B 5H4IB 1NPMA 5FL7D 1XMNB 4E06H 1G32B 2F4LA 3UFAA 2EI6A 3O8BA 1AQ7A 2ZPQA 2ZCLP 3PB1E 1HUTH 2TGTA 3GCTF 3TPIZ 1T8OA 2F43B 1MQ6A 1OX1A 2YOLA 1ETSH 1YCPM 4DIIH 1MZDA 1K1PA 3MH5A 4XRNA 4YZUA 1SPJA 3P70B 3QTVH 1QRZA 4BAQB 1AD8H 1LVYA 2HPPH 2Y5FA 3LIWA 4WMDA 4Z0KA 3PLBA 5C17A 5JBCS 1GVKB 4YLQH 3DCLA 4NSYA 2F9VA 2D26C 6CHAB 3SHAH 1Z1JA 4ASHA 1QHRB 4RT0A 3PMJA 2WINI 2HNTF 1C1MA 1GI3A 1YPKH 1FY4A 3IG6B 2IN2A 4Q63A 2Z9GA 4BTIB 1T7CA 3A7WA 1O2ZA 2W7UA 4R8TB 2AFQB 1ARBA 2FLBH 3VXEH 3LOXA 5A0BA 3EA8A 3DSGA 1BMAA 3GDVA 2QXIA 2VVCA 2B9LA 4UFDH 1TMTH 1BDAA 1UTOA 4J2YB 2ZGBH 1T4VH 3KQ5A 1EPTA 2OK5A 2ZQ1A 6CHAC 1YM0A 3MMGA 5EW1H 1AUJA 1C5OH 2BLOA 2VH0A 2CXVA 3MU0A 2FX6A 1J16A 1NRNH 2BDBA 1IQMA 1GHZA 4B73A 4GSOA 3RXPA 2GD4B 4UEHH 1SQOA 1JIMA 3P8OA 1O35A 5C0TA 3BTME 2J98A 2PTNA 1UVUH 1G36A 5EJZA 2VIPA 4B71A 5DP4A 4INKA 2PGBB 2OP9A 2HRVA 2R0KA 4TWYA 5ABWA 1GHBG 5JDUB 1CGHA 5T6DA 3UUZA 2BD2A 2JKHA 3PV4A 2A5AA 1KLJH 2A7HA 2FTMA 1PQ8A 1KYNA 1WYKA 3GY8A 1FJSA 3PWCA 2PLXA 2PTCE 2V0BA 1WU1A 2IOTA 3A88A 4ACAA 3M37A 5DGJA 5PTPA 1SLXB 4F49A 1TQ7B 2HGTH 1FY3A 1QQUA 2WZQA 2IJD1 2PV9B 3TJNA 4O9VA 4MLFB 3ZZBA 3ZVEA 2BQ6B 3EA9A 1SGCA 1H9IE 3OTPA 1V2QT 1A0LA 1WV7H 3E0NB 3V0XA 2L74A 1QL8A 1GJ4H 2OXSA 3ITIA 2W6ID 4KTUA 3EYDA 1DVAH 2BHGA 4XDEA 3GCHB 3RXSA 2GJGA 2BDHA 1YY3A 4DW2U 2ZTYA 1EZUC 1LMWB 5A8YA 3ODDA 2XC5A 1TX7A 1BMFD 4X6MA 5E2OA 1RD3B 2Z9LA 5KGOA 1O2JA 3P17H 1HAHH 1F5RA 3K2UA 3EE0B 3LGYA 4JCNA 2A2QH 5EODA 5DG6A 2JH5D 5A2MH 3V3MA 3S0NA 4K8YA 1CGIE 1GJDB 1JIRA 1PPHE 1HAXB 2FOAA 3GS9A 1INCA 1FAKH 1QCPA 1ZPBA 1QURH 1BRAA 1DY8A 1FNIA 1OWKA 3UNRA 1AGJA 3GCTG 5DPAA 1IOEA 1XX9A 2BOKA 4X6NA 3U8OH 3ZZ4A 4ABEA 1KDQA 1C2KA 3E0PB 3CS0A 3GCHC 3BTGE 3QX5H 3TK5A 1ZTJA 4H42U 1FDPA 2AGIX 2BX3A 1T8MA 1CQQA 1TGCA 2BXUH 4JZIA 4O97A 3A83A 3RLWH 4YESB 5GCHF 5F8TA 1A5HA 1V2MT 2FOHA 2AIPA 2PHBA 1EAUA 2TRMA 4AC9A 1J15A 1ZJDA 8ESTE 1MKWH 1GL0E 2K0QA 2ZA5A 1HV7A 4GAWA 5KECA 1X7AC 1CSOE 1MTSA 3A85A 2BDYA 1H9LB 3F2GA 1BJVA 1EAIA 1XUIA 1IHTH 2L6OA 4LK4A 5DN6D 2K1QA 1C4Y2 1E37B 1MD7A 5CHBA 5ETXA 4I7YH 1ELCA 1V2NT 2BZ6H 4UDWH 5DKMA 5DSFA 2GDEH 4NZQA 1P57B 4VGCB 1HAOH 3MU4A 2ZFFH 1CHOF 4FUIA 1HIAA 1M9UA 3FN8A 5T3HA 1AVWA 1SQRA 1W0KD 2FI4E 1AVXA 1SGQE 3M5OA 1O34A 1MBMA 4WWYA 1KXCA 4YO9A 1TNJA 1K1IA 5IK2D 4PROA 3FANA 1PQ5A 1Z8RA 4JZ1A 4YOGA 1H8ED 1ELBA 1K1MA 4Q7XA 4AYVB 1QRXA 2F9UA 4THNH 4WF8A 1QY6A 4ZXXH 2H9TH 3A8CA 3DA9B 2CMYA 1TIOA 1DANH 1ABJH 1O2PA 1QA0A 1E79D 1KTSB 2GMTB 3BSQA 3HGPA 1QBVH 3KEEA 2BY7X 1PYTD 5EG4A 1Z8JB 2Z3DA 2ZHFH 5LGOA 2BQ7B 2H9HA 3ENSB 2GV6A 1XUFA 2FDAA 3F2FA 5C1YA 2VH6A 5CE1A 1COWD 1EJMA 1NTPA 2QYIA 2THFB 1FXYA 3OSYA 1BA8B 2LP6A 4ISNA 2ZDVH 5ESTE 2NU0E 1NC6A 1O5CB 2XXLA 1O2KA 4MPXA 1G2LA 4ABJA 1P05A 4B2BA 1K1JA 1LCYA 2PSXA 1F92A 1HAYB 2ZU2A 3ZZ9A 1NBMD 4Y0YE 1A1RA 1TONA 2DUCA 2HWLB 1EASA 1Z7KA 2SNVA 3A7VA 2GMTC 3SI3H 1HAVB 2Y6TA 4OS2A 2NWNA 1GMHG 1SOZA 2LELA 1AIXH 1AFEH 4OM9A 3UPEA 4I32A 1U6QA 1ZHMA 3Q3KA 1KXDA 4D9RA 2J2UA 1OP2A 1DY9A 2UWOA 1FY8E 5LH8A 1HAZB 4AN7A 4B2CA 2ANMH 3LGUA 1BITA 1P2QA 1W12U 3S69A 4ZHAA 1BTPA 2HVXA 2EY4C 3E1XB 4RSPA 2KCOA 2TGPZ 2XC4A 3B8JA 1O2LA 2VB0A 1AU8A 1QJ6B 3IWMA 2C8XB 2PWXA 3I29A 2G51A 1SGTA 1V2OT 1KLIH 3UNSA 1LVBA 4HTCH 1P10A 1VGCB 2HLCA 3MNSA 3OAAD 1DUEA 1C1NA 2VIOA 2C4FH 4FVBA 1LQEA 1XUHA 2V6NA 1GJBB 1AN1E 3PRBA 1PFXC 1RS0A 1AY6H 3DSPA 3ODFA 2ODPA 4Y10E 5C3NA 4NWLA 1L4ZA 1ZOMA 2STBE 4P00A 1EJNA 3MFJA 4CRBA 3KIDU 1LKBA 1FIZA 1FY5A 3S7KB 1O3JA 3ZV8A 2AH4X 2CHAB 3UB0A 4K1SA 2FZZA 3FFGA 4FXGH 3SUGA 4OS4A 1BUIA 2B7DH 1AKSB 1E38B 5AFZH 1GJ6A 4I8LA 3U1IB 1VGCC 5EW2H 2O8UA 3PM3A 4BAOB 1JXPA 1K9OE 3MU1A 2BXTH 5FPSA 2I6QA 1EATA 3RXDA 4BOHA 3WY8A 1EB1H 2AGGX 1SFIA 1SGFG 2QXJA 4I31A 2BVSH 3RM2H 4B76A 2Q6FA 3EDXB 1SKYE 3JZ1B 1AVGH 1PPGE 1W3CA 3LONA 2BB4A 3MU8A 4ABGA 1ZGIA 1TALA 4X2YA 2ZDMA 1CT0E 3RUOA 2FWWA 3FP8E 5FPTA 1UTKA 2BLWA 4F4OC 4ISHH 1EZQA 2OC0A 1P04A 5DP6A 1W11U 1TNHA 3NZIA 3TH3H 2CHAC 3NRLA 1FQ3A 2GT7A 2G4TA 1V2RT 2ZG0H 1DSTA 4HGCA 4CH8B 3C27B 1YCPK 1QL9A 1OSSA 1TWXB 3M7TA 1NFWA 3OY5U 1HAIH 1MKXK 3K9XB 1O37A 2AMDA 2SGDE 3LU9B 3TVJB 1DITH 2FI3E 2H6MA 4DGJA 3QN7A 4INHA 1FLEE 1TNGA 1C5UA 2Z3EA 1E35B 3ZZAA 3ZZ3A 1FI8A 7GCHF 1QIXB 2CF9H 4BANB 1A0HB 3SU6A 1C2GA 1OYQA 2O8MA 1FPCH 4O3UA 4OS1A 2XRCA 2FTLE 1C5LH 1ZTLA 3BG8A 3LGTA 1C5TA 5LPRA 2BD7A 1CA0B 4ACBA 2ULLA 2JDID 1B7XB 2QGRA 4TT3D 1UHBB 1V2PT 3QUMP 3SU0A 9ESTA 4IC5A 4D7GA 1ANCA 3UQVA 2BQWB 4XBDA 3Q3YA 1O3IA 2BTCE 3QDZB 1OPHB 4DJZB 1IQKA 1CBWB 3QWCH 5C1XA 1MTWA 1C5YB 1D4PB 4MNVA 3SHCH 1O32A 2F9OA 4RT1A 1VITG 1A4WH 4BAKB 4DURA 3LPRA 2Y7ZA 1NRSH 3L3TA 3RM0H 1RTKA 1YPEH 4AB8A 1YLDA 3DHKH 2GZ7A 3U28C 3OX7U 1GHAG 3A82A 2O9QA 5DO4H 2ZNKH 4UONA 1XKBC 4MG3A 1TRNA 2GZ8A 5DP3A 1WAYB 3QK1A 1Y3YA 3Q3XA 4TPYA 1EB2A 1GBIA 3MH4A 3GY2A 3TLOA 5HIYA 4Y7AA 2QN5T 2ESTE 1O3AA 1CBWC 4FETA 1THRH 1GBTA 5C5OA 4JK6A 1EZSC 2ASUB 2XBXA 6GCHF 3H7OA 4AOQA 3VB5A 3PTBA 4Y7BA 1SVPA 2ZPSA 1KXFA 1P11E 4CHAB 2AEIH 1CT2E 3A7XA 1ZSKA 5A8XA 1DS2E 4FUJA 1O2VA 1J17T 3ZVDA 2XCNA 3MNXA 4AYYB 4NA8A 4ESTE 1ELGA 4LZ4B 3RU4D 4INLA 1O5DH 1J8AA 3A8AA 3M7UA 1GI1A 1ZHPA 4YOIA 1IQHA 1UCYE 2AIQA 2R9PA 2XNIA 2V7QD 3RC4A 2BLVA 1TNLA 5EQRA 2FM2A 1V6DA 4I33A 2ALPA 1DM4B 2ZDKA 4CR9A 4DT4A 1IQJA 3KYFA 1H8HD 2QAAA 2CGAA 2XTTB 4Y71A 3GCOA 4GHTA 3RMLH 3MNCA 3ZVGA 4NIXA 2R3YA 1N8OB 3GDUA 1SGNE 1L1NA 1HLTH 1N1LA 4ZKRU 1TQ0B 4CHAC 4HG6A 2FOGA 2F83A 4MQAA 3UOUA 1GMDF 1B5GH 4MNYA 4KTCA 1T4UH 3UNQA 5JB9S 2IJOB 3A89A 1LPZB 4FUHA 4E7RG 1ZMLA 1ELTA 1P2JA 3O8DA 3RXJA 4AFQA 2OLGA 1FPHH 1HAVA 1TLDA 1ZYOA 1O3DA 2A0QB 1MAYA 2OD3B 3PO1B 4Z1MD 3CENA 3KQDA 5T1VA 4GCHG 4BXWA 2G00A 3SGQE 2A32A 5F53A 1N8OC 4XOJA 1O3FA 4ABAA 1GHVH 1OWJA 3WWFA 4K8BA 1W0ZU 2KM0A 1BBRK 1QNJA 2JH6D 4A92A 2PUQH 4MPVA 1AUTC 2OQUA 4Y6DA 3SU1A 2CJIA 4X1SU 1ELVA 2Y80A 4M7GA 2F9NA 4YOJA 2TGDA 2GT8A 2W3KA 4IBLH 2D8WA 1LHFH 1QL7A 3P6ZB 2WPDD 5EPYA 3B23B 1BIOA 3T25A 2WPMS 2V3MA 1TE0A 1MCVA 3PO1C 3OYPA 4Q7ZA 1LVOA 1NFXA 1NRPH 1Y5BT 2KCYA 1A7SA 3HKJB 3FOAA 5F8ZA 5TJXA 3GY4A 1S6FA 2G55A 3D65E 3MU5A 4DIHH 4WMEA 3BTWE 4B1TA 3SQHE 1LPKB 3D23A 1UVPA 1Z6EA 1GBMA 4Q7YA 3SJKA 3A8DA 3LJOA 3MI4A 5EXLA 2HOBA 1MTUA 1AKSA 2BY6X 1W7GH 3NUMA 1ZTKA 5JPMH 2OC1A 1IQNA 5IDKA 3RXAA 3A8BA 1ORFA 2FXRA 3T2NA 2V35A 4HZHA 1NRRH 2WV9A 3PWBA 1K2I1 3SBKA 5LPEA 3SU3A 1BTYA 3S9CA 2FOCA 1B0EA 1TGBA 1THSH 4H4FA 3V13A 3F9FA 1O2QA 1SLUB 3L33A 3RU4T 3QZQA 4NA9H 1SFQB 2W7SA 5K7RA 3SV7A 1OWEA 1V2LT 2ALVA 3LGWA 3K65B 1K1OA 2XBVA 5E0HA 2NU2E 1FV9A 1KMHB 3KGPA 3LKWA 1BHXB 2ZQ2A 3BG4B 3VPKA 2IPHA 1ZMNA 1G3DA 1ZHRA 1UK3A 1SGYE 2G8TA 1TA6A 1GMCF 3WWBA 4UFEH 5J4SA 1SC8U 4D76A 1KSNA 3ZV9A 1QBNA 1CT4E 3KHVA 4FUFA 1Y8TA 3PV5A 1W14U 1QJ7B 2VIWA 4I86A 3ZYEA 1UK2A 4WXIA 1GI6A 1BHXF 1DT2A 1GBLA 4X8TH 1RFNA 3W95A 3KYGA 1NM6A 4CRGA 2BD5A 2H2ZA 2Z9IA 2XC0A 2NU1E 3OE7D 4IGDA 3ATKA 1BBRE 4AGKA 1C5MD 1QB9A 5TCCA 1F5LA 2B5TB 2GCHF 3BIVH 4I8JA 2J34A 5EXMA 1MCTA 1G2MA 1O3HA 3ZZDA 2RA0A 5E2PA 1E1RD 1QJ1B 3BG4C 1VCPA 4AFUA 1H8DH 5EJ1A 3QLPH 1UHBA 4GPGA 2ZU4A 2V3HH 2FLRH 2J4IA 2FS8A 3M3SA 4P02A 3PMHB 1HBTH 3PMBB 3TNSA 2A1DB 3ATIA 3BF6H 8KME2 3DSOA 2YMSB 2ANKH 1NRQH 3RXLA 2JH0D 1GHYH 3TNTA 2WPLS 2AMPA 1EP6A 1HJ8A 5C0UA 2UWLA 5JYIA 1O3LA 2A4QA 1C2FA 1TNKA 2FMJA 2M2AA 2XWAA 1S83A 2I6SA 2KZ4A 4X8UH 3VB7A 4MVNA 1YKTA 3AASA 1F5KU 3F6UH 1LKAA 4CRDA 1MU8B 3SORA 1V2WT 1LVMA 2WPHS 2WUCA 4WJG2 2FOEA 2QXHA 3GDSA 3FZDA 5JB8S 4JZEH 3M35A 4DOQA 3T62A 3SGBE 2JJ2D 1JMOH 2GTBA 1TGTA 1K22H 3E16B 4BTTB 3UAIC 1MH0A 3M36A 1L2EA 2TBSA 3RMMH 1Z8IB 2YMSC 3DUXH 5BPEA 1EUFA 1O3MA 4NWKA 1P0SH 1J14A 4ISOA 4YM9A 3RXEA 1WDIA 3E8LA 2GCTB 4NIYA 2Y7XA 2G5NA 4KELA 1DUAA 4ASUD 4GVUA 5HM9A 4CRCA 2ZFQH 1XKAC 1D3PB 1TMUH 2ZO3H 2BY8X 3F9HA 3UOPA 2XBYA 1WOFA 2B0FA 3AK5A 2WV4A 3ZZ8A 2GP9B 1PQAA 2O8WA 3Q76A 2XBWA 1UTJA 2AHME 3GY6A 1C2LA 1T8LA 1KXAA 2A7JA 1E34B 3VFEA 2ZKSA 4R0IA 3N99A 5CHAC 3SUDA 2BM2A 2GCTC 1GVLA 4TYDA 3URCA 1TGSZ 1WTHD 2Z9JA 8GCHF 1QFKH 1O5FH 2W26A 4XBCA 1DWEH 1S81A 4IMZA 4A6LA 4IW4E 3D49H 3MQKC 3GY5A 3MWIU 1KTTB 1VKYA 2RDLA 4TWWA 5EIYA 1TBZH 1L1JA 2ZP0H 1QB6A 5FX6A 1W13U 2ZEBA 4SGBE 1DWBH 4A1XA 1IQGA 1BT7A 1HFDA 2BDAA 1JOUB 1VJ9U 1YPHE 3AVZA 4DVAU 5KEDA 4Y79A 4WXVA 5AHGH 3B9FH 4ZXYH 3W94A 1O3GA 4A1TA 1UCYH 2O8TA 5F6MA 1C1WH 4AG2A 1JRSA 3KL6A 3I77A 4AGJA 1ELFA 1H1BA 1P2MA 2G81E 5DP7A 1FY1A 1ZPCA 3A81A 1CU1A 3PYHA 4JYVH 1SG8B 2JJ1D 2BD3A 3KN2A 1P3EA 1ZRBA 3RXGA 2C8YB 1KY9A 2BOHB 2PKAB 2ZCHP 3HK6B 2A31A 1TAWA 3U1JB 4DY7B 1GCDA 2JIZD 3ZZCA 3FP6E 1F0RA 2FO9A 1DOJA 3S9BA 1QA7A 4ZKNU 3E90B 4X1PU 2Z94A 1NBME 5C1UA 3SJIA 1E1QD 5A0CA 1JRTA 3SU5A 2GCHG 1V2VT 2AGEX 4K5ZA 4JYUH 2HLDD 3M61U 1DXPA 1A0JA 1ZZZA 2FYQA 4OS7A 4IS5A 1O0DH 1MABB 3A7ZA 1SSXA 5HKKD 3ATLA 5L2YH 4K1TA 1GBCA 2VBCA 4CR5A 1C1SA 1PPBH 1UO6A 1Z71A 1XXFA 1A5GH 1VZQH 5IYTA 3WW7A 2UWPA 3U8RH 4YTAA 3F0PA 1K1LA 4SGAE 4K3JA 1NS3A 1C4V2 1J9CH 5C20A 4GUXA 1AB9C 2ZPRA 1P12E 3AW1A 1MKWK 1HJ9A 2XCFA 4NCYA 4Y8ZA 3TIUA 1O33A 5L30H 1G3BA 1NO9H 1ID5H 2QF0A 1C5SA 5GPIB 2XYAA 1C1RA 1O38A 1GDNA 1YYY1 3ATWA 5GCHG 2YNAA 1KIGH 4LXBH 1SI5H 1GPZA 2XW9A 1UK4A 1EP5A 3SGAE 4CH2B 2WV5A 4WH6A 1Y59T 1DLEA 3Q00A 4ISLA 1P01A 2V3OH 3T26A 3UWJH 1LHCH 1MD8A 3BTTE 4UD9H 2A7CA 4AZ2B 1OHHD 2QV1A 2QE7D 3HGNA 3LT3A 1EQ9A 2QXGA 2ZI2H 1DDJA 4BNRA 1TFXA 1DXWA 3OEHD 1W2KH 3VG8A 1EOLA 2J97A 1HAPH 3RMOH 3SNAA 1C1QA 4MPWA 4ZROA 3NKKA 1CHOG 5HIZA 2VIQA 2OC8A 3ZZ6A 1HXFH 2HNTE 2J98B 1ANDA 4M9FA 3PRDA 1ZR0A 4XE4A 5E8EH 5C5NA 1O2NA 1AZZA 2VIDA 1P9SA 2PR3A 2Z3CA 2P94A 2Z7FE 1SQTA 3FZZA 2KR7A 4OS5A 1ETTH 1EJAA 2ZU5A 1O3OA 4ZCNA 1VCWA 3UWIA
chains in the Genus database with same CATH topology
1UVTH 4MPUA 5K0HA 3SI4H 2ZFSA 9LPRA 1XXDA 1O2UA 1HXEH 2CF8H 1XVOA 1VITH 5EQSA 1GI7B 3CS7A 5FCRA 4K2YA 3VB3A 1MZAA 1AMHA 1TPAE 4H6SB 1FONA 2OUAA 1OXGA 2G5VA 1DICA 2Y5GA 2UUFB 4U01A 3LDXH 1GJAB 1GWAA 1QTFA 1UTMA 2F9PA 3EA7A 2ZWLH 4WH8A 1HPGA 3MYWA 1TNIA 3E6PH 2ZDLA 4NGAH 3M3TA 1Z1IA 3TGJE 1P09A 3DD2H 4QT8C 1F0TA 1TPPA 1GHXH 3O8RA 4ABFA 2AS9A 3LC5A 4FUDA 1YF4A 1LQDB 3QTOH 1BBRH 1P2NA 1E0FD 1NFUA 1GHWH 1XM1A 3RDZA 1ARCA 1FN8A 2CN0H 1XUKA 4ZHMU 1RJXB 2R2MB 1HAGE 1O2YA 1UTQA 3K6ZA 3M3VA 2H1UA 4UFGH 1JBUH 1T8NA 5GXPA 3LJJA 3BEUA 2P95A 3QGNB 1THPB 1O39A 1ANEA 3F68H 1V3XA 4Y0ZE 5C2ZA 1ZLRA 1ZSLA 4XSKU 3UQOA 1SGFA 2JETB 2ZIQH 2GKVE 5T6FA 1GBFA 3V7TA 1IHSH 4RN6A 5FBIA 4KKDA 2ODQA 2VIVA 2PFEA 1C2IA 1W0YH 1KDQB 2OINA 1C5QA 2BYAX 1SGRE 6ESTA 3TITA 2PSYA 1NN6A 1RTLA 1SHHB 1NZQH 3FP7E 1ACBE 4Q2KA 3RXCA 1EOJA 3NWUA 1PPZA 2ZCKP 1SR5C 1F0SA 3NPSA 2Q6DA 5F03A 1ELAA 2BDIA 1PYTC 5HGGA 5A09A 2ANYA 3MH7A 4YLUA 3OY6U 5AVDA 1GHBF 2VWLA 3AAVA 4YT7H 3RXMA 3ATMA 1S6HA 5GDSH 4FUEA 5C67A 1HB0B 3KF2A 4X2XA 2JETC 5FCKA 1CGJE 1P06A 2FIRH 3M5LA 4Z6AH 2LPRA 3FVFB 1S0QA 3BTKE 3BN9A 3G01A 4NZLA 1DLKB 3JZ2B 2H5DA 4CRFA 1F2SE 1OYTH 1NU7B 5A0AE 8LPRA 2BY5X 3ZVFA 1SMFE 2VWNA 4NFFA 3RU4E 4X0WU 1GG6C 1W10U 2ZHDA 1YPJH 2GZ9A 3N7OA 1ESBA 1O2HA 2UUYA 3NXPA 2OCVB 2RCEA 5DP9A 1E36B 3BV9B 1Q31A 1TOMH 3QO6A 3KQBA 2H9EH 4AB9A 1P2IA 1RRKA 5DJ7A 2ZHEH 2A5KA 4JYTA 2SGFE 3SUFA 1GDUA 2LNCA 3A80A 4ABIA 1IAUA 1QBOA 4BAMB 3UY9A 4Y76A 1Y3XA 3EGKH 4LOYH 2TIOA 2XWBI 4X6PA 4GHQA 2PKAA 3TK9A 2P3TB 1P9UA 1Y5UT 4A5TS 4ZAEA 2KAIB 1BTHH 1D6WA 3BTHE 1TMBH 1V2TT 1GJCB 1GL1A 4DG4A 2PKSC 5F8XA 3RXRA 3NCLA 2OBOA 4MNXA 2FOFA 3RMNH 1OS8A 1K21H 1YP9A 1OKXA 1V2ST 3EQ0H 4I8GA 2ZGHA 2FODA 1S82A 4K60A 1HDTH 1ZRKA 3BTDE 1SGEE 3SV8A 1L0ZA 7GCHG 3UREA 3PMAB 3STJA 4YT6H 1LDTT 2QY0B 3GYLB 3SU2A 1EZXC 1C9TA 4ZH8A 1TOCB 2C90B 1VJAU 3RXQA 2Z9KA 1S5SA 3M5NA 4X6OA 1TPOA 1DWCH 1SQAA 3MO6A 2J38A 3AAUA 2WYJA 1BTZA 1Q2WA 4BTUB 3SNBA 2HNTC 1PPEE 3BTFE 1MTVA 1ZSJA 1H4WA 1BMNH 1W8BH 1IQIA 2P3UB 4RKJB 1G30B 2SGPE 1C5WB 3SO3A 3LGIA 1EX3A 1RGQA 4HI3A 1AO5A 1GVZA 1SHYA 4CBOA 2AYWA 1C1VH 2VJ1A 1AWHB 4I8HA 2BVXH 3A7YA 1O2MA 4X8VH 5CMXH 3TGIE 1LO6A 3MO9A 4B2AA 2EI7A 1HNEE 2AMQA 1ABIH 3MO3A 1FIWA 1NU9A 1NFYA 1O3CA 2H5CA 3TK6A 2WUBA 1A5IA 2A4RA 4JK5A 2VU8E 1S85A 4IN2A 1O30A 1YPGH 2VNTA 3C1KA 2NU3E 3KQEA 4FUBA 1D6RA 1B0FA 4OS6A 2P16A 6LPRA 2A45B 3ZVCA 1A46H 1O2TA 6GCHG 2GGVB 1O3NA 1K1NA 1Z8GA 3RXHA 1BMLA 3URDA 1V2KT 1WSSH 5B6OA 1GI5A 2WYGA 2SGEE 2OC7A 1TBRH 2STAE 1EKBB 1TX6A 1O36A 4D7FA 1D3DB 1O2RA 4DT7B 4XBBA 1MQ5A 3S7HB 2GV7A 4OGYA 1AE5A 1C5RA 2BLQA 3Q77A 1DX5M 2J9NA 3VB6A 3ZVBA 4O3TA 1O2WA 1QGFA 3DFLA 5FX5A 3RC5A 3H7TA 1VCQA 1AHTH 1GBBA 2Y81A 1GMHF 2OQ5A 1Y3WA 3VGCB 1O3KA 1RXPA 3VEQB 1BOQA 2FPZA 1BB0B 3SUEA 1YBWA 1GJ9B 3T28A 1GBHA 1GMDG 2FEQH 2Q6GA 1FUJA 1TRMA 2VINA 4ZKOU 1C2MA 1GBKA 2GVFA 1NT1A 1SGPE 1W7XH 5HMAA 4X1RU 3RXFA 1QR3E 5HM2A 1GI8B 1NESE 1ANBA 1EXFA 4ZHLU 1Y5AT 1OWDA 3RP2A 4X2VA 4ABBA 5FPYA 4I8KA 4AG1A 3HATH 3PLPA 5E0GA 3RLYH 3P8NA 3MNBA 3R3GB 3ELAH 3VGCC 3RXVA 4WY3A 1D3QB 1C1OA 5GWZA 2F3CE 3NK8A 2P93A 1P03A 1C1PA 3VXFH 2FOBA 1A2CH 2ZDAH 2PGQB 1TGNA 1PQ7A 3H5CB 2QCYA 4RKOB 5EU8A 1TA2A 2P3FH 1C1TA 5FBEA 1A3EH 2BD8A 1AI8H 1N6YA 4J1YA 2RG3A 2BX4A 1V2JT 5CHAB 1BRCE 1OP0A 3VB4A 3OU0A 3LH3A 2C8WB 3F1SB 2PW8H 3ZZ5A 1WBGB 5EGMA 1SL3A 3BTEE 1LHEH 4U30A 2GDDA 1P8VC 2EC9H 5E0JA 1BQYA 1FZZA 1GJ8B 1AWFH 1FMGA 1L4DA 1UVOA 1NY22 1ZGVA 2VVUA 1C5VA 1K28D 5JBTA 5L2ZH 5DK1A 3A87A 3PTNA 1H9HE 2P8OB 1UTNA 1YPLH 3DFJA 2WPJS 3A84A 5DP5A 1UVSH 2BD4A 3F9EA 2ZZUH 3RC6A 1TYNA 4ZMAH 3UTUH 3TH4H 4KGAA 1JWTA 1P2OA 1O3EA 2R3UA 4LZ1H 2FOMB 1AFQB 1BTWA 1Y3VA 3RXIA 3GICB 3ZZ7A 2ANWA 3BEFB 5I25A 1GDQA 2ZGCA 4O03A 5TCAA 2O8LA 3SZNA 3P8FA 2ZHQH 3ZVAA 1LTOA 2QF3A 2ZF0H 1YCPH 3TJVA 1MU6B 1G37A 1SOTA 4FUCA 1TPSA 1HJAB 1FAXA 1C1UH 3K6YA 4AFSA 4TY6A 1ESTA 4A1VA 2P8OC 2M5TA 7KMEH 1MKXH 1Y3UA 4NG9H 4VGCC 3SU4A 4AX9H 4TY7A 2KAIA 3PLKA 1GMCG 2BMGB 1BZXE 3HPTB 3LC3A 4UFFH 5AFYH 3UR9A 4CRAA 1YPMH 1S84A 4FVDA 3SW2B 5JBAS 1AFQC 3R0FA 2J92A 4NFEA 2WPIS 1WQVH 1DPOA 1EAXA 2R0LA 2ZGXH 2SGQE 5J4QA 1P2KA 1MAXA 1YC0A 1C9PA 1O5GH 2OBQA 3EAJA 2QC2A 2C8ZB 1AB9B 2VGCB 2VVVA 3E3TA 3RXTA 2CV3A 3SNDA 3O8CA 3UR6A 2QIQA 2GX4A 4JZFH 1VITF 1HYLA 1HJAC 4WMFA 1A3BH 3P95A 3KQCA 1F0UA 2B8OH 2W3IA 1D3TB 1CO7E 4D9QA 3QZRA 1ESAA 1GBEA 3RXBA 2EEKA 3CP7A 1GHAF 4X1NU 3U69H 1C4U2 4A7IB 4Y8YA 5EOKA 4NIWA 1FN6A 4WVPE 1SLWB 3SV9A 2FI5E 1Z6JH 2ODYB 4E7NA 2QA9E 1O2GH 4DCDA 3T5FH 3GCNA 1GBDA 1O3BA 1O2SA 3LGVA 4FU8A 1DFPA 1O5AB 1S0RA 3ESTA 3AW0A 3V12A 2ZTXA 2SGAA 4CREA 1P3CA 2VGCC 1ELEE 2ZU3A 1BTXA 1C2DA 3IITA 1F7ZA 1OP8A 5EQQA 1HGTH 1ZMJA 3BTQE 1BRUP 1C5XB 4OGXA 1GI2A 1BMMH 1LHGH 3SQEE 1GI9B 2F91A 2A2XH 1C2HA 1XVMA 1VR1H 3MHWU 1EPTB 1TBQH 2SNWA 4ABDA 1GBAA 3SJ8A 2D1JA 3GY7A 1IQFA 4X2WA 2ZHWH 2A5IA 2PUXB 3ZYDA 1PPFE 5DP8A 3HK3B 1H8IH 2W5EA 5A8ZA 3TGKE 1G3EA 1O31A 1KLTA 4ZKSU 5GJ4B 3KNXA 1IQLA 1P02A 4ABHA 1GJ7B 3TU7H 1C5NH 1C5ZB 1DE7H 1ZPZA 2ZFTA 3T27A 5EPNA 1DSUA 2J94A 1SGDE 1OOKB 1QB1A 2ZDNA 4UE7H 1KXBA 3D62A 1GJ5H 1MUEB 1MMJN 2DE9A 5I46H 1EPTC 2Z6BD 2HALA 1A61H 1LPGB 4D8NA 2DE8A 1BCUH 1G9IE 1AZ8A 4ISIH 3UIRA 3SOSA 1YLCA 5T6GA 1OWHA 8GCHG 5FAHA 1WTGH 3A86A 5HXFA 4GCHF 1SGIB 3T29A 1PPCE 2YNBA 4JZDH 3U9AH 1HCGA 4U32A 3FAOA 1CE5A 1KXEA 1O2XA 1UCYK 2D2DA 2RA3A 4XFQA 2EA3A 2FX4A 4B75A 2ZU1A 4TPIZ 1UMAH 1GI0A 1OWIA 5L6NH 2SFAA 1GBJA 5FHTA 3P92A 1TRYA 1DWDH 1LHDH 2TGAA 1T31A 2ZFRH 2ZFPH 1CHGA 4CBNA 4IN1A 4K69A 1GI4A 4BXSA 5ESBA 3LH1A 2HPQH 3HKIB 4MTBA 2AERH 4FU7A 2C3SA 2FESH 1O3PB 3GISB 3TH2H 1IQEA 1BJUA 3E91A 3GY3A 1O2OA 4U2WA 3RXKA 1SBWA 7ESTE 4MDSA 1GCTB 5SGAE 3S9AA 1N6XA 4NSVA 1C5PA 1L1GA 4KTSA 2OTVA 3RXUA 1ELDE 1YGCH 2ILNA 3A7TA 4HFPB 1O5EH 1CVWH 2VWMA 3STIA 1QQ4A 1QRWA 2BD9A 4E05H 4H6TA 1PJPA 2FP7B 1SB1H 2BDCA 2C93B 1T32A 2EI8A 7LPRA 1C2JA 3MOCA 3SNEA 3L6PA 3GYMA 1SLVB 2ZGJA 1G3CA 4NA7A 2BY9X 4JMYA 3BEIB 1YPHC 1CA8B 4IC6A 3TJUA 1CA0C 1GG6B 2Y5HA 2J95A 1RIWB 4Q80A 1ETRH 3MTYA 2ZC9H 3SNCA 3TJOA 1GCTC 4GLYA 4BAHB 2FYRA 4AFZA 3MH6A 2ZTZA 4ZUHA 3DT0H 2Q1JA 1GGDB 1TB6H 2BZAA 2G52A 1TX8A 2WPKS 3I78A 1HRTH 1MTNB 2F9BH 1UTPA 2FS9A 2UUKB 3GOVB 3P8GA 4Y11E 3SJ9A 4Y8XA 1RTFB 5BRRE 1WCZA 1C2EA 1UTLM 4B74A 5AF9H 2BVRH 1BRBE 1MBQA 4NIVA 3SN8A 2ZECA 2NU4E 2BDGA 3U8TH 2P59A 1V2UT 4FU9A 1ZJKA 5FXLA 1Q3XA 1AE8H 1HIAB 2TPIZ 3SJOA 1BTUA 2Y82A 4FUGA 2PKSB 3M7QA 1RIWC 1O2IA 4AORA 1TABE 4IMQA 5EXNA 3F9GA 1GGDC 1NROH 5JBBS 5GIBA 3QGJA 1MTNC 2A4OA 3OTJE 3PROA 4MNWA 4X8SH 1D9IA 5G4BA 2UUJB 3SV2H 1XUGA 3RXOA 3U98H 2VWOA 3M5MA 2G4UA 1EAWA 1XUJA 3KCGH 2R2WU 4K1EA 2A4GA 5LPFA 1WUNH 3SV6A 1WQSA 3BIUH 5HYOA 1O5BB 4X1QU 4KP0A 1UJ1A 5H4IB 1NPMA 1XMNB 4E06H 1G32B 3UFAA 2EI6A 3O8BA 1AQ7A 2ZPQA 2ZCLP 3PB1E 1HUTH 2TGTA 3GCTF 3TPIZ 1T8OA 1MQ6A 1OX1A 2YOLA 1ETSH 1YCPM 4DIIH 1MZDA 1K1PA 3MH5A 4YZUA 1SPJA 3P70B 3QTVH 1QRZA 4BAQB 1AD8H 1LVYA 2HPPH 2Y5FA 3LIWA 4WMDA 4Z0KA 3PLBA 5JBCS 1GVKB 4YLQH 4NSYA 2F9VA 2D26C 6CHAB 3SHAH 1Z1JA 4ASHA 1QHRB 3PMJA 2WINI 2HNTF 1C1MA 1GI3A 1YPKH 1FY4A 3IG6B 2IN2A 2Z9GA 4BTIB 1T7CA 3A7WA 1O2ZA 2W7UA 4R8TB 2AFQB 1ARBA 2FLBH 3VXEH 3LOXA 5A0BA 3EA8A 1BMAA 3GDVA 2QXIA 2VVCA 2B9LA 4UFDH 1TMTH 1BDAA 1UTOA 4J2YB 2ZGBH 1T4VH 1EPTA 2ZQ1A 6CHAC 1YM0A 3MMGA 5EW1H 1AUJA 1C5OH 2BLOA 2VH0A 2CXVA 3MU0A 2FX6A 1J16A 1NRNH 2BDBA 1IQMA 1GHZA 4B73A 4GSOA 3RXPA 2GD4B 4UEHH 1SQOA 1JIMA 3P8OA 1O35A 3BTME 2PTNA 1UVUH 1G36A 2VIPA 4B71A 5DP4A 4INKA 2PGBB 2OP9A 2HRVA 2R0KA 4TWYA 5ABWA 1GHBG 5JDUB 1CGHA 5T6DA 3UUZA 2BD2A 2JKHA 3PV4A 2A5AA 1KLJH 2A7HA 2FTMA 1PQ8A 1KYNA 1WYKA 3GY8A 1FJSA 3PWCA 2PLXA 2PTCE 2V0BA 1WU1A 2IOTA 3A88A 3M37A 5DGJA 5PTPA 1SLXB 4F49A 1TQ7B 2HGTH 1FY3A 1QQUA 2PV9B 3TJNA 4O9VA 4MLFB 3ZZBA 3ZVEA 2BQ6B 3EA9A 1SGCA 1H9IE 1V2QT 1A0LA 1WV7H 3E0NB 3V0XA 1QL8A 1GJ4H 2OXSA 3ITIA 4KTUA 3EYDA 1DVAH 2BHGA 4XDEA 3GCHB 3RXSA 2BDHA 4DW2U 2ZTYA 1EZUC 1LMWB 5A8YA 3ODDA 2XC5A