1FN6A

Crystal structure of porcine beta trypsin with 0.1% polydocanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structures of porcine beta-trypsin-detergent complexes: the stabilization of proteins through hydrophilic binding of polydocanol.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn6A02
2TIOA 4FUHA 3SORA 2P8OC 2ZDMA 1GGDC 1DDJA 2QA9E 4IBLH 3RXUA 3S7KB 1Z1IA 5FXLA 1O3BA 3O8CA 2RA0A 3U69H 1BRBE 5HM9A 2A7HA 1C1WH 2OC7A 1XKAC 1AHTH 4MPXA 3IWMA 4DG4A 4I33A 1T4VH 3RXGA 1FIWA 3A82A 2F91A 2STBE 4O9VA 3TGKE 4HI3A 1Y3XA 2PHBA 4A1XA 2FDAA 2AYWA 1NS3A 5DPAA 1W7XH 4E06H 1DY8A 2VNTA 2LNCA 1O2ZA 1XUFA 1X7AC 2Y81A 1GVLA 2R3UA 3BIVH 1W8BH 2BD4A 2C3SA 1AKSB 1WTHD 4M7GA 2QYIA 3TNTA 4Y11E 1WBGB 1D4PB 1FXYA 1V2WT 3QGJA 3RXVA 1H8IH 1TYNA 3TPIZ 1HAPH 1O3HA 1EPTB 2XCFA 4ASHA 4H42U 2OBQA 5GDSH 4YT7H 2BY8X 1NO9H 3ZZ3A 1C2GA 4FVDA 1HV7A 1ELDE 2WPHS 5C1YA 4CRGA 4B1TA 4ZHLU 2K1QA 2ZWLH 3M5OA 4D9RA 1BIOA 2ODQA 4IGDA 1CA0B 1AB9C 2A7JA 5H4IB 1TNLA 2ZGHA 2TRMA 1DLKB 1O5CB 1QBVH 2ZZUH 7ESTE 2FOGA 3A8BA 5DP3A 4CR9A 2FI5E 1GI4A 1F0UA 1V2JT 2BDHA 3GY2A 2ZECA 3BTWE 4AFUA 2A5AA 3F9GA 1GMDF 3MWIU 5K7RA 4LK4A 3GDUA 2TGPZ 1O2LA 3LC3A 5SGAE 1ZTJA 3GCTF 5A09A 4GPGA 1XUHA 1PPEE 1XX9A 4JYVH 1YGCH 1EJMA 1TGBA 5GCHG 3SU2A 4JYTA 3V3MA 1EAIA 2JETB 1VGCB 1MU8B 2EEKA 1ESBA 1K9OE 3F9HA 4AB9A 1ELBA 3TH2H 1MCTA 1P04A 3P92A 2Q6DA 1T8LA 2JH6D 3BTHE 1H1BA 1QFKH 1SGRE 2BVRH 3ODDA 1EB2A 1GVKB 1S81A 4E7NA 1RIWB 1W0YH 1BTHH 4I8HA 2ODYB 2J38A 3GY3A 4Y7BA 1IQMA 1O2WA 2FI3E 2PV9B 4TPYA 1S0RA 4GHTA 3V0XA 3E16B 2G81E 1GI3A 1BRCE 4UFGH 3LGYA 2D26C 4BAKB 2BZ6H 2CV3A 1DWDH 2ZKSA 1GI1A 2FZZA 5HGGA 3FP8E 1A0HB 4IC6A 3BF6H 2WPKS 5F6MA 1UCYE 1YBWA 4UEHH 2Q1JA 1GL1A 2GP9B 1GBMA 1HPGA 1PQAA 1EZQA 3TJVA 1TLDA 3ZVGA 2FOBA 4FU9A 1TNJA 4UFEH 3SW2B 3T29A 1BQYA 2GCTC 1HB0B 3DFJA 3BG4B 3PWCA 1BBRH 3MFJA 1TGSZ 2ZHDA 1CQQA 3JZ1B 5EQRA 2VH0A 1ZRBA 1XUGA 3E90B 1MKXK 1P10A 2BOKA 3ZYDA 1NFWA 3SNDA 1O3FA 5AHGH 2ZG0H 1TFXA 1NM6A 4KGAA 1P2OA 1Z6EA 1ETTH 1IQJA 1OX1A 3GY6A 1A3BH 4ZROA 1O2OA 3QLPH 3B8JA 1D9IA 4K8BA 2QIQA 2ZO3H 1O2SA 1G32B 5I46H 1BHXF 3BTQE 3SGAE 1ZGIA 2H9EH 4UFFH 4AFZA 2VIOA 1GVZA 2AIPA 1CT0E 2ZFFH 1Y3WA 1HAYB 2Z9KA 2BLOA 3TJOA 2FOFA 2HNTF 1ANCA 1F0SA 1FAKH 4ABJA 4O03A 5DP8A 1DS2E 1AFEH 1Y3YA 4XDEA 3HKJB 2HWLB 2WV5A 1F0RA 4SGAE 3SO3A 3M5LA 1JIRA 5EU8A 3RMNH 2HOBA 3RXBA 4U01A 3QZRA 1IQEA 1W2KH 1YF4A 1HFDA 1ELAA 5GWZA 2ZF0H 4KELA 3F9FA 2Y82A 4RKJB 1A2CH 1BUIA 1ZPZA 3SU5A 1RFNA 1TPOA 3RMMH 1QCPA 1SR5C 3VGCB 3PTNA 1SGFG 1GJBB 5CHAB 1GI8B 1IQLA 1F2SE 1N6YA 2NU3E 3PO1B 1K28D 1SL3A 4NIYA 3SJ9A 1QJ7B 4JZFH 4GVUA 1BHXB 4KP0A 1HJ9A 4Y79A 4GCHF 1C5VA 3AVZA 4DW2U 2QXGA 2A5KA 1PPGE 3LGVA 3SNAA 1TX6A 4DOQA 1IOEA 4LZ4B 2UWPA 4TWWA 1LPZB 2ZHFH 4NWKA 1KLJH 1OWKA 3P8NA 1U6QA 1V2LT 2RCEA 3SV9A 2Z9JA 2Q6GA 2A45B 1J15A 2BVXH 1C1TA 3KF2A 1SG8B 1SGCA 1BTPA 4X1NU 3BEUA 2FESH 1HAHH 2XNIA 1SLWB 1GJ8B 1BZXE 2DE9A 2W7UA 1HJAB 3O8BA 2BTCE 1FQ3A 3ODFA 3RU4D 2HGTH 3RU4T 1KXCA 2H2ZA 4CREA 3P8OA 3ENSB 3Q3YA 2GD4B 1A61H 1FY1A 2FP7B 3MU8A 1O3NA 4Y0YE 1RTLA 4B73A 1GI2A 5T6DA 1O2RA 4OS7A 3SNEA 2H5DA 2ZDAH 5K0HA 3DT0H 3S9BA 2ZPSA 2BB4A 4Y71A 4DIIH 4D8NA 5L30H 3RXRA 2W5EA 5AVDA 1ZJDA 3E1XB 2BQ7B 5FBIA 1WAYB 2FTLE 3UNQA 1KY9A 3ATIA 2VWLA 1ZSLA 1C2DA 2Z9GA 1YPGH 2UWOA 3HKIB 1ELTA 1MTWA 2ILNA 1G2MA 1B0FA 1NZQH 2DE8A 4DY7B 1HCGA 4X1PU 3A7WA 5C3NA 2UWLA 4X8VH 1GMDG 1VJAU 2A1DB 3ZV9A 1DLEA 3GCTG 1MZAA 3RLYH 5HYOA 1TNHA 1TMBH 1NROH 1Q31A 4OS2A 2P3TB 1EPTC 1KSNA 2FEQH 1QJ6B 2R0KA 1EAXA 1OYQA 1UTPA 4FUCA 7GCHF 1E34B 3OY5U 3RXPA 2ALVA 1K1MA 2THFB 1LVMA 4O97A 3KIDU 3GDVA 1JIMA 3MU5A 1BOQA 3QX5H 7KMEH 1TRNA 3O8RA 1O32A 2BX3A 4BAQB 2G5VA 3Q00A 2QXIA 2ZI2H 4ZKNU 4WF8A 4B2CA 1OWJA 1C2KA 2P59A 4HFPB 1CA0C 2VB0A 4XE4A 2OQUA 2QGRA 1C9PA 4ZH8A 4F49A 2C8XB 4B2BA 4FVBA 4JZ1A 1ZMLA 1LTOA 1C2MA 2WPJS 3ZZCA 1MTVA 4MNXA 3HGPA 2QAAA 1HNEE 3FFGA 4BTUB 4IN2A 4XBCA 4MDSA 1LPGB 2FLRH 4MLFB 1P01A 1UTOA 4YTAA 1QL7A 3WY8A 4AORA 4K3JA 2ZHEH 3SBKA 1V3XA 2PR3A 1HAZB 5BPEA 1AZZA 1AIXH 4U32A 2JKHA 1SB1H 5DP4A 1YCPH 3QN7A 2AERH 1TNKA 1SLUB 1K2I1 3BIUH 3EE0B 4ZXYH 2CF9H 2JETC 1O36A 3L3TA 3ZZ4A 3STJA 1GMHF 1H9HE 2BQ6B 1OKXA 2AGGX 3SJOA 1L1JA 4Y10E 5F8XA 1YPHC 1VCWA 1O3OA 1TABE 5JBCS 1J16A 1AWHB 2BX4A 2WV4A 3MU0A 1RIWC 1P9SA 3EDXB 2FPZA 1A5GH 1SHYA 2BDIA 1TRMA 3UNRA 1TMUH 3MO6A 1O2JA 3NK8A 6ESTA 5BRRE 4NFFA 1E36B 1BITA 1ZHRA 1B0EA 5A8ZA 3KGPA 2A2XH 4ABAA 2F9BH 3PB1E 2OC8A 4NFEA 3M5NA 2PGQB 3EYDA 2FS9A 1BBRK 4NA7A 1ELEE 1GJ5H 3A88A 1BMAA 2A5IA 3A7XA 3RXFA 1HAVA 2H1UA 2IJOB 2G4TA 5EOKA 4FXGH 2GZ9A 1TX7A 4AFSA 4A1TA 4OS6A 2UUJB 1SGYE 3BG4C 2CGAA 4I8GA 6GCHF 5A8YA 1C1UH 1EKBB 1D3PB 3BSQA 1UK3A 1Z71A 2R9PA 1C1PA 1GWAA 2RDLA 1TA6A 1GHVH 1HJ8A 2QF0A 1BMMH 1SGQE 3K6YA 4IW4E 3TH4H 1WTGH 4X2YA 4R8TB 1MBQA 3SZNA 1GBTA 1GMCF 1C5RA 5EPYA 3AASA 1CBWB 2BQWB 4THNH 1O3MA 1NFYA 2QY0B 1JMOH 5CMXH 4GCHG 2BD7A 4QT8C 2A2QH 1FV9A 5ETXA 4X2WA 2EI6A 1TNIA 2FX4A 1GBHA 3PV4A 3RP2A 2J34A 1G3BA 4JZIA 4VGCB 1YP9A 4X1SU 1C5MD 1MAXA 2HPQH 2R2WU 3HK6B 5L2ZH 2F9UA 1DANH 2PSXA 2SFAA 1AGJA 4D9QA 1LVYA 5EQSA 1O30A 3P17H 2P16A 1CA8B 4YOIA 1IQKA 3URCA 3HATH 2OP9A 2QXJA 4NSYA 1SGTA 3K2UA 3MNCA 1CVWH 3SUGA 5GJ4B 3PMJA 2A32A 2ZFRH 2QF3A 3GYLB 5DP7A 4BXSA 4CH2B 1P03A 2FOAA 5CHAC 1QBNA 3SQEE 1EJNA 1O3PB 1GI9B 1AN1E 1SGPE 3R0FA 1FY3A 4K69A 2O8TA 4CBNA 1AVWA 2NU0E 4NCYA 2FODA 1SGDE 1PPFE 1C5TA 2FOMB 2HNTC 3NXPA 1UVTH 2F9NA 3UR9A 1GG6B 2FYQA 2WYGA 2ZP0H 1D6WA 3LGTA 1KLIH 5TCCA 1DXPA 1W3CA 2CXVA 2AS9A 3SNCA 2P94A 1MCVA 2AMQA 4ISNA 4WXIA 3K9XB 4Y8XA 3CENA 1RJXB 4Q80A 1YPHE 1PQ7A 4FUFA 1ZZZA 4O3UA 1O3EA 2QC2A 1BA8B 3S7HB 1K1LA 3FAOA 2JH0D 4NZLA 3ZV8A 1J14A 1ELGA 4BXWA 3GCHB 3VXFH 1GBKA 1ZTLA 2G00A 2ULLA 1ZGVA 1W12U 1C1OA 1O5FH 3OYPA 4IMZA 2BM2A 1ANDA 3IITA 1UK2A 5TJXA 1N8OB 1Z6JH 2GVFA 2B7DH 5FPTA 1ZRKA 2VIDA 5FBEA 1YPLH 5EXLA 2XC4A 2Z6BD 1BMNH 3A85A 2XC5A 2VGCC 3VB4A 1AFQC 2FS8A 1O38A 4MVNA 3MHWU 4NSVA 1GJDB 3V13A 3P8FA 4WMEA 2ANYA 4ISIH 1RS0A 4MPUA 4YZUA 3ZVCA 5EW1H 4CRBA 3JZ2B 2CN0H 3TK5A 1GBLA 1TWXB 1TNGA 1TBRH 4TY7A 2ZCLP 4Y6DA 2G8TA 1AI8H 5A8XA 1Z1JA 3EAJA 3QO6A 2SNWA 1GHAF 2Y80A 1QRXA 4YO9A 2FOHA 3HK3B 1ZJKA 1SLXB 3TIUA 1V2UT 2B8OH 4WWYA 4AOQA 1SGIB 2XW9A 1EATA 3I77A 2BD3A 4FUGA 1DM4B 1H8DH 5DK1A 1TONA 3SI4H 1F92A 2ZHWH 2ZCKP 2OCVB 2Z9LA 1GPZA 1A5IA 1TIOA 4AB8A 3ATMA 3GY7A 1O2MA 1O2XA 4AFQA 3VB6A 3S69A 1Z7KA 3ZZBA 1NESE 4UE7H 2XWBI 4TYDA 4UDWH 1S0QA 1YCPK 2P93A 2V0BA 4I31A 1O2YA 1OOKB 1GCDA 1D3DB 4MNWA 3GCOA 4I7YH 5B6OA 1CGHA 1GJAB 1IHTH 1Y5AT 2PUXB 4K1TA 1P11E 1C5LH 2FX6A 2FMJA 2Y6TA 1DOJA 1ELCA 1P2NA 5E8EH 3RXSA 8GCHF 1SQTA 4E05H 3RXCA 1O3JA 1HYLA 1GI7B 2BYAX 1O5BB 2JH5D 1PPBH 2XRCA 2NU4E 4H6TA 1UTKA 1RTKA 3MH7A 3GYMA 3LGUA 1ZHPA 1YPEH 3RXKA 3ZZ8A 1INCA 1TMTH 2GV7A 1WOFA 1SVPA 4MG3A 2FI4E 2PUQH 4GSOA 4LXBH 3Q76A 3VEQB 1UTMA 5L6NH 1XXFA 1ZOMA 4WJG2 4A7IB 4BAMB 1DITH 1IQHA 3R3GB 1A1RA 1YPKH 2H5CA 1P02A 3U9AH 4D7GA 2O8LA 4A1VA 1CU1A 1XVOA 1JRSA 2ZU1A 2I6SA 1RGQA 2CJIA 5DP9A 2G4UA 2CF8H 5T6GA 2TGDA 2R0LA 1D3TB 1FIZA 4CRCA 1NFXA 3O8DA 3A83A 1QURH 2ZA5A 1C5NH 1NRRH 5FX5A 1VR1H 4ZUHA 3K65B 2ZDKA 1OWDA 5F8TA 1UMAH 4YOJA 9LPRA 1H4WA 1W7GH 3BEFB 3M3TA 1P09A 1ELFA 2VWNA 3OX7U 6LPRA 2BMGB 1TB6H 1BTXA 1DICA 1P3CA 1LMWB 3TITA 2ZCHP 3MO9A 3D65E 2OC1A 1GHBG 1SOZA 2Q6FA 4A5TS 3CP7A 1LPKB 4K5ZA 3RUOA 1BTYA 1LHCH 2ZFPH 3RC5A 1MQ5A 1W0ZU 4B2AA 1WQSA 2BOHB 2ZGCA 2SGQE 1D3QB 1THSH 3AW1A 4WH8A 1GBDA 5AFZH 1C5OH 5E0HA 2OUAA 3F6UH 2IOTA 1PQ8A 5FPYA 3TJNA 1V2KT 1TPAE 5FX6A 3UR6A 3URDA 4GUXA 2AMDA 3A89A 1PPZA 1QL8A 1Z8IB 1C5WB 1QNJA 4ESTE 2BHGA 2SGAA 2VVVA 4ZKOU 3DHKH 3G01A 3MU4A 3MTYA 3S9CA 3W95A 1THPB 2CMYA 3SGQE 1G3EA 1C5YB 1BB0B 1ABJH 1ZTKA 1O39A 2VWMA 3DD2H 3BTTE 3QUMP 4YLUA 3ZVAA 1XVMA 4WY3A 5ABWA 2AGIX 3MO3A 1XKBC 2W26A 1O3DA 1F7ZA 4Y76A 1FN8A 1PQ5A 1J9CH 1L4ZA 3S0NA 2H9TH 4ZKSU 4ZHMU 1K1IA 5J4SA 2C90B 2Y5GA 1O3AA 4AG1A 5LPFA 2HRVA 2GTBA 4AN7A 3AW0A 5FCKA 3UFAA 1DSUA 2FTMA 3SUEA 3Q3XA 3HGNA 4XBDA 1O2UA 1TOMH 3E3TA 1P2QA 1QY6A 2EI7A 2P8OB 1CHGA 5FHTA 3UQOA 1LHFH 5F8ZA 1VITH 3PM3A 5DG6A 1K1JA 3ZVFA 1TRYA 2PKSB 4IC5A 5EGMA 4BOHA 2ZU4A 2GMTB 5C1XA 1BT7A 1P12E 2BD9A 4K8YA 1Y3VA 4HGCA 3LJOA 4RKOB 5DP6A 3T27A 3KHVA 1S84A 4AG2A 4FUJA 3SV2H 1AO5A 1GBFA 1WCZA 5E0JA 5GXPA 4J2YB 3ZZ7A 1O2HA 2J2UA 3UIRA 1O2QA 1W14U 1NPMA 5E2OA 2BD5A 2V3HH 2ZFTA 3TGIE 1P3EA 3ESTA 1O0DH 1P9UA 1FI8A 2HALA 1M9UA 3RMLH 4DJZB 1ESTA 1GHAG 3A7ZA 2BDAA 3M61U 3I78A 1OS8A 3TK9A 1FLEE 5EW2H 1TPSA 1HAIH 3GCHC 3RXLA 2VJ1A 2V6NA 3F1SB 1W13U 1C9TA 1SMFE 3FANA 1TGTA 1A0LA 3SNBA 1MD7A 2AGEX 1N8OC 4MTBA 1BBRE 1GDQA 4NIVA 3NUMA 2ZQ1A 1C2JA 5A0BA 4TWYA 3GDSA 2Y7ZA 2ANMH 3UOUA 3LOXA 1OP2A 1JOUB 2G51A 1UVSH 1RRKA 2P3UB 2GT8A 3BTKE 3SOSA 8ESTE 4WH6A 1TGCA 3PLBA 3M3SA 1G9IE 3UREA 5C67A 2VWOA 1N6XA 5E2PA 2SGFE 2BDYA 1LO6A 1LVOA 3VXEH 1UHBA 4Y8ZA 4WMDA 3M7UA 5DKMA 1PYTC 1A4WH 1AE5A 1AY6H 1GI5A 1FZZA 2BVSH 1PPCE 4F4OC 3ZZ9A 3MU1A 4ABDA 1B5GH 1A3EH 1SI5H 3MMGA 2GV6A 4INLA 1V2QT 3AAVA 1ZMJA 3UPEA 2H6MA 1TGNA 3QZQA 1H9LB 1SGFA 3GOVB 4MPVA 4UFDH 4FUBA 1DE7H 2ZFSA 1HDTH 5EQQA 2ESTE 3QDZB 1VGCC 1QL9A 1UVOA 3A7TA 1QIXB 3EQ0H 2W7SA 5DJ7A 1WU1A 2ZQ2A 5T6FA 3RXHA 4ISOA 1C2FA 2YOLA 1WSSH 3MYWA 1LQEA 4JK6A 3GY4A 1ETSH 3LC5A 5C5OA 2O8WA 1IAUA 1AQ7A 3MI4A 1GHZA 5LGOA 1T31A 1NU7B 4Q7YA 2ZGJA 2A4GA 1TQ7B 1QQUA 1BCUH 1SBWA 2OINA 4K1EA 4B71A 3M3VA 4OGXA 5IYTA 1WYKA 4CRDA 1ZPCA 3A81A 1FAXA 1ZPBA 4KKDA 4RN6A 1GJCB 3T62A 1VCPA 1ZR0A 1BJUA 4CH8B 1FDPA 1BRUP 2F9VA 2ASUB 4JMYA 1BMLA 2GZ7A 1CGIE 1SFQB 1V2NT 5GCHF 1Q2WA 3SU3A 5FAHA 1MAYA 4CRAA 3SU0A 2GCTB 1CT2E 2FXRA 3BG8A 1AZ8A 4TPIZ 2ZDLA 1E37B 1C4Y2 3BTGE 1AU8A 4MNYA 1C1SA 1G36A 1LCYA 1EZUC 1SGEE 2OQ5A 3RLWH 3M7QA 3QGNB 1GL0E 3RC6A 1NN6A 5JYIA 1A46H 2SGEE 2F3CE 1HLTH 3UQVA 2VVCA 1UTQA 3ZZ5A 5A0CA 2BLVA 2AFQB 1P05A 4YLQH 1GI6A 1KTSB 1MKXH 3A80A 5DO4H 2WINI 2F83A 2VH6A 4AX9H 1T8OA 2KAIA 4K60A 1YYY1 4BAOB 1P06A 2GCHF 1UJ1A 2ZU5A 1P2IA 2A7CA 4X2VA 3TVJB 1XXDA 4FU8A 9ESTA 2A4OA 2XBWA 3PMHB 1G30B 3H7TA 3SQHE 1UVUH 2W3IA 1QB9A 4ABBA 2C8ZB 5J4QA 2RA3A 3L6PA 3LIWA 1JBUH 3C27B 3QK1A 1BRAA 5AFYH 1O33A 1VITF 5EG4A 5HM2A 3LH3A 2SNVA 1T8NA 2FLBH 2LPRA 5ESTE 1J8AA 1D6RA 1C5SA 4IS5A 1EASA 1SGNE 2FIRH 1LHGH 3RXAA 1T32A 3S9AA 5DGJA 2C8YB 1O2IA 1E38B 1YCPM 1YLCA 2ZTXA 1HIAA 2V35A 2TBSA 2B5TB 2VIQA 2WPLS 4FUDA 4ABHA 2ZGXH 2TPIZ 1C4U2 2P95A 4BAHB 1ELVA 1G3CA 2EC9H 2ALPA 1KIGH 3VGCC 5HXFA 3TJUA 4GHQA 4BTIB 3PO1C 1MTNB 1AMHA 3KQEA 4NA8A 1THRH 4NG9H 1UVPA 1EZXC 1GDUA 1O3GA 4YM9A 1YC0A 1CO7E 1DFPA 3T25A 1TAWA 1GHXH 5JB9S 3GY5A 1FY5A 2A4RA 2HPPH 1GJ7B 1UCYH 1TPPA 3P6ZB 2XBYA 4X8TH 3E6PH 3QWCH 3RXJA 2XYAA 1ESAA 2FM2A 2ZDNA 1TA2A 3MNXA 2BLWA 4ZMAH 3B9FH 1UK4A 2G5NA 2C8WB 1GBCA 4AYYB 1B7XB 3A8DA 3Q77A 1TQ0B 3A7VA 4XBBA 1HJAC 1IQNA 2ANWA 1OPHB 4YESB 2PKSC 4NIXA 3F9EA 3M7TA 5JB8S 4X6PA 2GMTC 4A6LA 1HGTH 7GCHG 2BXTH 1C5PA 4KTUA 2AIQA 1L4DA 1ACBE 5A0AE 5L2YH 1YPMH 3EA8A 5F03A 1NRPH 5LH8A 1QB6A 2Z9IA 3BEIB 1XM1A 2UUFB 3KNXA 4MNVA 3V12A 2UUKB 1CE5A 3PMBB 1C2LA 3PTBA 1NRQH 1T8MA 5AF9H 1QR3E 2V3OH 1UHBB 1C5QA 1O31A 1PPHE 2ZU2A 1O2TA 8KME2 1GBAA 1O3IA 3VB7A 3Q3KA 2A4QA 1C5ZB 3MNSA 1EZSC 3RXIA 2J92A 3SV8A 1K22H 1K21H 2TGTA 1GBEA 4AYVB 4GAWA 4CHAB 3E0PB 3D49H 3SHAH 1ID5H 1JRTA 3TU7H 2XXLA 1NRSH 3VB5A 1T7CA 4FUEA 1GMHG 2Y5FA 3BN9A 2ZPRA 1K1PA 1LVBA 1IQIA 1G37A 1QA7A 2AMPA 2NU1E 3M5MA 4Y0ZE 4YT6H 4LOYH 4B74A 4I32A 3GY8A 2BD8A 3LKWA 3KN2A 3NWUA 5PTPA 1IHSH 1S83A 1ANEA 2DUCA 2YNAA 2AEIH 3LPRA 1GDNA 4B75A 2B9LA 1QB1A 2SGDE 1MTUA 4JCNA 3GCNA 1HUTH 4Q7XA 1W11U 3H7OA 1KXBA 3A7YA 2Z3EA 1FPCH 1A5HA 4ABGA 3ZZDA 2BDCA 5JBAS 3PLPA 1MH0A 2PTNA 1DUAA 2IN2A 1BTUA 4CBOA 2W3KA 4YOGA 2WUBA 2WPIS 4MPWA 1EB1H 4DGJA 2FWWA 3PMAB 1C1RA 4NA9H 5G4BA 1FONA 4NIWA 1KXDA 1RTFB 2ZNKH 3FZDA 1P8VC 4H6SB 2PKAA 1ANBA 1HXEH 1KDQA 1NY22 1HAVB 4TY6A 4IMQA 2OC0A 5FCRA 1FY8E 3QTVH 4K2YA 1GHWH 1KXEA 3E91A 4UONA 1SQOA 1BTWA 4K1SA 1BTZA 6GCHG 1SOTA 5CE1A 2FOEA 1GJ6A 1NFUA 1MU6B 1EJAA 2TGAA 2GDDA 3LH1A 2Z3DA 1F5LA 2RG3A 3ZZ6A 1OWEA 3LJJA 3H5CB 4X1RU 3DA9B 1O5AB 1P2MA 1GCTB 2HNTE 1T4UH 1LHDH 2A31A 2ZPQA 5DP5A 3M36A 2KAIB 1Z8GA 1DT2A 1GMCG 2D1JA 3SUDA 1UO6A 1DWEH 2J94A 2GGVB 2GCHG 1O5EH 3EA9A 1C2EA 4E7RG 1BJVA 1CT4E 5HMAA 4AZ2B 1XUKA 2GKVE 1V2PT 5EODA 5LPEA 1GBJA 1QA0A 1F5RA 1GHYH 1VCQA 2PW8H 4FU7A 1S85A 2PTCE 4Y7AA 2EI8A 3SHCH 4ZXXH 2XBXA 1FN6A 4JZDH 3SGBE 3KCGH 3E8LA 4HZHA 4AGKA 4INHA 4SGBE 3NPSA 3BTFE 2QN5T 3BTME 4JK5A 3LT3A 1VITG 3BV9B 3C1KA 4DURA 1P2KA 1CHOF 2G55A 3QTOH 3NCLA 1DXWA 1AUJA 2P3FH 2XCNA 1O2GH 1A7SA 2Y7XA 3A86A 1JWTA 1C1NA 2IPHA 2OD3B 1HIAB 4NGAH 2FO9A 5GIBA 4WMFA 5LPRA 3K6ZA 3LU9B 1YPJH 1C5XB 3SUFA 4CR5A 2A0QB 2PWXA 1L2EA 4WVPE 1O34A 1G3DA 1L0ZA 3DFLA 1LKBA 3KEEA 3VFEA 1CBWC 1DPOA 2ZHQH 3U1IB 4DCDA 1SC8U 3ZVEA 3ATWA 3PLKA 1KXFA 4FUIA 1AE8H 2ZU3A 1Y5BT 4ABEA 5ESBA 2VINA 6CHAB 3SV6A 2CHAB 3ZZAA 1UTLM 1C5UA 3CS7A 1EQ9A 2D8WA 4VGCC 1AVXA 1J17T 1FUJA 1TE0A 1K1OA 1YKTA 1O2VA 2OBOA 3FVFB 1QRWA 2SGPE 2ANKH 1C1MA 3EA7A 1QRZA 5JBTA 1MKWH 1QQ4A 1C1VH 2B0FA 3N7OA 1QGFA 3SU4A 1Z8JB 4NWLA 1TBZH 3A8AA 4U2WA 4BNRA 1V2MT 3SJ8A 4HTCH 4DT7B 3ZYEA 1OYTH 2J95A 1BDAA 1MTNC 3A84A 2PSYA 1NT1A 1UCYK 4U30A 2O8MA 1O5GH 1GGDB 1FJSA 1O3LA 4ZAEA 4CRFA 4Y8YA 2J9NA 1V2RT 3T5FH 2XC0A 1QHRB 4ZKRU 1O37A 1E35B 3T2NA 5FPSA 2WYJA 1GG6C 4JZEH 3SN8A 2OXSA 1C1QA 1NU9A 3DUXH 1QTFA 1F0TA 3UTUH 4AGJA 2BY5X 1AUTC 2XWAA 3I29A 3RXEA 3TH3H 2ZTZA 4X2XA 2ZTYA 2BY6X 3RXOA 1SQAA 4DVAU 1FPHH 3SJKA 5C1UA 1ZSJA 3FP6E 2BLQA 1P2JA 3A87A 3T26A 1DWCH 2O9QA 4I8JA 1ZYOA 1ZSKA 3D23A 2F9PA 3PWBA 2F9OA 2OLGA 3TGJE 1ABIH 3ATKA 5E0GA 3VPKA 3OY6U 4ISHH 1OXGA 1HRTH 1Z8RA 4GLYA 4BTTB 3SI3H 2I6QA 2GDEH 2BDBA 3RU4E 1XMNB 2VIWA 5C2ZA 1L1NA 3RXQA 1MTSA 2UUYA 1KTTB 4OS5A 3UOPA 1HAOH 1N1LA 1SPJA 2VGCB 3U1JB 1OP8A 1UTJA 1AFQB 1Y3UA 2BZAA 3BTDE 1O5DH 1EP6A 1F5KU 1NRNH 1QJ1B 4D76A 4Q2KA 1C2HA 1AWFH 1DUEA 3B23B 3U98H 4MQAA 1RD3B 1DVAH 1IQFA 1P57B 2ZDVH 2WPMS 2C93B 3ELAH 3FP7E 3RDZA 4Q7ZA 1EUFA 2ZC9H 2VVUA 1AB9B 2QV1A 4IN1A 3T28A 1UTNA 1ZHMA 2PKAB 1CGJE 8GCHG 1KDQB 4Z0KA 4OGYA 1GBBA 3GISB 4CHAC 3L33A 3AAUA 1DY9A 4KTSA 1AKSA 2J4IA 1GI0A 3RXTA 4ABFA 1GJ9B 1EOLA 2G52A 3P95A 1HXFH 2PLXA 1GBIA 4I8KA 4OS1A 1SHHB 3KL6A 1MD8A 4A92A 3MH6A 4X8SH 1E0FD 3U8OH 1OP0A 1PJPA 2PGBB 1EPTA 4R0IA 3HPTB 1EXFA 5IDKA 2C4FH 4ISLA 1GJ4H 4ZHAA 4O3TA 1NC6A 5JDUB 3ATLA 3KQDA 1ORFA 4INKA 1ARCA 1K1NA 2BY9X 2ZFQH 4I8LA 4XSKU 2GZ8A 4J1YA 3IG6B 3LGWA 5JPMH 2Z3CA 2YNBA 1HBTH 5TCAA 1YLDA 1OWIA 2FOCA 1KYNA 1EX3A 3SU6A 5T3HA 1KXAA 1O3KA 3NKKA 1DX5M 2STAE 1QBOA 1JXPA 1LKAA 2O8UA 1C2IA 1XUJA 1ZMNA 1Y59T 2HVXA 3BTEE 1PFXC 1WUNH 1S6FA 3PYHA 3UNSA 1O3CA 4NZQA 4WXVA 1AD8H 1CHOG 1ETRH 2D2DA 1HAGE 2Y5HA 3P8GA 3UWJH 3F68H 5C5NA 3PROA 1EP5A 4PROA 2XBVA 2H9HA 1XUIA 2BY7X 1V2ST 1O2KA 1GCTC 1HAXB 4X8UH 1VZQH 2R2MB 1FY4A 1L1GA 1TALA 4DIHH 1LDTT 4X6NA 3OTJE 1EOJA 1CSOE 3RXDA 1EAWA 3EGKH 2BD2A 1LQDB 3FZZA 5I25A 1FMGA 3U8RH 2NU2E 3TNSA 1MZDA 1LHEH 2BXUH 3KQBA 4OS4A 1TBQH 4Z6AH 2Z94A 1WQVH 2ZGBH 1ARBA 1TOCB 1OSSA 4XOJA 2PFEA 3TLOA 1RXPA 2VIVA 3M37A 4KTCA 1H9IE 1V2TT 1S6HA 1FNIA 1SLVB 1MQ6A 3E0NB 2M5TA 2WUCA 2QCYA 4X0WU 3A8CA 1DSTA 4D7FA 3RM2H 2HLCA 2VIPA 8LPRA 3NZIA 4X6MA 4B76A 3M35A 3GICB 3LONA 4ABIA 1P0SH 2BDGA 1C4V2 1S5SA 3TK6A 4X1QU 1S82A 1KLTA 3STIA 3V7TA 1OWHA 1MUEB 1MBMA 2NWNA 2QXHA 4X6OA 1WV7H 2VU8E 3ZVBA 7LPRA 1AVGH 3RMOH 2GX4A 3UUZA 3MNBA 3SV7A 1DWBH 1O2NA 2ODPA 5EXMA 4LZ1H 3RXMA 2AH4X 3RC4A 3UWIA 1SFIA 2ZEBA 3OSYA 1PYTD 3OU0A 2FYRA 6CHAC 3KQCA 1TX8A 4BANB 2CHAC 1A0JA 3RM0H 1MMJN 1W10U 1GHBF 3MOCA 5EPNA 1O35A 3P70B 5GPIB 3MH5A 5EXNA 1MKWK 5JBBS 3U8TH 1G2LA 1VJ9U 3SU1A 1YM0A 3UY9A 5A2MH 1NTPA 4RSPA 1Q3XA 2EA3A 1IQGA 1SSXA 3CS0A 5C20A 1Y8TA 2GT7A 3LDXH 2Z7FE 4H4FA 4JYUH 3W94A 3ZVDA 2OTVA 3VB3A 3ITIA 3SJIA 3LGIA 1V2OT 4XFQA 2R3YA 1Y5UT 4UD9H 3D62A 1V2VT 1ZLRA 1EAUA 2ZIQH 3MH4A 1V6DA 1O2PA 2XTTB
chains in the Genus database with same CATH superfamily
2TIOA 4FUHA 3SORA 2P8OC 2ZDMA 1GGDC 1DDJA 2QA9E 4IBLH 3RXUA 3S7KB 1Z1IA 5FXLA 1O3BA 3O8CA 2RA0A 3U69H 1BRBE 5HM9A 2A7HA 1C1WH 2OC7A 1XKAC 1AHTH 4MPXA 3IWMA 4DG4A 4I33A 1T4VH 3RXGA 1FIWA 1SKYE 2F91A 3A82A 2STBE 4O9VA 3TGKE 4HI3A 1Y3XA 2PHBA 4A1XA 2FDAA 2AYWA 1NS3A 5DPAA 1W7XH 4E06H 1DY8A 2VNTA 2LNCA 1O2ZA 1XUFA 1W0KD 1X7AC 2Y81A 1GVLA 2R3UA 3BIVH 1W8BH 2BD4A 2C3SA 1AKSB 1WTHD 4M7GA 2EQNA 2QYIA 3TNTA 4Y11E 1WBGB 2QF4A 1D4PB 1FXYA 1V2WT 3QGJA 5CDFE 3RXVA 1H8IH 1TYNA 3TPIZ 1HAPH 1O3HA 3N7EA 1EPTB 2XCFA 4ASHA 4Q63A 4H42U 2OBQA 5GDSH 4YT7H 2BY8X 1NO9H 3ZZ3A 1C2GA 4FVDA 1HV7A 1ELDE 2WPHS 5C1YA 4CRGA 4B1TA 4ZHLU 2K1QA 2ZWLH 3M5OA 2L74A 4D9RA 1BIOA 4ASUD 2ODQA 4IGDA 3F3BA 1CA0B 1AB9C 2A7JA 5H4IB 1TNLA 2ZGHA 2TRMA 1DLKB 1O5CB 1QBVH 2ZZUH 7ESTE 2FOGA 3A8BA 5DP3A 4CR9A 2FI5E 1GI4A 1F0UA 1V2JT 4HG6A 2BDHA 3GY2A 2ZECA 3BTWE 4AFUA 2A5AA 3F9GA 1GMDF 3MWIU 5K7RA 4LK4A 3GDUA 2TGPZ 1O2LA 3LC3A 5SGAE 1ZTJA 3GCTF 5A09A 4GPGA 1XUHA 1PPEE 1XX9A 4JYVH 1YGCH 1EJMA 1TGBA 5GCHG 3SU2A 4JYTA 3V3MA 1EAIA 3FN8A 2JETB 1VGCB 1MU8B 2GJGA 2EEKA 1ESBA 1K9OE 3F9HA 4AB9A 1ELBA 3TH2H 1MCTA 1P04A 3P92A 2Q6DA 1T8LA 2JH6D 3BTHE 1H1BA 1QFKH 1SGRE 2BVRH 3ODDA 1EB2A 1GVKB 1S81A 2LELA 4E7NA 1RIWB 1W0YH 1BTHH 4I8HA 2ODYB 2J38A 3GY3A 4Y7BA 3KYGA 1IQMA 5F53A 1O2WA 2FI3E 2PV9B 4TPYA 1S0RA 4GHTA 3V0XA 3E16B 2G81E 1GI3A 1BRCE 4UFGH 3LGYA 2D26C 4BAKB 2BZ6H 2CV3A 1DWDH 2ZKSA 1GI1A 2FZZA 5HGGA 3FP8E 1A0HB 4IC6A 3BF6H 2WPKS 5F6MA 1WXRA 1UCYE 1YBWA 4UEHH 2Q1JA 1GL1A 2GP9B 1GBMA 1HPGA 1PQAA 1EZQA 3TJVA 1TLDA 3ZVGA 2FOBA 4FU9A 1TNJA 4UFEH 3SW2B 3T29A 1BQYA 2GCTC 1HB0B 3DFJA 3BG4B 3PWCA 1BBRH 3MFJA 1TGSZ 2ZHDA 1CQQA 3JZ1B 5EQRA 2VH0A 1ZRBA 1XUGA 3E90B 1MKXK 1P10A 2BOKA 3ZYDA 1NFWA 3SNDA 2WSSD 1O3FA 5AHGH 2ZG0H 1TFXA 1NM6A 4KGAA 1P2OA 1Z6EA 1ETTH 1IQJA 1OX1A 3GY6A 1A3BH 4ZROA 1O2OA 3QLPH 3B8JA 1D9IA 4K8BA 2QIQA 2ZO3H 1O2SA 1G32B 4M9FA 5I46H 1BHXF 3BTQE 3SGAE 1ZGIA 2H9EH 4UFFH 4AFZA 2VIOA 1GVZA 2AIPA 1CT0E 2ZFFH 1Y3WA 1HAYB 2Z9KA 2BLOA 3TJOA 2FOFA 2HNTF 1ANCA 1F0SA 1FAKH 4ABJA 4O03A 5DP8A 1DS2E 1AFEH 1Y3YA 4XDEA 3HKJB 2HWLB 2WV5A 1F0RA 4SGAE 3SO3A 3M5LA 1JIRA 5EU8A 3RMNH 4P00A 2HOBA 3RXBA 4U01A 3QZRA 1IQEA 1W2KH 3MQKC 1YF4A 1HFDA 4XRNA 1ELAA 5GWZA 2ZF0H 2F43B 4KELA 3F9FA 2Y82A 4RKJB 1A2CH 1BUIA 1ZPZA 3SU5A 1RFNA 1TPOA 3RMMH 1QCPA 1SR5C 3SYJA 3PTNA 3VGCB 1SGFG 1GJBB 5CHAB 1GI8B 1IQLA 1F2SE 1N6YA 2NU3E 3PO1B 1K28D 1SL3A 4NIYA 3SJ9A 1QJ7B 4JZFH 4GVUA 1BHXB 4KP0A 1HJ9A 4Y79A 4GCHF 1C5VA 3AVZA 4DW2U 2QXGA 2A5KA 1PPGE 3LGVA 3SNAA 1TX6A 4DOQA 1IOEA 4LZ4B 2UWPA 4TWWA 1LPZB 2ZHFH 4NWKA 1KLJH 1OWKA 3P8NA 1U6QA 1V2LT 2RCEA 4ACAA 3SV9A 2Z9JA 2Q6GA 2A45B 1J15A 2BVXH 1C1TA 3KF2A 2OK5A 1SG8B 3DSGA 1SGCA 1BTPA 4X1NU 3BEUA 2FESH 1HAHH 2XNIA 1SLWB 1GJ8B 1BZXE 2DE9A 2W7UA 1HJAB 3O8BA 2BTCE 1FQ3A 3ODFA 3RU4D 2HGTH 3RU4T 1KXCA 2H2ZA 4CREA 3P8OA 3ENSB 3Q3YA 2GD4B 1A61H 1FY1A 2FP7B 3MU8A 1O3NA 4Y0YE 1RTLA 4B73A 1GI2A 5T6DA 1O2RA 4OS7A 3SNEA 2H5DA 2ZDAH 5K0HA 3DT0H 3S9BA 2ZPSA 2BB4A 4Y71A 4DIIH 4D8NA 5L30H 3RXRA 2W5EA 5AVDA 1ZJDA 3E1XB 2BQ7B 5FBIA 1WAYB 2FTLE 3UNQA 1KY9A 3ATIA 2VWLA 1ZSLA 1C2DA 2Z9GA 1YPGH 2UWOA 3HKIB 1ELTA 1MTWA 2ILNA 2KCAA 2YMSD 1G2MA 1B0FA 1NZQH 2DE8A 4DY7B 1HCGA 4X1PU 3A7WA 5C3NA 2UWLA 4X8VH 5FL7D 1GMDG 4FETA 1VJAU 2A1DB 3ZV9A 1DLEA 3GCTG 1MZAA 3RLYH 5HYOA 1TNHA 1TMBH 1NROH 1Q31A 4OS2A 2P3TB 1EPTC 1KSNA 2FEQH 1QJ6B 2R0KA 1EAXA 1OYQA 1UTPA 4FUCA 7GCHF 2QF5A 1E34B 3OY5U 3RXPA 2ALVA 1K1MA 2THFB 1LVMA 4O97A 3KIDU 3GDVA 1JIMA 3MU5A 1BOQA 3QX5H 7KMEH 1TRNA 3O8RA 1O32A 2BX3A 4BAQB 2G5VA 3Q00A 2QXIA 2ZI2H 4ZKNU 4WF8A 4B2CA 1OWJA 1C2KA 2P59A 4HFPB 1CA0C 2VB0A 4XE4A 2OQUA 2QGRA 1C9PA 4ZH8A 4F49A 2C8XB 4B2BA 4FVBA 4JZ1A 1ZMLA 1LTOA 1C2MA 2WPJS 3ZZCA 1MTVA 2EY4C 4MNXA 3HGPA 2QAAA 1HNEE 3FFGA 4BTUB 4IN2A 4XBCA 4MDSA 1LPGB 2FLRH 4MLFB 1P01A 1UTOA 4YTAA 1QL7A 3WY8A 4AORA 4K3JA 2ZHEH 3SBKA 1V3XA 2PR3A 1HAZB 5BPEA 1AZZA 1AIXH 4U32A 2JKHA 1SB1H 5DP4A 1YCPH 3QN7A 2AERH 5KECA 1TNKA 1SLUB 1K2I1 3BIUH 3EE0B 4ZXYH 2CF9H 2JETC 1O36A 3L3TA 3ZZ4A 3STJA 1GMHF 1H9HE 5EIYA 3PV5A 2BQ6B 1OKXA 2AGGX 3SJOA 1L1JA 4Y10E 5F8XA 1YPHC 1VCWA 3U28C 1O3OA 1TABE 5JBCS 2W6ID 1J16A 1AWHB 1NBMD 2BX4A 2WV4A 3MU0A 1RIWC 1P9SA 3EDXB 5C0TA 2FPZA 1A5GH 1SHYA 2BDIA 1TRMA 3UNRA 1TMUH 3MO6A 1O2JA 3NK8A 6ESTA 5BRRE 4NFFA 1E36B 1BITA 1ZHRA 1B0EA 5A8ZA 3KGPA 2A2XH 4ABAA 2F9BH 3PB1E 2OC8A 4NFEA 5C94A 3M5NA 2PGQB 3EYDA 2FS9A 1BBRK 4NA7A 1ELEE 1GJ5H 3A88A 1BMAA 2A5IA 3A7XA 3RXFA 1HAVA 2H1UA 2IJOB 2G4TA 5EOKA 4FXGH 2GZ9A 1TX7A 4AFSA 4A1TA 4OS6A 2UUJB 4B6FA 1SGYE 3BG4C 2KCYA 2CGAA 4I8GA 6GCHF 5A8YA 1C1UH 1EKBB 2JJ1D 1D3PB 3BSQA 1UK3A 1Z71A 2R9PA 1C1PA 1GWAA 2RDLA 1TA6A 1GHVH 1HJ8A 2QF0A 1BMMH 1SGQE 5KEDA 3K6YA 4IW4E 3TH4H 1WTGH 4X2YA 4R8TB 1MBQA 3SZNA 1GBTA 1GMCF 1C5RA 5EPYA 3AASA 1CBWB 2BQWB 4THNH 1O3MA 1NFYA 2QY0B 3H09A 1JMOH 5CMXH 4GCHG 2BD7A 4QT8C 3OFND 2A2QH 1FV9A 5ETXA 4X2WA 2EI6A 1TNIA 2FX4A 1GBHA 3PV4A 3RP2A 2J34A 1G3BA 4JZIA 4VGCB 1YP9A 4X1SU 1C5MD 1MAXA 2HPQH 2R2WU 3HK6B 5L2ZH 2F9UA 1DANH 2PSXA 2SFAA 1AGJA 4D9QA 1LVYA 2CK3D 5EQSA 1O30A 3P17H 1BMFD 2P16A 1CA8B 4YOIA 1IQKA 3URCA 3HATH 2OP9A 2QXJA 4NSYA 1H8ED 1SGTA 3K2UA 3MNCA 1CVWH 3SUGA 5GJ4B 3PMJA 2A32A 2ZFRH 2QF3A 3GYLB 5DP7A 4BXSA 4CH2B 1P03A 2FOAA 5CHAC 1QBNA 3SQEE 3DSOA 1EJNA 1O3PB 1GI9B 1AN1E 1SGPE 3R0FA 1FY3A 4K69A 2RFKC 2O8TA 4CBNA 1VKYA 1AVWA 2NU0E 4NCYA 2FODA 1SGDE 1PPFE 1C5TA 2FOMB 2HNTC 3NXPA 1UVTH 2F9NA 3UR9A 3PV2A 1GG6B 2FYQA 2WYGA 2ZP0H 1D6WA 3LGTA 1KLIH 5TCCA 1DXPA 1W3CA 2CXVA 2AS9A 3SNCA 2P94A 1MCVA 2AMQA 4ISNA 4WXIA 3K9XB 4Y8XA 3CENA 1RJXB 4Q80A 1YPHE 1PQ7A 4FUFA 3AK5A 1ZZZA 4O3UA 1O3EA 2QC2A 1BA8B 3S7HB 1K1LA 3FAOA 2JH0D 4NZLA 3ZV8A 1J14A 1ELGA 4BXWA 3GCHB 4TT3D 3VXFH 1GBKA 1ZTLA 2G00A 2ULLA 1ZGVA 1W12U 1C1OA 1O5FH 3OYPA 4IMZA 2BM2A 1ANDA 3IITA 1UK2A 5TJXA 1N8OB 1Z6JH 2GVFA 2B7DH 5FPTA 1ZRKA 2VIDA 5FBEA 1YPLH 5EXLA 2XC4A 2Z6BD 3F2FA 1BMNH 3A85A 2XC5A 2VGCC 3VB4A 1AFQC 2FS8A 1O38A 4MVNA 3MHWU 4NSVA 1GJDB 3V13A 2J97A 3P8FA 4WMEA 2ANYA 4ISIH 1RS0A 4MPUA 4YZUA 3ZVCA 5EW1H 4CRBA 3JZ2B 2CN0H 3TK5A 1GBLA 1TWXB 1TNGA 1TBRH 4TY7A 2ZCLP 4Y6DA 2G8TA 1AI8H 5A8XA 1Z1JA 4AC9A 3EAJA 3QO6A 2SNWA 3OE7D 1GHAF 2Y80A 1QRXA 4YXWD 4YO9A 2FOHA 3HK3B 1ZJKA 1SLXB 3TIUA 1V2UT 2B8OH 2KCOA 4WWYA 4AOQA 1SGIB 2XW9A 1EATA 3I77A 2BD3A 4FUGA 1DM4B 1H8DH 5DK1A 1TONA 3SI4H 1F92A 2ZHWH 2ZCKP 2OCVB 2Z9LA 1GPZA 1A5IA 1TIOA 4AB8A 3ATMA 3GY7A 1O2MA 1O2XA 4AFQA 3VB6A 3S69A 1Z7KA 2F4LA 3ZZBA 1NESE 4UE7H 2XWBI 3SZEA 4TYDA 4UDWH 1S0QA 1YCPK 2P93A 2V0BA 4I31A 5HIZA 1O2YA 1OOKB 2HVYB 1GCDA 1D3DB 4MNWA 3GCOA 4I7YH 5B6OA 1CGHA 1GJAB 1IHTH 1Y5AT 2PUXB 4K1TA 1P11E 1C5LH 2FX6A 2V7QD 2FMJA 2Y6TA 1DOJA 1ELCA 3PRBA 1P2NA 5E8EH 3RXSA 8GCHF 1SQTA 4E05H 3RXCA 1O3JA 1HYLA 1GI7B 2BYAX 1O5BB 2JH5D 1OHHD 1PPBH 2XRCA 2NU4E 4H6TA 1UTKA 1RTKA 3MH7A 3GYMA 3LGUA 1ZHPA 1YPEH 3RXKA 3ZZ8A 2KM0A 1INCA 5CHBA 1TMTH 2GV7A 1WOFA 1SVPA 4MG3A 2FI4E 2PUQH 4GSOA 1E1QD 4LXBH 3Q76A 3VEQB 1UTMA 5L6NH 1XXFA 1ZOMA 4WJG2 4A7IB 4BAMB 1DITH 1IQHA 3R3GB 1A1RA 1YPKH 2H5CA 1P02A 3U9AH 4D7GA 2O8LA 4A1VA 1CU1A 1XVOA 1JRSA 2ZU1A 2I6SA 1RGQA 2CJIA 5DP9A 2G4UA 2CF8H 5T6GA 2TGDA 2R0LA 1D3TB 1FIZA 4CRCA 1NFXA 3O8DA 3A83A 1QURH 2ZA5A 1C5NH 1NRRH 5FX5A 1VR1H 4ZUHA 3K65B 2ZDKA 1OWDA 5F8TA 1UMAH 4YOJA 4P02A 9LPRA 1H4WA 1W7GH 3BEFB 3M3TA 1P09A 1ELFA 2VWNA 3OX7U 6LPRA 2BMGB 1TB6H 1BTXA 1DICA 1P3CA 1LMWB 3TITA 2ZCHP 3MO9A 3D65E 2OC1A 2J98B 1GHBG 1SOZA 2Q6FA 4A5TS 3CP7A 1LPKB 4K5ZA 3RUOA 1BTYA 1LHCH 2ZFPH 3RC5A 1MQ5A 3F2HA 1W0ZU 4B2AA 1WQSA 2BOHB 2ZGCA 2SGQE 3WWBA 1D3QB 1THSH 3AW1A 4WH8A 1GBDA 5AFZH 1C5OH 5E0HA 2OUAA 3F6UH 1COWD 2IOTA 1PQ8A 5FPYA 3TJNA 1V2KT 1TPAE 5FX6A 3UR6A 3URDA 4GUXA 2AMDA 3A89A 1PPZA 1QL8A 1Z8IB 1C5WB 1QNJA 3F0PA 4ESTE 2BHGA 2SGAA 2VVVA 4ZKOU 4FOUC 3DHKH 3FKSD 3G01A 3MU4A 3MTYA 3S9CA 3W95A 1THPB 2CMYA 3SGQE 1G3EA 1C5YB 1BB0B 1ABJH 1ZTKA 1O39A 2VWMA 3DD2H 3BTTE 3QUMP 4YLUA 3ZVAA 1XVMA 2KX4A 4WY3A 5ABWA 2AGIX 3MO3A 1XKBC 2W26A 1O3DA 1F7ZA 4Y76A 1FN8A 1PQ5A 1J9CH 5HIYA 1L4ZA 3S0NA 2H9TH 4ZKSU 4ZHMU 1K1IA 5J4SA 2C90B 2Y5GA 1O3AA 4AG1A 5LPFA 2HRVA 2GTBA 4AN7A 3AW0A 5FCKA 3UFAA 1DSUA 2FTMA 3SUEA 3Q3XA 3HGNA 4XBDA 5C0UA 1O2UA 1TOMH 3E3TA 1P2QA 1QY6A 2EI7A 2P8OB 1K0HA 1CHGA 5FHTA 3UQOA 1LHFH 5F8ZA 1VITH 3PM3A 5DG6A 1K1JA 3ZVFA 1TRYA 2PKSB 4IC5A 5EGMA 4BOHA 2ZU4A 2GMTB 5C1XA 1BT7A 1P12E 2BD9A 4K8YA 1Y3VA 4HGCA 3LJOA 2XNDD 4RKOB 5DP6A 3T27A 3KHVA 1S84A 4AG2A 4FUJA 5DSFA 3SV2H 1AO5A 1GBFA 1WCZA 5E0JA 5GXPA 4J2YB 3ZZ7A 1O2HA 2J2UA 3UIRA 1O2QA 1W14U 2WV9A 1NPMA 5E2OA 2BD5A 2V3HH 2ZFTA 1YY3A 3TGIE 1P3EA 3ESTA 1O0DH 1P9UA 1FI8A 4Z1MD 2HALA 1M9UA 3RMLH 4DJZB 1ESTA 1GHAG 3A7ZA 2BDAA 3M61U 3I78A 1OS8A 3TK9A 1FLEE 5EW2H 1TPSA 1HAIH 3GCHC 3RXLA 2VJ1A 2V6NA 3F1SB 1W13U 3CNRA 1C9TA 1SMFE 3FANA 1TGTA 1A0LA 3SNBA 1MD7A 2AGEX 1N8OC 4MTBA 1BBRE 1GDQA 4NIVA 3NUMA 2ZQ1A 1C2JA 5A0BA 2XOKD 2M2AA 4TWYA 3GDSA 2Y7ZA 2ANMH 3UOUA 3LOXA 1OP2A 1JOUB 2G51A 1UVSH 1RRKA 2P3UB 2GT8A 3BTKE 3SOSA 8ESTE 4WH6A 1TGCA 2WZQA 3PLBA 3M3SA 1G9IE 5EJZA 3UREA 5C67A 2VWOA 1N6XA 5E2PA 2SGFE 2BDYA 1LO6A 1LVOA 3VXEH 1UHBA 4Y8ZA 4WMDA 3M7UA 5DKMA 1PYTC 1A4WH 1AE5A 1AY6H 1GI5A 1FZZA 2BVSH 1PPCE 3WWFA 4F4OC 3ZZ9A 3DCLA 3MU1A 4ABDA 1B5GH 1A3EH 2QE7D 1SI5H 3MMGA 2GV6A 4INLA 1S6LA 1V2QT 3AAVA 1ZMJA 3UPEA 2H6MA 1TGNA 3QZQA 1H9LB 1SGFA 3GOVB 4MPVA 4UFDH 2AHME 4FUBA 1DE7H 2ZFSA 1HDTH 5EQQA 2ESTE 3QDZB 1VGCC 1QL9A 1UVOA 4F48B 3A7TA 1QIXB 3EQ0H 2W7SA 5DJ7A 1WU1A 2ZQ2A 5T6FA 3RXHA 4ISOA 1C2FA 2YOLA 1WSSH 5HKKD 3MYWA 1LQEA 4JK6A 2WHXA 3OTPA 3GY4A 1ETSH 3LC5A 5C5OA 2O8WA 1IAUA 1AQ7A 3MI4A 1GHZA 5LGOA 1T31A 1NU7B 4Q7YA 2ZGJA 2A4GA 1TQ7B 1QQUA 1BCUH 1SBWA 2OINA 3KYFA 4K1EA 3M3VA 2J5UA 4OGXA 5IYTA 4B71A 1WYKA 4CRDA 1ZPCA 3A81A 3OEHD 1FAXA 1ZPBA 4KKDA 4RN6A 1GJCB 3T62A 1VCPA 1ZR0A 1BJUA 4CH8B 1FDPA 1BRUP 2F9VA 2ASUB 4JMYA 1BMLA 2GZ7A 1CGIE 1SFQB 1V2NT 5GCHF 1Q2WA 3SU3A 5FAHA 1MAYA 4CRAA 3SU0A 2GCTB 1CT2E 2FXRA 3BG8A 1AZ8A 4TPIZ 1EFRD 2ZDLA 1E37B 1C4Y2 3BTGE 1AU8A 4MNYA 1C1SA 1G36A 1LCYA 1EZUC 1SGEE 2OQ5A 3RLWH 3M7QA 3QGNB 1GL0E 3RC6A 1NN6A 2YMSB 5JYIA 1A46H 2SGEE 2F3CE 1HLTH 3UQVA 2VVCA 1UTQA 3ZZ5A 5A0CA 2BLVA 2AFQB 1P05A 4YLQH 1GI6A 1KTSB 1MKXH 3A80A 5DO4H 2WINI 2F83A 2VH6A 4AX9H 1T8OA 2KAIA 4K60A 1YYY1 4BAOB 1P06A 2GCHF 1UJ1A 2ZU5A 1P2IA 2A7CA 4X2VA 3TVJB 1XXDA 4FU8A 9ESTA 2A4OA 2XBWA 3PMHB 1G30B 3H7TA 3SQHE 1UVUH 2W3IA 1QB9A 4ABBA 2C8ZB 5J4QA 2RA3A 3L6PA 3LIWA 1JBUH 3C27B 3QK1A 1BRAA 5AFYH 1O33A 1VITF 5EG4A 5HM2A 3LH3A 2SNVA 1T8NA 2FLBH 2LPRA 5ESTE 1J8AA 1D6RA 1C5SA 4IS5A 1EASA 1SGNE 2FIRH 1LHGH 2IPQX 3RXAA 1T32A 3S9AA 4ACBA 5DGJA 2C8YB 1O2IA 1E38B 1YCPM 1YLCA 2ZTXA 1HIAA 2V35A 2TBSA 2B5TB 2VIQA 2WPLS 4FUDA 4ABHA 2ZGXH 2TPIZ 1C4U2 1SQRA 2P95A 4BAHB 1ELVA 1G3CA 2EC9H 2ALPA 1KIGH 3VGCC 5HXFA 3TJUA 4GHQA 4BTIB 3PO1C 1H8HD 1MTNB 1AMHA 3KQEA 4NA8A 1THRH 4NG9H 1UVPA 1EZXC 1GDUA 1O3GA 4YM9A 1YC0A 1CO7E 1DFPA 4RT0A 3T25A 1TAWA 1GHXH 1WDIA 5JB9S 3GY5A 1FY5A 2A4RA 2HPPH 1GJ7B 1UCYH 1TPPA 3P6ZB 2XBYA 4X8TH 1FX0B 3E6PH 3QWCH 3RXJA 2XYAA 1QZ8A 1ESAA 2FM2A 2ZDNA 1TA2A 3MNXA 2BLWA 4ZMAH 3B9FH 1UK4A 2G5NA 2C8WB 3OEED 2VBCA 1GBCA 4AYYB 1B7XB 3A8DA 3Q77A 1TQ0B 3A7VA 4XBBA 3UB0A 1HJAC 1IQNA 2ANWA 1OPHB 4YESB 2PKSC 4NIXA 3F9EA 3M7TA 5JB8S 4X6PA 2GMTC 4A6LA 1HGTH 7GCHG 2BXTH 1C5PA 4KTUA 2AIQA 1L4DA 1ACBE 5A0AE 5L2YH 1YPMH 3EA8A 5F03A 1NRPH 5LH8A 5EJLA 1QB6A 2Z9IA 3BEIB 1XM1A 2JJ2D 2UUFB 3KNXA 4MNVA 3V12A 2UUKB 1CE5A 3PMBB 1C2LA 3PTBA 1NRQH 2L6OA 1T8MA 5AF9H 1QR3E 2V3OH 1UHBB 1C5QA 1O31A 1PPHE 2ZU2A 1O2TA 3GS9A 8KME2 1GBAA 1O3IA 3VB7A 3Q3KA 2A4QA 1C5ZB 3MNSA 1EZSC 3RXIA 3FO8D 2J92A 3SV8A 1K22H 1K21H 2TGTA 1GBEA 4AYVB 4GAWA 4DT4A 4CHAB 3E0PB 3D49H 3SHAH 1ID5H 1JRTA 3TU7H 2XXLA 1NRSH 3VB5A 1T7CA 4FUEA 1GMHG 2Y5FA 3BN9A 2ZPRA 4RI0A 1K1PA 1LVBA 1IQIA 1G37A 1QA7A 2AMPA 2NU1E 3M5MA 4Y0ZE 4YT6H 4LOYH 4B74A 4I32A 3GY8A 2BD8A 3LKWA 3KN2A 3NWUA 5PTPA 1IHSH 1S83A 1ANEA 2DUCA 3PRDA 2YNAA 2AEIH 3LPRA 1GDNA 4B75A 2B9LA 1QB1A 2SGDE 1MTUA 4JCNA 3GCNA 1HUTH 4Q7XA 1W11U 3H7OA 1KXBA 3A7YA 2Z3EA 1FPCH 1A5HA 4ABGA 3ZZDA 2BDCA 3F2GA 5JBAS 3PLPA 1MH0A 2PTNA 1DUAA 2IN2A 1BTUA 2JDID 2W3KA 4YOGA 4CBOA 2WUBA 2WPIS 5B6LA 4MPWA 1EB1H 4DGJA 2FWWA 3PMAB 1C1RA 4NA9H 5G4BA 1FONA 4NIWA 1KXDA 4I86A 1RTFB 2ZNKH 3FZDA 1P8VC 2KCPA 2PKAA 4H6SB 1ANBA 1HXEH 1KDQA 1NY22 1HAVB 4TY6A 4IMQA 2OC0A 5FCRA 1FY8E 3QTVH 4K2YA 1GHWH 1KXEA 3E91A 4UONA 1SQOA 1BTWA 4K1SA 3KQ5A 1BTZA 6GCHG 1SOTA 5EJ1A 5CE1A 2FOEA 1GJ6A 1NFUA 1MU6B 1EJAA 2TGAA 2GDDA 5IK2D 3LH1A 4OM9A 2Z3DA 1F5LA 2RG3A 3ZZ6A 1OWEA 3LJJA 3H5CB 1UW7A 4X1RU 3FOAA 3DA9B 1O5AB 1P2MA 1GCTB 2HNTE 1T4UH 1LHDH 2A31A 2ZPQA 5DP5A 3M36A 2KAIB 1Z8GA 1DT2A 1GMCG 2D1JA 3SUDA 1UO6A 1DWEH 2J94A 2GGVB 2GCHG 1O5EH 2W6JD 3EA9A 4Q4LA 1C2EA 3ZIAD 4E7RG 1BJVA 1CT4E 5HMAA 4AZ2B 1XUKA 2GKVE 1V2PT 5EODA 5LPEA 1GBJA 1QA0A 1F5RA 1GHYH 1VCQA 2PW8H 4FU7A 1S85A 2PTCE 4Y7AA 2EI8A 3SHCH 3W1EA 4ZXXH 2XBXA 2IJD1 1FN6A 4JZDH 3SGBE 3KCGH 3E8LA 3N99A 4HZHA 4AGKA 4INHA 4SGBE 3NPSA 3BTFE 2QN5T 3BTME 4JK5A 3LT3A 1VITG 3BV9B 3C1KA 4DURA 1P2KA 1CHOF 2KZ4A 2G55A 2YMSC 3QTOH 3NCLA 1DXWA 1AUJA 2P3FH 2XCNA 1O2GH 1A7SA 2Y7XA 3A86A 1JWTA 1C1NA 2IPHA 2OD3B 1HIAB 4NGAH 2FO9A 5GIBA 4WMFA 5LPRA 3K6ZA 5T1VA 3LU9B 1YPJH 1C5XB 3SUFA 2KFWA 4CR5A 2A0QB 2PWXA 1L2EA 4WVPE 1O34A 1G3DA 1L0ZA 3EE7A 3DFLA 1LKBA 3KEEA 3VFEA 1CBWC 1DPOA 2ZHQH 3U1IB 4DCDA 1SC8U 3ZVEA 3ATWA 3PLKA 1KXFA 4FUIA 1AE8H 2ZU3A 1Y5BT 4ABEA 5ESBA 2VINA 6CHAB 3SV6A 2CHAB 3ZZAA 1UTLM 1C5UA 3F0OA 3CS7A 1EQ9A 2D8WA 4VGCC 1AVXA 1J17T 1FUJA 1TE0A 1K1OA 1YKTA 1O2VA 2OBOA 3VG8A 3FVFB 1QRWA 2SGPE 2ANKH 3UAIC 1C1MA 4TSFD 3EA7A 1QRZA 5JBTA 1MKWH 1QQ4A 1C1VH 2B0FA 3N7OA 1QGFA 3SU4A 4B6EA 1Z8JB 4NWLA 1TBZH 3A8AA 4U2WA 4BNRA 1YLNA 1V2MT 3SJ8A 4HTCH 4DT7B 3ZYEA 1OYTH 2J95A 1BDAA 1MTNC 2WPDD 3A84A 2PSYA 5KGOA 1NT1A 1UCYK 4U30A 2O8MA 1O5GH 1GGDB 1FJSA 1MABB 1O3LA 4ZAEA 4CRFA 4Y8YA 2K8IA 2J9NA 1V2RT 3T5FH 2XC0A 1QHRB 4ZKRU 1O37A 2HLDD 1E35B 3T2NA 5FPSA 2WYJA 1GG6C 4JZEH 3SN8A 2OXSA 2JIZD 1C1QA 1NU9A 3DUXH 1QTFA 1F0TA 3UTUH 4AGJA 2BY5X 1AUTC 2XWAA 3I29A 3RXEA 3TH3H 2ZTZA 4X2XA 2ZTYA 2BY6X 3RXOA 1SQAA 4DVAU 1FPHH 3SJKA 5C1UA 1ZSJA 3FP6E 2BLQA 1P2JA 3A87A 3T26A 1DWCH 2O9QA 4I8JA 1ZYOA 1ZSKA 3D23A 2F9PA 3PWBA 2F9OA 2OLGA 3TGJE 1ABIH 3ATKA 5E0GA 3VPKA 3OY6U 4ISHH 1OXGA 2LP6A 1HRTH 1Z8RA 4GLYA 4BTTB 3SI3H 2I6QA 2GDEH 2BDBA 3RU4E 1XMNB 2VIWA 5C2ZA 1L1NA 3RXQA 1MTSA 2UUYA 1KTTB 4OS5A 3UOPA 1HAOH 1N1LA 1SPJA 2VGCB 3U1JB 1OP8A 1UTJA 1AFQB 1Y3UA 2BZAA 3BTDE 1O5DH 1EP6A 1F5KU 1NRNH 1QJ1B 4D76A 4Q2KA 1C2HA 1AWFH 1DUEA 3B23B 3U98H 4MQAA 1RD3B 1DVAH 1IQFA 1P57B 2ZDVH 2WPMS 2C93B 3ELAH 3FP7E 3RDZA 4Q7ZA 1EUFA 2ZC9H 2VVUA 1AB9B 2QV1A 4IN1A 3T28A 1UTNA 1ZHMA 2PKAB 1CGJE 8GCHG 1KDQB 4Z0KA 4OGYA 1GBBA 3GISB 4CHAC 3L33A 3N7DA 3AAUA 1DY9A 4KTSA 1AKSA 2J4IA 1GI0A 3RXTA 4ABFA 1GJ9B 1EOLA 2G52A 3P95A 1W0JD 1HXFH 2PLXA 1GBIA 4I8KA 4OS1A 5DN6D 1SHHB 3KL6A 1MD8A 4A92A 3MH6A 4X8SH 1E0FD 3U8OH 1OP0A 1PJPA 2PGBB 4ZCNA 1EPTA 2V3MA 4R0IA 3HPTB 1EXFA 5IDKA 2C4FH 4ISLA 1GJ4H 4ZHAA 4O3TA 1NC6A 5JDUB 3ATLA 3KQDA 1ORFA 4INKA 1ARCA 1K1NA 2BY9X 2ZFQH 4I8LA 4XSKU 2GZ8A 4J1YA 3IG6B 3LGWA 5JPMH 2Z3CA 1YWUA 1HBTH 2YNBA 5TCAA 1YLDA 1OWIA 2FOCA 5C17A 1KYNA 1EX3A 3SU6A 5T3HA 1KXAA 1O3KA 3NKKA 1DX5M 2STAE 1QBOA 1JXPA 1LKAA 4RT1A 2O8UA 1C2IA 1XUJA 1ZMNA 1Y59T 2HVXA 3BTEE 1PFXC 1WUNH 1S6FA 1E79D 3PYHA 3UNSA 1O3CA 4NZQA 4WXVA 1AD8H 1CHOG 1ETRH 2D2DA 1HAGE 2Y5HA 3P8GA 3UWJH 3F68H 5C5NA 3PROA 1EP5A 4PROA 2XBVA 2H9HA 1XUIA 2BY7X 2RDEA 1V2ST 1O2KA 1GCTC 1HAXB 4X8UH 1VZQH 2R2MB 1FY4A 1NBME 1L1GA 1TALA 4DIHH 1LDTT 4X6NA 3OTJE 1EOJA 1CSOE 3RXDA 1EAWA 3EGKH 2BD2A 1LQDB 3FZZA 5I25A 1FMGA 4F55A 3U8RH 2NU2E 3TNSA 1MZDA 1LHEH 2BXUH 3DSPA 3KQBA 4OS4A 1TBQH 4Z6AH 2Z94A 1WQVH 2ZGBH 1ARBA 1TOCB 1OSSA 4XOJA 2PFEA 3TLOA 1RXPA 2VIVA 3M37A 3NRLA 4KTCA 1H9IE 1V2TT 1S6HA 1FNIA 1SLVB 1MQ6A 3E0NB 2M5TA 2WUCA 2QCYA 4X0WU 3A8CA 1DSTA 4D7FA 3RM2H 2HLCA 2VIPA 8LPRA 3NZIA 4X6MA 3WW7A 4B76A 3M35A 3GICB 3LONA 4XD7D 4ABIA 1KMHB 1P0SH 2BDGA 1C4V2 1S5SA 3TK6A 4X1QU 1S82A 1KLTA 3STIA 5GNDA 1OWHA 1MUEB 3V7TA 3OAAD 1MBMA 2NWNA 2QXHA 4X6OA 1WV7H 2VU8E 3ZVBA 7LPRA 2KR7A 1AVGH 3RMOH 2GX4A 3UUZA 3MNBA 3SV7A 1DWBH 1O2NA 2ODPA 5EXMA 4LZ1H 3RXMA 2AH4X 3RC4A 3UWIA 1SFIA 2ZEBA 3OSYA 1PYTD 3OU0A 2FYRA 6CHAC 3KQCA 1TX8A 4BANB 2CHAC 1A0JA 3RM0H 1MMJN 2PP6A 2J98A 1W10U 1GHBF 3MOCA 5EPNA 1O35A 3P70B 5GPIB 3MH5A 5EXNA 1MKWK 5JBBS 3U8TH 1G2LA 1VJ9U 3SU1A 1YM0A 3UY9A 5A2MH 1NTPA 4RSPA 1Q3XA 2EA3A 1IQGA 1SSXA 3CS0A 5C20A 1Y8TA 2GT7A 3LDXH 2Z7FE 4H4FA 4JYUH 3W94A 3ZVDA 2OTVA 3VB3A 3ITIA 3SJIA 3LGIA 1V2OT 4XFQA 2R3YA 1Y5UT 4UD9H 3D62A 1V2VT 1ZLRA 1EAUA 2K0QA 2ZIQH 3MH4A 1V6DA 1O2PA 2XTTB 1E1RD
chains in the Genus database with same CATH topology
2TIOA 4FUHA 3SORA 2P8OC 2ZDMA 1GGDC 1DDJA 2QA9E 4IBLH 3RXUA 3S7KB 1Z1IA 5FXLA 1O3BA 3O8CA 2RA0A 3U69H 1BRBE 5HM9A 2A7HA 1C1WH 2OC7A 1XKAC 1AHTH 4MPXA 3IWMA 4DG4A 4I33A 1T4VH 3RXGA 1FIWA 3A82A 2F91A 2STBE 4O9VA 3TGKE 4HI3A 1Y3XA 2PHBA 4A1XA 2FDAA 2AYWA 1NS3A 5DPAA 1W7XH 4E06H 1DY8A 2VNTA 2LNCA 1O2ZA 1XUFA 1X7AC 2Y81A 1GVLA 2R3UA 3BIVH 1W8BH 2BD4A 2C3SA 1AKSB 1WTHD 4M7GA 2QYIA 3TNTA 4Y11E 1WBGB 1D4PB 1FXYA 1V2WT 3QGJA 3RXVA 1H8IH 1TYNA 3TPIZ 1HAPH 1O3HA 1EPTB 2XCFA 4ASHA 4H42U 2OBQA 5GDSH 4YT7H 2BY8X 1NO9H 3ZZ3A 1C2GA 4FVDA 1HV7A 1ELDE 2WPHS 5C1YA 4CRGA 4B1TA 4ZHLU 2K1QA 2ZWLH 3M5OA 4D9RA 1BIOA 2ODQA 4IGDA 1CA0B 1AB9C 2A7JA 5H4IB 1TNLA 2ZGHA 2TRMA 1DLKB 1O5CB 1QBVH 2ZZUH 7ESTE 2FOGA 3A8BA 5DP3A 4CR9A 2FI5E 1GI4A 1F0UA 1V2JT 2BDHA 3GY2A 2ZECA 3BTWE 4AFUA 2A5AA 3F9GA 1GMDF 3MWIU 5K7RA 4LK4A 3GDUA 2TGPZ 1O2LA 3LC3A 5SGAE 1ZTJA 3GCTF 5A09A 4GPGA 1XUHA 1PPEE 1XX9A 4JYVH 1YGCH 1EJMA 1TGBA 5GCHG 3SU2A 4JYTA 3V3MA 1EAIA 2JETB 1VGCB 1MU8B 2EEKA 1ESBA 1K9OE 3F9HA 4AB9A 1ELBA 3TH2H 1MCTA 1P04A 3P92A 2Q6DA 1T8LA 2JH6D 3BTHE 1H1BA 1QFKH 1SGRE 2BVRH 3ODDA 1EB2A 1GVKB 1S81A 4E7NA 1RIWB 1W0YH 1BTHH 4I8HA 2ODYB 2J38A 3GY3A 4Y7BA 1IQMA 1O2WA 2FI3E 2PV9B 4TPYA 1S0RA 4GHTA 3V0XA 3E16B 2G81E 1GI3A 1BRCE 4UFGH 3LGYA 2D26C 4BAKB 2BZ6H 2CV3A 1DWDH 2ZKSA 1GI1A 2FZZA 5HGGA 3FP8E 1A0HB 4IC6A 3BF6H 2WPKS 5F6MA 1UCYE 1YBWA 4UEHH 2Q1JA 1GL1A 2GP9B 1GBMA 1HPGA 1PQAA 1EZQA 3TJVA 1TLDA 3ZVGA 2FOBA 4FU9A 1TNJA 4UFEH 3SW2B 3T29A 1BQYA 2GCTC 1HB0B 3DFJA 3BG4B 3PWCA 1BBRH 3MFJA 1TGSZ 2ZHDA 1CQQA 3JZ1B 5EQRA 2VH0A 1ZRBA 1XUGA 3E90B 1MKXK 1P10A 2BOKA 3ZYDA 1NFWA 3SNDA 1O3FA 5AHGH 2ZG0H 1TFXA 1NM6A 4KGAA 1P2OA 1Z6EA 1ETTH 1IQJA 1OX1A 3GY6A 1A3BH 4ZROA 1O2OA 3QLPH 3B8JA 1D9IA 4K8BA 2QIQA 2ZO3H 1O2SA 1G32B 5I46H 1BHXF 3BTQE 3SGAE 1ZGIA 2H9EH 4UFFH 4AFZA 2VIOA 1GVZA 2AIPA 1CT0E 2ZFFH 1Y3WA 1HAYB 2Z9KA 2BLOA 3TJOA 2FOFA 2HNTF 1ANCA 1F0SA 1FAKH 4ABJA 4O03A 5DP8A 1DS2E 1AFEH 1Y3YA 4XDEA 3HKJB 2HWLB 2WV5A 1F0RA 4SGAE 3SO3A 3M5LA 1JIRA 5EU8A 3RMNH 2HOBA 3RXBA 4U01A 3QZRA 1IQEA 1W2KH 1YF4A 1HFDA 1ELAA 5GWZA 2ZF0H 4KELA 3F9FA 2Y82A 4RKJB 1A2CH 1BUIA 1ZPZA 3SU5A 1RFNA 1TPOA 3RMMH 1QCPA 1SR5C 3VGCB 3PTNA 1SGFG 1GJBB 5CHAB 1GI8B 1IQLA 1F2SE 1N6YA 2NU3E 3PO1B 1K28D 1SL3A 4NIYA 3SJ9A 1QJ7B 4JZFH 4GVUA 1BHXB 4KP0A 1HJ9A 4Y79A 4GCHF 1C5VA 3AVZA 4DW2U 2QXGA 2A5KA 1PPGE 3LGVA 3SNAA 1TX6A 4DOQA 1IOEA 4LZ4B 2UWPA 4TWWA 1LPZB 2ZHFH 4NWKA 1KLJH 1OWKA 3P8NA 1U6QA 1V2LT 2RCEA 3SV9A 2Z9JA 2Q6GA 2A45B 1J15A 2BVXH 1C1TA 3KF2A 1SG8B 1SGCA 1BTPA 4X1NU 3BEUA 2FESH 1HAHH 2XNIA 1SLWB 1GJ8B 1BZXE 2DE9A 2W7UA 1HJAB 3O8BA 2BTCE 1FQ3A 3ODFA 3RU4D 2HGTH 3RU4T 1KXCA 2H2ZA 4CREA 3P8OA 3ENSB 3Q3YA 2GD4B 1A61H 1FY1A 2FP7B 3MU8A 1O3NA 4Y0YE 1RTLA 4B73A 1GI2A 5T6DA 1O2RA 4OS7A 3SNEA 2H5DA 2ZDAH 5K0HA 3DT0H 3S9BA 2ZPSA 2BB4A 4Y71A 4DIIH 4D8NA 5L30H 3RXRA 2W5EA 5AVDA 1ZJDA 3E1XB 2BQ7B 5FBIA 1WAYB 2FTLE 3UNQA 1KY9A 3ATIA 2VWLA 1ZSLA 1C2DA 2Z9GA 1YPGH 2UWOA 3HKIB 1ELTA 1MTWA 2ILNA 1G2MA 1B0FA 1NZQH 2DE8A 4DY7B 1HCGA 4X1PU 3A7WA 5C3NA 2UWLA 4X8VH 1GMDG 1VJAU 2A1DB 3ZV9A 1DLEA 3GCTG 1MZAA 3RLYH 5HYOA 1TNHA 1TMBH 1NROH 1Q31A 4OS2A 2P3TB 1EPTC 1KSNA 2FEQH 1QJ6B 2R0KA 1EAXA 1OYQA 1UTPA 4FUCA 7GCHF 1E34B 3OY5U 3RXPA 2ALVA 1K1MA 2THFB 1LVMA 4O97A 3KIDU 3GDVA 1JIMA 3MU5A 1BOQA 3QX5H 7KMEH 1TRNA 3O8RA 1O32A 2BX3A 4BAQB 2G5VA 3Q00A 2QXIA 2ZI2H 4ZKNU 4WF8A 4B2CA 1OWJA 1C2KA 2P59A 4HFPB 1CA0C 2VB0A 4XE4A 2OQUA 2QGRA 1C9PA 4ZH8A 4F49A 2C8XB 4B2BA 4FVBA 4JZ1A 1ZMLA 1LTOA 1C2MA 2WPJS 3ZZCA 1MTVA 4MNXA 3HGPA 2QAAA 1HNEE 3FFGA 4BTUB 4IN2A 4XBCA 4MDSA 1LPGB 2FLRH 4MLFB 1P01A 1UTOA 4YTAA 1QL7A 3WY8A 4AORA 4K3JA 2ZHEH 3SBKA 1V3XA 2PR3A 1HAZB 5BPEA 1AZZA 1AIXH 4U32A 2JKHA 1SB1H 5DP4A 1YCPH 3QN7A 2AERH 1TNKA 1SLUB 1K2I1 3BIUH 3EE0B 4ZXYH 2CF9H 2JETC 1O36A 3L3TA 3ZZ4A 3STJA 1GMHF 1H9HE 2BQ6B 1OKXA 2AGGX 3SJOA 1L1JA 4Y10E 5F8XA 1YPHC 1VCWA 1O3OA 1TABE 5JBCS 1J16A 1AWHB 2BX4A 2WV4A 3MU0A 1RIWC 1P9SA 3EDXB 2FPZA 1A5GH 1SHYA 2BDIA 1TRMA 3UNRA 1TMUH 3MO6A 1O2JA 3NK8A 6ESTA 5BRRE 4NFFA 1E36B 1BITA 1ZHRA 1B0EA 5A8ZA 3KGPA 2A2XH 4ABAA 2F9BH 3PB1E 2OC8A 4NFEA 3M5NA 2PGQB 3EYDA 2FS9A 1BBRK 4NA7A 1ELEE 1GJ5H 3A88A 1BMAA 2A5IA 3A7XA 3RXFA 1HAVA 2H1UA 2IJOB 2G4TA 5EOKA 4FXGH 2GZ9A 1TX7A 4AFSA 4A1TA 4OS6A 2UUJB 1SGYE 3BG4C 2CGAA 4I8GA 6GCHF 5A8YA 1C1UH 1EKBB 1D3PB 3BSQA 1UK3A 1Z71A 2R9PA 1C1PA 1GWAA 2RDLA 1TA6A 1GHVH 1HJ8A 2QF0A 1BMMH 1SGQE 3K6YA 4IW4E 3TH4H 1WTGH 4X2YA 4R8TB 1MBQA 3SZNA 1GBTA 1GMCF 1C5RA 5EPYA 3AASA 1CBWB 2BQWB 4THNH 1O3MA 1NFYA 2QY0B 1JMOH 5CMXH 4GCHG 2BD7A 4QT8C 2A2QH 1FV9A 5ETXA 4X2WA 2EI6A 1TNIA 2FX4A 1GBHA 3PV4A 3RP2A 2J34A 1G3BA 4JZIA 4VGCB 1YP9A 4X1SU 1C5MD 1MAXA 2HPQH 2R2WU 3HK6B 5L2ZH 2F9UA 1DANH 2PSXA 2SFAA 1AGJA 4D9QA 1LVYA 5EQSA 1O30A 3P17H 2P16A 1CA8B 4YOIA 1IQKA 3URCA 3HATH 2OP9A 2QXJA 4NSYA 1SGTA 3K2UA 3MNCA 1CVWH 3SUGA 5GJ4B 3PMJA 2A32A 2ZFRH 2QF3A 3GYLB 5DP7A 4BXSA 4CH2B 1P03A 2FOAA 5CHAC 1QBNA 3SQEE 1EJNA 1O3PB 1GI9B 1AN1E 1SGPE 3R0FA 1FY3A 4K69A 2O8TA 4CBNA 1AVWA 2NU0E 4NCYA 2FODA 1SGDE 1PPFE 1C5TA 2FOMB 2HNTC 3NXPA 1UVTH 2F9NA 3UR9A 1GG6B 2FYQA 2WYGA 2ZP0H 1D6WA 3LGTA 1KLIH 5TCCA 1DXPA 1W3CA 2CXVA 2AS9A 3SNCA 2P94A 1MCVA 2AMQA 4ISNA 4WXIA 3K9XB 4Y8XA 3CENA 1RJXB 4Q80A 1YPHE 1PQ7A 4FUFA 1ZZZA 4O3UA 1O3EA 2QC2A 1BA8B 3S7HB 1K1LA 3FAOA 2JH0D 4NZLA 3ZV8A 1J14A 1ELGA 4BXWA 3GCHB 3VXFH 1GBKA 1ZTLA 2G00A 2ULLA 1ZGVA 1W12U 1C1OA 1O5FH 3OYPA 4IMZA 2BM2A 1ANDA 3IITA 1UK2A 5TJXA 1N8OB 1Z6JH 2GVFA 2B7DH 5FPTA 1ZRKA 2VIDA 5FBEA 1YPLH 5EXLA 2XC4A 2Z6BD 1BMNH 3A85A 2XC5A 2VGCC 3VB4A 1AFQC 2FS8A 1O38A 4MVNA 3MHWU 4NSVA 1GJDB 3V13A 3P8FA 4WMEA 2ANYA 4ISIH 1RS0A 4MPUA 4YZUA 3ZVCA 5EW1H 4CRBA 3JZ2B 2CN0H 3TK5A 1GBLA 1TWXB 1TNGA 1TBRH 4TY7A 2ZCLP 4Y6DA 2G8TA 1AI8H 5A8XA 1Z1JA 3EAJA 3QO6A 2SNWA 1GHAF 2Y80A 1QRXA 4YO9A 2FOHA 3HK3B 1ZJKA 1SLXB 3TIUA 1V2UT 2B8OH 4WWYA 4AOQA 1SGIB 2XW9A 1EATA 3I77A 2BD3A 4FUGA 1DM4B 1H8DH 5DK1A 1TONA 3SI4H 1F92A 2ZHWH 2ZCKP 2OCVB 2Z9LA 1GPZA 1A5IA 1TIOA 4AB8A 3ATMA 3GY7A 1O2MA 1O2XA 4AFQA 3VB6A 3S69A 1Z7KA 3ZZBA 1NESE 4UE7H 2XWBI 4TYDA 4UDWH 1S0QA 1YCPK 2P93A 2V0BA 4I31A 1O2YA 1OOKB 1GCDA 1D3DB 4MNWA 3GCOA 4I7YH 5B6OA 1CGHA 1GJAB 1IHTH 1Y5AT 2PUXB 4K1TA 1P11E 1C5LH 2FX6A 2FMJA 2Y6TA 1DOJA 1ELCA 1P2NA 5E8EH 3RXSA 8GCHF 1SQTA 4E05H 3RXCA 1O3JA 1HYLA 1GI7B 2BYAX 1O5BB 2JH5D 1PPBH 2XRCA 2NU4E 4H6TA 1UTKA 1RTKA 3MH7A 3GYMA 3LGUA 1ZHPA 1YPEH 3RXKA 3ZZ8A 1INCA 1TMTH 2GV7A 1WOFA 1SVPA 4MG3A 2FI4E 2PUQH 4GSOA 4LXBH 3Q76A 3VEQB 1UTMA 5L6NH 1XXFA 1ZOMA 4WJG2 4A7IB 4BAMB 1DITH 1IQHA 3R3GB 1A1RA 1YPKH 2H5CA 1P02A 3U9AH 4D7GA 2O8LA 4A1VA 1CU1A 1XVOA 1JRSA 2ZU1A 2I6SA 1RGQA 2CJIA 5DP9A 2G4UA 2CF8H 5T6GA 2TGDA 2R0LA 1D3TB 1FIZA 4CRCA 1NFXA 3O8DA 3A83A 1QURH 2ZA5A 1C5NH 1NRRH 5FX5A 1VR1H 4ZUHA 3K65B 2ZDKA 1OWDA 5F8TA 1UMAH 4YOJA 9LPRA 1H4WA 1W7GH 3BEFB 3M3TA 1P09A 1ELFA 2VWNA 3OX7U 6LPRA 2BMGB 1TB6H 1BTXA 1DICA 1P3CA 1LMWB 3TITA 2ZCHP 3MO9A 3D65E 2OC1A 1GHBG 1SOZA 2Q6FA 4A5TS 3CP7A 1LPKB 4K5ZA 3RUOA 1BTYA 1LHCH 2ZFPH 3RC5A 1MQ5A 1W0ZU 4B2AA 1WQSA 2BOHB 2ZGCA 2SGQE 1D3QB 1THSH 3AW1A 4WH8A 1GBDA 5AFZH 1C5OH 5E0HA 2OUAA 3F6UH 2IOTA 1PQ8A 5FPYA 3TJNA 1V2KT 1TPAE 5FX6A 3UR6A 3URDA 4GUXA 2AMDA 3A89A 1PPZA 1QL8A 1Z8IB 1C5WB 1QNJA 4ESTE 2BHGA 2SGAA 2VVVA 4ZKOU 3DHKH 3G01A 3MU4A 3MTYA 3S9CA 3W95A 1THPB 2CMYA 3SGQE 1G3EA 1C5YB 1BB0B 1ABJH 1ZTKA 1O39A 2VWMA 3DD2H 3BTTE 3QUMP 4YLUA 3ZVAA 1XVMA 4WY3A 5ABWA 2AGIX 3MO3A 1XKBC 2W26A 1O3DA 1F7ZA 4Y76A 1FN8A 1PQ5A 1J9CH 1L4ZA 3S0NA 2H9TH 4ZKSU 4ZHMU 1K1IA 5J4SA 2C90B 2Y5GA 1O3AA 4AG1A 5LPFA 2HRVA 2GTBA 4AN7A 3AW0A 5FCKA 3UFAA 1DSUA 2FTMA 3SUEA 3Q3XA 3HGNA 4XBDA 1O2UA 1TOMH 3E3TA 1P2QA 1QY6A 2EI7A 2P8OB 1CHGA 5FHTA 3UQOA 1LHFH 5F8ZA 1VITH 3PM3A 5DG6A 1K1JA 3ZVFA 1TRYA 2PKSB 4IC5A 5EGMA 4BOHA 2ZU4A 2GMTB 5C1XA 1BT7A 1P12E 2BD9A 4K8YA 1Y3VA 4HGCA 3LJOA 4RKOB 5DP6A 3T27A 3KHVA 1S84A 4AG2A 4FUJA 3SV2H 1AO5A 1GBFA 1WCZA 5E0JA 5GXPA