1GI3A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi3A02
1C5QA 1F2SE 4UD9H 4DURA 2ZU3A 1HV7A 1TNHA 1C2GA 4H4FA 4CRBA 1T8LA 5FXLA 1YKTA 1QBOA 3S9CA 1S5SA 3ZVGA 5LGOA 3RMOH 1DWDH 2ZFTA 1ZPZA 2WPMS 5DP6A 3UUZA 1XXFA 1D3TB 1W13U 1EOLA 2GT8A 2NU1E 1TONA 1E0FD 2FZZA 1UTPA 5TJXA 4AB8A 2HVXA 3M35A 3RXMA 1QB6A 1O36A 1HGTH 3QGJA 5EG4A 2ZTZA 2VWOA 1L4DA 3MU4A 2BLVA 2VH0A 5DKMA 4NSYA 4ISHH 1TPSA 1C5WB 4WXVA 2AFQB 1SHHB 1O33A 1SG8B 1YC0A 3SU4A 2ZECA 4ISNA 3TH2H 1XKBC 5E0GA 5F8TA 1GG6C 1UTKA 4NA9H 4NA8A 1BTYA 4XBBA 2ZTXA 1MTVA 1WQVH 4ABBA 5ABWA 1H9IE 1S83A 3A86A 1MBQA 1VCQA 3LGTA 4DGJA 3F68H 1BOQA 2A4RA 1MU8B 3A8DA 1D3QB 3SN8A 1GJ6A 2BQ7B 2ZQ1A 3RMNH 5FCRA 3RC5A 1QJ7B 4Q7XA 2W3IA 3GDUA 1PQAA 1TNIA 4SGBE 1QL7A 1GI7B 1O5BB 1YM0A 5EU8A 4FUDA 1UO6A 1WTHD 4X6MA 1AFEH 1HAOH 1W8BH 4U2WA 1H1BA 1Z8RA 1ELCA 3FVFB 4ZUHA 2P8OC 1FONA 2QAAA 5GCHF 1A1RA 5C5NA 2ODQA 5DGJA 1V2QT 1B5GH 1QNJA 3RDZA 1BBRH 2GMTC 3T28A 1ZPCA 2QXJA 1V2RT 1CU1A 1LPGB 2FI4E 4B71A 1ELFA 1O30A 2XBXA 1HRTH 3ZVDA 2UUKB 5BPEA 3SUDA 3VB5A 1TBQH 3SNCA 4I7YH 1JRSA 1PQ8A 1BMNH 2BVSH 1QTFA 4U32A 4X8UH 4A1VA 1EP5A 2FDAA 2J38A 1IQKA 2O8TA 1OOKB 2PLXA 1GJAB 1OYTH 1GBFA 2OC8A 2CHAB 3CP7A 4FUIA 2Y7XA 3ZVFA 1TYNA 2TIOA 3RMLH 5ESBA 1O3EA 4ZH8A 1O2LA 2VIWA 1VITF 1AWHB 3PMJA 1A7SA 1T31A 2A2XH 5T6DA 3LC3A 2A4GA 4GCHG 2FX4A 1P11E 2XRCA 1A4WH 3A85A 4Y0YE 2ZKSA 1BJUA 1A0HB 1C1QA 1K1MA 2K1QA 4GHTA 1AN1E 1THRH 3GOVB 1GGDB 2BVRH 5PTPA 1BIOA 1FDPA 1L2EA 5C67A 4YESB 3UY9A 5HM2A 2ZU1A 1C9TA 1BMAA 2RDLA 3Q77A 3KCGH 3STJA 1FPHH 2ZGJA 5DO4H 2P3TB 3UWJH 2A5KA 3O8RA 1XUKA 3GCHB 4UFFH 1MD8A 1JIMA 1UK3A 5EQQA 3S0NA 3STIA 3AW1A 1NU7B 2FOCA 3ZYDA 3RU4E 1ANDA 1T8OA 2DE9A 4B76A 3ATLA 2STAE 2BY5X 1O5FH 1DFPA 1ORFA 2AGGX 2ZDVH 4IN1A 5I25A 3RXDA 1MUEB 2J94A 1O2WA 2SNWA 2ZWLH 1Q2WA 5GPIB 3A7YA 3P95A 1ANEA 1BQYA 1WAYB 4Y7AA 1OP0A 1TRMA 4MNWA 3I78A 5JBBS 4FUGA 1O2ZA 1C5MD 3GCTG 1O2QA 3Q3YA 2AMPA 3P8NA 4U30A 1AE5A 3H7OA 4Y71A 5EGMA 4RKJB 1JWTA 1TQ0B 3AVZA 3GY4A 3M5MA 2H9TH 1GBKA 4AGKA 2WYGA 4BNRA 1EPTB 1G3DA 4X8VH 4B1TA 5I46H 1GHWH 2WYJA 4CH8B 1ABJH 1P02A 1YCPK 1GCTB 4RN6A 1MCVA 5F8XA 1UVSH 3AAVA 4Z6AH 1FLEE 1ELAA 2G8TA 1ZMLA 3C27B 2PWXA 1GJ9B 3PLBA 1YCPM 2OCVB 2ZF0H 4NFEA 4CR5A 3GY7A 4K2YA 5ESTE 4X6PA 1PPEE 3M5NA 3RU4T 4JZDH 3MH4A 2XTTB 1BMMH 1ZHPA 4SGAE 3RXJA 2VIOA 1LTOA 1MTNC 1T4VH 1UTNA 2WPKS 1WCZA 1D9IA 1IQJA 2BZ6H 2NU3E 3L3TA 3HATH 2F91A 7GCHG 1ETRH 5CHAB 1NRQH 2CHAC 1FJSA 1P9UA 1XM1A 5EOKA 4BTTB 3CS7A 1Z8JB 3SNBA 3E3TA 3C1KA 3AASA 1ZZZA 4AYVB 1O3BA 3PMBB 1YPMH 3ZZ9A 1E36B 4Y11E 2BD3A 4YOIA 2BDBA 2FLRH 2BLWA 4K8BA 1K21H 4FVBA 1F5KU 1AVXA 3S9BA 1YPGH 1C1UH 1GGDC 3GY8A 2J34A 2OBOA 6CHAB 1GI3A 5GIBA 3SU6A 1TX8A 4AX9H 2TGDA 2QXIA 3BTTE 3BG4B 3VB7A 3Q3XA 5G4BA 1HAVA 3OY6U 4I8KA 1PYTD 2H5DA 3GCHC 3VGCB 2QCYA 4X2XA 1H9HE 3EAJA 1QL8A 3RXFA 3SUGA 1NY22 2ZCKP 3LH3A 4X1PU 4GVUA 2ZPQA 1L1GA 5EQSA 1LMWB 4JYVH 4D8NA 1V3XA 3MWIU 1QR3E 2OXSA 1S6HA 1TPOA 1G32B 1V6DA 1GBAA 1IQNA 2FS8A 5C1XA 5LPFA 4Z0KA 5LPEA 1Y3YA 1YPHE 2GP9B 3SUFA 3KQBA 4AZ2B 4ZHAA 2PGQB 3MH7A 5AHGH 1A3BH 2ZDLA 3ZVEA 1LDTT 3HGNA 2XBWA 1Z6EA 5FPYA 3H7TA 1OWJA 1ELDE 3TK9A 1KY9A 1QJ1B 1MTWA 1HAIH 1WU1A 3NUMA 3SU5A 3U98H 4ABAA 4A92A 5AF9H 1MBMA 1UMAH 2H9EH 2GDEH 1QGFA 1BITA 4OS6A 1O3PB 1TGCA 2XYAA 2ZHDA 3CS0A 3DA9B 2D2DA 2G81E 1C4Y2 1EPTC 2BY8X 5H4IB 1BTXA 2AMDA 1C5XB 4FUHA 2V0BA 1O5CB 1OWEA 3TLOA 3SNDA 2IOTA 2B5TB 1GCTC 4IN2A 5FX6A 4CH2B 5IDKA 1DM4B 4Y8ZA 4UFEH 3LGVA 1DUAA 1GI0A 2W26A 4JK5A 1P2QA 1THPB 1EAUA 1HXEH 1GVLA 1NTPA 2ASUB 3DFLA 3T26A 3VPKA 3BTDE 2FOHA 2H1UA 1HLTH 3PB1E 1WYKA 1SI5H 2Y5FA 2BQWB 5J4QA 1Y3XA 3HK6B 3LDXH 2O8UA 4MNXA 1KLTA 3E91A 2ZFPH 1EP6A 1S82A 4GLYA 1Z7KA 5CHAC 1C5OH 1SGIB 1V2ST 1SQOA 1XMNB 3VB6A 1LHDH 2ZFSA 5E8EH 1EASA 1YCPH 5C2ZA 3ATMA 1UTJA 1L1JA 1E38B 5LPRA 1DT2A 1ZGVA 4YT7H 3UWIA 1YPHC 2XWAA 3QLPH 4ZXXH 3L6PA 3U8OH 3SU2A 3BV9B 1CHGA 3KF2A 2FO9A 1ETSH 3A7VA 2EI6A 1NRNH 2A5IA 2FOBA 1AO5A 2FS9A 1ZYOA 1T32A 3V12A 2VNTA 1HXFH 1QRXA 1RTLA 3BG4C 1G36A 3H5CB 1BRUP 1VITH 3OYPA 1IQFA 4NFFA 3SV8A 1FY1A 5C1UA 4KTSA 3VGCC 4INHA 4OS4A 1KYNA 1Q3XA 3PMHB 1DXWA 4MNYA 4Y6DA 1O5GH 3BSQA 3M7TA 1N6XA 4XBDA 4Y79A 2ANMH 2PUQH 3NKKA 4D76A 1F5LA 1TAWA 4ZMAH 1AI8H 3EDXB 2UUFB 4U01A 1EXFA 1O2OA 2FOGA 1THSH 1ZHMA 1GMCF 1LCYA 2C90B 1OWHA 1JMOH 1T4UH 3SJIA 4BXWA 2V35A 3TGKE 1SGRE 1SQTA 5E0JA 1ZMJA 2QGRA 1W10U 3PWCA 1N6YA 1Z1JA 1WV7H 1LHGH 1T8NA 5EPYA 1O0DH 1FV9A 3SJ9A 1GBJA 3QUMP 2ZU4A 1LPKB 2R3UA 2Z9LA 3RXHA 3MO9A 2Y80A 1BZXE 2PTCE 4IBLH 1TGNA 1ELTA 1S6FA 1HJAB 4BAKB 2VGCB 4HFPB 2OD3B 3ZVBA 1HFDA 2A7JA 2P94A 1O3DA 1UHBB 4H6SB 1P0SH 4YT6H 2HPPH 2EA3A 1HJ9A 3ZVCA 1V2OT 1O3OA 3A8BA 3MHWU 2ZQ2A 2A5AA 1GI8B 3BTFE 4AFQA 2BQ6B 3TJOA 3QTVH 2GCHF 5GCHG 1TNKA 3UNQA 9ESTA 1BB0B 1E37B 4VGCB 4K1SA 3A7TA 1YGCH 1G30B 3K2UA 3A7XA 3ODDA 1P09A 3RUOA 4MPVA 5TCCA 3MU1A 1B7XB 1NFXA 1W0ZU 4RKOB 1QJ6B 1NFWA 3F1SB 3TGIE 1GJCB 1O2JA 2PUXB 1CVWH 1GBBA 2QYIA 3FFGA 3S7HB 1AQ7A 1Y5AT 1SPJA 2I6QA 4CREA 2IN2A 1RGQA 4X8TH 3ATIA 1VITG 3MFJA 5A8YA 1SC8U 2O8LA 1IHTH 1DUEA 1O2UA 1KXDA 3BTGE 1DOJA 3HPTB 3F9HA 4FUJA 2ZNKH 2VVVA 3UNSA 1QB9A 1QRZA 1KXFA 3E6PH 5E2OA 2BM2A 5EW2H 1Z6JH 2AYWA 1ZTKA 1UHBA 2A1DB 4IC6A 1CGIE 1YBWA 4X0WU 1SLUB 1PQ7A 2VWMA 4FUEA 5EW1H 2G4TA 1GJDB 1UJ1A 4BTUB 2UWLA 3RXBA 2FODA 1FPCH 2HNTE 1QBVH 2P3FH 1H8DH 2F9PA 1P3EA 2ZDMA 1QL9A 3B9FH 2VVUA 3OTJE 2VWLA 7ESTE 4KP0A 1NRPH 2BD5A 3I77A 3RXTA 4BANB 3RXVA 2G00A 3R3GB 1V2LT 2AIQA 2ZTYA 4Y8XA 2R3YA 1MKWK 3P8GA 1TPAE 2SGAA 4WVPE 1DY9A 5EQRA 2OC0A 3RM2H 1E34B 1FMGA 3KGPA 3ESTA 2TBSA 2FX6A 2PKAA 2V3HH 4K8YA 4K3JA 3NZIA 4X1NU 1ACBE 1FZZA 2F9BH 1RJXB 3K6YA 3UQOA 4B2BA 2V3OH 1J16A 1IQEA 3AAUA 3M3VA 5C1YA 2NU4E 1FY3A 1AU8A 1AZ8A 3QTOH 1SHYA 1HJAC 1OXGA 1C2DA 2VGCC 2PSYA 1ESAA 2CN0H 3BTME 3F9GA 3VXEH 1RIWB 1D6WA 2Y5GA 3UOUA 1LVYA 1SQAA 1BUIA 1IQIA 1SLVB 1CGJE 1KXCA 4X6NA 1WBGB 1GI5A 3GY6A 1O2HA 3SNEA 3ZZBA 2ODPA 5DG6A 4I33A 1C5SA 3QN7A 1ZJKA 5F6MA 3UNRA 3PO1B 4DCDA 3EYDA 2VWNA 2RCEA 1DWCH 3KNXA 2WV5A 3MI4A 1TRYA 2XW9A 5C20A 4VGCC 1EZUC 1OP2A 3MNXA 3SU3A 1P2KA 1DSTA 4YLUA 2BMGB 1FAXA 2Z3CA 4KTCA 1SGFA 3U1IB 1TNLA 1O3CA 4NWKA 3TJVA 1O3HA 3JZ1B 4A6LA 2HNTC 2NU2E 2BX3A 1F0TA 2QF0A 5C3NA 3TNTA 5HGGA 2FYQA 1ANBA 3ZYEA 3A7WA 1UCYH 3LGIA 3NXPA 2Q1JA 2ZGHA 1SL3A 4NG9H 1P05A 2GV6A 1PPFE 3B23B 1Y8TA 1MTNB 2R0KA 1Y3UA 1AKSB 3LC5A 3A87A 1OWKA 4D7FA 1FY8E 3BIUH 4ZKSU 3UREA 1OX1A 1D3PB 1DSUA 2M5TA 4ABEA 4MPXA 4NIYA 4H42U 3M3SA 2Z3DA 4I8HA 2ZHEH 3BEUA 2VIPA 1MU6B 1EKBB 1FIZA 1GBEA 1V2TT 1EAWA 5FBIA 5JPMH 1VZQH 1O3GA 2JKHA 1UVTH 4A1TA 3ZZDA 4AB9A 1YLCA 3E0PB 3KQDA 2F83A 4QT8C 2FTLE 2AIPA 2WPJS 3M5LA 1YPJH 1C9PA 2BDCA 1NFUA 1QQ4A 4GHQA 1HNEE 1F0UA 1LVBA 3LGWA 4K60A 1AZZA 1GI1A 4ABGA 3K6ZA 1GBDA 4WMDA 5BRRE 1GMDF 1C2KA 2J95A 4DT7B 2D26C 3GDSA 3TK5A 4ZXYH 1UVUH 3DD2H 2WPHS 3KL6A 1MZAA 1O34A 2ZZUH 4YO9A 3NCLA 1AUTC 3M7UA 1P2OA 1QY6A 1RIWC 1CT2E 1GJ4H 2D8WA 3O8BA 3MNCA 5AVDA 3P8FA 2P93A 2BD9A 1DDJA 3UTUH 1P57B 1BHXB 1C1MA 3RC4A 3TITA 3EE0B 1W2KH 1NS3A 2J4IA 3PO1C 4AGJA 3RXGA 2FI3E 3RXPA 1NROH 3E8LA 1O3FA 2GTBA 4D9QA 2ESTE 1AWFH 1W3CA 4OS5A 1C4V2 1HCGA 3SGQE 3BTEE 1ELGA 3O8DA 1Z1IA 4OS1A 2AS9A 3UIRA 1Y5UT 1UVPA 2B0FA 2LPRA 2OTVA 2XXLA 3PYHA 3BEIB 3V0XA 3RXQA 3ZZ7A 1GMHF 1K1JA 1WUNH 4F49A 2BB4A 4FVDA 2ILNA 2ZA5A 1K1NA 1O2SA 1O3KA 4IS5A 2UWOA 3BN9A 1NESE 3GDVA 3DUXH 1P2MA 3LGUA 3OU0A 4TWWA 3U8TH 1GHAF 1TBRH 2GV7A 3SI4H 5L2ZH 1AE8H 1VCPA 2FYRA 3SV7A 1SGQE 2Z7FE 2WPLS 3A7ZA 2FOMB 3M5OA 4K1EA 3RP2A 2EI7A 1K1PA 2ZFQH 3ZZ8A 2OP9A 2ALVA 3T25A 1GVKB 1ELBA 5GDSH 2P59A 5LH8A 2C8WB 1CA0B 2CF8H 3ZZ6A 3T5FH 4DOQA 4WWYA 2VU8E 2CV3A 1UTOA 3BIVH 4O9VA 3BTQE 1SLWB 2OC7A 2XBYA 1S0QA 2FESH 1TGSZ 1KSNA 4O03A 1KLJH 2WUCA 1C1NA 1EPTA 2Q6GA 1C5PA 3SORA 3P17H 2ZU2A 3PTNA 4FU8A 4Y0ZE 2W7SA 3L33A 3KHVA 4INLA 1P03A 5A0AE 4B74A 5JBCS 1W7GH 3QX5H 3LIWA 1LQDB 2YNAA 1N1LA 1HJ8A 3O8CA 4X1RU 2QF3A 4A7IB 2OINA 1GMCG 1BBRE 1HDTH 3SBKA 1MQ6A 1GJBB 1UCYE 2FI5E 3F6UH 2HLCA 1ZRKA 1BRAA 5DJ7A 3D49H 4J1YA 5J4SA 2ZEBA 3OSYA 1D4PB 4E7RG 1FAKH 3U69H 4FXGH 4PROA 4XDEA 2FTMA 1FN8A 2SFAA 1CHOG 1C2JA 2C8XB 2QC2A 4HI3A 3PTBA 4F4OC 2Z6BD 1KDQB 1RFNA 4HTCH 1EZSC 3SQEE 4A5TS 4NCYA 5DP8A 3RXRA 1SLXB 1BA8B 2ODYB 1MAXA 2GZ8A 3S7KB 3HKIB 3E1XB 1GHBF 4FUBA 3UPEA 3SHCH 1G37A 2SGFE 3UR9A 1C1OA 3R0FA 2AEIH 4ZKOU 1HAHH 1HYLA 3GISB 1EAIA 4KTUA 3TK6A 1TX6A 1O2YA 5A2MH 2ZDKA 2GX4A 3ZV9A 1O2TA 2GCHG 1LQEA 2G51A 1MTUA 2HWLB 1V2UT 2FOFA 1INCA 2ZFRH 2FWWA 3OX7U 3ZZ3A 3BTKE 4Q7YA 5K7RA 3GICB 4JK6A 1TB6H 1GHXH 2BHGA 7LPRA 1SFIA 3JZ2B 3WY8A 4GUXA 4AG2A 5A8ZA 2G5VA 3W95A 1S85A 5IYTA 1OKXA 4LXBH 1ZLRA 1NRRH 4O3TA 2VINA 2YNBA 3M61U 1C5UA 1AB9B 2BVXH 1ELVA 2W3KA 3SU1A 1S0RA 3MU0A 5A0BA 2XCFA 1S81A 2EEKA 2ZFFH 1CT4E 1YP9A 2ZGXH 3MNSA 3LONA 1BTWA 3TJNA 3T27A 1CA0C 4B75A 1LVMA 2ANWA 2VIVA 4ABIA 1V2PT 2XC0A 1GJ8B 1ETTH 1GPZA 3A83A 8KME2 1LVOA 1SR5C 2CJIA 3HGPA 4ZKRU 2C3SA 1DE7H 3BTHE 1C5TA 3ENSB 1C5NH 2ZDNA 2QXGA 1PYTC 1TBZH 4GAWA 4JCNA 2A7CA 5EXMA 1OSSA 2PV9B 2GCTB 4AORA 4NA7A 4MVNA 1PPBH 1JIRA 4Y10E 2GGVB 1J15A 1D3DB 1P9SA 1SGYE 1IQHA 4IGDA 6LPRA 1BRBE 3SNAA 3LPRA 1CT0E 1C2EA 1SGNE 5JB8S 1OWIA 1P2IA 1YPEH 2CF9H 4E05H 1O5DH 4J2YB 3SGAE 1H8IH 1ANCA 2EI8A 1A61H 1P04A 1W14U 3AW0A 2O8WA 4R0IA 1GI6A 2QN5T 1RS0A 3IWMA 1HAZB 2KAIB 4YTAA 2V6NA 1C2IA 1DITH 4LOYH 1HAGE 4CBOA 1LHFH 1AMHA 4TY6A 1NPMA 4X6OA 2J92A 2PR3A 1EJMA 1PPCE 1O37A 1C5LH 2TGPZ 1L4ZA 1XUIA 5T6FA 3ZZCA 1WQSA 3ZZ4A 2J2UA 1TLDA 3SUEA 4TPIZ 3U1JB 3B8JA 1K1IA 2JH0D 1L1NA 2W7UA 3KQEA 1KTSB 1SVPA 4CRAA 1MTSA 4Q80A 1DLKB 5T6GA 3UR6A 1BBRK 2Z9JA 1AUJA 4GSOA 2HRVA 2XC5A 4ASHA 1C1VH 1A2CH 1GL1A 3EQ0H 1DWBH 4OGXA 1EUFA 4MG3A 4H6TA 3GYMA 1O5AB 4DVAU 2BXUH 1AB9C 4ISOA 2Y7ZA 2Z3EA 4WMEA 1GHZA 1MH0A 2ZHWH 1H4WA 2GKVE 4ZROA 4O97A 1D6RA 3K65B 1F7ZA 3GCOA 2TGTA 1NM6A 2SGEE 1ESBA 1O39A 4AYYB 5DP4A 2P16A 2ZHQH 1GBMA 1OYQA 1KXBA 4Y76A 5F8ZA 3G01A 1V2WT 5JBTA 2WV4A 1AHTH 1NRSH 1LKBA 2BDAA 1C2FA 2GDDA 3QDZB 1BTZA 2ZPSA 3GY2A 2PW8H 5FPSA 2BD7A 4AFUA 4I8JA 1SGFG 2P3UB 3M36A 1G3BA 4K69A 3Q00A 5E2PA 3NWUA 2GCTC 4Y7BA 1V2VT 1A0JA 3SJKA 3D23A 1TE0A 2JETB 1GDQA 4WMFA 5A8XA 2BZAA 4CRFA 1V2KT 1ZMNA 4YM9A 1G2MA 1A5GH 2O9QA 1TNGA 2ZG0H 1JRTA 2SGDE 4ZAEA 1QRWA 2Z9IA 2H5CA 4NIXA 3SV2H 5L6NH 3NPSA 1IAUA 1FXYA 2XC4A 1SGCA 1VJ9U 1GMDG 1BTPA 1QFKH 1KTTB 2VH6A 1O2VA 5FAHA 4AFSA 3V13A 3ATKA 3SV9A 5FCKA 1A46H 1F92A 1O3IA 1S84A 2Y81A 2SGPE 5EXLA 4FU9A 1AFQB 1HB0B 6GCHF 2F9OA 1ESTA 1GI4A 2JH6D 3TVJB 1A5HA 3SHAH 1TABE 3RXLA 1BCUH 3EA8A 2H6MA 2IPHA 2BY9X 2FEQH 2AGIX 3MU5A 5DK1A 1T7CA 1TOMH 2A4OA 2BDYA 3RXIA 5JBAS 4ABFA 5FHTA 1PQ5A 1TWXB 1FY4A 1O31A 4Q2KA 5FPTA 4I32A 2BD2A 4E7NA 4FUCA 2WINI 4Q7ZA 1GBLA 1ZSKA 1BJVA 2A2QH 1FQ3A 3A81A 1AY6H 1W11U 5TCAA 4DIIH 3ELAH 2GT7A 3HKJB 4BOHA 1M9UA 1HAXB 2XWBI 3SZNA 4BAOB 2WUBA 3SV6A 1GMHG 3M7QA 2GVFA 2OBQA 2PHBA 3W94A 2HNTF 1XX9A 1SBWA 2IJOB 3GCNA 4MNVA 1XUHA 1ARBA 3PLPA 8LPRA 3PMAB 3PV4A 4IMZA 2UWPA 2NU0E 1BRCE 1GHAG 1X7AC 3RC6A 4X2WA 1O2NA 1O2RA 3S69A 4ISIH 1RXPA 2ZCHP 4B73A 1P2JA 1ZPBA 5DP3A 3PM3A 1EQ9A 1TGTA 2C4FH 4GPGA 2QY0B 2UUJB 2VVCA 1A5IA 1G9IE 1V2NT 1JXPA 3QZRA 4LZ1H 1O3JA 1LHCH 1GVZA 1O32A 2CGAA 3A84A 1SGDE 3IITA 1RD3B 2Z9GA 2ZU5A 2C93B 3KN2A 3VB3A 4X2YA 5FX5A 2ZGCA 1TQ7B 1UK2A 2AMQA 1GDUA 1O35A 2BLOA 4JZFH 1XVMA 1C1TA 4X2VA 3RXKA 1DICA 1EZQA 1TA2A 2RA0A 1QA7A 2JETC 3RU4D 5JYIA 1B0EA 2ZC9H 4OGYA 1TNJA 4I8LA 4LZ4B 1EZXC 3FP7E 1EATA 1G3EA 2Q6DA 2ZHFH 1ZGIA 1FUJA 1EJNA 1TPPA 3MH5A 1XXDA 4NIWA 1XUJA 3T62A 1OS8A 3MOCA 3RXEA 5ETXA 1MKXK 2ANYA 1IQMA 3FP6E 8GCHF 3FZZA 1A3EH 3SU0A 2ZO3H 2D1JA 3MYWA 3A8AA 3FZDA 1P10A 2OUAA 4Y8YA 4IMQA 2PKSB 1AFQC 1NO9H 4CBNA 5A0CA 1G3CA 3FAOA 2RG3A 5JDUB 3LJOA 3FANA 5AFZH 1JBUH 4D9RA 5DP9A 4BAHB 2QA9E 1Z8IB 1HUTH 1KIGH 1GHBG 2BY7X 1DANH 3QK1A 1MMJN 3SI3H 3TPIZ 4ABHA 4I8GA 2Y5HA 2RA3A 2ALPA 1WTGH 3FP8E 2F9NA 3TU7H 2VJ1A 4X1QU 8ESTE 2F9UA 1V2MT 3BF6H 3DHKH 3MO3A 2FOAA 1GI9B 9LPRA 1AKSA 2A4QA 3NK8A 4MDSA 3EGKH 3ZV8A 3Q76A 1YPLH 2STBE 4B2CA 1QCPA 1FIWA 3RXAA 3SOSA 4UONA 3BEFB 3RM0H 1TX7A 1MKWH 1AD8H 1WSSH 2ZP0H 1Z71A 1NT1A 2BDIA 1SFQB 3P6ZB 2HGTH 1UVOA 3EA7A 1EJAA 1SOZA 2C8YB 1NN6A 1DWEH 2ZI2H 1YF4A 1RRKA 3LU9B 2BXTH 4X8SH 1LHEH 1TMTH 1K2I1 1MD7A 4THNH 1ARCA 1PPHE 3U9AH 5EXNA 3OY5U 1C5VA 3RXUA 1Y5BT 1VGCB 3E16B 1QIXB 1ZJDA 2FPZA 4FU7A 1YLDA 4CRCA 1HAVB 3LH1A 3PWBA 5EODA 1QA0A 1SSXA 3KIDU 4ZHLU 1H9LB 4NGAH 2H9HA 1ZSJA 4E06H 1DPOA 3LJJA 2PFEA 3MO6A 3ATWA 1A0LA 1KLIH 2ZDAH 4ZKNU 4CR9A 2FXRA 3ITIA 1PFXC 1GBHA 1UTLM 3MTYA 2HALA 3QWCH 1C5YB 4ESTE 3TH3H 4CRDA 3A89A 4JZIA 3UQVA 1O5EH 3ZZ5A 1NZQH 3LT3A 1GHYH 2G5NA 3IG6B 4KGAA 1Y3WA 1VR1H 5GXPA 4NSVA 4UEHH 1XUFA 2QXHA 1LKAA 3E0NB 1XUGA 1TGBA 3DT0H 2TGAA 4X1SU 1P3CA 1ZOMA 2FIRH 1J14A 1FY5A 1O2PA 2I6SA 2O8MA 1EAXA 4R8TB 2A7HA 4INKA 3E90B 4RSPA 1FI8A 4JYTA 3U8RH 2BTCE 4UDWH 2BYAX 3GYLB 1ZTLA 2BDGA 1YPKH 1P01A 1TFXA 1ID5H 1W7XH 5HYOA 2BOKA 1XVOA 1HIAB 2WPIS 4KKDA 5E0HA 4ABJA 4DJZB 1GWAA 2PKSC 4YLQH 3SW2B 2DUCA 3BTWE 4GCHF 1CO7E 3V3MA 2C8ZB 3KQCA 3VFEA 2EC9H 3SJ8A 1ZSLA 3LKWA 4HZHA 2QV1A 1GBCA 2TRMA 4YOGA 1GJ7B 3RLYH 2OLGA 2FLBH 4TYDA 3QO6A 1VCWA 1NFYA 2B9LA 4B2AA 4WH8A 1SOTA 1O3LA 1DS2E 1EX3A 3RLWH 3TNSA 1QBNA 4NZQA 1F0RA 1BHXF 1LPZB 2H2ZA 2YOLA 1MKXH 2NWNA 1C1WH 4JZEH 1UK4A 3TJUA 4WH6A 1P8VC 1G2LA 4JZ1A 5HM9A 3A80A 1N8OB 1MZDA 3UFAA 2AGEX 1HAYB 1K28D 2SNVA 3UOPA 2R9PA 4K5ZA 1VJAU 2F9VA 2XCNA 5DP5A 1BTHH 3T29A 3M3TA 5B6OA 1C2MA 2HOBA 1EB2A 3URCA 3PLKA 4CHAB 2AERH 3GCTF 1F0SA 1KXAA 3LGYA 4DG4A 2A45B 1VGCC 1UTQA 1ZRBA 2GZ7A 1KXEA 3KEEA 3RXCA 4MPWA 1QB1A 3RXSA 5FBEA 3I29A 1ZHRA 2B8OH 3RXOA 1GBIA 3VXFH 3ZZAA 1HIAA 3F9EA 4XSKU 5DPAA 5K0HA 3BG8A 5HMAA 4BXSA 4NWLA 2J9NA 2Y82A 4D7GA 4O3UA 1TA6A 1O3MA 2XBVA 4XOJA 1TOCB 2BD8A 2PTNA 2CXVA 4WXIA 4TPYA 1KDQA 4JYUH 1AGJA 4XE4A 1IOEA 1DY8A 4JMYA 2OC1A 1QQUA 1C1PA 2R0LA 5GJ4B 4BTIB 1BTUA 4K1TA 4LK4A 1TRNA 3T2NA 1IQGA 4HGCA 1J9CH 5EPNA 1O2XA 3ZVAA 2BX4A 5HXFA 5JB9S 5L30H 4IW4E 4DY7B 1LO6A 3TGJE 1L0ZA 1SB1H 1GHVH 1CBWB 1MQ5A 3MMGA 1HBTH 1Y3VA 7GCHF 2F3CE 3A8CA 4MPUA 1J8AA 1V2JT 2SGQE 1SGTA 1MCTA 1CE5A 4OS2A 2P95A 2VIQA 3P70B 3A82A 5C5OA 1GBTA 6CHAC 1SMFE 2G55A 2DE8A 2BD4A 2JH5D 4XBCA 5F03A 4AOQA 2A0QB 2G52A 4CRGA 1FNIA 1TALA 4BAMB 1P06A 1RTFB 1C1SA 2ZGBH 1BT7A 6GCHG 1K1OA 1GI2A 1C5ZB 2THFB 1K22H 1QHRB 1O2IA 1TMUH 2BDHA 1O3NA 3D65E 1WOFA 4DW2U 1HAPH 3LOXA 4TY7A 1PPGE 1NC6A 3GY5A 1CQQA 1C1RA 1SGEE 1DX5M 1SGPE 4ABDA 3ODFA 1Q31A 4WY3A 1Z8GA 2ZIQH 3SO3A 1O2GH 4ZHMU 4WF8A 1W12U 2B7DH 4XFQA 3P8OA 3GY3A 2PGBB 3HK3B 3URDA 5AFYH 1GDNA 2R2MB 3Q3KA 4M7GA 1N8OC 2ANKH 1W0YH 4I31A 1CSOE 3N7OA 3D62A 1PPZA 4AN7A 1CHOF 1AVGH 3K9XB 2Y6TA 1AIXH 4DIHH 1E35B 1C2HA 1OPHB 2FP7B 2GZ9A 4AFZA 4CHAC 1ZR0A 1GG6B 1K9OE 1K1LA 3SJOA 3PROA 4BAQB 5L2YH 1EOJA 1UCYK 2BY6X 3RMMH 2A31A 1DVAH 2GD4B 4UE7H 1ELEE 1RTKA 2W5EA 1BMLA 3QZQA 3V7TA 1O3AA 1ZTJA 4A1XA 1B0FA 1DLEA 4NZLA 5CMXH 1QURH 2FM2A 2Z9KA 1TIOA 2A32A 1YYY1 2OQUA 1IQLA 5SGAE 1C5RA 3TIUA 1DXPA 2Q6FA 3VEQB 1ABIH 4ISLA 3EA9A 2TPIZ 1O2KA 1T8MA 3CENA 1MAYA 4WJG2 3TH4H 2AH4X 1C4U2 1NU9A 4MTBA 2ZPRA 1O2MA 1PJPA 4AG1A 1TMBH 1BDAA 2P8OB 2KAIA 5DP7A 1C2LA 4MQAA 1EB1H 2FOEA 3MH6A 3SQHE 4YOJA 2G4UA 2PKAB 2GMTB 2XNIA 1OWDA 5CE1A 3QGNB 4UFDH 2FMJA 2OQ5A 1UTMA 2VB0A 3A88A 4UFGH 2BLQA 2UUYA 3M37A 1CBWC 1J17T 2R2WU 2PSXA 3DFJA 1JOUB 2Z94A 1GJ5H 1OP8A 1GL0E 4IC5A 1GCDA 1HPGA 4OS7A 1U6QA 8GCHG 2LNCA 3VB4A 2HPQH 1CGHA 1CA8B 1P12E 3S9AA 4FUFA 1FN6A 1IHSH 2ZCLP 1O38A 6ESTA 1XKAC 3P92A 5A09A 2ULLA 4NIVA 3F9FA 5T3HA 3MU8A 5GWZA 4KELA 4YZUA 3SGBE 1F5RA 2QIQA 4MLFB 1AVWA 2CMYA 2BOHB 1P2NA 1Y59T 3MNBA 4TWYA 2VIDA 7KMEH
chains in the Genus database with same CATH superfamily
1C5QA 1F2SE 4UD9H 4DURA 2ZU3A 1HV7A 1TNHA 1C2GA 4H4FA 3UB0A 4CRBA 1T8LA 5FXLA 1YKTA 1QBOA 3S9CA 1S5SA 3ZVGA 5LGOA 3RMOH 1DWDH 2ZFTA 1ZPZA 2WPMS 5DP6A 3UUZA 1XXFA 1D3TB 1W13U 1EOLA 2GT8A 2NU1E 1TONA 1E0FD 2FZZA 1UTPA 5TJXA 4AB8A 2HVXA 3M35A 3RXMA 1QB6A 1O36A 1HGTH 3QGJA 5EG4A 2ZTZA 2VWOA 1L4DA 3MU4A 2BLVA 2VH0A 3DSGA 5DKMA 4NSYA 4ISHH 1TPSA 1C5WB 4WXVA 2AFQB 1SHHB 1O33A 1SG8B 1YC0A 3SU4A 2ZECA 4ISNA 3TH2H 1XKBC 2IJD1 5E0GA 5F8TA 1GG6C 1UTKA 4NA9H 4NA8A 1BTYA 4XBBA 2ZTXA 1MTVA 1WQVH 4ABBA 5ABWA 1H9IE 1S83A 3A86A 1MBQA 1VCQA 3LGTA 2KCOA 4DGJA 3F68H 1BOQA 2A4RA 1MU8B 3A8DA 1D3QB 3SN8A 1GJ6A 1COWD 2BQ7B 2ZQ1A 3RMNH 5FCRA 3RC5A 1QJ7B 4Q7XA 2W3IA 3GDUA 1PQAA 1TNIA 4SGBE 1QL7A 1GI7B 1O5BB 1YM0A 5EU8A 4FUDA 1UO6A 1WTHD 4X6MA 3FKSD 1AFEH 1HAOH 1W8BH 4U2WA 1H1BA 1Z8RA 1ELCA 2GJGA 3FVFB 4ZUHA 2P8OC 1FONA 2QAAA 5GCHF 1A1RA 5C5NA 2ODQA 5DGJA 1V2QT 1B5GH 1QNJA 3N7DA 3RDZA 1BBRH 2GMTC 3T28A 1ZPCA 2QXJA 1V2RT 1CU1A 1LPGB 2FI4E 4B71A 1ELFA 1O30A 2XBXA 1HRTH 3ZVDA 2UUKB 5BPEA 3SUDA 3VB5A 1TBQH 3SNCA 4I7YH 1JRSA 1PQ8A 2YMSC 1BMNH 2BVSH 1QTFA 4U32A 4X8UH 4A1VA 1EP5A 2FDAA 2J38A 1IQKA 2O8TA 1OOKB 2PLXA 1GJAB 1OYTH 1GBFA 2OC8A 2CHAB 3CP7A 3N99A 4FUIA 2Y7XA 3ZVFA 1TYNA 2TIOA 3RMLH 5ESBA 1O3EA 4ZH8A 1O2LA 2VIWA 1VITF 1AWHB 3PMJA 1A7SA 1T31A 2A2XH 1WDIA 3LC3A 5T6DA 4FOUC 2A4GA 3KYGA 4GCHG 2FX4A 1P11E 2XRCA 1A4WH 1KMHB 3A85A 4Y0YE 2ZKSA 1BJUA 1A0HB 1C1QA 1K1MA 2EQNA 2K1QA 4GHTA 1AN1E 1THRH 3GOVB 1GGDB 2BVRH 5PTPA 1BIOA 1FDPA 1L2EA 5C67A 4YESB 3UY9A 5HM2A 2ZU1A 1C9TA 1BMAA 2RDLA 3Q77A 3KCGH 5C94A 3STJA 1FPHH 3OAAD 2ZGJA 5DO4H 2P3TB 3UWJH 2A5KA 3O8RA 1XUKA 3GCHB 4UFFH 1MD8A 1JIMA 1UK3A 3H09A 5EQQA 3S0NA 4TT3D 3STIA 3AW1A 1NU7B 2FOCA 3ZYDA 3RU4E 1ANDA 1T8OA 2DE9A 4B76A 3ATLA 2STAE 2BY5X 1O5FH 1DFPA 1YWUA 1ORFA 2AGGX 2ZDVH 4IN1A 3F0OA 5I25A 3RXDA 1MUEB 2J94A 1O2WA 2SNWA 2ZWLH 1Q2WA 5GPIB 3A7YA 3P95A 1ANEA 1BQYA 1WAYB 4Y7AA 1OP0A 2HLDD 1TRMA 4MNWA 3I78A 5JBBS 4FUGA 1O2ZA 1C5MD 3WWBA 3GCTG 1O2QA 3Q3YA 2AMPA 3P8NA 4U30A 1AE5A 3H7OA 4Y71A 5EGMA 4RKJB 1JWTA 1TQ0B 3AVZA 3GY4A 3M5MA 2H9TH 1GBKA 4AGKA 2WYGA 4BNRA 1EPTB 1G3DA 4X8VH 4B1TA 5I46H 1GHWH 2WYJA 4CH8B 1ABJH 2WHXA 1P02A 1YCPK 4AC9A 1GCTB 4RN6A 1MCVA 5F8XA 1EFRD 1UVSH 3AAVA 4Z6AH 1FLEE 1ELAA 2G8TA 1ZMLA 3C27B 2PWXA 1GJ9B 3PLBA 5KEDA 1YCPM 2OCVB 2ZF0H 4NFEA 4CR5A 3GY7A 4K2YA 2LELA 5ESTE 4X6PA 1PPEE 3M5NA 3RU4T 3KYFA 4JZDH 3MH4A 2XNDD 5DN6D 2XTTB 1BMMH 1ZHPA 4SGAE 3RXJA 2VIOA 1LTOA 1MTNC 1T4VH 1UTNA 2WPKS 1WCZA 1D9IA 1IQJA 2BZ6H 2NU3E 3L3TA 3HATH 2F91A 7GCHG 1ETRH 5CHAB 1NRQH 2CHAC 1FJSA 1P9UA 1XM1A 5EOKA 4BTTB 3CS7A 1Z8JB 3SNBA 3E3TA 3C1KA 3AASA 1ZZZA 4AYVB 1O3BA 3PMBB 1YPMH 3ZZ9A 1E36B 4Y11E 2BD3A 4YOIA 2BDBA 2FLRH 2BLWA 4K8BA 3W1EA 1K21H 4FVBA 1F5KU 3GS9A 1AVXA 3S9BA 1YPGH 1C1UH 1GGDC 3GY8A 2J34A 1W0JD 2OBOA 6CHAB 1GI3A 5GIBA 3SU6A 1TX8A 4AX9H 2TGDA 2QXIA 3BTTE 3BG4B 3VB7A 3Q3XA 5G4BA 1HAVA 3OY6U 4I8KA 1PYTD 2H5DA 3GCHC 3VGCB 2QCYA 4X2XA 1H9HE 3EAJA 1QL8A 3RXFA 3SUGA 1NY22 2ZCKP 3LH3A 3OEED 4X1PU 4GVUA 2J98A 2ZPQA 1L1GA 5EQSA 1LMWB 4JYVH 4D8NA 1UW7A 1V3XA 3MWIU 1QR3E 2OXSA 1S6HA 1TPOA 1G32B 1V6DA 1GBAA 1IQNA 2FS8A 5C1XA 5LPFA 2RDEA 4Z0KA 5LPEA 1Y3YA 1YPHE 2KR7A 2GP9B 3SUFA 2QE7D 3KQBA 4AZ2B 4ZHAA 2PGQB 3MH7A 5AHGH 1A3BH 2ZDLA 3ZVEA 1LDTT 3F2GA 2JJ1D 3HGNA 2XBWA 1Z6EA 5FPYA 3H7TA 1OWJA 1ELDE 3TK9A 1KY9A 2JJ2D 1QJ1B 3OFND 1MTWA 1HAIH 1WU1A 3NUMA 3SU5A 3U98H 4ABAA 4A92A 5AF9H 1MBMA 1UMAH 2H9EH 2GDEH 1QGFA 1BITA 4OS6A 1O3PB 1TGCA 2XYAA 2ZHDA 3CS0A 3DA9B 2D2DA 2G81E 1C4Y2 1EPTC 2BY8X 5H4IB 1BTXA 2AMDA 1C5XB 4FUHA 2V0BA 1O5CB 1OWEA 3TLOA 2AHME 3SNDA 2IOTA 2B5TB 1GCTC 4IN2A 5FX6A 4CH2B 5IDKA 1DM4B 4Y8ZA 4UFEH 3LGVA 1DUAA 1GI0A 2W26A 4JK5A 1P2QA 1THPB 1W0KD 1EAUA 1HXEH 1GVLA 1NTPA 2ASUB 3DFLA 3T26A 3VPKA 5HKKD 3BTDE 2FOHA 2H1UA 1HLTH 3PB1E 1WYKA 1SI5H 2Y5FA 2BQWB 5J4QA 1Y3XA 3HK6B 3LDXH 2O8UA 4MNXA 1KLTA 3E91A 2ZFPH 1EP6A 1S82A 4GLYA 1Z7KA 5CHAC 1C5OH 1SGIB 1V2ST 3WWFA 1SQOA 1XMNB 3VB6A 1LHDH 2ZFSA 5E8EH 1EASA 1YCPH 5C2ZA 3ATMA 2OK5A 1UTJA 1L1JA 3FN8A 1E38B 5LPRA 1DT2A 1ZGVA 4YT7H 3UWIA 1YPHC 2XWAA 3QLPH 4ZXXH 3L6PA 3U8OH 3SU2A 3BV9B 1BMFD 1CHGA 3KF2A 2FO9A 1ETSH 3A7VA 2WPDD 2EI6A 1NRNH 2A5IA 2FOBA 1AO5A 5F53A 2FS9A 1ZYOA 4ACAA 1T32A 3V12A 2VNTA 1HXFH 1QRXA 1RTLA 3BG4C 1G36A 3H5CB 1BRUP 1VITH 3OYPA 1IQFA 4NFFA 4RT1A 3SV8A 1FY1A 5C1UA 4KTSA 3VGCC 4INHA 4OS4A 1KYNA 1Q3XA 3PMHB 1DXWA 4MNYA 4Y6DA 1O5GH 3BSQA 3M7TA 1N6XA 4XBDA 4Y79A 2ANMH 2PUQH 3NKKA 4D76A 2RFKC 1F5LA 1TAWA 4ZMAH 1AI8H 3EDXB 2UUFB 4U01A 1EXFA 4P02A 1O2OA 2FOGA 4XRNA 1THSH 1ZHMA 1GMCF 1LCYA 2C90B 1OWHA 1JMOH 1T4UH 3SJIA 4BXWA 2V35A 3TGKE 1SGRE 1SQTA 5E0JA 1ZMJA 2QGRA 1W10U 3PWCA 1N6YA 1Z1JA 1WV7H 1LHGH 1T8NA 5EPYA 1O0DH 1FV9A 4P00A 1GBJA 3SJ9A 3QUMP 2ZU4A 1LPKB 2R3UA 2Z9LA 3RXHA 3MO9A 2Y80A 1BZXE 2PTCE 4IBLH 1TGNA 1ELTA 1S6FA 1HJAB 4BAKB 2VGCB 4HFPB 2OD3B 3ZVBA 1HFDA 2A7JA 2P94A 1O3DA 1UHBB 4H6SB 1P0SH 4YT6H 2HPPH 2EA3A 1HJ9A 3ZVCA 1V2OT 1O3OA 3A8BA 3MHWU 2ZQ2A 5C0TA 2A5AA 1GI8B 4F48B 2LP6A 3BTFE 5C17A 4AFQA 1H8HD 2L74A 3F2HA 2BQ6B 3TJOA 3QTVH 2GCHF 5GCHG 1TNKA 3UNQA 9ESTA 1BB0B 1E37B 4VGCB 4K1SA 3A7TA 1YGCH 1G30B 3K2UA 3A7XA 3ODDA 1P09A 3RUOA 4MPVA 5EJZA 5TCCA 3MU1A 1B7XB 1NFXA 1W0ZU 4RKOB 1QJ6B 1NFWA 3F1SB 3UAIC 4RT0A 3TGIE 2HVYB 3DCLA 1GJCB 1O2JA 2PUXB 1CVWH 1GBBA 2QYIA 3FFGA 3S7HB 1AQ7A 1Y5AT 1SPJA 2I6QA 4CREA 2IN2A 1RGQA 4X8TH 3ATIA 1VITG 3MFJA 5A8YA 1SC8U 2O8LA 3OE7D 1IHTH 1DUEA 2KCAA 1O2UA 1KXDA 3BTGE 1DOJA 3HPTB 3F9HA 4FUJA 2ZNKH 2VVVA 3UNSA 1QB9A 1QRZA 1KXFA 3E6PH 5E2OA 2BM2A 5EW2H 1Z6JH 2AYWA 1ZTKA 1UHBA 2A1DB 4IC6A 1CGIE 1YBWA 4X0WU 1SLUB 2YMSD 1PQ7A 2VWMA 4FUEA 5EW1H 2G4TA 1GJDB 1UJ1A 4BTUB 2UWLA 3RXBA 2FODA 1FPCH 2PP6A 2HNTE 1QBVH 2P3FH 1H8DH 2F9PA 1P3EA 2ZDMA 1QL9A 3B9FH 2VVUA 3OTJE 2VWLA 7ESTE 4KP0A 1NRPH 2BD5A 3I77A 3RXTA 4BANB 3RXVA 2G00A 3R3GB 1V2LT 2AIQA 2ZTYA 4Y8XA 2R3YA 1MKWK 3P8GA 1TPAE 2SGAA 4WVPE 1DY9A 5EQRA 2OC0A 2VBCA 3RM2H 1E34B 1FMGA 3KGPA 3ESTA 2TBSA 2FX6A 2PKAA 2V3HH 4K8YA 4K3JA 3NZIA 4X1NU 1ACBE 1FZZA 2F9BH 1RJXB 3K6YA 3UQOA 4B2BA 2V3OH 5CHBA 1J16A 1IQEA 3AAUA 3M3VA 5C1YA 1WXRA 2NU4E 1FY3A 1AU8A 1AZ8A 3QTOH 1SHYA 1HJAC 1OXGA 1C2DA 2VGCC 2PSYA 1ESAA 2CN0H 3BTME 3F9GA 1NBMD 3VXEH 4HG6A 1RIWB 1D6WA 2Y5GA 3UOUA 1LVYA 1SQAA 1BUIA 1IQIA 1SLVB 1CGJE 1KXCA 4X6NA 1WBGB 1GI5A 3GY6A 1O2HA 3SNEA 3ZZBA 2ODPA 5DG6A 4I33A 1C5SA 3QN7A 1ZJKA 5F6MA 3UNRA 3PO1B 4DCDA 3EYDA 2VWNA 2RCEA 1DWCH 3KNXA 2WV5A 3MI4A 1TRYA 2XW9A 5C20A 4VGCC 1EZUC 1OP2A 3MNXA 3SU3A 1P2KA 1DSTA 4YLUA 2BMGB 1FAXA 2Z3CA 4KTCA 1SGFA 3U1IB 1TNLA 1O3CA 4NWKA 3TJVA 1O3HA 3JZ1B 4A6LA 1S6LA 2HNTC 2NU2E 2BX3A 1F0TA 2QF0A 5C3NA 3TNTA 5HGGA 2FYQA 1ANBA 3ZYEA 3A7WA 1UCYH 3LGIA 3NXPA 2Q1JA 2ZGHA 1SL3A 4NG9H 1P05A 2GV6A 1PPFE 3B23B 1Y8TA 1MTNB 2R0KA 1Y3UA 1AKSB 3LC5A 3A87A 1OWKA 4D7FA 1FY8E 1E1RD 3BIUH 4ZKSU 3UREA 1OX1A 1D3PB 1DSUA 2M5TA 4ABEA 4MPXA 4NIYA 4H42U 3M3SA 2Z3DA 4ASUD 4I8HA 2ZHEH 3BEUA 3PV2A 2VIPA 4ZCNA 1MU6B 1EKBB 1FIZA 1GBEA 1V2TT 1EAWA 5FBIA 5JPMH 1VZQH 1O3GA 2JKHA 1UVTH 4A1TA 3ZZDA 4AB9A 1YLCA 3E0PB 3KQDA 2F83A 4QT8C 2FTLE 2AIPA 2WPJS 3M5LA 4YXWD 1YPJH 1C9PA 2BDCA 1NFUA 1QQ4A 4GHQA 1HNEE 1F0UA 1LVBA 3LGWA 1FX0B 4K60A 1AZZA 1GI1A 4ABGA 3K6ZA 1GBDA 4WMDA 5BRRE 1GMDF 5T1VA 1C2KA 2J95A 4DT7B 2D26C 3GDSA 3TK5A 4ZXYH 1UVUH 3DD2H 2WPHS 3KL6A 1MZAA 2EY4C 1O34A 2ZZUH 4YO9A 3NCLA 1AUTC 3M7UA 1P2OA 1QY6A 1RIWC 1CT2E 1GJ4H 2D8WA 3O8BA 3MNCA 5AVDA 3P8FA 2P93A 2BD9A 1DDJA 3UTUH 1P57B 1BHXB 5FL7D 1C1MA 3RC4A 3TITA 3EE0B 1W2KH 1OHHD 1NS3A 2J4IA 3PO1C 4AGJA 3RXGA 2FI3E 3RXPA 1NROH 3E8LA 1O3FA 2GTBA 4D9QA 2ESTE 1AWFH 4I86A 1W3CA 4OS5A 1C4V2 1HCGA 3SGQE 3BTEE 1ELGA 3O8DA 1Z1IA 4OS1A 2AS9A 3UIRA 1Y5UT 1UVPA 2B0FA 2LPRA 2OTVA 2XXLA 3PYHA 3BEIB 3V0XA 3RXQA 3ZZ7A 1GMHF 1K1JA 1WUNH 4F49A 2BB4A 4FVDA 2ILNA 2ZA5A 1K1NA 1O2SA 1O3KA 4IS5A 2UWOA 3BN9A 1NESE 3GDVA 3DUXH 1P2MA 3LGUA 3OU0A 4TWWA 3U8TH 1GHAF 1TBRH 2GV7A 3SI4H 5L2ZH 1AE8H 1VCPA 2FYRA 3SV7A 1SGQE 2Z7FE 2WPLS 3A7ZA 2FOMB 3M5OA 4K1EA 3RP2A 2EI7A 1K1PA 2ZFQH 3ZZ8A 2OP9A 2ALVA 3T25A 1GVKB 1ELBA 5GDSH 5CDFE 2P59A 2J5UA 5LH8A 2C8WB 1CA0B 2V3MA 2CF8H 3NRLA 3T5FH 3ZZ6A 4WWYA 4DOQA 2VU8E 2CV3A 1UTOA 3BIVH 4O9VA 3KQ5A 3BTQE 1SLWB 2OC7A 2XBYA 1S0QA 2FESH 1TGSZ 1KSNA 4O03A 3OEHD 1KLJH 2WUCA 1C1NA 1EPTA 2Q6GA 1C5PA 3SORA 3P17H 2ZU2A 3PTNA 4FU8A 4Y0ZE 2W7SA 3L33A 3KHVA 4INLA 1P03A 5A0AE 5HIYA 4B74A 5JBCS 1W7GH 3QX5H 3LIWA 1LQDB 2YNAA 1N1LA 3VG8A 1HJ8A 3O8CA 4X1RU 2QF3A 4A7IB 2OINA 1GMCG 1BBRE 1HDTH 3SBKA 1MQ6A 1GJBB 1UCYE 2FI5E 3F6UH 2HLCA 1ZRKA 1BRAA 5DJ7A 3D49H 4J1YA 5J4SA 2ZEBA 3OSYA 1D4PB 4E7RG 1FAKH 3U69H 4FXGH 4PROA 4XDEA 2FTMA 1FN8A 2SFAA 1CHOG 1C2JA 2C8XB 2QC2A 4HI3A 3PTBA 4F4OC 2Z6BD 1KDQB 1RFNA 4HTCH 1EZSC 3SQEE 4A5TS 4NCYA 5DP8A 3RXRA 1SLXB 1BA8B 2ODYB 1MAXA 2GZ8A 3S7KB 2W6JD 3HKIB 3E1XB 1GHBF 1MABB 4FUBA 3UPEA 3SHCH 1G37A 2SGFE 3UR9A 1C1OA 3R0FA 2AEIH 4ZKOU 1HAHH 1HYLA 3GISB 1EAIA 4KTUA 3TK6A 1TX6A 1O2YA 5A2MH 2ZDKA 1SQRA 2GX4A 3ZV9A 1O2TA 2GCHG 1LQEA 2G51A 3SYJA 1MTUA 2HWLB 1V2UT 2FOFA 1INCA 2ZFRH 2FWWA 5DSFA 3OX7U 3ZZ3A 3BTKE 4Q7YA 5K7RA 3GICB 4JK6A 1TB6H 1GHXH 2BHGA 7LPRA 1SFIA 3JZ2B 3WY8A 4GUXA 4AG2A 5A8ZA 2G5VA 3W95A 1S85A 5IYTA 1OKXA 4LXBH 1ZLRA 5KGOA 1NRRH 4O3TA 2VINA 2YNBA 3M61U 1C5UA 1AB9B 2BVXH 1ELVA 2W3KA 3SU1A 1S0RA 2J97A 3MU0A 5A0BA 2XCFA 1S81A 2EEKA 2ZFFH 1CT4E 1YP9A 2ZGXH 3MNSA 3LONA 1BTWA 3TJNA 3T27A 1CA0C 4B75A 1LVMA 2ANWA 2VIVA 2WZQA 4ABIA 1V2PT 2XC0A 1GJ8B 1ETTH 1GPZA 3A83A 8KME2 1LVOA 1SR5C 2CJIA 3HGPA 4ZKRU 2C3SA 1DE7H 3BTHE 1C5TA 3ENSB 1C5NH 2ZDNA 2QXGA 1PYTC 1TBZH 4GAWA 4JCNA 2A7CA 2V7QD 5EXMA 1OSSA 2WSSD 2PV9B 2GCTB 4Z1MD 4AORA 4NA7A 4MVNA 1PPBH 1JIRA 4Y10E 2GGVB 2CK3D 1J15A 1D3DB 1P9SA 1SGYE 1IQHA 4IGDA 6LPRA 1BRBE 3SNAA 3LPRA 1CT0E 1C2EA 1QZ8A 1SGNE 5JB8S 1OWIA 1P2IA 1YPEH 2CF9H 4E05H 1O5DH 4J2YB 3SGAE 1H8IH 1ANCA 2EI8A 1A61H 1P04A 1W14U 3AW0A 2O8WA 4R0IA 1GI6A 2QN5T 1SKYE 1RS0A 3IWMA 1HAZB 1E1QD 2KAIB 4YTAA 2V6NA 1C2IA 1DITH 4LOYH 1HAGE 4CBOA 1LHFH 1AMHA 4TY6A 1NPMA 4X6OA 2J92A 2PR3A 1EJMA 1PPCE 1O37A 1C5LH 2TGPZ 1L4ZA 1XUIA 5T6FA 3ZZCA 1WQSA 3ZZ4A 2J2UA 1TLDA 3SUEA 4TPIZ 3U1JB 3B8JA 1K1IA 1YLNA 1L1NA 2JH0D 2W7UA 3KQEA 1KTSB 1SVPA 4CRAA 1MTSA 4Q80A 1DLKB 5T6GA 3UR6A 1BBRK 2Z9JA 1AUJA 4GSOA 2HRVA 2XC5A 4ASHA 1C1VH 1A2CH 1GL1A 3EQ0H 1DWBH 4OGXA 1EUFA 4MG3A 4H6TA 3GYMA 1O5AB 4DVAU 1H8ED 2BXUH 1AB9C 4ISOA 2Y7ZA 2Z3EA 4WMEA 1GHZA 1MH0A 2ZHWH 1H4WA 2GKVE 4ZROA 3PRDA 4O97A 1D6RA 3K65B 1F7ZA 3GCOA 2TGTA 1NM6A 2SGEE 1ESBA 1O39A 4AYYB 5DP4A 2P16A 2ZHQH 1GBMA 1OYQA 1KXBA 4Y76A 5F8ZA 3G01A 1V2WT 5JBTA 2WV4A 1AHTH 1NRSH 1LKBA 2BDAA 1C2FA 2GDDA 3QDZB 1BTZA 2ZPSA 1K0HA 3GY2A 2PW8H 5FPSA 2BD7A 4AFUA 4I8JA 1SGFG 2P3UB 3M36A 4M9FA 1G3BA 4K69A 5C0UA 3DSOA 3Q00A 5E2PA 3NWUA 2GCTC 4Y7BA 1V2VT 1A0JA 4F55A 3SJKA 3D23A 1TE0A 2JETB 1GDQA 4WMFA 5A8XA 2BZAA 4CRFA 1V2KT 1ZMNA 4YM9A 1G2MA 1A5GH 1TNGA 2O9QA 2ZG0H 1JRTA 2SGDE 3F2FA 1QRWA 4ZAEA 2Z9IA 2H5CA 4NIXA 3SV2H 5L6NH 3NPSA 1IAUA 1FXYA 5KECA 2XC4A 1SGCA 3MQKC 1VJ9U 1GMDG 1BTPA 1QFKH 1KTTB 2VH6A 1O2VA 5FAHA 4AFSA 3V13A 3ATKA 3SV9A 5FCKA 1A46H 1F92A 1O3IA 1S84A 2Y81A 2SGPE 5EXLA 4FU9A 1AFQB 1HB0B 6GCHF 2F9OA 1ESTA 1GI4A 2JH6D 3TVJB 1A5HA 3SHAH 1TABE 3RXLA 1BCUH 3EA8A 2H6MA 2IPHA 2BY9X 2FEQH 2AGIX 3MU5A 5DK1A 1T7CA 1TOMH 2A4OA 2BDYA 3RXIA 5JBAS 4ABFA 5FHTA 1PQ5A 1TWXB 1FY4A 1O31A 4Q2KA 5FPTA 4I32A 2BD2A 4E7NA 4FUCA 2WINI 4Q7ZA 1GBLA 1ZSKA 1BJVA 2A2QH 1FQ3A 3A81A 1AY6H 1W11U 2L6OA 5TCAA 4DIIH 3ELAH 3PV5A 2GT7A 3HKJB 4BOHA 1M9UA 1HAXB 2XWBI 3SZNA 4BAOB 2WUBA 3SV6A 1GMHG 3M7QA 2GVFA 2OBQA 2PHBA 3W94A 3FOAA 2HNTF 1XX9A 1SBWA 2IJOB 3GCNA 4MNVA 1XUHA 1ARBA 3PLPA 8LPRA 3PMAB 3PV4A 4IMZA 2UWPA 2WV9A 2NU0E 1BRCE 1GHAG 1X7AC 3RC6A 4X2WA 1O2NA 1NBME 1O2RA 3S69A 4ISIH 2KX4A 1RXPA 2ZCHP 4B73A 1P2JA 1ZPBA 5DP3A 3PM3A 1EQ9A 1TGTA 2C4FH 4GPGA 2QY0B 2UUJB 2VVCA 1A5IA 1G9IE 1V2NT 1JXPA 3QZRA 4LZ1H 1O3JA 1LHCH 1GVZA 1O32A 2CGAA 3A84A 1SGDE 3IITA 1VKYA 1RD3B 2Z9GA 2ZU5A 2C93B 3KN2A 3VB3A 4X2YA 5FX5A 2ZGCA 1TQ7B 1UK2A 2AMQA 1GDUA 1O35A 5EIYA 2BLOA 4JZFH 1XVMA 1C1TA 4X2VA 3RXKA 1DICA 1EZQA 1TA2A 2RA0A 4RI0A 1QA7A 2JETC 3RU4D 5JYIA 1B0EA 2ZC9H 4OGYA 1TNJA 4I8LA 4LZ4B 4Q4LA 1EZXC 3FP7E 1EATA 1G3EA 2Q6DA 2ZHFH 1ZGIA 1FUJA 1EJNA 1TPPA 3MH5A 1XXDA 4NIWA 1XUJA 3T62A 5EJ1A 2W6ID 1OS8A 3MOCA 3RXEA 5ETXA 1MKXK 3ZIAD 2ANYA 1IQMA 3FP6E 3FO8D 8GCHF 3FZZA 1A3EH 3SU0A 2ZO3H 2D1JA 3MYWA 3A8AA 3FZDA 1P10A 2OUAA 4Y8YA 4IMQA 3DSPA 5IK2D 2PKSB 1AFQC 1NO9H 4CBNA 5A0CA 1G3CA 3FAOA 2RG3A 5JDUB 3LJOA 3FANA 5AFZH 1JBUH 4D9RA 5DP9A 4BAHB 2QA9E 1Z8IB 1HUTH 1KIGH 1GHBG 2BY7X 1DANH 3QK1A 1MMJN 3SI3H 3TPIZ 4ABHA 4I8GA 2Y5HA 2RA3A 2QF5A 2ALPA 1WTGH 3FP8E 2F9NA 3TU7H 2VJ1A 4X1QU 8ESTE 2F9UA 1V2MT 3BF6H 3DHKH 2JDID 3MO3A 2FOAA 1GI9B 9LPRA 1AKSA 2M2AA 2A4QA 3NK8A 4MDSA 3EGKH 3ZV8A 3Q76A 1YPLH 2STBE 4B2CA 1QCPA 1FIWA 3RXAA 3SOSA 4UONA 3BEFB 3RM0H 1TX7A 1MKWH 1AD8H 1WSSH 2ZP0H 1Z71A 1NT1A 2BDIA 1SFQB 2K0QA 3P6ZB 2HGTH 3EE7A 2KCPA 1UVOA 3EA7A 1EJAA 1SOZA 2C8YB 1NN6A 1DWEH 2ZI2H 1YF4A 1RRKA 3LU9B 2BXTH 4X8SH 1LHEH 1TMTH 1K2I1 1MD7A 2KZ4A 4THNH 1ARCA 1PPHE 3U9AH 5EXNA 3OY5U 1C5VA 3RXUA 1Y5BT 1VGCB 3E16B 1QIXB 1ZJDA 2FPZA 4FU7A 1YLDA 4CRCA 1HAVB 3LH1A 3PWBA 5EODA 1QA0A 1SSXA 3KIDU 3WW7A 4ZHLU 1H9LB 4NGAH 2H9HA 1ZSJA 4E06H 1DPOA 3LJJA 2PFEA 3MO6A 3ATWA 1A0LA 1KLIH 5GNDA 2J98B 2ZDAH 4ZKNU 4CR9A 2FXRA 3ITIA 1PFXC 1GBHA 1UTLM 3MTYA 2HALA 3QWCH 1C5YB 4ESTE 3TH3H 4CRDA 3A89A 4JZIA 3UQVA 1O5EH 3ZZ5A 1NZQH 4TSFD 3LT3A 1GHYH 2G5NA 3IG6B 4KGAA 1Y3WA 1VR1H 5GXPA 4NSVA 4ACBA 4UEHH 1XUFA 2QXHA 1LKAA 3E0NB 1XUGA 1TGBA 3DT0H 2TGAA 4X1SU 1P3CA 1ZOMA 2FIRH 1J14A 1FY5A 2I6SA 1O2PA 2O8MA 1EAXA 4R8TB 2A7HA 4INKA 3E90B 4RSPA 1FI8A 4JYTA 3U8RH 2BTCE 4UDWH 2BYAX 3GYLB 1ZTLA 2BDGA 1YPKH 1P01A 1TFXA 1ID5H 1W7XH 5HYOA 2BOKA 1XVOA 1HIAB 2WPIS 4KKDA 5E0HA 3N7EA 4ABJA 4DJZB 1GWAA 2PKSC 4YLQH 3SW2B 2DUCA 3BTWE 4GCHF 1CO7E 3V3MA 2C8ZB 3KQCA 3VFEA 2EC9H 3SJ8A 1ZSLA 3LKWA 4HZHA 2QV1A 1GBCA 2TRMA 4YOGA 1GJ7B 3RLYH 2OLGA 2FLBH 4TYDA 3QO6A 1VCWA 1NFYA 2B9LA 4B2AA 4WH8A 1SOTA 1O3LA 1DS2E 1EX3A 3RLWH 3TNSA 1QBNA 4NZQA 1F0RA 1BHXF 1LPZB 2H2ZA 2YOLA 1MKXH 2NWNA 3F3BA 4Q63A 1C1WH 4JZEH 1UK4A 3TJUA 4WH6A 1P8VC 1G2LA 4JZ1A 5HM9A 3A80A 1N8OB 1MZDA 3UFAA 2AGEX 1HAYB 1K28D 2SNVA 3UOPA 2R9PA 4K5ZA 1VJAU 2F9VA 2XCNA 5DP5A 1BTHH 3T29A 3M3TA 5B6OA 1C2MA 2HOBA 1EB2A 3URCA 3PLKA 4CHAB 2AERH 3GCTF 5HIZA 1F0SA 1KXAA 3LGYA 4DG4A 2A45B 1VGCC 1UTQA 1ZRBA 2GZ7A 1KXEA 3KEEA 3RXCA 4MPWA 1QB1A 3RXSA 5FBEA 3I29A 1ZHRA 2B8OH 3RXOA 1GBIA 3VXFH 4DT4A 4XD7D 3ZZAA 1HIAA 3F9EA 4XSKU 5DPAA 2JIZD 5K0HA 3BG8A 5HMAA 4BXSA 4NWLA 2J9NA 2Y82A 4D7GA 4O3UA 1TA6A 1O3MA 2XBVA 4XOJA 1TOCB 2BD8A 2PTNA 2CXVA 4WXIA 4TPYA 4B6FA 4OM9A 1KDQA 4JYUH 1AGJA 2QF4A 4XE4A 1IOEA 1DY8A 4JMYA 2OC1A 1QQUA 1C1PA 2R0LA 5GJ4B 4BTIB 1BTUA 4K1TA 4LK4A 1TRNA 3T2NA 1IQGA 4HGCA 1J9CH 5EPNA 1O2XA 2F43B 3ZVAA 2BX4A 5HXFA 5JB9S 5L30H 4IW4E 4DY7B 1LO6A 3TGJE 1L0ZA 1SB1H 1GHVH 1CBWB 1MQ5A 3MMGA 1HBTH 1Y3VA 7GCHF 2F3CE 3A8CA 4MPUA 1J8AA 1V2JT 2SGQE 1SGTA 1MCTA 1CE5A 4OS2A 2P95A 2VIQA 3P70B 3A82A 5C5OA 1GBTA 3CNRA 6CHAC 1SMFE 2G55A 2DE8A 2BD4A 2JH5D 4XBCA 5F03A 4AOQA 2A0QB 2G52A 2KCYA 1FNIA 1TALA 4CRGA 4BAMB 1P06A 1RTFB 1C1SA 3F0PA 2ZGBH 1BT7A 6GCHG 1K1OA 1GI2A 1C5ZB 2THFB 1K22H 3SZEA 5B6LA 1QHRB 2KM0A 1O2IA 1YY3A 1TMUH 2BDHA 1O3NA 3D65E 1WOFA 4DW2U 1HAPH 3LOXA 2XOKD 4TY7A 1PPGE 1NC6A 3GY5A 3U28C 1CQQA 1C1RA 1SGEE 1DX5M 1SGPE 4ABDA 3ODFA 1Q31A 4WY3A 1Z8GA 2ZIQH 3SO3A 1O2GH 4ZHMU 4WF8A 1W12U 2B7DH 4XFQA 3P8OA 3GY3A 2PGBB 3HK3B 3URDA 5AFYH 1GDNA 2R2MB 3Q3KA 4M7GA 1N8OC 2ANKH 1W0YH 4I31A 1CSOE 3N7OA 3D62A 1PPZA 2IPQX 4AN7A 1CHOF 1AVGH 3K9XB 2Y6TA 1AIXH 4DIHH 1E35B 1C2HA 1OPHB 2FP7B 2GZ9A 4AFZA 4CHAC 1ZR0A 4B6EA 1GG6B 1K9OE 1K1LA 3SJOA 3PROA 4BAQB 5L2YH 1EOJA 1UCYK 2BY6X 3RMMH 2A31A 1DVAH 2GD4B 4UE7H 1ELEE 1RTKA 2W5EA 1BMLA 3QZQA 3V7TA 1O3AA 1ZTJA 4A1XA 1B0FA 1DLEA 4NZLA 5CMXH 1QURH 2FM2A 2Z9KA 1TIOA 2A32A 1YYY1 2OQUA 1IQLA 5SGAE 1C5RA 3TIUA 1DXPA 2Q6FA 3VEQB 1ABIH 4ISLA 3EA9A 2TPIZ 1O2KA 1T8MA 2F4LA 3CENA 1MAYA 4WJG2 3TH4H 2AH4X 1C4U2 1NU9A 4MTBA 2ZPRA 1O2MA 1PJPA 4AG1A 1TMBH 1BDAA 2KAIA 2P8OB 5DP7A 1C2LA 4MQAA 1EB1H 2FOEA 3MH6A 3SQHE 4YOJA 2G4UA 2PKAB 2GMTB 2XNIA 1OWDA 5CE1A 3QGNB 3PRBA 4UFDH 2FMJA 2OQ5A 2YMSB 1UTMA 2VB0A 3OTPA 3A88A 4UFGH 2BLQA 2UUYA 3M37A 1CBWC 1J17T 2R2WU 2PSXA 3DFJA 1JOUB 2Z94A 1GJ5H 1OP8A 1GL0E 4IC5A 1GCDA 1HPGA 4OS7A 1U6QA 5EJLA 2LNCA 8GCHG 3VB4A 2HPQH 1CGHA 1CA8B 1P12E 3S9AA 4FUFA 1FN6A 1IHSH 2ZCLP 3AK5A 1O38A 6ESTA 1XKAC 4FETA 3P92A 5A09A 2ULLA 4NIVA 3F9FA 5T3HA 3MU8A 5GWZA 1E79D 4KELA 4YZUA 1F5RA 2QIQA 4MLFB 1AVWA 3SGBE 2KFWA 2CMYA 2BOHB 1P2NA 1Y59T 3MNBA 4TWYA 2VIDA 2K8IA 7KMEH
chains in the Genus database with same CATH topology
1C5QA 1F2SE 4UD9H 4DURA 2ZU3A 1HV7A 1TNHA 1C2GA 4H4FA 4CRBA 1T8LA 5FXLA 1YKTA 1QBOA 3S9CA 1S5SA 3ZVGA 5LGOA 3RMOH 1DWDH 2ZFTA 1ZPZA 2WPMS 5DP6A 3UUZA 1XXFA 1D3TB 1W13U 1EOLA 2GT8A 2NU1E 1TONA 1E0FD 2FZZA 1UTPA 5TJXA 4AB8A 2HVXA 3M35A 3RXMA 1QB6A 1O36A 1HGTH 3QGJA 5EG4A 2ZTZA 2VWOA 1L4DA 3MU4A 2BLVA 2VH0A 5DKMA 4NSYA 4ISHH 1TPSA 1C5WB 4WXVA 2AFQB 1SHHB 1O33A 1SG8B 1YC0A 3SU4A 2ZECA 4ISNA 3TH2H 1XKBC 5E0GA 5F8TA 1GG6C 1UTKA 4NA9H 4NA8A 1BTYA 4XBBA 2ZTXA 1MTVA 1WQVH 4ABBA 5ABWA 1H9IE 1S83A 3A86A 1MBQA 1VCQA 3LGTA 4DGJA 3F68H 1BOQA 2A4RA 1MU8B 3A8DA 1D3QB 3SN8A 1GJ6A 2BQ7B 2ZQ1A 3RMNH 5FCRA 3RC5A 1QJ7B 4Q7XA 2W3IA 3GDUA 1PQAA 1TNIA 4SGBE 1QL7A 1GI7B 1O5BB 1YM0A 5EU8A 4FUDA 1UO6A 1WTHD 4X6MA 1AFEH 1HAOH 1W8BH 4U2WA 1H1BA 1Z8RA 1ELCA 3FVFB 4ZUHA 2P8OC 1FONA 2QAAA 5GCHF 1A1RA 5C5NA 2ODQA 5DGJA 1V2QT 1B5GH 1QNJA 3RDZA 1BBRH 2GMTC 3T28A 1ZPCA 2QXJA 1V2RT 1CU1A 1LPGB 2FI4E 4B71A 1ELFA 1O30A 2XBXA 1HRTH 3ZVDA 2UUKB 5BPEA 3SUDA 3VB5A 1TBQH 3SNCA 4I7YH 1JRSA 1PQ8A 1BMNH 2BVSH 1QTFA 4U32A 4X8UH 4A1VA 1EP5A 2FDAA 2J38A 1IQKA 2O8TA 1OOKB 2PLXA 1GJAB 1OYTH 1GBFA 2OC8A 2CHAB 3CP7A 4FUIA 2Y7XA 3ZVFA 1TYNA 2TIOA 3RMLH 5ESBA 1O3EA 4ZH8A 1O2LA 2VIWA 1VITF 1AWHB 3PMJA 1A7SA 1T31A 2A2XH 5T6DA 3LC3A 2A4GA 4GCHG 2FX4A 1P11E 2XRCA 1A4WH 3A85A 4Y0YE 2ZKSA 1BJUA 1A0HB 1C1QA 1K1MA 2K1QA 4GHTA 1AN1E 1THRH 3GOVB 1GGDB 2BVRH 5PTPA 1BIOA 1FDPA 1L2EA 5C67A 4YESB 3UY9A 5HM2A 2ZU1A 1C9TA 1BMAA 2RDLA 3Q77A 3KCGH 3STJA 1FPHH 2ZGJA 5DO4H 2P3TB 3UWJH 2A5KA 3O8RA 1XUKA 3GCHB 4UFFH 1MD8A 1JIMA 1UK3A 5EQQA 3S0NA 3STIA 3AW1A 1NU7B 2FOCA 3ZYDA 3RU4E 1ANDA 1T8OA 2DE9A 4B76A 3ATLA 2STAE 2BY5X 1O5FH 1DFPA 1ORFA 2AGGX 2ZDVH 4IN1A 5I25A 3RXDA 1MUEB 2J94A 1O2WA 2SNWA 2ZWLH 1Q2WA 5GPIB 3A7YA 3P95A 1ANEA 1BQYA 1WAYB 4Y7AA 1OP0A 1TRMA 4MNWA 3I78A 5JBBS 4FUGA 1O2ZA 1C5MD 3GCTG 1O2QA 3Q3YA 2AMPA 3P8NA 4U30A 1AE5A 3H7OA 4Y71A 5EGMA 4RKJB 1JWTA 1TQ0B 3AVZA 3GY4A 3M5MA 2H9TH 1GBKA 4AGKA 2WYGA 4BNRA 1EPTB 1G3DA 4X8VH 4B1TA 5I46H 1GHWH 2WYJA 4CH8B 1ABJH 1P02A 1YCPK 1GCTB 4RN6A 1MCVA 5F8XA 1UVSH 3AAVA 4Z6AH 1FLEE 1ELAA 2G8TA 1ZMLA 3C27B 2PWXA 1GJ9B 3PLBA 1YCPM 2OCVB 2ZF0H 4NFEA 4CR5A 3GY7A 4K2YA 5ESTE 4X6PA 1PPEE 3M5NA 3RU4T 4JZDH 3MH4A 2XTTB 1BMMH 1ZHPA 4SGAE 3RXJA 2VIOA 1LTOA 1MTNC 1T4VH 1UTNA 2WPKS 1WCZA 1D9IA 1IQJA 2BZ6H 2NU3E 3L3TA 3HATH 2F91A 7GCHG 1ETRH 5CHAB 1NRQH 2CHAC 1FJSA 1P9UA 1XM1A 5EOKA 4BTTB 3CS7A 1Z8JB 3SNBA 3E3TA 3C1KA 3AASA 1ZZZA 4AYVB 1O3BA 3PMBB 1YPMH 3ZZ9A 1E36B 4Y11E 2BD3A 4YOIA 2BDBA 2FLRH 2BLWA 4K8BA 1K21H 4FVBA 1F5KU 1AVXA 3S9BA 1YPGH 1C1UH 1GGDC 3GY8A 2J34A 2OBOA 6CHAB 1GI3A 5GIBA 3SU6A 1TX8A 4AX9H 2TGDA 2QXIA 3BTTE 3BG4B 3VB7A 3Q3XA 5G4BA 1HAVA 3OY6U 4I8KA 1PYTD 2H5DA 3GCHC 3VGCB 2QCYA 4X2XA 1H9HE 3EAJA 1QL8A 3RXFA 3SUGA 1NY22 2ZCKP 3LH3A 4X1PU 4GVUA 2ZPQA 1L1GA 5EQSA 1LMWB 4JYVH 4D8NA 1V3XA 3MWIU 1QR3E 2OXSA 1S6HA 1TPOA 1G32B 1V6DA 1GBAA 1IQNA 2FS8A 5C1XA 5LPFA 4Z0KA 5LPEA 1Y3YA 1YPHE 2GP9B 3SUFA 3KQBA 4AZ2B 4ZHAA 2PGQB 3MH7A 5AHGH 1A3BH 2ZDLA 3ZVEA 1LDTT 3HGNA 2XBWA 1Z6EA 5FPYA 3H7TA 1OWJA 1ELDE 3TK9A 1KY9A 1QJ1B 1MTWA 1HAIH 1WU1A 3NUMA 3SU5A 3U98H 4ABAA 4A92A 5AF9H 1MBMA 1UMAH 2H9EH 2GDEH 1QGFA 1BITA 4OS6A 1O3PB 1TGCA 2XYAA 2ZHDA 3CS0A 3DA9B 2D2DA 2G81E 1C4Y2 1EPTC 2BY8X 5H4IB 1BTXA 2AMDA 1C5XB 4FUHA 2V0BA 1O5CB 1OWEA 3TLOA 3SNDA 2IOTA 2B5TB 1GCTC 4IN2A 5FX6A 4CH2B 5IDKA 1DM4B 4Y8ZA 4UFEH 3LGVA 1DUAA 1GI0A 2W26A 4JK5A 1P2QA 1THPB 1EAUA 1HXEH 1GVLA 1NTPA 2ASUB 3DFLA 3T26A 3VPKA 3BTDE 2FOHA 2H1UA 1HLTH 3PB1E 1WYKA 1SI5H 2Y5FA 2BQWB 5J4QA 1Y3XA 3HK6B 3LDXH 2O8UA 4MNXA 1KLTA 3E91A 2ZFPH 1EP6A 1S82A 4GLYA 1Z7KA 5CHAC 1C5OH 1SGIB 1V2ST 1SQOA 1XMNB 3VB6A 1LHDH 2ZFSA 5E8EH 1EASA 1YCPH 5C2ZA 3ATMA 1UTJA 1L1JA 1E38B 5LPRA 1DT2A 1ZGVA 4YT7H 3UWIA 1YPHC 2XWAA 3QLPH 4ZXXH 3L6PA 3U8OH 3SU2A 3BV9B 1CHGA 3KF2A 2FO9A 1ETSH 3A7VA 2EI6A 1NRNH 2A5IA 2FOBA 1AO5A 2FS9A 1ZYOA 1T32A 3V12A 2VNTA 1HXFH 1QRXA 1RTLA 3BG4C 1G36A 3H5CB 1BRUP 1VITH 3OYPA 1IQFA 4NFFA 3SV8A 1FY1A 5C1UA 4KTSA 3VGCC 4INHA 4OS4A 1KYNA 1Q3XA 3PMHB 1DXWA 4MNYA 4Y6DA 1O5GH 3BSQA 3M7TA 1N6XA 4XBDA 4Y79A 2ANMH 2PUQH 3NKKA 4D76A 1F5LA 1TAWA 4ZMAH 1AI8H 3EDXB 2UUFB 4U01A 1EXFA 1O2OA 2FOGA 1THSH 1ZHMA 1GMCF 1LCYA 2C90B 1OWHA 1JMOH 1T4UH 3SJIA 4BXWA 2V35A 3TGKE 1SGRE 1SQTA 5E0JA 1ZMJA 2QGRA 1W10U 3PWCA 1N6YA 1Z1JA 1WV7H 1LHGH 1T8NA 5EPYA 1O0DH 1FV9A 3SJ9A 1GBJA 3QUMP 2ZU4A 1LPKB 2R3UA 2Z9LA 3RXHA 3MO9A 2Y80A 1BZXE 2PTCE 4IBLH 1TGNA 1ELTA 1S6FA 1HJAB 4BAKB 2VGCB 4HFPB 2OD3B 3ZVBA 1HFDA 2A7JA 2P94A 1O3DA 1UHBB 4H6SB 1P0SH 4YT6H 2HPPH 2EA3A 1HJ9A 3ZVCA 1V2OT 1O3OA 3A8BA 3MHWU 2ZQ2A 2A5AA 1GI8B 3BTFE 4AFQA 2BQ6B 3TJOA 3QTVH 2GCHF 5GCHG 1TNKA 3UNQA 9ESTA 1BB0B 1E37B 4VGCB 4K1SA 3A7TA 1YGCH 1G30B 3K2UA 3A7XA 3ODDA 1P09A 3RUOA 4MPVA 5TCCA 3MU1A 1B7XB 1NFXA 1W0ZU 4RKOB 1QJ6B 1NFWA 3F1SB 3TGIE 1GJCB 1O2JA 2PUXB 1CVWH 1GBBA 2QYIA 3FFGA 3S7HB 1AQ7A 1Y5AT 1SPJA 2I6QA 4CREA 2IN2A 1RGQA 4X8TH 3ATIA 1VITG 3MFJA 5A8YA 1SC8U 2O8LA 1IHTH 1DUEA 1O2UA 1KXDA 3BTGE 1DOJA 3HPTB 3F9HA 4FUJA 2ZNKH 2VVVA 3UNSA 1QB9A 1QRZA 1KXFA 3E6PH 5E2OA 2BM2A 5EW2H 1Z6JH 2AYWA 1ZTKA 1UHBA 2A1DB 4IC6A 1CGIE 1YBWA 4X0WU 1SLUB 1PQ7A 2VWMA 4FUEA 5EW1H 2G4TA 1GJDB 1UJ1A 4BTUB 2UWLA 3RXBA 2FODA 1FPCH 2HNTE 1QBVH 2P3FH 1H8DH 2F9PA 1P3EA 2ZDMA 1QL9A 3B9FH 2VVUA 3OTJE 2VWLA 7ESTE 4KP0A 1NRPH 2BD5A 3I77A 3RXTA 4BANB 3RXVA 2G00A 3R3GB 1V2LT 2AIQA 2ZTYA 4Y8XA 2R3YA 1MKWK 3P8GA 1TPAE 2SGAA 4WVPE 1DY9A 5EQRA 2OC0A 3RM2H 1E34B 1FMGA 3KGPA 3ESTA 2TBSA 2FX6A 2PKAA 2V3HH 4K8YA 4K3JA 3NZIA 4X1NU 1ACBE 1FZZA 2F9BH 1RJXB 3K6YA 3UQOA 4B2BA 2V3OH 1J16A 1IQEA 3AAUA 3M3VA 5C1YA 2NU4E 1FY3A 1AU8A 1AZ8A 3QTOH 1SHYA 1HJAC 1OXGA 1C2DA 2VGCC 2PSYA 1ESAA 2CN0H 3BTME 3F9GA 3VXEH 1RIWB 1D6WA 2Y5GA 3UOUA 1LVYA 1SQAA 1BUIA 1IQIA 1SLVB 1CGJE 1KXCA 4X6NA 1WBGB 1GI5A 3GY6A 1O2HA 3SNEA 3ZZBA 2ODPA 5DG6A 4I33A 1C5SA 3QN7A 1ZJKA 5F6MA 3UNRA 3PO1B 4DCDA 3EYDA 2VWNA 2RCEA 1DWCH 3KNXA 2WV5A 3MI4A 1TRYA 2XW9A 5C20A 4VGCC 1EZUC 1OP2A 3MNXA 3SU3A 1P2KA 1DSTA 4YLUA 2BMGB 1FAXA 2Z3CA 4KTCA 1SGFA 3U1IB 1TNLA 1O3CA 4NWKA 3TJVA 1O3HA 3JZ1B 4A6LA 2HNTC 2NU2E 2BX3A 1F0TA 2QF0A 5C3NA 3TNTA 5HGGA 2FYQA 1ANBA 3ZYEA 3A7WA 1UCYH 3LGIA 3NXPA 2Q1JA 2ZGHA 1SL3A 4NG9H 1P05A 2GV6A 1PPFE 3B23B 1Y8TA 1MTNB 2R0KA 1Y3UA 1AKSB 3LC5A 3A87A 1OWKA 4D7FA 1FY8E 3BIUH 4ZKSU 3UREA 1OX1A 1D3PB 1DSUA 2M5TA 4ABEA 4MPXA 4NIYA 4H42U 3M3SA 2Z3DA 4I8HA 2ZHEH 3BEUA 2VIPA 1MU6B 1EKBB 1FIZA 1GBEA 1V2TT 1EAWA 5FBIA 5JPMH 1VZQH 1O3GA 2JKHA 1UVTH 4A1TA 3ZZDA 4AB9A 1YLCA 3E0PB 3KQDA 2F83A 4QT8C 2FTLE 2AIPA 2WPJS 3M5LA 1YPJH 1C9PA 2BDCA 1NFUA 1QQ4A 4GHQA 1HNEE 1F0UA 1LVBA 3LGWA 4K60A 1AZZA 1GI1A 4ABGA 3K6ZA 1GBDA 4WMDA 5BRRE 1GMDF 1C2KA 2J95A 4DT7B 2D26C 3GDSA 3TK5A 4ZXYH 1UVUH 3DD2H 2WPHS 3KL6A 1MZAA 1O34A 2ZZUH 4YO9A 3NCLA 1AUTC 3M7UA 1P2OA 1QY6A 1RIWC 1CT2E 1GJ4H 2D8WA 3O8BA 3MNCA 5AVDA 3P8FA 2P93A 2BD9A 1DDJA 3UTUH 1P57B 1BHXB 1C1MA 3RC4A 3TITA 3EE0B 1W2KH 1NS3A 2J4IA 3PO1C 4AGJA 3RXGA 2FI3E 3RXPA 1NROH 3E8LA 1O3FA 2GTBA 4D9QA 2ESTE 1AWFH 1W3CA 4OS5A 1C4V2 1HCGA 3SGQE 3BTEE 1ELGA 3O8DA 1Z1IA 4OS1A 2AS9A 3UIRA 1Y5UT 1UVPA 2B0FA 2LPRA 2OTVA 2XXLA 3PYHA 3BEIB 3V0XA 3RXQA 3ZZ7A 1GMHF 1K1JA 1WUNH 4F49A 2BB4A 4FVDA 2ILNA 2ZA5A 1K1NA 1O2SA 1O3KA 4IS5A 2UWOA 3BN9A 1NESE 3GDVA 3DUXH 1P2MA 3LGUA 3OU0A 4TWWA 3U8TH 1GHAF 1TBRH 2GV7A 3SI4H 5L2ZH 1AE8H 1VCPA 2FYRA 3SV7A 1SGQE 2Z7FE 2WPLS 3A7ZA 2FOMB 3M5OA 4K1EA 3RP2A 2EI7A 1K1PA 2ZFQH 3ZZ8A 2OP9A 2ALVA 3T25A 1GVKB 1ELBA 5GDSH 2P59A 5LH8A 2C8WB 1CA0B 2CF8H 3ZZ6A 3T5FH 4DOQA 4WWYA 2VU8E 2CV3A 1UTOA 3BIVH 4O9VA 3BTQE 1SLWB 2OC7A 2XBYA 1S0QA 2FESH 1TGSZ 1KSNA 4O03A 1KLJH 2WUCA 1C1NA 1EPTA 2Q6GA 1C5PA 3SORA 3P17H 2ZU2A 3PTNA 4FU8A 4Y0ZE 2W7SA 3L33A 3KHVA 4INLA 1P03A 5A0AE 4B74A 5JBCS 1W7GH 3QX5H 3LIWA 1LQDB 2YNAA 1N1LA 1HJ8A 3O8CA 4X1RU 2QF3A 4A7IB 2OINA 1GMCG 1BBRE 1HDTH 3SBKA 1MQ6A 1GJBB 1UCYE 2FI5E 3F6UH 2HLCA 1ZRKA 1BRAA 5DJ7A 3D49H 4J1YA 5J4SA