2QXGA

Crystal structure of human kallikrein 7 in complex with ala-ala-phe-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-7
total genus 53
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA02
3TIUA 4NIWA 2BQ6B 3MH6A 4UFDH 1ELEE 2BDHA 5T3HA 1IHTH 3SOSA 1GI0A 4DURA 1ESTA 2ZU1A 5FCKA 2CJIA 1EAXA 1CA8B 1GG6C 4U32A 3UR9A 1L4ZA 5AHGH 1TNGA 3TK5A 1G3DA 3SU2A 5DG6A 2FP7B 3RXDA 3S7KB 4DJZB 1RRKA 2FOGA 4MPWA 1HJAB 1ZPBA 4RKJB 2AEIH 2NU0E 2PLXA 5T6FA 4ZHMU 1BITA 1HJ9A 1QQUA 4LZ1H 1GHXH 4IC6A 4ASHA 3BTWE 1ZR0A 1GWAA 2GMTB 3QUMP 2VVUA 4UEHH 1A2CH 2GVFA 4GCHF 2C90B 1S0RA 3TH4H 4K69A 3TJOA 1A3EH 3IWMA 1SQAA 3QLPH 4MTBA 5J4QA 1TMUH 5A0CA 1O34A 4WMFA 1NPMA 1GI8B 1LHGH 1C2JA 4F49A 1KIGH 4IW4E 5E0JA 4D76A 3PWCA 1Y8TA 2M5TA 2FODA 2FX6A 2Q6FA 3A86A 4UE7H 3M3TA 2G52A 2F9OA 4MVNA 1EPTB 4E7NA 5GDSH 2QF0A 3UQOA 1W3CA 3FZDA 3GCTG 1YCPM 4JYUH 1TAWA 3ZZ8A 3ZYEA 2ILNA 3B23B 4WMEA 3U1JB 1BTPA 3RLWH 4A1TA 1K28D 3D65E 2LNCA 1O2OA 4R0IA 1X7AC 1ARBA 2A5IA 2VWOA 1XUKA 3MNCA 1GGDB 2PV9B 4TY6A 4MNYA 4X1QU 3MNXA 1IQJA 1TQ0B 1O30A 3LOXA 4WWYA 2FIRH 4NIVA 1KXBA 2ODYB 1BBRK 3RC6A 1HAZB 2WPKS 1FZZA 2PTNA 4DGJA 4K8BA 4X6OA 2XRCA 1GJ9B 4YLUA 1O0DH 1JWTA 2FLBH 4ISLA 1UK3A 2XWAA 1Q3XA 1YPHE 1P2OA 4BAOB 1NFUA 2WPMS 4Q7XA 5JDUB 2ZFPH 1O31A 3TH2H 4D7GA 2NU1E 3RXKA 3HK3B 3F9HA 2UUYA 3UY9A 2GMTC 3BSQA 3RXSA 1SGNE 4RSPA 3GY7A 1VCWA 1UTQA 3UTUH 3UWJH 1Z8JB 1C2IA 4HZHA 4KKDA 2SGEE 1LKBA 2W26A 3LDXH 1JRSA 1CBWB 2ZPQA 3M35A 2DE9A 2FM2A 2PHBA 4IS5A 2BD7A 2R2MB 1NS3A 1TGTA 4Y7BA 1L1NA 3SI4H 2WPHS 4TWWA 2FZZA 3QTOH 1D9IA 1SGDE 1UTLM 1SGYE 1BA8B 1LKAA 4DIIH 2F9PA 1C5WB 4FXGH 2VJ1A 2C8YB 4CRCA 4GUXA 1B5GH 1ELDE 1FN8A 1O2QA 1BHXF 1Y5UT 1OOKB 1ELVA 1WU1A 4YTAA 3SNBA 3SO3A 4BANB 7KMEH 1JIRA 5EQSA 8LPRA 9ESTA 1QRWA 2P3UB 3SZNA 2A32A 1TGNA 1BRCE 1FLEE 1O2NA 1LVBA 4ZHAA 3ZV8A 1GVKB 2ALVA 1GVLA 3K2UA 1KXAA 2ZFTA 2HWLB 1LO6A 1NN6A 3DUXH 4WH8A 4YESB 1C2EA 1AIXH 2BVXH 4H42U 1LDTT 2H5CA 2BD9A 3A89A 2V6NA 2GKVE 1AU8A 4LOYH 3P95A 1O5FH 4LZ4B 1TE0A 3V13A 1T8NA 1V2JT 3C1KA 1O37A 2RA0A 4MPVA 1C1QA 3M37A 1XUFA 4Q80A 1KSNA 2OC1A 1P9UA 3RXTA 4FUBA 2BD2A 2QY0B 3RXCA 1C1TA 3MO3A 1YPLH 1DY8A 2UWOA 2PSYA 1QFKH 1O5EH 2VWLA 3TGIE 1THRH 3H7OA 4GCHG 2V3OH 1JRTA 2BDCA 2FOEA 5E2PA 2GCHG 1MKXH 1G3CA 1DOJA 2PUXB 1AKSB 4X8UH 2G8TA 2P94A 4JZIA 1C5PA 5DP8A 3QTVH 5F8ZA 1TIOA 1S0QA 2ZHWH 1O2WA 1O2MA 1TA2A 1DSTA 4OS2A 5E8EH 1XVOA 4DCDA 3M5OA 1TWXB 1DY9A 1YPGH 5EQRA 3UOPA 4B71A 2P16A 4XE4A 1QRZA 1EZSC 2OP9A 1P11E 3PV4A 2QYIA 4HTCH 1G2LA 1C1OA 1QTFA 2GZ9A 3SQHE 3LGTA 3RDZA 1B0EA 4J1YA 1TBQH 3M5MA 2GV6A 2BHGA 2FI4E 3A8DA 3T5FH 2VGCC 3MHWU 1N6XA 4BXWA 1ZHPA 2HLCA 1HLTH 3MI4A 2GCHF 5G4BA 1V2TT 1YPKH 2VIVA 2XCFA 2ZI2H 1HIAA 1PYTD 3KIDU 1WOFA 2ZHDA 4D7FA 2ZU2A 1LPZB 2WUCA 2EEKA 1O38A 3UNSA 1XMNB 1F5KU 1MTWA 2Q6DA 2VIOA 2XBXA 3MH7A 3D23A 5JYIA 2G5NA 1FNIA 2PKAB 2R9PA 2ZZUH 3RMMH 1DLKB 4OS6A 3F9FA 1DXPA 2JKHA 2RG3A 3GY2A 3PWBA 2D2DA 2G5VA 3O8CA 3RXQA 2GGVB 5EGMA 5CHAB 2QF3A 4MNWA 3A7WA 1T32A 4CRGA 1SGCA 3JZ1B 3NK8A 4AFZA 7GCHF 3U8OH 2BY8X 3JZ2B 2W7SA 3LH1A 4ZAEA 1GBAA 4IMQA 1TLDA 1IAUA 4FUDA 1SQTA 3ZZ4A 1CGJE 1W13U 2A5KA 3STIA 3KHVA 4Y79A 1O5DH 1Z7KA 2PUQH 4X6MA 1NRRH 1C2MA 3VPKA 5F6MA 5HYOA 1T8LA 4ABDA 2ZTYA 3HKIB 3A8BA 4NA9H 1V2NT 1NM6A 4J2YB 2FDAA 4BAMB 2XCNA 4O9VA 5AF9H 3KQEA 2W3IA 2ZU4A 2GD4B 4MQAA 4AGKA 1TGCA 3ZZDA 1C9TA 1DM4B 1F5LA 3V0XA 1F92A 2ASUB 5TCAA 1CSOE 4K1TA 2F9BH 2XC0A 4DIHH 3A88A 1CA0B 1GDQA 4CH2B 4THNH 1UJ1A 1OSSA 3QZRA 3D49H 1V3XA 1UTMA 2BY7X 4K1SA 1P03A 1XUJA 3BTDE 2BZ6H 1WQSA 1YLCA 1UK4A 2VU8E 1A46H 1O3HA 1O3EA 1UK2A 2F83A 2ZGXH 1NRNH 5AFZH 1HPGA 1DPOA 1YPJH 3QGNB 3T62A 3RXUA 3VXEH 4D9QA 4NSYA 5FBIA 1BTWA 4Z6AH 1Z71A 1MUEB 1BB0B 1AN1E 5L2ZH 1MCTA 1VITH 2Y6TA 3SUFA 1YCPH 1SHHB 1OWIA 4MNVA 4WY3A 2FXRA 3RXFA 3BTGE 2SGPE 3ZVBA 3IG6B 1GHBF 4K8YA 3SGBE 1FY3A 3SJKA 3LH3A 4WXIA 5EXLA 1EB1H 4BXSA 4YOGA 3F68H 1Y5BT 3LPRA 4INKA 2QV1A 4CREA 2A7HA 1ZTJA 2ZFSA 3AASA 3HGPA 1TX6A 4I31A 1EB2A 1VJAU 1VZQH 1P05A 5DPAA 4VGCC 2J2UA 2CV3A 1OWEA 3VXFH 3ZZ9A 2ZHFH 4B2AA 1C2FA 1V2QT 3A84A 3BTME 1LPKB 1LTOA 1GPZA 3DT0H 4ZXXH 5T6GA 3RP2A 1GBCA 1P3EA 1LQDB 1TNLA 3MU0A 2H5DA 3SGAE 1V2RT 1K22H 4BAHB 5EOKA 1HUTH 4R8TB 4JK5A 2FOMB 2BD4A 4MNXA 2CMYA 4A6LA 1ETTH 3U98H 4Q7YA 4A5TS 2DUCA 2VWNA 3U69H 2OXSA 4YT6H 1PYTC 2B7DH 1OP2A 2ZHQH 2BD3A 4X2WA 2ZTZA 1Z8GA 1WSSH 5EW1H 4OGYA 1C1UH 4SGBE 4Y0ZE 1O2LA 1S82A 3PMJA 1E35B 1DANH 3GY5A 5A0AE 1MH0A 4H4FA 1MU8B 3KNXA 1EAWA 3BIUH 1DSUA 2GT8A 2ZFFH 1MTUA 2KAIB 4WF8A 3RXVA 1C2DA 1AZ8A 3L33A 4K5ZA 3A7XA 5DGJA 1SBWA 2PKAA 2Y5HA 3SU1A 2TGPZ 5EPYA 1A0LA 1QB9A 1DDJA 1KTSB 1ABJH 4UFGH 1MAXA 1BBRH 3ZYDA 5C3NA 2BDBA 5DP3A 3HGNA 1A5HA 3BTEE 3UPEA 1QHRB 3BV9B 3GCNA 1HJ8A 3M61U 1J14A 4BTTB 3G01A 3ODFA 1GHYH 3K65B 2GX4A 4ABFA 5C20A 2JH6D 1AWFH 2GCTC 2YNBA 2WYJA 3KF2A 3FVFB 4Q7ZA 3VFEA 3UQVA 3M5NA 5HGGA 3P17H 3FFGA 4E06H 3SJIA 5DKMA 4XBBA 3EDXB 1V2KT 2I6SA 3TK6A 5TJXA 1GCTB 5GXPA 1EJNA 3L6PA 1O2TA 2ZDMA 2TBSA 4WVPE 1QURH 1NZQH 1HBTH 5EPNA 1P2MA 1K9OE 3HKJB 1QJ1B 1T8MA 2FESH 1EAUA 1HRTH 1SLXB 3W95A 1DITH 1VCQA 2VIPA 4TYDA 2GZ8A 4NWLA 3GY6A 2FO9A 1LQEA 1BTXA 4X6PA 1F0SA 3TNTA 5L6NH 2IOTA 2EC9H 3RMOH 3V3MA 5LGOA 3F9EA 1O3NA 5HM9A 2WPIS 1YF4A 2CXVA 2J95A 3RXBA 2O8TA 2WYGA 1KXDA 3S69A 1RD3B 5EW2H 3H7TA 1KLIH 3LT3A 2BY6X 4AGJA 1D3TB 1HNEE 1J17T 3BN9A 2C8ZB 1YBWA 5C1XA 1TRMA 3E16B 1BZXE 4Z0KA 4BTIB 1PPFE 4UD9H 7LPRA 2WUBA 2O8MA 3M3VA 2TGDA 3GY3A 1TFXA 1EATA 3QGJA 1O5BB 1T4VH 4I33A 4JMYA 1DICA 3A7VA 5DP9A 1H1BA 4JYTA 4AG1A 3LGVA 4KGAA 5FXLA 2QN5T 3R0FA 1D6WA 1J16A 3SU6A 1C1SA 2ZU5A 4I32A 2LPRA 2XXLA 1O5CB 1AE5A 1S81A 1Z1JA 4INHA 1KXEA 1TMTH 5HXFA 4JZFH 2VH6A 3TJVA 1HFDA 1O32A 1O2VA 1U6QA 5GCHF 4ZKSU 3TNSA 3O8RA 1DLEA 3HATH 1G36A 4NSVA 4DOQA 3VGCB 3V12A 3TK9A 8GCHF 5FCRA 2SGQE 1FQ3A 3LC5A 1NT1A 1YPEH 2UUJB 3TITA 3U8TH 2QAAA 1SLWB 4ZKOU 1EQ9A 2OBOA 1GBJA 1C2HA 3SHCH 4B76A 4I8LA 1C4Y2 2Y82A 2FYRA 1AVGH 2O8WA 3OY5U 2Z3DA 1ELGA 1SG8B 1HXEH 1P2IA 2BOHB 4O3TA 3GCTF 1UTJA 4B75A 1TNJA 2A45B 3TLOA 1RIWC 1PQ5A 2ZCKP 2HOBA 3QWCH 3RMLH 4RN6A 3W94A 4OS5A 4YZUA 2J9NA 2PSXA 2ZG0H 3SJ9A 2AGGX 3V7TA 4ZHLU 4JK6A 3SU5A 1NTPA 3BEIB 1YPMH 4B2CA 2HNTF 4AFSA 1GI5A 1P01A 2G00A 3PMAB 1KTTB 1K21H 4NIYA 3SU3A 1ZRBA 1TA6A 4MPUA 1SVPA 1H9HE 3HPTB 1VGCB 1RTKA 3GY4A 1WAYB 3VB3A 5C2ZA 2TRMA 2W5EA 2H6MA 1S6HA 1TPSA 2BQWB 2EI6A 2ZNKH 3A82A 8KME2 2FPZA 5LH8A 1ESBA 1PQ7A 1GMCG 1T7CA 4Y0YE 1OWHA 1RTFB 1HCGA 2GT7A 4Y10E 1C5TA 4TPYA 1ZTKA 4DG4A 4I8GA 5GWZA 5TCCA 1WYKA 2ODQA 2ZQ2A 3I29A 4E7RG 2QC2A 4ABBA 3K6ZA 3A80A 1SB1H 1TONA 4Y6DA 4X1NU 1ZRKA 4JZEH 3SNDA 2PKSC 3EA7A 2P8OB 1P2QA 3LIWA 1TPOA 1YLDA 2B8OH 2H9HA 2ZDLA 3EGKH 1SGFA 1C2KA 4U30A 4X1PU 1PPZA 1QR3E 3C27B 1PPEE 2O8UA 2XYAA 4HFPB 1FPHH 1UHBA 1XKBC 3T2NA 3GCHB 2ZPSA 4FVBA 3Q00A 1O2SA 4Y8XA 4GLYA 1Y3WA 3K6YA 5C1UA 1IHSH 6GCHG 1HIAB 1FAKH 3E8LA 1AHTH 2NU3E 2RCEA 1ANCA 1IQKA 1FI8A 4RKOB 4JYVH 5C67A 1G2MA 1N8OC 2AMDA 3ODDA 4CR9A 5E0HA 2P3TB 1PQ8A 5EU8A 3CENA 3MWIU 4ZROA 4KELA 3SN8A 3P8NA 1ZTLA 4F4OC 1RFNA 2QXJA 4K2YA 3LONA 1O3DA 1IQFA 1EOJA 1NFYA 1TQ7B 1VCPA 2OD3B 2ZHEH 4CRFA 1SC8U 3MO9A 3PMBB 4OS1A 3U1IB 1GI4A 1UO6A 3F1SB 1TOCB 1MKWK 1A3BH 4NZLA 1UCYE 4I8HA 3SHAH 1VITG 2BDYA 1YYY1 3BEUA 2Y81A 1AE8H 1A4WH 1GJ4H 1W8BH 3OY6U 1GMHF 1CT4E 1W10U 2BMGB 1ETRH 1DWDH 2RA3A 1MQ5A 1HAXB 1P3CA 1BCUH 3FAOA 1OYQA 4AYYB 3KGPA 4DT7B 2Z9LA 1O2PA 1THPB 1NROH 2SGFE 1C5XB 1UHBB 1H9IE 1GJ8B 4ABHA 1O36A 2O9QA 3T28A 1QIXB 1KDQB 3PROA 1LHEH 1ZGVA 1W0YH 1TX8A 4YOIA 1BTUA 3OSYA 2BM2A 1OKXA 4XSKU 4HGCA 1T4UH 1BT7A 1XUHA 1EP6A 1SPJA 2Y7XA 3D62A 1SOTA 1GBLA 1V6DA 4OS7A 1W14U 1GI7B 1Y3XA 1YP9A 1GMHG 1MBQA 1LVMA 1GHBG 2BZAA 3M3SA 4NWKA 3SV6A 1OWDA 4Y7AA 3NZIA 3LKWA 1UTNA 3NXPA 3PB1E 5I25A 1MAYA 1H8DH 2CF9H 1E37B 1O3AA 4U2WA 1CQQA 1OWKA 3T27A 2Z3EA 4Q2KA 1BRAA 1CBWC 3RMNH 4IN2A 3ELAH 5DP6A 3NKKA 3MYWA 1CHOF 1QL8A 2FOAA 1NRPH 2Y80A 5SGAE 3ATMA 2R0KA 1HAVB 3RC5A 3GDVA 2UUFB 3Q76A 2ZO3H 3M7TA 2BY9X 4XBCA 1PQAA 1RS0A 3NWUA 1XXDA 1AGJA 5EXMA 2AMPA 3TGJE 1SL3A 5DO4H 1ZZZA 2ZCLP 3KEEA 1HAYB 2ZDNA 3BTFE 3ENSB 3S7HB 1E0FD 4XDEA 5AFYH 2F3CE 1P57B 1CT2E 2VIWA 3MU1A 1K1NA 2AERH 3A83A 5DP7A 1EZXC 1O2HA 1TNKA 1QNJA 2STAE 1NU9A 2ZWLH 1O3KA 3RM0H 1GMCF 3A7ZA 1FIWA 3E6PH 3SUEA 1J15A 1SI5H 5JBCS 1AMHA 1JOUB 3EE0B 1K1PA 2KAIA 3PO1C 7ESTE 2ODPA 3RU4D 4K60A 2ZDKA 2AMQA 1C5LH 5JBAS 1TPAE 1EP5A 1QQ4A 1NRSH 2WINI 4AB8A 1PPGE 2Y5GA 7GCHG 1PJPA 3RU4T 1O2RA 1EJMA 1O3OA 1GJ5H 2JETB 5ETXA 2Q1JA 4M7GA 1GCDA 1NESE 4BTUB 1O3MA 4JZDH 2VGCB 2OQ5A 1DFPA 3AAVA 3P8GA 3SNCA 1ZMJA 4K3JA 3FP7E 1O2GH 3GOVB 4Y71A 3TPIZ 4ZH8A 4Y11E 2ZC9H 2RDLA 4CRAA 2C3SA 1DWEH 1AKSA 2YOLA 5A0BA 1UVUH 2NU4E 1ZLRA 2P59A 1RXPA 5JB9S 1O2XA 3E1XB 2CHAB 3F6UH 1P02A 1OP0A 1EPTC 4KTSA 1GJCB 1J8AA 3I77A 3PLPA 1V2ST 1DVAH 1ORFA 1AVXA 1UVPA 4DVAU 2A2XH 4AX9H 1HAOH 4A1XA 5HMAA 2J34A 3PLKA 5DP5A 1MQ6A 3SUDA 3LJJA 4NGAH 3RXPA 2G51A 1QGFA 1CVWH 2XNIA 5PTPA 3RM2H 3UNQA 4ZXYH 1ELBA 2XC4A 1GI3A 2ZFRH 1MCVA 3O8BA 4BNRA 1O33A 1EAIA 1EJAA 1HJAC 3LGWA 2D1JA 2QGRA 3A85A 1SGPE 5AVDA 1ACBE 1NU7B 1OYTH 1W7GH 2GZ7A 1JIMA 3QN7A 4KP0A 4D8NA 1JBUH 3SV7A 1QRXA 2EI8A 3KN2A 3RXEA 4GHTA 2HGTH 4XBDA 3PLBA 1NC6A 2VVVA 2HNTE 2ESTE 2CF8H 1IQEA 1O2ZA 1QA7A 2Z9JA 2VIQA 3MO6A 2OQUA 1Y3UA 2FMJA 1P10A 1FMGA 1SGFG 1YKTA 1OWJA 2TGTA 4ABJA 1YGCH 3Q77A 2BDIA 1E36B 4FUCA 1AWHB 1O3JA 3URDA 2AYWA 2ANKH 4A7IB 1C5VA 2FS9A 2A4QA 2Z9IA 2OBQA 8ESTE 1O5AB 4X6NA 3AW1A 3PMHB 3ITIA 4ISOA 4CBOA 4AG2A 1J9CH 1GBTA 2J38A 1SGIB 2BOKA 5GIBA 4A1VA 1WTHD 1FN6A 2R0LA 3Q3KA 1TMBH 1NFWA 1NRQH 4UDWH 1W2KH 1FDPA 1VJ9U 1O2KA 2W7UA 1OP8A 4JCNA 3SGQE 1MD8A 3NPSA 4FU9A 2CN0H 1P09A 1Y5AT 3SI3H 2FOCA 4QT8C 1MKWH 3QDZB 3TH3H 3WY8A 3TJNA 3QO6A 4X2XA 5GCHG 4O03A 1KXFA 1YM0A 4U01A 4BAQB 3OX7U 4OS4A 3B9FH 5A2MH 8GCHG 1TNIA 1BUIA 3M5LA 3SORA 4D9RA 1P8VC 3E3TA 4AN7A 1A7SA 1UCYH 1NY22 4WH6A 1S5SA 1GBMA 1ARCA 1C1WH 1CHGA 4ZMAH 4BOHA 3BTHE 1AQ7A 1D6RA 5FPYA 2OC8A 3ATKA 1RGQA 4IBLH 3U9AH 2BLVA 2R3UA 4FUFA 4AZ2B 2Z7FE 1V2PT 5E2OA 2Y5FA 3ATIA 1K1MA 3R3GB 1KXCA 3VB7A 2H1UA 3RXAA 2TGAA 5H4IB 4WMDA 1HXFH 4YO9A 2C8XB 3NCLA 1V2UT 1C1VH 1MZAA 1GJ6A 1RJXB 1OPHB 2BDGA 3SU0A 4ISIH 3MTYA 1BMMH 1V2WT 4B2BA 1SLVB 3UOUA 3BF6H 2BDAA 1ABIH 4FUIA 4DY7B 1SQOA 1HB0B 1QB6A 2CHAC 4NA7A 4X8TH 1Z6EA 2TPIZ 2Z3CA 1L2EA 2ZDAH 5A8ZA 3KQCA 1TGSZ 1GJBB 1TBZH 1TRYA 2YNAA 1BMLA 1XX9A 1GGDC 3RUOA 2ZTXA 1WV7H 4ZKNU 1LVOA 2VH0A 1S85A 3ZVFA 1UTPA 3MH4A 1BRBE 3LGUA 2ANMH 4TY7A 2SNVA 1EUFA 2FYQA 2JETC 4A92A 2Z9KA 3KQBA 4B74A 2EA3A 4UONA 3VB6A 1Q31A 1PPBH 2BVRH 1SR5C 5IDKA 2G4UA 3PO1B 2XW9A 1C5OH 2ULLA 1C2LA 1FPCH 2AIQA 1ELFA 2ZGCA 3BTKE 1AUJA 1ZMNA 1MZDA 4CRBA 1IQHA 2QXHA 3S0NA 3OTJE 3DFLA 2BB4A 3RXLA 1L1JA 2PGBB 3ZVDA 1HV7A 2VINA 2H2ZA 3UWIA 1KDQA 3P92A 3ZZ3A 3STJA 1TPPA 1QB1A 3DA9B 5CE1A 1HAVA 2PWXA 1GL0E 1UVOA 3E0NB 2AH4X 5A8YA 1LCYA 1MKXK 1ZPZA 1ANDA 2A4RA 1KY9A 1RIWB 2ZA5A 2BXTH 1K1JA 1LHFH 3GDUA 2GDDA 4NCYA 1C1MA 5LPRA 1Y3YA 1SHYA 1ZSLA 1GI1A 1C5MD 5LPFA 1DWBH 3GCOA 3N7OA 3CP7A 2A5AA 6CHAB 2PR3A 1FY1A 4CH8B 3CS0A 4ISHH 1ZPCA 5EG4A 4ABAA 4I8KA 1D3PB 3SV9A 1ANEA 1MBMA 4I8JA 1GG6B 1BBRE 4IC5A 1F7ZA 2QA9E 2XBWA 1ZJKA 2FS8A 1TX7A 2PW8H 3B8JA 3FP8E 5C1YA 2VB0A 3RXGA 1AB9C 3MU4A 1MTSA 4SGAE 1WTGH 3DFJA 2Y7ZA 4JZ1A 3SBKA 2HPPH 3SNEA 3U8RH 1VITF 3BTTE 1H4WA 4CR5A 2P93A 2D26C 2CGAA 5ESTE 1XXFA 1Z1IA 2FEQH 3MU5A 4FUGA 1GBIA 3KCGH 2ALPA 4FVDA 1GVZA 4CRDA 3ZVCA 1HDTH 5C5OA 1FY8E 4BAKB 1HGTH 4WJG2 4GPGA 1BHXB 4FUHA 1IOEA 4FUEA 3BG4B 1YCPK 3TU7H 2OC7A 2ZKSA 2D8WA 1QJ7B 1GL1A 1GBKA 3SQEE 4X1SU 1UTOA 1E38B 1IQIA 1O3FA 4I7YH 5L2YH 2BD8A 4CHAB 3P6ZB 1ZMLA 1O3LA 3AVZA 3BG8A 1G32B 3M7QA 3I78A 4NA8A 2Z6BD 1FJSA 1THSH 1Z6JH 3A8CA 3MU8A 1GI9B 5IYTA 1AVWA 2BY5X 1TYNA 2W3KA 1IQLA 1ZYOA 1B7XB 2HVXA 3E91A 3FANA 1Y3VA 1V2LT 5T6DA 5F8XA 1AY6H 1CU1A 1W12U 5JBBS 2FOBA 2AFQB 2BVSH 4ESTE 1S84A 4PROA 2P95A 1GDNA 3VB4A 4GAWA 4YT7H 1SMFE 2A7CA 1AUTC 1EPTA 1CE5A 3SJOA 2AS9A 6LPRA 1DUEA 1G37A 5FPTA 1CHOG 2VNTA 4YM9A 6ESTA 1TNHA 2IPHA 3GICB 2A1DB 1N8OB 1C5NH 1A5GH 2UWPA 3L3TA 4K1EA 3PTBA 4TPIZ 2FX4A 1UTKA 1ID5H 1CGIE 1GHVH 1HYLA 1TRNA 1VR1H 1P2JA 1RTLA 1WUNH 5FBEA 1BTHH 2XBYA 1O3GA 4IGDA 1ANBA 2B5TB 2AGEX 3P8OA 1S6FA 2VVCA 3GCHC 1ZSJA 4X2YA 1Z8RA 4NFFA 1ZOMA 4H6SB 3TVJB 2GCTB 3OU0A 1BJUA 2FLRH 3RXHA 1V2OT 1GJAB 4X1RU 4NFEA 3UIRA 2GDEH 3MOCA 1P9SA 5FPSA 1GDUA 2Q6GA 1GMDG 1QBNA 2P8OC 2PKSB 4GSOA 1KLTA 1QL7A 3EA8A 5ESBA 1SGEE 3K9XB 3T25A 1CO7E 3ZVAA 1K1LA 6GCHF 2PTCE 3UUZA 4MG3A 3EYDA 5JBTA 1T31A 1AO5A 2SGAA 4UFFH 3M7UA 1LHCH 4FUJA 1V2MT 1G9IE 2WV4A 4HI3A 1V2VT 1DWCH 1TABE 1C5SA 1Z8IB 1TALA 1O2YA 1PFXC 3BIVH 1QBVH 2WPLS 2FI3E 1Y59T 2UWLA 2GTBA 1GHZA 2VIDA 2GP9B 3RXIA 1C5RA 1WCZA 1F0RA 2PGQB 5A8XA 2FOFA 2XBVA 1DE7H 3ZZ5A 3TGKE 1C1NA 4E05H 1BOQA 3LGYA 1XVMA 2BQ7B 1ELTA 2NWNA 1VGCC 2SGDE 3ATWA 1SGQE 3F9GA 1YPHC 3FP6E 3ZVEA 1ZGIA 3RLYH 3PTNA 1H9LB 1XM1A 3BTQE 1UVTH 3MNSA 3Q3XA 1IQNA 2OC0A 1D4PB 3A7YA 9LPRA 1EXFA 2FWWA 2ZGHA 4GVUA 4IMZA 5FX6A 2J4IA 3AW0A 1A0HB 1UCYK 3RXJA 1GI2A 1L4DA 1ESAA 2HNTC 3RXMA 1O2IA 2BYAX 4MDSA 1QY6A 3UR6A 1GBDA 3MMGA 4GHQA 4FU7A 2Z94A 1GBHA 2F9VA 3T29A 2WPJS 5GPIB 2VWMA 2XTTB 3P8FA 1N6YA 4XFQA 5CMXH 1O5GH 3S9BA 3RU4E 1BQYA 3ZZ6A 1EASA 1LMWB 1O3BA 1O2UA 1CT0E 2BLOA 4MPXA 4YOJA 3ZZBA 3PYHA 5K0HA 1O39A 3S9CA 4IN1A 1TB6H 2BTCE 1IQGA 3LGIA 3ZZAA 1W11U 1EX3A 1F5RA 1WBGB 1ZHMA 1S83A 1P2NA 1AI8H 2H9EH 5DK1A 4NG9H 1MTNC 1SSXA 3VGCC 2A31A 1MTVA 1ZJDA 3RXOA 4NIXA 4Y76A 4X8VH 2G55A 1GJDB 4ZKRU 1AFQC 3P70B 4CHAC 1W7XH 2ZP0H 3FZZA 1BTYA 3E0PB 1EOLA 5F8TA 2SNWA 2F9UA 2ZGJA 3BG4C 3AAUA 5LPEA 4CBNA 5BPEA 1BRUP 2JH0D 3MH5A 5FHTA 4AOQA 2IN2A 2AGIX 3EAJA 2BD5A 1IQMA 1B0FA 1FV9A 1UMAH 2XC5A 5EODA 2H9TH 2ZEBA 2ANYA 3M36A 1TGBA 3GYLB 1HAPH 1AFQB 1ELAA 1C5ZB 1LHDH 2A0QB 2XWBI 1O2JA 4ZUHA 1D3QB 2SFAA 2TIOA 4B73A 3O8DA 5JPMH 1CA0C 3IITA 1AB9B 2QXGA 2J94A 3UREA 1MTNB 1MU6B 4WXVA 2V0BA 3EA9A 2OCVB 4YLQH 3UNRA 4X2VA 3A81A 3ZV9A 2DE8A 3SUGA 3TJUA 4AFQA 1BMNH 5FAHA 1L1GA 4MLFB 1GJ7B 2AIPA 1FUJA 2ZQ1A 1F0UA 6CHAC 3SU4A 3HK6B 1GBEA 2C4FH 1C5UA 1O35A 5EXNA 2HPQH 1P06A 2B9LA 2BX3A 5C5NA 1O3CA 1G3EA 1MMJN 2ZF0H 1QA0A 5DJ7A 1QL9A 5GJ4B 1CGHA 3A8AA 3KL6A 2Z9GA 3MNBA 1JMOH 2ZDVH 2A2QH 1C1PA 4INLA 1QBOA 1TBRH 1GBBA 5EQQA 1FAXA 1GCTC 1DT2A 3SNAA 3CS7A 1AZZA 2V35A 4X8SH 1C5YB 5J4SA 4O3UA 1WQVH 5CHAC 2QXIA 2G4TA 3T26A 2R2WU 1BTZA 1MD7A 3A7TA 1FY4A 1C4U2 2GV7A 3QZQA 2BX4A 5BRRE 1NO9H 5F03A 3NUMA 1ETSH 1EKBB 2ZU3A 1ELCA 1HAGE 1GMDF 1K1IA 4AB9A 5ABWA 1BJVA 4OGXA 3RXRA 5K7RA 2A4GA 1AD8H 3LJOA 2OLGA 1JXPA 2OTVA 2WV5A 3GYMA 1GBFA 1G3BA 2THFB 2V3HH 2ZCHP 5DP4A 1C5QA 2ANWA 1XKAC 1C2GA 1C1RA 2OINA 4KTCA 1C4V2 2HALA 3QX5H 3OYPA 1H8IH 2G81E 2BXUH 1Q2WA 2IJOB 1HAIH 2I6QA 4ISNA 5HM2A 3VB5A 5A09A 3EQ0H 3GDSA 1A0JA 3SV2H 1OXGA 1DS2E 1P12E 2ZPRA 2P3FH 2BLQA 4UFEH 1DX5M 4ABGA 2EI7A 1M9UA 1GHWH 4H6TA 1O3PB 1O3IA 2HRVA 2FOHA 1HAHH 4AYVB 3KQDA 1N1LA 1GHAF 4KTUA 5E0GA 1BIOA 2QIQA 4ABIA 5I46H 1SGRE 1A5IA 1PPHE 3LU9B 2ZFQH 1LPGB 1FXYA 4LK4A 1K1OA 3LC3A 3S9AA 5FX5A 2QCYA 2A7JA 2PFEA 2O8LA 3H5CB 1EZQA 5JB8S 3QK1A 1FONA 3PM3A 1C9PA 1YC0A 4AFUA 2J92A 3ATLA 1F0TA 2C8WB 4Y8ZA 1KYNA 3SV8A 2A4OA 5L30H 1GI6A 5B6OA 2F9NA 2STBE 1EZUC 1SFIA 1DUAA 3DHKH 2FI5E 2R3YA 3RC4A 2ZECA 2NU2E 1BDAA 4AORA 3BEFB 1DXWA 3GY8A 1ZSKA 1LVYA 1SOZA 4TWYA 1W0ZU 4ABEA 4VGCB 4NZQA 4DW2U 1AFEH 1GHAG 3UFAA 1P04A 2B0FA 4FU8A 1T8OA 3VEQB 1A1RA 3A87A 1D3DB 1FIZA 2UUKB 2ZGBH 3SJ8A 1G30B 2OUAA 1L0ZA 1UVSH 4O97A 4Y8YA 1TOMH 3Q3YA 1OX1A 1PPCE 1SFQB 1ZHRA 4XOJA 3URCA 3ZZCA 2K1QA 3SW2B 1P0SH 3ZVGA 2JH5D 3GISB 1KLJH 1K2I1 1XUGA 1A61H 1P2KA 3ESTA 2F91A 3DD2H 1XUIA 1F2SE 1E34B 1QCPA 1OS8A 2C93B 2BLWA 2ZIQH 1SLUB 1INCA 2FTMA 1QJ6B 3E90B 1BMAA 3MFJA 1NFXA 4LXBH 3ZZ7A 4X0WU 4B1TA 2FTLE 1SGTA 1FY5A
chains in the Genus database with same CATH superfamily
3TIUA 4NIWA 2BQ6B 3MH6A 4UFDH 1ELEE 2BDHA 5T3HA 1IHTH 3SOSA 1GI0A 4DURA 1ESTA 2ZU1A 5FCKA 2CJIA 1EAXA 1CA8B 1GG6C 4U32A 3DCLA 3UR9A 1L4ZA 5AHGH 1TNGA 3TK5A 1G3DA 3SU2A 5DG6A 2FP7B 3RXDA 3S7KB 4DJZB 1RRKA 2FOGA 1E1RD 4MPWA 1HJAB 1ZPBA 4RKJB 2AEIH 2NU0E 2PLXA 3FOAA 4ZHMU 5T6FA 1BITA 1HJ9A 1QQUA 4LZ1H 1GHXH 4IC6A 4ASHA 3BTWE 1ZR0A 1GWAA 2GMTB 3QUMP 2VVUA 4UEHH 1A2CH 2GVFA 4GCHF 2C90B 1S0RA 3TH4H 3F3BA 4K69A 3TJOA 1A3EH 3IWMA 1SQAA 3QLPH 4MTBA 5J4QA 1TMUH 5A0CA 1O34A 4WMFA 1NPMA 1GI8B 1LHGH 1C2JA 4F49A 1KIGH 4IW4E 5E0JA 4D76A 3PWCA 1Y8TA 2M5TA 2FODA 2FX6A 2Q6FA 3A86A 4UE7H 3M3TA 2G52A 2F9OA 4MVNA 1EPTB 4E7NA 5GDSH 2QF0A 3UQOA 1W3CA 3FZDA 3GCTG 1YCPM 4JYUH 1TAWA 3ZZ8A 3ZYEA 2ILNA 3B23B 4WMEA 3U1JB 1BTPA 3RLWH 4A1TA 1K28D 3D65E 2LNCA 4Z1MD 1O2OA 4R0IA 1X7AC 1ARBA 2A5IA 2VWOA 1XUKA 3MNCA 1GGDB 2PV9B 1WDIA 4TY6A 4MNYA 4X1QU 3MNXA 1IQJA 1TQ0B 1O30A 3LOXA 4WWYA 2FIRH 4NIVA 1KXBA 2ODYB 1BBRK 3RC6A 1HAZB 2WPKS 1FZZA 2PTNA 4M9FA 4DGJA 4K8BA 4X6OA 2XRCA 2K8IA 1GJ9B 4YLUA 1O0DH 2K0QA 1JWTA 5CDFE 2FLBH 1H8HD 4ISLA 1UK3A 2XWAA 4F48B 1Q3XA 1YPHE 1P2OA 4BAOB 1NFUA 2WPMS 4Q7XA 5JDUB 2ZFPH 1O31A 3TH2H 4D7GA 2NU1E 3RXKA 3HK3B 3F9HA 2UUYA 3UY9A 2GMTC 3BSQA 3RXSA 1SGNE 4RSPA 3GY7A 1VCWA 1UTQA 3UTUH 3UWJH 1Z8JB 1C2IA 4HZHA 4KKDA 3FO8D 2SGEE 1LKBA 2W26A 3LDXH 1JRSA 3PV5A 5IK2D 1CBWB 2ZPQA 3M35A 2DE9A 2FM2A 2PHBA 4IS5A 3N7DA 2BD7A 2R2MB 4RT0A 1NS3A 1TGTA 4Y7BA 3EE7A 1L1NA 3SI4H 2WPHS 4TWWA 2FZZA 3QTOH 1D9IA 1SGDE 1UTLM 1SGYE 1BA8B 1LKAA 4DIIH 1WXRA 2F9PA 1C5WB 4FXGH 1NBME 2VJ1A 2J98B 2C8YB 4CRCA 4GUXA 1B5GH 1ELDE 1FN8A 1O2QA 1BHXF 1Y5UT 1OOKB 1ELVA 1WU1A 4YTAA 3SNBA 3SO3A 4BANB 4P02A 7KMEH 1JIRA 5EQSA 8LPRA 9ESTA 4OM9A 1QRWA 2P3UB 3SZNA 2A32A 1TGNA 1BRCE 1FLEE 1O2NA 1LVBA 2JJ2D 4ZHAA 3ZV8A 1GVKB 2ALVA 1GVLA 2IJD1 3WWFA 3K2UA 1KXAA 2ZFTA 2HWLB 1LO6A 1NN6A 3DUXH 4WH8A 4YESB 1BMFD 1C2EA 1AIXH 2BVXH 4H42U 1LDTT 2H5CA 2BD9A 3A89A 2V6NA 2GKVE 1AU8A 4LOYH 3OFND 3P95A 1O5FH 4LZ4B 1TE0A 3V13A 1T8NA 1V2JT 3C1KA 1O37A 2RA0A 4MPVA 1C1QA 3M37A 1XUFA 4Q80A 1KSNA 2OC1A 1P9UA 3RXTA 4FUBA 2BD2A 2QY0B 3RXCA 1C1TA 3KQ5A 3MO3A 1YPLH 1DY8A 2UWOA 2PSYA 1QFKH 1O5EH 2VWLA 3TGIE 1THRH 3H7OA 4GCHG 2V3OH 4RI0A 1JRTA 2BDCA 2FOEA 5E2PA 2GCHG 1MKXH 1G3CA 1DOJA 2PUXB 1AKSB 4X8UH 2G8TA 2P94A 4JZIA 1C5PA 5DP8A 5HIZA 4TT3D 3QTVH 5F8ZA 1TIOA 1S0QA 2ZHWH 1O2WA 1O2MA 1TA2A 1DSTA 4OS2A 5E8EH 3ZIAD 1XVOA 1COWD 4DCDA 3M5OA 1TWXB 1DY9A 1YPGH 5EQRA 3UOPA 4B71A 2P16A 4XE4A 1QRZA 1EZSC 2OP9A 1P11E 3PV4A 2QYIA 4HTCH 1NBMD 1G2LA 1C1OA 1QTFA 2GZ9A 3SQHE 3LGTA 3RDZA 1B0EA 4J1YA 1TBQH 3M5MA 2GV6A 2BHGA 2FI4E 3A8DA 3T5FH 2VGCC 3MHWU 1N6XA 4BXWA 1ZHPA 2HLCA 1HLTH 3MI4A 2GCHF 5G4BA 1V2TT 1YPKH 2VIVA 2XCFA 2ZI2H 1HIAA 1PYTD 3KIDU 1WOFA 2ZHDA 4D7FA 2ZU2A 1LPZB 2WUCA 2EEKA 1O38A 2KX4A 1XMNB 3UNSA 1F5KU 1MTWA 2Q6DA 2VIOA 2XBXA 3MH7A 3D23A 5JYIA 2G5NA 1FNIA 2PKAB 2R9PA 2ZZUH 3RMMH 1DLKB 4OS6A 3F9FA 1DXPA 2JKHA 2RG3A 3GY2A 3PWBA 2D2DA 2G5VA 3O8CA 3RXQA 2GGVB 5EGMA 4B6FA 5CHAB 2QF3A 4MNWA 3A7WA 1T32A 4CRGA 1SGCA 3JZ1B 3NK8A 4AFZA 7GCHF 3U8OH 2BY8X 3JZ2B 2W7SA 2WV9A 3LH1A 4ZAEA 1GBAA 4IMQA 1TLDA 1IAUA 4FUDA 1SQTA 1EFRD 3ZZ4A 1CGJE 1W13U 2A5KA 2EQNA 2YMSD 3STIA 3KHVA 4Y79A 1O5DH 1Z7KA 2PUQH 4X6MA 1NRRH 1C2MA 3VPKA 5F6MA 5HYOA 1T8LA 4ABDA 2ZTYA 3HKIB 3A8BA 4NA9H 1V2NT 1NM6A 4J2YB 2FDAA 4BAMB 2XCNA 4O9VA 5AF9H 3KQEA 2W3IA 2ZU4A 2GD4B 4MQAA 4AGKA 1TGCA 3ZZDA 1C9TA 1DM4B 1F5LA 3V0XA 1F92A 2ASUB 5TCAA 1KMHB 1CSOE 4K1TA 2F9BH 4ASUD 2XC0A 4DIHH 3A88A 2V3MA 1CA0B 1GDQA 4CH2B 4THNH 1UJ1A 1OSSA 3QZRA 3D49H 1V3XA 1UTMA 2BY7X 4K1SA 1P03A 1XUJA 3BTDE 2BZ6H 1WQSA 1YLCA 1UK4A 2VU8E 1A46H 1O3HA 1O3EA 1UK2A 2F83A 2ZGXH 1NRNH 5AFZH 1HPGA 1DPOA 1YPJH 3QGNB 3T62A 3RXUA 3VXEH 4D9QA 5F53A 4NSYA 5FBIA 1BTWA 4Z6AH 1Z71A 1MUEB 1BB0B 1AN1E 3NRLA 5L2ZH 1MCTA 1VITH 2Y6TA 3SUFA 1YCPH 1SHHB 1OWIA 4MNVA 4WY3A 2FXRA 3RXFA 3BTGE 2SGPE 3ZVBA 2J97A 3IG6B 1GHBF 4K8YA 3SGBE 1FY3A 3SJKA 3LH3A 4WXIA 5EXLA 1EB1H 4BXSA 4YOGA 3F68H 1Y5BT 3LPRA 4INKA 2QV1A 4CREA 2A7HA 1ZTJA 2ZFSA 3AASA 3HGPA 1TX6A 4I31A 1EB2A 1VJAU 5FL7D 1VZQH 1P05A 5DPAA 4VGCC 2J2UA 2CV3A 1OWEA 3VXFH 3ZZ9A 2ZHFH 2L74A 4B2AA 1C2FA 1V2QT 3A84A 3BTME 1LPKB 1LTOA 1GPZA 3DT0H 4ZXXH 5T6GA 3RP2A 1YLNA 1GBCA 1P3EA 1LQDB 2KZ4A 1TNLA 3MU0A 2H5DA 3SGAE 1V2RT 1K22H 4BAHB 5EOKA 1HUTH 4R8TB 4JK5A 2FOMB 2BD4A 4MNXA 2CMYA 4A6LA 1ETTH 3U98H 4Q7YA 4A5TS 2DUCA 2VWNA 3U69H 2OXSA 4YT6H 1PYTC 2B7DH 1OP2A 2ZHQH 2BD3A 4X2WA 2ZTZA 1Z8GA 1WSSH 5EW1H 4OGYA 1C1UH 4SGBE 4Y0ZE 1O2LA 1S6LA 1S82A 3PMJA 1E35B 1DANH 3GY5A 5A0AE 1MH0A 4H4FA 1MU8B 3KNXA 1EAWA 3BIUH 1DSUA 2GT8A 2ZFFH 1MTUA 2KAIB 4WF8A 3RXVA 1C2DA 1AZ8A 3L33A 4K5ZA 3A7XA 5DGJA 1SBWA 2PKAA 2Y5HA 3SU1A 2TGPZ 5EPYA 1A0LA 1QB9A 1DDJA 1KTSB 5C17A 1ABJH 4UFGH 1MAXA 1BBRH 3F2HA 3ZYDA 5C3NA 2BDBA 5DP3A 1QZ8A 3HGNA 1A5HA 3BTEE 3UPEA 1QHRB 3BV9B 3GCNA 1HJ8A 3M61U 1J14A 4BTTB 3G01A 3ODFA 1GHYH 3F0OA 4FOUC 1H8ED 3K65B 2GX4A 4ABFA 5C20A 2JH6D 1AWFH 2V7QD 2GCTC 2YNBA 2WYJA 3DSGA 3KF2A 3FVFB 4Q7ZA 3VFEA 3UQVA 3M5NA 5DSFA 5HGGA 3P17H 3FFGA 4E06H 3SJIA 5KEDA 5DKMA 4XBBA 3EDXB 1V2KT 2I6SA 3TK6A 5TJXA 1GCTB 5GXPA 1EJNA 3L6PA 1O2TA 2ZDMA 2TBSA 4WVPE 1QURH 1NZQH 1HBTH 5EPNA 1P2MA 1K9OE 3HKJB 1QJ1B 1T8MA 2FESH 1EAUA 1HRTH 1SLXB 3W95A 1DITH 1VCQA 2VIPA 4TYDA 2GZ8A 4NWLA 3GY6A 2FO9A 1LQEA 1BTXA 4X6PA 1F0SA 3TNTA 5L6NH 3DSOA 2IOTA 2EC9H 3RMOH 3V3MA 5LGOA 3F9EA 1O3NA 5HM9A 2WPDD 2WPIS 1YF4A 2CXVA 2J95A 3RXBA 2O8TA 2WYGA 1KXDA 3S69A 1RD3B 5EW2H 3H7TA 1KLIH 2JIZD 2GJGA 2QF4A 3LT3A 2BY6X 4AGJA 1K0HA 1D3TB 1HNEE 1J17T 3BN9A 2C8ZB 1YBWA 5C1XA 1TRMA 3E16B 1BZXE 4Z0KA 4BTIB 1PPFE 4UD9H 7LPRA 4F55A 2WUBA 2O8MA 3FKSD 3M3VA 2TGDA 3GY3A 1TFXA 1EATA 2QE7D 3QGJA 1O5BB 1T4VH 4I33A 4JMYA 1DICA 3A7VA 5DP9A 2EY4C 1H1BA 4JYTA 4AG1A 3LGVA 4KGAA 5FXLA 2QN5T 3R0FA 2F43B 1D6WA 1J16A 3SU6A 1C1SA 2ZU5A 4I32A 2LPRA 2XXLA 1O5CB 1AE5A 1S81A 1Z1JA 4INHA 1KXEA 1TMTH 5HXFA 4JZFH 2VH6A 3TJVA 1HFDA 1O32A 1O2VA 1U6QA 5GCHF 4ZKSU 3TNSA 3O8RA 1DLEA 3HATH 1G36A 4NSVA 4DOQA 3VGCB 3V12A 5GNDA 3TK9A 8GCHF 5FCRA 5B6LA 2SGQE 1FQ3A 3LC5A 1NT1A 1YPEH 2UUJB 3TITA 3U8TH 2QAAA 1SLWB 4ZKOU 4FETA 1EQ9A 2OBOA 5KECA 4ZCNA 1GBJA 1C2HA 3SHCH 4B76A 4I8LA 1C4Y2 2Y82A 2FYRA 1AVGH 2O8WA 3OY5U 2Z3DA 1ELGA 1SG8B 1HXEH 1P2IA 2BOHB 4O3TA 3GCTF 1UTJA 4B75A 1TNJA 2A45B 3TLOA 1RIWC 1PQ5A 2ZCKP 2HOBA 3QWCH 3RMLH 4RN6A 3W94A 4OS5A 4YZUA 2J9NA 2PSXA 2ZG0H 3SJ9A 2AGGX 3V7TA 4ZHLU 4JK6A 3SU5A 1NTPA 3BEIB 1YPMH 4B2CA 2HNTF 4AFSA 1GI5A 2KFWA 1P01A 2G00A 3PMAB 1KTTB 1K21H 2KCAA 4NIYA 3SU3A 1ZRBA 1TA6A 4MPUA 1SVPA 1H9HE 3HPTB 1VGCB 1RTKA 5C94A 3GY4A 1WAYB 3VB3A 5C2ZA 2TRMA 3OE7D 2W5EA 2H6MA 1S6HA 1TPSA 2BQWB 2EI6A 2ZNKH 3A82A 8KME2 2FPZA 5LH8A 1ESBA 1PQ7A 1GMCG 1T7CA 4Y0YE 1OWHA 1RTFB 1HCGA 2GT7A 4Y10E 1C5TA 4TPYA 1FX0B 1ZTKA 1E79D 4DG4A 4I8GA 5GWZA 5TCCA 1WYKA 2ODQA 2ZQ2A 3I29A 3OTPA 2QC2A 4E7RG 4ABBA 3K6ZA 3A80A 2JDID 5EJZA 1SB1H 1TONA 4Y6DA 4X1NU 1ZRKA 4JZEH 3SNDA 2PKSC 3EA7A 2P8OB 1P2QA 3LIWA 1TPOA 1YLDA 2B8OH 2H9HA 2ZDLA 3EGKH 3VG8A 1SGFA 1C2KA 4U30A 4X1PU 1PPZA 1QR3E 3C27B 1PPEE 2O8UA 2XYAA 4HFPB 1FPHH 1UHBA 1XKBC 3T2NA 3GCHB 2ZPSA 4FVBA 3PV2A 3Q00A 1O2SA 4Y8XA 4GLYA 1Y3WA 3K6YA 5DN6D 5C1UA 1IHSH 6GCHG 1HIAB 1FAKH 3E8LA 1AHTH 2NU3E 2RCEA 1ANCA 1IQKA 1FI8A 4RKOB 4JYVH 5C67A 1G2MA 1N8OC 2AMDA 3ODDA 4CR9A 5E0HA 2P3TB 1PQ8A 5EU8A 3CENA 3MWIU 4ZROA 4KELA 3SN8A 3P8NA 1ZTLA 2W6ID 4F4OC 2XOKD 1RFNA 2QXJA 4K2YA 3LONA 1O3DA 1IQFA 1EOJA 1NFYA 1TQ7B 1VCPA 2OD3B 2ZHEH 4CRFA 1SC8U 3MO9A 3PMBB 4OS1A 3U1IB 2RDEA 1GI4A 1UO6A 3F1SB 1TOCB 1MKWK 1A3BH 4NZLA 1UCYE 4I8HA 3SHAH 1VITG 2BDYA 1YYY1 3BEUA 2Y81A 1AE8H 1A4WH 1GJ4H 1W8BH 1W0KD 3OY6U 1GMHF 1CT4E 1W10U 2BMGB 1ETRH 1DWDH 2RA3A 5HKKD 2KCOA 1MQ5A 1HAXB 1P3CA 1BCUH 3FAOA 1OYQA 4AYYB 3KGPA 4DT7B 2Z9LA 1O2PA 1THPB 1NROH 2SGFE 1C5XB 1UHBB 1H9IE 1GJ8B 4ABHA 1O36A 2O9QA 3T28A 1QIXB 1KDQB 3PROA 5EIYA 1LHEH 1ZGVA 1W0YH 2F4LA 1TX8A 4YOIA 1BTUA 1MABB 3OSYA 2BM2A 1OKXA 4XSKU 2LELA 4HGCA 1T4UH 1BT7A 1XUHA 1EP6A 1SPJA 2Y7XA 2LP6A 3D62A 1SOTA 1GBLA 1V6DA 4OS7A 1W14U 1GI7B 1Y3XA 1YP9A 1GMHG 1MBQA 1LVMA 1GHBG 2BZAA 3M3SA 4NWKA 3SV6A 1OWDA 4Y7AA 3NZIA 3LKWA 1UTNA 3NXPA 3PB1E 5I25A 1MAYA 1H8DH 2CF9H 1E37B 1O3AA 1SQRA 4U2WA 1CQQA 1OWKA 3T27A 2Z3EA 4Q2KA 1BRAA 1CBWC 3RMNH 4IN2A 3ELAH 5DP6A 3NKKA 3MYWA 4P00A 1CHOF 1QL8A 2FOAA 1NRPH 2Y80A 5SGAE 3ATMA 2R0KA 1HAVB 3RC5A 3GDVA 2UUFB 3Q76A 2ZO3H 3M7TA 2BY9X 4XBCA 1PQAA 1RS0A 3NWUA 1XXDA 1AGJA 5EXMA 2AMPA 3TGJE 1SL3A 5DO4H 1ZZZA 2ZCLP 3KEEA 1HAYB 2ZDNA 3BTFE 3ENSB 3S7HB 1E0FD 4AC9A 4XDEA 5AFYH 2F3CE 1P57B 1CT2E 2VIWA 3MU1A 1K1NA 2AERH 3A83A 5DP7A 1EZXC 1O2HA 1TNKA 1QNJA 2STAE 1NU9A 2ZWLH 1O3KA 3RM0H 1GMCF 3A7ZA 1FIWA 3E6PH 3SUEA 1J15A 1SI5H 5JBCS 1AMHA 1JOUB 3EE0B 1K1PA 2KAIA 3PO1C 7ESTE 2ODPA 3RU4D 4K60A 2ZDKA 2AMQA 1C5LH 5JBAS 1TPAE 1EP5A 1QQ4A 1NRSH 2WINI 4AB8A 1PPGE 4ACBA 4XD7D 2Y5GA 7GCHG 1PJPA 1YWUA 3RU4T 1O2RA 1EJMA 1O3OA 1GJ5H 2JETB 5ETXA 2Q1JA 4M7GA 1GCDA 1NESE 4BTUB 1O3MA 4JZDH 2HVYB 2VGCB 2OQ5A 1DFPA 3AAVA 3P8GA 3SNCA 1ZMJA 4K3JA 3FP7E 1O2GH 3GOVB 4Y71A 3TPIZ 4ZH8A 4Y11E 2ZC9H 2RDLA 4CRAA 2C3SA 1DWEH 3GS9A 1AKSA 2YOLA 5A0BA 1UVUH 2NU4E 1ZLRA 2P59A 1RXPA 5JB9S 1O2XA 3E1XB 2CHAB 3F6UH 1P02A 1OP0A 1EPTC 4KTSA 1GJCB 1J8AA 3I77A 3PLPA 1V2ST 1DVAH 1ORFA 1AVXA 1UVPA 4DVAU 2A2XH 4AX9H 1HAOH 4A1XA 5HMAA 2J34A 3PLKA 1YY3A 5DP5A 1MQ6A 3SUDA 3LJJA 4NGAH 3RXPA 2G51A 1QGFA 1CVWH 2XNIA 5PTPA 3RM2H 3UNQA 4ZXYH 1ELBA 2XC4A 1GI3A 3H09A 5HIYA 2ZFRH 1MCVA 3F0PA 3O8BA 4BNRA 1O33A 1EAIA 1EJAA 1HJAC 3LGWA 2D1JA 2QGRA 3A85A 1SGPE 3UB0A 5AVDA 1ACBE 1NU7B 1OYTH 1W7GH 2GZ7A 1JIMA 3QN7A 2KCYA 4KP0A 4D8NA 1JBUH 3SV7A 1QRXA 2EI8A 3KN2A 3RXEA 4GHTA 2HGTH 4XBDA 3PLBA 1NC6A 2VVVA 2HNTE 2ESTE 2CF8H 1IQEA 1O2ZA 1QA7A 2Z9JA 2VIQA 3MO6A 2OQUA 1Y3UA 2FMJA 1P10A 1FMGA 1SGFG 1YKTA 1OWJA 2TGTA 4ABJA 1YGCH 3Q77A 2BDIA 1E36B 4FUCA 1AWHB 1O3JA 2WHXA 3URDA 2AYWA 2ANKH 4A7IB 1C5VA 2FS9A 2A4QA 2Z9IA 2OBQA 8ESTE 1O5AB 4X6NA 3AW1A 3PMHB 3ITIA 4ISOA 4CBOA 4AG2A 1J9CH 1GBTA 2J38A 1SGIB 2BOKA 5GIBA 4A1VA 1WTHD 1FN6A 2R0LA 3Q3KA 4I86A 1TMBH 1NFWA 1NRQH 4UDWH 1W2KH 1FDPA 1VJ9U 1O2KA 2W7UA 1OP8A 4JCNA 3SGQE 1MD8A 2HLDD 3NPSA 3OEED 4FU9A 2CN0H 1P09A 1Y5AT 3SI3H 2FOCA 4QT8C 1MKWH 3QDZB 3TH3H 3WY8A 3TJNA 3QO6A 4X2XA 5GCHG 4O03A 3W1EA 1KXFA 1YM0A 4U01A 4BAQB 3OX7U 4OS4A 3B9FH 5A2MH 8GCHG 1TNIA 1BUIA 3M5LA 3SORA 4D9RA 4B6EA 1P8VC 3E3TA 4AN7A 5KGOA 1A7SA 1UCYH 1NY22 4WH6A 1S5SA 1GBMA 1ARCA 1C1WH 1CHGA 4ZMAH 4BOHA 3BTHE 1AQ7A 1D6RA 5FPYA 2OC8A 3ATKA 1RGQA 4IBLH 3U9AH 2R3UA 2BLVA 2M2AA 4FUFA 2Z7FE 4AZ2B 1V2PT 5E2OA 2Y5FA 3ATIA 3PRBA 1K1MA 3R3GB 1KXCA 3VB7A 2H1UA 3RXAA 2TGAA 5H4IB 4WMDA 1HXFH 4YO9A 2C8XB 3NCLA 1V2UT 1C1VH 1MZAA 1GJ6A 1RJXB 1OPHB 2BDGA 3SU0A 4ISIH 3MTYA 1BMMH 1V2WT 4B2BA 1SLVB 3UOUA 3BF6H 2BDAA 1ABIH 4FUIA 2QF5A 4DY7B 1SQOA 1HB0B 1QB6A 2CHAC 4NA7A 4X8TH 3SYJA 1Z6EA 2TPIZ 2Z3CA 1L2EA 2ZDAH 5A8ZA 3KQCA 1TGSZ 1GJBB 1TBZH 1TRYA 2YNAA 1BMLA 1SKYE 2J5UA 2W6JD 1XX9A 1GGDC 3RUOA 2ZTXA 1WV7H 4ZKNU 1LVOA 2VH0A 1S85A 3ZVFA 1UTPA 3MH4A 1BRBE 3LGUA 2ANMH 4TY7A 2SNVA 1EUFA 2FYQA 2JETC 4A92A 2Z9KA 3KQBA 4B74A 2EA3A 4UONA 3VB6A 1Q31A 1PPBH 2BVRH 4YXWD 1SR5C 5IDKA 2G4UA 3PO1B 2ULLA 1C5OH 2XW9A 1C2LA 1FPCH 2AIQA 1ELFA 2ZGCA 3BTKE 1AUJA 1ZMNA 1MZDA 4XRNA 4CRBA 1IQHA 3SZEA 2QXHA 3S0NA 3OTJE 3DFLA 2BB4A 3RXLA 1L1JA 2PGBB 3ZVDA 1HV7A 2VINA 2H2ZA 3UWIA 1KDQA 3P92A 3ZZ3A 3STJA 1TPPA 1QB1A 3DA9B 5CE1A 1HAVA 2PWXA 1GL0E 1UVOA 3E0NB 2AH4X 5A8YA 1LCYA 1MKXK 1ZPZA 1ANDA 2A4RA 1KY9A 1RIWB 2ZA5A 2BXTH 1K1JA 1LHFH 3GDUA 2GDDA 4NCYA 1C1MA 5LPRA 1Y3YA 1SHYA 1ZSLA 1GI1A 1C5MD 5LPFA 1DWBH 3GCOA 3N7OA 3CP7A 2A5AA 6CHAB 2PR3A 1FY1A 4CH8B 3CS0A 2YMSB 4ISHH 1ZPCA 5EG4A 4ABAA 4I8KA 1D3PB 3SV9A 1ANEA 1MBMA 4I8JA 1GG6B 1BBRE 4IC5A 1F7ZA 2QA9E 2XBWA 1ZJKA 2FS8A 1TX7A 2PW8H 3B8JA 3FP8E 5C1YA 2VB0A 3RXGA 1AB9C 3MU4A 1MTSA 4SGAE 1WTGH 3DFJA 2Y7ZA 4JZ1A 3SBKA 2HPPH 3SNEA 3U8RH 1VITF 3BTTE 1H4WA 4CR5A 2P93A 2D26C 2CGAA 5ESTE 1XXFA 1Z1IA 2FEQH 3MU5A 4FUGA 1GBIA 3KCGH 2ALPA 4FVDA 1GVZA 4CRDA 3ZVCA 1HDTH 5C5OA 1FY8E 4HG6A 4BAKB 1HGTH 4WJG2 4GPGA 1BHXB 4FUHA 1IOEA 4FUEA 3BG4B 1YCPK 4TSFD 3TU7H 2OC7A 2ZKSA 2D8WA 1QJ7B 1GL1A 1GBKA 3SQEE 4X1SU 1UTOA 1E38B 1IQIA 1O3FA 4I7YH 5L2YH 2BD8A 4CHAB 3P6ZB 1ZMLA 1O3LA 3AVZA 3BG8A 1G32B 3M7QA 3I78A 4NA8A 2Z6BD 1FJSA 1THSH 1Z6JH 3A8CA 3MU8A 1GI9B 5IYTA 1AVWA 2BY5X 1TYNA 2W3KA 1IQLA 1ZYOA 1B7XB 2HVXA 3E91A 3FANA 1Y3VA 1V2LT 5T6DA 5F8XA 1AY6H 1CU1A 1W12U 3N7EA 5JBBS 2FOBA 2AFQB 3WWBA 2BVSH 4ESTE 1S84A 4PROA 2P95A 1GDNA 3VB4A 4GAWA 4YT7H 1SMFE 2A7CA 1AUTC 3AK5A 1EPTA 1CE5A 3SJOA 2AS9A 6LPRA 1DUEA 1G37A 5FPTA 1CHOG 2VNTA 4YM9A 3FN8A 1TNHA 2IPHA 3GICB 2A1DB 6ESTA 1N8OB 1C5NH 1A5GH 2UWPA 3L3TA 4K1EA 3PTBA 4TPIZ 2FX4A 1UTKA 1ID5H 1CGIE 1GHVH 1HYLA 1TRNA 1VR1H 1P2JA 1RTLA 1WUNH 5FBEA 1BTHH 2XBYA 1O3GA 3F2FA 4IGDA 1ANBA 2B5TB 2AGEX 3P8OA 5C0UA 1S6FA 2VVCA 3GCHC 1ZSJA 4X2YA 1Z8RA 1E1QD 4NFFA 1ZOMA 4H6SB 3TVJB 2GCTB 3OU0A 1BJUA 2FLRH 3RXHA 1V2OT 1GJAB 4X1RU 4NFEA 2VBCA 3UIRA 2GDEH 3MOCA 1P9SA 5FPSA 1GDUA 2Q6GA 1GMDG 1QBNA 2P8OC 2PKSB 4GSOA 1KLTA 1QL7A 3EA8A 5ESBA 1SGEE 3K9XB 3T25A 1CO7E 3ZVAA 1K1LA 6GCHF 2PTCE 3UUZA 4MG3A 3EYDA 5JBTA 1T31A 1AO5A 2SGAA 4UFFH 3M7UA 1LHCH 4FUJA 1V2MT 1G9IE 2WV4A 4HI3A 1V2VT 1DWCH 1TABE 1C5SA 1Z8IB 1TALA 1O2YA 1PFXC 3BIVH 1QBVH 2WPLS 2FI3E 1Y59T 2UWLA 2GTBA 1GHZA 2VIDA 2GP9B 3RXIA 1C5RA 1WCZA 1F0RA 2PGQB 5A8XA 2FOFA 2XBVA 1DE7H 3ZZ5A 3TGKE 1C1NA 4E05H 1BOQA 3LGYA 3F2GA 1XVMA 2BQ7B 1ELTA 2NWNA 1VGCC 2SGDE 3ATWA 1SGQE 3F9GA 1YPHC 3FP6E 3ZVEA 1ZGIA 3RLYH 3PTNA 1H9LB 1XM1A 3BTQE 1UVTH 1W0JD 3MNSA 3Q3XA 1IQNA 2OC0A 1D4PB 3A7YA 9LPRA 1EXFA 2FWWA 2ZGHA 4GVUA 4IMZA 5FX6A 2J4IA 3AW0A 1A0HB 1UCYK 3RXJA 1GI2A 1L4DA 1ESAA 2HNTC 3RXMA 1O2IA 2BYAX 4MDSA 1QY6A 2JJ1D 3UR6A 1GBDA 3MMGA 4GHQA 4FU7A 2Z94A 1GBHA 2F9VA 3T29A 2WPJS 5GPIB 2VWMA 2XTTB 3P8FA 1N6YA 4XFQA 5CMXH 1O5GH 3S9BA 3RU4E 1BQYA 3ZZ6A 1EASA 1LMWB 5EJ1A 1O3BA 1O2UA 1CT0E 2BLOA 4MPXA 4YOJA 3ZZBA 3PYHA 4RT1A 5K0HA 1O39A 3S9CA 4IN1A 1TB6H 2KR7A 2BTCE 1IQGA 3LGIA 3ZZAA 1W11U 1EX3A 1F5RA 1WBGB 1ZHMA 1S83A 1P2NA 1AI8H 2H9EH 5DK1A 4NG9H 1MTNC 1SSXA 3VGCC 2A31A 1MTVA 1ZJDA 3RXOA 4NIXA 2IPQX 4Y76A 4X8VH 2G55A 1GJDB 4ZKRU 1AFQC 3P70B 2AHME 4CHAC 1W7XH 2ZP0H 3FZZA 1BTYA 3E0PB 1EOLA 5F8TA 2SNWA 2F9UA 2ZGJA 5EJLA 2KCPA 3BG4C 3AAUA 5LPEA 4CBNA 5BPEA 1BRUP 2JH0D 3MH5A 5FHTA 4AOQA 2IN2A 2AGIX 3EAJA 2WZQA 2BD5A 1IQMA 1B0FA 1FV9A 1UMAH 2XC5A 5EODA 2H9TH 2ZEBA 2ANYA 3M36A 1TGBA 3GYLB 1HAPH 1AFQB 1ELAA 1C5ZB 1LHDH 2A0QB 2XWBI 1O2JA 4ZUHA 3MQKC 1D3QB 2SFAA 2TIOA 4B73A 3O8DA 5JPMH 1CA0C 3IITA 1AB9B 2QXGA 2J94A 3UREA 3OAAD 1MTNB 2L6OA 1MU6B 4WXVA 2V0BA 3EA9A 2OCVB 4YLQH 3UNRA 2PP6A 4X2VA 3A81A 3ZV9A 2DE8A 3SUGA 3TJUA 3WW7A 4AFQA 1BMNH 5FAHA 1L1GA 4MLFB 4ACAA 1GJ7B 2AIPA 1FUJA 2YMSC 2ZQ1A 1F0UA 6CHAC 1OHHD 3SU4A 3HK6B 1GBEA 2C4FH 1C5UA 1O35A 5EXNA 2HPQH 1P06A 2B9LA 2BX3A 4Q63A 5C5NA 1O3CA 1G3EA 1MMJN 2ZF0H 1QA0A 2XNDD 1QL9A 5DJ7A 1CGHA 3A8AA 3KL6A 2Z9GA 3MNBA 5GJ4B 1JMOH 2ZDVH 2A2QH 1C1PA 4INLA 1QBOA 1TBRH 1GBBA 5EQQA 1FAXA 1GCTC 1DT2A 3KYGA 3SNAA 3CS7A 1AZZA 2V35A 4X8SH 1C5YB 5J4SA 4O3UA 1WQVH 5CHAC 2QXIA 2G4TA 3T26A 2R2WU 1BTZA 1MD7A 3A7TA 1FY4A 1C4U2 2GV7A 3QZQA 2BX4A 5BRRE 1NO9H 5F03A 3NUMA 1ETSH 1EKBB 2ZU3A 1ELCA 5C0TA 1HAGE 2OK5A 1GMDF 1K1IA 4AB9A 2RFKC 5ABWA 1BJVA 4OGXA 3RXRA 5K7RA 2A4GA 1AD8H 3LJOA 2OLGA 1JXPA 2OTVA 2KM0A 2WV5A 3GYMA 3U28C 1GBFA 1G3BA 2THFB 2V3HH 2ZCHP 5DP4A 1C5QA 2ANWA 1XKAC 1C2GA 1C1RA 2OINA 4KTCA 1C4V2 2HALA 3QX5H 3OYPA 1UW7A 1H8IH 2G81E 2BXUH 1Q2WA 2IJOB 1HAIH 2I6QA 4ISNA 5HM2A 3VB5A 5A09A 3EQ0H 2CK3D 3GDSA 1A0JA 3SV2H 1OXGA 1DS2E 1P12E 2ZPRA 2P3FH 2BLQA 4UFEH 1DX5M 4ABGA 2EI7A 1M9UA 1GHWH 4H6TA 1O3PB 1O3IA 2HRVA 2FOHA 1HAHH 4AYVB 3KQDA 1N1LA 1GHAF 4KTUA 5E0GA 1BIOA 2QIQA 4ABIA 4DT4A 5I46H 1SGRE 1A5IA 1PPHE 3LU9B 2ZFQH 1LPGB 1FXYA 4LK4A 1K1OA 3LC3A 3CNRA 3S9AA 5FX5A 2QCYA 2A7JA 2PFEA 2O8LA 3H5CB 1EZQA 5JB8S 3QK1A 1FONA 3PM3A 1C9PA 1YC0A 4AFUA 2J92A 3ATLA 1F0TA 2C8WB 4Y8ZA 1KYNA 3SV8A 2A4OA 5L30H 1GI6A 4Q4LA 5B6OA 2F9NA 2STBE 1EZUC 3DSPA 1SFIA 1DUAA 3DHKH 2FI5E 2R3YA 3RC4A 2ZECA 2NU2E 1BDAA 1VKYA 3N99A 3BEFB 4AORA 3GY8A 1DXWA 1ZSKA 1LVYA 1SOZA 4TWYA 1W0ZU 4ABEA 4VGCB 4NZQA 4DW2U 1AFEH 1GHAG 3UFAA 3KYFA 1P04A 2B0FA 4FU8A 1T8OA 3VEQB 1A1RA 3A87A 1D3DB 1FIZA 5T1VA 2UUKB 2ZGBH 3SJ8A 1G30B 2OUAA 1L0ZA 1UVSH 4O97A 4Y8YA 1TOMH 3Q3YA 1OX1A 1PPCE 1SFQB 1ZHRA 2WSSD 4XOJA 3URCA 3ZZCA 2K1QA 3SW2B 1P0SH 3ZVGA 2JH5D 3GISB 1KLJH 1K2I1 1XUGA 3PRDA 1A61H 3UAIC 5CHBA 1P2KA 2J98A 3ESTA 2F91A 3DD2H 1XUIA 1F2SE 1E34B 1QCPA 1OS8A 2C93B 2BLWA 2ZIQH 1SLUB 1INCA 2FTMA 1QJ6B 3E90B 1BMAA 3MFJA 1NFXA 4LXBH 3ZZ7A 4X0WU 3OEHD 4B1TA 2FTLE 1SGTA 1FY5A
chains in the Genus database with same CATH topology
3TIUA 4NIWA 2BQ6B 3MH6A 4UFDH 1ELEE 2BDHA 5T3HA 1IHTH 3SOSA 1GI0A 4DURA 1ESTA 2ZU1A 5FCKA 2CJIA 1EAXA 1CA8B 1GG6C 4U32A 3UR9A 1L4ZA 5AHGH 1TNGA 3TK5A 1G3DA 3SU2A 5DG6A 2FP7B 3RXDA 3S7KB 4DJZB 1RRKA 2FOGA 4MPWA 1HJAB 1ZPBA 4RKJB 2AEIH 2NU0E 2PLXA 5T6FA 4ZHMU 1BITA 1HJ9A 1QQUA 4LZ1H 1GHXH 4IC6A 4ASHA 3BTWE 1ZR0A 1GWAA 2GMTB 3QUMP 2VVUA 4UEHH 1A2CH 2GVFA 4GCHF 2C90B 1S0RA 3TH4H 4K69A 3TJOA 1A3EH 3IWMA 1SQAA 3QLPH 4MTBA 5J4QA 1TMUH 5A0CA 1O34A 4WMFA 1NPMA 1GI8B 1LHGH 1C2JA 4F49A 1KIGH 4IW4E 5E0JA 4D76A 3PWCA 1Y8TA 2M5TA 2FODA 2FX6A 2Q6FA 3A86A 4UE7H 3M3TA 2G52A 2F9OA 4MVNA 1EPTB 4E7NA 5GDSH 2QF0A 3UQOA 1W3CA 3FZDA 3GCTG 1YCPM 4JYUH 1TAWA 3ZZ8A 3ZYEA 2ILNA 3B23B 4WMEA 3U1JB 1BTPA 3RLWH 4A1TA 1K28D 3D65E 2LNCA 1O2OA 4R0IA 1X7AC 1ARBA 2A5IA 2VWOA 1XUKA 3MNCA 1GGDB 2PV9B 4TY6A 4MNYA 4X1QU 3MNXA 1IQJA 1TQ0B 1O30A 3LOXA 4WWYA 2FIRH 4NIVA 1KXBA 2ODYB 1BBRK 3RC6A 1HAZB 2WPKS 1FZZA 2PTNA 4DGJA 4K8BA 4X6OA 2XRCA 1GJ9B 4YLUA 1O0DH 1JWTA 2FLBH 4ISLA 1UK3A 2XWAA 1Q3XA 1YPHE 1P2OA 4BAOB 1NFUA 2WPMS 4Q7XA 5JDUB 2ZFPH 1O31A 3TH2H 4D7GA 2NU1E 3RXKA 3HK3B 3F9HA 2UUYA 3UY9A 2GMTC 3BSQA 3RXSA 1SGNE 4RSPA 3GY7A 1VCWA 1UTQA 3UTUH 3UWJH 1Z8JB 1C2IA 4HZHA 4KKDA 2SGEE 1LKBA 2W26A 3LDXH 1JRSA 1CBWB 2ZPQA 3M35A 2DE9A 2FM2A 2PHBA 4IS5A 2BD7A 2R2MB 1NS3A 1TGTA 4Y7BA 1L1NA 3SI4H 2WPHS 4TWWA 2FZZA 3QTOH 1D9IA 1SGDE 1UTLM 1SGYE 1BA8B 1LKAA 4DIIH 2F9PA 1C5WB 4FXGH 2VJ1A 2C8YB 4CRCA 4GUXA 1B5GH 1ELDE 1FN8A 1O2QA 1BHXF 1Y5UT 1OOKB 1ELVA 1WU1A 4YTAA 3SNBA 3SO3A 4BANB 7KMEH 1JIRA 5EQSA 8LPRA 9ESTA 1QRWA 2P3UB 3SZNA 2A32A 1TGNA 1BRCE 1FLEE 1O2NA 1LVBA 4ZHAA 3ZV8A 1GVKB 2ALVA 1GVLA 3K2UA 1KXAA 2ZFTA 2HWLB 1LO6A 1NN6A 3DUXH 4WH8A 4YESB 1C2EA 1AIXH 2BVXH 4H42U 1LDTT 2H5CA 2BD9A 3A89A 2V6NA 2GKVE 1AU8A 4LOYH 3P95A 1O5FH 4LZ4B 1TE0A 3V13A 1T8NA 1V2JT 3C1KA 1O37A 2RA0A 4MPVA 1C1QA 3M37A 1XUFA 4Q80A 1KSNA 2OC1A 1P9UA 3RXTA 4FUBA 2BD2A 2QY0B 3RXCA 1C1TA 3MO3A 1YPLH 1DY8A 2UWOA 2PSYA 1QFKH 1O5EH 2VWLA 3TGIE 1THRH 3H7OA 4GCHG 2V3OH 1JRTA 2BDCA 2FOEA 5E2PA 2GCHG 1MKXH 1G3CA 1DOJA 2PUXB 1AKSB 4X8UH 2G8TA 2P94A 4JZIA 1C5PA 5DP8A 3QTVH 5F8ZA 1TIOA 1S0QA 2ZHWH 1O2WA 1O2MA 1TA2A 1DSTA 4OS2A 5E8EH 1XVOA 4DCDA 3M5OA 1TWXB 1DY9A 1YPGH 5EQRA 3UOPA 4B71A 2P16A 4XE4A 1QRZA 1EZSC 2OP9A 1P11E 3PV4A 2QYIA 4HTCH 1G2LA 1C1OA 1QTFA 2GZ9A 3SQHE 3LGTA 3RDZA 1B0EA 4J1YA 1TBQH 3M5MA 2GV6A 2BHGA 2FI4E 3A8DA 3T5FH 2VGCC 3MHWU 1N6XA 4BXWA 1ZHPA 2HLCA 1HLTH 3MI4A 2GCHF 5G4BA 1V2TT 1YPKH 2VIVA 2XCFA 2ZI2H 1HIAA 1PYTD 3KIDU 1WOFA 2ZHDA 4D7FA 2ZU2A 1LPZB 2WUCA 2EEKA 1O38A 3UNSA 1XMNB 1F5KU 1MTWA 2Q6DA 2VIOA 2XBXA 3MH7A 3D23A 5JYIA 2G5NA 1FNIA 2PKAB 2R9PA 2ZZUH 3RMMH 1DLKB 4OS6A 3F9FA 1DXPA 2JKHA 2RG3A 3GY2A 3PWBA 2D2DA 2G5VA 3O8CA 3RXQA 2GGVB 5EGMA 5CHAB 2QF3A 4MNWA 3A7WA 1T32A 4CRGA 1SGCA 3JZ1B 3NK8A 4AFZA 7GCHF 3U8OH 2BY8X 3JZ2B 2W7SA 3LH1A 4ZAEA 1GBAA 4IMQA 1TLDA 1IAUA 4FUDA 1SQTA 3ZZ4A 1CGJE 1W13U 2A5KA 3STIA 3KHVA 4Y79A 1O5DH 1Z7KA 2PUQH 4X6MA 1NRRH 1C2MA 3VPKA 5F6MA 5HYOA 1T8LA 4ABDA 2ZTYA 3HKIB 3A8BA 4NA9H 1V2NT 1NM6A 4J2YB 2FDAA 4BAMB 2XCNA 4O9VA 5AF9H 3KQEA 2W3IA 2ZU4A 2GD4B 4MQAA 4AGKA 1TGCA 3ZZDA 1C9TA 1DM4B 1F5LA 3V0XA 1F92A 2ASUB 5TCAA 1CSOE 4K1TA 2F9BH 2XC0A 4DIHH 3A88A 1CA0B 1GDQA 4CH2B 4THNH 1UJ1A 1OSSA 3QZRA 3D49H 1V3XA 1UTMA 2BY7X 4K1SA 1P03A 1XUJA 3BTDE 2BZ6H 1WQSA 1YLCA 1UK4A 2VU8E 1A46H 1O3HA 1O3EA 1UK2A 2F83A 2ZGXH 1NRNH 5AFZH 1HPGA 1DPOA 1YPJH 3QGNB 3T62A 3RXUA 3VXEH 4D9QA 4NSYA 5FBIA 1BTWA 4Z6AH 1Z71A 1MUEB 1BB0B 1AN1E 5L2ZH 1MCTA 1VITH 2Y6TA 3SUFA 1YCPH 1SHHB 1OWIA 4MNVA 4WY3A 2FXRA 3RXFA 3BTGE 2SGPE 3ZVBA 3IG6B 1GHBF 4K8YA 3SGBE 1FY3A 3SJKA 3LH3A 4WXIA 5EXLA 1EB1H 4BXSA 4YOGA 3F68H 1Y5BT 3LPRA 4INKA 2QV1A 4CREA 2A7HA 1ZTJA 2ZFSA 3AASA 3HGPA 1TX6A 4I31A 1EB2A 1VJAU 1VZQH 1P05A 5DPAA 4VGCC 2J2UA 2CV3A 1OWEA 3VXFH 3ZZ9A 2ZHFH 4B2AA 1C2FA 1V2QT 3A84A 3BTME 1LPKB 1LTOA 1GPZA 3DT0H 4ZXXH 5T6GA 3RP2A 1GBCA 1P3EA 1LQDB 1TNLA 3MU0A 2H5DA 3SGAE 1V2RT 1K22H 4BAHB 5EOKA 1HUTH 4R8TB 4JK5A 2FOMB 2BD4A 4MNXA 2CMYA 4A6LA 1ETTH 3U98H 4Q7YA 4A5TS 2DUCA 2VWNA 3U69H 2OXSA 4YT6H 1PYTC 2B7DH 1OP2A 2ZHQH 2BD3A 4X2WA 2ZTZA 1Z8GA 1WSSH 5EW1H 4OGYA 1C1UH 4SGBE 4Y0ZE 1O2LA 1S82A 3PMJA 1E35B 1DANH 3GY5A 5A0AE 1MH0A 4H4FA 1MU8B 3KNXA 1EAWA 3BIUH 1DSUA 2GT8A 2ZFFH 1MTUA 2KAIB 4WF8A 3RXVA 1C2DA 1AZ8A 3L33A 4K5ZA 3A7XA 5DGJA 1SBWA 2PKAA 2Y5HA 3SU1A 2TGPZ 5EPYA 1A0LA 1QB9A 1DDJA 1KTSB 1ABJH 4UFGH 1MAXA 1BBRH 3ZYDA 5C3NA 2BDBA 5DP3A 3HGNA 1A5HA 3BTEE 3UPEA 1QHRB 3BV9B 3GCNA 1HJ8A 3M61U 1J14A 4BTTB 3G01A 3ODFA 1GHYH 3K65B 2GX4A 4ABFA 5C20A 2JH6D 1AWFH 2GCTC 2YNBA 2WYJA 3KF2A 3FVFB 4Q7ZA 3VFEA 3UQVA 3M5NA 5HGGA 3P17H 3FFGA 4E06H 3SJIA 5DKMA 4XBBA 3EDXB 1V2KT 2I6SA 3TK6A 5TJXA 1GCTB 5GXPA 1EJNA 3L6PA 1O2TA 2ZDMA 2TBSA 4WVPE 1QURH 1NZQH 1HBTH 5EPNA 1P2MA 1K9OE 3HKJB 1QJ1B 1T8MA 2FESH 1EAUA 1HRTH 1SLXB 3W95A 1DITH 1VCQA 2VIPA 4TYDA 2GZ8A 4NWLA 3GY6A 2FO9A 1LQEA 1BTXA 4X6PA 1F0SA 3TNTA 5L6NH 2IOTA 2EC9H 3RMOH 3V3MA 5LGOA 3F9EA 1O3NA 5HM9A 2WPIS 1YF4A 2CXVA 2J95A 3RXBA 2O8TA 2WYGA 1KXDA 3S69A 1RD3B 5EW2H 3H7TA 1KLIH 3LT3A 2BY6X 4AGJA 1D3TB 1HNEE 1J17T 3BN9A 2C8ZB 1YBWA 5C1XA 1TRMA 3E16B 1BZXE 4Z0KA 4BTIB 1PPFE 4UD9H 7LPRA 2WUBA 2O8MA 3M3VA 2TGDA 3GY3A 1TFXA 1EATA 3QGJA 1O5BB 1T4VH 4I33A 4JMYA 1DICA 3A7VA 5DP9A 1H1BA 4JYTA 4AG1A 3LGVA 4KGAA 5FXLA 2QN5T 3R0FA 1D6WA 1J16A 3SU6A 1C1SA 2ZU5A 4I32A 2LPRA 2XXLA 1O5CB 1AE5A 1S81A 1Z1JA 4INHA 1KXEA 1TMTH 5HXFA 4JZFH 2VH6A 3TJVA 1HFDA 1O32A 1O2VA 1U6QA 5GCHF 4ZKSU 3TNSA 3O8RA 1DLEA 3HATH 1G36A 4NSVA 4DOQA 3VGCB 3V12A 3TK9A 8GCHF 5FCRA 2SGQE 1FQ3A 3LC5A 1NT1A 1YPEH 2UUJB 3TITA 3U8TH 2QAAA 1SLWB 4ZKOU 1EQ9A 2OBOA 1GBJA 1C2HA 3SHCH 4B76A 4I8LA 1C4Y2 2Y82A 2FYRA 1AVGH 2O8WA 3OY5U 2Z3DA 1ELGA 1SG8B 1HXEH 1P2IA 2BOHB 4O3TA 3GCTF 1UTJA 4B75A 1TNJA 2A45B 3TLOA 1RIWC 1PQ5A 2ZCKP 2HOBA 3QWCH 3RMLH 4RN6A 3W94A 4OS5A 4YZUA 2J9NA 2PSXA 2ZG0H 3SJ9A 2AGGX 3V7TA 4ZHLU 4JK6A 3SU5A 1NTPA 3BEIB 1YPMH 4B2CA 2HNTF 4AFSA 1GI5A 1P01A 2G00A 3PMAB 1KTTB 1K21H 4NIYA 3SU3A 1ZRBA 1TA6A 4MPUA 1SVPA 1H9HE 3HPTB 1VGCB 1RTKA 3GY4A 1WAYB 3VB3A 5C2ZA 2TRMA 2W5EA 2H6MA 1S6HA 1TPSA 2BQWB 2EI6A 2ZNKH 3A82A 8KME2 2FPZA 5LH8A 1ESBA 1PQ7A 1GMCG 1T7CA 4Y0YE 1OWHA 1RTFB 1HCGA 2GT7A 4Y10E 1C5TA 4TPYA 1ZTKA 4DG4A 4I8GA 5GWZA 5TCCA 1WYKA 2ODQA 2ZQ2A 3I29A 4E7RG 2QC2A 4ABBA 3K6ZA 3A80A 1SB1H 1TONA 4Y6DA 4X1NU 1ZRKA 4JZEH 3SNDA 2PKSC 3EA7A 2P8OB 1P2QA 3LIWA 1TPOA 1YLDA 2B8OH 2H9HA 2ZDLA 3EGKH 1SGFA 1C2KA 4U30A 4X1PU 1PPZA 1QR3E 3C27B 1PPEE 2O8UA 2XYAA 4HFPB 1FPHH 1UHBA 1XKBC 3T2NA 3GCHB 2ZPSA 4FVBA 3Q00A 1O2SA 4Y8XA 4GLYA 1Y3WA 3K6YA 5C1UA 1IHSH 6GCHG 1HIAB 1FAKH 3E8LA 1AHTH 2NU3E 2RCEA 1ANCA 1IQKA 1FI8A 4RKOB 4JYVH 5C67A 1G2MA 1N8OC 2AMDA 3ODDA 4CR9A 5E0HA 2P3TB 1PQ8A 5EU8A 3CENA 3MWIU 4ZROA 4KELA 3SN8A 3P8NA 1ZTLA 4F4OC 1RFNA 2QXJA 4K2YA 3LONA 1O3DA 1IQFA 1EOJA 1NFYA 1TQ7B 1VCPA 2OD3B 2ZHEH 4CRFA 1SC8U 3MO9A 3PMBB 4OS1A 3U1IB 1GI4A 1UO6A 3F1SB 1TOCB 1MKWK 1A3BH 4NZLA 1UCYE 4I8HA 3SHAH 1VITG 2BDYA 1YYY1 3BEUA 2Y81A 1AE8H 1A4WH 1GJ4H 1W8BH 3OY6U 1GMHF 1CT4E 1W10U 2BMGB 1ETRH 1DWDH 2RA3A 1MQ5A 1HAXB 1P3CA 1BCUH 3FAOA 1OYQA 4AYYB 3KGPA 4DT7B 2Z9LA 1O2PA 1THPB 1NROH 2SGFE 1C5XB 1UHBB 1H9IE 1GJ8B 4ABHA 1O36A 2O9QA 3T28A 1QIXB 1KDQB 3PROA 1LHEH 1ZGVA 1W0YH 1TX8A 4YOIA 1BTUA 3OSYA 2BM2A 1OKXA 4XSKU 4HGCA 1T4UH 1BT7A 1XUHA 1EP6A 1SPJA 2Y7XA 3D62A 1SOTA 1GBLA 1V6DA 4OS7A 1W14U 1GI7B 1Y3XA 1YP9A 1GMHG 1MBQA 1LVMA 1GHBG 2BZAA 3M3SA 4NWKA 3SV6A 1OWDA 4Y7AA 3NZIA 3LKWA 1UTNA 3NXPA 3PB1E 5I25A 1MAYA 1H8DH 2CF9H 1E37B 1O3AA 4U2WA 1CQQA 1OWKA 3T27A 2Z3EA 4Q2KA 1BRAA 1CBWC 3RMNH 4IN2A 3ELAH 5DP6A 3NKKA 3MYWA 1CHOF 1QL8A 2FOAA 1NRPH 2Y80A 5SGAE 3ATMA 2R0KA 1HAVB 3RC5A 3GDVA 2UUFB 3Q76A 2ZO3H 3M7TA 2BY9X 4XBCA 1PQAA 1RS0A 3NWUA 1XXDA 1AGJA 5EXMA 2AMPA 3TGJE 1SL3A 5DO4H 1ZZZA 2ZCLP 3KEEA 1HAYB 2ZDNA 3BTFE 3ENSB 3S7HB 1E0FD 4XDEA 5AFYH 2F3CE 1P57B 1C