2QXGA

Crystal structure of human kallikrein 7 in complex with ala-ala-phe-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA02
1W11U 1NT1A 1Y3XA 3SUFA 3EAJA 3EA9A 2ZGJA 1CHGA 1O3NA 3L6PA 2A31A 5I25A 5ESTE 2J9NA 1S6FA 4YZUA 4XSKU 3BTDE 5AFZH 4D7FA 3EA8A 3ZVEA 3RMLH 1WOFA 2HLCA 1UO6A 2IN2A 3GY6A 1LHFH 2BYAX 1VITG 1AD8H 3BTGE 1YPJH 1IQGA 1RXPA 3SGBE 4FVDA 2D26C 5FBIA 1N8OB 2ZU5A 4WF8A 2ODYB 1V2QT 1LPGB 2R9PA 3S7KB 4JZIA 1MUEB 5E2OA 2BD8A 2XBVA 1MMJN 4MLFB 3SNCA 5AHGH 3M3VA 4CR5A 1VCQA 2F9VA 4K60A 1UVOA 1C9PA 5F8XA 1UVTH 3EA7A 1TYNA 1N1LA 4KTSA 3FFGA 1DLKB 3TJOA 8ESTE 2W7UA 1TWXB 3HGPA 1BMAA 3MTYA 4ABDA 2ZC9H 3VGCB 1SLVB 5C5OA 3SORA 2EEKA 1P10A 1T8LA 5CMXH 3FZZA 4B74A 1Q2WA 2B7DH 1BTXA 4MPWA 3BTQE 4E7NA 2GT8A 1ZMNA 1DFPA 1XKBC 2ZCLP 5GIBA 2BDCA 3QK1A 1JIMA 3MU8A 1FUJA 1NU7B 1OWIA 1P9UA 4K5ZA 2SGPE 1G30B 2BLVA 3UREA 3TK6A 2VIOA 1EATA 2H5DA 2J38A 2BDGA 3KIDU 4JZEH 1YC0A 2BLOA 3S0NA 2ZU3A 2VWNA 1B0EA 3UNSA 1O2KA 4X1PU 4FU7A 4AFSA 4BANB 1ESBA 1CQQA 2HPQH 2ZDAH 2ZEBA 1OPHB 1MTWA 5HYOA 1K1PA 2YNBA 1O37A 1SFIA 1QB1A 1SQTA 4BAKB 1EASA 1O5CB 1F92A 1GVKB 2GCTB 5DP7A 1EZXC 5CE1A 4ABJA 1W8BH 2A4QA 3P8FA 3MI4A 2BOHB 1BJUA 1HYLA 2BDYA 1IOEA 1CHOF 1QL8A 3FANA 3Q3KA 4IC6A 4X1NU 3TH3H 1MTNB 3E3TA 1EB2A 2GD4B 1XUKA 1P3EA 1B7XB 4JYTA 5L6NH 1EAUA 5EU8A 1NROH 4Z6AH 2BDBA 3TLOA 1KLJH 2V0BA 2NU2E 1VITF 2Q6GA 1SQOA 3MYWA 1CO7E 5LH8A 1W0YH 3KQEA 1C1PA 2ZDKA 2H9TH 4GSOA 1CVWH 2ZWLH 4LK4A 2F9BH 3BTKE 5FX5A 5HGGA 1NFWA 3KEEA 4NFEA 4Y11E 1O35A 1MQ6A 1V3XA 3QO6A 1P57B 1VZQH 1YPEH 3O8RA 5FX6A 1QNJA 1GI5A 1WTHD 1THRH 2BY7X 1VR1H 5TCCA 1ACBE 2JETC 2ZF0H 3PB1E 4B76A 1FN6A 1HAVB 1E35B 1SOZA 4ZKRU 1FZZA 2XC4A 1P2MA 4Y8XA 3OX7U 3PO1B 1KSNA 2ZU2A 1P12E 2ZTXA 3BTHE 2WV5A 1ELAA 1RIWB 4TPYA 1O5BB 3SV8A 1TBRH 4I8JA 2P95A 6GCHG 1A3EH 2Z9IA 1TBQH 1K1NA 1XX9A 5HM9A 1SC8U 3VXFH 1XXDA 2W3KA 4B71A 2Z9LA 4CRBA 2BD3A 1V2UT 4MPVA 3KF2A 3GY4A 1S0RA 5GJ4B 3QN7A 3MH6A 5EG4A 3P6ZB 1GBBA 1A5GH 4FUDA 3ITIA 2PHBA 2SGAA 3QWCH 2BVSH 3DUXH 1XMNB 3A86A 1FONA 1QL9A 2FEQH 1S82A 1V2ST 1BJVA 2ULLA 2J2UA 4MPXA 2JH0D 1DE7H 3VFEA 2GKVE 4NIVA 1HPGA 1C5SA 4RKOB 2ZI2H 3P70B 3GY3A 2J92A 2SNWA 4A1VA 4IMZA 1UTMA 3A7WA 3EGKH 3I29A 3A7ZA 1UTPA 2VJ1A 1AWFH 1G32B 4ISOA 1GJ5H 2ZHDA 4Q7YA 3SZNA 2QA9E 2FTMA 3GY8A 2FDAA 2BD9A 3UOPA 1K21H 1ZTLA 1ETSH 2EC9H 4MQAA 1ZLRA 1UVSH 1ZOMA 3MNXA 1VCWA 3RU4T 2B9LA 4X8TH 4ZKNU 1O2HA 2ZO3H 1UCYE 1PFXC 1ELBA 3VB3A 1N6XA 2YNAA 1GJ9B 1NFYA 2FOHA 5AFYH 2AH4X 1NRQH 1BBRH 3T5FH 3ZZAA 2ZFRH 2ANYA 3FP6E 1QQ4A 1D3QB 4BAMB 1TNGA 3M35A 3P17H 3UWJH 1DANH 2HNTF 1TGCA 1G2LA 4RN6A 3BTTE 2UWPA 1MTSA 4XE4A 1UK3A 2GCTC 2K1QA 1TONA 1UTLM 2Z9KA 1UMAH 2ZU4A 1MD8A 5DP6A 4ZHMU 1D4PB 4AFQA 5PTPA 1FIWA 1RRKA 1ZZZA 3P95A 3STJA 1HJ9A 1KXCA 1V2OT 1O2IA 2ZPSA 1MZAA 4J1YA 1BZXE 2F9OA 4CRAA 4LZ1H 3SQHE 1D3TB 3D65E 3U69H 3SNBA 4AGJA 1PPEE 2W3IA 6GCHF 1NO9H 3P8OA 3RXUA 4ZH8A 3T29A 4D9QA 3ZYEA 1O5AB 4IN2A 1LTOA 3RXEA 3UIRA 1FMGA 2WYGA 4BTUB 1LPZB 1GHWH 1QB9A 3OY6U 3LDXH 3PROA 2ZGBH 1HB0B 5FPYA 2AGEX 4K8YA 1BHXB 1ELCA 4TY6A 2QIQA 4U30A 2IOTA 1TPOA 3A81A 2OC1A 1ZPZA 2WPMS 1IQIA 2Y80A 3A87A 2FZZA 3CS7A 3LH3A 4BAOB 1GHAG 4NFFA 2VIPA 4O97A 4ZKOU 3RXOA 1VJAU 2HRVA 1QRWA 1DPOA 2FIRH 2OINA 2BDAA 3GY2A 2BY5X 1EPTB 1GI8B 4INLA 1TGBA 4UONA 2VU8E 5DO4H 1WCZA 1P0SH 1RIWC 2DE8A 2BQ7B 4H6TA 1LQDB 1LKAA 1DSUA 2FYRA 1NC6A 3T27A 1V2PT 5EQRA 1F0TA 4KTCA 1O3JA 2A7CA 3H5CB 2VWLA 5C67A 4ZHAA 5JDUB 3LGVA 2FPZA 1CA0B 3EYDA 4BTIB 2FS8A 2AMDA 1DUEA 1JBUH 1AUTC 4I31A 4DY7B 1IQLA 2GX4A 1CSOE 1NRRH 4FU8A 4TWYA 3UOUA 1OWEA 2P3FH 1UTJA 1FY3A 1AU8A 2Q6DA 4NA8A 3D49H 2ZFQH 3A82A 1H1BA 3OU0A 3A8BA 1W2KH 2HVXA 5H4IB 4JZFH 4DG4A 4DIHH 1C2DA 1EZQA 3SU0A 1W12U 5FXLA 1K1MA 4ZAEA 4VGCB 2XCNA 4B73A 1O39A 1W0ZU 5JYIA 5CHAC 2H5CA 1WSSH 3RXSA 2C8ZB 2GVFA 1NFXA 2BY8X 4INHA 4YM9A 4D9RA 5DP4A 3U1IB 1TNIA 1DSTA 5DPAA 4NSYA 1HAXB 1A4WH 1UCYK 3U8OH 1W3CA 2GT7A 3GOVB 2PFEA 4CRFA 1O30A 5EW2H 1GHZA 2J94A 4WMFA 1CT2E 5AVDA 1AI8H 4UFGH 1CT4E 5F03A 3DD2H 3SNDA 3KCGH 1FN8A 4YOIA 3RU4E 4FUFA 4BXWA 2RA0A 1QR3E 3H7OA 3SOSA 2ILNA 4MDSA 2XCFA 2STBE 3SI3H 4WMDA 3SJIA 4CRCA 1HJ8A 2PKAB 1DT2A 1QURH 1GHAF 2R3UA 1VITH 1C2KA 1TGSZ 1ZYOA 3RXCA 1UK2A 2XBYA 3RXGA 2V3HH 3BTWE 1V2TT 2P8OB 3URDA 4CRDA 3BF6H 4Y7AA 1OWHA 1S84A 5DP8A 1BMMH 1C5WB 4ISIH 4UE7H 2PV9B 5DK1A 3HKJB 1AKSA 3F1SB 1ELGA 3VXEH 1HGTH 1HJAB 3OYPA 1IAUA 4B2CA 1HDTH 4H4FA 4ZHLU 1O2GH 2PTCE 5F6MA 1AVGH 1M9UA 1SGYE 5C2ZA 4O03A 1ZRBA 2B8OH 3SBKA 4K3JA 2FLBH 3LJJA 4E06H 1T8MA 3PLPA 1P03A 3RMOH 4OS7A 3E90B 1NRNH 3UTUH 2A5KA 3DT0H 1XUHA 4OGXA 1HCGA 3D23A 1TGNA 1ID5H 1EPTC 1QQUA 1RTFB 1TNHA 4AZ2B 2GMTB 3BV9B 3ZZ3A 1ZHMA 4NIYA 4GVUA 1CBWB 1O2SA 2R0LA 4I33A 1H8DH 2ZHFH 5HM2A 2ANWA 4I8GA 2VWMA 1GI9B 2PTNA 2WPKS 1CT0E 1LVBA 3D62A 2A2XH 3RLYH 1GVLA 5DP9A 4YT7H 3ZV9A 1C2LA 1TPPA 4AYVB 1EJAA 4XBDA 1EAIA 2AERH 3OTJE 1UTOA 1C2MA 3VEQB 1GBTA 1DXPA 3SU1A 1FXYA 3R0FA 1EB1H 1PYTD 2ZKSA 1GJCB 3I77A 5FBEA 1RFNA 2GV7A 2QXJA 1TX8A 4DIIH 5J4SA 3SN8A 2BY9X 3PYHA 4K1SA 4IGDA 3SGQE 1KXDA 4NIWA 3RDZA 2HGTH 2PKSC 2FWWA 4DURA 2QCYA 1GMHG 1O2VA 4JYUH 3TJNA 1IQMA 1J8AA 4VGCC 1O3DA 2ZQ1A 1GBHA 1SLXB 2WYJA 5A0BA 1ZTKA 1O2UA 3BEIB 1P2NA 5EXNA 4CREA 3ATLA 4ASHA 1LHCH 1MKXH 1UTNA 2TGTA 2ANKH 2WUBA 2BB4A 1GI3A 2BOKA 5IYTA 3PM3A 1LKBA 1P9SA 1NESE 1C5YB 1RTKA 4A5TS 3AAVA 5DKMA 3QLPH 2R0KA 2PWXA 3AW1A 2H9HA 3PMAB 1O3AA 3V0XA 3MHWU 4YOGA 1Z6EA 1OYQA 1WAYB 2XTTB 1FIZA 2ZHWH 2AEIH 2G4TA 1TOCB 7KMEH 2FYQA 5F8TA 2DUCA 5EPYA 1GG6C 2OD3B 4GCHG 3BIVH 5DG6A 1OWDA 1GGDB 2IPHA 3UWIA 1BITA 1ABIH 3RC4A 1GBMA 2EI7A 1MU8B 1GJ4H 4UD9H 5E0HA 2GTBA 3ENSB 1QRXA 1G36A 1TPSA 5T6FA 2TBSA 3MU5A 1GCDA 1WTGH 3MWIU 1GCTB 1OYTH 1DWDH 1FY4A 1PQ5A 3TIUA 1KY9A 1Z71A 4A7IB 1ZMLA 4Y10E 1HJAC 1ANCA 1ZJKA 4MNXA 3LOXA 1MAYA 2SFAA 1UVPA 5ABWA 1D3DB 1JOUB 2UWOA 1SLWB 3RXJA 1TMUH 3BN9A 4AFUA 4THNH 3V13A 1D6WA 1B5GH 1WBGB 3PMJA 1HIAB 2OC8A 2WPIS 2ZQ2A 1E36B 1AN1E 4Z0KA 3TGIE 4O9VA 1QA0A 2GMTC 3LGWA 1BRBE 5DGJA 1PQ7A 1F5RA 2O8UA 1CBWC 1IQEA 2QF0A 2LPRA 1SGNE 2Z3CA 1O3KA 1NM6A 1RD3B 1YYY1 2A7HA 1P8VC 4GAWA 2W26A 1AVXA 1F5LA 5SGAE 3BG4B 2BLWA 3A89A 2H9EH 3S9BA 1YM0A 5JBTA 2P59A 4ZKSU 3RXLA 4CR9A 2OCVB 4FVBA 4IN1A 2WINI 1DUAA 2G51A 3A7XA 6CHAB 1BCUH 1F0SA 2Z3EA 3QDZB 3SJKA 2AMQA 3A88A 3OY5U 5E8EH 2VH0A 2WV4A 5EOKA 2H6MA 4YLUA 3TGJE 5JBBS 1C4U2 1GL0E 4KTUA 9ESTA 1G3EA 1EP5A 2F3CE 1DY8A 3O8DA 1ZR0A 1A0HB 3SV9A 5C5NA 1H9LB 1S6HA 3ATKA 3S9CA 1NRPH 3B8JA 3RXTA 3EE0B 2UUJB 4GCHF 3ZVAA 2V6NA 5DP5A 4ABIA 1C5TA 4AG1A 1OX1A 4K2YA 2UUYA 2BVRH 3BSQA 2CF8H 3UNQA 4NG9H 4A1XA 1GPZA 4YT6H 1L1NA 1DWEH 1AMHA 3PWCA 1AZ8A 2Y82A 3ZZCA 1Z6JH 2GZ7A 2A4RA 1TMTH 4ABEA 1ELEE 2CXVA 1C1UH 2Z7FE 3BEFB 1ZRKA 2M5TA 2XWAA 2XBXA 4NSVA 1L1JA 2CMYA 5T3HA 3RLWH 1D3PB 1P06A 5E0JA 1C5UA 2SGEE 1TBZH 1YKTA 1K1IA 1JMOH 1QJ6B 3M5NA 2WPJS 1GDUA 1E38B 1QHRB 1MCTA 3HATH 3IWMA 1N8OC 1O2RA 3RXKA 2BQ6B 1CU1A 3SI4H 5JPMH 1EKBB 1GGDC 3KQBA 5G4BA 4AGKA 1QJ7B 1KXBA 1SVPA 1V2JT 8LPRA 1BUIA 4X8UH 1C2EA 1C5MD 2A7JA 3NPSA 2FO9A 3SJOA 2OC7A 5C1YA 3RP2A 1KDQA 3AASA 5EXLA 1MTUA 1P2IA 2TPIZ 3MO6A 4AYYB 1L2EA 3M36A 5LPEA 1Y5AT 1G9IE 1GCTC 2C8WB 4MNVA 1GBFA 1FNIA 2QXIA 3VGCC 1HRTH 3K2UA 1TRMA 3ZVBA 4JZ1A 2XXLA 1WV7H 1AB9B 1HLTH 1NZQH 2Y5FA 4LOYH 7GCHG 2NU0E 1TIOA 3M37A 1SGEE 2KAIA 4SGAE 2PGQB 3U8TH 1B0FA 1GMCG 3RXIA 1AZZA 1QB6A 4BAHB 1QBOA 3F9HA 3MMGA 2NU4E 1LQEA 2A1DB 1GHVH 1O2NA 2VVUA 3UFAA 2G52A 4JK5A 5ESBA 2FI5E 3ATWA 3E0NB 1OP2A 3FVFB 3MU1A 1DDJA 1VCPA 2CHAB 1UHBB 2Y6TA 3M5LA 3HPTB 3S69A 3LONA 1IHSH 1TALA 5BPEA 2TGDA 8KME2 3LT3A 4ABBA 2BXUH 3M7UA 1EP6A 3ZZDA 4D7GA 1YP9A 1BB0B 3A84A 4ABAA 1HAZB 1K9OE 4ISHH 1GBAA 3ZZ9A 1FI8A 3ATIA 2W7SA 1LO6A 5L30H 6CHAC 4WJG2 4NWLA 4ZXXH 5LGOA 1MTNC 2FESH 2A5IA 4D76A 4MPUA 1Q3XA 4Y71A 3MFJA 4KP0A 5AF9H 1FAXA 1GI2A 1F0RA 1ORFA 2SGQE 3T25A 1YCPH 1O3FA 2RA3A 3JZ2B 2Y5GA 1F5KU 1OXGA 3U98H 3HK3B 4AX9H 4X2YA 1W10U 1IQKA 5EXMA 1GBDA 3GCOA 1PPBH 2BMGB 1ESAA 3P8NA 3ODDA 3NWUA 3S7HB 1XM1A 1SGFG 3VPKA 2PUQH 1NN6A 4A6LA 4J2YB 3LC5A 3ODFA 3FAOA 1QBNA 4GHTA 2TGPZ 5BRRE 3I78A 5GDSH 1ELVA 1HAGE 1GI6A 1YPLH 1KLTA 1P01A 3MNBA 2AYWA 1OKXA 4DVAU 2PLXA 4NZLA 1Z1IA 4CH2B 1IQNA 1HIAA 3Q3XA 3PO1C 3SQEE 1QRZA 1C1OA 1C5QA 2AGIX 3TGKE 1O3CA 3TU7H 1MCVA 3F68H 3ZVGA 3W94A 1QTFA 4FUCA 4IW4E 2ZA5A 3RC6A 2QF3A 2BD2A 3PTNA 3RXHA 1P02A 3LKWA 1O3IA 1BBRE 1GMCF 1FQ3A 4X6MA 3KL6A 2Z9GA 2G81E 1O5FH 1HV7A 4Y0ZE 1C1RA 1ZHRA 2ZFTA 1GJBB 2F9PA 1TABE 3TK5A 3SV6A 1HAPH 1TNJA 1QFKH 1J17T 2ZFPH 3SJ8A 1IQHA 2VNTA 1O2PA 1Z7KA 3NKKA 4WH6A 3LJOA 5FHTA 3SNEA 4AB9A 1UVUH 1YLCA 4AG2A 3P8GA 2A5AA 1NY22 1E0FD 1J14A 1GJAB 2EI8A 1FPCH 1SQAA 2XYAA 4OS4A 1TX7A 3RXPA 1SPJA 5A8YA 2HPPH 1Y5BT 4I8HA 1QJ1B 3SNAA 2UWLA 5C20A 3WY8A 4U2WA 3IG6B 4HI3A 1GMDG 3GY5A 2BVXH 1F2SE 2OQ5A 1TNKA 3GDUA 4NGAH 3G01A 2ZHQH 5GPIB 4D8NA 5LPFA 1A46H 1GBLA 1PYTC 4BTTB 4H6SB 4UEHH 1EAXA 4XOJA 2A32A 1JIRA 1NFUA 4U32A 1J16A 3SU6A 2OC0A 2CHAC 4IC5A 4B1TA 5A09A 1HAVA 2Z3DA 3Q76A 1HUTH 2BTCE 2FXRA 4LXBH 3UPEA 1EQ9A 1S81A 2B5TB 1NRSH 1NPMA 2VGCB 2BD7A 2ZU1A 3SJ9A 1YPMH 5EPNA 1TFXA 8GCHG 3M7TA 4ABHA 2ZDNA 4ISNA 3ZVFA 1SHYA 3A7TA 3UNRA 1C5XB 5C1XA 5GXPA 1XXFA 2ZFSA 2AMPA 3RXQA 1O3GA 1V2VT 2BXTH 1YCPM 3RXDA 1HXEH 2FI4E 1K2I1 2WPLS 3SHCH 1TRYA 1ARCA 3KQCA 1AE8H 3MO3A 2J34A 1Y3UA 2Y81A 1BHXF 1BTWA 2BY6X 1THSH 1IHTH 1GJ7B 1Y3YA 2ZPRA 4Q2KA 4F4OC 7ESTE 1PQ8A 3QGNB 1HFDA 1GI0A 2I6QA 4UFEH 3A85A 3HK6B 3MU4A 3LIWA 4M7GA 1V2NT 1WQSA 5I46H 4RSPA 1BRCE 1TX6A 1T7CA 1OS8A 1ZHPA 1YPKH 1A5HA 3KHVA 3LU9B 3KQDA 1K1OA 3NXPA 3RMMH 3SHAH 3UQOA 4TY7A 1GBIA 2VVCA 3F9FA 2RCEA 3SU3A 1T31A 4HGCA 1ANEA 2HOBA 1HXFH 1G3BA 4CHAB 2EA3A 1C2GA 1BIOA 4K69A 3ESTA 5A0AE 1HNEE 1EXFA 3E8LA 1O3MA 3T28A 5GWZA 5K0HA 2GDEH 4X6OA 1UTQA 2F9UA 1Z1JA 1FPHH 1JXPA 1K28D 4GHQA 1Z8JB 4HTCH 3RXRA 1A0LA 1O2QA 3GYLB 3M3SA 2B0FA 1J9CH 2PSYA 1BMNH 1TNLA 1D9IA 1EOJA 1T4UH 1GMDF 2WPHS 1BDAA 2AFQB 2BX4A 1U6QA 1C5OH 2ANMH 2F9NA 1CE5A 1AFQB 3RM0H 4I8KA 1O2ZA 1OSSA 1EJNA 1BBRK 1CA0C 3GDVA 2LNCA 2C93B 1GHBG 4DCDA 3ATMA 1O36A 1DICA 2ESTE 3EDXB 4XDEA 4RKJB 1KIGH 4A92A 1ETTH 3TH2H 4XFQA 1RGQA 1P2KA 4R0IA 2Y7ZA 1C1QA 2XBWA 1V2LT 1TMBH 1GHYH 2R2WU 3M7QA 1GBCA 1GJ8B 2ZCHP 2ZGCA 1SSXA 8GCHF 1S5SA 1C1NA 3BIUH 1RTLA 4Y79A 3TITA 2OP9A 1G2MA 1SGFA 1ZJDA 1L1GA 4K8BA 4YOJA 6LPRA 3M5OA 1ZGVA 1RS0A 1K1JA 2O8LA 4WWYA 1MD7A 1BOQA 3DFLA 1TPAE 4BAQB 1ZGIA 2O8WA 3BTEE 5LPRA 4ZROA 2V3OH 2PUXB 3RXFA 3EQ0H 1OP0A 1BT7A 3L3TA 1S0QA 2CGAA 2ZG0H 1O32A 1LVMA 2QV1A 2ZHEH 2XRCA 5A0CA 1EAWA 4XBCA 2O8TA 2VGCC 1DXWA 2ODPA 1EPTA 3ELAH 3E0PB 4WH8A 4BOHA 3SV2H 4IS5A 5K7RA 4TWWA 5EODA 2BM2A 1CHOG 2CJIA 2ZFFH 5C1UA 3KNXA 4CH8B 2NU3E 4UDWH 4H42U 4QT8C 1C5ZB 3K9XB 2ZZUH 1N6YA 1KXFA 5FCRA 2Q1JA 4Y8YA 5T6DA 1FY1A 1G3CA 1TRNA 3R3GB 1C1VH 3CS0A 3OSYA 1TB6H 1LMWB 1MBQA 1H9IE 2GGVB 2P8OC 1LHGH 4Y8ZA 5L2YH 3PLKA 4X2XA 5E2PA 2O9QA 2R3YA 3RXAA 1SBWA 2QAAA 1O3HA 3O8CA 3FP7E 3A8AA 2I6SA 5JB8S 1AVWA 3LGIA 3JZ1B 2R2MB 3PV4A 1MAXA 4X6NA 1Y59T 2TGAA 1BRAA 1F7ZA 1GHBF 1KYNA 1GDQA 3A83A 3IITA 4I8LA 3DFJA 4CHAC 1FAKH 4MTBA 4SGBE 2STAE 4KGAA 1O3OA 3LPRA 2QXGA 1O2TA 1V2KT 3ZZ4A 2ZP0H 2H2ZA 3UY9A 1PPCE 2BD5A 3VB5A 1ELFA 5FAHA 4FUGA 1AE5A 5DJ7A 1NU9A 1L4ZA 4FUIA 4AB8A 1UK4A 3UR6A 1ANBA 3U1JB 4Y0YE 4LZ4B 4I7YH 1GMHF 3A8DA 3TH4H 1BMLA 1FY8E 1AFQC 3P92A 3U9AH 3K65B 1A61H 1VGCB 4FXGH 2O8MA 2FP7B 2HNTE 2OXSA 4GUXA 1O3BA 4X1SU 1DITH 5A2MH 1GI1A 1JRTA 3TJVA 3TPIZ 1V2RT 1NTPA 1LHDH 2PKAA 1O0DH 2FOFA 3KGPA 1MU6B 1QBVH 1V6DA 3M61U 5C3NA 4Q7ZA 1PPHE 3Q00A 4FUHA 3M5MA 3PTBA 3RXMA 3K6ZA 2FOBA 1QA7A 2ZGXH 1YGCH 3VB4A 2BZ6H 5F8ZA 1AO5A 1SMFE 1SGTA 2F91A 2JH6D 4DGJA 2D8WA 1O34A 2IJOB 2VWOA 1E34B 1YPGH 2FS9A 2BD4A 4X2WA 2G00A 1O2WA 1Z8GA 4UFDH 2AIPA 1HAIH 1A1RA 4MVNA 1AQ7A 4DT7B 1ZSLA 1SGQE 1GDNA 4BXSA 4CBNA 3MU0A 1O2LA 3HKIB 1XUJA 2ZDVH 3F6UH 4NZQA 4AORA 1A3BH 2OBQA 2Y7XA 3SUEA 2ZGHA 4NCYA 1SG8B 1SGDE 1UCYH 4Y6DA 2PR3A 1TGTA 1CGJE 2W5EA 3BG8A 3RM2H 1C5RA 2XNIA 3K6YA 3RXVA 4Y7BA 1D6RA 1QIXB 3MNCA 2QXHA 2FI3E 2NU1E 1DWBH 1C1TA 2D2DA 2PW8H 3RUOA 3BEUA 1GWAA 1WUNH 5A8ZA 2FOGA 3QZQA 5JB9S 2CV3A 2DE9A 2PSXA 2QGRA 1XUFA 2FODA 1V2MT 1AY6H 1C5NH 1C2JA 1ELDE 3GY7A 4E7RG 3E6PH 1HBTH 1MKWK 2VH6A 3SUDA 3UUZA 4O3UA 2VIWA 1O3PB 1SB1H 2AS9A 3TNSA 1GI4A 4OS6A 4GPGA 1C4Y2 1HAYB 3ZZBA 1FLEE 1YLDA 4FUEA 1INCA 2ODQA 1XVMA 1ZTJA 1GVZA 1BRUP 4TYDA 3RU4D 1O2YA 1OWKA 1AFEH 4B75A 1YPHE 1C4V2 1H9HE 1THPB 1O2MA 1T32A 3F9EA 1Y8TA 1E37B 1C1WH 2ALPA 3AVZA 1ZPCA 1AKSB 1ZPBA 3MH5A 4A1TA 1FV9A 1O3LA 1SFQB 1CA8B 5JBCS 4AOQA 1FJSA 2G8TA 3NCLA 2ALVA 1DOJA 3GISB 3GYMA 2JH5D 3O8BA 4ZMAH 1XVOA 2P3TB 1G37A 2FX4A 3U8RH 1C2HA 1EZUC 1P2QA 1T8OA 1YBWA 1O2JA 2Z94A 5EQQA 3SO3A 1GJ6A 1A5IA 4ESTE 2SGFE 1AWHB 4JYVH 1BTZA 5GCHG 2ZNKH 1XUIA 5CHAB 4NIXA 3LC3A 1MZDA 1GHXH 4INKA 1P04A 1OOKB 3E91A 3PWBA 1MKXK 1O5GH 1SGIB 1VGCC 1BA8B 3BG4C 4WY3A 1EX3A 2YOLA 3UR9A 4X1RU 5B6OA 1ZSKA 3RMNH 2VIQA 4K1TA 3T2NA 1C5PA 4OS1A 3ZZ8A 1BTYA 3NK8A 5TJXA 4MNYA 1MBMA 1C2IA 1ZMJA 2G5VA 2GP9B 1A0JA 3TVJB 1C1SA 1P2OA 2RG3A 1O3EA 1UTKA 9LPRA 1P05A 3T26A 2OLGA 2ZTYA 2C8YB 3LGUA 2SNVA 2BX3A 1EOLA 1PPGE 1J15A 1O2XA 3LH1A 2ZECA 3GCTG 3GCHB 4MNWA 3A80A 4O3TA 4FUJA 2CF9H 1AIXH 3SU4A 3TJUA 2FM2A 3SW2B 3W95A 1Z8IB 2HNTC 5FPSA 3URCA 4AFZA 2SGDE 1A2CH 6ESTA 2P3UB 1S83A 4YTAA 2BDIA 4BNRA 3VB6A 5L2ZH 5EQSA 2A4GA 1MTVA 5EGMA 1UJ1A 1SOTA 1KXAA 2J95A 3B9FH 2FX6A 3E16B 2XC5A 2HWLB 2AGGX 1KLIH 1F0UA 2A4OA 4NA9H 1PQAA 1XUGA 3ZVDA 3LGYA 3DHKH 1O31A 1DY9A 1JWTA 4JK6A 4F49A 4YESB 5JBAS 4WMEA 1QL7A 3SUGA 5DP3A 1SI5H 2HALA 3H7TA 4ABFA 7GCHF 1H4WA 3FP8E 2FOAA 4ISLA 1X7AC 1HAHH 1QCPA 1W14U 1HAOH 1C9TA 2ZDMA 3RXBA 4JMYA 1GBKA 3VB7A 1ETRH 2CN0H 3QTVH 1FDPA 2ZDLA 1AGJA 2ZTZA 1RJXB 1CGHA 1TAWA 3V3MA 2QY0B 1EJMA 5FPTA 3F9GA 2QN5T 1Z8RA 4FU9A 3MH4A 4JZDH 4TPIZ 3QX5H 2BLQA 5ETXA 5GCHF 4K1EA 1C5LH 1ZSJA 4WXIA 1H8IH 1XKAC 4U01A 3DA9B 1S85A 1KTSB 2JKHA 2P94A 4NWKA 1C2FA 2VB0A 4ZXYH 2TRMA 1AB9C 2BZAA 1JRSA 2Q6FA 3M3TA 4B2AA 1Y5UT 4I32A 2FMJA 1L4DA 2THFB 1EUFA 3FZDA 2EI6A 1O38A 2XC0A 1P2JA 2VIVA 1TQ0B 2GZ8A 1Y3WA 1W7GH 1OP8A 1SR5C 1LVYA 1DVAH 4CRGA 2BQWB 2QC2A 3TK9A 1O5DH 1LCYA 3QZRA 1PPFE 2A45B 2PKSB 4DJZB 1AUJA 1L0ZA 1OWJA 5EW1H 3S9AA 4ABGA 2ASUB 3PMBB 2VINA 2C8XB 1BQYA 2GCHG 3N7OA 1LVOA 3GCTF 4JCNA 1BTHH 1O33A 1TA6A 1CGIE 2J4IA 4OS5A 3Q77A 1GBEA 1TE0A 2PGBB 3BTME 3CP7A 1O2OA 1YPHC 2VVVA 2C4FH 3AW0A 1TOMH 2OBOA 3QUMP 3A7VA 4DW2U 5HXFA 4DOQA 4AN7A 2FLRH 1C1MA 1KTTB 3C1KA 3B23B 5A8XA 1TA2A 4X8SH 1BTUA 3A7YA 3MNSA 4Q80A 1GG6B 1DM4B 2A2QH 4X2VA 1MH0A 3ZVCA 2FOEA 2D1JA 2F83A 4ZUHA 2QYIA 1LHEH 3MOCA 3C27B 4YO9A 1FY5A 1W13U 3NUMA 3GCHC 3GICB 1BTPA 1K1LA 3L33A 4OS2A 4YLQH 3RC5A 1LDTT 2P93A 2C90B 3MH7A 2ZCKP 4WVPE 1VJ9U 2OTVA 5TCAA 1AHTH 1Y3VA 4X8VH 3STIA 3ZZ7A 1WYKA 1TQ7B 3A8CA 1GL1A 1ANDA 1WU1A 2UUFB 3SGAE 3ZZ6A 3UQVA 1T8NA 2UUKB 3BTFE 1WQVH 4R8TB 4E05H 5J4QA 2C3SA 2G5NA 1KXEA 1SLUB 1G3DA 1GJDB 3KN2A 3E1XB 3SU2A 3GDSA 1Q31A 1UHBA 2FOMB 2FOCA 4IBLH 2V35A 2VIDA 2WUCA 3NZIA 1IQJA 3T62A 4GLYA 4IMQA 1QY6A 1MQ5A 5E0GA 1V2WT 1ABJH 3QTOH 4NA7A 2TIOA 3ZV8A 1ELTA 2Z9JA 1GBJA 5FCKA 1NS3A 3MO9A 1SGPE 4B2BA 1W7XH 1O5EH 2AIQA 1SGCA 3TNTA 1SL3A 1MKWH 4X1QU 3V12A 2FTLE 1DS2E 3GCNA 3CENA 2BHGA 1EZSC 2GCHF 4HZHA 7LPRA 1SHHB 1LPKB 2Y5HA 2ZIQH 4KKDA 4FUBA 1ESTA 1KDQB 2Z6BD 2G4UA 1GI7B 4XBBA 1PJPA 2GV6A 1QGFA 3ZYDA 5HMAA 5IDKA 4UFFH 1A7SA 4KELA 4MG3A 1T4VH 2NWNA 2XW9A 1DLEA 1IQFA 1YCPK 2ZPQA 2OQUA 3HGNA 3QGJA 2GZ9A 2H1UA 1P09A 2G55A 2A0QB 1K22H 3PLBA 1P3CA 3PMHB 2RDLA 4Q7XA 4Y76A 4WXVA 4HFPB 1YF4A 2KAIB 3AAUA 3Q3YA 4X6PA 3SU5A 1C5VA 2OUAA 2P16A 1ARBA 4CBOA 2BDHA 1DWCH 4OGYA 4PROA 3SV7A 1SGRE 3LGTA 5T6GA 3V7TA 1P11E 3ZZ5A 2XWBI 1DX5M 1PPZA 2GDDA 2JETB 4X0WU 1TLDA
chains in the Genus database with same CATH superfamily
1W11U 1NT1A 1Y3XA 3SUFA 3EAJA 3EA9A 2ZGJA 1CHGA 1O3NA 3L6PA 2A31A 5I25A 5ESTE 2J9NA 1S6FA 4YZUA 4XSKU 3BTDE 5AFZH 4D7FA 3EA8A 3ZVEA 3RMLH 1WOFA 2HLCA 1UO6A 1WDIA 2IN2A 3GY6A 1LHFH 2BYAX 1VITG 4ASUD 1AD8H 3BTGE 1YPJH 1IQGA 2KCPA 1RXPA 3SGBE 4FVDA 2D26C 2PP6A 5FBIA 1N8OB 2ZU5A 4WF8A 2ODYB 1V2QT 1LPGB 2R9PA 3S7KB 2AHME 1MUEB 4JZIA 2BD8A 5E2OA 2XBVA 1MMJN 4MLFB 3SNCA 5AHGH 3M3VA 4CR5A 1VCQA 2F9VA 4K60A 1UVOA 1C9PA 5F8XA 1UVTH 3EA7A 1TYNA 1N1LA 4KTSA 3FFGA 1DLKB 2F4LA 3TJOA 8ESTE 2W7UA 1TWXB 3HGPA 1BMAA 3MTYA 4ABDA 2ZC9H 3VGCB 1SLVB 5C5OA 3SORA 1VKYA 1P10A 1T8LA 2EEKA 5CMXH 3FZZA 4B74A 1Q2WA 2B7DH 1BTXA 4MPWA 3BTQE 4E7NA 2GT8A 1ZMNA 1DFPA 1XKBC 2ZCLP 5GIBA 2BDCA 3QK1A 1JIMA 3MU8A 1FUJA 1NU7B 1OWIA 1P9UA 4K5ZA 2SGPE 1G30B 2BLVA 3UREA 3TK6A 2WSSD 2VIOA 1EATA 2H5DA 2J38A 2BDGA 3KIDU 4JZEH 1YC0A 2BLOA 3S0NA 2ZU3A 2VWNA 1B0EA 3UNSA 1O2KA 4X1PU 4FU7A 4AFSA 4BANB 1ESBA 1CQQA 2HPQH 2ZDAH 2ZEBA 3FO8D 1OPHB 1MTWA 5HYOA 1K1PA 2YNBA 1O37A 1SFIA 1QB1A 1SQTA 2V7QD 4BAKB 1EASA 1O5CB 1UW7A 1F92A 1GVKB 2GCTB 5DP7A 1EZXC 5CE1A 4ABJA 1W8BH 2A4QA 3P8FA 2EY4C 3MI4A 2BOHB 1BJUA 1HYLA 2BDYA 1IOEA 1CHOF 1QL8A 3FANA 3Q3KA 4IC6A 4X1NU 1E1RD 3TH3H 1MTNB 3E3TA 1EB2A 2GD4B 1XUKA 1P3EA 1B7XB 4JYTA 5L6NH 1EAUA 5EU8A 1NROH 4Z6AH 2BDBA 3TLOA 1KLJH 2V0BA 2NU2E 1VITF 2Q6GA 1SQOA 3MYWA 1CO7E 5LH8A 1W0YH 3KQEA 1C1PA 2ZDKA 2H9TH 4GSOA 1CVWH 2ZWLH 4LK4A 2F9BH 3BTKE 5FX5A 5FL7D 5HGGA 1NFWA 3KEEA 4NFEA 4Y11E 1O35A 1MQ6A 1V3XA 3QO6A 1P57B 1VZQH 1YPEH 3O8RA 5FX6A 1QNJA 1GI5A 1WTHD 1THRH 2BY7X 1VR1H 5TCCA 1ACBE 2JETC 4F48B 2ZF0H 3PB1E 4B76A 1FN6A 1HAVB 1E35B 1SOZA 4ZKRU 1FZZA 2XC4A 1P2MA 4Y8XA 3OX7U 3PO1B 1KSNA 2ZU2A 1P12E 2ZTXA 3BTHE 2WV5A 1ELAA 1RIWB 4TPYA 1O5BB 2IPQX 3SV8A 1TBRH 5C0TA 4I8JA 2P95A 6GCHG 1A3EH 2Z9IA 1TBQH 1K1NA 1XX9A 5HM9A 1SC8U 3VXFH 1XXDA 2W3KA 1YLNA 4B71A 2Z9LA 4CRBA 2BD3A 1V2UT 4MPVA 3KF2A 3GY4A 4B6FA 1S0RA 5GJ4B 3QN7A 3MH6A 5EG4A 3P6ZB 1GBBA 2JDID 1A5GH 4FUDA 4I86A 3ITIA 2PHBA 2SGAA 3QWCH 2BVSH 3DUXH 1XMNB 3A86A 1FONA 1QL9A 2FEQH 1S82A 1V2ST 1BJVA 2ULLA 2J2UA 2WV9A 4MPXA 2JH0D 1DE7H 3VFEA 2GKVE 4NIVA 1HPGA 1C5SA 4RKOB 2ZI2H 3P70B 3GY3A 2J92A 2SNWA 4A1VA 4IMZA 1UTMA 3A7WA 3EGKH 3I29A 3A7ZA 1UTPA 2VJ1A 1AWFH 1G32B 4ISOA 1GJ5H 2ZHDA 4Q7YA 3FOAA 3SZNA 2QA9E 2FTMA 1YWUA 3GY8A 2FDAA 2BD9A 4TT3D 3UOPA 1K21H 1ZTLA 1ETSH 2EC9H 4MQAA 1ZLRA 1UVSH 1ZOMA 3MNXA 4YXWD 1VCWA 1MABB 3RU4T 2B9LA 4X8TH 4ZKNU 1O2HA 2ZO3H 1UCYE 1PFXC 1ELBA 3VB3A 1N6XA 3PRBA 2YNAA 1GJ9B 1NFYA 2FOHA 5KEDA 5AFYH 2AH4X 1NRQH 1BBRH 3T5FH 3ZZAA 2ZFRH 2ANYA 3FP6E 1QQ4A 1D3QB 4BAMB 1TNGA 3M35A 3P17H 3UWJH 1DANH 2HNTF 1TGCA 1G2LA 4RN6A 3BTTE 2UWPA 1MTSA 4XE4A 1UK3A 2GCTC 2K1QA 1TONA 1UTLM 2Z9KA 1UMAH 2ZU4A 1MD8A 5B6LA 5DP6A 4ZHMU 1D4PB 4AFQA 5PTPA 1FIWA 1RRKA 1ZZZA 3P95A 3STJA 1HJ9A 1KXCA 1V2OT 1O2IA 2ZPSA 1MZAA 4J1YA 5DN6D 2J97A 1BZXE 1SKYE 2F9OA 4CRAA 3SQHE 1D3TB 4LZ1H 3D65E 3U69H 3SNBA 4AGJA 1PPEE 2W3IA 6GCHF 1NO9H 3P8OA 3RXUA 4ZH8A 3T29A 4D9QA 3ZYEA 1O5AB 4IN2A 1LTOA 3RXEA 3UIRA 1FMGA 2WYGA 4BTUB 1LPZB 1GHWH 1QB9A 3OY6U 3LDXH 3PROA 2ZGBH 1HB0B 5FPYA 2AGEX 4K8YA 1BHXB 1ELCA 4TY6A 2QIQA 4U30A 2IOTA 1TPOA 3A81A 2OC1A 1ZPZA 2WPMS 1IQIA 2Y80A 3A87A 2J98A 2FZZA 3CS7A 3LH3A 4BAOB 2QF4A 1GHAG 4NFFA 2VIPA 4O97A 4ZKOU 3RXOA 1VJAU 2HRVA 1QRWA 1DPOA 2FIRH 2OINA 2BDAA 3GY2A 2BY5X 1EPTB 1GI8B 4INLA 1TGBA 4UONA 2VU8E 5DO4H 1WCZA 1P0SH 5HIYA 1RIWC 2DE8A 2BQ7B 4H6TA 1LQDB 1LKAA 1DSUA 2FYRA 1NC6A 3T27A 1V2PT 5EQRA 1F0TA 4KTCA 1O3JA 2A7CA 3H5CB 4M9FA 2VWLA 5C67A 4ZHAA 5JDUB 3LGVA 2FPZA 1CA0B 3EYDA 4BTIB 2FS8A 3DCLA 2AMDA 1DUEA 1JBUH 1AUTC 4I31A 4DY7B 1IQLA 2GX4A 1CSOE 5EJZA 1NRRH 4FU8A 4TWYA 3UOUA 3WWFA 1OWEA 2P3FH 1UTJA 1FY3A 1AU8A 2Q6DA 3FKSD 4NA8A 3D49H 2ZFQH 3A82A 1H1BA 3OU0A 3A8BA 5C17A 1W2KH 2HVXA 5H4IB 4JZFH 4DG4A 4DIHH 1C2DA 1EZQA 2LP6A 3SU0A 2HVYB 1W12U 5FXLA 1K1MA 4ZAEA 4VGCB 2XCNA 4B73A 3OTPA 1O39A 1W0ZU 5JYIA 5CHAC 2H5CA 1WSSH 3RXSA 2C8ZB 2GVFA 1NFXA 2BY8X 4INHA 4YM9A 4D9RA 5DP4A 3U1IB 1TNIA 1DSTA 3SYJA 5DPAA 4NSYA 1HAXB 2K0QA 1A4WH 1UCYK 3U8OH 1W3CA 2GT7A 3GOVB 2PFEA 4CRFA 1O30A 5EW2H 4P02A 1GHZA 2J94A 4WMFA 1CT2E 5AVDA 1AI8H 4UFGH 1CT4E 5F03A 3DD2H 3SNDA 3KCGH 1FN8A 4YOIA 2HLDD 3RU4E 4FUFA 4BXWA 2RA0A 1QR3E 3H7OA 3SOSA 2ILNA 4MDSA 2XCFA 2STBE 3SI3H 4WMDA 3KYFA 3SJIA 4CRCA 1HJ8A 2PKAB 1DT2A 1QURH 1GHAF 1NBME 2R3UA 1VITH 1C2KA 1TGSZ 1ZYOA 3RXCA 1UK2A 2XBYA 3RXGA 2V3HH 3BTWE 1V2TT 2P8OB 3URDA 4CRDA 3BF6H 4Y7AA 1OWHA 1S84A 5DP8A 1BMMH 1C5WB 4ISIH 4UE7H 2PV9B 5DK1A 3HKJB 1AKSA 3F1SB 1ELGA 3VXEH 1HGTH 1HJAB 3OYPA 1IAUA 4B2CA 1HDTH 4H4FA 4ZHLU 3OEED 1O2GH 2PTCE 5F6MA 1AVGH 1M9UA 1SGYE 5C2ZA 4O03A 1ZRBA 2B8OH 3SBKA 4K3JA 5HKKD 2FLBH 3LJJA 4E06H 1T8MA 3PLPA 1P03A 3RMOH 4OS7A 3E90B 1NRNH 3UTUH 2A5KA 3DT0H 1XUHA 4OGXA 1HCGA 3D23A 1TGNA 1ID5H 1EPTC 1QQUA 1RTFB 1TNHA 4AZ2B 2GMTB 3BV9B 3ZZ3A 1ZHMA 4NIYA 4GVUA 1CBWB 1O2SA 2R0LA 2IJD1 4I33A 1H8DH 2ZHFH 2WZQA 5HM2A 2ANWA 4I8GA 2VWMA 1GI9B 2PTNA 2WPKS 1CT0E 1LVBA 3D62A 2A2XH 3RLYH 1GVLA 5DP9A 4YT7H 3ZV9A 1C2LA 1TPPA 4AYVB 1EJAA 4XBDA 1EAIA 2AERH 3OTJE 1UTOA 3ZIAD 1K0HA 1C2MA 3VEQB 1GBTA 1DXPA 3SU1A 1FXYA 3R0FA 1YY3A 1EB1H 1PYTD 2ZKSA 1GJCB 2JIZD 3I77A 5FBEA 1RFNA 2LELA 3UAIC 2GV7A 2QXJA 1TX8A 4DIIH 5J4SA 3SN8A 2BY9X 3PYHA 4K1SA 4IGDA 4XD7D 3SGQE 1KXDA 4NIWA 3RDZA 2HGTH 2PKSC 2FWWA 4RT1A 4DURA 2QCYA 1GMHG 1O2VA 4JYUH 3TJNA 1IQMA 1J8AA 4VGCC 1O3DA 2ZQ1A 1GBHA 1SLXB 2WYJA 5A0BA 1ZTKA 1O2UA 3BEIB 1P2NA 3FN8A 5EXNA 4CREA 2VBCA 3ATLA 4ASHA 1LHCH 1MKXH 1UTNA 2TGTA 2ANKH 2WUBA 2BB4A 1GI3A 2BOKA 5IYTA 3PM3A 1LKBA 1P9SA 1NESE 1C5YB 1RTKA 4A5TS 3AAVA 5DKMA 3QLPH 2R0KA 2PWXA 3AW1A 2H9HA 3PMAB 1O3AA 3V0XA 3MHWU 4YOGA 1Z6EA 1OYQA 5C94A 1WAYB 2XTTB 1FIZA 2ZHWH 2AEIH 4OM9A 2G4TA 1TOCB 5CHBA 7KMEH 2FYQA 5F8TA 2DUCA 5EPYA 1GG6C 2OD3B 1QZ8A 4GCHG 3BIVH 4HG6A 5DG6A 1OWDA 1GGDB 2IPHA 3UWIA 1BITA 3H09A 1ABIH 3RC4A 1GBMA 2EI7A 1MU8B 1GJ4H 4UD9H 5E0HA 2GTBA 3ENSB 1QRXA 1G36A 1TPSA 5T6FA 2TBSA 3MU5A 1GCDA 1WTGH 3MWIU 1GCTB 1OYTH 1DWDH 1FY4A 1PQ5A 3TIUA 1KY9A 1Z71A 4A7IB 4Q4LA 1ZMLA 4Y10E 1HJAC 1ANCA 1ZJKA 4MNXA 3LOXA 1MAYA 3DSOA 2SFAA 1UVPA 5ABWA 1D3DB 1JOUB 2UWOA 1SLWB 3RXJA 1TMUH 3BN9A 4AFUA 4THNH 3V13A 1D6WA 1B5GH 1WBGB 3MQKC 3PMJA 1HIAB 2OC8A 2WPIS 2ZQ2A 1E36B 2KCYA 1AN1E 4Z0KA 3TGIE 4O9VA 5F53A 1QA0A 2GMTC 3LGWA 1BRBE 5DGJA 1PQ7A 1F5RA 2O8UA 1CBWC 1IQEA 2L6OA 2QF0A 2LPRA 1SGNE 2Z3CA 1O3KA 1NM6A 1RD3B 1YYY1 2A7HA 1P8VC 4GAWA 2W26A 1AVXA 1F5LA 5SGAE 3BG4B 2YMSB 2BLWA 3A89A 2H9EH 1FX0B 3S9BA 1YM0A 5JBTA 2P59A 4ZKSU 3RXLA 4CR9A 2OCVB 4FVBA 4IN1A 2WINI 1DUAA 2G51A 3A7XA 1COWD 6CHAB 1BCUH 1F0SA 2Z3EA 3QDZB 3SJKA 2AMQA 3A88A 3OY5U 5E8EH 2VH0A 2WV4A 5EOKA 2KM0A 2H6MA 4YLUA 3TGJE 5JBBS 1C4U2 1GL0E 4KTUA 9ESTA 1G3EA 1EP5A 2F3CE 1DY8A 3O8DA 3WWBA 1ZR0A 1A0HB 3SV9A 1H8HD 5C5NA 1H9LB 1S6HA 3ATKA 3S9CA 1NRPH 3B8JA 3RXTA 3EE0B 2UUJB 4GCHF 3ZVAA 2V6NA 5DP5A 4ABIA 1C5TA 4AG1A 1OX1A 4K2YA 2UUYA 2BVRH 3BSQA 2CF8H 3UNQA 4NG9H 4A1XA 1GPZA 2JJ1D 4YT6H 1L1NA 1DWEH 1AMHA 3PWCA 1AZ8A 2Y82A 3ZZCA 1Z6JH 2GZ7A 2A4RA 1TMTH 4ABEA 1ELEE 2CXVA 1C1UH 2Z7FE 3BEFB 1ZRKA 2M5TA 2XWAA 2XBXA 4NSVA 1L1JA 2CMYA 5T3HA 3RLWH 1D3PB 1P06A 5E0JA 1C5UA 2SGEE 1TBZH 1YKTA 1K1IA 1JMOH 1QJ6B 3M5NA 2WPJS 1GDUA 1E38B 1QHRB 1MCTA 3HATH 3IWMA 1N8OC 1O2RA 3RXKA 2BQ6B 1CU1A 3SI4H 5JPMH 1EKBB 1GGDC 3KQBA 5G4BA 4AGKA 1QJ7B 1KXBA 1SVPA 1V2JT 8LPRA 1BUIA 4X8UH 1C2EA 1C5MD 2A7JA 3NPSA 2FO9A 3SJOA 2OC7A 5C1YA 3RP2A 1KDQA 3AASA 5EXLA 1MTUA 1P2IA 2TPIZ 3MO6A 4AYYB 1L2EA 3M36A 5LPEA 1Y5AT 1G9IE 1GCTC 2C8WB 4MNVA 1GBFA 1FNIA 2QXIA 3VGCC 1HRTH 3K2UA 1TRMA 3ZVBA 4JZ1A 2XXLA 1WV7H 1WXRA 1AB9B 1HLTH 1NZQH 2Y5FA 5EIYA 4LOYH 7GCHG 2NU0E 1TIOA 3M37A 1SGEE 2KAIA 4SGAE 2PGQB 3U8TH 1B0FA 1GMCG 3RXIA 1AZZA 1QB6A 4BAHB 1QBOA 3F9HA 3MMGA 2NU4E 1LQEA 2A1DB 1GHVH 1O2NA 2VVUA 3UFAA 4B6EA 2G52A 4JK5A 5ESBA 2FI5E 2EQNA 3ATWA 3E0NB 1OP2A 3FVFB 3MU1A 1DDJA 1VCPA 2CHAB 1UHBB 2Y6TA 3M5LA 3HPTB 3S69A 3LONA 1IHSH 1TALA 5BPEA 2TGDA 8KME2 3LT3A 4ABBA 2BXUH 3M7UA 1EP6A 3U28C 3ZZDA 4D7GA 1YP9A 1BB0B 2YMSC 3A84A 4RT0A 4ABAA 1HAZB 1K9OE 4ISHH 1GBAA 3ZZ9A 1FI8A 3ATIA 2W7SA 1LO6A 5L30H 6CHAC 4WJG2 4NWLA 4ZXXH 5LGOA 1MTNC 2FESH 2A5IA 4D76A 4MPUA 1Q3XA 4Y71A 3MFJA 4KP0A 5AF9H 1FAXA 1GI2A 1F0RA 1ORFA 2SGQE 3T25A 1YCPH 1O3FA 2RA3A 3JZ2B 2Y5GA 1F5KU 1OXGA 3U98H 3HK3B 4AX9H 4X2YA 1W10U 1IQKA 5EXMA 1GBDA 3GCOA 1KMHB 2KR7A 1PPBH 2BMGB 1ESAA 3P8NA 3ODDA 3NWUA 3S7HB 1XM1A 1SGFG 3VPKA 2PUQH 1NN6A 4A6LA 4J2YB 3LC5A 3ODFA 3FAOA 1QBNA 4GHTA 2TGPZ 5BRRE 3I78A 5GDSH 1ELVA 1HAGE 1GI6A 1YPLH 1KLTA 1P01A 3MNBA 2AYWA 4Z1MD 1OKXA 4DVAU 2PLXA 4NZLA 1Z1IA 4CH2B 1IQNA 1HIAA 3Q3XA 3PO1C 3SQEE 2RFKC 1QRZA 1C1OA 1C5QA 2AGIX 3TGKE 1O3CA 3TU7H 2XNDD 2XOKD 1MCVA 3F68H 3ZVGA 3W94A 1QTFA 4FUCA 4IW4E 2ZA5A 3RC6A 2QF3A 2BD2A 3PTNA 3RXHA 1P02A 3LKWA 1O3IA 4DT4A 1BBRE 1GMCF 1FQ3A 4X6MA 3KL6A 2Z9GA 2G81E 2OK5A 1O5FH 1HV7A 4Y0ZE 1C1RA 1ZHRA 2ZFTA 1GJBB 2F9PA 1TABE 3TK5A 3SV6A 1HAPH 1TNJA 1QFKH 1J17T 2ZFPH 3SJ8A 1IQHA 2VNTA 1O2PA 1Z7KA 3NKKA 4WH6A 3LJOA 5FHTA 3SNEA 4AB9A 1UVUH 1YLCA 4AG2A 3P8GA 2A5AA 1NY22 1E0FD 1J14A 1GJAB 2EI8A 1FPCH 1SQAA 2XYAA 4OS4A 1TX7A 3RXPA 1SPJA 5A8YA 2HPPH 1Y5BT 4I8HA 1QJ1B 3SNAA 2UWLA 5C20A 3WY8A 4U2WA 3IG6B 4HI3A 1GMDG 3GY5A 2BVXH 1F2SE 2OQ5A 1TNKA 3GDUA 4NGAH 3G01A 2ZHQH 5GPIB 4D8NA 5LPFA 1A46H 1GBLA 1PYTC 4BTTB 4H6SB 4UEHH 1EAXA 4XOJA 2A32A 4RI0A 1JIRA 1NFUA 3KYGA 4U32A 1J16A 3SU6A 2OC0A 2CHAC 4IC5A 4B1TA 5A09A 1HAVA 2Z3DA 3Q76A 1HUTH 2BTCE 2FXRA 4LXBH 3UPEA 1EQ9A 1S81A 2B5TB 1NRSH 1NPMA 2VGCB 2BD7A 2ZU1A 3SJ9A 1YPMH 5EPNA 1TFXA 8GCHG 3M7TA 4ABHA 2ZDNA 4ISNA 3ZVFA 1SHYA 3A7TA 3UNRA 1C5XB 5C1XA 5GXPA 4XRNA 1XXFA 2ZFSA 2AMPA 3RXQA 3F3BA 1O3GA 1BMFD 1V2VT 2BXTH 1YCPM 3RXDA 1HXEH 2FI4E 1K2I1 2WPLS 3SHCH 1TRYA 1ARCA 3KQCA 2QF5A 1AE8H 3MO3A 2J34A 1Y3UA 2Y81A 2KFWA 1BHXF 1BTWA 2BY6X 1THSH 1IHTH 1GJ7B 1Y3YA 2ZPRA 4Q2KA 4F4OC 7ESTE 1PQ8A 3QGNB 1HFDA 1GI0A 2I6QA 4UFEH 3A85A 3HK6B 3MU4A 3LIWA 4M7GA 1V2NT 1WQSA 5I46H 4RSPA 1BRCE 1TX6A 1T7CA 1OS8A 1ZHPA 1YPKH 1A5HA 3KHVA 3LU9B 3KQDA 1K1OA 3NXPA 3RMMH 3N7DA 3SHAH 3UQOA 4TY7A 1GBIA 2VVCA 3F9FA 2RCEA 3SU3A 1T31A 4HGCA 1ANEA 2HOBA 1HXFH 1G3BA 4P00A 4CHAB 2EA3A 1C2GA 1BIOA 2L74A 4K69A 2W6ID 3ESTA 5A0AE 1HNEE 1EXFA 3E8LA 3OFND 1O3MA 3T28A 5GWZA 5K0HA 2GDEH 4X6OA 1UTQA 2F9UA 5GNDA 1Z1JA 1FPHH 1JXPA 1K28D 4GHQA 1Z8JB 4HTCH 3RXRA 1A0LA 1O2QA 3GYLB 3M3SA 2B0FA 1J9CH 2PSYA 1BMNH 1TNLA 1D9IA 1EOJA 1T4UH 1GMDF 2WPHS 1BDAA 2AFQB 2BX4A 1U6QA 1C5OH 2ANMH 2F9NA 1CE5A 1AFQB 3RM0H 4I8KA 1O2ZA 4F55A 1OSSA 1EJNA 1BBRK 1CA0C 3GDVA 3OAAD 2LNCA 2C93B 1GHBG 4DCDA 3ATMA 1O36A 1DICA 2ESTE 3EDXB 4XDEA 4RKJB 1KIGH 4A92A 1ETTH 3TH2H 4XFQA 1RGQA 1P2KA 4R0IA 2Y7ZA 1C1QA 2XBWA 1V2LT 1TMBH 1GHYH 2R2WU 3M7QA 1GBCA 1GJ8B 3WW7A 2ZCHP 2ZGCA 1SSXA 8GCHF 1S5SA 1C1NA 3BIUH 1RTLA 4Y79A 3TITA 2OP9A 1G2MA 3PRDA 1SGFA 1ZJDA 1L1GA 4K8BA 4YOJA 6LPRA 3M5OA 1ZGVA 1RS0A 1K1JA 2O8LA 4WWYA 1MD7A 3KQ5A 1BOQA 3DFLA 1TPAE 3OE7D 1ZGIA 4BAQB 2O8WA 3BTEE 5LPRA 4ZROA 2V3OH 2PUXB 4FETA 3RXFA 3EQ0H 1OP0A 1BT7A 3L3TA 1S0QA 2CGAA 2ZG0H 1O32A 1LVMA 2QV1A 2ZHEH 2XRCA 5A0CA 1EAWA 4XBCA 2O8TA 2VGCC 1DXWA 2ODPA 3F2HA 1EPTA 3ELAH 3E0PB 4WH8A 4BOHA 3SV2H 4IS5A 5K7RA 4TWWA 4ZCNA 5EODA 2BM2A 3AK5A 1CHOG 2CJIA 2ZFFH 5C1UA 3KNXA 4CH8B 2NU3E 4UDWH 4H42U 4QT8C 1C5ZB 3K9XB 2ZZUH 1N6YA 1KXFA 5FCRA 2Q1JA 4Y8YA 5T6DA 1FY1A 1G3CA 1TRNA 3R3GB 1C1VH 5KECA 3CS0A 1W0JD 3OSYA 1TB6H 1LMWB 1MBQA 1H9IE 2GGVB 2P8OC 2WPDD 1LHGH 4Y8ZA 4ACBA 5L2YH 3PLKA 4X2XA 5E2PA 5T1VA 2O9QA 2R3YA 3RXAA 1SBWA 2QAAA 1O3HA 3O8CA 3EE7A 3A8AA 2I6SA 3FP7E 5JB8S 1AVWA 3LGIA 3JZ1B 2R2MB 3PV4A 1MAXA 4X6NA 1Y59T 2TGAA 1BRAA 1F7ZA 1GHBF 1KYNA 1GDQA 3A83A 3IITA 4I8LA 3DFJA 4CHAC 1FAKH 4MTBA 4SGBE 2STAE 4KGAA 1O3OA 3LPRA 1W0KD 2QXGA 1O2TA 1V2KT 3ZZ4A 2ZP0H 2H2ZA 3UY9A 1PPCE 2BD5A 3VB5A 1ELFA 5FAHA 4FUGA 1AE5A 5DJ7A 1NU9A 1L4ZA 2J98B 4FUIA 3NRLA 4AB8A 1UK4A 3UR6A 1ANBA 3U1JB 4Y0YE 4LZ4B 4I7YH 1GMHF 3A8DA 3TH4H 3SZEA 1BMLA 1FY8E 1AFQC 3P92A 3U9AH 3K65B 1A61H 1VGCB 4FXGH 3PV2A 2O8MA 2FP7B 2HNTE 4Q63A 2OXSA 4GUXA 1O3BA 4X1SU 1DITH 5A2MH 5C0UA 1GI1A 3CNRA 1JRTA 3TJVA 3TPIZ 1V2RT 1NTPA 1LHDH 1O0DH 2PKAA 2FOFA 3KGPA 1MU6B 1QBVH 1V6DA 3M61U 3F0OA 5DSFA 5C3NA 4Q7ZA 1PPHE 3Q00A 4FUHA 3M5MA 3PTBA 3RXMA 3K6ZA 2FOBA 1QA7A 2ZGXH 1YGCH 3VB4A 2BZ6H 5F8ZA 1AO5A 3N99A 1SMFE 1SGTA 2F91A 1EFRD 2JH6D 4DGJA 2D8WA 1O34A 2IJOB 2VWOA 1E34B 1YPGH 2FS9A 2BD4A 4X2WA 2G00A 1O2WA 1Z8GA 4UFDH 2AIPA 1HAIH 1A1RA 4MVNA 1AQ7A 4DT7B 1ZSLA 1SGQE 1GDNA 4BXSA 4CBNA 3MU0A 1O2LA 3HKIB 1XUJA 2ZDVH 3F6UH 4NZQA 4AORA 1A3BH 2OBQA 2Y7XA 3SUEA 2ZGHA 4NCYA 1SG8B 1E1QD 1SGDE 1UCYH 4Y6DA 2PR3A 1TGTA 1CGJE 2W5EA 3BG8A 3RM2H 1C5RA 2XNIA 3K6YA 3RXVA 4Y7BA 1D6RA 1QIXB 3MNCA 2QXHA 2FI3E 2NU1E 1DWBH 1C1TA 2D2DA 2PW8H 3RUOA 3BEUA 1GWAA 1WUNH 5A8ZA 2FOGA 3QZQA 5JB9S 2CV3A 3PV5A 2DE9A 2PSXA 2QGRA 5IK2D 1XUFA 2FODA 1V2MT 1AY6H 1C5NH 1C2JA 1ELDE 3GY7A 4E7RG 3E6PH 1HBTH 1MKWK 2VH6A 3SUDA 3UUZA 4O3UA 2VIWA 2KCOA 1O3PB 1SB1H 2AS9A 3TNSA 1GI4A 2KZ4A 4OS6A 4GPGA 1C4Y2 1HAYB 3ZZBA 1FLEE 1YLDA 4FUEA 3GS9A 1INCA 2ODQA 1XVMA 1ZTJA 1GVZA 1BRUP 4TYDA 3RU4D 1O2YA 1OWKA 1AFEH 4B75A 1YPHE 2V3MA 1C4V2 1H9HE 1THPB 1O2MA 1T32A 3F9EA 1Y8TA 1E37B 1C1WH 2ALPA 3AVZA 3N7EA 1ZPCA 1AKSB 1ZPBA 3MH5A 3UB0A 1FV9A 1O3LA 1SFQB 1CA8B 4A1TA 5JBCS 4AOQA 1FJSA 1NBMD 2G8TA 3NCLA 2ALVA 1DOJA 3GISB 3GYMA 2JH5D 3O8BA 4ZMAH 1XVOA 2P3TB 1G37A 2FX4A 3U8RH 1C2HA 1EZUC 1P2QA 1T8OA 1YBWA 1O2JA 2Z94A 1SQRA 5EQQA 3SO3A 1GJ6A 1A5IA 4ESTE 2SGFE 1AWHB 4JYVH 3F0PA 1BTZA 5GCHG 2ZNKH 1XUIA 5CHAB 4NIXA 3LC3A 1MZDA 1GHXH 4INKA 1P04A 1OOKB 3E91A 3PWBA 1MKXK 1O5GH 1SGIB 1VGCC 1BA8B 3BG4C 4WY3A 1EX3A 2YOLA 3UR9A 4X1RU 5B6OA 1ZSKA 3RMNH 2VIQA 1H8ED 4K1TA 3T2NA 1C5PA 4OS1A 3ZZ8A 1BTYA 1OHHD 3NK8A 5EJLA 5TJXA 4MNYA 1MBMA 1C2IA 1ZMJA 2G5VA 2GP9B 1A0JA 3TVJB 1C1SA 1P2OA 2RG3A 1O3EA 1UTKA 9LPRA 1P05A 3T26A 2OLGA 2ZTYA 2C8YB 3LGUA 2SNVA 2BX3A 1EOLA 1PPGE 1J15A 1O2XA 3LH1A 2ZECA 3GCTG 3GCHB 4MNWA 3A80A 4O3TA 4FUJA 2CF9H 1AIXH 3SU4A 3TJUA 2FM2A 3SW2B 3W95A 1Z8IB 2HNTC 5FPSA 3URCA 4AFZA 2SGDE 1A2CH 6ESTA 2K8IA 2P3UB 1S83A 4YTAA 2BDIA 4BNRA 3VB6A 4AC9A 5L2ZH 5EQSA 2A4GA 1MTVA 5EGMA 1UJ1A 1SOTA 1KXAA 2J95A 3B9FH 2FX6A 3E16B 2XC5A 2HWLB 5CDFE 2AGGX 1KLIH 1F0UA 2A4OA 4NA9H 1PQAA 1XUGA 3ZVDA 3LGYA 3DHKH 1O31A 1DY9A 1JWTA 4JK6A 4F49A 4YESB 5JBAS 4WMEA 1QL7A 3SUGA 2GJGA 5DP3A 1SI5H 2HALA 3H7TA 4ABFA 7GCHF 1H4WA 3FP8E 2FOAA 4ISLA 1X7AC 1HAHH 1QCPA 1W14U 1HAOH 2J5UA 1C9TA 2ZDMA 3RXBA 4JMYA 1GBKA 3VB7A 1ETRH 2CN0H 3QTVH 1FDPA 2ZDLA 2F43B 1AGJA 2ZTZA 1RJXB 1CGHA 1TAWA 3V3MA 2QY0B 1EJMA 5FPTA 3F9GA 2QN5T 1Z8RA 4FU9A 4FOUC 3MH4A 4JZDH 4TPIZ 3QX5H 2BLQA 5ETXA 5GCHF 4K1EA 1C5LH 1ZSJA 2RDEA 4WXIA 1H8IH 1XKAC 4U01A 3DA9B 1S85A 5EJ1A 3DSPA 3VG8A 1KTSB 2JKHA 2P94A 4NWKA 1C2FA 2VB0A 4ZXYH 2TRMA 1AB9C 2BZAA 1JRSA 2Q6FA 3M3TA 4B2AA 1Y5UT 4I32A 2FMJA 1L4DA 2THFB 1EUFA 3FZDA 2EI6A 1O38A 2XC0A 1P2JA 2VIVA 1TQ0B 2GZ8A 1Y3WA 3W1EA 1W7GH 1OP8A 1SR5C 2JJ2D 1LVYA 5HIZA 1DVAH 4CRGA 2BQWB 2QC2A 3TK9A 1O5DH 1LCYA 3QZRA 1PPFE 2A45B 2PKSB 4DJZB 1AUJA 1L0ZA 2KX4A 1OWJA 5KGOA 5EW1H 3S9AA 4ABGA 2ASUB 3PMBB 2VINA 2C8XB 1BQYA 2GCHG 3N7OA 2YMSD 1LVOA 3GCTF 4JCNA 1BTHH 1O33A 1TA6A 1CGIE 2J4IA 4OS5A 3Q77A 1GBEA 1TE0A 2PGBB 3F2GA 3BTME 3CP7A 1O2OA 1YPHC 2VVVA 2C4FH 3AW0A 1TOMH 2KCAA 2OBOA 3QUMP 3A7VA 4DW2U 5HXFA 4DOQA 4AN7A 2FLRH 1C1MA 1KTTB 3C1KA 3B23B 5A8XA 1TA2A 4X8SH 1BTUA 3A7YA 3MNSA 4Q80A 1GG6B 1DM4B 2A2QH 4X2VA 1MH0A 3ZVCA 2FOEA 2D1JA 2F83A 4ZUHA 3DSGA 2QYIA 1LHEH 3MOCA 3C27B 4YO9A 1FY5A 1W13U 3NUMA 3GCHC 3GICB 1BTPA 1K1LA 3L33A 4OS2A 4YLQH 3RC5A 1LDTT 2P93A 2W6JD 2C90B 3MH7A 1E79D 3OEHD 2ZCKP 4WVPE 1VJ9U 2OTVA 3F2FA 5TCAA 1AHTH 1Y3VA 4X8VH 3STIA 3ZZ7A 1WYKA 1TQ7B 3A8CA 1GL1A 1ANDA 1WU1A 2UUFB 4ACAA 3SGAE 3ZZ6A 3UQVA 1T8NA 2UUKB 3BTFE 2M2AA 1WQVH 4R8TB 4E05H 5J4QA 2C3SA 2G5NA 1KXEA 1SLUB 1G3DA 1GJDB 3KN2A 4TSFD 3E1XB 3SU2A 3GDSA 1Q31A 1UHBA 2FOMB 2FOCA 4IBLH 2V35A 2VIDA 2WUCA 3NZIA 1IQJA 3T62A 4GLYA 4IMQA 1QY6A 1MQ5A 5E0GA 1V2WT 1ABJH 3QTOH 1S6LA 4NA7A 2TIOA 3ZV8A 1ELTA 2Z9JA 1GBJA 5FCKA 1NS3A 3MO9A 1SGPE 4B2BA 1W7XH 1O5EH 2AIQA 1SGCA 3TNTA 1SL3A 1MKWH 4X1QU 3V12A 2FTLE 1DS2E 2QE7D 3GCNA 3CENA 2BHGA 1EZSC 2GCHF 4HZHA 7LPRA 1SHHB 1LPKB 2Y5HA 2ZIQH 4KKDA 4FUBA 1ESTA 1KDQB 2Z6BD 2G4UA 1GI7B 4XBBA 1PJPA 2GV6A 1QGFA 2WHXA 5HMAA 3ZYDA 5IDKA 4UFFH 1A7SA 4KELA 4MG3A 1T4VH 2NWNA 2XW9A 1DLEA 1IQFA 1YCPK 2ZPQA 2OQUA 3HGNA 3QGJA 2GZ9A 2H1UA 1P09A 2G55A 2A0QB 1K22H 2CK3D 3PLBA 1P3CA 3PMHB 2RDLA 4Q7XA 4Y76A 4WXVA 4HFPB 1YF4A 2KAIB 3AAUA 3Q3YA 4X6PA 3SU5A 1C5VA 2OUAA 2P16A 1ARBA 4CBOA 2BDHA 1DWCH 4OGYA 4PROA 3SV7A 1SGRE 3LGTA 5T6GA 3V7TA 1P11E 3ZZ5A 2XWBI 1DX5M 1PPZA 2GDDA 2JETB 4X0WU 1TLDA
chains in the Genus database with same CATH topology
1W11U 1NT1A 1Y3XA 3SUFA 3EAJA 3EA9A 2ZGJA 1CHGA 1O3NA 3L6PA 2A31A 5I25A 5ESTE 2J9NA 1S6FA 4YZUA 4XSKU 3BTDE 5AFZH 4D7FA 3EA8A 3ZVEA 3RMLH 1WOFA 2HLCA 1UO6A 2IN2A 3GY6A 1LHFH 2BYAX 1VITG 1AD8H 3BTGE 1YPJH 1IQGA 1RXPA 3SGBE 4FVDA 2D26C 5FBIA 1N8OB 2ZU5A 4WF8A 2ODYB 1V2QT 1LPGB 2R9PA 3S7KB 4JZIA 1MUEB 5E2OA 2BD8A 2XBVA 1MMJN 4MLFB 3SNCA 5AHGH 3M3VA 4CR5A 1VCQA 2F9VA 4K60A 1UVOA 1C9PA 5F8XA 1UVTH 3EA7A 1TYNA 1N1LA 4KTSA 3FFGA 1DLKB 3TJOA 8ESTE 2W7UA 1TWXB 3HGPA 1BMAA 3MTYA 4ABDA 2ZC9H 3VGCB 1SLVB 5C5OA 3SORA 2EEKA 1P10A 1T8LA 5CMXH 3FZZA 4B74A 1Q2WA 2B7DH 1BTXA 4MPWA 3BTQE 4E7NA 2GT8A 1ZMNA 1DFPA 1XKBC 2ZCLP 5GIBA 2BDCA 3QK1A 1JIMA 3MU8A 1FUJA 1NU7B 1OWIA 1P9UA 4K5ZA 2SGPE 1G30B 2BLVA 3UREA 3TK6A 2VIOA 1EATA 2H5DA 2J38A 2BDGA 3KIDU 4JZEH 1YC0A 2BLOA 3S0NA 2ZU3A 2VWNA 1B0EA 3UNSA 1O2KA 4X1PU 4FU7A 4AFSA 4BANB 1ESBA 1CQQA 2HPQH 2ZDAH 2ZEBA 1OPHB 1MTWA 5HYOA 1K1PA 2YNBA 1O37A 1SFIA 1QB1A 1SQTA 4BAKB 1EASA 1O5CB 1F92A 1GVKB 2GCTB 5DP7A 1EZXC 5CE1A 4ABJA 1W8BH 2A4QA 3P8FA 3MI4A 2BOHB 1BJUA 1HYLA 2BDYA 1IOEA 1CHOF 1QL8A 3FANA 3Q3KA 4IC6A 4X1NU 3TH3H 1MTNB 3E3TA 1EB2A 2GD4B 1XUKA 1P3EA 1B7XB 4JYTA 5L6NH 1EAUA 5EU8A 1NROH 4Z6AH 2BDBA 3TLOA 1KLJH 2V0BA 2NU2E 1VITF 2Q6GA 1SQOA 3MYWA 1CO7E 5LH8A 1W0YH 3KQEA 1C1PA 2ZDKA 2H9TH 4GSOA 1CVWH 2ZWLH 4LK4A 2F9BH 3BTKE 5FX5A 5HGGA 1NFWA 3KEEA 4NFEA 4Y11E 1O35A 1MQ6A 1V3XA 3QO6A 1P57B 1VZQH 1YPEH 3O8RA 5FX6A 1QNJA 1GI5A 1WTHD 1THRH 2BY7X 1VR1H 5TCCA 1ACBE 2JETC 2ZF0H 3PB1E 4B76A 1FN6A 1HAVB 1E35B 1SOZA 4ZKRU 1FZZA 2XC4A 1P2MA 4Y8XA 3OX7U 3PO1B 1KSNA 2ZU2A 1P12E 2ZTXA 3BTHE 2WV5A 1ELAA 1RIWB 4TPYA 1O5BB 3SV8A 1TBRH 4I8JA 2P95A 6GCHG 1A3EH 2Z9IA 1TBQH 1K1NA 1XX9A 5HM9A 1SC8U 3VXFH 1XXDA 2W3KA 4B71A 2Z9LA 4CRBA 2BD3A 1V2UT 4MPVA 3KF2A 3GY4A 1S0RA 5GJ4B 3QN7A 3MH6A 5EG4A 3P6ZB 1GBBA 1A5GH 4FUDA 3ITIA 2PHBA 2SGAA 3QWCH 2BVSH 3DUXH 1XMNB 3A86A 1FONA 1QL9A 2FEQH 1S82A 1V2ST 1BJVA 2ULLA 2J2UA 4MPXA 2JH0D 1DE7H 3VFEA 2GKVE 4NIVA 1HPGA 1C5SA 4RKOB 2ZI2H 3P70B 3GY3A 2J92A 2SNWA 4A1VA 4IMZA 1UTMA 3A7WA 3EGKH 3I29A 3A7ZA 1UTPA 2VJ1A 1AWFH 1G32B 4ISOA 1GJ5H 2ZHDA 4Q7YA 3SZNA 2QA9E 2FTMA 3GY8A 2FDAA 2BD9A 3UOPA 1K21H 1ZTLA 1ETSH 2EC9H 4MQAA 1ZLRA 1UVSH 1ZOMA 3MNXA 1VCWA 3RU4T 2B9LA 4X8TH 4ZKNU 1O2HA 2ZO3H 1UCYE 1PFXC 1ELBA 3VB3A 1N6XA 2YNAA 1GJ9B 1NFYA 2FOHA 5AFYH 2AH4X 1NRQH 1BBRH 3T5FH 3ZZAA 2ZFRH 2ANYA 3FP6E 1QQ4A 1D3QB 4BAMB 1TNGA 3M35A 3P17H 3UWJH 1DANH 2HNTF 1TGCA 1G2LA 4RN6A 3BTTE 2UWPA 1MTSA 4XE4A 1UK3A 2GCTC 2K1QA 1TONA 1UTLM 2Z9KA 1UMAH 2ZU4A 1MD8A 5DP6A 4ZHMU 1D4PB 4AFQA 5PTPA 1FIWA 1RRKA 1ZZZA 3P95A 3STJA 1HJ9A 1KXCA 1V2OT 1O2IA 2ZPSA 1MZAA 4J1YA 1BZXE 2F9OA 4CRAA 4LZ1H 3SQHE 1D3TB 3D65E 3U69H 3SNBA 4AGJA 1PPEE 2W3IA 6GCHF 1NO9H 3P8OA 3RXUA 4ZH8A 3T29A 4D9QA 3ZYEA 1O5AB 4IN2A 1LTOA 3RXEA 3UIRA 1FMGA 2WYGA 4BTUB 1LPZB 1GHWH 1QB9A 3OY6U 3LDXH 3PROA 2ZGBH 1HB0B 5FPYA 2AGEX 4K8YA 1BHXB 1ELCA 4TY6A 2QIQA 4U30A 2IOTA 1TPOA 3A81A 2OC1A 1ZPZA 2WPMS 1IQIA 2Y80A 3A87A 2FZZA 3CS7A 3LH3A 4BAOB 1GHAG 4NFFA 2VIPA 4O97A 4ZKOU 3RXOA 1VJAU 2HRVA 1QRWA 1DPOA 2FIRH 2OINA 2BDAA 3GY2A 2BY5X 1EPTB 1GI8B 4INLA 1TGBA 4UONA 2VU8E 5DO4H 1WCZA 1P0SH 1RIWC 2DE8A 2BQ7B 4H6TA 1LQDB 1LKAA 1DSUA 2FYRA 1NC6A 3T27A 1V2PT 5EQRA 1F0TA 4KTCA 1O3JA 2A7CA 3H5CB 2VWLA 5C67A 4ZHAA 5JDUB 3LGVA 2FPZA 1CA0B 3EYDA 4BTIB 2FS8A 2AMDA 1DUEA 1JBUH 1AUTC 4I31A 4DY7B 1IQLA 2GX4A 1CSOE 1NRRH 4FU8A 4TWYA 3UOUA 1OWEA 2P3FH 1UTJA 1FY3A 1AU8A 2Q6DA 4NA8A 3D49H 2ZFQH 3A82A 1H1BA 3OU0A 3A8BA 1W2KH 2HVXA 5H4IB 4JZFH 4DG4A 4DIHH 1C2DA 1EZQA 3SU0A 1W12U 5FXLA 1K1MA 4ZAEA 4VGCB 2XCNA 4B73A 1O39A 1W0ZU 5JYIA 5CHAC 2H5CA 1WSSH 3RXSA 2C8ZB 2GVFA 1NFXA 2BY8X 4INHA 4YM9A 4D9RA 5DP4A 3U1IB 1TNIA 1DSTA 5DPAA 4NSYA 1HAXB 1A4WH 1UCYK 3U8OH 1W3CA 2GT7A 3GOVB 2PFEA 4CRFA 1O30A 5EW2H 1GHZA 2J94A 4WMFA 1CT2E 5AVDA 1AI8H 4UFGH 1CT4E 5F03A 3DD2H 3SNDA 3KCGH 1FN8A 4YOIA 3RU4E 4FUFA 4BXWA 2RA0A 1QR3E 3H7OA 3SOSA 2ILNA 4MDSA 2XCFA 2STBE 3SI3H 4WMDA 3SJIA 4CRCA 1HJ8A 2PKAB 1DT2A 1QURH 1GHAF 2R3UA 1VITH 1C2KA 1TGSZ 1ZYOA 3RXCA 1UK2A 2XBYA 3RXGA 2V3HH 3BTWE 1V2TT 2P8OB 3URDA 4CRDA 3BF6H 4Y7AA 1OWHA 1S84A 5DP8A 1BMMH 1C5WB 4ISIH 4UE7H 2PV9B 5DK1A 3HKJB 1AKSA 3F1SB 1ELGA 3VXEH 1HGTH 1HJAB 3OYPA 1IAUA 4B2CA 1HDTH 4H4FA 4ZHLU 1O2GH 2PTCE 5F6MA 1AVGH 1M9UA 1SGYE 5C2ZA 4O03A 1ZRBA 2B8OH 3SBKA 4K3JA 2FLBH 3LJJA 4E06H 1T8MA 3PLPA 1P03A 3RMOH 4OS7A 3E90B 1NRNH 3UTUH 2A5KA 3DT0H 1XUHA 4OGXA 1HCGA 3D23A 1TGNA 1ID5H 1EPTC 1QQUA 1RTFB 1TNHA 4AZ2B 2GMTB 3BV9B 3ZZ3A 1ZHMA 4NIYA 4GVUA 1CBWB 1O2SA 2R0LA 4I33A 1H8DH 2ZHFH 5HM2A 2ANWA 4I8GA 2VWMA 1GI9B 2PTNA 2WPKS 1CT0E 1LVBA 3D62A 2A2XH 3RLYH 1GVLA 5DP9A 4YT7H 3ZV9A 1C2LA 1TPPA 4AYVB 1EJAA 4XBDA 1EAIA 2AERH 3OTJE 1UTOA 1C2MA 3VEQB 1GBTA 1DXPA 3SU1A 1FXYA 3R0FA 1EB1H 1PYTD 2ZKSA 1GJCB 3I77A 5FBEA 1RFNA 2GV7A 2QXJA 1TX8A 4DIIH 5J4SA 3SN8A 2BY9X 3PYHA 4K1SA 4IGDA 3SGQE 1KXDA 4NIWA 3RDZA 2HGTH 2PKSC 2FWWA 4DURA 2QCYA 1GMHG 1O2VA 4JYUH 3TJNA 1IQMA 1J8AA 4VGCC 1O3DA 2ZQ1A 1GBHA 1SLXB 2WYJA 5A0BA 1ZTKA 1O2UA 3BEIB 1P2NA 5EXNA 4CREA 3ATLA 4ASHA 1LHCH 1MKXH 1UTNA 2TGTA 2ANKH 2WUBA 2BB4A 1GI3A 2BOKA 5IYTA 3PM3A 1LKBA 1P9SA 1NESE 1C5YB 1RTKA 4A5TS 3AAVA 5DKMA 3QLPH 2R0KA 2PWXA 3AW1A 2H9HA 3PMAB 1O3AA 3V0XA 3MHWU 4YOGA 1Z6EA 1OYQA 1WAYB 2XTTB 1FIZA 2ZHWH 2AEIH 2G4TA 1TOCB 7KMEH 2FYQA 5F8TA 2DUCA 5EPYA 1GG6C 2OD3B 4GCHG 3BIVH 5DG6A 1OWDA 1GGDB 2IPHA 3UWIA 1BITA 1ABIH 3RC4A 1GBMA 2EI7A 1MU8B 1GJ4H 4UD9H 5E0HA 2GTBA 3ENSB 1QRXA 1G36A 1TPSA 5T6FA 2TBSA 3MU5A 1GCDA 1WTGH 3MWIU 1GCTB 1OYTH 1DWDH 1FY4A 1PQ5A 3TIUA 1KY9A 1Z71A 4A7IB 1ZMLA 4Y10E 1HJAC 1ANCA 1ZJKA 4MNXA 3LOXA 1MAYA 2SFAA 1UVPA 5ABWA 1D3DB 1JOUB 2UWOA 1SLWB 3RXJA 1TMUH 3BN9A 4AFUA 4THNH 3V13A 1D6WA 1B5GH 1WBGB 3PMJA 1HIAB 2OC8A 2WPIS 2ZQ2A 1E36B 1AN1E 4Z0KA 3TGIE 4O9VA 1QA0A 2GMTC 3LGWA 1BRBE 5DGJA 1PQ7A 1F5RA 2O8UA 1CBWC 1IQEA 2QF0A 2LPRA 1SGNE 2Z3CA 1O3KA 1NM6A 1RD3B 1YYY1 2A7HA 1P8VC 4GAWA 2W26A 1AVXA 1F5LA 5SGAE 3BG4B 2BLWA 3A89A 2H9EH 3S9BA 1YM0A 5JBTA 2P59A 4ZKSU 3RXLA 4CR9A 2OCVB 4FVBA 4IN1A 2WINI 1DUAA 2G51A 3A7XA 6CHAB 1BCUH 1F0SA 2Z3EA 3QDZB 3SJKA 2AMQA 3A88A 3OY5U 5E8EH 2VH0A 2WV4A 5EOKA 2H6MA 4YLUA 3TGJE 5JBBS 1C4U2 1GL0E 4KTUA 9ESTA 1G3EA 1EP5A 2F3CE 1DY8A 3O8DA 1ZR0A 1A0HB 3SV9A 5C5NA 1H9LB 1S6HA 3ATKA 3S9CA 1NRPH 3B8JA 3RXTA 3EE0B 2UUJB 4GCHF 3ZVAA 2V6NA 5DP5A 4ABIA 1C5TA 4AG1A 1OX1A 4K2YA 2UUYA 2BVRH 3BSQA 2CF8H 3UNQA 4NG9H 4A1XA 1GPZA 4YT6H 1L1NA 1DWEH 1AMHA 3PWCA 1AZ8A 2Y82A 3ZZCA 1Z6JH 2GZ7A 2A4RA 1TMTH 4ABEA 1ELEE 2CXVA 1C1UH 2Z7FE 3BEFB 1ZRKA 2M5TA 2XWAA 2XBXA 4NSVA 1L1JA 2CMYA 5T3HA 3RLWH 1D3PB 1P06A 5E0JA 1C5UA 2SGEE 1TBZH 1YKTA 1K1IA 1JMOH 1QJ6B 3M5NA 2WPJS 1GDUA 1E38B 1QHRB 1MCTA 3HATH 3IWMA 1N8OC 1O2RA 3RXKA 2BQ6B 1CU1A 3SI4H 5JPMH 1EKBB 1GGDC 3KQBA 5G4BA 4AGKA 1QJ7B 1KXBA 1SVPA 1V2JT 8LPRA 1BUIA 4X8UH 1C2EA 1C5MD 2A7JA 3NPSA 2FO9A 3SJOA 2OC7A 5C1YA 3RP2A 1KDQA 3AASA 5EXLA 1MTUA 1P2IA 2TPIZ 3MO6A 4AYYB 1L2EA 3M36A 5LPEA 1Y5AT 1G9IE 1GCTC 2C8WB 4MNVA 1GBFA 1FNIA 2QXIA 3VGCC 1HRTH 3K2UA 1TRMA 3ZVBA 4JZ1A 2XXLA 1WV7H 1AB9B 1HLTH 1NZQH 2Y5FA 4LOYH 7GCHG 2NU0E 1TIOA 3M37A 1SGEE 2KAIA 4SGAE 2PGQB 3U8TH 1B0FA 1GMCG 3RXIA 1AZZA 1QB6A 4BAHB 1QBOA 3F9HA 3MMGA 2NU4E 1LQEA 2A1DB 1GHVH 1O2NA 2VVUA 3UFAA 2G52A 4JK5A 5ESBA 2FI5E 3ATWA 3E0NB 1OP2A 3FVFB 3MU1A 1DDJA 1VCPA 2CHAB 1UHBB 2Y6TA 3M5LA 3HPTB 3S69A 3LONA 1IHSH 1TALA 5BPEA 2TGDA 8KME2 3LT3A 4ABBA 2BXUH 3M7UA 1EP6A 3ZZDA 4D7GA 1YP9A 1BB0B 3A84A 4ABAA 1HAZB 1K9OE 4ISHH 1GBAA 3ZZ9A 1FI8A 3ATIA 2W7SA 1LO6A 5L30H 6CHAC 4WJG2 4NWLA 4ZXXH 5LGOA 1MTNC 2FESH 2A5IA 4D76A 4MPUA 1Q3XA 4Y71A 3MFJA 4KP0A 5AF9H 1FAXA 1GI2A 1F0RA 1ORFA 2SGQE 3T25A 1YCPH 1O3FA 2RA3A 3JZ2B 2Y5GA 1F5KU 1OXGA 3U98H 3HK3B 4AX9H 4X2YA 1W10U 1IQKA 5EXMA 1GBDA 3GCOA 1PPBH 2BMGB 1ESAA 3P8NA 3ODDA 3NWUA 3S7HB 1XM1A 1SGFG 3VPKA 2PUQH 1NN6A 4A6LA 4J2YB 3LC5A 3ODFA 3FAOA 1QBNA 4GHTA 2TGPZ