2QXGA

Crystal structure of human kallikrein 7 in complex with ala-ala-phe-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxgA02
1BMAA 1H4WA 3TLOA 3LDXH 1HV7A 2H6MA 1C2EA 4R0IA 4NA8A 1N8OC 1WU1A 5EQRA 2I6QA 1C5MD 1TA2A 1GJ9B 2XC5A 4Y7AA 1BTHH 2ZDKA 3BEUA 1KXCA 2HVXA 1A3BH 1C2HA 3MU1A 1C1SA 5C3NA 1V2MT 5JBTA 1UVPA 3TNSA 1J17T 3P8NA 2ZFQH 1WCZA 2GMTB 5LPEA 3RXCA 1QB6A 2R3YA 4K60A 4AFSA 1QTFA 2FS8A 3RC6A 1IQFA 4B2CA 1SGRE 3V0XA 1KDQB 1CGIE 1FLEE 1SGTA 1UHBA 4CR5A 4ABFA 4HTCH 4ZUHA 3ZVFA 4DY7B 3C27B 3MU5A 1GMHF 2OCVB 2FOEA 4JK5A 1FAXA 3T27A 1SG8B 1TPPA 2F9BH 1QRWA 2ANKH 1A0JA 3STJA 1H8DH 3P8GA 4UFDH 3NK8A 3BTTE 1HB0B 1ZHPA 5K0HA 1QBNA 4JZDH 3C1KA 5FAHA 2FS9A 3ZZ6A 1ELEE 1V2KT 1ZYOA 2C93B 3ZZBA 3A8BA 1TRMA 2CXVA 1WBGB 3UNSA 5L30H 2QA9E 2P94A 1L2EA 2WPKS 1Z71A 4A1VA 3RMMH 2ZGCA 1P09A 4BAKB 1MH0A 5DJ7A 1YPMH 4NA7A 1FV9A 3S69A 1OPHB 2FX6A 3HKJB 4CBOA 2SGDE 1QRXA 3E91A 4QT8C 2FOCA 4HI3A 4ISNA 2XNIA 2THFB 1UTKA 4Y8XA 4FU9A 2BX4A 4OS2A 1AFEH 1EZXC 3LPRA 3T28A 1C5UA 3ZV8A 5GXPA 5EPNA 1N6XA 2FTLE 4NZLA 3MMGA 3RUOA 2F9UA 2WPMS 1E38B 1C5SA 4X2VA 1SB1H 3FFGA 1LHFH 3BIUH 5EODA 1MMJN 1HFDA 2ZDMA 4B1TA 5L6NH 2PKAA 1IQIA 1O2ZA 2ILNA 1DUEA 1GVKB 2NU1E 1DWCH 2C8WB 1P05A 3H7OA 1DDJA 1P11E 8ESTE 4Z6AH 1E34B 1EP5A 2VVVA 4X1NU 4YO9A 1O3GA 1WOFA 1BRBE 2FDAA 5TCAA 1VCQA 2D8WA 1P02A 5DP4A 5LH8A 3H7TA 3PMJA 1GMHG 2JH0D 5EG4A 1DX5M 1P8VC 4FUJA 3AAUA 4RSPA 1EJAA 2BVXH 2ZIQH 1OWHA 2F9OA 2ZECA 5BRRE 2TRMA 4O97A 3QO6A 1D3QB 1V2ST 4IC6A 1V2VT 3RXRA 1EJNA 1BMNH 4CHAC 3HGPA 1GL0E 3OTJE 1SGFG 2BYAX 1V2LT 2WPLS 2W7SA 2GCTC 2C90B 3UY9A 1XKAC 5FPTA 1GBLA 5DP8A 5AFZH 3PMBB 2GT7A 5J4SA 1MBQA 4K8BA 3UQOA 3R3GB 1BOQA 3GCOA 1YCPK 2VIPA 1GG6C 3SJOA 5JDUB 4ZROA 3A7WA 1K1IA 4DCDA 1MZAA 1SGPE 4B75A 4U2WA 1O2IA 1W12U 3MNXA 2ZCLP 2OBOA 1Z6JH 2R0LA 2J2UA 2J9NA 1Z8JB 1Z6EA 3O8BA 4X6OA 2PKSB 4LOYH 4H6SB 2A0QB 2BY8X 3BSQA 3KQDA 1P9UA 1XUJA 1AFQB 5FCKA 2A2XH 1S81A 2GTBA 1OWEA 4FUCA 1J16A 3A89A 3V12A 2XBWA 3D49H 1HJ8A 1V2UT 2AGGX 3GDSA 2ODPA 1FAKH 2FM2A 2G4UA 4A1XA 4JYVH 5LPFA 3RXKA 1UK2A 1PPBH 2GT8A 4GSOA 5C20A 4YLUA 1BJUA 2V0BA 5JYIA 1EAWA 1BDAA 1BRAA 3P8OA 3HKIB 2QC2A 2ODQA 1EPTA 1GJCB 1TOMH 3VB5A 2XCFA 1GJ8B 1C2JA 3F9FA 1CBWB 4AORA 1CSOE 1EQ9A 5ABWA 6LPRA 4ESTE 1X7AC 4Y0YE 2JH6D 2Q6FA 1JOUB 4UFFH 5TCCA 1HAHH 5BPEA 2O8TA 3RXOA 2Y82A 3A7YA 4D7GA 1EX3A 2OC7A 3RMNH 1NRSH 1V2TT 1SR5C 1S83A 2BLQA 1YPHC 3NCLA 1P2IA 3LC3A 1C5TA 2D2DA 1FY3A 1AN1E 1YYY1 3MO9A 4B74A 5EGMA 1KXEA 2ZEBA 4CRCA 1T8LA 1BTYA 1JRTA 2ESTE 1SL3A 2ZZUH 1MCTA 2HGTH 1GBJA 1BTZA 3FZZA 3MYWA 5AHGH 1HJAB 2CGAA 3SUFA 1A46H 1LO6A 4F49A 4CRDA 4GAWA 3U8RH 1ABIH 3ZVEA 1Z1JA 1HGTH 3SV9A 3O8RA 2Q6DA 1YCPH 2A31A 1V2PT 2XBXA 2J94A 5ETXA 3FP6E 1O2KA 2BVRH 1ZZZA 3RXVA 1IQLA 1O2QA 3SNAA 4MDSA 4YESB 1DOJA 1QHRB 1P57B 1PPFE 1F0RA 2BZ6H 5A8YA 2Z9JA 3EA9A 2VJ1A 1QJ6B 1C2KA 4IC5A 3Q76A 1G32B 1NRRH 1T4VH 1GDQA 1XUGA 1TNLA 1DLKB 3VXEH 5FX6A 9LPRA 2ZHDA 1C1PA 4IGDA 1O3AA 1M9UA 2DE9A 2O8LA 2W3IA 3Q3XA 4X2WA 5C67A 4INKA 2A4OA 3RXEA 1AI8H 2EA3A 2SGEE 1AD8H 3I78A 1S6FA 1CVWH 2KAIA 4DVAU 3Q77A 1A2CH 1GI9B 1UTMA 4TWWA 2CHAB 2ZPQA 3KNXA 4OGXA 3M3TA 4OS7A 3QX5H 4ZHLU 1ZLRA 4B76A 1HAOH 4CRFA 2OC0A 1A5IA 3TNTA 1AVXA 3F68H 4BTIB 3PTNA 1FI8A 1FQ3A 3PB1E 1ANBA 2C8YB 4Q7XA 1H9HE 2BDAA 4BTUB 3M7UA 2FLBH 4OS6A 2FLRH 2ZNKH 2M5TA 2OP9A 2FZZA 5FPSA 2AEIH 1MQ5A 3F1SB 4X6MA 2VINA 1PQ5A 5B6OA 3MWIU 2ZDNA 2OBQA 1WTHD 2AYWA 3SI4H 1SGYE 2PSXA 3M37A 1MTSA 4TY7A 2BDBA 1F0SA 4OS5A 5A0BA 3SO3A 4WXIA 1P04A 1O38A 1O3LA 1UTNA 3LGIA 1GCTC 2XCNA 1K1NA 1MTUA 3W95A 1W3CA 1LMWB 1K22H 4Y71A 1TRYA 3TPIZ 3M5NA 1LVBA 5E8EH 1G2MA 1GWAA 5CHAB 4TWYA 1JIMA 2GKVE 3D23A 2W26A 3MU0A 3ZZ9A 1MAXA 1Z8RA 1V2WT 3UOUA 4D7FA 1AWFH 2GZ9A 3CENA 3SU4A 3SUEA 3DA9B 1V2RT 1SGCA 2V3OH 5GJ4B 1GJ5H 1HAYB 1HCGA 1ZOMA 2IN2A 3PMHB 1SOZA 1GBDA 3UREA 1BA8B 3OU0A 2P3FH 3BG4C 2PWXA 1UTPA 3M35A 2WINI 1AB9B 1ZTKA 1IHSH 1TGBA 3AASA 1INCA 1C9TA 2AGEX 3ZZ7A 2ZCKP 3DHKH 1O5GH 3PLKA 1FONA 1OYQA 1GI1A 3P8FA 1LVOA 2OQUA 3T29A 4Y0ZE 1XXFA 1O3DA 1UCYK 1GJ4H 1O5EH 2ULLA 3F9EA 1SGNE 2R9PA 3BF6H 1LQEA 4ISHH 1W13U 2BOHB 2NU0E 1O5FH 4FUBA 1AY6H 2BXTH 1TFXA 1JMOH 1O30A 1BTXA 1CGJE 2HNTE 3DT0H 3KN2A 1FUJA 4CRGA 3TJOA 1C4U2 3TH3H 1CT2E 3ELAH 1ELFA 1CHOG 2QXGA 3JZ2B 1GJ7B 1BITA 5E0JA 3W94A 3ZVDA 1W14U 1CA0B 1OP0A 4K1SA 3A87A 3U9AH 3UR9A 1CGHA 1NS3A 2AERH 4MG3A 1Y5BT 1THSH 1S6HA 3LKWA 4KTUA 1TWXB 4D76A 1K1OA 2BZAA 3SNBA 1O2HA 2TGPZ 1QA7A 2B7DH 2FMJA 1S0QA 1B7XB 5E0GA 5A8XA 4DGJA 3RXPA 2BY5X 2XTTB 1KSNA 2VWLA 1EAIA 3NZIA 2V6NA 2XW9A 1O36A 4VGCC 3T26A 1ARBA 3ATLA 1AWHB 1GBKA 1GI2A 1KXFA 1KXBA 2HPQH 4NFFA 1TBZH 1O2OA 5LPRA 1ID5H 2QGRA 5C2ZA 1BUIA 2Q1JA 3PLBA 1EUFA 2ZGXH 5GIBA 4KKDA 2QF3A 3A7ZA 4DJZB 3FZDA 2BX3A 1TE0A 3PROA 1QQUA 4SGAE 1C2FA 7KMEH 2ZTZA 3B9FH 2RA0A 2JETC 2FTMA 2BVSH 4I31A 4E05H 2FYRA 1VGCB 1O2UA 4RKJB 4IS5A 1LHDH 1VJ9U 4AGJA 1BTUA 1P3CA 2O8MA 4AYYB 4AFZA 2OD3B 3E16B 1AVGH 3SNCA 3RXUA 2BD9A 1FJSA 5A09A 1EB2A 3UWJH 2J34A 3K6YA 4DT7B 3LGYA 1SOTA 1VITF 3QTVH 1DWBH 3SN8A 3CP7A 4TPIZ 4Y8YA 2XWAA 3GISB 1UCYH 3ATMA 4XBBA 3VB4A 2HNTC 1SGEE 2WPHS 1O3KA 3VPKA 1GMDF 5HGGA 5HM2A 1T8NA 3GY4A 5GDSH 1ZTLA 3NUMA 2FOGA 1GBAA 2ZU5A 3F9HA 3RXSA 4ZKNU 2RA3A 1MCVA 1BHXF 2ANYA 4NIYA 2AIQA 4FUEA 1VCWA 4BOHA 1A5GH 1F7ZA 2P8OC 2AMPA 4MNWA 1C1NA 2QAAA 3S9BA 2A2QH 1W0ZU 1ZJKA 8GCHF 1SMFE 3M5LA 3PMAB 1ORFA 1RTLA 1IQMA 3FP7E 1Q2WA 4X8TH 4WXVA 1TONA 5CMXH 1H8IH 1LHCH 3CS7A 1EB1H 1DICA 4BAMB 2GV6A 1GCDA 2ZC9H 2XC0A 1GHBF 1L1GA 1TYNA 4JZFH 1A5HA 1RXPA 1SFQB 1K28D 2PW8H 1O0DH 3TK5A 1MZDA 1NN6A 3TJVA 1NT1A 4I8GA 3A88A 2VIOA 1QL9A 1Y5AT 1UVUH 4I33A 3S7KB 1UHBB 1UVOA 1FN8A 1MTNB 3AAVA 4UE7H 1ANCA 1TNGA 3SUGA 4Y10E 1GHXH 3RXIA 1O2TA 1UTJA 1RTFB 1OS8A 2AMQA 1CE5A 1GBHA 4X0WU 2BOKA 2VB0A 2GCTB 3GOVB 4FXGH 4I8JA 4XOJA 2BQ6B 3UR6A 3BTKE 1VITG 5ESBA 1ZSLA 2H2ZA 4KP0A 1DWEH 3M3VA 1O3MA 1UMAH 2W5EA 4E7NA 1GMDG 3LGWA 1K9OE 1C2GA 1KTSB 1BRCE 4ZKOU 3GYMA 3QGNB 1GI0A 3EAJA 1W7GH 3PM3A 3LH1A 2AFQB 4A7IB 5FXLA 4BANB 3D62A 1OWJA 1GL1A 2C8ZB 3UPEA 2VIQA 1GGDB 4M7GA 3ATIA 1O2LA 1TPOA 4O3UA 3OYPA 3QGJA 2R2WU 1C1TA 2C4FH 3RC5A 2BB4A 1K1JA 5SGAE 1ELGA 2PKAB 3HK3B 5A2MH 1ELAA 2OQ5A 3MH6A 3ZZ3A 1GI8B 1C4V2 3E8LA 2XWBI 2FIRH 1UK4A 1C5NH 1FIWA 4DG4A 1MAYA 3EA7A 1BMLA 2QV1A 1WQSA 1ELVA 2HNTF 4KTSA 3MTYA 1SPJA 2UUFB 4A6LA 2PR3A 2WUBA 2FOHA 3RXFA 4WWYA 5T3HA 6CHAB 4JYTA 2BD8A 1CT0E 2R2MB 2UUYA 2VH0A 5F8XA 3RXGA 3SORA 2H9HA 1TBQH 1SLUB 2GMTC 1QQ4A 3LJJA 1TRNA 1V6DA 2ZFPH 4B2AA 2A5IA 3E1XB 3TITA 1A3EH 4U30A 2ZQ1A 4NA9H 4NCYA 1O2MA 1YPHE 2BD7A 4HFPB 4JZIA 5DP6A 2B9LA 2G5NA 1ZTJA 2ALPA 4YOIA 1XXDA 1GDUA 1FNIA 4X2XA 5AF9H 3QDZB 1NFWA 1OP8A 5EQSA 1EP6A 1LVYA 1L0ZA 1W8BH 1A7SA 3SV8A 1HDTH 1RS0A 2R3UA 1TA6A 2VVUA 2Z9LA 3ESTA 3GY5A 2FWWA 2B5TB 3GCTF 1GHWH 1OWKA 1LHGH 2VGCB 1T32A 2G00A 1Y3VA 3QK1A 4NIVA 2NU4E 1F0TA 3RM0H 4FUIA 3LH3A 4J1YA 2WYJA 2BD3A 1QGFA 1TALA 3FVFB 3BTGE 1V2NT 2TIOA 3ENSB 4CH2B 1WTGH 2XYAA 5JBBS 3VGCC 1O2VA 2ZFTA 2HRVA 1NU9A 5HMAA 3LIWA 1ZSKA 2BHGA 1YLDA 4ISIH 3GY6A 1EPTB 1CT4E 1SC8U 3A8AA 2ZFRH 3GYLB 3RXBA 1P3EA 1NPMA 3SU3A 2P59A 5DP5A 1TPSA 1AU8A 3LJOA 3MH4A 8KME2 9ESTA 4CBNA 2A4QA 1SHHB 1A1RA 2YNBA 3P17H 3HATH 2NU2E 3EA8A 7LPRA 3QZQA 3SBKA 5FHTA 3SV2H 4ABHA 3M5OA 1O3OA 3V13A 2PGQB 1BQYA 1GHVH 2ZU4A 1LVMA 2EI8A 4K5ZA 1TNIA 2EEKA 1WSSH 3LC5A 4TPYA 4WJG2 1F5LA 4O3TA 1B0EA 1DANH 1NRNH 1EZSC 2GGVB 3BEFB 1SHYA 2Z9KA 2FOFA 2ZGJA 4AB8A 4YZUA 1EKBB 3SGQE 3JZ1B 3SGBE 3VB3A 3SV7A 2WPIS 1GMCF 1EATA 2VH6A 3RU4E 1GI5A 2G51A 1ELBA 1K21H 1O5DH 3UFAA 1NFYA 1QL7A 2J92A 1P06A 3S9CA 2FODA 3SNDA 2HALA 1C2IA 2FOAA 2RDLA 1C5VA 3QLPH 1O5BB 1QY6A 2LNCA 1ELDE 4CH8B 4AZ2B 1Y3WA 3GICB 5EPYA 2BD2A 2QN5T 1YM0A 6GCHF 1F92A 3A84A 2ZG0H 3GCHB 1W10U 3S0NA 1D3PB 1GI4A 4X1SU 3ZZAA 3MO3A 3RXJA 3VB6A 4GUXA 1BHXB 1HAVB 4IN2A 1AHTH 5A0AE 5GCHF 4LZ1H 1HAVA 3K65B 5ESTE 4JZ1A 1L4ZA 2IPHA 1Y3YA 2QIQA 4ISLA 2H1UA 1ZGVA 3GY7A 2ASUB 4H4FA 1J9CH 1ESBA 2ZU1A 1GBFA 3ZV9A 2XBYA 4MPUA 2PKSC 2KAIB 2V3HH 1MQ6A 2ZGBH 2BLOA 2TPIZ 3LONA 4X6PA 1QNJA 5JB9S 1AFQC 4OGYA 3GCNA 2Z9GA 1DSUA 1GBBA 1U6QA 3N7OA 2QYIA 1PJPA 2G81E 4ZMAH 2Y5FA 1GI6A 1XVMA 1PFXC 2HOBA 5JB8S 3P6ZB 1E37B 1JRSA 4FUDA 3AVZA 1XM1A 4YT7H 4XE4A 1LHEH 1DLEA 3P70B 1ETTH 4AFUA 2W7UA 1OKXA 1RRKA 1GJAB 1KLTA 4K8YA 1RFNA 1CBWC 4TYDA 5L2ZH 1P9SA 4FUFA 3M61U 1D3TB 3MU8A 4AYVB 3ZZ4A 1D4PB 3R0FA 1F2SE 1UCYE 4Z0KA 1HAPH 1UVSH 5A8ZA 1HNEE 2WV5A 5K7RA 1D9IA 1O5CB 2PSYA 4FUHA 2PLXA 3GDVA 1IQNA 1FY1A 4GCHF 1UK3A 1GVZA 4I8HA 5H4IB 2PTNA 2OTVA 2QXJA 2H9EH 3IG6B 2WUCA 1GHYH 4ABJA 5DPAA 3T62A 4GHQA 6GCHG 1JIRA 2HPPH 1AVWA 4J2YB 5C5NA 2J4IA 1OYTH 2ZP0H 2H5DA 1IQEA 1TX7A 1MTWA 4ABDA 4HZHA 4K1EA 2LPRA 1Q31A 1HYLA 2JH5D 1TGSZ 2FI5E 1QBOA 1KXAA 1Q3XA 3MOCA 5GCHG 3KHVA 3ZVAA 4YOGA 2ZPRA 3QN7A 4D9RA 4O03A 1TMTH 1TGTA 1G9IE 3FAOA 1FMGA 3SW2B 2TGAA 3SQEE 1DM4B 4LXBH 4UFEH 1GI3A 2NWNA 1RIWB 1AE8H 1C1QA 2A1DB 1P10A 2BDGA 4MNYA 1IQGA 5F8ZA 3VXFH 1SGDE 4HGCA 1CA8B 2P3UB 3ZZCA 1TLDA 4ABGA 1IQJA 1BJVA 3BTDE 1A0LA 4UD9H 1G3BA 4FUGA 5E0HA 1PPZA 4UEHH 4MPXA 3PO1B 3TGJE 1Y3UA 3MFJA 2ZTYA 1BBRK 4U32A 2VVCA 2OC8A 1MD8A 4IMZA 4K69A 2A45B 5FBIA 1QFKH 2A32A 3MNBA 1H9LB 4DIIH 1C1WH 2FESH 1EXFA 2OC1A 1YF4A 4NWKA 4O9VA 3L33A 1DPOA 1IQHA 1VZQH 2BDYA 2G4TA 2CHAC 1GBCA 2O8UA 1IHTH 3URDA 3TJNA 1FPHH 1QCPA 2FOBA 1N8OB 1KLIH 2PUXB 5I46H 4MLFB 3CS0A 3NXPA 1YC0A 1NRPH 4BAOB 1XUHA 3RXLA 4BXWA 2Y80A 2BY9X 2H9TH 4TY6A 3ZYEA 4XSKU 4AB9A 1TMUH 3TJUA 1SLXB 4DIHH 1SLWB 1NFUA 2UWPA 1ZJDA 2ZTXA 3SJ8A 2BXUH 1CHGA 1A61H 1HAXB 5EQQA 2PHBA 2VNTA 3RP2A 5DK1A 1HIAA 3OSYA 2ANMH 3TK9A 6ESTA 1DUAA 1JXPA 2QCYA 1Z8IB 2WYGA 5EW2H 4KELA 2K1QA 3M7TA 5C1XA 1HLTH 2UUJB 4JYUH 4B71A 3SOSA 4E06H 1ELTA 1GJDB 3LT3A 4WMFA 4K1TA 1OSSA 5CHAC 3MHWU 4ABIA 1TAWA 4WH8A 3PLPA 2BD4A 4MNXA 2ZU3A 4MTBA 3LGUA 1F5RA 4FU7A 1P2NA 1EZUC 1K1PA 2FP7B 3FANA 3MNCA 2C3SA 1IOEA 1QJ7B 2Z9IA 1V2OT 1WQVH 1KLJH 2F9NA 5CE1A 1MKWK 4SGBE 4BAHB 1ZR0A 1P0SH 1HAGE 2ZGHA 3SI3H 2ZFFH 3ZVGA 1AO5A 2F3CE 4CRAA 3GY2A 1TGCA 4GVUA 2SGAA 1DVAH 1MUEB 2PUQH 2ZPSA 1O31A 1TPAE 1BBRH 1ESTA 3PTBA 4XDEA 1D6RA 1LPGB 3SU1A 1C4Y2 1AB9C 1E36B 2PTCE 2PV9B 5L2YH 3QTOH 4Y6DA 4I32A 3TGIE 2FYQA 4ASHA 3ODFA 1O5AB 1S5SA 2F9PA 4ZAEA 3KIDU 2ZI2H 3ZVCA 2CMYA 3M3SA 1CU1A 5T6FA 2YNAA 2QXIA 5I25A 1MTVA 1N6YA 2GCHF 1KY9A 3KL6A 1K2I1 1WYKA 4Y76A 2P3TB 1O32A 1QJ1B 3L6PA 1O2WA 1C2DA 1G2LA 1W7XH 1NFXA 2IOTA 1KYNA 1SI5H 2FXRA 1EAXA 1ESAA 1HXFH 1PPGE 1K1LA 4RN6A 2A4GA 2AIPA 4AOQA 1BRUP 1K1MA 1CA0C 1O2RA 1T7CA 1ETSH 1GDNA 3SU5A 2FO9A 1PYTD 3UOPA 3NPSA 1ETRH 1O2JA 1Z7KA 4X8VH 1DSTA 1T8OA 4JMYA 2BLVA 5F8TA 4XFQA 3A85A 1LTOA 3I77A 4X1RU 3LGVA 2GVFA 1TOCB 1YP9A 1KTTB 2YOLA 1C5WB 1C9PA 1NROH 1S84A 3A7TA 3B8JA 4X8SH 4WMDA 3TVJB 4CHAB 4B73A 1TQ0B 1Y5UT 1IAUA 4YTAA 3A86A 1HAIH 2ZDVH 3ZZDA 3KGPA 1XMNB 2Y6TA 1EOJA 1KDQA 1O35A 3MO6A 4MPVA 2XRCA 3ODDA 1ZPCA 2D26C 3V3MA 1O39A 1V2QT 1NM6A 4XBCA 2VIDA 3O8CA 2G55A 5JPMH 2ZHFH 5EXMA 3U8TH 1MKWH 3SV6A 1DFPA 2CJIA 1UO6A 1QIXB 4IBLH 1GG6B 1AIXH 3RM2H 1V3XA 3BTQE 4WF8A 3SZNA 4ABBA 3UQVA 1VGCC 1XUFA 3T2NA 3PWBA 1BT7A 4U01A 1O3HA 2EC9H 2J95A 1NY22 2B8OH 1FY8E 4A1TA 4X6NA 1S82A 1E35B 2AS9A 3F9GA 3UNQA 4I7YH 3ATKA 1SBWA 5T6DA 4DURA 4WH6A 1ABJH 1HXEH 3M36A 5FPYA 3SHCH 8GCHG 1C1RA 1BMMH 1WUNH 1ANEA 2GCHG 3MU4A 4ABAA 1MU8B 1G36A 1P2MA 3VGCB 3KF2A 2AMDA 1ZPZA 2ZHEH 2ZQ2A 1QBVH 1GBTA 1GHBG 3LOXA 1SLVB 4IMQA 1N1LA 1JWTA 1LPKB 1YLCA 1AQ7A 3DUXH 2AH4X 5DO4H 1RGQA 3SUDA 3RMLH 1P03A 3OX7U 5JBCS 2SNWA 2BY6X 2G5VA 1O3BA 2B0FA 2G8TA 3BTWE 1QRZA 3T5FH 1OWIA 1PQ8A 1LPZB 2ZDLA 1BCUH 1PPHE 3SJKA 2WPJS 3NWUA 5EW1H 4OS4A 3PYHA 4INHA 1XVOA 4ABEA 2DUCA 1DY9A 3SJ9A 3ZYDA 3VB7A 5T6GA 2BTCE 4Y11E 7GCHF 4ZH8A 3E90B 1TBRH 2I6SA 1PPEE 1UJ1A 3PV4A 2VU8E 2EI6A 2ZF0H 1MTNC 4NSYA 2A4RA 3KQCA 1IQKA 1YPLH 1PYTC 2FEQH 2ALVA 1UTLM 1W0YH 4RKOB 1L4DA 1D6WA 1RD3B 3BIVH 3RXAA 4Q7ZA 5JBAS 1TNKA 3BTME 1L1NA 3SJIA 3EQ0H 1G30B 1A0HB 4FVDA 4I8LA 3QWCH 1C5OH 1OWDA 2BQWB 3BTHE 1RTKA 3BTEE 5C1UA 4AG2A 1C5ZB 1TX6A 3E6PH 3A8CA 1Y8TA 4FVBA 1O34A 2XC4A 1C5PA 1BZXE 1BTWA 3SGAE 4X8UH 1MKXK 1QB1A 4A92A 1Z8GA 1O3CA 1TABE 1ACBE 2ZA5A 1C1MA 3M7QA 3Q3YA 4WMEA 3A81A 1VCPA 4X1QU 1GHAF 3SNEA 1TB6H 3U1JB 1O37A 1J14A 1AGJA 4BXSA 1BIOA 2NU3E 4E7RG 1C5YB 2Z6BD 4X2YA 1THRH 3SU6A 2SGFE 1CQQA 1YPEH 3T25A 1GGDC 2BDHA 3SHAH 4AN7A 1BTPA 1GBEA 5F6MA 1O3PB 5HYOA 1ZMLA 4H6TA 4PROA 1P2KA 1FPCH 2BMGB 4Y8ZA 1LKAA 2CN0H 3IWMA 2Z3EA 1XKBC 3UUZA 3A8DA 7GCHG 3RU4D 1AKSB 2CF8H 1NZQH 5EXNA 2F83A 2TGDA 1Y59T 1XUIA 1O2GH 1AKSA 1O2YA 2Z3DA 1OXGA 3A7VA 4LZ4B 3RXHA 2ZHQH 3A83A 1F0UA 2O8WA 4ZKRU 1WAYB 2OXSA 1SQTA 1HAZB 6CHAC 1HPGA 4MVNA 1HRTH 3EGKH 5DKMA 2GZ8A 3OY6U 3RMOH 1SFIA 1EJMA 5DG6A 4YM9A 2A5KA 2OINA 1QL8A 3U69H 3RLYH 4D8NA 1EZQA 1G3CA 1GCTB 1TNHA 2ZFSA 1ZSJA 2O9QA 4IW4E 3TGKE 2TBSA 1P2QA 4Q7YA 4ZXYH 3GCTG 4INLA 1DT2A 1YBWA 1AE5A 1T8MA 4JZEH 4NZQA 1SQAA 2GDEH 4ISOA 4ZHMU 3HPTB 4JK6A 1G3DA 1O2SA 2UWOA 1H1BA 1MKXH 1G3EA 3V7TA 4CRBA 4K3JA 2H5CA 2VWNA 5PTPA 1GHAG 3RU4T 5DGJA 1C1VH 2J38A 3FP8E 1J15A 2VIVA 4NIWA 4ZXXH 5C5OA 1ZRBA 1ANDA 1S0RA 3F6UH 3MNSA 4UDWH 1YPGH 2ZHWH 3AW1A 1KIGH 2VGCC 4BTTB 3TK6A 1LKBA 3BG4B 2A7HA 1S85A 1JBUH 1DWDH 1O3IA 2GDDA 3KQEA 3PWCA 3QUMP 4UFGH 4NWLA 4KTCA 5LGOA 2Z7FE 4ZKSU 2F9VA 2RCEA 3SU2A 1ZPBA 1UVTH 3VFEA 1C2MA 1O3NA 4NSVA 3QZRA 2QY0B 2BDIA 2ZWLH 1RJXB 5IYTA 2PGBB 5AFYH 2CF9H 3KEEA 2GX4A 1EPTC 1KXDA 4D9QA 1FY5A 1LDTT 1ZHRA 2HLCA 1QA0A 1PQAA 3RLWH 4NFEA 2HWLB 4AFQA 4LK4A 3BTFE 1ZGIA 1NC6A 3RXTA 4AGKA 3UIRA 3BV9B 1WV7H 1GMCG 1O33A 1ZMJA 1QURH 5AVDA 1DXPA 4OS1A 5DP3A 2Z3CA 5FX5A 4BAQB 3I29A 3RXMA 4KGAA 3RXQA 2BD5A 1O3JA 2R0KA 1BBRE 1TIOA 3VEQB 3BG8A 3URCA 1MBMA 2C8XB 2FOMB 5F03A 1DXWA 2Q6GA 1O2NA 2FPZA 1ARCA 3S9AA 1HJ9A 2TGTA 4VGCB 1FZZA 2V35A 3LGTA 1W2KH 4YLQH 2QF0A 5DP7A 1BB0B 1CHOF 1TX8A 3U8OH 3ZVBA 2G52A 2A7JA 3RC4A 2F91A 3L3TA 1FIZA 1PQ7A 2GZ7A 3GY3A 1HJAC 3E3TA 5GPIB 5FCRA 4X1PU 2XXLA 4NG9H 1QR3E 1ZRKA 3UWIA 1FXYA 3O8DA 1SGFA 2PFEA 2JETB 2P93A 2BQ7B 3HK6B 1NESE 1ZMNA 3MH7A 3K9XB 1FDPA 3K2UA 7ESTE 3DFJA 1AZ8A 1B0FA 2VIWA 1VJAU 2FX4A 1LQDB 1UTOA 2A7CA 3GCHC 1C5XB 3BEIB 4AG1A 5EXLA 4YT6H 5J4QA 8LPRA 1C5QA 4CREA 3BN9A 2ZDAH 3UNRA 3EYDA 1TGNA 1TMBH 2P95A 3KQBA 1O3EA 3OY5U 3HGNA 1YCPM 1B5GH 2RG3A 1THPB 3IITA 2STBE 2Y7XA 2ZU2A 3A80A 1C5RA 4R8TB 4WY3A 2UWLA 3TU7H 4DW2U 3LU9B 3S7HB 1GJ6A 1OOKB 4Q2KA 4H42U 2OUAA 4UONA 1ZHMA 2GV7A 4NIXA 1C1OA 1P2OA 1MD7A 2P8OB 3M5MA 1GVLA 5GWZA 5G4BA 1O2XA 1G37A 1EASA 1V2JT 3U98H 1OP2A 2STAE 3GDUA 1ELCA 1J8AA 1T4UH 1EOLA 1O3FA 3B23B 3WY8A 5HM9A 1NO9H 1FN6A 1E0FD 3KCGH 4GCHG 4Y79A 3RDZA 4MNVA 4YOJA 2Y5GA 5HXFA 3G01A 1NRQH 1SGQE 4F4OC 3A7XA 3H5CB 1O2PA 4WVPE 5E2OA 2GD4B 1GPZA 2ZO3H 2BY7X 1YKTA 1YPJH 1GBIA 1XX9A 2XBVA 3E0NB 5IDKA 3MI4A 1VR1H 2Y7ZA 3EE0B 1HIAB 1VITH 2IJOB 4GPGA 4MQAA 1YGCH 2EI7A 1NU7B 1C5LH 2Y5HA 5TJXA 1TNJA 1Y3XA 1HUTH 2VWMA 2ODYB 1A4WH 5E2PA 5EU8A 1SVPA 2A5AA 3TH2H 1CO7E 1LCYA 1XUKA 2Z94A 4A5TS 2AGIX 2ZKSA 1AUTC 3DFLA 5EOKA 2WV4A 1YPKH 1HBTH 4DOQA 4BNRA 2BDCA 4FU8A 4ZHAA 2OLGA 1DS2E 2FI4E 1C2LA 4Y7BA 3EDXB 1NTPA 3Q00A 1P2JA 4XBDA 1P12E 1UTQA 3ITIA 2P16A 2BLWA 3AW0A 1GBMA 3GY8A 3ATWA 4JCNA 5FBEA 1FY4A 3UTUH 3NKKA 5DP9A 3P95A 1PPCE 1DE7H 4GHTA 4IN1A 4NGAH 1AUJA 1L1JA 4K2YA 2D1JA 1W11U 2W3KA 1MU6B 3E0PB 3TH4H 2QXHA 4Q80A 2SNVA 2SGQE 3SU0A 3A82A 3DD2H 1SGIB 1GI7B 1RIWC 4GLYA 1GHZA 3D65E 1AMHA 3SQHE 3STIA 3ZZ5A 2CV3A 3RXDA 4THNH 2ANWA 4CR9A 1H9IE 2GP9B 3MH5A 3U1IB 3ZZ8A 1QB9A 2DE8A 3P92A 2BM2A 1SQOA 3PO1C 3K6ZA 1DY8A 4MPWA 1P01A 1EAUA 1SSXA 2JKHA 1OX1A 5C1YA 1F5KU 2ZCHP 2SFAA 4AX9H 1D3DB 2SGPE 1AZZA 2UUKB 5A0CA 1C1UH 3Q3KA 1T31A 2VWOA 2Y81A 4B2BA 4I8KA 1TQ7B 1GJBB 1Z1IA 3TIUA 1DITH 2FI3E
chains in the Genus database with same CATH superfamily
1BMAA 1H4WA 3TLOA 3LDXH 1HV7A 2H6MA 1C2EA 4R0IA 4NA8A 1N8OC 1WU1A 5EQRA 2I6QA 2CK3D 1C5MD 1TA2A 1GJ9B 2XC5A 4Y7AA 1BTHH 2ZDKA 3BEUA 1KXCA 2HVXA 1A3BH 1C2HA 3MU1A 1C1SA 5C3NA 1V2MT 5JBTA 1UVPA 3TNSA 1J17T 3P8NA 2ZFQH 1WCZA 2GMTB 5LPEA 3RXCA 1QB6A 2R3YA 4K60A 4AFSA 1QTFA 2FS8A 3RC6A 1IQFA 4B2CA 1SGRE 3V0XA 1KDQB 1CGIE 1FLEE 1SGTA 1UHBA 4CR5A 4ABFA 5C17A 3GS9A 4HTCH 4ZUHA 3ZVFA 4DY7B 3C27B 3MU5A 1GMHF 2OCVB 2FOEA 4JK5A 1FAXA 3T27A 1YY3A 1SG8B 1TPPA 2F9BH 1QRWA 2ANKH 1A0JA 2JJ1D 3STJA 1H8DH 3P8GA 4UFDH 3NK8A 3BTTE 5KGOA 1HB0B 1ZHPA 5K0HA 1QBNA 4JZDH 3C1KA 5GNDA 5FAHA 2FS9A 3ZZ6A 5DSFA 1ELEE 1V2KT 1ZYOA 2C93B 3ZZBA 3A8BA 1TRMA 2J97A 2CXVA 1WBGB 3UNSA 5L30H 5C94A 2QA9E 2P94A 1L2EA 2WPKS 1Z71A 4A1VA 3RMMH 2ZGCA 1P09A 4BAKB 1MH0A 5DJ7A 1YPMH 4NA7A 1FV9A 3S69A 1OPHB 2FX6A 3HKJB 4CBOA 2SGDE 1QRXA 3E91A 4QT8C 2FOCA 4HI3A 4ISNA 2XNIA 2THFB 1UTKA 4Y8XA 4FU9A 2BX4A 4OS2A 1AFEH 1EZXC 3LPRA 3T28A 1C5UA 3ZV8A 5GXPA 3FO8D 5EPNA 1N6XA 2FTLE 4NZLA 3MMGA 3RUOA 2F9UA 2WPMS 1E38B 1C5SA 4X2VA 1SB1H 3FFGA 1LHFH 3BIUH 5EODA 1MMJN 4ASUD 1HFDA 2ZDMA 4B1TA 5L6NH 2PKAA 1IQIA 1O2ZA 2ILNA 1DUEA 1GVKB 2NU1E 1DWCH 2C8WB 1P05A 3H7OA 1DDJA 1P11E 8ESTE 4Z6AH 1E34B 1EP5A 2VVVA 4X1NU 4YO9A 1O3GA 1WOFA 1BRBE 2FDAA 5TCAA 1VCQA 2D8WA 1P02A 5DP4A 5LH8A 3H7TA 3PMJA 1QZ8A 1GMHG 2JH0D 5EG4A 1DX5M 1P8VC 4FUJA 5KECA 3AAUA 4RSPA 1EJAA 2BVXH 2ZIQH 1OWHA 2F9OA 2ZECA 5BRRE 2TRMA 4O97A 3QO6A 1D3QB 1V2ST 4IC6A 1V2VT 3RXRA 1EJNA 1BMNH 4CHAC 3HGPA 1GL0E 3OTJE 1SGFG 2BYAX 1V2LT 2WPLS 2W7SA 2GCTC 2C90B 3UY9A 1XKAC 5FPTA 1GBLA 5DP8A 2K0QA 5AFZH 3PMBB 2GT7A 5J4SA 1MBQA 1WDIA 4K8BA 3UQOA 3R3GB 1BOQA 3GCOA 3SZEA 1YCPK 2VIPA 1GG6C 3SJOA 5JDUB 4ZROA 3A7WA 1K1IA 4DCDA 1MZAA 1SGPE 3N99A 4B75A 4U2WA 1O2IA 1W12U 3MNXA 2ZCLP 2OBOA 1Z6JH 2R0LA 2J2UA 2J9NA 1Z8JB 1Z6EA 3O8BA 4X6OA 2PKSB 4LOYH 4H6SB 2A0QB 2BY8X 3BSQA 3KQDA 1P9UA 1XUJA 1AFQB 5FCKA 2A2XH 1S81A 2GTBA 1OWEA 4FUCA 4XRNA 1J16A 3A89A 3V12A 2XBWA 3D49H 1HJ8A 1V2UT 2AGGX 3GDSA 3DSPA 2ODPA 1FAKH 2FM2A 2G4UA 4A1XA 2W6ID 4JYVH 3RXKA 1UK2A 1PPBH 2GT8A 5LPFA 4GSOA 5C20A 4YLUA 1BJUA 2V0BA 5JYIA 1EAWA 1BDAA 1BRAA 3P8OA 3HKIB 2QC2A 2AHME 2ODQA 1EPTA 1GJCB 1TOMH 3VB5A 5DN6D 2XCFA 1GJ8B 1C2JA 3F9FA 1CBWB 4AORA 5C0TA 1CSOE 1EQ9A 1H8ED 5ABWA 6LPRA 4ESTE 1X7AC 4Y0YE 2JH6D 2Q6FA 1JOUB 4UFFH 5TCCA 1HAHH 5BPEA 2O8TA 3RXOA 2Y82A 3A7YA 3F2FA 4D7GA 1EX3A 2OC7A 3RMNH 1NRSH 1V2TT 1SR5C 1S83A 2BLQA 1YPHC 3NCLA 1P2IA 3LC3A 1C5TA 2D2DA 1FY3A 1AN1E 1YYY1 3MO9A 4B74A 5EGMA 1KXEA 2ZEBA 4CRCA 1T8LA 1BTYA 1JRTA 2ESTE 1SL3A 2F4LA 2ZZUH 1MCTA 2HGTH 1GBJA 1BTZA 3FZZA 3MYWA 5AHGH 1HJAB 2CGAA 3SUFA 1A46H 1LO6A 4F49A 4CRDA 4GAWA 3U8RH 1ABIH 3ZVEA 1Z1JA 1HGTH 1NBMD 3SV9A 3O8RA 2Q6DA 1YCPH 2A31A 1V2PT 2XBXA 3MQKC 2IJD1 2J94A 3FP6E 1O2KA 5ETXA 2BVRH 1ZZZA 3RXVA 1IQLA 1O2QA 3SNAA 4MDSA 4YESB 1DOJA 1QHRB 1P57B 1PPFE 1COWD 1F0RA 2BZ6H 1KMHB 5A8YA 2Z9JA 3EA9A 2VJ1A 1QJ6B 2WZQA 1C2KA 4IC5A 3Q76A 1G32B 1NRRH 1T4VH 1GDQA 1XUGA 1TNLA 1DLKB 3VXEH 5FX6A 9LPRA 4RT0A 2ZHDA 1C1PA 4IGDA 1O3AA 1M9UA 2DE9A 2O8LA 2W3IA 3N7DA 3Q3XA 4X2WA 4TT3D 3U28C 5C67A 4INKA 2A4OA 3RXEA 1AI8H 2EA3A 2SGEE 1AD8H 3I78A 1S6FA 2LELA 1CVWH 2KAIA 4RI0A 4OM9A 4DVAU 3Q77A 1A2CH 1GI9B 1UTMA 4TWWA 2CHAB 2ZPQA 3KNXA 4OGXA 3M3TA 4OS7A 3QX5H 4ZHLU 1ZLRA 4B76A 1HAOH 4CRFA 2OC0A 1A5IA 3TNTA 1AVXA 3F68H 4BTIB 3PTNA 1FI8A 1FQ3A 3PB1E 1ANBA 2C8YB 4Q7XA 1H9HE 2BDAA 4BTUB 3M7UA 2FLBH 4OS6A 2FLRH 2ZNKH 2M5TA 2OP9A 2FZZA 5FPSA 2AEIH 1MQ5A 3F1SB 4X6MA 2VINA 1PQ5A 5B6OA 3MWIU 2ZDNA 2OBQA 1WTHD 2AYWA 3SI4H 1SGYE 2PSXA 3M37A 1MTSA 4TY7A 2BDBA 1F0SA 4OS5A 5A0BA 3SO3A 4WXIA 1P04A 1O38A 1O3LA 1UTNA 3LGIA 1GCTC 2XCNA 1K1NA 3VG8A 1MTUA 3W95A 1W3CA 1LMWB 1K22H 4Y71A 1TRYA 3TPIZ 3M5NA 1LVBA 2WV9A 5E8EH 1G2MA 1GWAA 5CHAB 4TWYA 1JIMA 2GKVE 3D23A 2W26A 3MU0A 3ZZ9A 1MAXA 1Z8RA 2RFKC 1V2WT 3UOUA 4D7FA 1AWFH 2GZ9A 3CENA 3SU4A 3SUEA 3DA9B 4F55A 1V2RT 1SGCA 2YMSC 1W0KD 2V3OH 5GJ4B 1GJ5H 1HAYB 1HCGA 1ZOMA 2IN2A 3PMHB 1SOZA 1GBDA 3UREA 1BA8B 3OU0A 2P3FH 2JJ2D 2PWXA 3BG4C 1UTPA 3M35A 2WINI 1AB9B 1ZTKA 1IHSH 1TGBA 3AASA 1INCA 1C9TA 2AGEX 3ZZ7A 4XD7D 2ZCKP 2QE7D 3DHKH 1O5GH 3PLKA 1FONA 1OYQA 1GI1A 3P8FA 1LVOA 2OQUA 3T29A 4Y0ZE 1XXFA 1O3DA 1UCYK 1GJ4H 1O5EH 2ULLA 5F53A 3F9EA 3OFND 1SGNE 2R9PA 3BF6H 1LQEA 4ISHH 1W13U 2BOHB 2NU0E 1O5FH 4FUBA 1AY6H 2BXTH 1TFXA 1JMOH 1O30A 1BTXA 1CGJE 2HNTE 3DT0H 3KN2A 1FUJA 4CRGA 3TJOA 3WW7A 1C4U2 3TH3H 1CT2E 3NRLA 3ELAH 1ELFA 1CHOG 2QXGA 3JZ2B 1GJ7B 1BITA 5E0JA 3W94A 3ZVDA 1W14U 1CA0B 1OP0A 4K1SA 3A87A 3U9AH 2KCAA 3UR9A 1CGHA 1NS3A 2AERH 4MG3A 1Y5BT 1THSH 1S6HA 3LKWA 4KTUA 1TWXB 4D76A 1K1OA 2BZAA 3SNBA 1O2HA 2TGPZ 1QA7A 2B7DH 2FMJA 1S0QA 1B7XB 5E0GA 5A8XA 4DGJA 3RXPA 2BY5X 2XTTB 1KSNA 2VWLA 1EAIA 3NZIA 2V6NA 2XW9A 1O36A 4VGCC 3T26A 1ARBA 3ATLA 1AWHB 1GBKA 1GI2A 1KXFA 1KXBA 2HPQH 4NFFA 1TBZH 1O2OA 5LPRA 1ID5H 2QGRA 5C2ZA 1BUIA 2Q1JA 3PLBA 1EUFA 3FN8A 2ZGXH 5GIBA 4KKDA 3PRDA 2QF3A 3A7ZA 4DJZB 3FZDA 2BX3A 1TE0A 3PROA 1QQUA 2WHXA 4SGAE 1C2FA 7KMEH 2ZTZA 3B9FH 2RA0A 3WWFA 2JETC 2FTMA 2BVSH 4I31A 4E05H 1YWUA 2FYRA 1VGCB 1O2UA 4RKJB 4IS5A 1LHDH 1VJ9U 4AGJA 1BTUA 1P3CA 2O8MA 4AYYB 4AFZA 2OD3B 3E16B 1AVGH 2JDID 3SNCA 3RXUA 2BD9A 1FJSA 5A09A 1EB2A 3UWJH 2J34A 3K6YA 4DT7B 3LGYA 1SOTA 1VITF 3QTVH 1DWBH 3SN8A 3CP7A 4TPIZ 4Y8YA 2XWAA 3GISB 1UCYH 3ATMA 4XBBA 3VB4A 2F43B 2HNTC 1SGEE 2WPHS 1O3KA 3VPKA 1GMDF 5HGGA 5HM2A 1T8NA 3GY4A 5GDSH 1ZTLA 3NUMA 2FOGA 1GBAA 2ZU5A 3F9HA 3RXSA 4ZKNU 2RA3A 1MCVA 1BHXF 2ANYA 3DCLA 4NIYA 2AIQA 4FUEA 1VCWA 4BOHA 1A5GH 1F7ZA 2P8OC 2AMPA 4MNWA 1C1NA 2QAAA 3S9BA 2A2QH 1W0ZU 1ZJKA 8GCHF 1SMFE 3ZIAD 3M5LA 3PMAB 1ORFA 1RTLA 1IQMA 3FP7E 1Q2WA 4X8TH 4WXVA 1TONA 5CMXH 1H8IH 1LHCH 3CS7A 1EB1H 3F0PA 1DICA 4BAMB 2GV6A 1GCDA 2ZC9H 2XC0A 1GHBF 1L1GA 1TYNA 4JZFH 1A5HA 1RXPA 1SFQB 1K28D 2PW8H 1OHHD 1O0DH 3TK5A 1MZDA 1NN6A 3TJVA 1NT1A 4I8GA 3A88A 2VIOA 1QL9A 1Y5AT 1UVUH 4I33A 3S7KB 1UHBB 1UVOA 1FN8A 1MTNB 3AAVA 3UAIC 4UE7H 1ANCA 1TNGA 3SUGA 4Y10E 3UB0A 1GHXH 3RXIA 1O2TA 1UTJA 1RTFB 1OS8A 2AMQA 1CE5A 1GBHA 4X0WU 2BOKA 2VB0A 2GCTB 3GOVB 4FXGH 4I8JA 4XOJA 2BQ6B 3UR6A 3BTKE 1VITG 5ESBA 1ZSLA 2H2ZA 4KP0A 1DWEH 5EJLA 3M3VA 1O3MA 1UMAH 2W5EA 4E7NA 1GMDG 3LGWA 1K9OE 1C2GA 1KTSB 1BRCE 4ZKOU 3GYMA 3QGNB 1GI0A 3EAJA 1W7GH 3F2HA 3PM3A 3LH1A 2AFQB 4A7IB 5FXLA 4BANB 3D62A 1OWJA 1GL1A 2C8ZB 2XNDD 2VIQA 3UPEA 1GGDB 4M7GA 4RT1A 3ATIA 1O2LA 1TPOA 4O3UA 3OYPA 3QGJA 2R2WU 1C1TA 2C4FH 3RC5A 2BB4A 2HVYB 1K1JA 5SGAE 1ELGA 2PKAB 3HK3B 5A2MH 1ELAA 2OQ5A 3MH6A 3ZZ3A 1GI8B 1C4V2 3E8LA 3CNRA 2XWBI 2FIRH 1UK4A 1C5NH 1FIWA 4DG4A 1MAYA 3EA7A 1BMLA 2QV1A 1WQSA 1ELVA 2HNTF 4KTSA 3MTYA 1SPJA 2UUFB 4A6LA 2PR3A 2WUBA 2FOHA 3RXFA 2VBCA 4WWYA 5T3HA 6CHAB 4JYTA 2BD8A 1CT0E 2R2MB 2UUYA 2VH0A 2KFWA 1UW7A 5F8XA 1S6LA 3RXGA 3SORA 2H9HA 3W1EA 1TBQH 1SLUB 2GMTC 1QQ4A 3LJJA 1TRNA 1V6DA 2ZFPH 4B2AA 2A5IA 3E1XB 3TITA 1A3EH 4U30A 2ZQ1A 4NA9H 4NCYA 1O2MA 1YPHE 2BD7A 4HFPB 4JZIA 5DP6A 4DT4A 2B9LA 2G5NA 1ZTJA 2ALPA 4YOIA 1XXDA 1GDUA 1FNIA 4X2XA 5AF9H 3QDZB 1NFWA 2KR7A 1OP8A 5EQSA 1EP6A 1LVYA 1L0ZA 1W8BH 1A7SA 3SV8A 1HDTH 1RS0A 2R3UA 1TA6A 2VVUA 4B6EA 2Z9LA 3ESTA 3GY5A 2FWWA 2B5TB 3GCTF 1GHWH 1OWKA 1LHGH 2VGCB 1T32A 2G00A 1Y3VA 3QK1A 4NIVA 2NU4E 1F0TA 3RM0H 4FUIA 3LH3A 4J1YA 1SKYE 2WYJA 2BD3A 1QGFA 1TALA 3FVFB 3BTGE 1V2NT 2TIOA 5HIZA 4AC9A 3ENSB 4CH2B 1WTGH 2XYAA 5HIYA 5JBBS 3VGCC 1O2VA 2ZFTA 2HRVA 1NU9A 5HMAA 3LIWA 1ZSKA 2BHGA 1YLDA 4ISIH 3GY6A 1EPTB 1CT4E 1SC8U 3A8AA 2ZFRH 3GYLB 3RXBA 1P3EA 1NPMA 3SU3A 2P59A 5DP5A 1TPSA 1AU8A 2KM0A 3LJOA 3MH4A 8KME2 9ESTA 5EJZA 2EQNA 4CBNA 2A4QA 1SHHB 1A1RA 2YNBA 3P17H 3HATH 2NU2E 3EA8A 7LPRA 3QZQA 3SBKA 5FHTA 3SV2H 4ABHA 3M5OA 1O3OA 3V13A 2PGQB 1BQYA 1GHVH 2ZU4A 1LVMA 2EI8A 4K5ZA 1TNIA 2EEKA 1WSSH 3LC5A 4TPYA 4WJG2 1F5LA 4O3TA 1B0EA 1DANH 1NRNH 1EZSC 2GGVB 3BEFB 2J98A 1SHYA 2Z9KA 2FOFA 2ZGJA 4AB8A 4YZUA 1EKBB 3SGQE 3JZ1B 3SGBE 3VB3A 3SV7A 2IPQX 2WPIS 1GMCF 1EATA 2VH6A 3RU4E 1VKYA 1GI5A 2G51A 1ELBA 1K21H 1O5DH 3UFAA 1NFYA 1QL7A 2J92A 1P06A 3S9CA 2FODA 3SNDA 2HALA 1C2IA 2FOAA 2RDLA 1C5VA 3QLPH 1O5BB 1QY6A 2LNCA 1ELDE 4CH8B 4AZ2B 1Y3WA 3GICB 3PV2A 2PP6A 5EPYA 2BD2A 2QN5T 1YM0A 6GCHF 1F92A 3A84A 2ZG0H 3GCHB 1W10U 3S0NA 1D3PB 1GI4A 4X1SU 3ZZAA 3MO3A 3RXJA 3PV5A 3VB6A 4GUXA 1BHXB 1HAVB 4IN2A 1AHTH 5A0AE 5GCHF 5CDFE 4LZ1H 1HAVA 3K65B 5ESTE 4JZ1A 1L4ZA 2IPHA 1Y3YA 2QIQA 4ISLA 4ACAA 2H1UA 1ZGVA 3GY7A 2ASUB 4P00A 4H4FA 1J9CH 1ESBA 2ZU1A 1GBFA 3ZV9A 2XBYA 4MPUA 1NBME 2PKSC 2KAIB 2V3HH 1MQ6A 2ZGBH 2BLOA 2TPIZ 3LONA 4X6PA 5CHBA 1QNJA 5JB9S 1AFQC 4OGYA 3GCNA 2Z9GA 1DSUA 1GBBA 1U6QA 3N7OA 2QYIA 3FOAA 1PJPA 2G81E 4ZMAH 2Y5FA 1GI6A 1XVMA 1PFXC 2HOBA 5JB8S 3P6ZB 1E37B 1JRSA 4FUDA 3AVZA 1XM1A 4YT7H 4XE4A 1LHEH 1DLEA 3P70B 1ETTH 4AFUA 2W7UA 1OKXA 1RRKA 1GJAB 1KLTA 4K8YA 1RFNA 1CBWC 4TYDA 5L2ZH 1P9SA 4FUFA 3M61U 1D3TB 3MU8A 4AYVB 2OK5A 3ZZ4A 1D4PB 3R0FA 1F2SE 1UCYE 4Z0KA 1HAPH 1UVSH 5A8ZA 1HNEE 2WV5A 3F2GA 5K7RA 1D9IA 1E1QD 1O5CB 2PSYA 4FUHA 2PLXA 3GDVA 1IQNA 1FY1A 4GCHF 1UK3A 1GVZA 4I8HA 5H4IB 2PTNA 2OTVA 2QXJA 2H9EH 3IG6B 2WUCA 1GHYH 4ABJA 5DPAA 3T62A 4GHQA 6GCHG 1JIRA 2HPPH 1AVWA 4J2YB 5C5NA 2J4IA 1OYTH 2ZP0H 2H5DA 1IQEA 1TX7A 1MTWA 4ABDA 4HZHA 4K1EA 2LPRA 1Q31A 1HYLA 2JH5D 1TGSZ 2FI5E 1QBOA 1KXAA 4F48B 1Q3XA 3MOCA 5GCHG 3KHVA 3ZVAA 4YOGA 2ZPRA 3QN7A 4D9RA 4O03A 1TMTH 1TGTA 1G9IE 3FAOA 1FMGA 5C0UA 3SW2B 2TGAA 3SQEE 1DM4B 4LXBH 2L74A 4UFEH 1GI3A 2NWNA 1RIWB 2HLDD 1AE8H 1C1QA 2A1DB 1P10A 2BDGA 4MNYA 1IQGA 5F8ZA 1BMFD 3VXFH 1SGDE 4HGCA 3SYJA 1CA8B 2P3UB 3ZZCA 1TLDA 4ABGA 1IQJA 1BJVA 3BTDE 1A0LA 4UD9H 1G3BA 4FUGA 5E0HA 1PPZA 4UEHH 4MPXA 4Z1MD 3PO1B 3TGJE 1Y3UA 3MFJA 2ZTYA 1SQRA 1BBRK 4U32A 2VVCA 2OC8A 1MD8A 4IMZA 4K69A 2A45B 5FBIA 1QFKH 2A32A 3MNBA 1H9LB 4DIIH 1C1WH 2FESH 1EXFA 2OC1A 1YF4A 4NWKA 4O9VA 3L33A 1DPOA 1IQHA 1VZQH 4I86A 2BDYA 2G4TA 2CHAC 1GBCA 2O8UA 1IHTH 3URDA 3TJNA 1FPHH 1QCPA 2FOBA 1N8OB 1KLIH 2PUXB 5I46H 4MLFB 3CS0A 3NXPA 1YC0A 1NRPH 4BAOB 1XUHA 3RXLA 4BXWA 2Y80A 2BY9X 2H9TH 4Q63A 4TY6A 3ZYEA 4XSKU 4AB9A 2WPDD 1TMUH 3TJUA 1SLXB 4DIHH 1SLWB 1NFUA 2UWPA 1ZJDA 2ZTXA 3SJ8A 1E1RD 2BXUH 4P02A 1CHGA 4M9FA 3WWBA 1A61H 1HAXB 5EQQA 2PHBA 2VNTA 3RP2A 5DK1A 1HIAA 3OSYA 2ANMH 3OEED 2KCOA 3TK9A 6ESTA 1DUAA 1JXPA 2QCYA 1Z8IB 2WYGA 5EW2H 4KELA 2K1QA 3M7TA 5C1XA 1HLTH 2UUJB 4JYUH 4B71A 3SOSA 4E06H 1ELTA 1GJDB 3LT3A 4WMFA 4K1TA 1OSSA 5CHAC 3MHWU 4ABIA 1TAWA 4WH8A 3PLPA 2BD4A 4MNXA 3KYGA 2ZU3A 4MTBA 3LGUA 1F5RA 4FU7A 1K0HA 1P2NA 1EZUC 1K1PA 2FP7B 3FANA 3MNCA 2C3SA 1IOEA 1QJ7B 2Z9IA 1V2OT 1WQVH 1KLJH 2F9NA 5CE1A 2V7QD 1MKWK 4SGBE 4BAHB 1ZR0A 1P0SH 1HAGE 2ZGHA 3SI3H 2ZFFH 3ZVGA 1AO5A 2F3CE 4CRAA 3GY2A 1TGCA 2WSSD 4GVUA 2SGAA 1DVAH 1MUEB 2PUQH 2ZPSA 1O31A 1TPAE 1BBRH 1ESTA 3PTBA 4XDEA 1D6RA 1LPGB 3SU1A 1C4Y2 1AB9C 1E36B 2PTCE 2PV9B 5L2YH 3QTOH 2KX4A 4Y6DA 4I32A 1H8HD 3H09A 3TGIE 2FYQA 4ASHA 3ODFA 1O5AB 1S5SA 2F9PA 4ZAEA 3KIDU 2ZI2H 3ZVCA 2CMYA 3M3SA 1CU1A 5T6FA 2YNAA 2QXIA 5I25A 1MTVA 1N6YA 2GCHF 1KY9A 3KL6A 1K2I1 1WYKA 4Y76A 2P3TB 1O32A 1QJ1B 3L6PA 1O2WA 1C2DA 1G2LA 1W7XH 1NFXA 2IOTA 1KYNA 5T1VA 1SI5H 2FXRA 1EAXA 1ESAA 1HXFH 1PPGE 1K1LA 4B6FA 4RN6A 2A4GA 2AIPA 4AOQA 1BRUP 1K1MA 1CA0C 1O2RA 1T7CA 1ETSH 1GDNA 3SU5A 2FO9A 3EE7A 1PYTD 3UOPA 3NPSA 1ETRH 5EJ1A 1O2JA 1Z7KA 4X8VH 1DSTA 1T8OA 4JMYA 2BLVA 5F8TA 4XFQA 3A85A 4ZCNA 1LTOA 3I77A 4X1RU 3LGVA 2GVFA 1TOCB 1YP9A 1KTTB 2YOLA 1C5WB 1C9PA 1NROH 1S84A 3A7TA 3B8JA 4X8SH 4WMDA 3TVJB 4CHAB 4B73A 1TQ0B 3OEHD 1Y5UT 1IAUA 4YTAA 3A86A 1HAIH 2ZDVH 3ZZDA 3KGPA 1XMNB 2Y6TA 1EOJA 1KDQA 1O35A 3MO6A 4MPVA 2XRCA 3ODDA 1ZPCA 2D26C 3V3MA 1O39A 1V2QT 1NM6A 2QF5A 4XBCA 2VIDA 3O8CA 2G55A 5JPMH 2ZHFH 5EXMA 3U8TH 1MKWH 3SV6A 1DFPA 2CJIA 1UO6A 1QIXB 4FOUC 3N7EA 1GG6B 1AIXH 4IBLH 3RM2H 1V3XA 3BTQE 4WF8A 3SZNA 4ABBA 3UQVA 1VGCC 1XUFA 3KQ5A 3PWBA 3T2NA 4YXWD 1BT7A 4U01A 1O3HA 2EC9H 2J95A 1NY22 2B8OH 1FY8E 4A1TA 4X6NA 1S82A 1E35B 2AS9A 3F9GA 5FL7D 3UNQA 3ATKA 4I7YH 1SBWA 5T6DA 4DURA 4WH6A 1ABJH 5IK2D 1HXEH 3M36A 5FPYA 3SHCH 8GCHG 1C1RA 1BMMH 1WUNH 1ANEA 2GCHG 1W0JD 3MU4A 4ABAA 1MU8B 1G36A 1E79D 1P2MA 3VGCB 3KF2A 2AMDA 1ZPZA 2ZHEH 2ZQ2A 1QBVH 1GBTA 1GHBG 3LOXA 1SLVB 4IMQA 1N1LA 1JWTA 1LPKB 1YLCA 1AQ7A 3DUXH 2AH4X 5DO4H 1RGQA 3SUDA 3RMLH 1P03A 3OX7U 5JBCS 2SNWA 2BY6X 2G5VA 1O3BA 2B0FA 2G8TA 3BTWE 1QRZA 3T5FH 1OWIA 3AK5A 1PQ8A 1LPZB 2ZDLA 1BCUH 1PPHE 3SJKA 2WPJS 3NWUA 5EW1H 4OS4A 3PYHA 4INHA 1XVOA 4ABEA 2DUCA 1DY9A 3SJ9A 3ZYDA 3VB7A 5T6GA 2BTCE 4Y11E 7GCHF 4ZH8A 3E90B 1TBRH 2I6SA 1PPEE 1UJ1A 3PV4A 2VU8E 2EI6A 2ZF0H 1MTNC 4NSYA 3FKSD 2A4RA 3KQCA 1IQKA 1YPLH 1PYTC 2FEQH 2ALVA 2KCYA 1UTLM 1W0YH 4RKOB 1L4DA 1D6WA 1RD3B 3BIVH 3RXAA 4Q7ZA 5JBAS 1TNKA 3BTME 1L1NA 3SJIA 2V3MA 3EQ0H 1G30B 1A0HB 4FVDA 4I8LA 3QWCH 1C5OH 1OWDA 2BQWB 3BTHE 1RTKA 3BTEE 5C1UA 4AG2A 1C5ZB 1TX6A 3E6PH 3A8CA 1Y8TA 4FVBA 1O34A 2XC4A 1C5PA 1BZXE 1BTWA 3SGAE 4X8UH 1MKXK 1QB1A 4A92A 1Z8GA 1O3CA 1TABE 1ACBE 2ZA5A 1C1MA 3M7QA 3Q3YA 4WMEA 3A81A 1VCPA 2M2AA 1GHAF 4X1QU 3SNEA 1TB6H 3U1JB 1O37A 1J14A 1AGJA 4BXSA 1BIOA 2NU3E 4E7RG 1C5YB 2Z6BD 4X2YA 1THRH 3SU6A 2SGFE 1CQQA 1YPEH 3T25A 1GGDC 2BDHA 3SHAH 4AN7A 1BTPA 1GBEA 5F6MA 1O3PB 5HYOA 1ZMLA 4H6TA 4PROA 1P2KA 1FPCH 2BMGB 4Y8ZA 1LKAA 2CN0H 1EFRD 3IWMA 2Z3EA 1XKBC 3UUZA 3A8DA 7GCHG 3RU4D 1AKSB 2CF8H 1NZQH 5EXNA 2F83A 2TGDA 1Y59T 1XUIA 2J98B 1O2GH 1AKSA 1O2YA 2Z3DA 1OXGA 2K8IA 3A7VA 4LZ4B 3RXHA 2ZHQH 3A83A 1F0UA 2O8WA 4ZKRU 1WAYB 1MABB 2OXSA 1SQTA 1HAZB 6CHAC 1HPGA 4MVNA 1HRTH 3EGKH 5DKMA 2GZ8A 3OY6U 3RMOH 1SFIA 1EJMA 5DG6A 4YM9A 2A5KA 2OINA 1QL8A 3U69H 3RLYH 4D8NA 1EZQA 1G3CA 1GCTB 1TNHA 2ZFSA 1ZSJA 2O9QA 4IW4E 3TGKE 2TBSA 1P2QA 4Q7YA 4ZXYH 3GCTG 4INLA 1DT2A 1YBWA 1AE5A 1T8MA 4JZEH 4NZQA 1SQAA 2GDEH 1WXRA 4ISOA 4ZHMU 3HPTB 4JK6A 2RDEA 1G3DA 1O2SA 4Q4LA 2UWOA 1H1BA 1MKXH 1G3EA 3V7TA 4CRBA 4K3JA 2H5CA 2VWNA 2YMSD 5PTPA 1GHAG 3RU4T 5DGJA 1C1VH 2J38A 3FP8E 1J15A 2YMSB 1FX0B 2VIVA 4NIWA 4ZXXH 5C5OA 1ZRBA 1ANDA 1S0RA 3F6UH 3MNSA 4UDWH 1YPGH 2ZHWH 3AW1A 1KIGH 2VGCC 4BTTB 2L6OA 3TK6A 1LKBA 3BG4B 2A7HA 1S85A 1JBUH 1DWDH 1O3IA 2GDDA 3KQEA 3PWCA 3F3BA 3QUMP 4UFGH 4NWLA 4KTCA 5LGOA 2Z7FE 4ZKSU 2F9VA 2RCEA 3SU2A 1ZPBA 1UVTH 2QF4A 3OE7D 3VFEA 1C2MA 1O3NA 4NSVA 2W6JD 2QY0B 3QZRA 2BDIA 2ZWLH 1RJXB 5IYTA 4HG6A 2PGBB 5AFYH 2CF9H 3KEEA 2GX4A 1EPTC 1KXDA 4D9QA 1FY5A 1LDTT 1ZHRA 2HLCA 1QA0A 1PQAA 3RLWH 4NFEA 2HWLB 4AFQA 4LK4A 3BTFE 1ZGIA 1NC6A 3RXTA 4AGKA 3UIRA 1YLNA 3BV9B 1WV7H 1GMCG 1O33A 1ZMJA 1QURH 5AVDA 1DXPA 4OS1A 5DP3A 2Z3CA 5FX5A 4BAQB 3I29A 3RXMA 4KGAA 3RXQA 2BD5A 1O3JA 2R0KA 1BBRE 1TIOA 3VEQB 3BG8A 3URCA 1MBMA 2C8XB 2FOMB 5F03A 1DXWA 2Q6GA 1O2NA 2FPZA 1ARCA 3S9AA 3OAAD 1HJ9A 2TGTA 4VGCB 1FZZA 2V35A 3LGTA 1W2KH 4YLQH 2QF0A 5DP7A 1BB0B 1CHOF 1TX8A 3U8OH 3ZVBA 2G52A 2A7JA 3RC4A 2F91A 3L3TA 1FIZA 1PQ7A 2GZ7A 3GY3A 1HJAC 3E3TA 5GPIB 5FCRA 4X1PU 2XXLA 4NG9H 1QR3E 5B6LA 1ZRKA 3UWIA 2LP6A 1FXYA 3O8DA 1SGFA 2PFEA 2JETB 2P93A 2BQ7B 3HK6B 1NESE 1ZMNA 3MH7A 3K9XB 1FDPA 3K2UA 7ESTE 3DFJA 1AZ8A 1B0FA 2VIWA 1VJAU 2FX4A 1LQDB 1UTOA 2A7CA 3GCHC 1C5XB 3BEIB 4AG1A 5EXLA 4YT6H 5J4QA 8LPRA 1C5QA 4CREA 3BN9A 2ZDAH 3KYFA 3UNRA 3EYDA 1TGNA 1TMBH 2P95A 3KQBA 3DSOA 1O3EA 3OY5U 3HGNA 1YCPM 1B5GH 2RG3A 1THPB 3IITA 2STBE 2Y7XA 2ZU2A 3A80A 1C5RA 4R8TB 4WY3A 2UWLA 4FETA 3TU7H 4DW2U 3LU9B 3S7HB 1GJ6A 1OOKB 4Q2KA 4H42U 2OUAA 4UONA 1ZHMA 2GV7A 4NIXA 1C1OA 1P2OA 1MD7A 2P8OB 3M5MA 1GVLA 5GWZA 5G4BA 1O2XA 1G37A 1EASA 1V2JT 3U98H 1OP2A 2STAE 3GDUA 1ELCA 1J8AA 1T4UH 1EOLA 1O3FA 3B23B 3WY8A 5HM9A 1NO9H 1FN6A 1E0FD 3KCGH 4GCHG 4Y79A 3RDZA 4MNVA 4YOJA 2XOKD 3F0OA 2Y5GA 5HXFA 3G01A 1NRQH 1SGQE 4F4OC 3A7XA 3H5CB 1O2PA 4WVPE 5E2OA 2GD4B 1GPZA 2ZO3H 2BY7X 1YKTA 1YPJH 1GBIA 1XX9A 4ACBA 2XBVA 3E0NB 5IDKA 3MI4A 1VR1H 2Y7ZA 3OTPA 3EE0B 1HIAB 1VITH 2IJOB 4GPGA 4MQAA 1YGCH 2EI7A 1NU7B 1C5LH 2Y5HA 5TJXA 1TNJA 1Y3XA 1HUTH 2VWMA 2ODYB 1A4WH 5E2PA 5EU8A 1SVPA 2A5AA 2KZ4A 3TH2H 1CO7E 1LCYA 1XUKA 2Z94A 4A5TS 2AGIX 2ZKSA 1AUTC 3DFLA 5EOKA 2WV4A 1YPKH 1HBTH 4DOQA 3DSGA 4BNRA 2BDCA 4FU8A 4ZHAA 2OLGA 1DS2E 2FI4E 1C2LA 4Y7BA 3EDXB 1NTPA 3Q00A 1P2JA 4XBDA 1P12E 1UTQA 3ITIA 2P16A 2BLWA 3AW0A 1GBMA 3GY8A 3ATWA 4JCNA 5FBEA 1FY4A 3UTUH 3NKKA 4TSFD 5DP9A 3P95A 1PPCE 1DE7H 4GHTA 4IN1A 4NGAH 1AUJA 1L1JA 4K2YA 2D1JA 1W11U 2W3KA 1MU6B 3E0PB 3TH4H 2QXHA 4Q80A 2SNVA 2SGQE 3SU0A 3A82A 2EY4C 3DD2H 1SGIB 1GI7B 1RIWC 4GLYA 2J5UA 1GHZA 2KCPA 3D65E 1AMHA 3SQHE 3STIA 5HKKD 3ZZ5A 2CV3A 3RXDA 4THNH 2ANWA 4CR9A 1H9IE 2GP9B 3MH5A 3U1IB 3ZZ8A 1QB9A 2DE8A 3P92A 2BM2A 1SQOA 3PO1C 3K6ZA 1DY8A 4MPWA 1P01A 1EAUA 3PRBA 1SSXA 2JKHA 1OX1A 5C1YA 1F5KU 2ZCHP 2SFAA 4AX9H 1D3DB 2SGPE 1AZZA 2UUKB 5A0CA 1C1UH 3Q3KA 1T31A 2VWOA 2Y81A 4B2BA 4I8KA 5KEDA 1TQ7B 1GJBB 2GJGA 1Z1IA 3TIUA 5EIYA 2JIZD 1DITH 2FI3E
chains in the Genus database with same CATH topology
1BMAA 1H4WA 3TLOA 3LDXH 1HV7A 2H6MA 1C2EA 4R0IA 4NA8A 1N8OC 1WU1A 5EQRA 2I6QA 1C5MD 1TA2A 1GJ9B 2XC5A 4Y7AA 1BTHH 2ZDKA 3BEUA 1KXCA 2HVXA 1A3BH 1C2HA 3MU1A 1C1SA 5C3NA 1V2MT 5JBTA 1UVPA 3TNSA 1J17T 3P8NA 2ZFQH 1WCZA 2GMTB 5LPEA 3RXCA 1QB6A 2R3YA 4K60A 4AFSA 1QTFA 2FS8A 3RC6A 1IQFA 4B2CA 1SGRE 3V0XA 1KDQB 1CGIE 1FLEE 1SGTA 1UHBA 4CR5A 4ABFA 4HTCH 4ZUHA 3ZVFA 4DY7B 3C27B 3MU5A 1GMHF 2OCVB 2FOEA 4JK5A 1FAXA 3T27A 1SG8B 1TPPA 2F9BH 1QRWA 2ANKH 1A0JA 3STJA 1H8DH 3P8GA 4UFDH 3NK8A 3BTTE 1HB0B 1ZHPA 5K0HA 1QBNA 4JZDH 3C1KA 5FAHA 2FS9A 3ZZ6A 1ELEE 1V2KT 1ZYOA 2C93B 3ZZBA 3A8BA 1TRMA 2CXVA 1WBGB 3UNSA 5L30H 2QA9E 2P94A 1L2EA 2WPKS 1Z71A 4A1VA 3RMMH 2ZGCA 1P09A 4BAKB 1MH0A 5DJ7A 1YPMH 4NA7A 1FV9A 3S69A 1OPHB 2FX6A 3HKJB 4CBOA 2SGDE 1QRXA 3E91A 4QT8C 2FOCA 4HI3A 4ISNA 2XNIA 2THFB 1UTKA 4Y8XA 4FU9A 2BX4A 4OS2A 1AFEH 1EZXC 3LPRA 3T28A 1C5UA 3ZV8A 5GXPA 5EPNA 1N6XA 2FTLE 4NZLA 3MMGA 3RUOA 2F9UA 2WPMS 1E38B 1C5SA 4X2VA 1SB1H 3FFGA 1LHFH 3BIUH 5EODA 1MMJN 1HFDA 2ZDMA 4B1TA 5L6NH 2PKAA 1IQIA 1O2ZA 2ILNA 1DUEA 1GVKB 2NU1E 1DWCH 2C8WB 1P05A 3H7OA 1DDJA 1P11E 8ESTE 4Z6AH 1E34B 1EP5A 2VVVA 4X1NU 4YO9A 1O3GA 1WOFA 1BRBE 2FDAA 5TCAA 1VCQA 2D8WA 1P02A 5DP4A 5LH8A 3H7TA 3PMJA 1GMHG 2JH0D 5EG4A 1DX5M 1P8VC 4FUJA 3AAUA 4RSPA 1EJAA 2BVXH 2ZIQH 1OWHA 2F9OA 2ZECA 5BRRE 2TRMA 4O97A 3QO6A 1D3QB 1V2ST 4IC6A 1V2VT 3RXRA 1EJNA 1BMNH 4CHAC 3HGPA 1GL0E 3OTJE 1SGFG 2BYAX 1V2LT 2WPLS 2W7SA 2GCTC 2C90B 3UY9A 1XKAC 5FPTA 1GBLA 5DP8A 5AFZH 3PMBB 2GT7A 5J4SA 1MBQA 4K8BA 3UQOA 3R3GB 1BOQA 3GCOA 1YCPK 2VIPA 1GG6C 3SJOA 5JDUB 4ZROA 3A7WA 1K1IA 4DCDA 1MZAA 1SGPE 4B75A 4U2WA 1O2IA 1W12U 3MNXA 2ZCLP 2OBOA 1Z6JH 2R0LA 2J2UA 2J9NA 1Z8JB 1Z6EA 3O8BA 4X6OA 2PKSB 4LOYH 4H6SB 2A0QB 2BY8X 3BSQA 3KQDA 1P9UA 1XUJA 1AFQB 5FCKA 2A2XH 1S81A 2GTBA 1OWEA 4FUCA 1J16A 3A89A 3V12A 2XBWA 3D49H 1HJ8A 1V2UT 2AGGX 3GDSA 2ODPA 1FAKH 2FM2A 2G4UA 4A1XA 4JYVH 5LPFA 3RXKA 1UK2A 1PPBH 2GT8A 4GSOA 5C20A 4YLUA 1BJUA 2V0BA 5JYIA 1EAWA 1BDAA 1BRAA 3P8OA 3HKIB 2QC2A 2ODQA 1EPTA 1GJCB 1TOMH 3VB5A 2XCFA 1GJ8B 1C2JA 3F9FA 1CBWB 4AORA 1CSOE 1EQ9A 5ABWA 6LPRA 4ESTE 1X7AC 4Y0YE 2JH6D 2Q6FA 1JOUB 4UFFH 5TCCA 1HAHH 5BPEA 2O8TA 3RXOA 2Y82A 3A7YA 4D7GA 1EX3A 2OC7A 3RMNH 1NRSH 1V2TT 1SR5C 1S83A 2BLQA 1YPHC 3NCLA 1P2IA 3LC3A 1C5TA 2D2DA 1FY3A 1AN1E 1YYY1 3MO9A 4B74A 5EGMA 1KXEA 2ZEBA 4CRCA 1T8LA 1BTYA 1JRTA 2ESTE 1SL3A 2ZZUH 1MCTA 2HGTH 1GBJA 1BTZA 3FZZA 3MYWA 5AHGH 1HJAB 2CGAA 3SUFA 1A46H 1LO6A 4F49A 4CRDA 4GAWA 3U8RH 1ABIH 3ZVEA 1Z1JA 1HGTH 3SV9A 3O8RA 2Q6DA 1YCPH 2A31A 1V2PT 2XBXA 2J94A 5ETXA 3FP6E 1O2KA 2BVRH 1ZZZA 3RXVA 1IQLA 1O2QA 3SNAA 4MDSA 4YESB 1DOJA 1QHRB 1P57B 1PPFE 1F0RA 2BZ6H 5A8YA 2Z9JA 3EA9A 2VJ1A 1QJ6B 1C2KA 4IC5A 3Q76A 1G32B 1NRRH 1T4VH 1GDQA 1XUGA 1TNLA 1DLKB 3VXEH 5FX6A 9LPRA 2ZHDA 1C1PA 4IGDA 1O3AA 1M9UA 2DE9A 2O8LA 2W3IA 3Q3XA 4X2WA 5C67A 4INKA 2A4OA 3RXEA 1AI8H 2EA3A 2SGEE 1AD8H 3I78A 1S6FA 1CVWH 2KAIA 4DVAU 3Q77A 1A2CH 1GI9B 1UTMA 4TWWA 2CHAB 2ZPQA 3KNXA 4OGXA 3M3TA 4OS7A 3QX5H 4ZHLU 1ZLRA 4B76A 1HAOH 4CRFA 2OC0A 1A5IA 3TNTA 1AVXA 3F68H 4BTIB 3PTNA 1FI8A 1FQ3A 3PB1E 1ANBA 2C8YB 4Q7XA 1H9HE 2BDAA 4BTUB 3M7UA 2FLBH 4OS6A 2FLRH 2ZNKH 2M5TA 2OP9A 2FZZA 5FPSA 2AEIH 1MQ5A 3F1SB 4X6MA 2VINA 1PQ5A 5B6OA 3MWIU 2ZDNA 2OBQA 1WTHD 2AYWA 3SI4H 1SGYE 2PSXA 3M37A 1MTSA 4TY7A 2BDBA 1F0SA 4OS5A 5A0BA 3SO3A 4WXIA 1P04A 1O38A 1O3LA 1UTNA 3LGIA 1GCTC 2XCNA 1K1NA 1MTUA 3W95A 1W3CA 1LMWB 1K22H 4Y71A 1TRYA 3TPIZ 3M5NA 1LVBA 5E8EH 1G2MA 1GWAA 5CHAB 4TWYA 1JIMA 2GKVE 3D23A 2W26A 3MU0A 3ZZ9A 1MAXA 1Z8RA 1V2WT 3UOUA 4D7FA 1AWFH 2GZ9A 3CENA 3SU4A 3SUEA 3DA9B 1V2RT 1SGCA 2V3OH 5GJ4B 1GJ5H 1HAYB 1HCGA 1ZOMA 2IN2A 3PMHB 1SOZA 1GBDA 3UREA 1BA8B 3OU0A 2P3FH 3BG4C 2PWXA 1UTPA 3M35A 2WINI 1AB9B 1ZTKA 1IHSH 1TGBA 3AASA 1INCA 1C9TA 2AGEX 3ZZ7A 2ZCKP 3DHKH 1O5GH 3PLKA 1FONA 1OYQA 1GI1A 3P8FA 1LVOA 2OQUA 3T29A 4Y0ZE 1XXFA 1O3DA 1UCYK 1GJ4H 1O5EH 2ULLA 3F9EA 1SGNE 2R9PA 3BF6H 1LQEA 4ISHH 1W13U 2BOHB 2NU0E 1O5FH 4FUBA 1AY6H 2BXTH 1TFXA 1JMOH 1O30A 1BTXA 1CGJE 2HNTE 3DT0H 3KN2A 1FUJA 4CRGA 3TJOA 1C4U2 3TH3H 1CT2E 3ELAH 1ELFA 1CHOG 2QXGA 3JZ2B 1GJ7B 1BITA 5E0JA 3W94A 3ZVDA 1W14U 1CA0B 1OP0A 4K1SA 3A87A 3U9AH 3UR9A 1CGHA 1NS3A 2AERH 4MG3A 1Y5BT 1THSH 1S6HA 3LKWA 4KTUA 1TWXB 4D76A 1K1OA 2BZAA 3SNBA 1O2HA 2TGPZ 1QA7A 2B7DH 2FMJA 1S0QA 1B7XB 5E0GA 5A8XA 4DGJA 3RXPA 2BY5X 2XTTB 1KSNA 2VWLA 1EAIA 3NZIA 2V6NA 2XW9A 1O36A 4VGCC 3T26A 1ARBA 3ATLA 1AWHB 1GBKA 1GI2A 1KXFA 1KXBA 2HPQH 4NFFA 1TBZH 1O2OA 5LPRA 1ID5H 2QGRA 5C2ZA 1BUIA 2Q1JA 3PLBA 1EUFA 2ZGXH 5GIBA 4KKDA 2QF3A 3A7ZA 4DJZB 3FZDA 2BX3A 1TE0A 3PROA 1QQUA 4SGAE 1C2FA 7KMEH 2ZTZA 3B9FH 2RA0A 2JETC 2FTMA 2BVSH 4I31A 4E05H 2FYRA 1VGCB 1O2UA 4RKJB 4IS5A 1LHDH 1VJ9U 4AGJA 1BTUA 1P3CA 2O8MA 4AYYB 4AFZA 2OD3B 3E16B 1AVGH 3SNCA 3RXUA 2BD9A 1FJSA 5A09A 1EB2A 3UWJH 2J34A 3K6YA 4DT7B 3LGYA 1SOTA 1VITF 3QTVH 1DWBH 3SN8A 3CP7A 4TPIZ 4Y8YA 2XWAA 3GISB 1UCYH 3ATMA 4XBBA 3VB4A 2HNTC 1SGEE 2WPHS 1O3KA 3VPKA 1GMDF 5HGGA 5HM2A 1T8NA 3GY4A 5GDSH 1ZTLA 3NUMA 2FOGA 1GBAA 2ZU5A 3F9HA 3RXSA 4ZKNU 2RA3A 1MCVA 1BHXF 2ANYA 4NIYA 2AIQA 4FUEA 1VCWA 4BOHA 1A5GH 1F7ZA 2P8OC 2AMPA 4MNWA 1C1NA 2QAAA 3S9BA 2A2QH 1W0ZU 1ZJKA 8GCHF 1SMFE 3M5LA 3PMAB 1ORFA 1RTLA 1IQMA 3FP7E 1Q2WA 4X8TH 4WXVA 1TONA 5CMXH 1H8IH 1LHCH 3CS7A 1EB1H 1DICA 4BAMB 2GV6A 1GCDA 2ZC9H 2XC0A 1GHBF 1L1GA 1TYNA 4JZFH 1A5HA 1RXPA 1SFQB 1K28D 2PW8H 1O0DH 3TK5A 1MZDA 1NN6A 3TJVA 1NT1A 4I8GA 3A88A 2VIOA 1QL9A 1Y5AT 1UVUH 4I33A 3S7KB 1UHBB 1UVOA 1FN8A 1MTNB 3AAVA 4UE7H 1ANCA 1TNGA 3SUGA 4Y10E 1GHXH 3RXIA 1O2TA 1UTJA 1RTFB 1OS8A 2AMQA 1CE5A 1GBHA 4X0WU 2BOKA 2VB0A 2GCTB 3GOVB 4FXGH 4I8JA 4XOJA 2BQ6B 3UR6A 3BTKE 1VITG 5ESBA 1ZSLA 2H2ZA 4KP0A 1DWEH 3M3VA 1O3MA 1UMAH 2W5EA 4E7NA 1GMDG 3LGWA 1K9OE 1C2GA 1KTSB 1BRCE 4ZKOU 3GYMA 3QGNB 1GI0A 3EAJA 1W7GH 3PM3A 3LH1A 2AFQB 4A7IB 5FXLA 4BANB 3D62A 1OWJA 1GL1A 2C8ZB 3UPEA 2VIQA 1GGDB 4M7GA 3ATIA 1O2LA 1TPOA 4O3UA 3OYPA 3QGJA 2R2WU 1C1TA 2C4FH 3RC5A 2BB4A 1K1JA 5SGAE 1ELGA 2PKAB 3HK3B 5A2MH 1ELAA 2OQ5A 3MH6A 3ZZ3A 1GI8B 1C4V2 3E8LA 2XWBI 2FIRH 1UK4A 1C5NH 1FIWA 4DG4A 1MAYA 3EA7A 1BMLA 2QV1A 1WQSA 1ELVA 2HNTF 4KTSA 3MTYA 1SPJA 2UUFB 4A6LA 2PR3A 2WUBA 2FOHA 3RXFA 4WWYA 5T3HA 6CHAB 4JYTA 2BD8A 1CT0E 2R2MB 2UUYA 2VH0A 5F8XA 3RXGA 3SORA 2H9HA 1TBQH 1SLUB 2GMTC 1QQ4A 3LJJA 1TRNA 1V6DA 2ZFPH 4B2AA 2A5IA 3E1XB 3TITA 1A3EH 4U30A 2ZQ1A 4NA9H 4NCYA 1O2MA 1YPHE 2BD7A 4HFPB 4JZIA 5DP6A 2B9LA 2G5NA 1ZTJA 2ALPA 4YOIA 1XXDA 1GDUA 1FNIA 4X2XA 5AF9H 3QDZB 1NFWA 1OP8A 5EQSA 1EP6A 1LVYA 1L0ZA 1W8BH 1A7SA 3SV8A 1HDTH 1RS0A 2R3UA 1TA6A 2VVUA 2Z9LA 3ESTA 3GY5A 2FWWA 2B5TB 3GCTF 1GHWH 1OWKA 1LHGH 2VGCB 1T32A 2G00A 1Y3VA 3QK1A 4NIVA 2NU4E 1F0TA 3RM0H 4FUIA 3LH3A 4J1YA 2WYJA 2BD3A 1QGFA 1TALA 3FVFB 3BTGE 1V2NT 2TIOA 3ENSB 4CH2B 1WTGH 2XYAA 5JBBS 3VGCC 1O2VA 2ZFTA 2HRVA 1NU9A 5HMAA 3LIWA 1ZSKA 2BHGA 1YLDA 4ISIH 3GY6A 1EPTB 1CT4E 1SC8U 3A8AA 2ZFRH 3GYLB 3RXBA 1P3EA 1NPMA 3SU3A 2P59A 5DP5A 1TPSA 1AU8A 3LJOA 3MH4A 8KME2 9ESTA 4CBNA 2A4QA 1SHHB 1A1RA 2YNBA 3P17H 3HATH 2NU2E 3EA8A 7LPRA 3QZQA 3SBKA 5FHTA 3SV2H 4ABHA 3M5OA 1O3OA 3V13A 2PGQB 1BQYA 1GHVH 2ZU4A 1LVMA 2EI8A 4K5ZA 1TNIA 2EEKA 1WSSH 3LC5A 4TPYA 4WJG2 1F5LA 4O3TA 1B0EA 1DANH 1NRNH 1EZSC 2GGVB 3BEFB 1SHYA 2Z9KA 2FOFA 2ZGJA 4AB8A 4YZUA 1EKBB 3SGQE 3JZ1B 3SGBE 3VB3A 3SV7A 2WPIS 1GMCF 1EATA 2VH6A 3RU4E 1GI5A 2G51A 1ELBA 1K21H 1O5DH 3UFAA 1NFYA 1QL7A 2J92A 1P06A 3S9CA 2FODA 3SNDA 2HALA 1C2IA 2FOAA 2RDLA 1C5VA 3QLPH 1O5BB 1QY6A 2LNCA 1ELDE 4CH8B 4AZ2B 1Y3WA 3GICB 5EPYA 2BD2A 2QN5T 1YM0A 6GCHF 1F92A 3A84A 2ZG0H 3GCHB 1W10U 3S0NA 1D3PB 1GI4A 4X1SU 3ZZAA 3MO3A 3RXJA 3VB6A 4GUXA 1BHXB 1HAVB 4IN2A 1AHTH 5A0AE 5GCHF 4LZ1H 1HAVA 3K65B 5ESTE 4JZ1A 1L4ZA 2IPHA 1Y3YA 2QIQA 4ISLA 2H1UA 1ZGVA 3GY7A 2ASUB 4H4FA 1J9CH 1ESBA 2ZU1A 1GBFA 3ZV9A 2XBYA 4MPUA 2PKSC 2KAIB 2V3HH 1MQ6A 2ZGBH 2BLOA 2TPIZ 3LONA 4X6PA 1QNJA 5JB9S