3WWBA

Crystal structure of the computationally designed pizza2-sr protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
b'NTQTVLPFTGLNTPSGVAVDSAGTVYVTDRGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDRGNNRVVKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pizza2-SR protein
molecule tags De novo protein
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3wwbA00
3WWFA 3WWBA 3WW7A 5F53A 5CHBA 4ZCNA
chains in the Genus database with same CATH superfamily
1C1MA 1KTTB 2SGQE 1MBQA 3M36A 3A84A 5HXFA 1L1JA 1GCTC 1L0ZA 2OBOA 1PQAA 3TVJB 1O2LA 3OX7U 1OP0A 2HPQH 4CR5A 1SQRA 3DCLA 1LPKB 5TCCA 2G5VA 2C4FH 3M3TA 2ZU3A 3P95A 4R0IA 1GMHG 3RXBA 3VB3A 1BUIA 5ABWA 1GJ6A 1T7CA 1MCTA 1NC6A 2IJD1 4OGXA 1TNJA 1T8LA 1GMHF 2GV6A 3PWBA 1S0QA 2BVXH 3F0PA 4NZQA 4XBCA 4Y79A 3SNBA 3O8RA 1BBRH 4GLYA 1Z71A 2BY6X 4INHA 1MCVA 1O2PA 3GCHC 1GBDA 1V2MT 2SGEE 1THSH 4OS4A 1DXWA 3ZVDA 4XE4A 3GCTG 4FXGH 3PMAB 1BITA 5HKKD 1O3NA 1BTUA 1P03A 1Z8GA 1MD8A 2BMGB 4INLA 2ODYB 4ZMAH 1AGJA 2J9NA 2K0QA 3ELAH 4Y71A 3KQDA 1QBVH 2EQNA 9ESTA 1H4WA 4BXSA 4DG4A 1ZRBA 1H8DH 2FLRH 2WHXA 3UPEA 8ESTE 3HGPA 1EP5A 4YLQH 3SU1A 1AVGH 2BDAA 5LPRA 1QIXB 1BA8B 3P70B 1A46H 4D7FA 2FIRH 1PJPA 1ELFA 3IITA 3RC6A 2R2WU 4D8NA 3MO3A 5FBEA 6ESTA 2Y7XA 2PWXA 1Z8IB 1NESE 4FUFA 1F0TA 1K21H 3PLPA 5C0TA 3W95A 4BAKB 1KMHB 3R3GB 4DIHH 1OKXA 1CA0C 3QGJA 2Z9GA 2H6MA 2CHAB 2ZA5A 1VCPA 2ILNA 5FPYA 1AFEH 2VWMA 2Q6DA 2CMYA 1JBUH 4TPIZ 4ISOA 3BEIB 1O30A 3GY3A 1J14A 3S9AA 1SI5H 1SLWB 1YPHC 1N8OC 4ZCNA 1TRMA 1P2MA 1WYKA 4ASHA 1FY5A 3GDVA 3UWIA 2HWLB 1TGTA 2XOKD 3RXKA 3RC5A 1VITG 2QN5T 2ANKH 2M2AA 2VVUA 5DG6A 1H9HE 3PRDA 2EY4C 5LGOA 1YC0A 4NIYA 5FX6A 1ZGVA 2UWPA 4RT0A 1EX3A 3M7TA 5KECA 3KEEA 4MPWA 4RKOB 1QZ8A 1KSNA 1ELTA 5DP5A 4WH8A 2KCOA 1NM6A 2G4UA 1NY22 4YOIA 3WWBA 4U01A 1HAGE 1MAYA 1GHZA 3KQCA 3SJ9A 4CR9A 4UFEH 2QXHA 5T3HA 1TB6H 2P8OB 4P00A 2ZU5A 1MTWA 2O8TA 1UVTH 1RTLA 2BX3A 2Y5GA 2XWBI 1INCA 1GI2A 3SU4A 3GISB 2CGAA 3RU4E 4WXIA 3FP8E 1UK2A 3TGJE 1LVOA 4JZDH 3UWJH 4BAMB 4Y0ZE 3L6PA 3BTQE 1P2QA 1LHEH 4FOUC 3I78A 4J1YA 1YPLH 2ZEBA 3M61U 3ZVFA 1O35A 1T8MA 4K8YA 1C2HA 2Q6GA 2C8ZB 4X2XA 2Z9JA 1A5HA 3URCA 1DSUA 2PTNA 3QLPH 1RTFB 1F5LA 4ZKNU 4ISNA 3BIVH 1EJAA 1UJ1A 3GY7A 3ZVGA 2XC0A 1XKBC 2O8MA 1O5DH 7KMEH 3RXAA 4TT3D 2A2QH 2FYRA 1UVPA 2Z7FE 2W3IA 4FU8A 1FMGA 1MBMA 1HYLA 2ZNKH 5EW2H 5E0GA 1C2LA 1DANH 1G32B 3MU1A 3E90B 1FN6A 2TRMA 2FMJA 2WPKS 2C93B 2UUFB 2PUQH 4AGKA 2C90B 3T62A 1TBRH 1NBMD 3OE7D 6CHAC 4Q80A 2XWAA 3PM3A 4AX9H 2BD8A 4BAHB 1ARCA 1BRAA 1TIOA 3DT0H 1HAZB 3FP6E 1AQ7A 2ZFRH 2ZPQA 1Y5UT 2QV1A 4GSOA 1CT4E 3EDXB 5DP8A 2VIWA 1GI5A 2JETC 4B71A 1FDPA 1PYTC 1YLDA 2Z9LA 1D3QB 2A4QA 5TCAA 2ZFQH 1P05A 3D65E 2HNTC 3T26A 1PPHE 1RTKA 1BJUA 2OQUA 2XCFA 4B2CA 1IQGA 3QZRA 5DP9A 3UIRA 2SGDE 1NPMA 1TQ7B 3AK5A 3O8BA 2SGPE 3AW1A 2XBVA 5AF9H 2GX4A 4JYUH 1BJVA 1XUIA 2ZHFH 2XBYA 1OPHB 3TH3H 1WSSH 3ATIA 1CQQA 1LQDB 2NU1E 1SQTA 1QB9A 2JJ1D 4A1VA 1BTHH 1KXBA 1LHGH 4XD7D 3RXFA 1D6RA 2ULLA 1BMFD 3A81A 4YOJA 5FHTA 3G01A 2J97A 1PPBH 4K3JA 1MU6B 3SNEA 1SOZA 3QDZB 1EAUA 1SLUB 2D2DA 1S83A 2ODQA 3S7HB 1Q31A 4Y76A 3T25A 2B5TB 4CBOA 4FUCA 3SNCA 3KYGA 1BIOA 3KNXA 2GT8A 1GI1A 1O5CB 1PPFE 5A8YA 1DUAA 4GPGA 3SHAH 1P9SA 4AB9A 1NBME 3TU7H 1E0FD 1SSXA 5F8TA 2KZ4A 1P9UA 2QE7D 2A4GA 1C5MD 4MNXA 4BOHA 4JZEH 2ZF0H 3OY5U 5EJ1A 5DSFA 1GI3A 3ZZ3A 1DT2A 1XMNB 4KELA 3I77A 3SZEA 2WV5A 1GGDC 3A89A 4NWKA 1SL3A 2NU4E 4D9QA 1TPPA 1YBWA 3GDSA 2QXJA 1PPGE 3TGIE 1F0UA 1ZPCA 2IPQX 4CRGA 3TPIZ 1IQLA 1EOLA 3MYWA 4JZ1A 2V6NA 1EKBB 1HXFH 5GIBA 3UAIC 1AB9C 1K22H 3V0XA 1TOMH 3VFEA 1O5BB 3BTDE 2GZ7A 1OWJA 2QF4A 3RXRA 1DXPA 2KR7A 2STAE 1ETTH 1UMAH 1FIWA 3TK9A 1C5UA 2ZPRA 3N7EA 3M37A 1QFKH 2BD9A 2ZCLP 4YT6H 3T28A 1MQ6A 4AZ2B 5EJLA 1GHVH 1EB2A 4I8GA 3FKSD 4B75A 1SGYE 3ESTA 2ZDVH 3TK5A 2LNCA 2V7QD 4AFSA 1VKYA 1TNLA 1K1JA 1HFDA 1Y3XA 1D3PB 2B0FA 3A85A 3UY9A 3CNRA 4ISIH 3PO1C 4HGCA 1K0HA 1VITF 2IPHA 3ENSB 1FLEE 4LZ1H 1C2EA 1ELGA 2ZU2A 1G3BA 2BQWB 1T31A 4D76A 3LH3A 3ZZDA 3RLWH 2GCHG 1ELVA 1LHFH 1OS8A 1QL9A 3P8GA 4FVBA 2ZG0H 1D3TB 5F8ZA 2BLOA 3A86A 1Z1IA 2BVRH 5JDUB 3SI3H 3RXUA 3RMLH 1GBBA 1ZJDA 3UQVA 2VGCC 1K1IA 1O2IA 2R2MB 1ARBA 4KTSA 4NGAH 1NU9A 3VPKA 4IN2A 1CO7E 1YCPH 1GBFA 3SHCH 4ZKOU 4X2YA 2BDHA 1DOJA 5FL7D 1KXAA 5IYTA 5ESBA 5JB8S 2JDID 2VWNA 3HPTB 1O3JA 5EPYA 1P10A 1XM1A 2F9OA 1C5LH 2JH5D 1TWXB 1TPSA 1PPEE 4Y8ZA 1SOTA 1Y3WA 2G00A 2ZECA 4E06H 1MABB 1BMMH 1O2GH 5AFYH 4MQAA 2ZKSA 9LPRA 2H9EH 4IMZA 2ZHWH 3C1KA 2FP7B 2BQ7B 3A7XA 4NZLA 1L1GA 2QYIA 3N7OA 3UR9A 4BNRA 1GBMA 6LPRA 5GCHG 1F5KU 2HVXA 1BHXB 3M3VA 3GCOA 3MO6A 1MD7A 1W3CA 2J5UA 1LCYA 3GICB 5SGAE 2A5KA 4AG1A 2Z3EA 3PO1B 2B7DH 2PKAB 3F9GA 1UTOA 2VGCB 3DFJA 3UTUH 1MKWK 1T8NA 3LDXH 2H5DA 2PKAA 4ABHA 1QL8A 3ATWA 1YCPM 1ELCA 1O3LA 1K28D 3QWCH 3A7YA 1FY8E 1M9UA 4X6MA 1C1NA 1QB1A 3MU4A 3O8DA 4UD9H 1SGFA 2BLQA 3NKKA 3PMJA 2GJGA 5DK1A 1G9IE 2GGVB 2Z9IA 1QURH 2WPIS 1UK3A 5C94A 1MU8B 1GWAA 1PPZA 2WPLS 2PP6A 3OEED 4FU9A 4LOYH 3RXEA 1ID5H 5L6NH 2BD3A 4F55A 1YPHE 2XC4A 1O33A 1AMHA 1RD3B 5HIYA 1GVKB 2EEKA 4UE7H 2GDEH 1JRSA 4RSPA 3SJOA 1GMCF 5A2MH 1GMDG 3DSPA 3P17H 1SMFE 1BTWA 1IQMA 2PTCE 4IN1A 3S7KB 5LPEA 2F9BH 1XX9A 3FANA 1KLIH 3HKIB 1O3OA 1TMBH 2FOAA 1HV7A 4IW4E 3PB1E 4DGJA 3A82A 1TX6A 1EZSC 3VG8A 2ESTE 5C67A 1FPCH 3PRBA 3NUMA 1G2MA 2RDEA 5I46H 1O3MA 3RU4D 2FODA 1C5NH 2WPMS 1UTPA 1E37B 1WAYB 5GWZA 1ZZZA 1AKSA 1W0JD 1NS3A 3T27A 3KN2A 3UUZA 1D6WA 1O3EA 1G2LA 1DPOA 5JBTA 2A5AA 1LKAA 4KTCA 1RRKA 4AYVB 3EE0B 1XVMA 3E0NB 2YNAA 1LPZB 2ZGHA 1B0EA 1V2VT 4XBDA 2RA3A 2FOBA 2WV4A 4ZKRU 1X7AC 2QIQA 3P6ZB 3DD2H 2EC9H 1MTSA 4ZXYH 1ZPZA 4D7GA 2TGPZ 2LP6A 1BRBE 2FTLE 3W1EA 5JBAS 1DVAH 1XVOA 1YLCA 3B23B 1QGFA 4THNH 1SLVB 1N1LA 4K1EA 2V0BA 1KY9A 3MU5A 2WPJS 2FI3E 4YXWD 1W12U 4CREA 1SQOA 3GY6A 3BTHE 1BCUH 1O2KA 1Z6EA 3T5FH 2P93A 3SI4H 3V7TA 4ABAA 4YM9A 4I8KA 5JPMH 5C0UA 1A7SA 5K0HA 2QXIA 1YWUA 2V3OH 1W7GH 2BVSH 2Z9KA 5CDFE 2ZGBH 4MPXA 1Q3XA 2NWNA 1NO9H 1SHHB 2Z94A 1ELBA 1G37A 5FPTA 5EXLA 3BIUH 3RXOA 2F4LA 2BB4A 3QX5H 1MKWH 4K8BA 1AIXH 1XXDA 2J94A 1O3HA 2PV9B 3A8CA 3V12A 1SPJA 2Q6FA 1V2KT 3SUEA 3AAVA 2HALA 1O3GA 3SNDA 1O2TA 5KEDA 5A0AE 3UREA 1B5GH 1TFXA 2BOHB 2WV9A 4JYVH 4Y8XA 2GMTC 4GCHG 5F6MA 1MZDA 1TLDA 2ZCKP 5FPSA 4BXWA 2TGTA 1GJ7B 4ZHLU 1F5RA 1AFQC 2UWOA 1W0KD 4A1TA 1C5ZB 1GDQA 2BD4A 3EQ0H 3VB7A 3SBKA 1CE5A 1A0JA 2XRCA 2F91A 3PMBB 2A4OA 2V35A 1LKBA 2ZHDA 2UUKB 3L3TA 1OP8A 1TONA 1Y3UA 1S84A 1DS2E 1IQFA 1QB6A 1BMLA 1A1RA 2SNVA 2Z3CA 2ZFFH 4ZKSU 7ESTE 1ZGIA 2OC7A 4ABBA 4XBBA 1UTLM 2NU2E 1IHSH 1O2WA 1FIZA 1O5AB 1QA7A 1CHOG 3GOVB 5CMXH 2L6OA 2OTVA 4Q7ZA 1GJAB 1AHTH 1AE5A 3RU4T 1C1PA 1NFYA 3P8FA 4DT7B 2H9TH 3HATH 4FUEA 2NU3E 1BRCE 1LO6A 4HG6A 1HGTH 3ZIAD 4H42U 4A92A 1Z7KA 2TIOA 1F2SE 1GJ9B 2ZTZA 5EU8A 4A1XA 5IDKA 1NTPA 1GI8B 1COWD 1QQ4A 1KYNA 3E91A 4TWYA 3QN7A 1UTMA 5DP4A 4MVNA 4Y7AA 1TA2A 3A8BA 5HM9A 1TPOA 2AMQA 2GKVE 1W0YH 4U2WA 1BTZA 2VWOA 1WTHD 2A45B 1THRH 3RXSA 2F83A 1P2IA 4DVAU 4B73A 1GBKA 2R0KA 3BG8A 3SW2B 5DN6D 1BB0B 1HB0B 1O2ZA 1MTVA 5A8XA 1DDJA 4BAQB 1TA6A 5HGGA 1TNHA 4IGDA 3LIWA 1SR5C 1L1NA 4LXBH 2QF0A 1IQKA 2OCVB 3ZZ7A 3QGNB 1Y3VA 2BOKA 1FY3A 1TABE 5EXMA 1YF4A 1QY6A 4NA7A 5AVDA 1K1NA 2GD4B 1O39A 2A1DB 1GG6C 1GHAF 1HAVA 3QZQA 3WW7A 1ZR0A 2G55A 1GMDF 1YM0A 2OUAA 1WU1A 1E34B 1HAVB 2B8OH 3F2GA 4FUHA 3E16B 1C1QA 2ZU1A 1J9CH 1VR1H 5C1UA 3STIA 4GCHF 2W26A 2GMTB 1BTXA 2UUJB 5GPIB 4MPUA 4Y11E 2HLCA 2Y81A 2FOGA 5DKMA 4WMDA 1C4V2 2BLVA 2QF3A 4NIVA 3F3BA 4GVUA 2VIQA 3AAUA 1AZ8A 1O37A 2BHGA 5CHAC 2FEQH 1Z8JB 3HGNA 1DUEA 1DWCH 4JK5A 4YOGA 3MO9A 2AIQA 5JB9S 1O36A 3SUFA 2C8XB 2A7JA 3Q77A 2ZU4A 1TNGA 1P11E 2W5EA 3OTPA 2J2UA 1P02A 1S6LA 3RXIA 3K65B 7LPRA 4FU7A 1EPTC 2OK5A 3LGTA 1A0HB 3F9FA 4CRFA 4YZUA 1G30B 1DM4B 1TNIA 1RXPA 2HRVA 3SU6A 3RXQA 3RXGA 1CSOE 2WYJA 3K6ZA 4DJZB 1P12E 3BG4C 2G8TA 3T2NA 2PSYA 4MNYA 4PROA 4X6PA 1P0SH 5EGMA 1PQ5A 2ZO3H 2PGQB 3M3SA 1FQ3A 2FXRA 4I32A 2VH6A 4INKA 3LONA 2O8LA 3A83A 8LPRA 3RXHA 2Y80A 4NFFA 2H2ZA 2BDYA 4OS7A 4LK4A 1H9IE 2ZIQH 3K6YA 3SORA 3QK1A 1L4ZA 5JBCS 2FI5E 2P8OC 4B1TA 3SU2A 1NRSH 4GUXA 3T29A 1PQ8A 1QCPA 4FUIA 1YPGH 5CE1A 3TIUA 1KIGH 5ESTE 2AEIH 1GBCA 1GI9B 5GXPA 2PSXA 5L2ZH 2F9UA 2VIPA 3LGVA 4O3TA 1O34A 2W7UA 1RFNA 4K5ZA 1KLJH 3ATMA 1L2EA 1ELDE 1CA8B 1JIRA 2EA3A 4O3UA 1GL1A 1GHBF 1RGQA 1GBJA 1UHBB 5EODA 1MTNB 2XNDD 3MWIU 1FXYA 4ABFA 4XRNA 3V13A 4UFGH 3U9AH 1KXCA 2FO9A 3Q00A 1NRPH 1FJSA 1BT7A 2P59A 3A80A 3SJ8A 3D49H 2YMSD 3PYHA 2ASUB 3FO8D 4DIIH 1FI8A 3N99A 5C20A 5E2OA 1JRTA 1J15A 5B6LA 1NROH 1D4PB 3MNSA 2GT7A 1GGDB 2FYQA 2ZC9H 4AFZA 3ODDA 2VIDA 2BY5X 3VGCC 1EAXA 4FETA 2ZHEH 4F49A 4X1SU 1AN1E 1OSSA 1UTNA 3GY2A 3STJA 1N8OB 2Y5FA 3F2FA 2CF9H 3PTNA 1FY4A 1TNKA 3UOPA 5EW1H 5DP3A 4WF8A 1DE7H 1O0DH 2YMSB 3M35A 2ZTXA 3ZZ6A 4TWWA 4WY3A 1AU8A 4NG9H 1XXFA 1GJ5H 1IHTH 3TNSA 3RMNH 3FAOA 3LC3A 1G3CA 1NU7B 5E2PA 1O2HA 1GBIA 2RFKC 1C5XB 2PFEA 2VH0A 2ZWLH 4GAWA 4IC6A 2KCPA 4I8JA 2QAAA 2AGIX 1OHHD 4DY7B 3BTGE 1NFXA 1DLEA 1TX8A 5EPNA 3B9FH 3RM2H 3FZDA 4AGJA 2FOCA 3RXPA 1JWTA 3UOUA 4A7IB 4DW2U 5BPEA 5C5NA 1QR3E 4Y8YA 4YLUA 4ZROA 1ZRKA 3D62A 3JZ2B 4CHAB 3P8NA 3K9XB 3Q76A 1RJXB 3TK6A 3W94A 1EATA 3LJJA 1ZTLA 1ETRH 4MDSA 1C2FA 2WPDD 3RLYH 3SJKA 3ZYDA 1MQ5A 1YLNA 2ZTYA 1A5IA 2AIPA 2AGGX 4Q2KA 3EE7A 5EQSA 1AO5A 3KQBA 2AERH 1HJ8A 4NCYA 1GVLA 2J98A 3F9HA 3S9BA 4YT7H 2BD5A 3R0FA 2AMDA 2GCTB 3GS9A 4TY7A 4CBNA 2EI8A 4X6NA 1DITH 1BTYA 2ZFPH 2B9LA 4E05H 3MNBA 4F4OC 4TYDA 1IAUA 5T6DA 3H7TA 1QRXA 3NZIA 1V2JT 2VJ1A 3BTWE 8GCHG 3UR6A 1KXDA 1C5WB 3U1IB 2K1QA 3U8TH 3ZVCA 4U30A 1O2VA 3E6PH 1W2KH 4WMFA 2BD7A 2XBWA 2VIOA 5I25A 1O5EH 5C1XA 3MOCA 1KXEA 4A6LA 3MHWU 3SOSA 1BDAA 3LJOA 1EQ9A 2GZ8A 3MFJA 1O2NA 1S6HA 1RIWB 1O2YA 1KXFA 4B6FA 2J34A 2PW8H 1C4U2 1AKSB 4AFUA 3S9CA 2ZGJA 4I86A 1BMNH 1H1BA 4Q7YA 3BTME 3B8JA 1DWBH 1S0RA 4FUGA 2ALPA 3MNCA 4X8UH 1AUJA 2GP9B 1J17T 2F3CE 4UFDH 5T1VA 1P3EA 4Z1MD 3UQOA 1JIMA 2AS9A 2CJIA 2D8WA 3FN8A 1CU1A 1AUTC 1O5GH 3TH2H 6GCHG 1UO6A 1Y5AT 1GHBG 2G5NA 1PFXC 1T4VH 1V2UT 2PHBA 2BX4A 1C5PA 2O8WA 1H8HD 1C5YB 1OYTH 3GYMA 2XW9A 1GBTA 2G51A 2BDCA 1V2WT 2FM2A 3HKJB 3SUGA 2YOLA 1ZMNA 1DWDH 4O97A 5EQQA 2AMPA 2AHME 2RDLA 1TBZH 4XFQA 1HBTH 1C5SA 1TGCA 2AYWA 5J4QA 1GHWH 3RXMA 1S81A 3RXLA 1U6QA 1OOKB 2ZI2H 2SNWA 3NK8A 1AVWA 3LU9B 2FESH 1O3DA 2FLBH 4JZFH 1G36A 1GBLA 5T6GA 2KM0A 1O3PB 1P2OA 1SBWA 4RT1A 2G4TA 3PROA 4K69A 4CRDA 1A5GH 4Z0KA 1P57B 1WTGH 1BOQA 1SGFG 3OTJE 2I6SA 3JZ1B 4HZHA 1E1RD 1UVUH 3A7WA 2WSSD 4I33A 2QA9E 5EXNA 2C8YB 3RXDA 1ABJH 3ZVBA 2TGAA 2CK3D 1O2MA 2LPRA 3WWFA 4K2YA 2A7HA 1IQIA 4K1SA 1BQYA 3A7VA 4ABDA 2G52A 4HTCH 4R8TB 1Y8TA 3SV9A 3MNXA 1GDNA 1AE8H 4DURA 1QJ6B 1WUNH 4H4FA 1YP9A 3GYLB 3NCLA 6CHAB 1Q2WA 2DE8A 1OWIA 2HPPH 2XYAA 1O3KA 2W6JD 1WV7H 1NRNH 1O2XA 1W7XH 1J8AA 4X1QU 3ZVEA 4IC5A 1HDTH 1CT2E 1C1RA 2A2XH 1UHBA 5HM2A 3RUOA 1CHOF 1E79D 1HRTH 2BTCE 1KTSB 2R9PA 1TGBA 1V2QT 5FXLA 1UVOA 3DSOA 2Z3DA 1CGHA 4SGBE 2FI4E 2GDDA 1TX7A 3IWMA 2AGEX 1KDQA 4ZH8A 2BYAX 2TGDA 3OSYA 3KIDU 4FUJA 3FFGA 5HYOA 1C2MA 4WH6A 2FOMB 2FS8A 2IN2A 1W10U 1HAIH 2FPZA 1OWHA 1FPHH 2D1JA 3QTOH 1AWHB 2J92A 4RKJB 2R3YA 3A7ZA 4HI3A 5KGOA 5ETXA 2XC5A 1ANEA 1Z1JA 3F6UH 3TJUA 4M9FA 1WXRA 1CT0E 1GL0E 2BXUH 3BTEE 1D9IA 1QBOA 1AZZA 1C2IA 3BTFE 1YPEH 3BEFB 2JH0D 2OINA 1ZSJA 2ZP0H 1GJ8B 3ZZ9A 1A3BH 3ATLA 1O3AA 2WINI 2KCYA 3E0PB 1C2GA 3VXEH 4AG2A 4B76A 2VWLA 1NFWA 3M7QA 5J4SA 4XSKU 4X8TH 1B0FA 1O3BA 1W8BH 1Y3YA 1K2I1 2PLXA 3FP7E 2KFWA 2GCTC 1YYY1 2F9PA 1IQHA 3RP2A 1V6DA 4WJG2 4WVPE 3M5OA 5L2YH 2BM2A 1MZAA 5GNDA 1HJ9A 4Q4LA 3U28C 3S69A 1FZZA 2OC1A 3DA9B 1MAXA 3LGUA 5CHBA 1QRZA 4KTUA 3KHVA 1TMTH 2AFQB 3NRLA 4JZIA 4OGYA 4OS5A 5EIYA 5A0BA 1HCGA 4BTIB 4KKDA 4ZHAA 3CS0A 1VCQA 2OC0A 4ABEA 2ZPSA 1Z8RA 3PV4A 3TLOA 5L30H 2Y5HA 4IS5A 3VB6A 1TRNA 2R0LA 3ATKA 1QA0A 3ZYEA 1VZQH 1ZSLA 2FOFA 4E7NA 1G3EA 2OQ5A 1V2NT 1XUFA 2OLGA 3NXPA 3SV6A 1SB1H 1C5VA 3BG4B 1UVSH 1GCTB 2GZ9A 1ZHMA 2WUBA 1ELAA 1CBWC 3SQEE 4ABJA 4Q7XA 4ZHMU 2ZDMA 1ORFA 3TGKE 2Y82A 2D26C 1V2OT 1O3IA 2QXGA 2NU0E 3OEHD 4X1RU 3LKWA 1DX5M 4B74A 1ZTKA 5H4IB 2PGBB 3OYPA 1P09A 2Z6BD 5A8ZA 3LGIA 3GY5A 3BN9A 5HMAA 1BMAA 1C2DA 2C8WB 2DE9A 3OFND 1P2KA 5DGJA 4OS2A 3C27B 3SU3A 3BTTE 4JK6A 1HIAA 2G81E 1GHAG 3SGQE 5F03A 4X8SH 3LH1A 3GCTF 3ZVAA 5C2ZA 2M5TA 1QBNA 2FTMA 3PMHB 5DJ7A 5GCHF 3Q3YA 1THPB 3LC5A 3F9EA 2EI7A 1TE0A 1EAIA 4E7RG 1FY1A 3TJVA 1CBWB 1EAWA 1ESTA 1TALA 2ANYA 1H9LB 5EOKA 1WQVH 2TBSA 2ZDNA 3VEQB 2W6ID 5F8XA 1GVZA 1MTUA 5CHAB 3U8RH 1K1LA 1EJMA 1FAKH 2J98B 2P3TB 4CRCA 1N6XA 1UTQA 1O2UA 1K1OA 1VGCC 2ZZUH 3E3TA 1TMUH 1K1MA 1NZQH 3PV2A 1SLXB 4HFPB 1OYQA 2HVYB 3VGCB 2XCNA 3SGBE 4X1NU 3HK6B 2BD2A 4B6EA 1L4DA 1T4UH 3SN8A 1P2JA 3A8AA 4DOQA 4OM9A 1OWDA 3P8OA 1HAHH 2FWWA 2P3FH 4IMQA 1PPCE 1XUHA 3SO3A 1O32A 2KAIB 3MI4A 4XOJA 1OWKA 2THFB 3KL6A 3EYDA 1A2CH 2IOTA 5LH8A 3RC4A 1F0RA 2JETB 3LT3A 1MTNC 5E0JA 1LDTT 3SV8A 4F48B 1V2LT 3ZZCA 1E35B 8KME2 4ZXXH 1C1UH 3GCNA 4VGCC 3UB0A 1E1QD 2QGRA 1GI7B 3E1XB 4ZUHA 3F68H 1ANDA 1KDQB 1QTFA 1SGCA 4JCNA 1A61H 3FZZA 3L33A 2GV7A 4LZ4B 1SGQE 1HAYB 2AH4X 1UTKA 3ZZBA 4NFEA 3U8OH 1HNEE 1GDUA 2BDGA 2CHAC 2P16A 3BF6H 5HIZA 2Y6TA 3CS7A 5GJ4B 1UK4A 3DSGA 1EXFA 5C3NA 4RI0A 1S82A 2H1UA 3MMGA 3EA8A 2HNTF 1W0ZU 1CHGA 3H5CB 3LPRA 2PR3A 1QNJA 1J16A 1EPTB 1MUEB 4OS1A 1ZTJA 2A0QB 2TPIZ 2YNBA 2FOHA 2ZHQH 3S0NA 3O8CA 4X1PU 3F0OA 4ABGA 1HIAB 1S5SA 3SJIA 4B2BA 2VVCA 5DP6A 1ABIH 1YPJH 1ZHPA 1HXEH 1AWFH 2FX4A 4JMYA 4I7YH 4Y7BA 3SNAA 1O2SA 2H9HA 4MPVA 1S6FA 4NA8A 4AORA 2BQ6B 1SGDE 1JOUB 2QY0B 1B7XB 3N7DA 1TGSZ 2P3UB 1Y59T 3KQ5A 4X0WU 3URDA 1DSTA 3V3MA 5EQRA 5GDSH 4BTTB 1GJ4H 1ZJKA 2A31A 1LVBA 2BY8X 1BHXF 2XBXA 4ASUD 1F7ZA 4CH8B 5LPFA 1C1OA 3TJNA 1TPAE 3KF2A 1ZMJA 2GCHF 2OBQA 3I29A 2FDAA 3BTKE 1E38B 4ESTE 1UCYE 1XUJA 3SUDA 1IQNA 1P04A 3MU8A 3NWUA 4TSFD 2FS9A 4NSVA 1TYNA 2A5IA 5E8EH 1PQ7A 3MH5A 3ZV8A 1NRQH 3PV5A 3NPSA 1OP2A 4KP0A 1C1VH 1O31A 2O8UA 2ZFTA 2QF5A 1QRWA 1ZLRA 5IK2D 1BZXE 4MTBA 1O38A 2XXLA 1Y5BT 1TRYA 1JMOH 2PKSB 1FAXA 1N6YA 3H09A 1MKXK 2V3HH 5JBBS 1P2NA 3E8LA 3KQEA 1AD8H 1ZPBA 4Q63A 1DY8A 2XTTB 2OD3B 3ITIA 3PLKA 1ZHRA 4NWLA 4VGCB 4FUBA 1FX0B 3UNSA 2FX6A 3LGYA 3BSQA 3GCHB 1T32A 4MG3A 2YMSC 3LOXA 2ZQ1A 1SVPA 2IJOB 2VNTA 3ZV9A 5A09A 3F1SB 4UEHH 4O03A 3SZNA 4ACBA 1EP6A 2OC8A 1P8VC 5K7RA 3AVZA 1T8OA 1ETSH 1NT1A 3UNQA 1TGNA 1DICA 3ODFA 2JH6D 3TJOA 5TJXA 2VU8E 3MQKC 2QC2A 3M5MA 5A0CA 3SV2H 3UNRA 1SGEE 1CGJE 1Z6JH 1YGCH 2WZQA 1O2QA 1GMCG 2A32A 2J38A 4WXVA 3MH6A 3SU5A 1GBEA 1LVYA 3SYJA 3WY8A 4ISHH 1OWEA 2BZAA 2ALVA 1C5QA 1GI4A 2K8IA 3RMOH 1H8ED 1EZQA 2BY9X 3FOAA 4ZAEA 2VVVA 3OU0A 4CH2B 1ESBA 1CVWH 3QUMP 1DFPA 1NN6A 5FCKA 1SG8B 1S85A 2O9QA 4A5TS 5G4BA 4X6OA 1ANBA 1QJ7B 1A3EH 3ZZ8A 4NA9H 1V2RT 1AY6H 1LHDH 2EI6A 2HGTH 1HLTH 2CN0H 3SQHE 5AHGH 7GCHG 3M5LA 1W13U 1H8IH 2LELA 4AN7A 3U1JB 1IQEA 4AFQA 3F2HA 1EFRD 1K9OE 4CRBA 4JYTA 1HPGA 1W14U 2OXSA 1C5RA 3GDUA 1NFUA 4RN6A 4X2VA 4DCDA 2ZQ2A 3DUXH 1EZXC 1VCWA 4X2WA 3EGKH 1GBAA 3Q3KA 4UDWH 1FV9A 2WPHS 5EJZA 1SGIB 1ZOMA 3TNTA 1XKAC 2SGFE 5F53A 2ZFSA 1RIWC 1AFQB 2BXTH 1GCDA 3VB5A 1YPKH 1UTJA 2GVFA 1A4WH 4O9VA 2WUCA 3K2UA 3OAAD 4K60A 1WDIA 4ABIA 1DY9A 2STBE 1YCPK 1OXGA 1MMJN 8GCHF 1LMWB 2CV3A 3A7TA 4H6SB 4Y10E 1GHYH 1C9PA 2CXVA 1FN8A 2F43B 1UW7A 1AI8H 1D3DB 2R3UA 2HLDD 2RG3A 2QCYA 1EPTA 2BDBA 1ELEE 1EOJA 1HAPH 3RXTA 3ZZ5A 2ZDLA 2ZCHP 2PKSC 4AC9A 1UCYK 1VJAU 1WCZA 3PWCA 4YTAA 3EAJA 5AFZH 1IQJA 3Q3XA 1SHYA 6GCHF 1O2RA 5DPAA 2HNTE 1SGNE 1FUJA 1UCYH 1LPGB 1AB9B 1LVMA 1XUGA 3PTBA 1C1SA 4GHTA 5EG4A 5FBIA 1OX1A 1C5OH 4MNWA 1SFIA 2RA0A 3BEUA 1LHCH 4NIXA 3P92A 2C3SA 4NIWA 2BLWA 3DFLA 4YO9A 2UUYA 4WMEA 3A8DA 1GBHA 3AW0A 4FUDA 7GCHF 1EB1H 1GJDB 1ACBE 4BTUB 2KX4A 1P3CA 3FVFB 4P02A 2KCAA 1O2OA 4MLFB 1CA0B 3MH7A 2VINA 3VB4A 1DWEH 4TY6A 3M5NA 1EUFA 1GG6B 3KCGH 3EA9A 4X8VH 4H6TA 2P94A 2SFAA 4I8HA 4MNVA 1ZSKA 4YESB 5BRRE 4I31A 1YKTA 2KAIA 5B6OA 1MKXH 2OP9A 5T6FA 4CRAA 3MU0A 1GHXH 3VXFH 1LTOA 1GI0A 1SC8U 1C9TA 1VITH 5JYIA 1TAWA 1C1TA 3PLBA 1C2KA 1VJ9U 2BY7X 3CP7A 1HAOH 5FAHA 1FNIA 1SFQB 3SGAE 2ODPA 3AASA 4NSYA 4IBLH 1TOCB 4UFFH 4ACAA 1YY3A 3GY8A 1EZUC 2A4RA 3QTVH 1TQ0B 5C1YA 2VIVA 3TH4H 3RXCA 2J95A 3U98H 2W3KA 3RXJA 1V2TT 1EASA 1K1PA 4M7GA 2W7SA 1FONA 4XDEA 3UFAA 1QHRB 4K1TA 1DLKB 4Y6DA 4SGAE 4OS6A 1VGCB 2VB0A 3QO6A 1GI6A 2PUXB 1P01A 3D23A 1HJAC 2CF8H 4FVDA 2ZGCA 2ZDAH 5DP7A 2GTBA 1BTPA 1A0LA 3RDZA 1SQAA 1YPMH 3OY6U 4U32A 2F9VA 1E36B 1RS0A 1LQEA 4WWYA 5C17A 3A88A 1NRRH 2Y7ZA 1V2PT 2V3MA 1F92A 2L74A 1C5TA 1GJBB 3U69H 2FZZA 1QL7A 2JIZD 1V3XA 2H5CA 2P95A 5C5OA 2WYGA 1SKYE 4J2YB 1P06A 1ZYOA 4ISLA 3KGPA 4CHAC 3HK3B 4QT8C 1O2JA 4KGAA 4B2AA 3H7OA 1EJNA 3RXVA 1QJ1B 3ZZAA 2XNIA 5E0HA 3A87A 2BDIA 1HJAB 2J4IA 2UWLA 1KLTA 5FCRA 3RMMH 3SV7A 2JKHA 2ZDKA 1O5FH 1PYTD 1SGPE 2JJ2D 4TPYA 3EA7A 1TBQH 3KYFA 1W11U 1AVXA 1WQSA 2Q1JA 5PTPA 1GJCB 4D9RA 1ESAA 1WBGB 1C4Y2 2HOBA 1WOFA 2ANMH 4DT4A 2VBCA 2DUCA 2BZ6H 1SGTA 1O3CA 1IOEA 4BANB 2RCEA 4GHQA 3CENA 1O3FA 1HUTH 1V2ST 1MH0A 2I6QA 3GY4A 3SU0A 1JXPA 1ZMLA 1C1WH 4UONA 4BAOB 1ANCA 1BBRE 3LGWA 1G3DA 2FOEA 3M7UA 2F9NA 3DHKH 5DO4H 1C2JA 1HAXB 5FX5A 3RM0H 4AYYB 3IG6B 1CGIE 2ANWA 3MTYA 4AB8A 3MH4A 1F0SA 3BV9B 2A7CA 1SGRE 1GPZA 3ZZ4A 4AOQA 1XUKA 4I8LA 2ZGXH 4Z6AH 2SGAA 1BRUP 1QQUA 3TITA 4Y0YE 1BBRK
chains in the Genus database with same CATH topology
3RC5A 3FN8A 1DXPA 1CU1A 2OC8A 5EPNA 3O8DA 2KR7A 2M2AA 2OBOA 3N7EA 3PRDA 4B71A 5ETXA 5CDFE 4B73A 1BT7A 2A4QA 5DN6D 5C0UA 3M5MA 1WXRA 1H8HD 2GGVB 4M9FA 3DCLA 3SU2A 3O8CA 3P8NA 2XCFA 3KEEA 5FPTA 2F9VA 3F0OA 2WZQA 2FM2A 3SUGA 2F4LA 2YOLA 3OEED 4WH8A 5EQQA 3FKSD 3SU5A 2KCOA 2AHME 4B75A 4F55A 5C17A 3AK5A 2F9UA 2WPDD 3O8BA 4K8BA 3SYJA 2OINA 3WWBA 4U01A 2V7QD 2IJD1 4JMYA 2W6ID 2JIZD 3F0PA 2K8IA 3SUEA 1H8ED 2KCYA 3FOAA 3O8RA 4B76A 1SKYE 5EQSA 3DSPA 3N7DA 2WV9A 1RGQA 1RTLA 3WW7A 2JJ1D 2KFWA 4A1VA 5EQRA 2KM0A 1DXWA 4XD7D 5FPSA 2XNIA 2KCAA 1BMFD 1W0KD 2XNDD 3SU4A 4A1TA 3PV2A 3F2GA 5HKKD 3M5OA 4ASUD 3M5NA 3SV7A 3VG8A 2XCNA 3PRBA 5GNDA 4Q4LA 3M5LA 1E1RD 3GS9A 2OC1A 2JJ2D 5GPIB 5CHBA 2LELA 4B6EA 3KF2A 2P59A 2K0QA 3L6PA 3U1JB 2WSSD 4I33A 3F2HA 2XOKD 2CK3D 2OBQA 4OM9A 1EFRD 3WWFA 3KNXA 3NRLA 3P8OA 2YMSD 3F3BA 4TYDA 1W0JD 3FO8D 1NS3A 4I31A 2WHXA 3KN2A 1A1RA 3N99A 3SU1A 1NBME 4R8TB 2OC7A 2KZ4A 2OC0A 2QE7D 3SUDA 4DT4A 5B6LA 3SV9A 3U1IB 2VBCA 2A4GA 4KTCA 5FL7D 2K1QA 4TSFD 3EYDA 5ESBA 2JDID 3PV5A 4FETA 5F53A 3SUFA 2W6JD 3RC4A 5EPYA 5DSFA 2L6OA 3RC6A 3OTPA 2O8MA 2QF5A 3SV8A 3SZEA 1S6LA 3SV6A 4NWKA 3SU0A 5IK2D 1MABB 1JXPA 2GVFA 4TT3D 3F2FA 1E79D 3OAAD 2OK5A 5C0TA 1KMHB 1E1QD 3UB0A 3W1EA 3H09A 4B6FA 1DY9A 2FP7B 2A4RA 4WF8A 2YMSB 3ZIAD 4A92A 3DSOA 3SU6A 5FPYA 4Q63A 3OEHD 1N1LA 3LKWA 1DY8A 1W3CA 2J5UA 3E90B 4A1XA 5IDKA 4NWLA 4B74A 4YXWD 5H4IB 1COWD 1FX0B 3OYPA 3OE7D 1NBMD 2YMSC 3LOXA 4WH6A 4I32A 5T1VA 2F43B 4ZCNA 2FOMB 2KCPA 2IJOB 3LONA 5GJ4B 4Z1MD 3OFND 4RI0A 2HLDD 2QF4A 1OHHD 2QV1A 3SU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWF A;  3WWB A;  3WW7 A;  5F53 A;  5CHB A;  4ZCN A; 
#chains in the Genus database with same CATH topology
 1C1M A;  1KTT B;  2SGQ E;  1MBQ A;  3M36 A;  3A84 A;  5HXF A;  1L1J A;  1GCT C;  1L0Z A;  2OBO A;  1PQA A;  3TVJ B;  1O2L A;  3OX7 U;  1OP0 A;  2HPQ H;  4CR5 A;  1SQR A;  3DCL A;  1LPK B;  5TCC A;  2G5V A;  2C4F H;  3M3T A;  2ZU3 A;  3P95 A;  4R0I A;  1GMH G;  3RXB A;  3VB3 A;  1BUI A;  5ABW A;  1GJ6 A;  1T7C A;  1MCT A;  1NC6 A;  2IJD 1;  4OGX A;  1TNJ A;  1T8L A;  1GMH F;  2GV6 A;  3PWB A;  1S0Q A;  2BVX H;  3F0P A;  4NZQ A;  4XBC A;  4Y79 A;  3SNB A;  3O8R A;  1BBR H;  4GLY A;  1Z71 A;  2BY6 X;  4INH A;  1MCV A;  1O2P A;  3GCH C;  1GBD A;  1V2M T;  2SGE E;  1THS H;  4OS4 A;  1DXW A;  3ZVD A;  4XE4 A;  3GCT G;  4FXG H;  3PMA B;  1BIT A;  5HKK D;  1O3N A;  1BTU A;  1P03 A;  1Z8G A;  1MD8 A;  2BMG B;  4INL A;  2ODY B;  4ZMA H;  1AGJ A;  2J9N A;  2K0Q A;  3ELA H;  4Y71 A;  3KQD A;  1QBV H;  2EQN A;  9EST A;  1H4W A;  4BXS A;  4DG4 A;  1ZRB A;  1H8D H;  2FLR H;  2WHX A;  3UPE A;  8EST E;  3HGP A;  1EP5 A;  4YLQ H;  3SU1 A;  1AVG H;  2BDA A;  5LPR A;  1QIX B;  1BA8 B;  3P70 B;  1A46 H;  4D7F A;  2FIR H;  1PJP A;  1ELF A;  3IIT A;  3RC6 A;  2R2W U;  4D8N A;  3MO3 A;  5FBE A;  6EST A;  2Y7X A;  2PWX A;  1Z8I B;  1NES E;  4FUF A;  1F0T A;  1K21 H;  3PLP A;  5C0T A;  3W95 A;  4BAK B;  1KMH B;  3R3G B;  4DIH H;  1OKX A;  1CA0 C;  3QGJ A;  2Z9G A;  2H6M A;  2CHA B;  2ZA5 A;  1VCP A;  2ILN A;  5FPY A;  1AFE H;  2VWM A;  2Q6D A;  2CMY A;  1JBU H;  4TPI Z;  4ISO A;  3BEI B;  1O30 A;  3GY3 A;  1J14 A;  3S9A A;  1SI5 H;  1SLW B;  1YPH C;  1N8O C;  4ZCN A;  1TRM A;  1P2M A;  1WYK A;  4ASH A;  1FY5 A;  3GDV A;  3UWI A;  2HWL B;  1TGT A;  2XOK D;  3RXK A;  3RC5 A;  1VIT G;  2QN5 T;  2ANK H;  2M2A A;  2VVU A;  5DG6 A;  1H9H E;  3PRD A;  2EY4 C;  5LGO A;  1YC0 A;  4NIY A;  5FX6 A;  1ZGV A;  2UWP A;  4RT0 A;  1EX3 A;  3M7T A;  5KEC A;  3KEE A;  4MPW A;  4RKO B;  1QZ8 A;  1KSN A;  1ELT A;  5DP5 A;  4WH8 A;  2KCO A;  1NM6 A;  2G4U A;  1NY2 2;  4YOI A;  3WWB A;  4U01 A;  1HAG E;  1MAY A;  1GHZ A;  3KQC A;  3SJ9 A;  4CR9 A;  4UFE H;  2QXH A;  5T3H A;  1TB6 H;  2P8O B;  4P00 A;  2ZU5 A;  1MTW A;  2O8T A;  1UVT H;  1RTL A;  2BX3 A;  2Y5G A;  2XWB I;  1INC A;  1GI2 A;  3SU4 A;  3GIS B;  2CGA A;  3RU4 E;  4WXI A;  3FP8 E;  1UK2 A;  3TGJ E;  1LVO A;  4JZD H;  3UWJ H;  4BAM B;  4Y0Z E;  3L6P A;  3BTQ E;  1P2Q A;  1LHE H;  4FOU C;  3I78 A;  4J1Y A;  1YPL H;  2ZEB A;  3M61 U;  3ZVF A;  1O35 A;  1T8M A;  4K8Y A;  1C2H A;  2Q6G A;  2C8Z B;  4X2X A;  2Z9J A;  1A5H A;  3URC A;  1DSU A;  2PTN A;  3QLP H;  1RTF B;  1F5L A;  4ZKN U;  4ISN A;  3BIV H;  1EJA A;  1UJ1 A;  3GY7 A;  3ZVG A;  2XC0 A;  1XKB C;  2O8M A;  1O5D H;  7KME H;  3RXA A;  4TT3 D;  2A2Q H;  2FYR A;  1UVP A;  2Z7F E;  2W3I A;  4FU8 A;  1FMG A;  1MBM A;  1HYL A;  2ZNK H;  5EW2 H;  5E0G A;  1C2L A;  1DAN H;  1G32 B;  3MU1 A;  3E90 B;  1FN6 A;  2TRM A;  2FMJ A;  2WPK S;  2C93 B;  2UUF B;  2PUQ H;  4AGK A;  2C90 B;  3T62 A;  1TBR H;  1NBM D;  3OE7 D;  6CHA C;  4Q80 A;  2XWA A;  3PM3 A;  4AX9 H;  2BD8 A;  4BAH B;  1ARC A;  1BRA A;  1TIO A;  3DT0 H;  1HAZ B;  3FP6 E;  1AQ7 A;  2ZFR H;  2ZPQ A;  1Y5U T;  2QV1 A;  4GSO A;  1CT4 E;  3EDX B;  5DP8 A;  2VIW A;  1GI5 A;  2JET C;  4B71 A;  1FDP A;  1PYT C;  1YLD A;  2Z9L A;  1D3Q B;  2A4Q A;  5TCA A;  2ZFQ H;  1P05 A;  3D65 E;  2HNT C;  3T26 A;  1PPH E;  1RTK A;  1BJU A;  2OQU A;  2XCF A;  4B2C A;  1IQG A;  3QZR A;  5DP9 A;  3UIR A;  2SGD E;  1NPM A;  1TQ7 B;  3AK5 A;  3O8B A;  2SGP E;  3AW1 A;  2XBV A;  5AF9 H;  2GX4 A;  4JYU H;  1BJV A;  1XUI A;  2ZHF H;  2XBY A;  1OPH B;  3TH3 H;  1WSS H;  3ATI A;  1CQQ A;  1LQD B;  2NU1 E;  1SQT A;  1QB9 A;  2JJ1 D;  4A1V A;  1BTH H;  1KXB A;  1LHG H;  4XD7 D;  3RXF A;  1D6R A;  2ULL A;  1BMF D;  3A81 A;  4YOJ A;  5FHT A;  3G01 A;  2J97 A;  1PPB H;  4K3J A;  1MU6 B;  3SNE A;  1SOZ A;  3QDZ B;  1EAU A;  1SLU B;  2D2D A;  1S83 A;  2ODQ A;  3S7H B;  1Q31 A;  4Y76 A;  3T25 A;  2B5T B;  4CBO A;  4FUC A;  3SNC A;  3KYG A;  1BIO A;  3KNX A;  2GT8 A;  1GI1 A;  1O5C B;  1PPF E;  5A8Y A;  1DUA A;  4GPG A;  3SHA H;  1P9S A;  4AB9 A;  1NBM E;  3TU7 H;  1E0F D;  1SSX A;  5F8T A;  2KZ4 A;  1P9U A;  2QE7 D;  2A4G A;  1C5M D;  4MNX A;  4BOH A;  4JZE H;  2ZF0 H;  3OY5 U;  5EJ1 A;  5DSF A;  1GI3 A;  3ZZ3 A;  1DT2 A;  1XMN B;  4KEL A;  3I77 A;  3SZE A;  2WV5 A;  1GGD C;  3A89 A;  4NWK A;  1SL3 A;  2NU4 E;  4D9Q A;  1TPP A;  1YBW A;  3GDS A;  2QXJ A;  1PPG E;  3TGI E;  1F0U A;  1ZPC A;  2IPQ X;  4CRG A;  3TPI Z;  1IQL A;  1EOL A;  3MYW A;  4JZ1 A;  2V6N A;  1EKB B;  1HXF H;  5GIB A;  3UAI C;  1AB9 C;  1K22 H;  3V0X A;  1TOM H;  3VFE A;  1O5B B;  3BTD E;  2GZ7 A;  1OWJ A;  2QF4 A;  3RXR A;  1DXP A;  2KR7 A;  2STA E;  1ETT H;  1UMA H;  1FIW A;  3TK9 A;  1C5U A;  2ZPR A;  3N7E A;  3M37 A;  1QFK H;  2BD9 A;  2ZCL P;  4YT6 H;  3T28 A;  1MQ6 A;  4AZ2 B;  5EJL A;  1GHV H;  1EB2 A;  4I8G A;  3FKS D;  4B75 A;  1SGY E;  3EST A;  2ZDV H;  3TK5 A;  2LNC A;  2V7Q D;  4AFS A;  1VKY A;  1TNL A;  1K1J A;  1HFD A;  1Y3X A;  1D3P B;  2B0F A;  3A85 A;  3UY9 A;  3CNR A;  4ISI H;  3PO1 C;  4HGC A;  1K0H A;  1VIT F;  2IPH A;  3ENS B;  1FLE E;  4LZ1 H;  1C2E A;  1ELG A;  2ZU2 A;  1G3B A;  2BQW B;  1T31 A;  4D76 A;  3LH3 A;  3ZZD A;  3RLW H;  2GCH G;  1ELV A;  1LHF H;  1OS8 A;  1QL9 A;  3P8G A;  4FVB A;  2ZG0 H;  1D3T B;  5F8Z A;  2BLO A;  3A86 A;  1Z1I A;  2BVR H;  5JDU B;  3SI3 H;  3RXU A;  3RML H;  1GBB A;  1ZJD A;  3UQV A;  2VGC C;  1K1I A;  1O2I A;  2R2M B;  1ARB A;  4KTS A;  4NGA H;  1NU9 A;  3VPK A;  4IN2 A;  1CO7 E;  1YCP H;  1GBF A;  3SHC H;  4ZKO U;  4X2Y A;  2BDH A;  1DOJ A;  5FL7 D;  1KXA A;  5IYT A;  5ESB A;  5JB8 S;  2JDI D;  2VWN A;  3HPT B;  1O3J A;  5EPY A;  1P10 A;  1XM1 A;  2F9O A;  1C5L H;  2JH5 D;  1TWX B;  1TPS A;  1PPE E;  4Y8Z A;  1SOT A;  1Y3W A;  2G00 A;  2ZEC A;  4E06 H;  1MAB B;  1BMM H;  1O2G H;  5AFY H;  4MQA A;  2ZKS A;  9LPR A;  2H9E H;  4IMZ A;  2ZHW H;  3C1K A;  2FP7 B;  2BQ7 B;  3A7X A;  4NZL A;  1L1G A;  2QYI A;  3N7O A;  3UR9 A;  4BNR A;  1GBM A;  6LPR A;  5GCH G;  1F5K U;  2HVX A;  1BHX B;  3M3V A;  3GCO A;  3MO6 A;  1MD7 A;  1W3C A;  2J5U A;  1LCY A;  3GIC B;  5SGA E;  2A5K A;  4AG1 A;  2Z3E A;  3PO1 B;  2B7D H;  2PKA B;  3F9G A;  1UTO A;  2VGC B;  3DFJ A;  3UTU H;  1MKW K;  1T8N A;  3LDX H;  2H5D A;  2PKA A;  4ABH A;  1QL8 A;  3ATW A;  1YCP M;  1ELC A;  1O3L A;  1K28 D;  3QWC H;  3A7Y A;  1FY8 E;  1M9U A;  4X6M A;  1C1N A;  1QB1 A;  3MU4 A;  3O8D A;  4UD9 H;  1SGF A;  2BLQ A;  3NKK A;  3PMJ A;  2GJG A;  5DK1 A;  1G9I E;  2GGV B;  2Z9I A;  1QUR H;  2WPI S;  1UK3 A;  5C94 A;  1MU8 B;  1GWA A;  1PPZ A;  2WPL S;  2PP6 A;  3OEE D;  4FU9 A;  4LOY H;  3RXE A;  1ID5 H;  5L6N H;  2BD3 A;  4F55 A;  1YPH E;  2XC4 A;  1O33 A;  1AMH A;  1RD3 B;  5HIY A;  1GVK B;  2EEK A;  4UE7 H;  2GDE H;  1JRS A;  4RSP A;  3SJO A;  1GMC F;  5A2M H;  1GMD G;  3DSP A;  3P17 H;  1SMF E;  1BTW A;  1IQM A;  2PTC E;  4IN1 A;  3S7K B;  5LPE A;  2F9B H;  1XX9 A;  3FAN A;  1KLI H;  3HKI B;  1O3O A;  1TMB H;  2FOA A;  1HV7 A;  4IW4 E;  3PB1 E;  4DGJ A;  3A82 A;  1TX6 A;  1EZS C;  3VG8 A;  2EST E;  5C67 A;  1FPC H;  3PRB A;  3NUM A;  1G2M A;  2RDE A;  5I46 H;  1O3M A;  3RU4 D;  2FOD A;  1C5N H;  2WPM S;  1UTP A;  1E37 B;  1WAY B;  5GWZ A;  1ZZZ A;  1AKS A;  1W0J D;  1NS3 A;  3T27 A;  3KN2 A;  3UUZ A;  1D6W A;  1O3E A;  1G2L A;  1DPO A;  5JBT A;  2A5A A;  1LKA A;  4KTC A;  1RRK A;  4AYV B;  3EE0 B;  1XVM A;  3E0N B;  2YNA A;  1LPZ B;  2ZGH A;  1B0E A;  1V2V T;  4XBD A;  2RA3 A;  2FOB A;  2WV4 A;  4ZKR U;  1X7A C;  2QIQ A;  3P6Z B;  3DD2 H;  2EC9 H;  1MTS A;  4ZXY H;  1ZPZ A;  4D7G A;  2TGP Z;  2LP6 A;  1BRB E;  2FTL E;  3W1E A;  5JBA S;  1DVA H;  1XVO A;  1YLC A;  3B23 B;  1QGF A;  4THN H;  1SLV B;  1N1L A;  4K1E A;  2V0B A;  1KY9 A;  3MU5 A;  2WPJ S;  2FI3 E;  4YXW D;  1W12 U;  4CRE A;  1SQO A;  3GY6 A;  3BTH E;  1BCU H;  1O2K A;  1Z6E A;  3T5F H;  2P93 A;  3SI4 H;  3V7T A;  4ABA A;  4YM9 A;  4I8K A;  5JPM H;  5C0U A;  1A7S A;  5K0H A;  2QXI A;  1YWU A;  2V3O H;  1W7G H;  2BVS H;  2Z9K A;  5CDF E;  2ZGB H;  4MPX A;  1Q3X A;  2NWN A;  1NO9 H;  1SHH B;  2Z94 A;  1ELB A;  1G37 A;  5FPT A;  5EXL A;  3BIU H;  3RXO A;  2F4L A;  2BB4 A;  3QX5 H;  1MKW H;  4K8B A;  1AIX H;  1XXD A;  2J94 A;  1O3H A;  2PV9 B;  3A8C A;  3V12 A;  1SPJ A;  2Q6F A;  1V2K T;  3SUE A;  3AAV A;  2HAL A;  1O3G A;  3SND A;  1O2T A;  5KED A;  5A0A E;  3URE A;  1B5G H;  1TFX A;  2BOH B;  2WV9 A;  4JYV H;  4Y8X A;  2GMT C;  4GCH G;  5F6M A;  1MZD A;  1TLD A;  2ZCK P;  5FPS A;  4BXW A;  2TGT A;  1GJ7 B;  4ZHL U;  1F5R A;  1AFQ C;  2UWO A;  1W0K D;  4A1T A;  1C5Z B;  1GDQ A;  2BD4 A;  3EQ0 H;  3VB7 A;  3SBK A;  1CE5 A;  1A0J A;  2XRC A;  2F91 A;  3PMB B;  2A4O A;  2V35 A;  1LKB A;  2ZHD A;  2UUK B;  3L3T A;  1OP8 A;  1TON A;  1Y3U A;  1S84 A;  1DS2 E;  1IQF A;  1QB6 A;  1BML A;  1A1R A;  2SNV A;  2Z3C A;  2ZFF H;  4ZKS U;  7EST E;  1ZGI A;  2OC7 A;  4ABB A;  4XBB A;  1UTL M;  2NU2 E;  1IHS H;  1O2W A;  1FIZ A;  1O5A B;  1QA7 A;  1CHO G;  3GOV B;  5CMX H;  2L6O A;  2OTV A;  4Q7Z A;  1GJA B;  1AHT H;  1AE5 A;  3RU4 T;  1C1P A;  1NFY A;  3P8F A;  4DT7 B;  2H9T H;  3HAT H;  4FUE A;  2NU3 E;  1BRC E;  1LO6 A;  4HG6 A;  1HGT H;  3ZIA D;  4H42 U;  4A92 A;  1Z7K A;  2TIO A;  1F2S E;  1GJ9 B;  2ZTZ A;  5EU8 A;  4A1X A;  5IDK A;  1NTP A;  1GI8 B;  1COW D;  1QQ4 A;  1KYN A;  3E91 A;  4TWY A;  3QN7 A;  1UTM A;  5DP4 A;  4MVN A;  4Y7A A;  1TA2 A;  3A8B A;  5HM9 A;  1TPO A;  2AMQ A;  2GKV E;  1W0Y H;  4U2W A;  1BTZ A;  2VWO A;  1WTH D;  2A45 B;  1THR H;  3RXS A;  2F83 A;  1P2I A;  4DVA U;  4B73 A;  1GBK A;  2R0K A;  3BG8 A;  3SW2 B;  5DN6 D;  1BB0 B;  1HB0 B;  1O2Z A;  1MTV A;  5A8X A;  1DDJ A;  4BAQ B;  1TA6 A;  5HGG A;  1TNH A;  4IGD A;  3LIW A;  1SR5 C;  1L1N A;  4LXB H;  2QF0 A;  1IQK A;  2OCV B;  3ZZ7 A;  3QGN B;  1Y3V A;  2BOK A;  1FY3 A;  1TAB E;  5EXM A;  1YF4 A;  1QY6 A;  4NA7 A;  5AVD A;  1K1N A;  2GD4 B;  1O39 A;  2A1D B;  1GG6 C;  1GHA F;  1HAV A;  3QZQ A;  3WW7 A;  1ZR0 A;  2G55 A;  1GMD F;  1YM0 A;  2OUA A;  1WU1 A;  1E34 B;  1HAV B;  2B8O H;  3F2G A;  4FUH A;  3E16 B;  1C1Q A;  2ZU1 A;  1J9C H;  1VR1 H;  5C1U A;  3STI A;  4GCH F;  2W26 A;  2GMT B;  1BTX A;  2UUJ B;  5GPI B;  4MPU A;  4Y11 E;  2HLC A;  2Y81 A;  2FOG A;  5DKM A;  4WMD A;  1C4V 2;  2BLV A;  2QF3 A;  4NIV A;  3F3B A;  4GVU A;  2VIQ A;  3AAU A;  1AZ8 A;  1O37 A;  2BHG A;  5CHA C;  2FEQ H;  1Z8J B;  3HGN A;  1DUE A;  1DWC H;  4JK5 A;  4YOG A;  3MO9 A;  2AIQ A;  5JB9 S;  1O36 A;  3SUF A;  2C8X B;  2A7J A;  3Q77 A;  2ZU4 A;  1TNG A;  1P11 E;  2W5E A;  3OTP A;  2J2U A;  1P02 A;  1S6L A;  3RXI A;  3K65 B;  7LPR A;  4FU7 A;  1EPT C;  2OK5 A;  3LGT A;  1A0H B;  3F9F A;  4CRF A;  4YZU A;  1G30 B;  1DM4 B;  1TNI A;  1RXP A;  2HRV A;  3SU6 A;  3RXQ A;  3RXG A;  1CSO E;  2WYJ A;  3K6Z A;  4DJZ B;  1P12 E;  3BG4 C;  2G8T A;  3T2N A;  2PSY A;  4MNY A;  4PRO A;  4X6P A;  1P0S H;  5EGM A;  1PQ5 A;  2ZO3 H;  2PGQ B;  3M3S A;  1FQ3 A;  2FXR A;  4I32 A;  2VH6 A;  4INK A;  3LON A;  2O8L A;  3A83 A;  8LPR A;  3RXH A;  2Y80 A;  4NFF A;  2H2Z A;  2BDY A;  4OS7 A;  4LK4 A;  1H9I E;  2ZIQ H;  3K6Y A;  3SOR A;  3QK1 A;  1L4Z A;  5JBC S;  2FI5 E;  2P8O C;  4B1T A;  3SU2 A;  1NRS H;  4GUX A;  3T29 A;  1PQ8 A;  1QCP A;  4FUI A;  1YPG H;  5CE1 A;  3TIU A;  1KIG H;  5EST E;  2AEI H;  1GBC A;  1GI9 B;  5GXP A;  2PSX A;  5L2Z H;  2F9U A;  2VIP A;  3LGV A;  4O3T A;  1O34 A;  2W7U A;  1RFN A;  4K5Z A;  1KLJ H;  3ATM A;  1L2E A;  1ELD E;  1CA8 B;  1JIR A;  2EA3 A;  4O3U A;  1GL1 A;  1GHB F;  1RGQ A;  1GBJ A;  1UHB B;  5EOD A;  1MTN B;  2XND D;  3MWI U;  1FXY A;  4ABF A;  4XRN A;  3V13 A;  4UFG H;  3U9A H;  1KXC A;  2FO9 A;  3Q00 A;  1NRP H;  1FJS A;  1BT7 A;  2P59 A;  3A80 A;  3SJ8 A;  3D49 H;  2YMS D;  3PYH A;  2ASU B;  3FO8 D;  4DII H;  1FI8 A;  3N99 A;  5C20 A;  5E2O A;  1JRT A;  1J15 A;  5B6L A;  1NRO H;  1D4P B;  3MNS A;  2GT7 A;  1GGD B;  2FYQ A;  2ZC9 H;  4AFZ A;  3ODD A;  2VID A;  2BY5 X;  3VGC C;  1EAX A;  4FET A;  2ZHE H;  4F49 A;  4X1S U;  1AN1 E;  1OSS A;  1UTN A;  3GY2 A;  3STJ A;  1N8O B;  2Y5F A;  3F2F A;  2CF9 H;  3PTN A;  1FY4 A;  1TNK A;  3UOP A;  5EW1 H;  5DP3 A;  4WF8 A;  1DE7 H;  1O0D H;  2YMS B;  3M35 A;  2ZTX A;  3ZZ6 A;  4TWW A;  4WY3 A;  1AU8 A;  4NG9 H;  1XXF A;  1GJ5 H;  1IHT H;  3TNS A;  3RMN H;  3FAO A;  3LC3 A;  1G3C A;  1NU7 B;  5E2P A;  1O2H A;  1GBI A;  2RFK C;  1C5X B;  2PFE A;  2VH0 A;  2ZWL H;  4GAW A;  4IC6 A;  2KCP A;  4I8J A;  2QAA A;  2AGI X;  1OHH D;  4DY7 B;  3BTG E;  1NFX A;  1DLE A;  1TX8 A;  5EPN A;  3B9F H;  3RM2 H;  3FZD A;  4AGJ A;  2FOC A;  3RXP A;  1JWT A;  3UOU A;  4A7I B;  4DW2 U;  5BPE A;  5C5N A;  1QR3 E;  4Y8Y A;  4YLU A;  4ZRO A;  1ZRK A;  3D62 A;  3JZ2 B;  4CHA B;  3P8N A;  3K9X B;  3Q76 A;  1RJX B;  3TK6 A;  3W94 A;  1EAT A;  3LJJ A;  1ZTL A;  1ETR H;  4MDS A;  1C2F A;  2WPD D;  3RLY H;  3SJK A;  3ZYD A;  1MQ5 A;  1YLN A;  2ZTY A;  1A5I A;  2AIP A;  2AGG X;  4Q2K A;  3EE7 A;  5EQS A;  1AO5 A;  3KQB A;  2AER H;  1HJ8 A;  4NCY A;  1GVL A;  2J98 A;  3F9H A;  3S9B A;  4YT7 H;  2BD5 A;  3R0F A;  2AMD A;  2GCT B;  3GS9 A;  4TY7 A;  4CBN A;  2EI8 A;  4X6N A;  1DIT H;  1BTY A;  2ZFP H;  2B9L A;  4E05 H;  3MNB A;  4F4O C;  4TYD A;  1IAU A;  5T6D A;  3H7T A;  1QRX A;  3NZI A;  1V2J T;  2VJ1 A;  3BTW E;  8GCH G;  3UR6 A;  1KXD A;  1C5W B;  3U1I B;  2K1Q A;  3U8T H;  3ZVC A;  4U30 A;  1O2V A;  3E6P H;  1W2K H;  4WMF A;  2BD7 A;  2XBW A;  2VIO A;  5I25 A;  1O5E H;  5C1X A;  3MOC A;  1KXE A;  4A6L A;  3MHW U;  3SOS A;  1BDA A;  3LJO A;  1EQ9 A;  2GZ8 A;  3MFJ A;  1O2N A;  1S6H A;  1RIW B;  1O2Y A;  1KXF A;  4B6F A;  2J34 A;  2PW8 H;  1C4U 2;  1AKS B;  4AFU A;  3S9C A;  2ZGJ A;  4I86 A;  1BMN H;  1H1B A;  4Q7Y A;  3BTM E;  3B8J A;  1DWB H;  1S0R A;  4FUG A;  2ALP A;  3MNC A;  4X8U H;  1AUJ A;  2GP9 B;  1J17 T;  2F3C E;  4UFD H;  5T1V A;  1P3E A;  4Z1M D;  3UQO A;  1JIM A;  2AS9 A;  2CJI A;  2D8W A;  3FN8 A;  1CU1 A;  1AUT C;  1O5G H;  3TH2 H;  6GCH G;  1UO6 A;  1Y5A T;  1GHB G;  2G5N A;  1PFX C;  1T4V H;  1V2U T;  2PHB A;  2BX4 A;  1C5P A;  2O8W A;  1H8H D;  1C5Y B;  1OYT H;  3GYM A;  2XW9 A;  1GBT A;  2G51 A;  2BDC A;  1V2W T;  2FM2 A;  3HKJ B;  3SUG A;  2YOL A;  1ZMN A;  1DWD H;  4O97 A;  5EQQ A;  2AMP A;  2AHM E;  2RDL A;  1TBZ H;  4XFQ A;  1HBT H;  1C5S A;  1TGC A;  2AYW A;  5J4Q A;  1GHW H;  3RXM A;  1S81 A;  3RXL A;  1U6Q A;  1OOK B;  2ZI2 H;  2SNW A;  3NK8 A;  1AVW A;  3LU9 B;  2FES H;  1O3D A;  2FLB H;  4JZF H;  1G36 A;  1GBL A;  5T6G A;  2KM0 A;  1O3P B;  1P2O A;  1SBW A;  4RT1 A;  2G4T A;  3PRO A;  4K69 A;  4CRD A;  1A5G H;  4Z0K A;  1P57 B;  1WTG H;  1BOQ A;  1SGF G;  3OTJ E;  2I6S A;  3JZ1 B;  4HZH A;  1E1R D;  1UVU H;  3A7W A;  2WSS D;  4I33 A;  2QA9 E;  5EXN A;  2C8Y B;  3RXD A;  1ABJ H;  3ZVB A;  2TGA A;  2CK3 D;  1O2M A;  2LPR A;  3WWF A;  4K2Y A;  2A7H A;  1IQI A;  4K1S A;  1BQY A;  3A7V A;  4ABD A;  2G52 A;  4HTC H;  4R8T B;  1Y8T A;  3SV9 A;  3MNX A;  1GDN A;  1AE8 H;  4DUR A;  1QJ6 B;  1WUN H;  4H4F A;  1YP9 A;  3GYL B;  3NCL A;  6CHA B;  1Q2W A;  2DE8 A;  1OWI A;  2HPP H;  2XYA A;  1O3K A;  2W6J D;  1WV7 H;  1NRN H;  1O2X A;  1W7X H;  1J8A A;  4X1Q U;  3ZVE A;  4IC5 A;  1HDT H;  1CT2 E;  1C1R A;  2A2X H;  1UHB A;  5HM2 A;  3RUO A;  1CHO F;  1E79 D;  1HRT H;  2BTC E;  1KTS B;  2R9P A;  1TGB A;  1V2Q T;  5FXL A;  1UVO A;  3DSO A;  2Z3D A;  1CGH A;  4SGB E;  2FI4 E;  2GDD A;  1TX7 A;  3IWM A;  2AGE X;  1KDQ A;  4ZH8 A;  2BYA X;  2TGD A;  3OSY A;  3KID U;  4FUJ A;  3FFG A;  5HYO A;  1C2M A;  4WH6 A;  2FOM B;  2FS8 A;  2IN2 A;  1W10 U;  1HAI H;  2FPZ A;  1OWH A;  1FPH H;  2D1J A;  3QTO H;  1AWH B;  2J92 A;  4RKJ B;  2R3Y A;  3A7Z A;  4HI3 A;  5KGO A;  5ETX A;  2XC5 A;  1ANE A;  1Z1J A;  3F6U H;  3TJU A;  4M9F A;  1WXR A;  1CT0 E;  1GL0 E;  2BXU H;  3BTE E;  1D9I A;  1QBO A;  1AZZ A;  1C2I A;  3BTF E;  1YPE H;  3BEF B;  2JH0 D;  2OIN A;  1ZSJ A;  2ZP0 H;  1GJ8 B;  3ZZ9 A;  1A3B H;  3ATL A;  1O3A A;  2WIN I;  2KCY A;  3E0P B;  1C2G A;  3VXE H;  4AG2 A;  4B76 A;  2VWL A;  1NFW A;  3M7Q A;  5J4S A;  4XSK U;  4X8T H;  1B0F A;  1O3B A;  1W8B H;  1Y3Y A;  1K2I 1;  2PLX A;  3FP7 E;  2KFW A;  2GCT C;  1YYY 1;  2F9P A;  1IQH A;  3RP2 A;  1V6D A;  4WJG 2;  4WVP E;  3M5O A;  5L2Y H;  2BM2 A;  1MZA A;  5GND A;  1HJ9 A;  4Q4L A;  3U28 C;  3S69 A;  1FZZ A;  2OC1 A;  3DA9 B;  1MAX A;  3LGU A;  5CHB A;  1QRZ A;  4KTU A;  3KHV A;  1TMT H;  2AFQ B;  3NRL A;  4JZI A;  4OGY A;  4OS5 A;  5EIY A;  5A0B A;  1HCG A;  4BTI B;  4KKD A;  4ZHA A;  3CS0 A;  1VCQ A;  2OC0 A;  4ABE A;  2ZPS A;  1Z8R A;  3PV4 A;  3TLO A;  5L30 H;  2Y5H A;  4IS5 A;  3VB6 A;  1TRN A;  2R0L A;  3ATK A;  1QA0 A;  3ZYE A;  1VZQ H;  1ZSL A;  2FOF A;  4E7N A;  1G3E A;  2OQ5 A;  1V2N T;  1XUF A;  2OLG A;  3NXP A;  3SV6 A;  1SB1 H;  1C5V A;  3BG4 B;  1UVS H;  1GCT B;  2GZ9 A;  1ZHM A;  2WUB A;  1ELA A;  1CBW C;  3SQE E;  4ABJ A;  4Q7X A;  4ZHM U;  2ZDM A;  1ORF A;  3TGK E;  2Y82 A;  2D26 C;  1V2O T;  1O3I A;  2QXG A;  2NU0 E;  3OEH D;  4X1R U;  3LKW A;  1DX5 M;  4B74 A;  1ZTK A;  5H4I B;  2PGB B;  3OYP A;  1P09 A;  2Z6B D;  5A8Z A;  3LGI A;  3GY5 A;  3BN9 A;  5HMA A;  1BMA A;  1C2D A;  2C8W B;  2DE9 A;  3OFN D;  1P2K A;  5DGJ A;  4OS2 A;  3C27 B;  3SU3 A;  3BTT E;  4JK6 A;  1HIA A;  2G81 E;  1GHA G;  3SGQ E;  5F03 A;  4X8S H;  3LH1 A;  3GCT F;  3ZVA A;  5C2Z A;  2M5T A;  1QBN A;  2FTM A;  3PMH B;  5DJ7 A;  5GCH F;  3Q3Y A;  1THP B;  3LC5 A;  3F9E A;  2EI7 A;  1TE0 A;  1EAI A;  4E7R G;  1FY1 A;  3TJV A;  1CBW B;  1EAW A;  1EST A;  1TAL A;  2ANY A;  1H9L B;  5EOK A;  1WQV H;  2TBS A;  2ZDN A;  3VEQ B;  2W6I D;  5F8X A;  1GVZ A;  1MTU A;  5CHA B;  3U8R H;  1K1L A;  1EJM A;  1FAK H;  2J98 B;  2P3T B;  4CRC A;  1N6X A;  1UTQ A;  1O2U A;  1K1O A;  1VGC C;  2ZZU H;  3E3T A;  1TMU H;  1K1M A;  1NZQ H;  3PV2 A;  1SLX B;  4HFP B;  1OYQ A;  2HVY B;  3VGC B;  2XCN A;  3SGB E;  4X1N U;  3HK6 B;  2BD2 A;  4B6E A;  1L4D A;  1T4U H;  3SN8 A;  1P2J A;  3A8A A;  4DOQ A;  4OM9 A;  1OWD A;  3P8O A;  1HAH H;  2FWW A;  2P3F H;  4IMQ A;  1PPC E;  1XUH A;  3SO3 A;  1O32 A;  2KAI B;  3MI4 A;  4XOJ A;  1OWK A;  2THF B;  3KL6 A;  3EYD A;  1A2C H;  2IOT A;  5LH8 A;  3RC4 A;  1F0R A;  2JET B;  3LT3 A;  1MTN C;  5E0J A;  1LDT T;  3SV8 A;  4F48 B;  1V2L T;  3ZZC A;  1E35 B;  8KME 2;  4ZXX H;  1C1U H;  3GCN A;  4VGC C;  3UB0 A;  1E1Q D;  2QGR A;  1GI7 B;  3E1X B;  4ZUH A;  3F68 H;  1AND A;  1KDQ B;  1QTF A;  1SGC A;  4JCN A;  1A61 H;  3FZZ A;  3L33 A;  2GV7 A;  4LZ4 B;  1SGQ E;  1HAY B;  2AH4 X;  1UTK A;  3ZZB A;  4NFE A;  3U8O H;  1HNE E;  1GDU A;  2BDG A;  2CHA C;  2P16 A;  3BF6 H;  5HIZ A;  2Y6T A;  3CS7 A;  5GJ4 B;  1UK4 A;  3DSG A;  1EXF A;  5C3N A;  4RI0 A;  1S82 A;  2H1U A;  3MMG A;  3EA8 A;  2HNT F;  1W0Z U;  1CHG A;  3H5C B;  3LPR A;  2PR3 A;  1QNJ A;  1J16 A;  1EPT B;  1MUE B;  4OS1 A;  1ZTJ A;  2A0Q B;  2TPI Z;  2YNB A;  2FOH A;  2ZHQ H;  3S0N A;  3O8C A;  4X1P U;  3F0O A;  4ABG A;  1HIA B;  1S5S A;  3SJI A;  4B2B A;  2VVC A;  5DP6 A;  1ABI H;  1YPJ H;  1ZHP A;  1HXE H;  1AWF H;  2FX4 A;  4JMY A;  4I7Y H;  4Y7B A;  3SNA A;  1O2S A;  2H9H A;  4MPV A;  1S6F A;  4NA8 A;  4AOR A;  2BQ6 B;  1SGD E;  1JOU B;  2QY0 B;  1B7X B;  3N7D A;  1TGS Z;  2P3U B;  1Y59 T;  3KQ5 A;  4X0W U;  3URD A;  1DST A;  3V3M A;  5EQR A;  5GDS H;  4BTT B;  1GJ4 H;  1ZJK A;  2A31 A;  1LVB A;  2BY8 X;  1BHX F;  2XBX A;  4ASU D;  1F7Z A;  4CH8 B;  5LPF A;  1C1O A;  3TJN A;  1TPA E;  3KF2 A;  1ZMJ A;  2GCH F;  2OBQ A;  3I29 A;  2FDA A;  3BTK E;  1E38 B;  4EST E;  1UCY E;  1XUJ A;  3SUD A;  1IQN A;  1P04 A;  3MU8 A;  3NWU A;  4TSF D;  2FS9 A;  4NSV A;  1TYN A;  2A5I A;  5E8E H;  1PQ7 A;  3MH5 A;  3ZV8 A;  1NRQ H;  3PV5 A;  3NPS A;  1OP2 A;  4KP0 A;  1C1V H;  1O31 A;  2O8U A;  2ZFT A;  2QF5 A;  1QRW A;  1ZLR A;  5IK2 D;  1BZX E;  4MTB A;  1O38 A;  2XXL A;  1Y5B T;  1TRY A;  1JMO H;  2PKS B;  1FAX A;  1N6Y A;  3H09 A;  1MKX K;  2V3H H;  5JBB S;  1P2N A;  3E8L A;  3KQE A;  1AD8 H;  1ZPB A;  4Q63 A;  1DY8 A;  2XTT B;  2OD3 B;  3ITI A;  3PLK A;  1ZHR A;  4NWL A;  4VGC B;  4FUB A;  1FX0 B;  3UNS A;  2FX6 A;  3LGY A;  3BSQ A;  3GCH B;  1T32 A;  4MG3 A;  2YMS C;  3LOX A;  2ZQ1 A;  1SVP A;  2IJO B;  2VNT A;  3ZV9 A;  5A09 A;  3F1S B;  4UEH H;  4O03 A;  3SZN A;  4ACB A;  1EP6 A;  2OC8 A;  1P8V C;  5K7R A;  3AVZ A;  1T8O A;  1ETS H;  1NT1 A;  3UNQ A;  1TGN A;  1DIC A;  3ODF A;  2JH6 D;  3TJO A;  5TJX A;  2VU8 E;  3MQK C;  2QC2 A;  3M5M A;  5A0C A;  3SV2 H;  3UNR A;  1SGE E;  1CGJ E;  1Z6J H;  1YGC H;  2WZQ A;  1O2Q A;  1GMC G;  2A32 A;  2J38 A;  4WXV A;  3MH6 A;  3SU5 A;  1GBE A;  1LVY A;  3SYJ A;  3WY8 A;  4ISH H;  1OWE A;  2BZA A;  2ALV A;  1C5Q A;  1GI4 A;  2K8I A;  3RMO H;  1H8E D;  1EZQ A;  2BY9 X;  3FOA A;  4ZAE A;  2VVV A;  3OU0 A;  4CH2 B;  1ESB A;  1CVW H;  3QUM P;  1DFP A;  1NN6 A;  5FCK A;  1SG8 B;  1S85 A;  2O9Q A;  4A5T S;  5G4B A;  4X6O A;  1ANB A;  1QJ7 B;  1A3E H;  3ZZ8 A;  4NA9 H;  1V2R T;  1AY6 H;  1LHD H;  2EI6 A;  2HGT H;  1HLT H;  2CN0 H;  3SQH E;  5AHG H;  7GCH G;  3M5L A;  1W13 U;  1H8I H;  2LEL A;  4AN7 A;  3U1J B;  1IQE A;  4AFQ A;  3F2H A;  1EFR D;  1K9O E;  4CRB A;  4JYT A;  1HPG A;  1W14 U;  2OXS A;  1C5R A;  3GDU A;  1NFU A;  4RN6 A;  4X2V A;  4DCD A;  2ZQ2 A;  3DUX H;  1EZX C;  1VCW A;  4X2W A;  3EGK H;  1GBA A;  3Q3K A;  4UDW H;  1FV9 A;  2WPH S;  5EJZ A;  1SGI B;  1ZOM A;  3TNT A;  1XKA C;  2SGF E;  5F53 A;  2ZFS A;  1RIW C;  1AFQ B;  2BXT H;  1GCD A;  3VB5 A;  1YPK H;  1UTJ A;  2GVF A;  1A4W H;  4O9V A;  2WUC A;  3K2U A;  3OAA D;  4K60 A;  1WDI A;  4ABI A;  1DY9 A;  2STB E;  1YCP K;  1OXG A;  1MMJ N;  8GCH F;  1LMW B;  2CV3 A;  3A7T A;  4H6S B;  4Y10 E;  1GHY H;  1C9P A;  2CXV A;  1FN8 A;  2F43 B;  1UW7 A;  1AI8 H;  1D3D B;  2R3U A;  2HLD D;  2RG3 A;  2QCY A;  1EPT A;  2BDB A;  1ELE E;  1EOJ A;  1HAP H;  3RXT A;  3ZZ5 A;  2ZDL A;  2ZCH P;  2PKS C;  4AC9 A;  1UCY K;  1VJA U;  1WCZ A;  3PWC A;  4YTA A;  3EAJ A;  5AFZ H;  1IQJ A;  3Q3X A;  1SHY A;  6GCH F;  1O2R A;  5DPA A;  2HNT E;  1SGN E;  1FUJ A;  1UCY H;  1LPG B;  1AB9 B;  1LVM A;  1XUG A;  3PTB A;  1C1S A;  4GHT A;  5EG4 A;  5FBI A;  1OX1 A;  1C5O H;  4MNW A;  1SFI A;  2RA0 A;  3BEU A;  1LHC H;  4NIX A;  3P92 A;  2C3S A;  4NIW A;  2BLW A;  3DFL A;  4YO9 A;  2UUY A;  4WME A;  3A8D A;  1GBH A;  3AW0 A;  4FUD A;  7GCH F;  1EB1 H;  1GJD B;  1ACB E;  4BTU B;  2KX4 A;  1P3C A;  3FVF B;  4P02 A;  2KCA A;  1O2O A;  4MLF B;  1CA0 B;  3MH7 A;  2VIN A;  3VB4 A;  1DWE H;  4TY6 A;  3M5N A;  1EUF A;  1GG6 B;  3KCG H;  3EA9 A;  4X8V H;  4H6T A;  2P94 A;  2SFA A;  4I8H A;  4MNV A;  1ZSK A;  4YES B;  5BRR E;  4I31 A;  1YKT A;  2KAI A;  5B6O A;  1MKX H;  2OP9 A;  5T6F A;  4CRA A;  3MU0 A;  1GHX H;  3VXF H;  1LTO A;  1GI0 A;  1SC8 U;  1C9T A;  1VIT H;  5JYI A;  1TAW A;  1C1T A;  3PLB A;  1C2K A;  1VJ9 U;  2BY7 X;  3CP7 A;  1HAO H;  5FAH A;  1FNI A;  1SFQ B;  3SGA E;  2ODP A;  3AAS A;  4NSY A;  4IBL H;  1TOC B;  4UFF H;  4ACA A;  1YY3 A;  3GY8 A;  1EZU C;  2A4R A;  3QTV H;  1TQ0 B;  5C1Y A;  2VIV A;  3TH4 H;  3RXC A;  2J95 A;  3U98 H;  2W3K A;  3RXJ A;  1V2T T;  1EAS A;  1K1P A;  4M7G A;  2W7S A;  1FON A;  4XDE A;  3UFA A;  1QHR B;  4K1T A;  1DLK B;  4Y6D A;  4SGA E;  4OS6 A;  1VGC B;  2VB0 A;  3QO6 A;  1GI6 A;  2PUX B;  1P01 A;  3D23 A;  1HJA C;  2CF8 H;  4FVD A;  2ZGC A;  2ZDA H;  5DP7 A;  2GTB A;  1BTP A;  1A0L A;  3RDZ A;  1SQA A;  1YPM H;  3OY6 U;  4U32 A;  2F9V A;  1E36 B;  1RS0 A;  1LQE A;  4WWY A;  5C17 A;  3A88 A;  1NRR H;  2Y7Z A;  1V2P T;  2V3M A;  1F92 A;  2L74 A;  1C5T A;  1GJB B;  3U69 H;  2FZZ A;  1QL7 A;  2JIZ D;  1V3X A;  2H5C A;  2P95 A;  5C5O A;  2WYG A;  1SKY E;  4J2Y B;  1P06 A;  1ZYO A;  4ISL A;  3KGP A;  4CHA C;  3HK3 B;  4QT8 C;  1O2J A;  4KGA A;  4B2A A;  3H7O A;  1EJN A;  3RXV A;  1QJ1 B;  3ZZA A;  2XNI A;  5E0H A;  3A87 A;  2BDI A;  1HJA B;  2J4I A;  2UWL A;  1KLT A;  5FCR A;  3RMM H;  3SV7 A;  2JKH A;  2ZDK A;  1O5F H;  1PYT D;  1SGP E;  2JJ2 D;  4TPY A;  3EA7 A;  1TBQ H;  3KYF A;  1W11 U;  1AVX A;  1WQS A;  2Q1J A;  5PTP A;  1GJC B;  4D9R A;  1ESA A;  1WBG B;  1C4Y 2;  2HOB A;  1WOF A;  2ANM H;  4DT4 A;  2VBC A;  2DUC A;  2BZ6 H;  1SGT A;  1O3C A;  1IOE A;  4BAN B;  2RCE A;  4GHQ A;  3CEN A;  1O3F A;  1HUT H;  1V2S T;  1MH0 A;  2I6Q A;  3GY4 A;  3SU0 A;  1JXP A;  1ZML A;  1C1W H;  4UON A;  4BAO B;  1ANC A;  1BBR E;  3LGW A;  1G3D A;  2FOE A;  3M7U A;  2F9N A;  3DHK H;  5DO4 H;  1C2J A;  1HAX B;  5FX5 A;  3RM0 H;  4AYY B;  3IG6 B;  1CGI E;  2ANW A;  3MTY A;  4AB8 A;  3MH4 A;  1F0S A;  3BV9 B;  2A7C A;  1SGR E;  1GPZ A;  3ZZ4 A;  4AOQ A;  1XUK A;  4I8L A;  2ZGX H;  4Z6A H;  2SGA A;  1BRU P;  1QQU A;  3TIT A;  4Y0Y E;  1BBR K; 
#chains in the Genus database with same CATH homology
 3RC5 A;  3FN8 A;  1DXP A;  1CU1 A;  2OC8 A;  5EPN A;  3O8D A;  2KR7 A;  2M2A A;  2OBO A;  3N7E A;  3PRD A;  4B71 A;  5ETX A;  5CDF E;  4B73 A;  1BT7 A;  2A4Q A;  5DN6 D;  5C0U A;  3M5M A;  1WXR A;  1H8H D;  2GGV B;  4M9F A;  3DCL A;  3SU2 A;  3O8C A;  3P8N A;  2XCF A;  3KEE A;  5FPT A;  2F9V A;  3F0O A;  2WZQ A;  2FM2 A;  3SUG A;  2F4L A;  2YOL A;  3OEE D;  4WH8 A;  5EQQ A;  3FKS D;  3SU5 A;  2KCO A;  2AHM E;  4B75 A;  4F55 A;  5C17 A;  3AK5 A;  2F9U A;  2WPD D;  3O8B A;  4K8B A;  3SYJ A;  2OIN A;  3WWB A;  4U01 A;  2V7Q D;  2IJD 1;  4JMY A;  2W6I D;  2JIZ D;  3F0P A;  2K8I A;  3SUE A;  1H8E D;  2KCY A;  3FOA A;  3O8R A;  4B76 A;  1SKY E;  5EQS A;  3DSP A;  3N7D A;  2WV9 A;  1RGQ A;  1RTL A;  3WW7 A;  2JJ1 D;  2KFW A;  4A1V A;  5EQR A;  2KM0 A;  1DXW A;  4XD7 D;  5FPS A;  2XNI A;  2KCA A;  1BMF D;  1W0K D;  2XND D;  3SU4 A;  4A1T A;  3PV2 A;  3F2G A;  5HKK D;  3M5O A;  4ASU D;  3M5N A;  3SV7 A;  3VG8 A;  2XCN A;  3PRB A;  5GND A;  4Q4L A;  3M5L A;  1E1R D;  3GS9 A;  2OC1 A;  2JJ2 D;  5GPI B;  5CHB A;  2LEL A;  4B6E A;  3KF2 A;  2P59 A;  2K0Q A;  3L6P A;  3U1J B;  2WSS D;  4I33 A;  3F2H A;  2XOK D;  2CK3 D;  2OBQ A;  4OM9 A;  1EFR D;  3WWF A;  3KNX A;  3NRL A;  3P8O A;  2YMS D;  3F3B A;  4TYD A;  1W0J D;  3FO8 D;  1NS3 A;  4I31 A;  2WHX A;  3KN2 A;  1A1R A;  3N99 A;  3SU1 A;  1NBM E;  4R8T B;  2OC7 A;  2KZ4 A;  2OC0 A;  2QE7 D;  3SUD A;  4DT4 A;  5B6L A;  3SV9 A;  3U1I B;  2VBC A;  2A4G A;  4KTC A;  5FL7 D;  2K1Q A;  4TSF D;  3EYD A;  5ESB A;  2JDI D;  3PV5 A;  4FET A;  5F53 A;  3SUF A;  2W6J D;  3RC4 A;  5EPY A;  5DSF A;  2L6O A;  3RC6 A;  3OTP A;  2O8M A;  2QF5 A;  3SV8 A;  3SZE A;  1S6L A;  3SV6 A;  4NWK A;  3SU0 A;  5IK2 D;  1MAB B;  1JXP A;  2GVF A;  4TT3 D;  3F2F A;  1E79 D;  3OAA D;  2OK5 A;  5C0T A;  1KMH B;  1E1Q D;  3UB0 A;  3W1E A;  3H09 A;  4B6F A;  1DY9 A;  2FP7 B;  2A4R A;  4WF8 A;  2YMS B;  3ZIA D;  4A92 A;  3DSO A;  3SU6 A;  5FPY A;  4Q63 A;  3OEH D;  1N1L A;  3LKW A;  1DY8 A;  1W3C A;  2J5U A;  3E90 B;  4A1X A;  5IDK A;  4NWL A;  4B74 A;  4YXW D;  5H4I B;  1COW D;  1FX0 B;  3OYP A;  3OE7 D;  1NBM D;  2YMS C;  3LOX A;  4WH6 A;  4I32 A;  5T1V A;  2F43 B;  4ZCN A;  2FOM B;  2KCP A;  2IJO B;  3LON A;  5GJ4 B;  4Z1M D;  3OFN D;  4RI0 A;  2HLD D;  2QF4 A;  1OHH D;  2QV1 A;  3SU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...