1BTWA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btwA02
5L2ZH 4Q2KA 5L6NH 2F83A 1A5HA 1GCTC 1X7AC 3AVZA 2CF9H 3M37A 2ZFRH 1YPKH 1P9UA 4FU7A 1XUFA 5T6FA 2DE9A 2F3CE 3LGIA 1C5XB 3SJKA 1V2NT 4H6SB 2B7DH 2H9HA 8KME2 2ZGXH 4ABIA 3LGWA 2VWOA 1O5BB 1MTWA 2ZDMA 1SGEE 1C5PA 4HZHA 2ZP0H 1C2MA 1O36A 5T6GA 2GGVB 1OYQA 2CF8H 5TCCA 1TWXB 4FU9A 5FX5A 1GJ4H 1ZSKA 3QUMP 1T32A 4MNXA 4WWYA 2ESTE 5DKMA 3E90B 2QIQA 3NWUA 2V0BA 4YTAA 3RM0H 4X1NU 4NWKA 2BZ6H 2ZGHA 1GBBA 1ETRH 3GY3A 1C4V2 3SJIA 3Q3YA 1GI9B 2A7CA 2ZCKP 1DUEA 1S84A 2Z7FE 1GI5A 2ZHEH 1ARCA 2C8WB 2O8LA 2PW8H 1FPHH 1EXFA 1EJMA 1C2LA 1ZGIA 3UNSA 1W12U 3EA8A 1ZRKA 4MNVA 3SNEA 2AMQA 1PQAA 3V12A 1EJAA 4LZ1H 3ESTA 5GCHG 1A0LA 3ZVDA 1VCWA 3BG8A 3ENSB 1TNLA 3A89A 4TPIZ 2FOFA 3RXTA 1NN6A 1TQ7B 3QN7A 2C8XB 1P2IA 3GCHC 3H7TA 5TCAA 4DGJA 2WUBA 4UONA 4K1EA 1IQKA 1QURH 2AIPA 2AEIH 2BLVA 1SSXA 3SUDA 4AFSA 2EI7A 2GZ9A 1WU1A 3U8TH 1NY22 3ZVEA 3RXOA 2Y80A 3Q3XA 2TRMA 2JETC 2ZIQH 5F03A 4TPYA 4AB8A 1H9LB 4Z6AH 5FAHA 4Y0YE 3TJUA 1O37A 1OP8A 4OGXA 3EYDA 1ANBA 1FY5A 3I78A 1LKBA 2A32A 2WYJA 5C67A 1O30A 1HFDA 1CE5A 2PKSB 1W14U 1AWHB 2A4RA 3LOXA 1ABJH 3MU5A 1PPCE 2G4TA 4Y76A 1TNJA 3GYMA 1C5NH 2VH6A 3HPTB 4CRGA 2ZO3H 4AORA 1DVAH 4NSVA 5ETXA 2BVXH 2GTBA 1CHOF 3U9AH 3E3TA 1C5SA 2BDBA 3SU5A 2ZC9H 1EASA 2YOLA 3FZDA 3LC5A 1S6HA 1SI5H 2G8TA 4IN2A 4U2WA 3E16B 2JKHA 4B2BA 1BRCE 1Z8IB 3GY4A 4OS4A 4RKJB 1NM6A 1W8BH 1BHXB 1J15A 1GBCA 1TPOA 3ITIA 1NS3A 1ZPBA 1MD7A 3AW1A 1TGSZ 4I8JA 4D76A 4RSPA 1GHXH 5T3HA 1TRNA 1H1BA 3RXHA 1LMWB 3RXIA 4AGJA 1LHEH 4TY6A 2D1JA 2I6QA 2ZDNA 2HOBA 1Q2WA 2ZU1A 2B0FA 1GDNA 2ZNKH 1IQHA 1J17T 1HJAC 4ABHA 1FI8A 1K1NA 1OX1A 2FOBA 4TYDA 4YESB 4ABJA 1GG6B 2GCTB 1VCQA 3E6PH 3U1IB 1AD8H 3KGPA 3CS7A 4NZLA 2SGQE 1DWBH 4JK6A 2GP9B 5E2PA 2VGCC 3KNXA 1GHVH 1W0ZU 4AX9H 1HJ9A 2PWXA 2BDGA 1D6RA 4UFEH 1ELTA 1GJ8B 3RXGA 3C1KA 1SL3A 2Z94A 4FUHA 1C1SA 1C1WH 5GXPA 1G32B 1OWKA 3K9XB 2G4UA 2FESH 1O32A 3F1SB 1SG8B 2BDIA 4NA8A 3SU6A 4E06H 3BTEE 2NU1E 3S7HB 4TWWA 2XCNA 2VIQA 4ZH8A 1GHAG 1KXBA 1W10U 2TPIZ 3T26A 1LPKB 4JZDH 4AG2A 1C1OA 3BTHE 3BN9A 1DE7H 2OUAA 4JZIA 1GJCB 1O2SA 3QDZB 1GBIA 1P3EA 1D3TB 1YPLH 3LJJA 3UQOA 1D9IA 1YCPH 1TX8A 5HYOA 4ZKNU 1TBRH 1WOFA 1O3OA 4BAOB 1O2ZA 4ZHLU 2RDLA 1EOJA 1ZPCA 3RXRA 5JB8S 1A5GH 1KLIH 1ZLRA 1F0TA 2GZ7A 2XC0A 3BV9B 4YOIA 4BAKB 6GCHF 1OXGA 3PYHA 4H42U 1AKSA 4X8TH 3GDUA 1QJ1B 1F92A 3GCOA 1KSNA 3SQEE 3LIWA 4IMQA 3E0NB 1UVUH 1K1IA 1P2QA 2UUYA 3B9FH 1C1PA 2ZHQH 3Q76A 1OP0A 1SGIB 1TLDA 2OTVA 4B74A 2OLGA 1UHBA 1C5ZB 1RS0A 3VB7A 2R9PA 5A09A 2ZHFH 3PB1E 1MBQA 2Z9IA 2PKAA 4CR9A 1SB1H 1YPGH 1Y5BT 5DPAA 3UOPA 2Y5GA 3K6YA 1ZZZA 3DT0H 5F6MA 1GMDF 3V3MA 2OC8A 1YM0A 4B75A 2IJOB 2V3OH 1H8IH 2BY7X 2VIDA 3UUZA 5CMXH 1SVPA 1DXWA 1UCYK 2AIQA 2FODA 1SBWA 3RU4D 2PGQB 1KDQA 1O3GA 1YPMH 1P57B 1XUIA 3RC6A 2UWLA 2FP7B 2FXRA 4MQAA 3OSYA 1XUGA 3AW0A 1O31A 1F0RA 1TAWA 1DSUA 1BTHH 2GCHF 3MH5A 5HM2A 1Z8JB 4ABAA 4X6MA 4ISLA 1ZGVA 1QGFA 5BPEA 2V3HH 3NPSA 2OINA 4GHTA 3WY8A 8GCHF 1AFQB 5HMAA 1GGDC 3FP8E 3K6ZA 1BBRK 2UWOA 1GVKB 2A31A 1C5RA 4Y71A 3QGJA 4AYYB 3DD2H 3QX5H 1TBZH 3A80A 3SU2A 4ZKOU 3F9GA 4QT8C 2GT8A 3BEFB 2YNAA 2VWLA 2EC9H 2P16A 2ZTYA 5AF9H 5JDUB 3GCNA 3CS0A 1KTSB 1A0JA 1BTWA 1G2LA 1N8OC 3MNBA 1GBMA 4NA7A 1F0UA 2BLOA 2D26C 3VB3A 4JZ1A 4WMFA 1BTYA 3GDSA 2NU3E 2Y7ZA 3LGYA 1K1LA 1QL7A 4FUBA 2VJ1A 1QQ4A 1SGCA 2JH5D 2FOEA 1EAUA 1FJSA 2A4QA 2ZEBA 1G9IE 1DPOA 2ZU5A 1LO6A 2O8MA 3TJOA 3OTJE 2QYIA 1CSOE 1P02A 4GVUA 4YO9A 1IQMA 1AHTH 2HPPH 2BX4A 4IBLH 1TOMH 2H9EH 3P6ZB 3SO3A 3RMLH 5A8YA 2BDCA 2Q6GA 4WH8A 1MQ5A 1FIZA 1DX5M 5C5NA 1FAXA 1HDTH 1OSSA 4GHQA 1P04A 2H5CA 4KKDA 1S85A 5DP7A 3TH3H 1BDAA 3MO9A 3A8AA 4J1YA 2PUXB 1FIWA 1F5LA 3RDZA 2PSXA 1BT7A 3EA7A 3RXSA 1VZQH 1V2LT 1O3FA 1AU8A 1J16A 4YT6H 1HAVB 3KQCA 1HAHH 1H9IE 2CN0H 3MU1A 1GMCF 2VNTA 4MDSA 1RXPA 4GSOA 2JH6D 4O9VA 3RU4T 3TJNA 3UR9A 2FZZA 2VH0A 1DWDH 1NRQH 1NT1A 3PTNA 3VXEH 3M5LA 3STIA 3MU4A 1GI3A 1HLTH 2FX6A 4M7GA 3TJVA 3ZZ6A 5DP3A 2GT7A 1A3EH 3ZVFA 4AFQA 2WYGA 3SU1A 1PPGE 3UIRA 3S69A 5B6OA 4XDEA 4CH8B 4AZ2B 3MU8A 1O5EH 5L30H 2BB4A 1YCPM 2ZA5A 1FQ3A 2VIVA 1C5OH 4OS1A 1Z1IA 1Z6EA 3SV8A 1RFNA 1JBUH 4Y7AA 3MNCA 4JMYA 3A88A 1ETTH 1GI4A 1S0RA 1G2MA 5F8ZA 2HNTC 3SBKA 1E34B 1O3CA 3FP6E 1C2IA 2O8TA 1C1MA 2FLBH 3VFEA 2RG3A 1N1LA 4K8BA 5JBAS 3O8RA 3PWCA 3SHCH 1MCVA 1OWHA 3QTVH 4YLUA 1PYTC 4XBCA 4Y8ZA 4DIIH 1KXCA 2A5AA 2ANKH 2FI3E 1BITA 1TMTH 3Q3KA 3VB4A 4F49A 4FUDA 3GY8A 5DJ7A 1TNIA 1ETSH 3F9FA 4NIXA 1GBLA 1AWFH 3FZZA 1EZXC 2P94A 5A2MH 1BA8B 1LHCH 3M3VA 2BQWB 5EQSA 1D3QB 1LTOA 3BF6H 3A7TA 3UFAA 1O2HA 4LXBH 4XSKU 2FTMA 1ZMNA 3ZVBA 2FLRH 2ZTZA 1EP6A 3PO1B 1AGJA 2AFQB 2Y7XA 1WBGB 2ZDKA 4NSYA 2SGAA 1EQ9A 4AN7A 2PTNA 1OYTH 3ODDA 1VITH 1GG6C 2GCTC 3MI4A 4K2YA 3SNCA 1TX7A 3T28A 1ZJDA 4CRCA 4BTTB 1AKSB 5LPFA 3HGPA 2O8UA 4CRAA 4ZMAH 5C2ZA 1MTNC 1CT4E 2GDEH 1GHBF 1PQ8A 4HTCH 1AUJA 3P8FA 3EDXB 1L1JA 1O33A 1SHYA 5F8XA 3ZZ3A 4O03A 4SGBE 3LGUA 2UUFB 2ALPA 1AZ8A 1O3NA 8LPRA 1RTKA 5A0AE 1V2RT 1GDQA 1UHBB 1TA6A 3TPIZ 1L1NA 1XKBC 2HPQH 3T62A 3U69H 3LDXH 1CBWC 3U98H 2ULLA 2PKAB 3UWIA 1BMMH 1NRNH 4WY3A 3RC4A 4NIWA 4Y0ZE 4U32A 1IQFA 3UQVA 1GBKA 1FV9A 3NCLA 1C2FA 3N7OA 1WAYB 1EZUC 1EAXA 1HAIH 2J4IA 2Q6DA 4O3UA 1KDQB 4GAWA 1T8LA 2A2XH 3A8BA 1OPHB 1ZTLA 2QGRA 1BJUA 2A7HA 2TIOA 5DP4A 1SPJA 1SGFG 4ISOA 4U01A 4IGDA 4YZUA 1GI6A 5EXMA 1RTLA 1K1JA 1XXDA 1LHDH 1G3BA 5LGOA 1GJDB 4F4OC 1WYKA 1ELAA 4B2CA 1AIXH 2NWNA 1QRXA 3V7TA 2GMTB 1B5GH 3C27B 1SGFA 4A1TA 1L0ZA 1OWJA 1TNKA 3SNDA 1HUTH 2W7SA 1SGNE 5EPNA 1SLUB 1YGCH 2RA0A 2AGEX 3SNBA 1QNJA 2OC1A 1CGIE 4K8YA 2XTTB 4B71A 1O2WA 1UVPA 1Y3UA 1HXFH 1V2VT 2FTLE 4ISIH 4XE4A 5HM9A 4CHAB 2P3FH 4I8GA 2ZI2H 1GBDA 1TPAE 1ZR0A 1EPTA 2P95A 3VXFH 2GV6A 3BTME 5C3NA 1NO9H 1UTPA 4OS2A 1A1RA 1GI0A 1C5YB 2Y5HA 4DY7B 3PMBB 5LH8A 1EAIA 1BTXA 1EP5A 1G3EA 4I31A 1O2TA 1O3MA 2WPIS 5A8ZA 1BB0B 1DS2E 1MH0A 1T4VH 3ATKA 3LC3A 4FVDA 4MPUA 3ZV9A 2WPKS 5K0HA 1AN1E 5JBTA 1BIOA 1MKXK 3VGCB 1P2KA 4KTUA 3GOVB 1UTLM 1SHHB 1V2QT 3GDVA 4K69A 1ELBA 1C9PA 1CU1A 2Z6BD 2ZKSA 1LHGH 1YP9A 2FDAA 3A7ZA 3GISB 1TFXA 1HBTH 4ZHAA 1KTTB 3EGKH 3NXPA 6CHAB 4LZ4B 1AFQC 1GJAB 3DUXH 5EW1H 1QBNA 1Y5AT 4XOJA 3M7QA 4Y10E 1CHOG 4DOQA 1P05A 4WXVA 1F7ZA 2G55A 1TMUH 4BTIB 1GHWH 1LPGB 3SV2H 5I46H 4KGAA 4FUGA 2BZAA 1C4U2 3BTKE 1CA0B 3RXUA 2BVSH 2AERH 3PMJA 4I8KA 4JYTA 5A8XA 2VWNA 5DP9A 2HRVA 2A2QH 2F9BH 1ZYOA 1O2LA 2RCEA 1PPFE 1AMHA 1L2EA 1WTGH 1EUFA 1HYLA 5EQQA 1S83A 4MTBA 2UUJB 4YM9A 2Z3EA 2ZQ1A 1Q3XA 3UNRA 2ZHWH 4A92A 3TK9A 1XUJA 4WH6A 2OD3B 1HJ8A 1HAVA 1C5VA 1O2OA 1P2MA 3MNXA 2EEKA 1MU8B 4Y8YA 3BTQE 1MZDA 3UPEA 1S0QA 1C1TA 3D62A 1G30B 1GCDA 4UFGH 3M3TA 3ATMA 3GYLB 2WV4A 2VWMA 4R0IA 3SUGA 2BOKA 3W95A 3RXDA 1QTFA 1FUJA 1GHZA 1JRSA 1ELCA 3EE0B 1WQVH 1MZAA 4TWYA 4CRBA 5E0GA 4GLYA 7LPRA 1SFIA 1P06A 3KEEA 4INKA 3RMNH 1O3KA 1FN6A 4X1QU 2P59A 2BD4A 1K1OA 4OS6A 1XVMA 2PTCE 3P8GA 4ABFA 1FAKH 3BTWE 1RIWB 1ELFA 3MTYA 1O3LA 4DW2U 1TGNA 1WTHD 3MHWU 1P2JA 2J9NA 5J4QA 1UCYH 3FANA 6ESTA 1PPHE 2I6SA 2O8WA 3BTTE 3TK6A 4VGCB 1TIOA 1ESAA 1Z8GA 6GCHG 2F9UA 4IS5A 5E0JA 3P92A 4X2VA 1AZZA 1XUHA 1W7GH 5EW2H 2K1QA 1ZPZA 1HAZB 4X1PU 1B7XB 2NU2E 5ESTE 3A7VA 5I25A 2CXVA 1O2IA 3OY5U 2QXIA 1C2DA 3SQHE 1GMHF 1HV7A 3JZ1B 1LDTT 1IQIA 3P8NA 3T25A 8ESTE 3A83A 5FPSA 1H9HE 1O3PB 1P2OA 3TGJE 1HAGE 1ACBE 5CHAC 1Z71A 4Q80A 1Y5UT 4NWLA 3KIDU 1EX3A 4AFUA 1WQSA 1BBRH 4K1SA 1ID5H 4MLFB 1XXFA 1C1NA 2STBE 5G4BA 1W3CA 1GMDG 4Q7XA 3L6PA 4FUIA 2Y82A 3UOUA 2W26A 1V6DA 3I77A 1SMFE 3ZZAA 3SI4H 2GDDA 3F6UH 3S7KB 1P09A 4AOQA 1BRUP 1K22H 3L33A 1D3DB 2P93A 3DFJA 1O0DH 2C3SA 2ANYA 3RXVA 2ZCHP 1A3BH 5E8EH 3LKWA 3TH4H 1CT0E 3PM3A 3PLKA 1XMNB 2CJIA 1AVWA 2ODQA 5DP8A 3RXLA 3UY9A 4KP0A 1QCPA 2GCHG 3SUFA 1P9SA 4Q7YA 2YNBA 1O3HA 1GVZA 5J4SA 4ISNA 2ILNA 2ZZUH 1LVMA 5L2YH 2OBOA 3E0PB 1GCTB 3QTOH 3AASA 8GCHG 1PPEE 1VGCC 2SNVA 1HIAB 3PROA 1BQYA 1HNEE 1ZOMA 2CGAA 1KYNA 5CE1A 3CENA 3IG6B 1ZHRA 5AFYH 2PHBA 3LPRA 2ZFTA 1DUAA 2BDHA 3MYWA 2GX4A 1TGCA 4X8UH 4BAHB 3HKJB 3NZIA 1A61H 1C4Y2 1YPJH 1EZQA 1P2NA 3KQBA 1NU9A 1MQ6A 2WPLS 1MTSA 2WPMS 1ELDE 2FOAA 2R0KA 1ZJKA 1VITF 2VB0A 1SOZA 2HALA 2EI8A 4JYVH 1EPTB 4NFFA 4RKOB 1Z6JH 2ZFSA 2JH0D 2P8OC 1C5LH 3B8JA 1O2UA 4AYVB 2BYAX 2FOCA 2ZGJA 1GJ7B 1ANDA 4MPVA 1HB0B 4GCHF 3UREA 7GCHF 1O2GH 2OC0A 1PQ7A 1P01A 3H7OA 4J2YB 2ZTXA 1GL0E 4ZROA 4BANB 3MU0A 2OXSA 1S82A 3RXJA 5DO4H 1HRTH 1SQAA 1ESTA 1MKWK 2R2MB 3K65B 1BMAA 1ZHPA 2ZG0H 2BD7A 4DIHH 1O2KA 2CHAB 2ODYB 2KAIA 3QGNB 5DP5A 1NFXA 1NFWA 1O3BA 1L4DA 2WINI 3ZYEA 3RXBA 2GD4B 2TBSA 1THSH 3EA9A 3W94A 4DG4A 3GCTG 1ESBA 1KXFA 1O5FH 1C9TA 2BD5A 4ZHMU 3GCHB 2Z9KA 3F68H 1CT2E 1FN8A 1K21H 3P95A 1YC0A 1IQLA 2XWBI 4D7FA 1MD8A 2BLWA 4X8VH 1BJVA 1G37A 1ELGA 1GMCG 1LVBA 1AFEH 1MUEB 4CHAC 1QBVH 1AQ7A 1JIRA 1XKAC 4FU8A 1AI8H 5JB9S 1J9CH 1SGRE 1E0FD 1O3AA 4A1VA 4I8HA 1GBAA 1UVSH 2VINA 3A84A 3M7TA 5C1XA 1TABE 2A0QB 3RC5A 3GICB 1V2ST 3LH3A 1HAXB 1SQOA 4HFPB 2FS8A 1IAUA 5H4IB 2TGAA 3A7XA 1GI7B 3EAJA 4FUFA 2ZGCA 2O9QA 1RRKA 3QZQA 3VGCC 2PSYA 1A4WH 1PPBH 4CBNA 1O2VA 3MWIU 5HGGA 1UTNA 3RMOH 2FMJA 3B23B 4ZKRU 5IYTA 1G3CA 1F2SE 1OS8A 5C1YA 1B0FA 1UTQA 6CHAC 3SOSA 2G51A 2BY5X 3BIVH 3E8LA 3LGVA 3BTFE 1NESE 1C5WB 3BIUH 4O97A 1Y3YA 3LT3A 5AFZH 3IITA 5FPTA 2XWAA 3PMAB 3SGQE 1XUKA 1KLTA 1GWAA 1H4WA 3QK1A 1BTPA 3KF2A 3RXMA 2BVRH 3M35A 1SC8U 1MAXA 2OC7A 2XNIA 1O3JA 3SI3H 2QY0B 1H8DH 1UVOA 3L3TA 1CA0C 1EB1H 2DUCA 4X1RU 1HCGA 1VR1H 1C2HA 1ARBA 1P12E 4ZAEA 1V3XA 2AGIX 3P8OA 3ATIA 4D9QA 1HJAB 1W11U 3E1XB 2OCVB 3E91A 1WSSH 4IN1A 3DFLA 2PKSC 2QV1A 3RLWH 2QA9E 2PR3A 2QCYA 4SGAE 3SJOA 3TITA 4YLQH 2VU8E 2GZ8A 4MVNA 3OYPA 1O2NA 2B5TB 2THFB 2BXUH 1ORFA 2W7UA 1OKXA 1D3PB 2DE8A 1FONA 2H6MA 2VVVA 1GHBG 2WPJS 2C8ZB 5EG4A 3LH1A 2FOGA 1TBQH 1ZSJA 1C2EA 2HNTF 2ZPQA 4AGKA 2SNWA 3U8OH 4JK5A 1JIMA 1P8VC 1NFUA 4YOGA 5JBBS 9LPRA 1O5CB 3MOCA 3A7YA 3BG4B 1Z1JA 1QA0A 1C5MD 1DY8A 1TYNA 2XBXA 1JRTA 1V2PT 2BOHB 2IOTA 4TY7A 3ZZ9A 5FHTA 4X6PA 4THNH 1QB9A 3M5NA 4NGAH 1GVLA 1RIWC 1C5UA 5AVDA 1XX9A 5EU8A 2ZF0H 2BX3A 4CH2B 4MNWA 1S6FA 3GY6A 1AUTC 3KN2A 2XC5A 1E35B 5EQRA 2V6NA 1C2GA 4AFZA 4X6OA 1J8AA 1IHTH 2ODPA 2GKVE 3UTUH 2B8OH 1JOUB 1QJ7B 3DA9B 2R0LA 1VCPA 1UK3A 1Y3VA 3MH6A 3T29A 1SOTA 3SNAA 1DXPA 2BXTH 1LHFH 1UTJA 2BDYA 1YPHE 6LPRA 4ABBA 3NKKA 2QXGA 4K60A 1EJNA 2J34A 1S5SA 1FMGA 2GV7A 1RTFB 3VB5A 3QO6A 2FOMB 3SU4A 3UWJH 1WV7H 2BDAA 4I8LA 1W13U 1ZMLA 3SN8A 1AB9B 2ZDLA 3GY2A 4WJG2 5EXNA 5FPYA 1HAYB 1KIGH 5FBEA 3U8RH 2SFAA 1CO7E 1Z7KA 3MH4A 4FUJA 2QXHA 1UCYE 1BOQA 3A86A 1A46H 1C2JA 3TGIE 2J2UA 2G5VA 1BCUH 2V35A 1O35A 1T4UH 1EB2A 4Y79A 5GPIB 3RUOA 4X8SH 1NROH 3RP2A 1UTKA 1O39A 1FPCH 1JXPA 3OX7U 3QLPH 3V13A 1VJ9U 1MU6B 2A1DB 1HIAA 1QRZA 5DP6A 2BY6X 2H5DA 4Y7BA 1NTPA 1O2XA 2W5EA 1A2CH 1UJ1A 4B2AA 1GGDB 4OGYA 3PLBA 3KHVA 1AVGH 3SZNA 3FP7E 2ZQ2A 1BBRE 1NRRH 3FVFB 3ZZ4A 1C5QA 3ATLA 2A7JA 2ZFFH 2KAIB 1HPGA 4Y8XA 4B73A 1N8OB 5EXLA 1QL9A 3ZZ5A 2G52A 2R2WU 2B9LA 3HATH 2PLXA 1VJAU 1QL8A 1EAWA 2BY8X 1TMBH 3SUEA 1GDUA 2AH4X 1W2KH 1V2KT 5DK1A 1EPTC 5K7RA 2J94A 4NG9H 4YT7H 1DT2A 1GPZA 4JZEH 2C4FH 1BZXE 2FEQH 5E0HA 1C5TA 1NRPH 4IC5A 1T31A 4A5TS 1ABIH 1ANEA 4D7GA 2QN5T 4B1TA 1V2WT 4OS7A 1UK2A 3SU3A 3A8DA 5EGMA 2FYRA 1BTUA 3UR6A 3URDA 1NC6A 2OBQA 3LJOA 3U1JB 2AYWA 3K2UA 1CGJE 2VIWA 1TNHA 1GBHA 2CHAC 2STAE 2XRCA 4X0WU 4O3TA 1GI2A 1M9UA 1NU7B 1ZRBA 3ZYDA 1BRAA 1SLWB 2ANMH 1OWEA 2H1UA 5E2OA 1G3DA 2H2ZA 1O38A 2BQ7B 1D6WA 1XM1A 2ZDVH 3ZVCA 5JPMH 2VIPA 4JZFH 3LGTA 3T27A 1AVXA 2QAAA 4X2WA 3ZZ7A 1K2I1 4LK4A 2CV3A 2FS9A 1CGHA 1AE8H 4WMDA 2C90B 3SGBE 3NK8A 1NFYA 3ZZCA 2G00A 1MBMA 3MO6A 4ABEA 5ABWA 1SGTA 4MG3A 1BTZA 2ZFQH 3MO3A 3SORA 2ZDAH 2OQUA 3ZZ8A 2BMGB 3A81A 3Q00A 1TOCB 3MH7A 4E7NA 2AMDA 1INCA 4X2XA 1GBFA 5GCHF 2AGGX 2UWPA 1ZTJA 3F9HA 2NU4E 1MMJN 2RA3A 2C93B 4Y6DA 1O34A 1OWIA 3ZZDA 1YBWA 1GMHG 1T8NA 3A85A 1DICA 1GL1A 2Z9LA 1CA8B 2VVCA 3RXQA 1TONA 2HWLB 3M7UA 3GY7A 3VEQB 2HVXA 1P0SH 1Q31A 4BOHA 2PV9B 4INHA 2ZFPH 4Z0KA 5SGAE 1DITH 5FXLA 2XBYA 4ISHH 1TX6A 1WCZA 1F5KU 3QZRA 4NCYA 2VVUA 5ESBA 4WVPE 1FZZA 5TJXA 2F9VA 1QB6A 1FDPA 1SFQB 2FI4E 2Z9JA 1FLEE 1GJ5H 3ZZBA 1HAOH 1PFXC 3RXCA 2FOHA 2G81E 4ZXXH 1RGQA 1UMAH 3I29A 3ELAH 3T5FH 1V2TT 4MNYA 5A0BA 2A4GA 4YOJA 1NZQH 4WMEA 3T2NA 1C1QA 3BEUA 4UFDH 3BEIB 1NRSH 1A0HB 1MTUA 4FXGH 3FFGA 4CRFA 3KQEA 4BAMB 2OQ5A 1FNIA 3HK6B 4NIYA 2QF3A 1MTNB 2FX4A 1QRWA 4Y11E 1ZMJA 4ASHA 3G01A 2ZECA 4NZQA 3AAVA 3PTBA 5DGJA 1YKTA 3PLPA 1S81A 3IWMA 1FY1A 1TE0A 2SGEE 1EKBB 1Y3WA 2ZWLH 3VB6A 4DURA 5DG6A 4X6NA 2D8WA 1CBWB 1MKWH 4CRDA 3TLOA 4ABDA 4K1TA 3TK5A 3S9CA 1QB1A 4RN6A 1PJPA 1DM4B 3TGKE 5FBIA 3BG4C 1ZSLA 2BD9A 5HXFA 4MPWA 1KY9A 3PO1C 1BUIA 1V2UT 2FO9A 1JWTA 2A45B 1C1RA 1Z8RA 1DANH 1UVTH 2W3KA 3DHKH 3R3GB 4WF8A 4D8NA 1VITG 2ASUB 3MMGA 4PROA 1K1PA 1V2MT 4H6TA 1GBJA 4ESTE 1SLXB 4WXIA 3KQDA 5FCRA 3PWBA 1THPB 3SHAH 2UUKB 2QXJA 4GCHG 2Z3DA 1O5GH 4I7YH 4A6LA 2FM2A 7GCHG 4INLA 2F9OA 2J38A 1JMOH 1B0EA 3A7WA 3NUMA 1THRH 5GDSH 2WUCA 1GHAF 5F8TA 4K5ZA 1KXAA 4X2YA 1TA2A 1O5DH 2FI5E 2SGPE 1YPEH 3RXPA 1ZHMA 1YF4A 1GJ9B 3RXKA 3KL6A 2ZGBH 5FCKA 2P3TB 1Y3XA 4CBOA 2XBWA 2PGBB 4HGCA 4DT7B 3BTGE 2M5TA 4BAQB 1IQGA 2AMPA 3RLYH 3RXAA 5BRRE 1DDJA 1AB9C 1QY6A 1CVWH 1T8MA 1SQTA 3FAOA 3TU7H 1IQJA 1O2JA 1P10A 2XCFA 1FXYA 3MNSA 3ATWA 1LKAA 4BXSA 9ESTA 1TNGA 4XBBA 1O2RA 1Y8TA 2XC4A 2Q1JA 3M5MA 2FYQA 2PFEA 1QHRB 2GMTC 1EOLA 1BRBE 1T8OA 3KCGH 5PTPA 5AHGH 2ZU4A 3PMHB 2ANWA 3A87A 1QR3E 2R3YA 3ZVAA 1DWEH 4AG1A 1PYTD 2TGTA 1SGDE 2H9TH 1DWCH 2TGPZ 1YYY1 1YCPK 1J14A 1DLKB 1O3DA 1O2PA 2R3UA 2Y5FA 3R0FA 2SGDE 2D2DA 1LVYA 3URCA 3ODFA 1D4PB 1RD3B 2VIOA 1AY6H 3HGNA 2JETB 4GUXA 1T7CA 1TPSA 2ZU3A 4KTCA 2LPRA 2WV5A 3ZVGA 1LQDB 1AE5A 3AAUA 1W7XH 1IQNA 2AS9A 1O2MA 2ALVA 4FVBA 4A7IB 3P17H 1EZSC 4DJZB 2J95A 4FUEA 4AB9A 1CHGA 1G36A 1C1VH 4UE7H 5JYIA 3ZV8A 4KTSA 1SGYE 2IN2A 2XYAA 1UTMA 4ZUHA 3HKIB 1U6QA 1C2KA 1TGBA 4R8TB 1OWDA 2Z3CA 1BMNH 3GY5A 1P11E 3M61U 1EATA 4JYUH 5EPYA 3SW2B 1SGPE 1BMLA 2FPZA 4UEHH 4H4FA 3SV6A 2FWWA 4A1XA 1GI8B 4MPXA 1O3IA 5A0CA 3TH2H 1O3EA 1MCTA 4B76A 3GCTF 1IOEA 1N6YA 2BLQA 4BTUB 3CP7A 1DSTA 2IPHA 2NU0E 4ZXYH 3OY6U 4JCNA 3F9EA 1W0YH 3TVJB 3SU0A 3M36A 4IC6A 1GJ6A 2F9PA 4NIVA 1O2QA 5EODA 1RJXB 1MAYA 3A82A 2SGFE 1K28D 1SGQE 2OP9A 3D65E 4FUCA 1P3CA 2C8YB 3V0XA 3O8CA 1LCYA 3QWCH 2J92A 3SGAE 2F91A 1ZTKA 2ZHDA 2ZCLP 3RU4E 1GI1A 1TALA 2VGCB 2HGTH 3RM2H 5C20A 5IDKA 1ELEE 3BSQA 3M3SA 1L4ZA 2P3UB 1IQEA 1DOJA 2LNCA 4XBDA 1F5RA 4IW4E 4NFEA 1C1UH 1A7SA 5JBCS 2HLCA 4ABGA 1QJ6B 2QC2A 5GJ4B 3O8BA 1TQ0B 1TB6H 5GWZA 2XXLA 4XFQA 7ESTE 1A5IA 1PPZA 2HNTE 1LPZB 1LVOA 1MTVA 1SLVB 5CHAB 1TRYA 4BXWA 1OOKB 1WUNH 2BD3A 1GJBB 3TIUA 4I32A 3SJ9A 1AO5A 1E36B 1V2OT 4Q7ZA 4U30A 1DLEA 3TNTA 4CREA 2Y81A 5LPEA 4LOYH 1UTOA 4UDWH 5FX6A 7KMEH 1PQ5A 1GBTA 2WPHS 3LONA 4KELA 3HK3B 1DFPA 3BTDE 4UFFH 4X1SU 1FY3A 1HGTH 1CQQA 3RXFA 4CR5A 1KXDA 2EI6A 2CMYA 1HXEH 1FY8E 1XVOA 3S0NA 5T6DA 1BHXF 1GHYH 4E7RG 1ELVA 1OP2A 3S9BA 2Q6FA 2W3IA 4OS5A 1FY4A 1QQUA 1SR5C 3JZ2B 4VGCC 2BQ6B 1F0SA 2TGDA 1V2JT 2QF0A 4K3JA 5LPRA 3D49H 1YPHC 1QA7A 2Y6TA 3UNQA 1Y59T 1N6XA 3A8CA 1MKXH 2FIRH 2BY9X 1LQEA 4BNRA 2GVFA 1E37B 1TRMA 2ZPRA 1E38B 1VGCB 4E05H 3M5OA 1K9OE 4DCDA 2BM2A 3TNSA 3Q77A 4ZKSU 4I33A 5EOKA 3RMMH 5GIBA 3LU9B 1ANCA 3SV7A 1UK4A 3PV4A 2F9NA 2XBVA 2PUQH 3MFJA 2XW9A 3RXEA 1DY9A 4NA9H 2BD2A 1KLJH 2BHGA 2ZU2A 4GPGA 3STJA 1QIXB 4D9RA 1KXEA 3S9AA 2EA3A 3H5CB 2BD8A 4IMZA 2G5NA 1UO6A 1QFKH 3D23A 1L1GA 4HI3A 2Z9GA 1O5AB 1GBEA 2A5KA 1HAPH 1O2YA 2BTCE 3P70B 1QBOA 3OU0A 2P8OB 3O8DA 4DVAU 3SJ8A 3VPKA 4UD9H 2A4OA 1NPMA 1K1MA 1YLCA 1IHSH 1P03A 5C5OA 2A5IA 1TPPA 3EQ0H 1TGTA 1YLDA 5C1UA 2ZPSA 3SV9A
chains in the Genus database with same CATH superfamily
5L2ZH 4Q2KA 5L6NH 2F83A 1A5HA 1GCTC 2PP6A 1X7AC 3AVZA 2CF9H 3M37A 2ZFRH 1YPKH 1P9UA 4FU7A 1XUFA 5T6FA 2DE9A 2F3CE 3LGIA 2YMSB 1C5XB 3SJKA 1H8HD 1V2NT 4H6SB 2B7DH 2H9HA 8KME2 2ZGXH 4ABIA 3LGWA 2VWOA 1O5BB 1MTWA 2ZDMA 1SGEE 1C5PA 4HZHA 2ZP0H 1C2MA 1O36A 5T6GA 2GGVB 1OYQA 2CF8H 5TCCA 1TWXB 4FU9A 5FX5A 1GJ4H 1ZSKA 3QUMP 1T32A 4MNXA 4WWYA 3N7DA 2ESTE 5DKMA 3E90B 2QIQA 3NWUA 2V0BA 4YTAA 3RM0H 4X1NU 3F0PA 4NWKA 2BZ6H 2ZGHA 1GBBA 1ETRH 3GY3A 1C4V2 1FX0B 3SJIA 3Q3YA 1GI9B 2A7CA 2ZCKP 1DUEA 1S84A 2Z7FE 1GI5A 2ZHEH 1ARCA 2C8WB 2O8LA 2PW8H 1FPHH 3PRBA 1EXFA 1EJMA 1C2LA 1ZGIA 3UNSA 1W12U 3EA8A 1ZRKA 4MNVA 3SNEA 2AMQA 1PQAA 3V12A 1EJAA 4LZ1H 3ESTA 5GCHG 2EQNA 1A0LA 3ZVDA 1VCWA 3BG8A 3ENSB 1TNLA 3A89A 4TPIZ 2FOFA 3RXTA 1NN6A 1TQ7B 3QN7A 2C8XB 1P2IA 3GCHC 3H7TA 5TCAA 4DGJA 2WUBA 4UONA 4K1EA 3EE7A 1IQKA 1QURH 2AIPA 2AEIH 2BLVA 1SSXA 3SUDA 4AFSA 2EI7A 2GZ9A 1WU1A 5CHBA 3U8TH 1NY22 3ZVEA 3RXOA 2Y80A 3Q3XA 2TRMA 2JETC 2ZIQH 5F03A 4TPYA 4AB8A 1H9LB 4Z6AH 5FAHA 4Y0YE 3F0OA 3TJUA 1O37A 1OP8A 4OGXA 3EYDA 1ANBA 1FY5A 3I78A 1LKBA 2A32A 2WYJA 5C67A 1O30A 1HFDA 1CE5A 2PKSB 1W14U 1AWHB 2A4RA 3LOXA 1ABJH 3MU5A 1PPCE 2G4TA 4Y76A 1TNJA 3GYMA 1C5NH 2VH6A 3HPTB 4CRGA 2ZO3H 4AORA 1DVAH 4NSVA 5ETXA 2BVXH 2GTBA 1CHOF 3U9AH 3E3TA 1C5SA 1WDIA 2AHME 2BDBA 3SU5A 2ZC9H 1EASA 2YOLA 3FZDA 3LC5A 1S6HA 1SI5H 2G8TA 4IN2A 4U2WA 3E16B 2JKHA 4B2BA 1BRCE 1Z8IB 3GY4A 4OS4A 4RKJB 1NM6A 1W8BH 1BHXB 2KCYA 1J15A 1GBCA 1TPOA 3ITIA 1NS3A 1ZPBA 1MD7A 3AW1A 1TGSZ 4I8JA 4D76A 4RSPA 1GHXH 5T3HA 1TRNA 1H1BA 3RXHA 1LMWB 3RXIA 4AGJA 1LHEH 4TY6A 2D1JA 2I6QA 2ZDNA 2HOBA 1Q2WA 2ZU1A 2B0FA 1GDNA 2ZNKH 1IQHA 1J17T 1HJAC 4ABHA 1FI8A 1K1NA 1OX1A 2FOBA 4TYDA 4YESB 4ABJA 1GG6B 2GCTB 1VCQA 3E6PH 3U1IB 1AD8H 3KGPA 3CS7A 4NZLA 5EJZA 2SGQE 1DWBH 4JK6A 2GP9B 5E2PA 2VGCC 3KNXA 1GHVH 1W0ZU 4AX9H 1HJ9A 2PWXA 2BDGA 1D6RA 4UFEH 1ELTA 1GJ8B 3RXGA 3C1KA 1SL3A 2Z94A 4FUHA 1C1SA 2LELA 1C1WH 5GXPA 1G32B 1OWKA 3K9XB 2G4UA 2FESH 1O32A 3F1SB 1SG8B 2BDIA 4NA8A 3SU6A 1KMHB 4E06H 3BTEE 2NU1E 3S7HB 4TWWA 2XCNA 2VIQA 4ZH8A 1GHAG 1KXBA 1W10U 2TPIZ 3T26A 1LPKB 4JZDH 4AG2A 1C1OA 3BTHE 3BN9A 1DE7H 2OUAA 4JZIA 1GJCB 1O2SA 3QDZB 1GBIA 1P3EA 1D3TB 1YPLH 3LJJA 3UQOA 1D9IA 1YCPH 1TX8A 5HYOA 4ZKNU 1TBRH 1WOFA 1O3OA 4BAOB 1O2ZA 4ZHLU 5IK2D 2RDLA 1EOJA 1ZPCA 3RXRA 5JB8S 1A5GH 1KLIH 1ZLRA 1F0TA 2GZ7A 2XC0A 3BV9B 4YOIA 4BAKB 6GCHF 1OXGA 3PYHA 4H42U 1AKSA 4X8TH 3GDUA 1QJ1B 1F92A 3GCOA 1KSNA 3SQEE 3LIWA 3KYGA 3E0NB 4IMQA 1UVUH 1K1IA 1P2QA 2UUYA 3B9FH 1C1PA 2ZHQH 3Q76A 1OP0A 1SGIB 1TLDA 2OTVA 4B74A 2OLGA 1UHBA 1C5ZB 1RS0A 3VB7A 2R9PA 5A09A 2ZHFH 3PB1E 1MBQA 2Z9IA 2PKAA 4CR9A 1SB1H 1YPGH 1Y5BT 5DPAA 3UOPA 2Y5GA 3K6YA 1ZZZA 3DT0H 5F6MA 1GMDF 3V3MA 2OC8A 1YM0A 4B75A 2IJOB 2V3OH 2F4LA 1H8IH 2BY7X 2VIDA 3UUZA 5CMXH 1SVPA 1DXWA 1UCYK 2AIQA 2FODA 1SBWA 3RU4D 4P00A 2PGQB 1KDQA 1O3GA 1YPMH 1P57B 1XUIA 3RC6A 2UWLA 2FP7B 2FXRA 4MQAA 3OSYA 1XUGA 3AW0A 1O31A 1F0RA 1TAWA 1DSUA 2V3MA 1BTHH 2GCHF 3MH5A 5HM2A 1Z8JB 4ABAA 4X6MA 4ISLA 1ZGVA 1QGFA 5BPEA 2V3HH 3NPSA 2OINA 4GHTA 3WY8A 8GCHF 1AFQB 5HMAA 1GGDC 3FP8E 3K6ZA 1BBRK 2UWOA 1GVKB 2A31A 1C5RA 4Y71A 2RDEA 3QGJA 4AYYB 3DD2H 3QX5H 1TBZH 3A80A 3SU2A 4ZKOU 3F9GA 4QT8C 2GT8A 3BEFB 2YNAA 2VWLA 2EC9H 2P16A 2ZTYA 5AF9H 5JDUB 3GCNA 3CS0A 1KTSB 1A0JA 1BTWA 1G2LA 1N8OC 3MNBA 1GBMA 4NA7A 1F0UA 2BLOA 2D26C 3VB3A 4JZ1A 4WMFA 1BTYA 3GDSA 2NU3E 2Y7ZA 3LGYA 1K1LA 1QL7A 4FUBA 2VJ1A 1QQ4A 1SGCA 2KCOA 2JH5D 2FOEA 1EAUA 1FJSA 1E79D 2A4QA 3F3BA 2ZEBA 1G9IE 1DPOA 2ZU5A 1LO6A 2O8MA 3TJOA 3OTJE 2QYIA 1CSOE 1P02A 4GVUA 4YO9A 1IQMA 1AHTH 2HPPH 2BX4A 4IBLH 1TOMH 2H9EH 3P6ZB 3SO3A 3RMLH 5A8YA 1YLNA 2BDCA 2Q6GA 4WH8A 1MQ5A 1FIZA 1DX5M 5C5NA 1FAXA 1HDTH 1OSSA 4GHQA 1P04A 2H5CA 4KKDA 1S85A 5DP7A 3TH3H 1BDAA 3MO9A 3A8AA 4J1YA 2PUXB 1FIWA 1F5LA 3RDZA 2PSXA 1BT7A 3EA7A 3RXSA 1VZQH 1V2LT 1O3FA 1AU8A 1J16A 4YT6H 1HAVB 3KQCA 1HAHH 3GS9A 1H9IE 2CN0H 3MU1A 1GMCF 2VNTA 4MDSA 1RXPA 4GSOA 2JH6D 4O9VA 3RU4T 3TJNA 3UR9A 2FZZA 2VH0A 1DWDH 1NRQH 1NT1A 3PTNA 3VXEH 3M5LA 3STIA 3MU4A 1GI3A 1HLTH 2FX6A 4M7GA 3TJVA 3ZZ6A 5DP3A 2GT7A 1A3EH 3ZVFA 4AFQA 2WYGA 3SU1A 1PPGE 3UIRA 3S69A 5B6OA 4XDEA 4CH8B 4AZ2B 3MU8A 1O5EH 5L30H 2BB4A 1YCPM 4XRNA 2ZA5A 1FQ3A 2VIVA 1C5OH 4OS1A 1Z1IA 1Z6EA 3SV8A 1RFNA 5C0TA 1JBUH 4Y7AA 3MNCA 4JMYA 3A88A 1ETTH 1GI4A 1S0RA 1G2MA 5F8ZA 2HNTC 3SBKA 1E34B 1O3CA 3FP6E 1C2IA 2O8TA 1C1MA 2FLBH 3VFEA 2RG3A 1N1LA 4K8BA 5JBAS 3O8RA 3PWCA 3SHCH 1MCVA 1OWHA 3QTVH 4YLUA 1PYTC 4XBCA 2XNDD 4Y8ZA 4DIIH 1KXCA 2A5AA 2ANKH 2FI3E 1BITA 1TMTH 3Q3KA 3VB4A 4F49A 4FUDA 3GY8A 5DJ7A 1TNIA 1ETSH 3F9FA 4NIXA 1GBLA 1AWFH 3FZZA 1EZXC 2P94A 5A2MH 1BA8B 4FETA 1LHCH 3M3VA 2BQWB 5EQSA 3ZIAD 1D3QB 1LTOA 3BF6H 3A7TA 3UFAA 1O2HA 4LXBH 4XSKU 2FTMA 1ZMNA 2WV9A 3ZVBA 2FLRH 2ZTZA 1EP6A 3PO1B 1AGJA 2AFQB 2Y7XA 5HIYA 1WBGB 2ZDKA 3DSOA 4NSYA 2SGAA 3OEHD 1EQ9A 4AN7A 2PTNA 1OYTH 3ODDA 1VITH 1GG6C 2GCTC 3MI4A 4K2YA 3SNCA 4ACBA 1TX7A 2WZQA 5T1VA 3T28A 1ZJDA 4CRCA 4BTTB 1AKSB 5LPFA 3HGPA 2O8UA 4CRAA 4ZMAH 5C2ZA 1MTNC 1CT4E 2JIZD 2GDEH 1GHBF 1PQ8A 4HTCH 1AUJA 3P8FA 3EDXB 1L1JA 1O33A 1SHYA 5F8XA 3ZZ3A 4O03A 4SGBE 2CK3D 3FO8D 3LGUA 2UUFB 2ALPA 1AZ8A 1O3NA 1E1RD 4M9FA 8LPRA 1RTKA 5A0AE 1V2RT 1GDQA 1UHBB 1TA6A 3TPIZ 1L1NA 1XKBC 2HPQH 3T62A 3U69H 3LDXH 1CBWC 3U98H 2ULLA 2PKAB 3UWIA 1BMMH 1NRNH 4WY3A 3RC4A 4NIWA 4Y0ZE 4U32A 1IQFA 3UQVA 1GBKA 1FV9A 3NCLA 1C2FA 3N7OA 1WAYB 1EZUC 1EAXA 1HAIH 2J4IA 2Q6DA 4O3UA 1KDQB 4GAWA 1T8LA 2A2XH 3A8BA 1OPHB 1ZTLA 2QGRA 1BJUA 2A7HA 2TIOA 5DP4A 1SPJA 1SGFG 4ISOA 4U01A 4IGDA 4YZUA 1GI6A 5EXMA 1RTLA 1K1JA 1XXDA 1LHDH 1G3BA 5LGOA 1GJDB 4F4OC 1WYKA 1ELAA 4B2CA 1AIXH 2NWNA 1QRXA 3V7TA 2GMTB 4AC9A 1B5GH 3C27B 1SGFA 2KZ4A 4A1TA 1L0ZA 1OWJA 1TNKA 3SNDA 1HUTH 2W7SA 1SGNE 5DSFA 5EPNA 1SLUB 1YGCH 2RA0A 2AGEX 3SNBA 3CNRA 1QNJA 2OC1A 2QF4A 1CGIE 4K8YA 2XTTB 4B71A 1O2WA 1UVPA 1Y3UA 1HXFH 1V2VT 2FTLE 3N99A 4ISIH 4XE4A 5HM9A 4CHAB 2P3FH 4I8GA 2ZI2H 1GBDA 1TPAE 1ZR0A 1EPTA 2P95A 3VXFH 2GV6A 3BTME 5C3NA 1NO9H 1UTPA 4OS2A 1A1RA 1GI0A 1C5YB 2Y5HA 4DY7B 3PMBB 5LH8A 1EAIA 1BTXA 1EP5A 1G3EA 4I31A 1O2TA 1O3MA 3KQ5A 2WPIS 5A8ZA 1BB0B 5C17A 1DS2E 1MH0A 1T4VH 3ATKA 3LC3A 4FVDA 4MPUA 3ZV9A 2WPKS 5K0HA 1AN1E 5JBTA 1BIOA 1MKXK 3VGCB 1P2KA 4KTUA 3GOVB 1UTLM 1SHHB 1V2QT 3GDVA 4K69A 1ELBA 1C9PA 1CU1A 2Z6BD 2ZKSA 1LHGH 1YP9A 2FDAA 3A7ZA 3GISB 1TFXA 1HBTH 4ZHAA 1KTTB 3EGKH 3NXPA 6CHAB 4LZ4B 1AFQC 1GJAB 3DUXH 5EW1H 1QBNA 1Y5AT 1OHHD 4XOJA 3M7QA 2KM0A 4Y10E 1CHOG 4DOQA 4P02A 1P05A 4WXVA 1F7ZA 2G55A 4TSFD 1TMUH 4BTIB 1GHWH 1LPGB 4ASUD 3OTPA 3SV2H 5I46H 4KGAA 4FUGA 2BZAA 1C4U2 3BTKE 1CA0B 3RXUA 2BVSH 2AERH 3PMJA 4I8KA 4JYTA 5A8XA 2VWNA 5DP9A 2HRVA 2A2QH 2F9BH 1ZYOA 1O2LA 2RCEA 1PPFE 1AMHA 1L2EA 1WTGH 1EUFA 1HYLA 5EQQA 1S83A 4MTBA 2UUJB 4YM9A 2Z3EA 2ZQ1A 1Q3XA 3UNRA 2ZHWH 4A92A 3TK9A 1XUJA 4WH6A 2OD3B 1HJ8A 1HAVA 1C5VA 1O2OA 1P2MA 3MNXA 2EEKA 1MU8B 4Y8YA 1WXRA 3BTQE 1MZDA 3UPEA 1S0QA 1C1TA 3D62A 1G30B 1GCDA 4UFGH 3M3TA 1S6LA 3ATMA 3GYLB 2WV4A 2VWMA 4R0IA 3SUGA 2BOKA 3W95A 3RXDA 1QTFA 1FUJA 1GHZA 1JRSA 1ELCA 3EE0B 1WQVH 1MZAA 4TWYA 4CRBA 5E0GA 4GLYA 7LPRA 1SFIA 1P06A 3KEEA 4INKA 3RMNH 5F53A 1O3KA 1FN6A 4X1QU 2P59A 2BD4A 1K1OA 4OS6A 1XVMA 2PTCE 3P8GA 4ABFA 1FAKH 3BTWE 3FKSD 1RIWB 1ELFA 3MTYA 3SZEA 2RFKC 1E1QD 1O3LA 4DW2U 1TGNA 1WTHD 3MHWU 1P2JA 2J9NA 4DT4A 5J4QA 1UCYH 3FANA 6ESTA 3WW7A 1PPHE 2I6SA 2O8WA 3BTTE 3TK6A 4VGCB 1TIOA 1ESAA 1Z8GA 6GCHG 1MABB 2F9UA 4IS5A 5E0JA 3P92A 4X2VA 5KECA 1AZZA 1XUHA 1W7GH 5EW2H 5EJLA 1H8ED 2K1QA 1ZPZA 3WWFA 1HAZB 4X1PU 3PV5A 1B7XB 2NU2E 5ESTE 3A7VA 5I25A 2CXVA 1O2IA 3OY5U 2QXIA 1C2DA 3SQHE 1GMHF 1HV7A 3JZ1B 1LDTT 1IQIA 3P8NA 3T25A 8ESTE 3A83A 5FPSA 1H9HE 1O3PB 1P2OA 3TGJE 1HAGE 1ACBE 5CHAC 1Z71A 4Q80A 1Y5UT 4NWLA 3KIDU 1EX3A 5KEDA 4AFUA 1WQSA 1BBRH 4K1SA 1ID5H 4MLFB 1XXFA 1C1NA 2STBE 5G4BA 1W3CA 1GMDG 4Q7XA 3L6PA 4FUIA 2Y82A 3UOUA 2W26A 1V6DA 3I77A 1SMFE 3ZZAA 3SI4H 2GDDA 3F6UH 3S7KB 1P09A 4AOQA 1BRUP 1K22H 3L33A 3U28C 1D3DB 2P93A 3DFJA 1O0DH 2C3SA 2ANYA 3RXVA 2ZCHP 1A3BH 5E8EH 3LKWA 3TH4H 1CT0E 3PM3A 3PLKA 1XMNB 2CJIA 1AVWA 2ODQA 5DP8A 3RXLA 3UY9A 4KP0A 1QCPA 2GCHG 3SUFA 1P9SA 4Q7YA 2YNBA 1O3HA 1GVZA 5J4SA 4ISNA 3DSPA 2ILNA 2ZZUH 1LVMA 5L2YH 2OBOA 3E0PB 1GCTB 3QTOH 3AASA 8GCHG 3FOAA 1PPEE 1VGCC 2SNVA 1HIAB 3PROA 1YY3A 1BQYA 3FN8A 1HNEE 1ZOMA 2CGAA 1KYNA 5CE1A 3CENA 3IG6B 3H09A 1ZHRA 5AFYH 2PHBA 3LPRA 2ZFTA 1DUAA 2BDHA 3MYWA 2GX4A 1TGCA 4X8UH 4BAHB 3HKJB 1EFRD 3NZIA 1A61H 4OM9A 1C4Y2 1YPJH 1EZQA 1P2NA 3KQBA 1NU9A 1MQ6A 2WPLS 1MTSA 2WPMS 1ELDE 2FOAA 2R0KA 1ZJKA 1VITF 2VB0A 1SOZA 2HALA 2EI8A 4JYVH 1EPTB 4NFFA 4RKOB 1Z6JH 2ZFSA 2JH0D 2P8OC 1C5LH 1YWUA 1O2UA 3B8JA 2BYAX 4AYVB 2FOCA 2ZGJA 1GJ7B 1ANDA 4MPVA 1HB0B 4GCHF 3UREA 7GCHF 1O2GH 3PV2A 2OC0A 1PQ7A 1P01A 3H7OA 4J2YB 2ZTXA 1GL0E 4ZROA 4BANB 3MU0A 2OXSA 1S82A 2HVYB 3RXJA 5DO4H 1HRTH 1SQAA 1ESTA 1MKWK 2R2MB 3K65B 1BMAA 1ZHPA 2ZG0H 2BD7A 4DIHH 1O2KA 2CHAB 2ODYB 2KAIA 3F2HA 3QGNB 5DP5A 1NFXA 1NFWA 1O3BA 2YMSC 1L4DA 2WINI 3ZYEA 3RXBA 2GD4B 2TBSA 1THSH 3EA9A 3W94A 4DG4A 3GCTG 1ESBA 1KXFA 1O5FH 1C9TA 2BD5A 4ZHMU 3GCHB 2Z9KA 3F68H 1CT2E 1FN8A 1K21H 3P95A 1YC0A 1IQLA 2XWBI 4D7FA 1MD8A 2BLWA 4X8VH 1BJVA 1G37A 1ELGA 1GMCG 1LVBA 1AFEH 1MUEB 4CHAC 1QBVH 1AQ7A 1JIRA 1XKAC 4FU8A 1AI8H 5JB9S 1J9CH 1SGRE 1E0FD 1O3AA 4Q4LA 4A1VA 4I8HA 1GBAA 1UVSH 2VINA 3A84A 3M7TA 5C1XA 1TABE 2A0QB 3RC5A 3GICB 1V2ST 2IPQX 3LH3A 1HAXB 1SQOA 4HFPB 2FS8A 1IAUA 5H4IB 2TGAA 4HG6A 3A7XA 1GI7B 3EAJA 4FUFA 2ZGCA 2O9QA 1RRKA 3QZQA 3VGCC 2PSYA 1A4WH 1PPBH 4CBNA 1O2VA 3MWIU 3NRLA 1UTNA 5HGGA 2FMJA 3RMOH 3B23B 4ZKRU 5IYTA 1G3CA 1W0KD 1F2SE 1OS8A 5C1YA 1B0FA 1UTQA 6CHAC 3SOSA 2G51A 2BY5X 3BIVH 3E8LA 3LGVA 3BTFE 1NESE 1C5WB 3BIUH 4O97A 1Y3YA 3LT3A 5AFZH 3IITA 5FPTA 2XWAA 3PMAB 3SGQE 1XUKA 1KLTA 1GWAA 1H4WA 3OE7D 3QK1A 1BTPA 3KF2A 3RXMA 2BVRH 2HLDD 3M35A 1SC8U 1MAXA 2OC7A 2XNIA 1O3JA 3SI3H 2QY0B 1H8DH 1UVOA 3KYFA 3L3TA 1CA0C 1EB1H 2DUCA 4X1RU 1HCGA 1VKYA 1VR1H 1C2HA 1ARBA 1P12E 4ZAEA 1V3XA 2AGIX 3P8OA 3ATIA 4D9QA 1HJAB 1W11U 3E1XB 2OCVB 3E91A 1WSSH 4IN1A 3DFLA 2PKSC 2QV1A 3RLWH 2QA9E 2PR3A 2QCYA 4SGAE 3SJOA 3TITA 4YLQH 2VU8E 2GZ8A 1SQRA 4MVNA 3OYPA 1NBMD 1O2NA 2B5TB 2THFB 2BXUH 3F2GA 1ORFA 2W7UA 1OKXA 3MQKC 1D3PB 2DE8A 1FONA 2H6MA 2VVVA 1GHBG 2WPJS 2C8ZB 5EG4A 3LH1A 2FOGA 1TBQH 1ZSJA 1C2EA 2HNTF 2KCPA 2ZPQA 4AGKA 2SNWA 3N7EA 3U8OH 4JK5A 1JIMA 4XD7D 1P8VC 1UW7A 1NFUA 4YOGA 5JBBS 9LPRA 1O5CB 3MOCA 3A7YA 3BG4B 1Z1JA 1QA0A 1C5MD 1DY8A 1TYNA 2XBXA 1JRTA 1V2PT 2BOHB 2IOTA 4TY7A 2KFWA 3ZZ9A 5FHTA 4X6PA 4THNH 1QB9A 3M5NA 4NGAH 1GVLA 1RIWC 2QF5A 1C5UA 5AVDA 1XX9A 5EU8A 2ZF0H 2BX3A 5B6LA 4CH2B 2K0QA 4MNWA 4FOUC 1S6FA 2V7QD 3GY6A 1AUTC 3KN2A 3SYJA 2XC5A 1E35B 5EQRA 2V6NA 1C2GA 4AFZA 4X6OA 1J8AA 1IHTH 2ODPA 2GKVE 3UTUH 2B8OH 1JOUB 1QJ7B 3DA9B 3OAAD 2R0LA 1VCPA 1UK3A 1Y3VA 3MH6A 3T29A 1SOTA 3SNAA 1DXPA 2BXTH 1LHFH 1UTJA 2BDYA 1YPHE 6LPRA 4ABBA 3NKKA 2QXGA 4K60A 1EJNA 2J34A 1S5SA 1FMGA 2GV7A 1BMFD 1RTFB 3VB5A 3QO6A 2FOMB 3SU4A 3UWJH 1WV7H 2BDAA 4I8LA 1W13U 1ZMLA 3SN8A 1AB9B 2ZDLA 3GY2A 4WJG2 5EXNA 5FPYA 1HAYB 1KIGH 5FBEA 3U8RH 2SFAA 1CO7E 1Z7KA 3MH4A 4FUJA 2QXHA 1UCYE 1BOQA 3A86A 1A46H 1C2JA 3TGIE 2J2UA 2L74A 2G5VA 1BCUH 2V35A 1O35A 1T4UH 1EB2A 4Y79A 5GPIB 3RUOA 4X8SH 1NROH 3RP2A 1UTKA 1O39A 1FPCH 1JXPA 3OX7U 3QLPH 3V13A 1VJ9U 1MU6B 2A1DB 1HIAA 1QRZA 5DP6A 2BY6X 2H5DA 4Y7BA 5EIYA 1NTPA 1O2XA 2W5EA 1A2CH 1UJ1A 4B2AA 1GGDB 4OGYA 3PLBA 3KHVA 1AVGH 3SZNA 3FP7E 2ZQ2A 1BBRE 1NRRH 3DCLA 3FVFB 1C5QA 3ZZ4A 3ATLA 1NBME 2A7JA 2ZFFH 4Z1MD 2LP6A 2KAIB 1HPGA 2IJD1 2JDID 4Y8XA 4B73A 1N8OB 5EXLA 1QL9A 3ZZ5A 2G52A 2R2WU 2B9LA 3HATH 2PLXA 1VJAU 1QL8A 1EAWA 2BY8X 1TMBH 3SUEA 2W6JD 1GDUA 2AH4X 2EY4C 1W2KH 1V2KT 5DK1A 1EPTC 5K7RA 5C0UA 2J94A 4NG9H 4YT7H 1DT2A 1GPZA 2KR7A 4JZEH 2C4FH 1BZXE 2FEQH 5E0HA 1C5TA 1NRPH 4IC5A 1T31A 4A5TS 1ABIH 1ANEA 4D7GA 2WPDD 2QN5T 4B1TA 1V2WT 4OS7A 1UK2A 3SU3A 3A8DA 5EGMA 2FYRA 1BTUA 3UR6A 3URDA 1NC6A 2OBQA 3LJOA 3U1JB 2AYWA 3K2UA 1CGJE 2VIWA 1TNHA 1GBHA 2CHAC 2STAE 2XRCA 4X0WU 5KGOA 4O3TA 1GI2A 1M9UA 1NU7B 1ZRBA 3ZYDA 1BRAA 1SLWB 2ANMH 1OWEA 2H1UA 5E2OA 1G3DA 2H2ZA 1O38A 2BQ7B 1D6WA 1XM1A 2ZDVH 2L6OA 3ZVCA 5JPMH 2VIPA 4JZFH 3LGTA 3T27A 1AVXA 2QAAA 4X2WA 3ZZ7A 1K2I1 4LK4A 2CV3A 2FS9A 1CGHA 1AE8H 4WMDA 2C90B 3SGBE 4Q63A 5HIZA 3NK8A 5EJ1A 1NFYA 3ZZCA 2G00A 1MBMA 3MO6A 4ABEA 5ABWA 1SGTA 4MG3A 1BTZA 2ZFQH 3MO3A 3SORA 2ZDAH 2OQUA 3ZZ8A 2BMGB 3A81A 3Q00A 1TOCB 3MH7A 4E7NA 2AMDA 1INCA 4X2XA 1GBFA 5DN6D 5GCHF 2AGGX 2UWPA 5FL7D 1ZTJA 3F9HA 2NU4E 1MMJN 2RA3A 2C93B 4Y6DA 1O34A 1OWIA 3ZZDA 1YBWA 1GMHG 1T8NA 3A85A 1DICA 1GL1A 2Z9LA 1CA8B 2VVCA 3RXQA 1TONA 2HWLB 3M7UA 3GY7A 3VEQB 2HVXA 1P0SH 1Q31A 4BOHA 2PV9B 4INHA 2ZFPH 4Z0KA 5SGAE 1DITH 5FXLA 2XBYA 4ISHH 1TX6A 1WCZA 1F5KU 3QZRA 4NCYA 2VVUA 5ESBA 4WVPE 2W6ID 1FZZA 5TJXA 2F9VA 1QB6A 1FDPA 1SFQB 2FI4E 2Z9JA 1FLEE 1GJ5H 3ZZBA 1HAOH 1PFXC 3RXCA 2FOHA 2G81E 4ZXXH 3VG8A 1RGQA 1UMAH 3I29A 5GNDA 3ELAH 3T5FH 1V2TT 4MNYA 5A0BA 2A4GA 4YOJA 1NZQH 4WMEA 3T2NA 1C1QA 3BEUA 4UFDH 3BEIB 1NRSH 1A0HB 1MTUA 4FXGH 3FFGA 4CRFA 3KQEA 4BAMB 2OQ5A 1FNIA 3HK6B 4NIYA 2QF3A 1MTNB 2FX4A 1W0JD 1QRWA 4Y11E 1ZMJA 4ASHA 3G01A 2ZECA 2OK5A 4NZQA 3AAVA 3PTBA 5DGJA 1YKTA 3PLPA 1S81A 3IWMA 1FY1A 1TE0A 2SGEE 1EKBB 1Y3WA 2ZWLH 3VB6A 4DURA 5DG6A 4X6NA 2D8WA 1CBWB 2YMSD 1MKWH 4CRDA 4RI0A 3TLOA 4ABDA 4K1TA 3TK5A 3S9CA 1QB1A 4RN6A 1PJPA 2JJ1D 1DM4B 3TGKE 5FBIA 3BG4C 1ZSLA 2BD9A 5HXFA 4MPWA 1KY9A 3PO1C 1BUIA 1V2UT 2FO9A 1JWTA 2A45B 1C1RA 1Z8RA 1DANH 3WWBA 1UVTH 2W3KA 3DHKH 3R3GB 4WF8A 4D8NA 1VITG 2ASUB 3MMGA 4PROA 1K1PA 1V2MT 4H6TA 1GBJA 4ESTE 4F48B 1SLXB 4WXIA 3KQDA 5FCRA 3PWBA 1THPB 3SHAH 2UUKB 2QXJA 4GCHG 2Z3DA 1O5GH 4I7YH 4A6LA 2FM2A 7GCHG 4INLA 2F9OA 2J38A 1JMOH 1B0EA 3A7WA 3NUMA 1THRH 5GDSH 2WUCA 1GHAF 4F55A 5F8TA 2KCAA 1QZ8A 4K5ZA 1KXAA 4X2YA 1TA2A 1O5DH 2FI5E 2JJ2D 1YPEH 2SGPE 3RXPA 1ZHMA 1YF4A 2J98A 1GJ9B 3RXKA 3KL6A 2J5UA 2ZGBH 2P3TB 1Y3XA 5FCKA 4CBOA 2XBWA 1SKYE 2PGBB 3UAIC 4HGCA 4DT7B 3BTGE 2M5TA 4BAQB 1IQGA 2AMPA 3RLYH 3RXAA 5BRRE 1DDJA 1AB9C 1QY6A 1CVWH 1T8MA 1SQTA 3FAOA 3TU7H 1IQJA 1O2JA 1P10A 2XCFA 1FXYA 3MNSA 3ATWA 1LKAA 4BXSA 4B6FA 9ESTA 1TNGA 4XBBA 1O2RA 1Y8TA 2XC4A 2Q1JA 3M5MA 2FYQA 2PFEA 3OEED 1QHRB 2GMTC 1EOLA 1BRBE 1T8OA 3KCGH 5PTPA 5AHGH 2ZU4A 3PMHB 2ANWA 3A87A 1QR3E 2R3YA 3ZVAA 1DWEH 4AG1A 1PYTD 2TGTA 1SGDE 2H9TH 1DWCH 2TGPZ 3DSGA 1YYY1 1YCPK 1COWD 1J14A 1DLKB 1O3DA 1O2PA 2R3UA 2Y5FA 3R0FA 2SGDE 2D2DA 1LVYA 3URCA 3ODFA 1D4PB 1RD3B 2VIOA 1AY6H 3HGNA 2JETB 4GUXA 1T7CA 1TPSA 2ZU3A 3W1EA 4KTCA 2LPRA 2WV5A 3ZVGA 1LQDB 2WHXA 1AE5A 3AAUA 1W7XH 1IQNA 2AS9A 1O2MA 2J97A 2ALVA 4FVBA 4A7IB 3P17H 1EZSC 4DJZB 2J95A 4FUEA 4AB9A 1CHGA 1G36A 1C1VH 4UE7H 5JYIA 3ZV8A 4KTSA 1K0HA 1SGYE 2IN2A 2XYAA 4YXWD 1UTMA 4ZUHA 3HKIB 1U6QA 1C2KA 2QE7D 1TGBA 4R8TB 1OWDA 2Z3CA 1BMNH 3GY5A 1P11E 3M61U 1EATA 4JYUH 5EPYA 3SW2B 3UB0A 1SGPE 1BMLA 2FPZA 4UEHH 4H4FA 3SV6A 2FWWA 4A1XA 1GI8B 4MPXA 1O3IA 5A0CA 3TH2H 1O3EA 1MCTA 4B76A 3GCTF 1IOEA 1N6YA 2BLQA 4BTUB 3CP7A 1DSTA 2IPHA 2NU0E 4ZXYH 3OY6U 4JCNA 3F9EA 1W0YH 3TVJB 3SU0A 3M36A 4IC6A 1GJ6A 2F9PA 4NIVA 1O2QA 4I86A 1RJXB 5EODA 3OFND 4RT0A 1MAYA 2WSSD 3A82A 4TT3D 2SGFE 1K28D 1SGQE 2OP9A 3D65E 4FUCA 1P3CA 2C8YB 3V0XA 3O8CA 1LCYA 3QWCH 2J92A 3SGAE 2F91A 1ZTKA 2ZHDA 2M2AA 2ZCLP 3RU4E 1GI1A 1TALA 2VGCB 2HGTH 3RM2H 5C20A 4RT1A 5IDKA 1ELEE 3BSQA 3M3SA 1L4ZA 2P3UB 4ACAA 1IQEA 1DOJA 2LNCA 4XBDA 1F5RA 4IW4E 4NFEA 1C1UH 1A7SA 5JBCS 2HLCA 4ABGA 5C94A 1QJ6B 2QC2A 5GJ4B 3O8BA 1TQ0B 1TB6H 5GWZA 2XXLA 4XFQA 7ESTE 1A5IA 1PPZA 2HNTE 1LPZB 1LVOA 1MTVA 1SLVB 5CHAB 1TRYA 4BXWA 1OOKB 1WUNH 2BD3A 1GJBB 3TIUA 4I32A 3SJ9A 1AO5A 1E36B 1V2OT 4Q7ZA 4U30A 1DLEA 3TNTA 4CREA 2Y81A 5LPEA 4LOYH 1UTOA 4UDWH 5FX6A 7KMEH 1PQ5A 1GBTA 2WPHS 3LONA 4KELA 2KX4A 3HK3B 1DFPA 3BTDE 4UFFH 4X1SU 1FY3A 1HGTH 1CQQA 3RXFA 4CR5A 1KXDA 2EI6A 2CMYA 1HXEH 1FY8E 1XVOA 3S0NA 5HKKD 2VBCA 5T6DA 1BHXF 1GHYH 4E7RG 1ELVA 1OP2A 3S9BA 2Q6FA 2W3IA 4OS5A 1FY4A 1QQUA 1SR5C 3JZ2B 4VGCC 2BQ6B 1F0SA 2TGDA 1V2JT 2QF0A 4K3JA 5LPRA 3D49H 1YPHC 1QA7A 2Y6TA 3UNQA 1Y59T 1N6XA 3A8CA 1MKXH 2FIRH 2BY9X 1LQEA 4B6EA 4BNRA 2GVFA 1E37B 1TRMA 2ZPRA 1E38B 1VGCB 4E05H 3M5OA 2XOKD 1K9OE 2F43B 4DCDA 2BM2A 3TNSA 3AK5A 3Q77A 4ZKSU 4I33A 5EOKA 3RMMH 5GIBA 3LU9B 1ANCA 3SV7A 1UK4A 3PV4A 2F9NA 2XBVA 2PUQH 3MFJA 2XW9A 3RXEA 1DY9A 4NA9H 2BD2A 1KLJH 2BHGA 2ZU2A 4GPGA 3STJA 1QIXB 4D9RA 1KXEA 2GJGA 2J98B 3S9AA 2EA3A 3H5CB 2BD8A 4IMZA 2G5NA 5CDFE 1UO6A 1QFKH 3D23A 1L1GA 4HI3A 3PRDA 2Z9GA 2K8IA 1O5AB 1GBEA 2A5KA 1HAPH 1O2YA 4ZCNA 2BTCE 3P70B 1QBOA 3OU0A 2P8OB 3F2FA 3O8DA 4DVAU 3SJ8A 3VPKA 4UD9H 2A4OA 1NPMA 1K1MA 1YLCA 1IHSH 1P03A 5C5OA 2A5IA 1TPPA 3EQ0H 1TGTA 1YLDA 5C1UA 2ZPSA 3SV9A
chains in the Genus database with same CATH topology
5L2ZH 4Q2KA 5L6NH 2F83A 1A5HA 1GCTC 1X7AC 3AVZA 2CF9H 3M37A 2ZFRH 1YPKH 1P9UA 4FU7A 1XUFA 5T6FA 2DE9A 2F3CE 3LGIA 1C5XB 3SJKA 1V2NT 4H6SB 2B7DH 2H9HA 8KME2 2ZGXH 4ABIA 3LGWA 2VWOA 1O5BB 1MTWA 2ZDMA 1SGEE 1C5PA 4HZHA 2ZP0H 1C2MA 1O36A 5T6GA 2GGVB 1OYQA 2CF8H 5TCCA 1TWXB 4FU9A 5FX5A 1GJ4H 1ZSKA 3QUMP 1T32A 4MNXA 4WWYA 2ESTE 5DKMA 3E90B 2QIQA 3NWUA 2V0BA 4YTAA 3RM0H 4X1NU 4NWKA 2BZ6H 2ZGHA 1GBBA 1ETRH 3GY3A 1C4V2 3SJIA 3Q3YA 1GI9B 2A7CA 2ZCKP 1DUEA 1S84A 2Z7FE 1GI5A 2ZHEH 1ARCA 2C8WB 2O8LA 2PW8H 1FPHH 1EXFA 1EJMA 1C2LA 1ZGIA 3UNSA 1W12U 3EA8A 1ZRKA 4MNVA 3SNEA 2AMQA 1PQAA 3V12A 1EJAA 4LZ1H 3ESTA 5GCHG 1A0LA 3ZVDA 1VCWA 3BG8A 3ENSB 1TNLA 3A89A 4TPIZ 2FOFA 3RXTA 1NN6A 1TQ7B 3QN7A 2C8XB 1P2IA 3GCHC 3H7TA 5TCAA 4DGJA 2WUBA 4UONA 4K1EA 1IQKA 1QURH 2AIPA 2AEIH 2BLVA 1SSXA 3SUDA 4AFSA 2EI7A 2GZ9A 1WU1A 3U8TH 1NY22 3ZVEA 3RXOA 2Y80A 3Q3XA 2TRMA 2JETC 2ZIQH 5F03A 4TPYA 4AB8A 1H9LB 4Z6AH 5FAHA 4Y0YE 3TJUA 1O37A 1OP8A 4OGXA 3EYDA 1ANBA 1FY5A 3I78A 1LKBA 2A32A 2WYJA 5C67A 1O30A 1HFDA 1CE5A 2PKSB 1W14U 1AWHB 2A4RA 3LOXA 1ABJH 3MU5A 1PPCE 2G4TA 4Y76A 1TNJA 3GYMA 1C5NH 2VH6A 3HPTB 4CRGA 2ZO3H 4AORA 1DVAH 4NSVA 5ETXA 2BVXH 2GTBA 1CHOF 3U9AH 3E3TA 1C5SA 2BDBA 3SU5A 2ZC9H 1EASA 2YOLA 3FZDA 3LC5A 1S6HA 1SI5H 2G8TA 4IN2A 4U2WA 3E16B 2JKHA 4B2BA 1BRCE 1Z8IB 3GY4A 4OS4A 4RKJB 1NM6A 1W8BH 1BHXB 1J15A 1GBCA 1TPOA 3ITIA 1NS3A 1ZPBA 1MD7A 3AW1A 1TGSZ 4I8JA 4D76A 4RSPA 1GHXH 5T3HA 1TRNA 1H1BA 3RXHA 1LMWB 3RXIA 4AGJA 1LHEH 4TY6A 2D1JA 2I6QA 2ZDNA 2HOBA 1Q2WA 2ZU1A 2B0FA 1GDNA 2ZNKH 1IQHA 1J17T 1HJAC 4ABHA 1FI8A 1K1NA 1OX1A 2FOBA 4TYDA 4YESB 4ABJA 1GG6B 2GCTB 1VCQA 3E6PH 3U1IB 1AD8H 3KGPA 3CS7A 4NZLA 2SGQE 1DWBH 4JK6A 2GP9B 5E2PA 2VGCC 3KNXA 1GHVH 1W0ZU 4AX9H 1HJ9A 2PWXA 2BDGA 1D6RA 4UFEH 1ELTA 1GJ8B 3RXGA 3C1KA 1SL3A 2Z94A 4FUHA 1C1SA 1C1WH 5GXPA 1G32B 1OWKA 3K9XB 2G4UA 2FESH 1O32A 3F1SB 1SG8B 2BDIA 4NA8A 3SU6A 4E06H 3BTEE 2NU1E 3S7HB 4TWWA 2XCNA 2VIQA 4ZH8A 1GHAG 1KXBA 1W10U 2TPIZ 3T26A 1LPKB 4JZDH 4AG2A 1C1OA 3BTHE 3BN9A 1DE7H 2OUAA 4JZIA 1GJCB 1O2SA 3QDZB 1GBIA 1P3EA 1D3TB 1YPLH 3LJJA 3UQOA 1D9IA 1YCPH 1TX8A 5HYOA 4ZKNU 1TBRH 1WOFA 1O3OA 4BAOB 1O2ZA 4ZHLU 2RDLA 1EOJA 1ZPCA 3RXRA 5JB8S 1A5GH 1KLIH 1ZLRA 1F0TA 2GZ7A 2XC0A 3BV9B 4YOIA 4BAKB 6GCHF 1OXGA 3PYHA 4H42U 1AKSA 4X8TH 3GDUA 1QJ1B 1F92A 3GCOA 1KSNA 3SQEE 3LIWA 4IMQA 3E0NB 1UVUH 1K1IA 1P2QA 2UUYA 3B9FH 1C1PA 2ZHQH 3Q76A 1OP0A 1SGIB 1TLDA 2OTVA 4B74A 2OLGA 1UHBA 1C5ZB 1RS0A 3VB7A 2R9PA 5A09A 2ZHFH 3PB1E 1MBQA 2Z9IA 2PKAA 4CR9A 1SB1H 1YPGH 1Y5BT 5DPAA 3UOPA 2Y5GA 3K6YA 1ZZZA 3DT0H 5F6MA 1GMDF 3V3MA 2OC8A 1YM0A 4B75A 2IJOB 2V3OH 1H8IH 2BY7X 2VIDA 3UUZA 5CMXH 1SVPA 1DXWA 1UCYK 2AIQA 2FODA 1SBWA 3RU4D 2PGQB 1KDQA 1O3GA 1YPMH 1P57B 1XUIA 3RC6A 2UWLA 2FP7B 2FXRA 4MQAA 3OSYA 1XUGA 3AW0A 1O31A 1F0RA 1TAWA 1DSUA 1BTHH 2GCHF 3MH5A 5HM2A 1Z8JB 4ABAA 4X6MA 4ISLA 1ZGVA 1QGFA 5BPEA 2V3HH 3NPSA 2OINA 4GHTA 3WY8A 8GCHF 1AFQB 5HMAA 1GGDC 3FP8E 3K6ZA 1BBRK 2UWOA 1GVKB 2A31A 1C5RA 4Y71A 3QGJA 4AYYB 3DD2H 3QX5H 1TBZH 3A80A 3SU2A 4ZKOU 3F9GA 4QT8C 2GT8A 3BEFB 2YNAA 2VWLA 2EC9H 2P16A 2ZTYA 5AF9H 5JDUB 3GCNA 3CS0A 1KTSB 1A0JA 1BTWA 1G2LA 1N8OC 3MNBA 1GBMA 4NA7A 1F0UA 2BLOA 2D26C 3VB3A 4JZ1A 4WMFA 1BTYA 3GDSA 2NU3E 2Y7ZA 3LGYA 1K1LA 1QL7A 4FUBA 2VJ1A 1QQ4A 1SGCA 2JH5D 2FOEA 1EAUA 1FJSA 2A4QA 2ZEBA 1G9IE 1DPOA 2ZU5A 1LO6A 2O8MA 3TJOA 3OTJE 2QYIA 1CSOE 1P02A 4GVUA 4YO9A 1IQMA 1AHTH 2HPPH 2BX4A 4IBLH 1TOMH 2H9EH 3P6ZB 3SO3A 3RMLH 5A8YA 2BDCA 2Q6GA 4WH8A 1MQ5A 1FIZA 1DX5M 5C5NA 1FAXA 1HDTH 1OSSA 4GHQA 1P04A 2H5CA 4KKDA 1S85A 5DP7A 3TH3H 1BDAA 3MO9A 3A8AA 4J1YA 2PUXB 1FIWA 1F5LA 3RDZA 2PSXA 1BT7A 3EA7A 3RXSA 1VZQH 1V2LT 1O3FA 1AU8A 1J16A 4YT6H 1HAVB 3KQCA 1HAHH 1H9IE 2CN0H 3MU1A 1GMCF 2VNTA 4MDSA 1RXPA 4GSOA 2JH6D 4O9VA 3RU4T 3TJNA 3UR9A 2FZZA 2VH0A 1DWDH 1NRQH 1NT1A 3PTNA 3VXEH 3M5LA 3STIA 3MU4A 1GI3A 1HLTH 2FX6A 4M7GA 3TJVA 3ZZ6A 5DP3A 2GT7A 1A3EH 3ZVFA 4AFQA 2WYGA 3SU1A 1PPGE 3UIRA 3S69A 5B6OA 4XDEA 4CH8B 4AZ2B 3MU8A 1O5EH 5L30H 2BB4A 1YCPM 2ZA5A 1FQ3A 2VIVA 1C5OH 4OS1A 1Z1IA 1Z6EA 3SV8A 1RFNA 1JBUH 4Y7AA 3MNCA 4JMYA 3A88A 1ETTH 1GI4A 1S0RA 1G2MA 5F8ZA 2HNTC 3SBKA 1E34B 1O3CA 3FP6E 1C2IA 2O8TA 1C1MA 2FLBH 3VFEA 2RG3A 1N1LA 4K8BA 5JBAS 3O8RA 3PWCA 3SHCH 1MCVA 1OWHA 3QTVH 4YLUA 1PYTC 4XBCA 4Y8ZA 4DIIH 1KXCA 2A5AA 2ANKH 2FI3E 1BITA 1TMTH 3Q3KA 3VB4A 4F49A 4FUDA 3GY8A 5DJ7A 1TNIA 1ETSH 3F9FA 4NIXA 1GBLA 1AWFH 3FZZA 1EZXC 2P94A 5A2MH 1BA8B 1LHCH 3M3VA 2BQWB 5EQSA 1D3QB 1LTOA 3BF6H 3A7TA 3UFAA 1O2HA 4LXBH 4XSKU 2FTMA 1ZMNA 3ZVBA 2FLRH 2ZTZA 1EP6A 3PO1B 1AGJA 2AFQB 2Y7XA 1WBGB 2ZDKA 4NSYA 2SGAA 1EQ9A 4AN7A 2PTNA 1OYTH 3ODDA 1VITH 1GG6C 2GCTC 3MI4A 4K2YA 3SNCA 1TX7A 3T28A 1ZJDA 4CRCA 4BTTB 1AKSB 5LPFA 3HGPA 2O8UA 4CRAA 4ZMAH 5C2ZA 1MTNC 1CT4E 2GDEH 1GHBF 1PQ8A 4HTCH 1AUJA 3P8FA 3EDXB 1L1JA 1O33A 1SHYA 5F8XA 3ZZ3A 4O03A 4SGBE 3LGUA 2UUFB 2ALPA 1AZ8A 1O3NA 8LPRA 1RTKA 5A0AE 1V2RT 1GDQA 1UHBB 1TA6A 3TPIZ 1L1NA 1XKBC 2HPQH 3T62A 3U69H 3LDXH 1CBWC 3U98H 2ULLA 2PKAB 3UWIA 1BMMH 1NRNH 4WY3A 3RC4A 4NIWA 4Y0ZE 4U32A 1IQFA 3UQVA 1GBKA 1FV9A 3NCLA 1C2FA 3N7OA 1WAYB 1EZUC 1EAXA 1HAIH 2J4IA 2Q6DA 4O3UA 1KDQB 4GAWA 1T8LA 2A2XH 3A8BA 1OPHB 1ZTLA 2QGRA 1BJUA 2A7HA 2TIOA 5DP4A 1SPJA 1SGFG 4ISOA 4U01A 4IGDA 4YZUA 1GI6A 5EXMA 1RTLA 1K1JA 1XXDA 1LHDH 1G3BA 5LGOA 1GJDB 4F4OC 1WYKA 1ELAA 4B2CA 1AIXH 2NWNA 1QRXA 3V7TA 2GMTB 1B5GH 3C27B 1SGFA 4A1TA 1L0ZA 1OWJA 1TNKA 3SNDA 1HUTH 2W7SA 1SGNE 5EPNA 1SLUB 1YGCH 2RA0A 2AGEX 3SNBA 1QNJA 2OC1A 1CGIE 4K8YA 2XTTB 4B71A 1O2WA 1UVPA 1Y3UA 1HXFH 1V2VT 2FTLE 4ISIH 4XE4A 5HM9A 4CHAB 2P3FH 4I8GA 2ZI2H 1GBDA 1TPAE 1ZR0A 1EPTA 2P95A 3VXFH 2GV6A 3BTME 5C3NA 1NO9H 1UTPA 4OS2A 1A1RA 1GI0A 1C5YB 2Y5HA 4DY7B 3PMBB 5LH8A 1EAIA 1BTXA 1EP5A 1G3EA 4I31A 1O2TA 1O3MA 2WPIS 5A8ZA 1BB0B 1DS2E 1MH0A 1T4VH 3ATKA 3LC3A 4FVDA 4MPUA 3ZV9A 2WPKS 5K0HA 1AN1E 5JBTA 1BIOA 1MKXK 3VGCB 1P2KA 4KTUA 3GOVB 1UTLM 1SHHB 1V2QT 3GDVA 4K69A 1ELBA 1C9PA 1CU1A 2Z6BD 2ZKSA 1LHGH 1YP9A 2FDAA 3A7ZA 3GISB 1TFXA 1HBTH 4ZHAA 1KTTB 3EGKH 3NXPA 6CHAB 4LZ4B 1AFQC 1GJAB 3DUXH 5EW1H 1QBNA 1Y5AT 4XOJA 3M7QA 4Y10E 1CHOG 4DOQA 1P05A 4WXVA 1F7ZA 2G55A 1TMUH 4BTIB 1GHWH 1LPGB 3SV2H 5I46H 4KGAA 4FUGA 2BZAA 1C4U2 3BTKE 1CA0B 3RXUA 2BVSH 2AERH 3PMJA 4I8KA 4JYTA 5A8XA 2VWNA 5DP9A 2HRVA 2A2QH 2F9BH 1ZYOA 1O2LA 2RCEA 1PPFE 1AMHA 1L2EA 1WTGH 1EUFA 1HYLA 5EQQA 1S83A 4MTBA 2UUJB 4YM9A 2Z3EA 2ZQ1A 1Q3XA 3UNRA 2ZHWH 4A92A 3TK9A 1XUJA 4WH6A 2OD3B 1HJ8A 1HAVA 1C5VA 1O2OA 1P2MA 3MNXA 2EEKA 1MU8B 4Y8YA 3BTQE 1MZDA 3UPEA 1S0QA 1C1TA 3D62A 1G30B 1GCDA 4UFGH 3M3TA 3ATMA 3GYLB 2WV4A 2VWMA 4R0IA 3SUGA 2BOKA 3W95A 3RXDA 1QTFA 1FUJA 1GHZA 1JRSA 1ELCA 3EE0B 1WQVH 1MZAA 4TWYA 4CRBA 5E0GA 4GLYA 7LPRA 1SFIA 1P06A 3KEEA 4INKA 3RMNH 1O3KA 1FN6A 4X1QU 2P59A 2BD4A 1K1OA 4OS6A 1XVMA 2PTCE 3P8GA 4ABFA 1FAKH 3BTWE 1RIWB 1ELFA 3MTYA 1O3LA 4DW2U 1TGNA 1WTHD 3MHWU 1P2JA 2J9NA 5J4QA 1UCYH 3FANA 6ESTA 1PPHE 2I6SA 2O8WA 3BTTE 3TK6A 4VGCB 1TIOA 1ESAA 1Z8GA 6GCHG 2F9UA 4IS5A 5E0JA 3P92A 4X2VA 1AZZA 1XUHA 1W7GH 5EW2H 2K1QA 1ZPZA 1HAZB 4X1PU 1B7XB 2NU2E 5ESTE 3A7VA 5I25A 2CXVA 1O2IA 3OY5U 2QXIA 1C2DA 3SQHE 1GMHF 1HV7A 3JZ1B 1LDTT 1IQIA 3P8NA 3T25A 8ESTE 3A83A 5FPSA 1H9HE 1O3PB 1P2OA 3TGJE 1HAGE 1ACBE 5CHAC 1Z71A 4Q80A 1Y5UT 4NWLA 3KIDU 1EX3A 4AFUA 1WQSA 1BBRH 4K1SA 1ID5H 4MLFB 1XXFA 1C1NA 2STBE 5G4BA 1W3CA 1GMDG 4Q7XA 3L6PA 4FUIA 2Y82A 3UOUA 2W26A 1V6DA 3I77A 1SMFE 3ZZAA 3SI4H 2GDDA 3F6UH 3S7KB 1P09A 4AOQA 1BRUP 1K22H 3L33A 1D3DB 2P93A 3DFJA 1O0DH 2C3SA 2ANYA 3RXVA 2ZCHP 1A3BH 5E8EH 3LKWA 3TH4H 1CT0E 3PM3A 3PLKA 1XMNB 2CJIA 1AVWA 2ODQA 5DP8A 3RXLA 3UY9A 4KP0A 1QCPA 2GCHG 3SUFA 1P9SA 4Q7YA 2YNBA 1O3HA 1GVZA 5J4SA 4ISNA 2ILNA 2ZZUH 1LVMA 5L2YH 2OBOA 3E0PB 1GCTB 3QTOH 3AASA 8GCHG 1PPEE 1VGCC 2SNVA 1HIAB 3PROA 1BQYA 1HNEE 1ZOMA 2CGAA 1KYNA 5CE1A 3CENA 3IG6B 1ZHRA 5AFYH 2PHBA 3LPRA 2ZFTA 1DUAA 2BDHA 3MYWA 2GX4A 1TGCA 4X8UH 4BAHB 3HKJB 3NZIA 1A61H 1C4Y2 1YPJH<