1BTWA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule keywords BETA-TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btwA02
3RXAA 2FOCA 3PMJA 3ZZ6A 2BX3A 3VB5A 3MOCA 2ZDLA 5L6NH 1C5SA 2ANMH 2PLXA 1Y8TA 5DP7A 3PMHB 5AFYH 2G4UA 1SLXB 1C1OA 1FY8E 5C5NA 1OWHA 4DY7B 2XTTB 4UFGH 1PPGE 1AMHA 4I32A 1GI0A 2FOAA 4O97A 3A82A 1C1MA 1HJAB 3AW1A 2A31A 2BLVA 3SUEA 1O2IA 4TY6A 1KTTB 1ELGA 3SUDA 1Y5BT 2ZI2H 5F8TA 1P2QA 1C5XB 1DVAH 4MNWA 5LPEA 2ZFQH 2QGRA 2CGAA 3M7TA 2J94A 1CSOE 1GBMA 4IGDA 2EI6A 3F9FA 5EXLA 5EPYA 2G51A 5FXLA 1IQHA 2H9EH 2LPRA 4FXGH 5GJ4B 2ZP0H 1EPTC 1YPHC 3JZ1B 4XBBA 5FPYA 1HIAB 3RC6A 1C2EA 1GMDF 2EEKA 1EJMA 1LVYA 2V3OH 1DDJA 2OD3B 3NPSA 4X8UH 3TJNA 3UNSA 2D26C 3OU0A 1GJDB 3V13A 1ZLRA 2NU0E 1QB1A 3W95A 1O30A 1O3NA 3M5NA 1HAXB 2O8TA 5G4BA 1FLEE 6LPRA 1RRKA 1UTQA 2JH0D 5A0BA 4ZUHA 1HAPH 1IQJA 1ZOMA 4DW2U 3ZZBA 1AWHB 1TPOA 1GGDB 2QF3A 3OY5U 2P3TB 1FUJA 2FS9A 1P0SH 2Z94A 2WYJA 1EAWA 3RXRA 2P94A 1DE7H 1KSNA 3LGIA 3GY4A 4PROA 1DXPA 4MPVA 3KGPA 1O3GA 1MTNB 1TBRH 1YBWA 3L6PA 1WTHD 1DSTA 1MUEB 2Z3EA 2PTCE 1L2EA 1UK4A 1Y3YA 2Z9JA 4X6NA 1O35A 1XX9A 2F9OA 2FWWA 2AERH 1NM6A 2V6NA 1NY22 3GYLB 4NG9H 5HGGA 3LONA 1DY8A 1ESAA 1BITA 1S83A 2ZDKA 1LVBA 1ORFA 2A7HA 1SC8U 2Z6BD 3CP7A 1MCTA 2G00A 2HNTC 1PQAA 3NCLA 2H5DA 1IHTH 1RD3B 2ZTZA 5T6GA 1DT2A 4JYVH 5L30H 4RN6A 4KGAA 2Q6DA 2R9PA 2EI8A 1WV7H 3QDZB 1BHXF 5A8XA 3PMBB 3ZZAA 5GCHF 1C5UA 1A0LA 1AVXA 1LPGB 3MU0A 3K6YA 2VIOA 2CMYA 2OQ5A 5CHAB 4CRGA 5DGJA 2AIPA 3FANA 4O3UA 2WPJS 4NIVA 2TGPZ 3SV2H 1QA7A 1ZYOA 2PSYA 2A5AA 2FTLE 3OYPA 1N6YA 1OXGA 1QRWA 3P8NA 4SGAE 1JBUH 2H9HA 2J2UA 3F68H 2J92A 1C4U2 3S69A 5F8XA 3ZZ7A 1UVSH 2VVUA 5JPMH 1GBBA 1A0HB 2QXGA 1O2KA 1YM0A 2GT7A 4ABBA 4FUFA 4YLUA 2F91A 2A5IA 7GCHG 4LZ1H 1AD8H 3O8DA 1KXDA 1EAUA 1PQ5A 3MYWA 4RKOB 2VU8E 5FX6A 3ZZCA 1QB6A 1TA6A 1MD8A 2YNBA 2BHGA 4DURA 1TGTA 1GBLA 1UVPA 5EODA 1GJCB 2OC7A 3BTME 3ZV8A 2ZCKP 3SU4A 1QRXA 3KQCA 3F9HA 1KLJH 3A7YA 1ZHRA 1NRQH 1YC0A 2WUCA 1HYLA 1HGTH 1NRNH 1P05A 3KIDU 1E38B 3QZRA 5A8YA 3UNRA 1ZTJA 1QJ7B 3U1IB 5DJ7A 1TRYA 3LT3A 3TITA 1DX5M 1XUIA 5HM9A 3RXUA 2SFAA 3RXVA 2J9NA 2G52A 1ELAA 2AGGX 3LOXA 3A7XA 1SBWA 5GPIB 1BMLA 1BB0B 1QRZA 5HYOA 3LJJA 1C1NA 3SW2B 4Y8YA 1GJ8B 1SHYA 2CF9H 3DT0H 1C1RA 1K1OA 1FY4A 1A0JA 1HAVB 3E90B 1C2GA 1O5BB 3D23A 1IQIA 1ZZZA 1ELEE 1SGFG 1XUGA 3HK3B 1L1GA 3EE0B 2FX4A 4WJG2 4X1PU 4XFQA 5ESBA 2G4TA 4B2BA 4CH2B 4GHTA 2IPHA 4NIXA 1ANBA 4TWWA 1O3KA 1TABE 4MNXA 2JH5D 4ISOA 1IQNA 2FOHA 4VGCB 1O2GH 3RM0H 3SGBE 1NC6A 1TOMH 3FZZA 1QURH 3A8CA 2XC4A 2ZO3H 2Q6FA 5DP3A 1D3DB 1DUAA 1QNJA 1Q2WA 6GCHG 1IOEA 1EAIA 2PW8H 1O3BA 3TGJE 4ZHLU 1XUFA 3SV6A 4MG3A 2R3YA 1EOLA 1TNHA 3WY8A 1GI9B 1GHYH 5JYIA 3S9CA 1GCTC 3P8FA 2C4FH 8LPRA 2UWPA 5DK1A 5DP5A 2SGPE 1S6HA 1UHBB 5LH8A 1J17T 2HRVA 4YT6H 4B2CA 2FI5E 3TVJB 2IJOB 2F9UA 2BQ6B 3BEFB 1O3CA 1XXFA 2UUFB 2VWMA 2VINA 3SHCH 1XMNB 1AI8H 1A7SA 4ZKSU 1VITG 5TCCA 1NROH 1F0TA 1O32A 4OGXA 2ANKH 4FUEA 4CREA 3T25A 1ZJDA 1AN1E 1O3HA 4A1VA 1PPBH 3E3TA 1D6RA 2BM2A 2FI4E 1GPZA 4ABIA 2AIQA 3RXSA 1GJ7B 5FX5A 2ZDNA 4X1RU 1T7CA 4FUIA 3RXOA 1GI3A 4U2WA 3O8CA 3K65B 1O2XA 1LO6A 3H5CB 4LOYH 1O34A 2RDLA 4Q2KA 3S7KB 6GCHF 4CRBA 2ZHFH 4K3JA 1MQ6A 1OWKA 1F0SA 3M7QA 3KNXA 1GL0E 4DVAU 2P59A 1C1VH 2FOGA 2H5CA 1HJ9A 3ZZ5A 4ABGA 1QQ4A 1DPOA 1O3FA 1TGSZ 5TJXA 4BAQB 1SGQE 1GG6B 1EPTA 1V2LT 2PFEA 5E0HA 1ELTA 4X8SH 2ZQ1A 3URCA 1C9TA 1P04A 1O2QA 2QYIA 1S0QA 3FP7E 1QJ1B 1V2RT 2C8ZB 2ZFPH 3QX5H 3ATWA 1AY6H 5EW1H 1Y5AT 2XNIA 2H6MA 3GYMA 3A8BA 4DIHH 1MAXA 3QO6A 1VITF 1YKTA 1QBOA 3M5OA 1F5RA 1C5OH 4UDWH 1TGCA 2ODPA 1SLUB 3PO1C 2FXRA 1TIOA 3ESTA 2BD3A 4H6SB 1C5MD 2FO9A 1MAYA 1NRPH 3BG8A 3GISB 3V0XA 1E35B 5DG6A 1SGTA 2H1UA 3RU4T 5CMXH 4I33A 2B0FA 4MDSA 3TNTA 2ZGCA 1NFUA 1Y3XA 1BMMH 1GBJA 3U1JB 3QLPH 2EI7A 2HNTE 1F92A 4AG2A 1ZRBA 2BY5X 1L0ZA 4DG4A 1FAKH 1PPFE 3VXEH 1AZ8A 1BTHH 3E1XB 4ZAEA 1MTWA 2Z9KA 1GI2A 1CBWC 1V2OT 2AYWA 3A86A 1BHXB 4DCDA 5ETXA 4D8NA 5TCAA 4DT7B 1BOQA 3EYDA 3SU0A 2TBSA 1KY9A 1BTUA 1K1MA 1GBFA 3EAJA 4MVNA 1EB2A 1XVOA 1QBNA 3HPTB 1W0ZU 4U32A 3RMMH 1SGDE 1WSSH 1UTLM 5C1UA 1ZSJA 1T8LA 1EUFA 1BQYA 1XKAC 2BB4A 1NN6A 2HALA 1K28D 3KQDA 5IDKA 1O38A 5EPNA 1ZPCA 5E0GA 1WCZA 1AQ7A 2VNTA 2ZU3A 2TIOA 5F6MA 1H8DH 1T31A 2Z3CA 5A2MH 4AFZA 1Z8RA 1MZAA 3BTGE 3LC3A 4X1QU 1GJBB 1G3DA 1UTJA 4Y7BA 3BIVH 1GHBG 4IN2A 2V35A 4I8JA 5K0HA 2ZPQA 4ABAA 1O33A 3L3TA 3P92A 3G01A 4BAKB 3Q77A 1O5EH 3PYHA 4JYTA 1XVMA 4X2VA 3Q3XA 4SGBE 1O5CB 1HAOH 2UUYA 1O2OA 1HBTH 1P06A 2GCHG 2VIDA 2AH4X 5GIBA 3GCHB 4MLFB 3M35A 4CRDA 1IAUA 2BMGB 2ZHWH 1SGPE 1AFQB 3E0NB 1KXFA 1Y3VA 1BTZA 2VWNA 4CH8B 4AOQA 1A3EH 1M9UA 1UCYE 1IHSH 4INHA 1QL7A 4K1EA 1GJAB 2G5NA 4JZFH 3MH7A 5PTPA 3PMAB 2NWNA 4GPGA 5C5OA 3ZVFA 4I7YH 4AX9H 1O5AB 4UFEH 2CJIA 3UY9A 1O2LA 1K21H 1X7AC 3SQHE 1C5WB 3RXFA 2XWAA 2QCYA 3DFJA 4X6PA 5JDUB 1LVOA 2GMTC 2ZTXA 3QZQA 1BJVA 1DWDH 1GJ4H 5AHGH 4K1SA 3PLKA 4Q80A 1YYY1 2ZU2A 3T27A 3BTQE 1C5QA 5EU8A 1OS8A 4CR5A 1NO9H 2P8OB 3S9AA 1AKSA 1N8OB 4GVUA 4Y8XA 1GBIA 4WH8A 4CHAB 2VIVA 1BBRH 3T26A 1KXAA 1GHBF 2ZCLP 1V2TT 2CF8H 1ESTA 3MU4A 1E0FD 2FM2A 2C90B 1C5ZB 3R0FA 3VPKA 3U9AH 1ZSLA 1BBRE 1P01A 1WYKA 4TWYA 1TOCB 3LJOA 4YESB 3GDSA 2HVXA 1O2RA 3UPEA 4AB9A 2FPZA 3K2UA 2JETB 1AUTC 3STJA 1TBQH 4LZ4B 1FY5A 1C2DA 3VXFH 4AGJA 3LU9B 1HV7A 3GY8A 1BT7A 2XRCA 5A0AE 3SJ8A 2ZGJA 2ZGXH 4GUXA 4I8HA 2SNWA 3PWCA 1BMNH 4CRAA 1FY1A 2FMJA 1O2SA 3SU1A 4AYYB 1LHFH 3M7UA 1SPJA 1EJNA 2C8WB 1C1QA 3ATIA 2BDIA 3KQEA 3SORA 1AE5A 3MTYA 4H6TA 5F8ZA 4O3TA 3RC5A 1A3BH 1DLEA 1LHCH 3PLPA 4U01A 3GOVB 3AW0A 4K5ZA 3UWIA 4BTUB 1NZQH 3KCGH 1EASA 1ZJKA 2XBXA 4INKA 4E06H 5IYTA 3JZ2B 1NTPA 1TB6H 2GVFA 4GSOA 3DA9B 3A84A 1SGRE 1SGIB 1QHRB 1VCWA 2WPMS 1MCVA 3LGYA 3HGNA 1CQQA 1XKBC 3K6ZA 3BIUH 1OWJA 1CU1A 3T29A 5GCHG 3RXBA 4D7FA 2UWOA 2ZFFH 2PHBA 3SI4H 1TA2A 3ZVCA 1L4ZA 3MI4A 1NS3A 2EC9H 2STAE 2PWXA 4ABHA 1PYTD 4A7IB 2K1QA 4AFUA 1AWFH 1XUKA 1TAWA 3A7TA 4FUJA 4IBLH 4MQAA 1B7XB 2PKSB 2J38A 4IMZA 4A6LA 5E0JA 4AG1A 3TNSA 2BDGA 1C2HA 1OP8A 2A0QB 1C2FA 1HXEH 2BVXH 5HM2A 2VGCC 1FPHH 4YLQH 1A5GH 1RJXB 4JZDH 1P09A 4A5TS 2NU4E 3IG6B 1MBQA 2ZGBH 1GVZA 1BA8B 2RA0A 1C5VA 1ZMLA 1EX3A 2ZHQH 3E0PB 3NZIA 5E2PA 5A8ZA 1AFEH 1TNKA 3KQBA 4ABFA 1FAXA 3HATH 3A81A 4J1YA 4VGCC 4NA7A 1TBZH 1UVTH 1J8AA 2ODQA 1VCQA 2GV6A 5EGMA 1N1LA 2SGFE 1O36A 1EZQA 1LHGH 1IQFA 1LMWB 2A7CA 2D2DA 2O9QA 2VH6A 3M61U 1NESE 4X0WU 3BG4C 1S82A 4Y76A 3RXDA 1HJ8A 3KF2A 3SJ9A 1GVKB 1SSXA 1UTOA 3GICB 3MFJA 2ZWLH 1QL8A 6ESTA 3RXEA 3VB3A 1KXEA 4Y71A 2PR3A 2QIQA 1G36A 4CR9A 3V3MA 1BBRK 1Q3XA 2BOKA 2A5KA 1OWEA 4Y0YE 2ZQ2A 3OX7U 2RG3A 3B9FH 1QFKH 3RU4D 5DPAA 5GWZA 3A7VA 2B7DH 5DP6A 4DOQA 2VJ1A 1K9OE 3ZVDA 3P8GA 3PTNA 3RXCA 4JZIA 4CBNA 1K1JA 3A87A 2GKVE 3MHWU 1C2IA 1FPCH 2VB0A 4CRFA 4AZ2B 2SGAA 1E37B 4I31A 1AVWA 1EZXC 3SQEE 3P95A 1D6WA 1O2NA 2XCNA 4THNH 5JBCS 5T3HA 4B76A 3FFGA 1O2HA 4YTAA 3R3GB 1ZGVA 8KME2 2FESH 1AO5A 1WQVH 2Y82A 1IQKA 2ALVA 3V12A 2A7JA 2FP7B 5FCKA 4ZH8A 1TFXA 3RXJA 1MTUA 5FPSA 1VJAU 9ESTA 1ZR0A 4K1TA 1V3XA 1F0UA 1Z1IA 3SOSA 1TPSA 1AHTH 4INLA 1IQGA 1XXDA 1IQEA 1YPMH 1CA8B 2VIQA 2ANYA 1MTSA 4Y10E 2W5EA 2BZ6H 1H8IH 1EPTB 1XUHA 4UEHH 1CGIE 2ZC9H 1FY3A 1MKXK 2XCFA 4FU9A 3ZVAA 1Z7KA 1GG6C 3BF6H 4X1NU 1CHGA 2BDHA 3OSYA 1DWBH 4NIWA 2YOLA 4ZHMU 4RKJB 5EQQA 1Q31A 4XE4A 4XBCA 3A80A 3QWCH 2RCEA 1GI1A 4ZKRU 1TMBH 2HPPH 1UK3A 2GCTC 1ZHMA 2VWOA 1CA0C 1S85A 3SUGA 3U8OH 1TX7A 3GCNA 5JB8S 1FMGA 1OYTH 4M7GA 1THRH 5J4SA 4UD9H 4OS4A 4BAMB 2ZU5A 1C5PA 3FVFB 4KKDA 4D7GA 1DS2E 1GBTA 1WBGB 2XYAA 3BTDE 4BAOB 2F83A 1RFNA 2W7SA 1G2MA 5EG4A 4K69A 2VIWA 3OY6U 1OWDA 4Y6DA 1T4UH 4B74A 2ZECA 1J15A 1KTSB 1L1NA 3SNDA 3VB7A 1GL1A 1EAXA 1P2JA 2BD8A 1W11U 2GZ9A 1MD7A 1MMJN 4FVDA 9LPRA 2AMPA 2WUBA 3IITA 1J9CH 1OP2A 2WPKS 2UWLA 4R0IA 3A7WA 1DANH 3ZVGA 2SGEE 3D49H 3BEIB 2OINA 1Z1JA 1O2PA 3IWMA 4CBOA 1BUIA 2ALPA 2BY6X 3UFAA 3M5LA 1G9IE 1W7XH 1LCYA 3PB1E 1UMAH 3N7OA 5DO4H 2ZKSA 4WVPE 2B5TB 3GCTG 1YPJH 2F9BH 3VGCC 4ABJA 1P9SA 2A32A 1G32B 1QL9A 2BD5A 1KYNA 3SNEA 1DICA 1P02A 2FOFA 2PGBB 5JBBS 1GVLA 2D1JA 4Q7YA 3UR9A 4OS5A 1GBCA 3NWUA 1H9IE 1HFDA 2RA3A 4Y8ZA 1TX6A 1EZUC 4DJZB 1H1BA 2B8OH 4ISNA 3GY6A 2WPHS 3NUMA 3MMGA 5H4IB 1QR3E 4AN7A 1TGBA 3I29A 3SV8A 3SNAA 2XC5A 1W10U 1WQSA 4FUBA 1D3QB 4IMQA 2QN5T 2ULLA 4WMDA 2BQ7B 2ZU4A 3GCHC 4FVBA 1ID5H 1THSH 3CENA 1W3CA 2NU3E 3BSQA 2Y7XA 1AFQC 1OWIA 5A09A 2BY9X 4B75A 1BTPA 3ELAH 1DXWA 2J95A 1C5YB 3SGQE 1C1WH 1LDTT 1H9LB 1Z71A 1G3BA 4Q7XA 3RLWH 3P17H 1TQ7B 4KELA 4ASHA 2A45B 1WUNH 1NFWA 1RIWC 2CHAB 2Z9IA 1PPEE 1JXPA 4XBDA 1FIZA 3BTKE 1V2PT 3GCTF 3QGJA 2P16A 4WXVA 3I78A 4UFDH 1VGCC 3FP8E 3E16B 4IW4E 3LH3A 2QC2A 3ZVBA 5DP4A 4ABDA 2W26A 4ZMAH 3T2NA 3QTVH 4JCNA 1O2JA 2FYQA 3I77A 2GV7A 3UOUA 5JB9S 1QA0A 1S0RA 4MPWA 1NU7B 4BXSA 1TRMA 2VH0A 4H42U 2OLGA 2ZGHA 4MPUA 4CHAC 1D4PB 3SU5A 1DLKB 3S7HB 5C1XA 2ZDAH 2SGDE 3C27B 3Q3YA 4JYUH 2AEIH 4Y11E 4WMEA 4K8YA 2ZFRH 2QXJA 1GI7B 2BLQA 3B23B 3QUMP 1QCPA 2XXLA 2WV4A 1ZHPA 1BZXE 5DP9A 2VIPA 1SMFE 3MO9A 1O2TA 4BTTB 1TMTH 3PLBA 4Y0ZE 1K1PA 4UFFH 1TRNA 2GDDA 5C20A 1OPHB 1GCTB 2BDCA 5BRRE 1CVWH 1GBEA 2YNAA 1HXFH 2BQWB 3BEUA 2ZNKH 3RMOH 3MU8A 3GDUA 3Q00A 2H9TH 3MNCA 3LDXH 1AVGH 3MNXA 1KIGH 2R2MB 1O2VA 1H4WA 3TJVA 1C1SA 2BY7X 2KAIA 1A61H 1AUJA 1HCGA 1O2MA 1S81A 1K2I1 1JWTA 1FN6A 2BDYA 4DIIH 3U98H 4JZEH 1V2MT 4Y79A 4AB8A 5J4QA 1HJAC 1THPB 1SVPA 1MKWH 3SU2A 1UCYH 3TGKE 1MH0A 1KXBA 3PV4A 1PPCE 2FIRH 2BY8X 1TLDA 1N6XA 2Z9GA 3C1KA 1G3CA 1GJ9B 5HMAA 1P57B 1EOJA 1VJ9U 1W0YH 3TH3H 2XBWA 3F6UH 4GHQA 3Q76A 1SLWB 2O8MA 1C1PA 5C3NA 1OSSA 1DWCH 2FZZA 3GY2A 1S84A 1O5FH 1C5LH 1QBVH 2GZ8A 2BLWA 1OYQA 2GTBA 1S5SA 4ISIH 3RMNH 3P70B 3UIRA 5ABWA 3RUOA 2G8TA 4E05H 3D62A 2PUQH 4ABEA 2Y80A 3DHKH 2W3IA 1LVMA 1SL3A 3UREA 4UONA 3MO6A 1AB9B 1FN8A 1OP0A 4O9VA 3TJUA 1ETRH 4NIYA 4YOJA 4NWKA 1GGDC 4YT7H 1O3MA 4NWLA 3TH2H 3UQVA 1LQDB 1SI5H 2PKSC 6CHAB 2ANWA 4X6MA 3GCOA 5C2ZA 1O3OA 8ESTE 1DITH 1MTNC 1HAZB 1ANEA 1O2UA 1INCA 2C3SA 1P2KA 1P9UA 2P3UB 1C2JA 1OOKB 1BMAA 3ATLA 2ILNA 1QTFA 4Q7ZA 3M37A 1GMCG 4JK5A 1YCPH 2ZCHP 1Z6EA 1A5HA 1EB1H 4ISLA 2BX4A 3TGIE 3H7OA 1ZRKA 4YOGA 1PQ8A 2THFB 4D76A 1NFXA 3M3VA 1HNEE 3HK6B 1ELFA 1GDNA 3EDXB 2TGTA 1C2KA 1F0RA 2Q1JA 3KN2A 4I8KA 3EQ0H 1Y3WA 2CV3A 1D3PB 1WOFA 1ARBA 1SQAA 3NXPA 5FAHA 2I6QA 1V2WT 1CBWB 1AGJA 1UVOA 2OC1A 3KL6A 1QGFA 4D9QA 2WPLS 5ESTE 3FZDA 1RTLA 4K60A 2CXVA 3RXIA 1S6FA 4HFPB 3VB4A 1GI6A 4TY7A 1ANCA 2Y5FA 2HNTF 2OCVB 1PPZA 5CHAC 1O37A 2O8LA 3ZVEA 2G5VA 1TONA 4X1SU 3SN8A 2OBQA 2A4RA 1W2KH 3AAVA 2BD2A 1Z8IB 2O8UA 4H4FA 4X8VH 1TALA 4LXBH 4KTUA 2QAAA 1J14A 7LPRA 1RTFB 4F4OC 3A83A 1JRTA 1QJ6B 1FNIA 1FXYA 3RXQA 1MKXH 1V2UT 1O3PB 1GHXH 1RGQA 4IN1A 1TNGA 1ZTKA 1EP5A 1RXPA 2ASUB 3BTTE 1GI4A 1VZQH 1GMCF 3SI3H 3PTBA 2ZZUH 2F9NA 3EA8A 2LNCA 1RTKA 1YLCA 2ODYB 1GBAA 2BD7A 1P2MA 3D65E 2FEQH 2WYGA 1V2NT 1SFQB 4B71A 2I6SA 4WF8A 3ZZ8A 2QV1A 1SB1H 1ZMNA 3DFLA 1C2LA 2OUAA 4OS1A 4AYVB 3STIA 3BTHE 2QF0A 4JK6A 1EQ9A 2Y81A 4ZHAA 5E2OA 1LKAA 4NFEA 3MH6A 3BN9A 3MO3A 4D9RA 2FTMA 1AE8H 3ITIA 3RU4E 3RXKA 2ZU1A 4NFFA 1W13U 3F9GA 3SUFA 5T6FA 1P8VC 4I8LA 2Y5GA 8GCHG 3P8OA 3RXPA 5T6DA 3ZYDA 1MKWK 4FUDA 5GXPA 1P12E 3T62A 1D9IA 1UCYK 4KTSA 5LPRA 2OC0A 3SGAE 3U8RH 5JBTA 7KMEH 3TJOA 3LKWA 1NU9A 3RC4A 2OXSA 4UE7H 2GMTB 3FP6E 3RXHA 2W3KA 1CGHA 1BIOA 3RDZA 5E8EH 1Z6JH 1DM4B 3O8BA 4IC6A 1QIXB 3E6PH 1EXFA 3H7TA 7ESTE 1YLDA 1O3EA 2DE9A 1ESBA 1CT2E 4F49A 1CGJE 2BDAA 1KDQA 3T5FH 1XUJA 1ACBE 3ZZ9A 1KLIH 1HLTH 2BDBA 1MZDA 5C1YA 5EXNA 1ELDE 5A0CA 3QN7A 1FONA 2FI3E 3AAUA 3CS0A 3NKKA 3EA9A 1F7ZA 1P3CA 1BRCE 1K1IA 1YP9A 4CRCA 2BD9A 2VVVA 3F9EA 5DKMA 3RXMA 3SO3A 2ZHDA 3SJOA 4A1TA 2C8YB 3MU1A 1ETTH 2PKAA 1SQTA 3TK9A 1ELVA 5F03A 2GX4A 2G55A 2H2ZA 4X8TH 1A1RA 2GDEH 1NPMA 1O5GH 2UUJB 1C4Y2 2F3CE 3DUXH 3U8TH 3ZZ3A 2P93A 1ABIH 2PUXB 1C5RA 1K1LA 1DSUA 3E8LA 1P2OA 3F1SB 8GCHF 1A2CH 1L1JA 2UUKB 1QQUA 1C5TA 1H9HE 1GJ6A 1ZGIA 1IQLA 3S9BA 1YCPK 4AFSA 1U6QA 1LPKB 1HPGA 2BVSH 5I46H 3HGPA 4NA8A 2QA9E 2FX6A 1O3IA 1O3DA 3QK1A 4E7NA 2GZ7A 2A2XH 1D3TB 4E7RG 2F9PA 1HDTH 3E91A 1GHVH 2W7UA 4ZKNU 3SV9A 1BTWA 3AASA 1P3EA 1FV9A 4YM9A 1SGFA 3TU7H 1Y3UA 2QY0B 3GDVA 4MPXA 1GBHA 2WINI 4ZXYH 1IQMA 2JKHA 1C9PA 1ZSKA 4FUGA 4Y7AA 5EQRA 1NT1A 1T8OA 1WTGH 1DUEA 2BD4A 2SGQE 3QGNB 1VITH 4XOJA 2O8WA 1MU8B 4Z6AH 1TQ0B 3M36A 1JIRA 1MU6B 2A4GA 3RLYH 1SFIA 2SNVA 2TGAA 3VFEA 4YO9A 1EATA 1GWAA 1TNLA 1UTMA 4BOHA 1XM1A 1G3EA 1CE5A 2HWLB 5EOKA 4OS7A 2CN0H 2BXTH 2BYAX 2V3HH 2XBVA 4WXIA 2G81E 3SU6A 1TNJA 1HIAA 2XBYA 2FLBH 3SNBA 2EA3A 4HGCA 4B2AA 1G30B 1HAHH 1SHHB 2FDAA 2AFQB 3KHVA 4BAHB 3O8RA 1MQ5A 1EP6A 2CHAC 1LTOA 1GI8B 3URDA 3ZV9A 3A8AA 1HAYB 4BXWA 1YPKH 2P95A 1O5DH 5FBEA 4JZ1A 1TMUH 4NSVA 5FHTA 1O2ZA 4FUCA 5GDSH 3GY3A 1AIXH 1J16A 1PQ7A 1JMOH 2IN2A 3KEEA 3RM2H 1W14U 1O2WA 1QB9A 2ZA5A 1YPLH 2AGEX 1W8BH 2VGCB 1SG8B 1V2VT 2F9VA 1GJ5H 3MH5A 3LPRA 1EJAA 2ZTYA 4XSKU 3TH4H 4KP0A 2GT8A 3SJIA 1WU1A 2R0LA 2ZDMA 2HPQH 1K22H 2BTCE 1PFXC 1FIWA 2D8WA 4X6OA 7GCHF 1EZSC 5DP8A 2Q6GA 4YZUA 4ISHH 4FUHA 1HAIH 3EA7A 3MWIU 1O0DH 2ZPSA 3ZYEA 1TGNA 4K2YA 1G2LA 4QT8C 2V0BA 1ETSH 2NU2E 1UK2A 2IOTA 2OC8A 4I8GA 3NK8A 1CT4E 2ESTE 1GBKA 3A7ZA 3BG4B 1LHEH 1VCPA 1YCPM 5AFZH 4BANB 1V2QT 2GGVB 1B0FA 1KXCA 1A5IA 1CO7E 1L4DA 1ZPBA 1GI5A 1PYTC 4GLYA 1YF4A 5I25A 1W7GH 3LGUA 2FOEA 4ZXXH 4O03A 2PV9B 3CS7A 2A4QA 2KAIB 3UWJH 2FOBA 3M5MA 4JMYA 1OKXA 1TPAE 1ANDA 3M3SA 3A88A 4NSYA 3VEQB 5FCRA 1F5KU 1AZZA 2PSXA 3S0NA 1BRBE 4ESTE 1UJ1A 3LGWA 2BZAA 4XDEA 1WAYB 3FAOA 3A89A 4AGKA 3PWBA 1SGYE 2AGIX 2JH6D 4MNVA 4A92A 3SV7A 1DOJA 5AF9H 2AMDA 2DUCA 2A4OA 3HKIB 4X2YA 1YPHE 3LH1A 3U69H 1Z8JB 5EQSA 1YPEH 1TX8A 3BTEE 1GCDA 1RS0A 1LKBA 2ZEBA 1TE0A 2HGTH 2NU1E 2WV5A 4NGAH 4WY3A 2J34A 1SOZA 4NZLA 4LK4A 1MTVA 1CHOG 5BPEA 3LGVA 1CT0E 1C1TA 3ATMA 3L33A 3PROA 3UNQA 4AORA 1A4WH 3TK6A 1ELBA 1O3AA 2ZFTA 4X2WA 1LQEA 3DD2H 1P11E 1NFYA 1F5LA 2VWLA 1FDPA 1SLVB 1G37A 2A1DB 1V2ST 1T4VH 1UVUH 1AB9C 1SQOA 1YPGH 1NRSH 2Y7ZA 4ZKOU 3ODDA 3GY5A 3SU3A 3SJKA 1AKSB 1GHWH 3LIWA 1A46H 1V2KT 2P8OC 2GCTB 6CHAC 1CA0B 2P3FH 3MNSA 1P10A 4FU8A 3RXTA 1N8OC 5HXFA 3UR6A 1SGEE 4KTCA 5L2ZH 5B6OA 3A8DA 1HAVA 2FS8A 1V2JT 2ZFSA 4GAWA 1HRTH 4NZQA 4TPYA 5LPFA 2C8XB 1SOTA 4A1XA 3MNBA 2BXUH 2WPIS 2XC0A 3PM3A 1FI8A 4DGJA 3LC5A 1UTKA 2B9LA 3M3TA 1KLTA 1HB0B 1LPZB 1TPPA 4X2XA 3A85A 3TK5A 1W12U 2JETC 2AMQA 1BRUP 3SNCA 4Z0KA 4K8BA 4FU7A 3BTFE 1GHZA 3RXGA 2QXIA 1GBDA 3K9XB 3AVZA 1CHOF 1TNIA 4ZROA 1O2YA 3B8JA 4B1TA 5CE1A 3OTJE 1JOUB 2XW9A 3VB6A 1ABJH 4MNYA 1UHBA 1FQ3A 2BLOA 1GHAG 1UO6A 4HZHA 1PJPA 1T32A 4AFQA 5EXMA 1C5NH 2Z7FE 2ZHEH 3ODFA 4U30A 1BTYA 2ZF0H 2FOMB 2HOBA 4YOIA 3TIUA 2OQUA 3VGCB 3RXLA 1SR5C 3LGTA 4GCHG 1P2IA 1DFPA 4RSPA 1QY6A 1JIMA 1JRSA 1B5GH 1EKBB 2R2WU 1LHDH 2AS9A 2Z9LA 1NRRH 2XWBI 1O39A 4HTCH 3UQOA 5FPTA 5K7RA 4HI3A 4OGYA 2ZIQH 3EGKH 3ZZDA 2OBOA 2Z3DA 2QXHA 1P2NA 3TLOA 1YGCH 3BTWE 3MH4A 1GMHG 3RMLH 1VR1H 2TGDA 1T8MA 1SGNE 5FBIA 1PPHE 1FJSA 1E36B 1GDUA 1V6DA 2M5TA 3ATKA 1ZMJA 1BJUA 2GD4B 3HKJB 4R8TB 4J2YB 1P03A 1MBMA 1Y5UT 2J4IA 2GP9B 1ZTLA 1SGCA 3RP2A 5LGOA 3ENSB 3ZZ4A 4BTIB 1BDAA 2TRMA 5JBAS 1GHAF 1FZZA 3Q3KA 1RIWB 1AU8A 5AVDA 2STBE 3GY7A 3V7TA 3UUZA 3PO1B 1DWEH 1VGCB 2R3UA 2DE8A 2ZPRA 3SHAH 3MU5A 4GCHF 1E34B 1BRAA 1C4V2 2FODA 2Y6TA 4WMFA 1KDQB 2BOHB 2PTNA 5C67A 5L2YH 5EW2H 1UTNA 4TPIZ 5SGAE 2Y5HA 2FYRA 1OX1A 2A2QH 4IC5A 2OTVA 1TWXB 2BVRH 3P6ZB 3UTUH 2FLRH 1DY9A 2VVCA 4MTBA 1T8NA 1UTPA 1Z8GA 2PGQB 1GMHF 2HLCA 2PKAB 2TPIZ 4WH6A 4TYDA 1O3LA 1K1NA 4WWYA 1TYNA 2R0KA 4OS2A 2OP9A 4B73A 1Y59T 3SZNA 1O3JA 2GCHF 4NA9H 3TPIZ 1GDQA 2ZG0H 1ELCA 1GMDG 1HUTH 1BTXA 2ZDVH 1BCUH 3SBKA 1C2MA 4BNRA 1F2SE 2C93B 1B0EA 3W94A 3UOPA 3T28A 1HAGE 3QTOH 4NCYA 1O31A 4OS6A 1C1UH 1ZPZA 4IS5A 1ARCA 3BV9B
chains in the Genus database with same CATH superfamily
3RXAA 2FOCA 3PMJA 3ZZ6A 5HKKD 2BX3A 3VB5A 3MOCA 2ZDLA 4Q4LA 5L6NH 3N7EA 1C5SA 2ANMH 2PLXA 1Y8TA 5DP7A 3PMHB 5AFYH 2G4UA 1SLXB 1C1OA 1FY8E 5C5NA 1OWHA 4DY7B 2XTTB 4P00A 4UFGH 1PPGE 1AMHA 4I32A 3F2HA 1GI0A 2FOAA 4O97A 3A82A 1C1MA 1HJAB 3AW1A 2A31A 2BLVA 3SUEA 1O2IA 4TY6A 1KTTB 1ELGA 3SUDA 1Y5BT 2ZI2H 5F8TA 2LP6A 1P2QA 1C5XB 1DVAH 4MNWA 5LPEA 2ZFQH 2QGRA 2CGAA 3PV5A 3M7TA 2J94A 1CSOE 1GBMA 2W6JD 2EI6A 4IGDA 3F9FA 5EXLA 5EPYA 2G51A 5FXLA 1IQHA 2H9EH 2LPRA 4FXGH 5GJ4B 2ZP0H 1EPTC 1YPHC 3JZ1B 4XBBA 5FPYA 1HIAB 3RC6A 1C2EA 1GMDF 2EEKA 1EJMA 1LVYA 2V3OH 1DDJA 2OD3B 3NPSA 4X8UH 3TJNA 3UNSA 2D26C 3OU0A 1GJDB 3V13A 1ZLRA 2NU0E 1QB1A 3W95A 1O30A 2JIZD 1O3NA 3M5NA 1HAXB 2O8TA 5G4BA 1FLEE 1W0KD 6LPRA 1RRKA 1UTQA 2JH0D 5A0BA 4ZUHA 1HAPH 1IQJA 1ZOMA 4DW2U 3ZZBA 1AWHB 1TPOA 1GGDB 2QF3A 5DSFA 3OY5U 2P3TB 1FUJA 2FS9A 1P0SH 2Z94A 2WYJA 1EAWA 3RXRA 2P94A 1DE7H 1KSNA 3LGIA 3GY4A 4PROA 1DXPA 4MPVA 3KGPA 1O3GA 1MTNB 1TBRH 1YBWA 3L6PA 1WTHD 1DSTA 1MUEB 2Z3EA 2PTCE 1L2EA 1UK4A 1Y3YA 2Z9JA 4X6NA 2KZ4A 1O35A 1XX9A 2F9OA 2FWWA 2AERH 1NM6A 2IPQX 2V6NA 1NY22 3GYLB 4NG9H 5HGGA 3LONA 1DY8A 1ESAA 1BITA 3FKSD 1S83A 2ZDKA 1LVBA 1ORFA 2A7HA 1SC8U 2Z6BD 3CP7A 1MCTA 2G00A 4HG6A 2HNTC 1PQAA 3NCLA 2H5DA 1IHTH 1RD3B 2ZTZA 5T6GA 1DT2A 4JYVH 5L30H 4RN6A 4KGAA 2Q6DA 2R9PA 2EI8A 1WV7H 3QDZB 1BHXF 5A8XA 3PMBB 3ZZAA 3OFND 5GCHF 1C5UA 1A0LA 1AVXA 1LPGB 3MU0A 3K6YA 2VIOA 2CMYA 2OQ5A 5CHAB 4CRGA 5DGJA 2AIPA 3FANA 4O3UA 2WPJS 4NIVA 2TGPZ 3SV2H 3WW7A 1QA7A 1ZYOA 2PSYA 2A5AA 2FTLE 3OYPA 1N6YA 1OXGA 1QRWA 3P8NA 4SGAE 1JBUH 2H9HA 2J2UA 3F68H 2J92A 1C4U2 3S69A 5F8XA 3ZZ7A 1UVSH 2VVUA 4DT4A 5JPMH 1GBBA 1A0HB 2QXGA 1O2KA 1YM0A 2GT7A 4ABBA 4FUFA 4YLUA 2F91A 2A5IA 7GCHG 4LZ1H 1AD8H 3O8DA 1KXDA 1EAUA 1PQ5A 3MYWA 4RKOB 2VU8E 5FX6A 3ZZCA 1QB6A 1TA6A 1MD8A 2YNBA 2BHGA 4DURA 1TGTA 1GBLA 1UVPA 5EODA 1GJCB 2OC7A 3BTME 3ZV8A 2ZCKP 3SU4A 1QRXA 3KQCA 3F9HA 1KLJH 3A7YA 1ZHRA 1NRQH 1YC0A 2WUCA 1HYLA 1HGTH 1NRNH 1P05A 3KIDU 1E38B 3QZRA 5A8YA 3UNRA 1ZTJA 1QJ7B 3U1IB 5DJ7A 1TRYA 3LT3A 3TITA 3OAAD 1DX5M 1XUIA 5HM9A 3RXUA 2SFAA 3RXVA 2J9NA 2G52A 1ELAA 2AGGX 2KCYA 3LOXA 3A7XA 1SBWA 5GPIB 1NBME 1BMLA 1BB0B 1QRZA 5HYOA 3LJJA 1C1NA 3SW2B 4Y8YA 1GJ8B 1SHYA 2CF9H 3DT0H 1C1RA 1K1OA 1FY4A 1A0JA 1HAVB 3E90B 1C2GA 1O5BB 3D23A 1IQIA 1ZZZA 1ELEE 1SGFG 1XUGA 3HK3B 1L1GA 3EE0B 2FX4A 4WJG2 4X1PU 4XFQA 5ESBA 2G4TA 4B2BA 4CH2B 4GHTA 2IPHA 4NIXA 1ANBA 4TWWA 1O3KA 1TABE 4MNXA 2JH5D 4ISOA 1IQNA 2FOHA 4VGCB 5C0TA 1O2GH 3RM0H 3SGBE 1NC6A 1TOMH 3FZZA 1QURH 3A8CA 2XC4A 2ZO3H 2Q6FA 4M9FA 5DP3A 1D3DB 1DUAA 1QNJA 1Q2WA 6GCHG 1IOEA 1EAIA 2PW8H 1O3BA 3TGJE 4ZHLU 1XUFA 3SV6A 4MG3A 2R3YA 1EOLA 1TNHA 3WY8A 1GI9B 1GHYH 5JYIA 3S9CA 1GCTC 3P8FA 2C4FH 8LPRA 2UWPA 5DK1A 5DP5A 2SGPE 1S6HA 1UHBB 5LH8A 1J17T 5HIYA 2HRVA 4YT6H 4ACBA 4B2CA 2FI5E 3TVJB 4RI0A 2IJOB 2F9UA 2BQ6B 3BEFB 1O3CA 1XXFA 2UUFB 2VWMA 2VINA 3SHCH 1XMNB 1AI8H 1A7SA 4ZKSU 1VITG 5TCCA 1NROH 1F0TA 1O32A 4OGXA 2F4LA 2ANKH 4FUEA 4CREA 3T25A 1ZJDA 1AN1E 1O3HA 4A1VA 1PPBH 3E3TA 5IK2D 1D6RA 2BM2A 2FI4E 1GPZA 4ABIA 2AIQA 3RXSA 1GJ7B 5FX5A 2ZDNA 4X1RU 5EJZA 1T7CA 4TSFD 4FUIA 3RXOA 1GI3A 4U2WA 3O8CA 1KMHB 3K65B 1O2XA 1LO6A 3H5CB 4LOYH 1O34A 2YMSC 2RDLA 4Q2KA 3S7KB 6GCHF 4CRBA 4I86A 2ZHFH 4K3JA 1MQ6A 1OWKA 1F0SA 3M7QA 3KNXA 1GL0E 4DVAU 2P59A 1C1VH 2FOGA 2H5CA 1HJ9A 3ZZ5A 4ABGA 1QQ4A 1DPOA 1O3FA 1TGSZ 5TJXA 4BAQB 1SGQE 1GG6B 1EPTA 1V2LT 2PFEA 5E0HA 1ELTA 4X8SH 2ZQ1A 3URCA 3DSOA 1C9TA 1P04A 1O2QA 3PV2A 2QYIA 1S0QA 3FP7E 1QJ1B 3H09A 1V2RT 2C8ZB 2ZFPH 3QX5H 3ATWA 1AY6H 5EW1H 1Y5AT 2XNIA 3FN8A 2H6MA 3GYMA 3A8BA 4DIHH 1MAXA 3QO6A 1VITF 4F48B 1YKTA 1QBOA 3M5OA 1F5RA 1C5OH 4UDWH 1TGCA 2ODPA 1SLUB 3PO1C 2FXRA 1TIOA 3ESTA 2BD3A 4H6SB 1C5MD 2FO9A 8GCHG 1MAYA 1NRPH 3BG8A 3GISB 3V0XA 1E35B 5DG6A 1SGTA 2H1UA 3RU4T 5CMXH 4I33A 2B0FA 2J5UA 4MDSA 3TNTA 1S6LA 2ZGCA 1NFUA 1Y3XA 1BMMH 1GBJA 3U1JB 3QLPH 2EI7A 2HNTE 1F92A 4AG2A 1ZRBA 2BY5X 1L0ZA 4DG4A 1FAKH 1PPFE 3VXEH 1AZ8A 1BTHH 3E1XB 4ZAEA 1MTWA 2Z9KA 1GI2A 1CBWC 1V2OT 2AYWA 3A86A 1BHXB 4DCDA 5ETXA 4D8NA 5TCAA 4DT7B 1BOQA 3EYDA 3SU0A 2TBSA 1KY9A 1BMFD 1BTUA 1K1MA 1GBFA 3EAJA 4MVNA 1EB2A 1XVOA 1QBNA 3HPTB 1W0ZU 3VG8A 4U32A 3RMMH 1SGDE 2XNDD 1WSSH 1UTLM 5C1UA 1ZSJA 1T8LA 1EUFA 1BQYA 1XKAC 2BB4A 1NN6A 2HALA 1K28D 3KQDA 5IDKA 1O38A 5EPNA 1ZPCA 3FO8D 5E0GA 1WCZA 1AQ7A 2VNTA 2ZU3A 2TIOA 5F6MA 1H8DH 1T31A 2Z3CA 5A2MH 4AFZA 1Z8RA 1MZAA 3BTGE 3LC3A 4OM9A 4X1QU 1GJBB 1G3DA 3WWFA 1UTJA 2AHME 4Y7BA 3BIVH 1GHBG 4IN2A 2V35A 4I8JA 5K0HA 2ZPQA 5CDFE 4ABAA 1O33A 3L3TA 3P92A 3G01A 4BAKB 3Q77A 1O5EH 3PYHA 4JYTA 1XVMA 4X2VA 3Q3XA 4SGBE 1O5CB 1HAOH 2UUYA 1O2OA 1HBTH 1P06A 2GCHG 2VIDA 2AH4X 4XRNA 5GIBA 3GCHB 4MLFB 3M35A 4CRDA 1IAUA 2BMGB 2ZHWH 1SGPE 1AFQB 3E0NB 1KXFA 1Y3VA 1BTZA 2VWNA 4CH8B 3OEHD 4AOQA 1A3EH 1M9UA 1UCYE 1IHSH 4INHA 1QL7A 4K1EA 1GJAB 2G5NA 4JZFH 3MH7A 5PTPA 3PMAB 2NWNA 4GPGA 5C5OA 3ZVFA 4I7YH 4AX9H 1O5AB 4UFEH 2CJIA 2K0QA 3UY9A 1O2LA 1K21H 1X7AC 3SQHE 1C5WB 2PP6A 3RXFA 2XWAA 2QCYA 3DFJA 4X6PA 5JDUB 1LVOA 2GMTC 2ZTXA 3QZQA 1BJVA 1DWDH 1GJ4H 5AHGH 4Q63A 4K1SA 3PLKA 4Q80A 1YYY1 2ZU2A 3T27A 3BTQE 1C5QA 5EU8A 1OS8A 4CR5A 1NO9H 2P8OB 3S9AA 1AKSA 1N8OB 3KQ5A 4GVUA 4Y8XA 1GBIA 4WH8A 4CHAB 2VIVA 1BBRH 3T26A 1KXAA 1GHBF 2ZCLP 1V2TT 2CF8H 2LELA 1ESTA 1K0HA 3MU4A 1E0FD 2FM2A 2C90B 1W0JD 1C5ZB 2J98B 3R0FA 3VPKA 3U9AH 1ZSLA 1BBRE 1P01A 1WYKA 5DN6D 4TWYA 1TOCB 3LJOA 4YESB 3GDSA 2HVXA 1O2RA 3UPEA 4AB9A 1E1RD 2FPZA 3K2UA 2JETB 1AUTC 3STJA 1TBQH 4F55A 4LZ4B 1FY5A 1C2DA 3VXFH 4AGJA 3LU9B 1HV7A 3GY8A 1BT7A 2XRCA 5A0AE 3SJ8A 2ZGJA 2ZGXH 4GUXA 4I8HA 2SNWA 3PWCA 1BMNH 4CRAA 1FY1A 2FMJA 1O2SA 3SU1A 4AYYB 5CHBA 1LHFH 3M7UA 1SPJA 1EJNA 2C8WB 1C1QA 3ATIA 2BDIA 3KQEA 3SORA 1AE5A 3MTYA 4ACAA 4H6TA 5F8ZA 4O3TA 3RC5A 3SYJA 1A3BH 1DLEA 1LHCH 3PLPA 4U01A 3GOVB 3AW0A 4K5ZA 3UWIA 4BTUB 1NZQH 2JJ2D 3KCGH 1EASA 2KR7A 1ZJKA 2XBXA 4INKA 4E06H 5IYTA 3JZ2B 1NTPA 1TB6H 2GVFA 4GSOA 1YWUA 3DA9B 3A84A 1SGRE 1SGIB 1QHRB 1VCWA 2WPMS 1MCVA 2JJ1D 3LGYA 3UAIC 3HGNA 1CQQA 5GNDA 1XKBC 3K6ZA 3BIUH 1OWJA 1CU1A 3T29A 5GCHG 3RXBA 4D7FA 2UWOA 2ZFFH 2PHBA 3SI4H 1TA2A 3ZVCA 1L4ZA 3MI4A 1NS3A 2EC9H 2STAE 2PWXA 4ABHA 1PYTD 4A7IB 2K1QA 4AFUA 1AWFH 1XUKA 1TAWA 3A7TA 4FUJA 2WPDD 4IBLH 4MQAA 1B7XB 2PKSB 2QF4A 2J38A 4IMZA 4A6LA 5E0JA 4AG1A 3TNSA 2BDGA 1C2HA 1OP8A 2A0QB 1C2FA 1HXEH 2BVXH 5HM2A 2VGCC 1FPHH 4YLQH 1A5GH 1RJXB 4JZDH 1P09A 4A5TS 2NU4E 3IG6B 2XOKD 1MBQA 2ZGBH 2K8IA 1GVZA 1BA8B 4RT0A 2RA0A 1C5VA 1ZMLA 1EX3A 2ZHQH 3E0PB 3NZIA 4XD7D 5E2PA 5A8ZA 1AFEH 1TNKA 3KQBA 4ABFA 3DSGA 1FAXA 3HATH 3A81A 4J1YA 4VGCC 4NA7A 1TBZH 1UVTH 1J8AA 2ODQA 1VCQA 2GV6A 5EGMA 1N1LA 2SGFE 1O36A 1EZQA 1LHGH 1IQFA 1LMWB 2A7CA 2D2DA 2O9QA 2VH6A 3M61U 1NESE 3WWBA 1YLNA 4X0WU 3BG4C 1S82A 4Y76A 3RXDA 1HJ8A 3KF2A 3SJ9A 1GVKB 1SSXA 1UTOA 3GICB 3MFJA 2ZWLH 1QL8A 6ESTA 3RXEA 3VB3A 1KXEA 2V7QD 2PR3A 2QIQA 4Y71A 1G36A 4CR9A 3V3MA 4AC9A 1BBRK 1Q3XA 2BOKA 2A5KA 1OWEA 4Y0YE 2ZQ2A 3OX7U 2RG3A 3B9FH 1QFKH 3RU4D 5DPAA 5GWZA 3A7VA 2B7DH 5DP6A 4DOQA 2VJ1A 1K9OE 3ZVDA 3P8GA 3PTNA 3RXCA 4JZIA 4CBNA 1K1JA 3A87A 2GKVE 3MHWU 1C2IA 1FPCH 2VB0A 4CRFA 4AZ2B 2SGAA 1E37B 4I31A 2M2AA 1AVWA 1EZXC 3SQEE 3P95A 1D6WA 1O2NA 2XCNA 4THNH 5JBCS 5T3HA 4B76A 3FFGA 1O2HA 4YTAA 3R3GB 1SKYE 1ZGVA 8KME2 1UW7A 2FESH 1AO5A 1WQVH 2Y82A 1IQKA 2ALVA 2RDEA 3V12A 2A7JA 2FP7B 5EJLA 5FCKA 4ZH8A 1TFXA 3RXJA 1MTUA 5FPSA 1VJAU 9ESTA 1ZR0A 4K1TA 1V3XA 1F0UA 1Z1IA 3SOSA 1TPSA 1AHTH 4INLA 1IQGA 1XXDA 1IQEA 1YPMH 1CA8B 2VIQA 2ANYA 1MTSA 4Y10E 2W5EA 3KYFA 2BZ6H 1H8IH 1EPTB 1XUHA 4UEHH 1CGIE 2ZC9H 1FY3A 1MKXK 2XCFA 4FU9A 3ZVAA 1Z7KA 1GG6C 3BF6H 4X1NU 1CHGA 2BDHA 3OSYA 1DWBH 4NIWA 2YOLA 4ZHMU 4RKJB 5EQQA 1Q31A 4XE4A 4XBCA 3A80A 3QWCH 2RCEA 1GI1A 4ZKRU 1TMBH 2HPPH 1UK3A 2GCTC 1ZHMA 2VWOA 1CA0C 1S85A 3SUGA 3U8OH 1TX7A 3GCNA 5JB8S 1FMGA 1OYTH 4M7GA 1THRH 2L6OA 5J4SA 4UD9H 4OS4A 4BAMB 2ZU5A 1C5PA 3FVFB 4KKDA 4D7GA 1DS2E 1GBTA 1WBGB 2XYAA 3BTDE 4BAOB 2F83A 1RFNA 2W7SA 1G2MA 5EG4A 4K69A 2VIWA 3OY6U 1OWDA 4Y6DA 1T4UH 4B74A 2ZECA 1J15A 1KTSB 1L1NA 3OTPA 3SNDA 3VB7A 1GL1A 1EAXA 1P2JA 2BD8A 1W11U 2GZ9A 1MD7A 1MMJN 4FVDA 2WZQA 9LPRA 2AMPA 2WUBA 3IITA 1J9CH 1OP2A 2WPKS 4TT3D 3NRLA 2UWLA 4R0IA 3A7WA 1DANH 3ZVGA 2SGEE 3D49H 3BEIB 3MQKC 2OINA 1EFRD 1Z1JA 1O2PA 3IWMA 4CBOA 1BUIA 2ALPA 3OEED 2BY6X 2EY4C 3UFAA 3M5LA 1G9IE 1W7XH 1LCYA 3PB1E 1UMAH 3N7OA 5DO4H 2ZKSA 4WVPE 2B5TB 3GCTG 1YPJH 2F9BH 3VGCC 4ABJA 1P9SA 2A32A 1G32B 1QL9A 2BD5A 1KYNA 3SNEA 1DICA 1P02A 2FOFA 2PGBB 5JBBS 1GVLA 2D1JA 3F0PA 4Q7YA 3UR9A 4OS5A 1GBCA 3NWUA 1H9IE 1HFDA 2RA3A 4Y8ZA 1TX6A 1EZUC 4DJZB 1H1BA 2B8OH 4ISNA 3GY6A 2WPHS 3NUMA 3MMGA 5H4IB 1QR3E 4AN7A 1TGBA 3I29A 3SV8A 3SNAA 2XC5A 1W10U 1WQSA 4FUBA 1D3QB 4IMQA 2QN5T 2ULLA 4WMDA 3ZIAD 2BQ7B 2ZU4A 3GCHC 4FVBA 1ID5H 1THSH 3CENA 1W3CA 2NU3E 3BSQA 2Y7XA 1AFQC 1OWIA 5A09A 2BY9X 4B75A 1BTPA 3ELAH 2KX4A 1DXWA 2J95A 2HLDD 1C5YB 3SGQE 1C1WH 1LDTT 1H9LB 1Z71A 1G3BA 4Q7XA 3RLWH 3P17H 1TQ7B 4KELA 4ASHA 1YY3A 2A45B 1WUNH 1NFWA 1RIWC 2CHAB 2Z9IA 1PPEE 1JXPA 1QZ8A 4XBDA 1FIZA 2VBCA 3BTKE 1V2PT 3GCTF 3QGJA 2P16A 4WXVA 3I78A 4UFDH 1VGCC 3FP8E 3E16B 4IW4E 3LH3A 2QC2A 3ZVBA 5DP4A 4ABDA 2W26A 4ZMAH 4FOUC 3T2NA 3QTVH 4JCNA 1O2JA 2FYQA 3I77A 2GV7A 3UOUA 5JB9S 1QA0A 3PRDA 1S0RA 4MPWA 1NU7B 4BXSA 1TRMA 2VH0A 4H42U 2OLGA 2ZGHA 4MPUA 4CHAC 3W1EA 1D4PB 3SU5A 1DLKB 3S7HB 5C1XA 2ZDAH 2SGDE 3C27B 3Q3YA 4JYUH 2AEIH 4Y11E 1WXRA 4WMEA 4K8YA 4B6FA 2ZFRH 2QXJA 1GI7B 2BLQA 3B23B 3QUMP 1QCPA 2QF5A 2XXLA 2WV4A 1ZHPA 1BZXE 5DP9A 2VIPA 1SMFE 3MO9A 1O2TA 4BTTB 1TMTH 3PLBA 4Y0ZE 1K1PA 3AK5A 4UFFH 1TRNA 2GDDA 5C20A 1OPHB 1GCTB 2BDCA 5BRRE 1CVWH 1GBEA 2YNAA 1HXFH 2BQWB 3BEUA 2W6ID 2ZNKH 3RMOH 3MU8A 3GDUA 3Q00A 2H9TH 3MNCA 3LDXH 4Z1MD 1AVGH 3MNXA 1KIGH 2R2MB 1O2VA 2KFWA 1H4WA 3TJVA 1C1SA 2BY7X 2KAIA 1MABB 1A61H 1AUJA 1HCGA 1O2MA 1S81A 4FETA 1K2I1 1JWTA 1FN6A 2BDYA 4DIIH 3U98H 4JZEH 1V2MT 5EIYA 4Y79A 4AB8A 5J4QA 1HJAC 1THPB 1SVPA 1MKWH 3SU2A 1UCYH 3TGKE 1MH0A 1KXBA 3PV4A 1PPCE 2FIRH 2BY8X 1TLDA 1N6XA 2Z9GA 3C1KA 1G3CA 1GJ9B 5HMAA 1WDIA 5C17A 1P57B 3N7DA 1EOJA 1VJ9U 1W0YH 3TH3H 2XBWA 2YMSB 3F6UH 4GHQA 3Q76A 1SLWB 2O8MA 1C1PA 5C3NA 1OSSA 1DWCH 2FZZA 3GY2A 1S84A 1O5FH 1C5LH 1QBVH 2GZ8A 2BLWA 1OYQA 2GTBA 1S5SA 4ISIH 3RMNH 3P70B 3UIRA 5ABWA 3RUOA 2G8TA 4E05H 3D62A 2PUQH 4ABEA 2Y80A 5F53A 3DHKH 2W3IA 1LVMA 1SL3A 3UREA 4UONA 3MO6A 1AB9B 1FN8A 1OP0A 4O9VA 5FL7D 3TJUA 1ETRH 4NIYA 4YOJA 4NWKA 1GGDC 4YT7H 1O3MA 4NWLA 3TH2H 3UQVA 1LQDB 1SI5H 2PKSC 6CHAB 2ANWA 4X6MA 3GCOA 5C2ZA 1O3OA 8ESTE 1DITH 1MTNC 1HAZB 1ANEA 1O2UA 1INCA 2C3SA 1P2KA 1P9UA 2P3UB 1C2JA 1OOKB 1BMAA 3ATLA 2ILNA 1QTFA 4Q7ZA 3M37A 1GMCG 4JK5A 1YCPH 2ZCHP 1Z6EA 1A5HA 1EB1H 4ISLA 2BX4A 3TGIE 3H7OA 1ZRKA 4YOGA 1PQ8A 2THFB 4D76A 1NFXA 3M3VA 1HNEE 3HK6B 1ELFA 1GDNA 3EDXB 2TGTA 1C2KA 1F0RA 2Q1JA 3KN2A 4I8KA 1H8ED 3EQ0H 1Y3WA 2CV3A 1D3PB 1WOFA 1ARBA 1E79D 1SQAA 3NXPA 5FAHA 2I6QA 1V2WT 1CBWB 1AGJA 1UVOA 2OC1A 3KL6A 1QGFA 4D9QA 2WPLS 5ESTE 3FZDA 1RTLA 4K60A 2CXVA 3RXIA 1S6FA 4HFPB 3VB4A 1GI6A 4TY7A 1ANCA 2Y5FA 2HNTF 2OCVB 1PPZA 2GJGA 5CHAC 1O37A 2O8LA 3ZVEA 2G5VA 1TONA 4X1SU 3SN8A 2OBQA 2A4RA 1W2KH 3AAVA 2BD2A 1Z8IB 3F0OA 2O8UA 2OK5A 4H4FA 4X8VH 1TALA 4LXBH 4KTUA 2QAAA 1J14A 7LPRA 1RTFB 4F4OC 3A83A 1JRTA 1QJ6B 1FNIA 1FXYA 3RXQA 1MKXH 1V2UT 1O3PB 1GHXH 1RGQA 4IN1A 1TNGA 1ZTKA 1EP5A 1RXPA 2ASUB 3BTTE 1GI4A 1VZQH 1GMCF 3SI3H 3PTBA 2ZZUH 2F9NA 3EA8A 2LNCA 1RTKA 1YLCA 2ODYB 4ASUD 1GBAA 2BD7A 1P2MA 4ZCNA 3D65E 2FEQH 2WYGA 1V2NT 1SFQB 4B71A 2I6SA 4WF8A 3ZZ8A 2QV1A 1SB1H 1ZMNA 3DFLA 1C2LA 2OUAA 4OS1A 4AYVB 3STIA 3BTHE 2QF0A 4JK6A 1EQ9A 2Y81A 4ZHAA 5E2OA 1LKAA 4NFEA 3MH6A 3BN9A 3MO3A 4D9RA 2FTMA 1AE8H 3ITIA 3RU4E 3RXKA 2ZU1A 4NFFA 1W13U 3F9GA 3KYGA 3SUFA 5T6FA 1OHHD 1P8VC 2Y5GA 4I8LA 3P8OA 3RXPA 5T6DA 3ZYDA 1MKWK 4FUDA 5GXPA 1P12E 3T62A 1D9IA 1UCYK 4KTSA 5LPRA 2OC0A 3SGAE 3U8RH 5JBTA 7KMEH 3TJOA 3LKWA 3U28C 1NU9A 3RC4A 2OXSA 4UE7H 2GMTB 3FP6E 3RXHA 2W3KA 1CGHA 1BIOA 3RDZA 5E8EH 1Z6JH 1DM4B 3O8BA 4IC6A 1QIXB 3E6PH 1EXFA 3H7TA 5T1VA 7ESTE 1YLDA 1O3EA 2DE9A 1ESBA 1CT2E 4F49A 1CGJE 2BDAA 1KDQA 3T5FH 1XUJA 1ACBE 3ZZ9A 1KLIH 1HLTH 2BDBA 1MZDA 5C1YA 5EXNA 1ELDE 5A0CA 3QN7A 1FONA 2FI3E 3AAUA 3CS0A 3NKKA 3EA9A 1F7ZA 1P3CA 1BRCE 1K1IA 1YP9A 4CRCA 2BD9A 2VVVA 3F9EA 5DKMA 3RXMA 3SO3A 2ZHDA 3SJOA 4A1TA 2C8YB 3MU1A 1ETTH 2PKAA 1SQTA 3TK9A 1ELVA 3SZEA 5F03A 2YMSD 2GX4A 2G55A 2H2ZA 4X8TH 1A1RA 2GDEH 1NPMA 1O5GH 1COWD 2UUJB 2J98A 1C4Y2 2F3CE 3DUXH 3U8TH 3ZZ3A 2P93A 1ABIH 2PUXB 1C5RA 1K1LA 1DSUA 3E8LA 1P2OA 3F1SB 8GCHF 1A2CH 1L1JA 2UUKB 1QQUA 1C5TA 1H9HE 1GJ6A 1ZGIA 2RFKC 1IQLA 3S9BA 1YCPK 4AFSA 1U6QA 1LPKB 1HPGA 2JDID 2BVSH 5I46H 3HGPA 4NA8A 2QA9E 2FX6A 1O3IA 1O3DA 3QK1A 4E7NA 2GZ7A 2A2XH 1D3TB 4E7RG 2F9PA 1HDTH 3E91A 1GHVH 2W7UA 4YXWD 4ZKNU 3SV9A 1BTWA 2CK3D 3AASA 1P3EA 1FV9A 4YM9A 3PRBA 1SGFA 3TU7H 1Y3UA 2QY0B 3GDVA 2V3MA 4MPXA 1GBHA 2WINI 4ZXYH 1IQMA 2JKHA 1C9PA 1ZSKA 4FUGA 4Y7AA 5EQRA 1NT1A 1T8OA 1WTGH 1DUEA 2BD4A 2SGQE 3QGNB 1VITH 4XOJA 2O8WA 1MU8B 4Z6AH 1TQ0B 3M36A 1JIRA 1MU6B 2A4GA 3RLYH 1SFIA 2SNVA 2J97A 2TGAA 3VFEA 4YO9A 1EATA 1GWAA 1TNLA 1UTMA 4BOHA 1XM1A 1G3EA 1CE5A 2HWLB 5EOKA 4OS7A 2CN0H 2BXTH 2BYAX 2V3HH 2XBVA 4WXIA 2G81E 3SU6A 1TNJA 1HIAA 2XBYA 2FLBH 3SNBA 2EA3A 4HGCA 4B2AA 1G30B 1HAHH 5B6LA 1SHHB 2FDAA 2AFQB 3KHVA 4BAHB 3O8RA 1MQ5A 1EP6A 2CHAC 1LTOA 1GI8B 3URDA 3ZV9A 3A8AA 1HAYB 4BXWA 1YPKH 2P95A 1O5DH 5FBEA 4JZ1A 1TMUH 4NSVA 5FHTA 1O2ZA 4FUCA 5GDSH 3GY3A 1AIXH 1J16A 1PQ7A 1JMOH 2IN2A 3KEEA 3RM2H 1W14U 1O2WA 1QB9A 2ZA5A 1YPLH 2AGEX 1W8BH 2VGCB 1SG8B 1V2VT 2F9VA 1GJ5H 3MH5A 3LPRA 1EJAA 2ZTYA 4XSKU 3TH4H 4KP0A 2GT8A 3SJIA 1WU1A 2R0LA 2ZDMA 2HPQH 1K22H 2BTCE 1PFXC 1FIWA 2D8WA 2IJD1 4X6OA 7GCHF 1EZSC 5DP8A 2Q6GA 4YZUA 4ISHH 4FUHA 1HAIH 3EA7A 3MWIU 1O0DH 2ZPSA 3ZYEA 1TGNA 4K2YA 1G2LA 4QT8C 2V0BA 1ETSH 2NU2E 1UK2A 2IOTA 2OC8A 4I8GA 3NK8A 1CT4E 2ESTE 1GBKA 3A7ZA 3BG4B 1LHEH 1VCPA 4P02A 3F2FA 1YCPM 5AFZH 4BANB 1V2QT 2GGVB 3DSPA 1B0FA 1KXCA 1A5IA 1CO7E 1L4DA 1ZPBA 1GI5A 1PYTC 4GLYA 1YF4A 5I25A 1W7GH 3LGUA 2FOEA 4ZXXH 4O03A 2PV9B 3CS7A 2A4QA 2KAIB 3UWJH 2FOBA 3M5MA 4JMYA 1OKXA 1TPAE 1ANDA 3M3SA 3A88A 4NSYA 3VEQB 5FCRA 1F5KU 1AZZA 2PSXA 3S0NA 1BRBE 4ESTE 1NBMD 1UJ1A 3LGWA 2BZAA 4XDEA 1WAYB 3FAOA 3A89A 4AGKA 3PWBA 1SGYE 2AGIX 2JH6D 4MNVA 5HIZA 4A92A 3SV7A 1DOJA 5AF9H 2AMDA 2DUCA 2A4OA 3HKIB 4X2YA 1YPHE 3LH1A 3U69H 1Z8JB 5EQSA 1YPEH 1TX8A 3BTEE 2F43B 1GCDA 1RS0A 1LKBA 2ZEBA 1TE0A 2HGTH 2NU1E 2WV5A 2KM0A 4NGAH 4WY3A 2J34A 1SOZA 5C0UA 4NZLA 4LK4A 1MTVA 3N99A 3EE7A 1CHOG 3OE7D 5BPEA 3LGVA 3GS9A 1CT0E 1C1TA 3ATMA 3L33A 3PROA 3UNQA 4AORA 1A4WH 3TK6A 1ELBA 1O3AA 2ZFTA 4X2WA 1LQEA 3DD2H 1P11E 1NFYA 1F5LA 2VWLA 1FDPA 1SLVB 1G37A 2A1DB 1V2ST 1T4VH 1UVUH 1AB9C 1SQOA 1YPGH 5KGOA 1NRSH 2Y7ZA 4ZKOU 3ODDA 3GY5A 2QE7D 3SJKA 3SU3A 1AKSB 1GHWH 3LIWA 1A46H 1V2KT 2P8OC 2GCTB 6CHAC 1CA0B 2P3FH 3MNSA 1P10A 2KCPA 4FU8A 3RXTA 1N8OC 5HXFA 3UR6A 1SGEE 4KTCA 5L2ZH 5B6OA 3A8DA 1HAVA 3F2GA 2FS8A 1V2JT 1VKYA 2ZFSA 4GAWA 1HRTH 4NZQA 4TPYA 5LPFA 2C8XB 1SOTA 4A1XA 3MNBA 2BXUH 2WPIS 2XC0A 3PM3A 1FI8A 5EJ1A 4DGJA 3LC5A 1UTKA 2B9LA 2KCOA 3M3TA 1KLTA 1HB0B 4RT1A 1LPZB 1TPPA 4X2XA 3A85A 3TK5A 1W12U 2JETC 2AMQA 1BRUP 3DCLA 3SNCA 4Z0KA 4K8BA 4FU7A 3BTFE 1FX0B 1GHZA 3RXGA 2QXIA 1GBDA 3K9XB 3AVZA 1CHOF 1TNIA 4ZROA 1O2YA 2WHXA 3B8JA 4B1TA 5CE1A 2HVYB 3OTJE 1JOUB 2XW9A 3VB6A 1ABJH 4MNYA 1UHBA 1FQ3A 2BLOA 1GHAG 1UO6A 4HZHA 1PJPA 1T32A 4AFQA 5EXMA 1C5NH 2Z7FE 2ZHEH 3ODFA 4U30A 1BTYA 2ZF0H 2FOMB 2HOBA 4YOIA 3TIUA 2OQUA 3VGCB 3RXLA 1SR5C 3LGTA 3UB0A 4GCHG 1P2IA 1DFPA 4RSPA 1QY6A 1JIMA 1JRSA 1B5GH 1EKBB 2R2WU 1LHDH 2AS9A 2Z9LA 1NRRH 2XWBI 1O39A 4HTCH 3UQOA 5FPTA 5K7RA 4HI3A 4OGYA 2ZIQH 3EGKH 3ZZDA 2OBOA 2Z3DA 2QXHA 1P2NA 3TLOA 1YGCH 3BTWE 3MH4A 1GMHG 3RMLH 1VR1H 3CNRA 2TGDA 1T8MA 1SGNE 5FBIA 1PPHE 1SQRA 1E1QD 1FJSA 1E36B 5C94A 1GDUA 1V6DA 2M5TA 3ATKA 1ZMJA 1H8HD 1BJUA 2GD4B 3HKJB 4R8TB 4J2YB 1P03A 2EQNA 1MBMA 1Y5UT 2J4IA 2GP9B 1ZTLA 1SGCA 3RP2A 5LGOA 3ENSB 3ZZ4A 2L74A 4BTIB 1BDAA 2TRMA 5JBAS 1GHAF 2WV9A 1FZZA 3Q3KA 1RIWB 5KECA 1AU8A 5AVDA 2STBE 3GY7A 3V7TA 3UUZA 3PO1B 1DWEH 1VGCB 2R3UA 2DE8A 2ZPRA 3SHAH 3MU5A 4GCHF 1E34B 1BRAA 1C4V2 2FODA 2Y6TA 4WMFA 1KDQB 2BOHB 2PTNA 5C67A 5L2YH 5EW2H 1UTNA 4TPIZ 5SGAE 2Y5HA 2FYRA 1OX1A 2A2QH 4IC5A 2OTVA 1TWXB 2BVRH 3P6ZB 3UTUH 2FLRH 1DY9A 2VVCA 3F3BA 4MTBA 1T8NA 1UTPA 1Z8GA 2PGQB 1GMHF 2HLCA 2PKAB 2TPIZ 4WH6A 4TYDA 1O3LA 5KEDA 1K1NA 4WWYA 1TYNA 2R0KA 4OS2A 3FOAA 2OP9A 4B73A 1Y59T 3SZNA 1O3JA 2GCHF 2KCAA 4NA9H 3TPIZ 1GDQA 2ZG0H 1ELCA 1GMDG 1HUTH 1BTXA 2ZDVH 1BCUH 3SBKA 1C2MA 4BNRA 1F2SE 2C93B 1B0EA 3W94A 3UOPA 3T28A 1HAGE 3QTOH 4NCYA 1O31A 4OS6A 1C1UH 1ZPZA 2WSSD 4IS5A 1ARCA 3BV9B 4B6EA
chains in the Genus database with same CATH topology
3RXAA 2FOCA 3PMJA 3ZZ6A 2BX3A 3VB5A 3MOCA 2ZDLA 5L6NH 1C5SA 2ANMH 2PLXA 1Y8TA 5DP7A 3PMHB 5AFYH 2G4UA 1SLXB 1C1OA 1FY8E 5C5NA 1OWHA 4DY7B 2XTTB 4UFGH 1PPGE 1AMHA 4I32A 1GI0A 2FOAA 4O97A 3A82A 1C1MA 1HJAB 3AW1A 2A31A 2BLVA 3SUEA 1O2IA 4TY6A 1KTTB 1ELGA 3SUDA 1Y5BT 2ZI2H 5F8TA 1P2QA 1C5XB 1DVAH 4MNWA 5LPEA 2ZFQH 2QGRA 2CGAA 3M7TA 2J94A 1CSOE 1GBMA 4IGDA 2EI6A 3F9FA 5EXLA 5EPYA 2G51A 5FXLA 1IQHA 2H9EH 2LPRA 4FXGH 5GJ4B 2ZP0H 1EPTC 1YPHC 3JZ1B 4XBBA 5FPYA 1HIAB 3RC6A 1C2EA 1GMDF 2EEKA 1EJMA 1LVYA 2V3OH 1DDJA 2OD3B 3NPSA 4X8UH 3TJNA 3UNSA 2D26C 3OU0A 1GJDB 3V13A 1ZLRA 2NU0E 1QB1A 3W95A 1O30A 1O3NA 3M5NA 1HAXB 2O8TA 5G4BA 1FLEE 6LPRA 1RRKA 1UTQA 2JH0D 5A0BA 4ZUHA 1HAPH 1IQJA 1ZOMA 4DW2U 3ZZBA 1AWHB 1TPOA 1GGDB 2QF3A 3OY5U 2P3TB 1FUJA 2FS9A 1P0SH 2Z94A 2WYJA 1EAWA 3RXRA 2P94A 1DE7H 1KSNA 3LGIA 3GY4A 4PROA 1DXPA 4MPVA 3KGPA 1O3GA 1MTNB 1TBRH 1YBWA 3L6PA 1WTHD 1DSTA 1MUEB 2Z3EA 2PTCE 1L2EA 1UK4A 1Y3YA 2Z9JA 4X6NA 1O35A 1XX9A 2F9OA 2FWWA 2AERH 1NM6A 2V6NA 1NY22 3GYLB 4NG9H 5HGGA 3LONA 1DY8A 1ESAA 1BITA 1S83A 2ZDKA 1LVBA 1ORFA 2A7HA 1SC8U 2Z6BD 3CP7A 1MCTA 2G00A 2HNTC 1PQAA 3NCLA 2H5DA 1IHTH 1RD3B 2ZTZA 5T6GA 1DT2A 4JYVH 5L30H 4RN6A 4KGAA 2Q6DA 2R9PA 2EI8A 1WV7H 3QDZB 1BHXF 5A8XA 3PMBB 3ZZAA 5GCHF 1C5UA 1A0LA 1AVXA 1LPGB 3MU0A 3K6YA 2VIOA 2CMYA 2OQ5A 5CHAB 4CRGA 5DGJA 2AIPA 3FANA 4O3UA 2WPJS 4NIVA 2TGPZ 3SV2H 1QA7A 1ZYOA 2PSYA 2A5AA 2FTLE 3OYPA 1N6YA 1OXGA 1QRWA 3P8NA 4SGAE 1JBUH 2H9HA 2J2UA 3F68H 2J92A 1C4U2 3S69A 5F8XA 3ZZ7A 1UVSH 2VVUA 5JPMH 1GBBA 1A0HB 2QXGA 1O2KA 1YM0A 2GT7A 4ABBA 4FUFA 4YLUA 2F91A 2A5IA 7GCHG 4LZ1H 1AD8H 3O8DA 1KXDA 1EAUA 1PQ5A 3MYWA 4RKOB 2VU8E 5FX6A 3ZZCA 1QB6A 1TA6A 1MD8A 2YNBA 2BHGA 4DURA 1TGTA 1GBLA 1UVPA 5EODA 1GJCB 2OC7A 3BTME 3ZV8A 2ZCKP 3SU4A 1QRXA 3KQCA 3F9HA 1KLJH 3A7YA 1ZHRA 1NRQH 1YC0A 2WUCA 1HYLA 1HGTH 1NRNH 1P05A 3KIDU 1E38B 3QZRA 5A8YA 3UNRA 1ZTJA 1QJ7B 3U1IB 5DJ7A 1TRYA 3LT3A 3TITA 1DX5M 1XUIA 5HM9A 3RXUA 2SFAA 3RXVA 2J9NA 2G52A 1ELAA 2AGGX 3LOXA 3A7XA 1SBWA 5GPIB 1BMLA 1BB0B 1QRZA 5HYOA 3LJJA 1C1NA 3SW2B 4Y8YA 1GJ8B 1SHYA 2CF9H 3DT0H 1C1RA 1K1OA 1FY4A 1A0JA 1HAVB 3E90B 1C2GA 1O5BB 3D23A 1IQIA 1ZZZA 1ELEE 1SGFG 1XUGA 3HK3B 1L1GA 3EE0B 2FX4A 4WJG2 4X1PU 4XFQA 5ESBA 2G4TA 4B2BA 4CH2B 4GHTA 2IPHA 4NIXA 1ANBA 4TWWA 1O3KA 1TABE 4MNXA 2JH5D 4ISOA 1IQNA 2FOHA 4VGCB 1O2GH 3RM0H 3SGBE 1NC6A 1TOMH 3FZZA 1QURH 3A8CA 2XC4A 2ZO3H 2Q6FA 5DP3A 1D3DB 1DUAA 1QNJA 1Q2WA 6GCHG 1IOEA 1EAIA 2PW8H 1O3BA 3TGJE 4ZHLU 1XUFA 3SV6A 4MG3A 2R3YA 1EOLA 1TNHA 3WY8A 1GI9B 1GHYH 5JYIA 3S9CA 1GCTC 3P8FA 2C4FH 8LPRA 2UWPA 5DK1A 5DP5A 2SGPE 1S6HA 1UHBB 5LH8A 1J17T 2HRVA 4YT6H 4B2CA 2FI5E 3TVJB 2IJOB 2F9UA 2BQ6B 3BEFB 1O3CA 1XXFA 2UUFB 2VWMA 2VINA 3SHCH 1XMNB 1AI8H 1A7SA 4ZKSU 1VITG 5TCCA 1NROH 1F0TA 1O32A 4OGXA 2ANKH 4FUEA 4CREA 3T25A 1ZJDA 1AN1E 1O3HA 4A1VA 1PPBH 3E3TA 1D6RA 2BM2A 2FI4E 1GPZA 4ABIA 2AIQA 3RXSA 1GJ7B 5FX5A 2ZDNA 4X1RU 1T7CA 4FUIA 3RXOA 1GI3A 4U2WA 3O8CA 3K65B 1O2XA 1LO6A 3H5CB 4LOYH 1O34A 2RDLA 4Q2KA 3S7KB 6GCHF 4CRBA 2ZHFH 4K3JA 1MQ6A 1OWKA 1F0SA 3M7QA 3KNXA 1GL0E 4DVAU 2P59A 1C1VH 2FOGA 2H5CA 1HJ9A 3ZZ5A 4ABGA 1QQ4A 1DPOA 1O3FA 1TGSZ 5TJXA 4BAQB 1SGQE 1GG6B 1EPTA 1V2LT 2PFEA 5E0HA 1ELTA 4X8SH 2ZQ1A 3URCA 1C9TA 1P04A 1O2QA 2QYIA 1S0QA 3FP7E 1QJ1B 1V2RT 2C8ZB 2ZFPH 3QX5H 3ATWA 1AY6H 5EW1H 1Y5AT 2XNIA 2H6MA 3GYMA 3A8BA 4DIHH 1MAXA 3QO6A 1VITF 1YKTA 1QBOA 3M5OA 1F5RA 1C5OH 4UDWH 1TGCA 2ODPA 1SLUB 3PO1C 2FXRA 1TIOA 3ESTA 2BD3A 4H6SB 1C5MD 2FO9A 1MAYA 1NRPH 3BG8A 3GISB 3V0XA 1E35B 5DG6A 1SGTA 2H1UA 3RU4T 5CMXH 4I33A 2B0FA 4MDSA 3TNTA 2ZGCA 1NFUA 1Y3XA 1BMMH 1GBJA 3U1JB 3QLPH 2EI7A 2HNTE 1F92A 4AG2A 1ZRBA 2BY5X 1L0ZA 4DG4A 1FAKH 1PPFE 3VXEH 1AZ8A 1BTHH 3E1XB 4ZAEA 1MTWA 2Z9KA 1GI2A 1CBWC 1V2OT 2AYWA 3A86A 1BHXB 4DCDA 5ETXA 4D8NA 5TCAA 4DT7B 1BOQA 3EYDA 3SU0A 2TBSA 1KY9A 1BTUA 1K1MA 1GBFA 3EAJA 4MVNA 1EB2A 1XVOA 1QBNA 3HPTB 1W0ZU 4U32A 3RMMH 1SGDE 1WSSH 1UTLM 5C1UA 1ZSJA 1T8LA 1EUFA 1BQYA 1XKAC 2BB4A 1NN6A 2HALA 1K28D 3KQDA 5IDKA 1O38A 5EPNA 1ZPCA 5E0GA 1WCZA 1AQ7A 2VNTA 2ZU3A 2TIOA 5F6MA 1H8DH 1T31A 2Z3CA 5A2MH 4AFZA 1Z8RA 1MZAA 3BTGE 3LC3A 4X1QU 1GJBB 1G3DA 1UTJA 4Y7BA 3BIVH 1GHBG 4IN2A 2V35A 4I8JA 5K0HA 2ZPQA 4ABAA 1O33A 3L3TA 3P92A 3G01A 4BAKB 3Q77A 1O5EH 3PYHA 4JYTA 1XVMA 4X2VA 3Q3XA 4SGBE 1O5CB 1HAOH 2UUYA 1O2OA 1HBTH 1P06A 2GCHG 2VIDA 2AH4X 5GIBA 3GCHB 4MLFB 3M35A 4CRDA 1IAUA 2BMGB 2ZHWH 1SGPE 1AFQB 3E0NB 1KXFA 1Y3VA 1BTZA 2VWNA 4CH8B 4AOQA 1A3EH 1M9UA 1UCYE 1IHSH 4INHA 1QL7A 4K1EA 1GJAB 2G5NA 4JZFH 3MH7A 5PTPA 3PMAB 2NWNA 4GPGA 5C5OA 3ZVFA 4I7YH 4AX9H 1O5AB 4UFEH 2CJIA 3UY9A 1O2LA 1K21H 1X7AC 3SQHE 1C5WB 3RXFA 2XWAA 2QCYA 3DFJA 4X6PA 5JDUB 1LVOA 2GMTC 2ZTXA 3QZQA 1BJVA 1DWDH 1GJ4H 5AHGH 4K1SA 3PLKA 4Q80A 1YYY1 2ZU2A 3T27A 3BTQE 1C5QA 5EU8A 1OS8A 4CR5A 1NO9H 2P8OB 3S9AA 1AKSA 1N8OB 4GVUA 4Y8XA 1GBIA 4WH8A 4CHAB 2VIVA 1BBRH 3T26A 1KXAA 1GHBF 2ZCLP 1V2TT 2CF8H 1ESTA 3MU4A 1E0FD 2FM2A 2C90B 1C5ZB 3R0FA 3VPKA 3U9AH 1ZSLA 1BBRE 1P01A 1WYKA 4TWYA 1TOCB 3LJOA 4YESB 3GDSA 2HVXA 1O2RA 3UPEA 4AB9A 2FPZA 3K2UA 2JETB 1AUTC 3STJA 1TBQH 4LZ4B 1FY5A 1C2DA 3VXFH 4AGJA 3LU9B 1HV7A 3GY8A 1BT7A 2XRCA 5A0AE 3SJ8A 2ZGJA 2ZGXH 4GUXA 4I8HA 2SNWA 3PWCA 1BMNH 4CRAA 1FY1A 2FMJA 1O2SA 3SU1A 4AYYB 1LHFH 3M7UA 1SPJA 1EJNA 2C8WB 1C1QA 3ATIA 2BDIA 3KQEA 3SORA 1AE5A 3MTYA 4H6TA 5F8ZA 4O3TA 3RC5A 1A3BH 1DLEA 1LHCH 3PLPA 4U01A 3GOVB 3AW0A 4K5ZA 3UWIA 4BTUB 1NZQH 3KCGH 1EASA 1ZJKA 2XBXA 4INKA 4E06H 5IYTA 3JZ2B 1NTPA 1TB6H 2GVFA 4GSOA 3DA9B 3A84A 1SGRE 1SGIB 1QHRB 1VCWA 2WPMS 1MCVA 3LGYA 3HGNA 1CQQA 1XKBC 3K6ZA 3BIUH 1OWJA 1CU1A 3T29A 5GCHG 3RXBA 4D7FA 2UWOA 2ZFFH 2PHBA 3SI4H 1TA2A 3ZVCA 1L4ZA 3MI4A 1NS3A 2EC9H 2STAE 2PWXA 4ABHA 1PYTD 4A7IB 2K1QA 4AFUA 1AWFH 1XUKA 1TAWA 3A7TA 4FUJA 4IBLH 4MQAA 1B7XB 2PKSB 2J38A 4IMZA 4A6LA 5E0JA 4AG1A 3TNSA 2BDGA 1C2HA 1OP8A 2A0QB 1C2FA 1HXEH 2BVXH 5HM2A 2VGCC 1FPHH 4YLQH 1A5GH 1RJXB 4JZDH 1P09A 4A5TS 2NU4E 3IG6B 1MBQA 2ZGBH 1GVZA 1BA8B 2RA0A 1C5VA 1ZMLA 1EX3A 2ZHQH 3E0PB 3NZIA 5E2PA 5A8ZA 1AFEH 1TNKA 3KQBA 4ABFA 1FAXA 3HATH 3A81A 4J1YA 4VGCC 4NA7A 1TBZH 1UVTH 1J8AA 2ODQA 1VCQA 2GV6A 5EGMA 1N1LA 2SGFE 1O36A 1EZQA 1LHGH 1IQFA 1LMWB 2A7CA 2D2DA 2O9QA 2VH6A 3M61U 1NESE 4X0WU 3BG4C 1S82A 4Y76A 3RXDA 1HJ8A 3KF2A 3SJ9A 1GVKB 1SSXA 1UTOA 3GICB 3MFJA 2ZWLH 1QL8A 6ESTA 3RXEA 3VB3A 1KXEA 4Y71A 2PR3A 2QIQA 1G36A 4CR9A 3V3MA 1BBRK 1Q3XA 2BOKA 2A5KA 1OWEA 4Y0YE 2ZQ2A 3OX7U 2RG3A 3B9FH 1QFKH 3RU4D 5DPAA 5GWZA 3A7VA 2B7DH 5DP6A 4DOQA 2VJ1A 1K9OE 3ZVDA 3P8GA 3PTNA 3RXCA 4JZIA 4CBNA 1K1JA 3A87A 2GKVE 3MHWU 1C2IA 1FPCH 2VB0A 4CRFA 4AZ2B 2SGAA 1E37B 4I31A 1AVWA 1EZXC 3SQEE 3P95A 1D6WA 1O2NA 2XCNA 4THNH 5JBCS 5T3HA 4B76A 3FFGA 1O2HA 4YTAA 3R3GB 1ZGVA 8KME2 2FESH 1AO5A 1WQVH 2Y82A 1IQKA 2ALVA 3V12A 2A7JA 2FP7B 5FCKA 4ZH8A 1TFXA 3RXJA 1MTUA 5FPSA 1VJAU 9ESTA 1ZR0A 4K1TA 1V3XA 1F0UA 1Z1IA 3SOSA 1TPSA 1AHTH 4INLA 1IQGA 1XXDA 1IQEA 1YPMH 1CA8B 2VIQA 2ANYA 1MTSA 4Y10E 2W5EA 2BZ6H 1H8IH 1EPTB 1XUHA 4UEHH 1CGIE 2ZC9H 1FY3A 1MKXK 2XCFA 4FU9A 3ZVAA 1Z7KA 1GG6C 3BF6H 4X1NU 1CHGA 2BDHA 3OSYA 1DWBH 4NIWA 2YOLA 4ZHMU 4RKJB 5EQQA 1Q31A 4XE4A 4XBCA 3A80A 3QWCH 2RCEA 1GI1A 4ZKRU 1TMBH 2HPPH 1UK3A 2GCTC 1ZHMA 2VWOA 1CA0C 1S85A 3SUGA 3U8OH 1TX7A 3GCNA 5JB8S 1FMGA 1OYTH 4M7GA 1THRH 5J4SA 4UD9H 4OS4A 4BAMB 2ZU5A 1C5PA 3FVFB 4KKDA 4D7GA 1DS2E 1GBTA 1WBGB 2XYAA 3BTDE 4BAOB 2F83A 1RFNA 2W7SA 1G2MA 5EG4A 4K69A 2VIWA 3OY6U 1OWDA 4Y6DA 1T4UH 4B74A 2ZECA 1J15A 1KTSB 1L1NA 3SNDA 3VB7A 1GL1A 1EAXA 1P2JA 2BD8A 1W11U 2GZ9A 1MD7A 1MMJN 4FVDA 9LPRA 2AMPA 2WUBA 3IITA 1J9CH 1OP2A 2WPKS 2UWLA 4R0IA 3A7WA 1DANH 3ZVGA 2SGEE 3D49H 3BEIB 2OINA 1Z1JA 1O2PA 3IWMA 4CBOA 1BUIA 2ALPA 2BY6X 3UFAA 3M5LA 1G9IE 1W7XH 1LCYA 3PB1E 1UMAH 3N7OA 5DO4H 2ZKSA 4WVPE 2B5TB 3GCTG 1YPJH 2F9BH 3VGCC 4ABJA 1P9SA 2A32A 1G32B 1QL9A 2BD5A 1KYNA 3SNEA 1DICA 1P02A 2FOFA 2PGBB 5JBBS 1GVLA 2D1JA 4Q7YA 3UR9A 4OS5A 1GBCA 3NWUA 1H9IE 1HFDA <