3AASA

Bovine beta-trypsin bound to meta-guanidino schiff base copper (ii) chelate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural basis for the design of novel Schiff base metal chelate inhibitors of trypsin
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aasA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aasA02
3V12A 2A2XH 3DD2H 4YT7H 3GY7A 3O8CA 2ZP0H 4MG3A 1O2LA 1P02A 3GDUA 3ATIA 3ZV8A 2H1UA 2CF8H 2ILNA 1MZAA 2FODA 2ZGBH 2ZU1A 2C8XB 3DT0H 2CMYA 1FZZA 3UQOA 1YBWA 4ZKRU 2GZ9A 1O2UA 2SGQE 5DP5A 1VGCC 2R2WU 3SO3A 1SGFG 4HFPB 4THNH 5B6OA 4XBCA 4X6OA 3QZRA 2A4GA 1BCUH 1AKSB 4XBBA 1Y3XA 1TNLA 4ZMAH 2TBSA 1FAXA 4YZUA 3UNSA 1VITH 1C1MA 2A5KA 1XVMA 2Z7FE 1GJDB 5EG4A 3S69A 1AN1E 3FP8E 1D4PB 2TPIZ 1EOLA 4BANB 4K69A 4FVBA 3GY5A 1FY3A 1O3BA 1NESE 4DW2U 1Y8TA 5EPNA 1O2IA 4D9QA 1BQYA 1RTFB 1FJSA 2ZTYA 1C2EA 2OC8A 3TH3H 5EW2H 2ZGCA 2IPHA 2XNIA 2A32A 3UNRA 1UVUH 1C2DA 1GL0E 4WMFA 4NA7A 1GBFA 1A2CH 2VWMA 4RSPA 2Z9JA 3F9EA 1CU1A 3SBKA 1VCWA 2ODYB 5IDKA 1AD8H 4HGCA 1YCPM 5EODA 2WPIS 1GI4A 2G00A 2HVXA 1V2WT 4ZKOU 1Y3YA 4CRGA 1TRNA 2ANYA 2BQ7B 3HGNA 5DG6A 7GCHG 5J4SA 1IQLA 3T5FH 1DXPA 1TRMA 1ESTA 1W12U 2VVVA 3SV2H 4D76A 4FUEA 2VVCA 4ABJA 1TX8A 2LNCA 2GMTC 5JBTA 1LTOA 3TNTA 1O34A 2FYRA 2UWLA 3QWCH 2GKVE 4BAKB 3BTQE 1V2VT 1P57B 1KXAA 3QTVH 1ELBA 2CGAA 3HKIB 1QA0A 4A92A 1XXFA 3M7UA 1UVPA 1A46H 3M36A 2G5VA 1MKWH 1NROH 3K6YA 5FHTA 1GMHG 2PSXA 2Z94A 1HAVA 1GCDA 1DY9A 2ZU2A 1TMTH 3QLPH 2P59A 2UUJB 3H7TA 1MU8B 2GZ8A 6GCHG 1A5HA 1UMAH 1PPHE 2WUCA 1OOKB 1OWIA 1E37B 2NWNA 3E6PH 5I46H 4H6SB 1XUIA 3N7OA 2JETC 1W0YH 2BY5X 3SUGA 1DY8A 3UR6A 2QYIA 3TJNA 2NU4E 5L2YH 2OBOA 3LIWA 3QGJA 1JIMA 2OC7A 3CS7A 1NU7B 4K2YA 1HFDA 2ZCKP 3I29A 3UWJH 4X0WU 3UOPA 1GWAA 1FIZA 1S6HA 1BBRH 1SLWB 2AYWA 1AUTC 4I8GA 1D3QB 5DPAA 4ESTE 4IC5A 3ZZ5A 1NT1A 3LJJA 5K0HA 1TGBA 1JRSA 1HXEH 1PFXC 1UVOA 1XUGA 3SHAH 1O3HA 3RC6A 3ATMA 1O2ZA 2V3HH 1NN6A 4AYVB 1S6FA 1GVZA 4IS5A 2BY7X 1SOTA 4B71A 1SLVB 1QA7A 2YNBA 3PM3A 5F03A 1Y3UA 2FPZA 2XTTB 1AWFH 1OKXA 1RRKA 2BM2A 2P95A 1MTVA 4IN2A 4TY7A 1E36B 2IOTA 4AG2A 1BT7A 4AFZA 3O8RA 5DP6A 1OWDA 1PYTD 3PTNA 1PPZA 1L1JA 3T2NA 4IC6A 4UE7H 1UTNA 4JK6A 1ELTA 3QN7A 1GDQA 1NRSH 2BQWB 4YM9A 1O3GA 5C2ZA 5JBCS 1BBRE 1HUTH 1OP2A 5E0GA 1DPOA 3ESTA 4B2AA 2SNVA 2W5EA 2VIPA 1H1BA 2ZPQA 2QY0B 2BYAX 4OS2A 1DLKB 5FXLA 1O3MA 1HLTH 2J95A 1DXWA 1FI8A 1HIAB 4ABFA 4OS4A 3AVZA 4FU9A 1SQOA 1ACBE 1K1NA 3PO1B 1OWHA 3SQEE 3EDXB 1C1TA 1O2YA 1G3CA 5AFZH 4D8NA 1NM6A 1ANBA 4RN6A 3BTHE 1PPEE 2H6MA 1WTGH 2WYGA 1WQSA 1HJAB 1WOFA 2BDGA 3TPIZ 1TRYA 1AB9C 1FPCH 5BRRE 3RUOA 3VXFH 4I7YH 4JYVH 3A8AA 3QO6A 3RXTA 4BAOB 1V2NT 1S5SA 2Z6BD 3FP7E 4OGYA 4FUHA 4GPGA 4TWWA 1A0LA 1ZPZA 2CJIA 2P93A 3A7VA 3SNCA 1MTUA 1Y5UT 3F9GA 3GCHC 2SGDE 5I25A 1GJCB 1XUKA 2GCHG 1HPGA 1L4ZA 2C90B 1VCQA 1ETRH 1Z1JA 4TY6A 3LT3A 1GI8B 3LGIA 3OY6U 4BOHA 2W3KA 1BTXA 3U69H 5C1XA 1KXFA 1RS0A 2C8WB 3Q77A 1XKAC 4I31A 3LH1A 2ZFPH 2J2UA 1DANH 3M5MA 3F9HA 3SU2A 1C5SA 6GCHF 2XBWA 3ELAH 1CA0B 1SGQE 4E7RG 2H9TH 1B0EA 1K22H 4AN7A 2ZQ2A 2JH6D 5GXPA 3SU0A 4YESB 2ZU4A 4GSOA 1FONA 3T26A 1P8VC 3JZ2B 1MBMA 1GMCG 3SNDA 3V7TA 2PFEA 3EYDA 2FXRA 1AZ8A 2PGBB 4NGAH 1TPAE 2UUKB 1EJMA 1QIXB 5C3NA 1V2TT 2ZGXH 3RMLH 1TX7A 1L0ZA 2ZWLH 4X1SU 1O2JA 1KTSB 2BQ6B 1B0FA 1TWXB 3UR9A 3SOSA 2FOMB 1ZLRA 2VWNA 1KXCA 1VCPA 1LVOA 1QURH 2GCTB 2ULLA 2BOKA 1ANEA 1HDTH 3S9AA 1P10A 2WINI 1VITF 1F0UA 3PV4A 1GI2A 3AW1A 2QF0A 5DKMA 1YKTA 4I8JA 2ZDNA 3QGNB 1FY1A 1V2PT 2ESTE 2B5TB 3B9FH 2R0KA 3GY4A 2FOEA 1Z8IB 1N8OC 1OYTH 4MTBA 4BAMB 1DUAA 1QRWA 5CHAC 2O8WA 1C5WB 4JCNA 1H9HE 4ISIH 3VFEA 3UUZA 1MAYA 4Q80A 1Z6EA 3EE0B 4AB9A 4BNRA 4LOYH 1O5EH 2EA3A 1CHOG 2BLOA 4Q7ZA 2GV6A 3OU0A 3F1SB 3UPEA 3KL6A 2G52A 5EQSA 3SUFA 1H8IH 4Y76A 1CBWC 1S82A 2QGRA 5EOKA 9ESTA 1BTHH 2G81E 1C4V2 4ISOA 5EQRA 3MU4A 2QA9E 1GHZA 2Q1JA 4K5ZA 3SU4A 5EW1H 3KGPA 3O8BA 2FLRH 5F6MA 1IHTH 5FPTA 1N6YA 1GBAA 1S0RA 4ABHA 1DSUA 4AGJA 1FQ3A 1C1PA 1ZRKA 2BLVA 1YCPK 5EU8A 1O3KA 5GPIB 2TIOA 4B2BA 1W8BH 1P9UA 3RXPA 3RXQA 2Z9KA 1FPHH 3PWCA 3TK9A 2UWOA 3BIUH 4XOJA 1WV7H 1ZPBA 2GDEH 1H8DH 2GT8A 3MU5A 2WV5A 2QXJA 3VEQB 1QJ6B 2ZDMA 2SGAA 1MH0A 1GJ6A 2H2ZA 5A8YA 2QAAA 1C4Y2 1ELCA 1FN8A 4FUDA 1EZUC 5CMXH 4BTTB 3URCA 3MH4A 2PW8H 1CT4E 3PROA 4KELA 4CHAC 1SGTA 1O2OA 1A3EH 1VZQH 5A8XA 1SR5C 3C27B 3ZZ8A 3UIRA 5FAHA 2CHAC 3QUMP 6LPRA 2VIDA 1YLCA 2BVSH 1TA2A 3RU4D 1M9UA 1GI5A 4VGCB 5AVDA 4DGJA 2VB0A 2FS9A 2FTLE 5DP7A 3K2UA 1AIXH 1YPMH 1INCA 1FAKH 5TJXA 1C5NH 2FESH 4E7NA 1GHXH 2FS8A 3DFLA 1MD7A 1O5BB 1O3PB 5EGMA 3MU8A 1OP0A 3RXHA 3LH3A 1O2XA 4A6LA 3C1KA 2GX4A 1AVGH 1BRUP 1O5CB 3GICB 1E38B 2BHGA 1GBIA 1PQ7A 1Y5BT 1O2GH 1DVAH 4CRAA 2PGQB 4DCDA 4ZAEA 2TRMA 1MKXK 1KIGH 3TITA 2P8OC 1TNIA 2Y80A 2GP9B 3RXKA 3TK5A 4AFQA 4LK4A 2WPKS 2DE8A 2F9PA 3ZVEA 1EXFA 3E0NB 2ZFRH 1LVBA 3ZVBA 2F9VA 1SGRE 3URDA 2ZNKH 1A7SA 2H5DA 4X8TH 1HAVB 3M5OA 4ZKSU 1MBQA 3H5CB 1GBHA 2F83A 4UFEH 3VB6A 1QJ1B 1TE0A 5A2MH 3NUMA 1G37A 5SGAE 1TNJA 1UK3A 1BRCE 5TCCA 4ZHLU 1L1NA 1SQTA 5FBEA 4X6NA 1W7GH 3W94A 1A5IA 3BEIB 1TPSA 1HV7A 4FUIA 1NPMA 1VGCB 1AFEH 2BD7A 1FMGA 1O3CA 1RTKA 3K65B 1TABE 1WCZA 3E90B 1F2SE 3A85A 3ZZ7A 4UEHH 2R0LA 3A8BA 2H9EH 5A0BA 1FXYA 4X2VA 3SU3A 4UFGH 1BMNH 2AERH 1A1RA 2RA0A 3U98H 1ABIH 1ZZZA 5G4BA 3VGCC 1Z7KA 1G30B 3SI4H 1LKBA 2D8WA 3A7YA 4E06H 1O37A 1Z6JH 1GVLA 2XC4A 2HNTF 2PUXB 1F92A 1KLJH 1RTLA 3HK3B 3HPTB 2F3CE 3RXIA 2V0BA 3MO6A 1ZMLA 2CF9H 1O2TA 2BZAA 2Z3DA 1EQ9A 2AIPA 1HNEE 5C5OA 3STIA 2PUQH 2WPLS 4KGAA 1C9PA 4A1TA 4BTIB 1KYNA 2ZU3A 1OWKA 1V2ST 1G3BA 1C2KA 2W7UA 1ZOMA 1TA6A 2STAE 3W95A 3TGIE 4ZH8A 2XBXA 1AQ7A 2F9BH 2NU3E 2FO9A 3S7HB 1ESAA 1KTTB 2R2MB 4RKJB 1BUIA 1TBZH 3A7ZA 1C1RA 1TQ0B 1LPZB 5H4IB 1XUFA 4TPIZ 3M35A 1UCYH 4MLFB 3ZVCA 2ZDAH 2GMTB 2WPMS 4AGKA 2C93B 3LGYA 2BDIA 1EP5A 3VPKA 3RXEA 3ZZ6A 4AG1A 1O0DH 3PLKA 1C5YB 1MTNC 1WBGB 1TALA 5HYOA 3SJIA 2VIVA 2BZ6H 1ELDE 2FEQH 1BZXE 1RFNA 1YM0A 2VJ1A 1NRRH 3TIUA 3ZYEA 4BXSA 1O3JA 2FM2A 3UOUA 4ABIA 1AZZA 3BTTE 1P3CA 3BTME 3MNSA 1V2QT 4KTCA 3RM2H 1TLDA 2BB4A 2Y81A 4CH2B 1EB2A 3BG4C 2FI4E 1IQJA 2TGTA 4FXGH 1K1OA 1MAXA 3UNQA 4DIIH 3QK1A 1ELEE 4TWYA 1D9IA 2F91A 3U1JB 2JETB 1V2MT 3A7WA 1O33A 1TAWA 4B73A 2BD8A 1T8MA 4A1VA 1AY6H 3P92A 3P70B 1HCGA 3ATKA 2ZKSA 1HAHH 1MZDA 3H7OA 4Y7AA 3P6ZB 2W7SA 1SSXA 1UCYE 8LPRA 1IQEA 1MCTA 2XYAA 3BEFB 3SHCH 1HJ8A 1QGFA 1EP6A 4IMQA 1OPHB 2FTMA 4ZUHA 5F8ZA 5DP9A 1FDPA 1O39A 1QFKH 3FZDA 3RC4A 1EJNA 3D62A 3TK6A 3G01A 1BHXB 1OXGA 1GJ5H 1ELGA 1GJBB 1SB1H 1IOEA 1DWEH 1L4DA 2ZU5A 4ZXYH 1SMFE 1F5LA 2BMGB 3NCLA 3PYHA 1YPEH 2NU1E 1GCTC 3TH4H 4JYUH 1SGPE 3A82A 4NWKA 4A5TS 4E05H 2H9HA 3RMMH 4CBOA 4UFDH 5JBBS 1ORFA 1IQGA 3A80A 2VH0A 2XWBI 3ZVDA 1OYQA 2ZGHA 4I33A 2XWAA 4B1TA 1GMDG 1P12E 3FP6E 2ZHQH 2HALA 2J92A 3RXRA 1VJ9U 3STJA 1P06A 5AFYH 3ZZAA 2VWLA 4YO9A 1DX5M 3V3MA 3BTGE 1C5UA 1JMOH 1EB1H 3A88A 1LHGH 1DSTA 1UTQA 2AMPA 3DA9B 4I32A 5T6FA 3SU6A 2ZDLA 1SGNE 4BAQB 2PKSC 3BTEE 2FOCA 2BXTH 3LGTA 2YNAA 1K28D 1K21H 1DITH 1ELVA 5LPFA 1A4WH 4MNXA 3F6UH 1JIRA 2V6NA 4LZ4B 2RA3A 4X6MA 4Z0KA 1VITG 1F0TA 2Y7XA 1SG8B 1V2LT 2BD5A 2BVRH 2OC0A 1DFPA 3RXSA 1NRNH 5ESTE 1T4VH 1CGHA 4INLA 4IMZA 2BDBA 3SW2B 2EI8A 2F9UA 2SGEE 5E8EH 5T3HA 1BB0B 1SLXB 3LKWA 2FZZA 2ZA5A 2A7HA 1AGJA 4ASHA 5C5NA 2VGCC 2C4FH 4IW4E 1YPKH 1D3PB 4Y7BA 2CN0H 4K3JA 1AB9B 1MQ5A 3M61U 2SFAA 3MMGA 3PWBA 3IG6B 1GGDC 1EX3A 5FBIA 2GZ7A 2WPHS 1EZSC 2PR3A 1ARCA 3GCHB 1FV9A 2BD2A 3K9XB 3MNBA 5TCAA 4ZROA 1L1GA 2ZC9H 1MUEB 1NY22 3RXOA 4MPXA 1AO5A 1THSH 2A0QB 1PPCE 1EAUA 3A83A 3R0FA 4MNYA 2VNTA 1O31A 4MDSA 4JYTA 1BTWA 1BMLA 2BLQA 3GCNA 1G2MA 1C2FA 2NU0E 1YP9A 1D3TB 1ANCA 1LKAA 1LVMA 1RD3B 2Q6FA 4K1EA 3SUDA 2B7DH 3JZ1B 2OLGA 1GJ8B 3Q00A 5C1YA 4K60A 1LHCH 4XFQA 5ESBA 1ETSH 1CA8B 3DHKH 1NFUA 1U6QA 2XXLA 1EAWA 2PSYA 2P3FH 4WH6A 4X1QU 5DJ7A 1JOUB 2A4RA 4F49A 1V2RT 1PQAA 2FOAA 1O2VA 1ZRBA 2XBYA 1CE5A 1AU8A 2QV1A 1WTHD 1V6DA 1Z8GA 4FUGA 3RLYH 2PTNA 4O3UA 1X7AC 2EC9H 2A4OA 2HNTC 4R0IA 3UQVA 1O2PA 3MWIU 2HOBA 1PJPA 1K2I1 1C5VA 2Y5FA 4O97A 1UHBB 3EQ0H 1ESBA 1N6XA 3OYPA 1H4WA 3SV6A 2J34A 2Y82A 3GCOA 4WH8A 1LO6A 1UK2A 1BOQA 2ANWA 1XMNB 1EPTC 2PLXA 3ZYDA 1AUJA 1THRH 1O5FH 4X1PU 5L6NH 1Y59T 4GHTA 3FZZA 3VXEH 3TGJE 2SGFE 1GBBA 1UTJA 4OS7A 1QR3E 4AOQA 3A86A 3MH5A 4NIWA 1O5DH 1N8OB 1V2OT 1GMDF 2HNTE 1Y3WA 5CHAB 4KP0A 4B75A 4YTAA 4WVPE 2BX4A 2Z9IA 2Z3CA 3TJVA 3T25A 1MD8A 1MCVA 2K1QA 1CO7E 1P9SA 1T31A 3SNBA 1GG6C 1V3XA 4XSKU 2BOHB 4UDWH 2GD4B 2OQ5A 3ZVGA 4M7GA 1J17T 4AB8A 1QHRB 2FOHA 1P05A 3S7KB 1SGDE 5FX5A 2R3YA 4Q7YA 3UY9A 1P2IA 1YC0A 1CBWB 1S0QA 4YT6H 1P2JA 1SQAA 2ZECA 1GJ7B 2AH4X 2W26A 4CH8B 1WYKA 3QX5H 2D26C 5EPYA 4X6PA 1E0FD 1XX9A 2QN5T 5FCRA 3MTYA 1AHTH 4H4FA 1QQUA 3TU7H 2BDYA 3E91A 2ZFFH 2ZQ1A 3BV9B 2HRVA 2B9LA 2ZPRA 2PHBA 1J16A 1RGQA 1P09A 2WUBA 1W13U 1O2QA 5LPEA 4X8SH 1BA8B 1O3DA 1P04A 3SI3H 4XBDA 2BY9X 2LPRA 1J15A 4X2YA 1PPBH 1DWDH 4NZQA 1ABJH 1GI9B 4ABGA 1NFXA 4PROA 1BTYA 5HMAA 3GY6A 2A5IA 2A7CA 1SHYA 2VU8E 4MQAA 1G2LA 8ESTE 1A61H 2GGVB 4I8KA 1MU6B 4Q2KA 2VVUA 4ISLA 1AFQC 3QDZB 1O2SA 5GDSH 3KF2A 4ISHH 2PV9B 4WWYA 4CHAB 1IAUA 6CHAC 4ABBA 5EXLA 5LGOA 3MO3A 1DE7H 1FNIA 3ZZBA 1FLEE 1IQMA 1DM4B 3PB1E 2VWOA 1YF4A 2CHAB 4FUFA 3U8OH 1NU9A 2RDLA 3UREA 1P2KA 1EAXA 1HIAA 1EPTA 1SFIA 2R3UA 1A0JA 4WXVA 1DUEA 1TIOA 3LC5A 3SV7A 4WY3A 1WAYB 3SU1A 2Y6TA 4ABAA 1GI1A 2XC0A 1FUJA 1GPZA 3D23A 2DUCA 1W0ZU 4A1XA 1QCPA 2WV4A 3MO9A 2AGEX 4FU7A 2ZFSA 3RXVA 1G36A 1O3IA 2XC5A 2AFQB 1EUFA 4YOIA 3RXUA 1HGTH 4Y8ZA 4HZHA 3SV8A 4ZKNU 3LU9B 3P8FA 3MH6A 1D6RA 1GHWH 1ARBA 1C1SA 3RXJA 4FVDA 4Y6DA 3SJ8A 1WU1A 3A84A 1QBNA 3BTKE 4MNWA 1O5AB 2BDAA 2H5CA 1C5XB 3MNXA 1Y5AT 1ZR0A 1ELAA 2P8OB 3GY2A 1PQ5A 2B8OH 5F8XA 4IBLH 3BSQA 1HAOH 2SGPE 3ZZ9A 4CRFA 1MKWK 5C67A 1AE5A 3ZZ3A 1EAIA 1O3LA 8GCHF 2OD3B 3P8NA 3PLBA 1OWJA 1P2QA 4Y79A 1OWEA 1H9LB 1TMUH 4H42U 1EATA 1GVKB 4K1SA 2OC1A 2Q6DA 1TNGA 3TLOA 3LPRA 3KNXA 1LDTT 3BIVH 3FFGA 4GVUA 1VR1H 5L30H 1QBVH 1GBMA 1DWBH 2QCYA 3RXCA 2FMJA 5L2ZH 4WMEA 2KAIA 1CGIE 4Y10E 4IN1A 3UFAA 1GBKA 1GJ9B 1C2LA 3RXMA 1TPPA 3MYWA 1ID5H 1PPGE 1DOJA 1ZMNA 3ZV9A 2Z9GA 1NZQH 1T7CA 3PLPA 1BBRK 1TBQH 4GLYA 1O32A 5JBAS 1A5GH 3BG8A 5EXMA 1BIOA 3VGCB 2BXUH 3MHWU 3M5LA 2A45B 1GBDA 3QZQA 4OGXA 4NSVA 3UTUH 2BLWA 1V2JT 3M3VA 1CGJE 3CENA 3MOCA 1MTWA 1UTKA 1DS2E 1TNHA 1QBOA 3LOXA 4BXWA 1C2IA 4ABDA 1HJ9A 3ATWA 1YPHC 5F8TA 1KXDA 1TYNA 3SNEA 3LGUA 3GYLB 2ZTZA 2I6QA 1C2GA 1G9IE 3LGVA 1E35B 2O9QA 3RMOH 3DUXH 2C8ZB 1HAYB 1ZYOA 2ZCHP 3AASA 3SN8A 2Y7ZA 4AFSA 1Z8JB 3A8DA 1XUHA 2WYJA 4AYYB 3PMBB 4I8LA 2ZDKA 4NIXA 1QQ4A 3S9CA 2TGPZ 1C1UH 1GDUA 2O8LA 4NSYA 3MH7A 2ANKH 2PKAA 3SQHE 4KTSA 3KIDU 3U8TH 1YPHE 3FANA 3MFJA 3Q76A 3SUEA 4INKA 5E0JA 1QL9A 1MTNB 1W14U 4O03A 3RM0H 2ALPA 2QIQA 1SFQB 2BD9A 1CT2E 5DK1A 1ETTH 4LXBH 1P03A 2G51A 1GI6A 4JZFH 1GBLA 2BY6X 1RIWC 1C5QA 4J2YB 3S0NA 1ZHMA 1XUJA 3AAVA 1ZTLA 5GWZA 1P2NA 3BTDE 4MPWA 1UJ1A 3MI4A 4FUJA 1KDQA 1C5TA 1LQDB 2Z9LA 1EZQA 2OXSA 5HXFA 1T4UH 3BG4B 3BTWE 3TJUA 5IYTA 1C1OA 2RCEA 3ZZ4A 1C9TA 1SGIB 1TGCA 2OCVB 4XDEA 1DWCH 5JB8S 2OINA 4SGAE 3A89A 1YPJH 1Z71A 1AWHB 3SJKA 5A09A 3SJ9A 3M7QA 5HGGA 1CT0E 3HKJB 1C5ZB 1WQVH 4GUXA 1SGFA 2ZGJA 3SNAA 1O2NA 2O8TA 1ZHRA 2HPQH 3HK6B 1BRAA 1UTMA 4NIYA 4MVNA 3ATLA 1IQHA 2FWWA 1T32A 1ANDA 1TGNA 3LONA 4MNVA 1BMAA 1KSNA 4JZEH 1DDJA 3KN2A 4A7IB 1GCTB 5LPRA 3M3TA 4Y8YA 1TOCB 3RU4E 4DY7B 2ZFTA 1HXFH 4XE4A 4DURA 1B5GH 1SHHB 4JZIA 2D1JA 2BVXH 5HM2A 3TJOA 5FPSA 2UUFB 1GHBF 1JBUH 1EASA 1THPB 4CRDA 1YCPH 3M7TA 1KLIH 1SLUB 1QJ7B 4SGBE 4AZ2B 3SGQE 2FLBH 1BTZA 1OP8A 1KLTA 3GY3A 3GYMA 5CE1A 3RU4T 3TVJB 3KEEA 3ODDA 1GHAF 3T27A 1C5RA 3M3SA 1QL8A 2F9NA 5LH8A 1IQKA 3L33A 1PQ8A 2A7JA 1UO6A 2OP9A 4ISNA 1JRTA 2PKSB 4D9RA 1GL1A 2P3UB 5JDUB 1ZGIA 1EZXC 5AHGH 4J1YA 4LZ1H 1BITA 1ZJDA 4K8YA 3BF6H 1ELFA 5GJ4B 2O8MA 4CR9A 4HTCH 1O2KA 4B74A 3RMNH 4YOGA 1K1JA 2FP7B 3AW0A 5A0CA 1Z8RA 4ABEA 1C4U2 4WXIA 1A3BH 1BDAA 3ZVFA 4DVAU 1NRQH 1HAPH 2AGIX 3SZNA 5DP4A 4GCHF 1OSSA 3GISB 2CXVA 2V3OH 1FY5A 4OS6A 2VGCB 2NU2E 1VJAU 4YLUA 5FPYA 3DFJA 3CS0A 1YGCH 5E2PA 4UONA 1GGDB 1GI7B 3P17H 1S83A 4YOJA 5AF9H 1SBWA 3GDSA 3R3GB 4K8BA 7ESTE 3GCTG 3IWMA 4OS1A 4DIHH 3RLWH 2BTCE 1KXEA 1T8OA 2FIRH 3RXAA 9LPRA 4YLQH 1O36A 2XBVA 1XVOA 1CHGA 1AVXA 1O3EA 2A1DB 2A5AA 3NWUA 4BAHB 1MKXH 3OTJE 1CVWH 5C20A 5C1UA 3U8RH 3MNCA 1K1PA 1Z1IA 1TGSZ 2FOGA 2Z3EA 1C1NA 1J9CH 4DG4A 3BEUA 3CP7A 3PMAB 1O2WA 2OBQA 4Y0ZE 1Q2WA 1ZSJA 2AS9A 3V13A 2Q6GA 1G3EA 1ZPCA 4WJG2 1HAZB 1ZSLA 3GOVB 1IQIA 3EA7A 2EEKA 4O9VA 2JH0D 2WPJS 3RC5A 1LPKB 1K1LA 3KQEA 2IJOB 4AORA 2ZHWH 1TOMH 3E3TA 1N1LA 1GJAB 1C5LH 1O35A 1KY9A 1P0SH 5DP3A 2BDHA 3K6ZA 1FN6A 4X8VH 5E2OA 3MU1A 4Y8XA 3GDVA 1AKSA 2FOBA 4Y0YE 1P2MA 3OY5U 4KKDA 2J38A 5J4QA 1EKBB 1QL7A 1BJVA 4QT8C 3T28A 5PTPA 4NG9H 1SGEE 2UUYA 4TYDA 4JMYA 2W3IA 4CRCA 1HRTH 3NKKA 1TNKA 1NFYA 4GAWA 1OS8A 4NZLA 3B8JA 5K7RA 1ZGVA 7LPRA 3FVFB 1SVPA 4TPYA 1TB6H 4Q7XA 1DICA 1O3AA 2ZTXA 1EPTB 1O3NA 2PTCE 2EI7A 4U2WA 2ODPA 3TNSA 5GCHG 5FX6A 1NS3A 1OX1A 1SC8U 5ETXA 1TGTA 1NFWA 2P16A 4NFEA 3S9BA 1BTPA 2ZG0H 2G5NA 1RXPA 3A7TA 1IHSH 1P2OA 1TPOA 2GT7A 1GI0A 5A8ZA 4ZXXH 1QY6A 2FX6A 1TONA 1MTSA 4DT7B 4ZHAA 2A2QH 1GG6B 1S81A 2PWXA 4OS5A 5T6DA 3EA9A 3I78A 1HAIH 4BTUB 3NPSA 1O30A 1TFXA 7GCHF 4MPVA 5JB9S 5DO4H 1TMBH 1XKBC 2A31A 8GCHG 1B7XB 1P3EA 1E34B 2FOFA 1AI8H 1ZJKA 1C2HA 3E8LA 1UVSH 2A4QA 2P3TB 3NXPA 3PMHB 3E16B 2ODQA 3PO1C 3RP2A 1HAXB 1EOJA 2G4TA 4WF8A 1S85A 2B0FA 1SPJA 1GMHF 1LHFH 1C5OH 3EAJA 1O3FA 1JWTA 1NRPH 4X1NU 3Q3KA 1H9IE 2ZO3H 5EXNA 1J14A 2KAIB 1QRXA 1W10U 1F7ZA 1LVYA 1GBCA 1HJAC 1PYTC 2ZHDA 1G32B 1LPGB 2HPPH 3GCTF 1C1QA 5HM9A 2P94A 1AFQB 1T8LA 1TQ7B 1XM1A 6CHAB 3RXFA 4D7GA 4KTUA 3PTBA 1BMMH 2AGGX 3U9AH 3RXGA 3VB7A 1SGCA 5DP8A 1C5PA 3RDZA 2TGAA 4GHQA 6ESTA 2XRCA 1UTPA 4D7FA 4ZHMU 3A7XA 3ENSB 1FY8E 1SL3A 2G8TA 4NCYA 1NTPA 1FY4A 5EQQA 2R9PA 2J4IA 1GBEA 4B2CA 2ZHEH 1LQEA 4I8HA 1YPGH 4X2WA 3RXDA 1W2KH 2GTBA 2AIQA 1ZHPA 2QC2A 2ZPSA 4X8UH 4NIVA 1UVTH 1CA0C 1UK4A 2XW9A 2VIQA 4JZ1A 1BTUA 1GBTA 2FYQA 1C1VH 3L6PA 3NZIA 3KHVA 5T6GA 1EJAA 1UCYK 2FDAA 4Y11E 1Q31A 3P8OA 3LGWA 3E1XB 3MU0A 1C1WH 3BTFE 4H6TA 1QNJA 4HI3A 4CREA 3E0PB 1ZTJA 1YPLH 2PKAB 1IQNA 2HLCA 1O5GH 4DOQA 3RXBA 1QB1A 1AVWA 1IQFA 1AMHA 2ZCLP 5ABWA 3HGPA 2G4UA 5JPMH 5BPEA 2EI6A 4K1TA 1HYLA 3HATH 3LJOA 2STBE 2V35A 1TBRH 4FUCA 1P11E 2F9OA 4X1RU 1MMJN 2ASUB 1LHEH 2AEIH 2BD4A 3IITA 3I77A 1D6WA 3WY8A 4CRBA 1CQQA 3AAUA 1KDQB 2TGDA 2GCTC 4IGDA 5GIBA 1FIWA 1F0SA 1K1MA 1O2MA 3KCGH 4JZDH 1YLDA 1BRBE 2QXGA 2HWLB 3QTOH 4RKOB 5GCHF 2ZIQH 2JH5D 1ZSKA 1ZMJA 4F4OC 1NO9H 1S84A 1F5RA 2ZDVH 1LCYA 4Y71A 1AE8H 1RJXB 4U01A 2AMQA 3OSYA 1V2UT 1F0RA 4MPUA 2D2DA 1C5MD 2QXHA 4WMDA 2IN2A 5A0AE 3KQDA 4U32A 1ZTKA 2ZFQH 3A87A 2BX3A 1GHYH 3EA8A 1O38A 1L2EA 3SU5A 2ZZUH 3GY8A 1GHVH 1HAGE 4Z6AH 3D49H 1LMWB 3BN9A 1TX6A 3F68H 2THFB 2ZI2H 3UWIA 1WSSH 3ZZCA 3VB5A 1GDNA 3LDXH 2GCHF 1BHXF 2JKHA 2BD3A 1GHBG 1UHBA 3KQBA 4NFFA 2ZHFH 3ITIA 3SORA 1SGYE 1O2HA 2XCNA 3B23B 4UD9H 3M37A 2G55A 2VINA 8KME2 1XXDA 4U30A 1HBTH 3PMJA 4CR5A 1GHAG 1PPFE 1V2KT 4O3TA 1D3DB 2OTVA 2I6SA 2HGTH 1W7XH 1WUNH 2QF3A 3M5NA 2GVFA 1HB0B 3ZVAA 1T8NA 4FU8A 4UFFH 3NK8A 1K9OE 3A8CA 5E0HA 3SV9A 3FAOA 2UWPA 2J94A 2ZF0H 3ZZDA 4R8TB 1O2RA 1J8AA 3TH2H 1GMCF 1K1IA 3P95A 3EGKH 3V0XA 1YYY1 4NA9H 2XCFA 2C8YB 1RIWB 2BDCA 4INHA 3SGBE 1GJ4H 2FI3E 3L3TA 2YOLA 3SGAE 1CSOE 2SNWA 2VIWA 5FCKA 2VH6A 2ALVA 3RXLA 1A0HB 2VIOA 3VB3A 3LC3A 2GV7A 1NC6A 4GCHG 4AX9H 1C2MA 1Y3VA 2C3SA 1UTOA 3ODFA 1QTFA 2BY8X 3U1IB 3VB4A 2ZEBA 2M5TA 2DE9A 1UTLM 1W11U 5DGJA 4DJZB 1GBJA 2AMDA 3P8GA 4B76A 3O8DA 3TGKE 4VGCC 3T62A 3OX7U 1SOZA 2Y5HA 3SJOA 2CV3A 2GDDA 3KQCA 2J9NA 3Q3YA 2OQUA 1QB6A 2O8UA 1GI3A 1DT2A 2OUAA 1F5KU 2RG3A 4JK5A 7KMEH 4FUBA 4NA8A 2ANMH 1O3OA 1QRZA 1SI5H 5JYIA 3D65E 4X2XA 1QB9A 1CHOF 3T29A 2FI5E 1W3CA 1MQ6A 2QXIA 4NWLA 4AFUA 3Q3XA 1P01A 1Q3XA 1KXBA 1C2JA 1LHDH 1BJUA 1DLEA 1G3DA 4CBNA 1JXPA 3F9FA 3A81A 2FX4A 2Y5GA
chains in the Genus database with same CATH superfamily
3V12A 2A2XH 3DD2H 3OEHD 4YT7H 3GY7A 3O8CA 2ZP0H 4MG3A 1O2LA 1P02A 3GDUA 3ATIA 3ZV8A 2H1UA 2K0QA 2CF8H 2ILNA 1MZAA 2FODA 2ZGBH 2ZU1A 2C8XB 3DT0H 2CMYA 1FZZA 3UQOA 5CHBA 1YBWA 2KM0A 4ZKRU 2GZ9A 1O2UA 1EFRD 2SGQE 5DP5A 1VGCC 2R2WU 3SO3A 1SGFG 4HFPB 4THNH 5B6OA 4XBCA 4X6OA 5C94A 3QZRA 2A4GA 1BCUH 1AKSB 4XBBA 1Y3XA 1TNLA 4ZMAH 2TBSA 1FAXA 4YZUA 3SYJA 3UNSA 1VITH 1C1MA 2A5KA 1XVMA 2Z7FE 1GJDB 5EG4A 3S69A 1AN1E 3FP8E 1D4PB 2TPIZ 1EOLA 4BANB 4K69A 4FVBA 3GY5A 1FY3A 1O3BA 1NESE 4DW2U 1Y8TA 5EPNA 1O2IA 4D9QA 1BQYA 1RTFB 1FJSA 2ZTYA 1C2EA 2OC8A 3TH3H 5EW2H 2ZGCA 1MABB 2IPHA 2XNIA 2A32A 3UNRA 1UVUH 1C2DA 4RT0A 1GL0E 4WMFA 4NA7A 2VBCA 1GBFA 1A2CH 2VWMA 4RSPA 2Z9JA 3F9EA 3FKSD 1CU1A 3SBKA 2KZ4A 1VCWA 2ODYB 5C0TA 5IDKA 1AD8H 4HGCA 1YCPM 5EODA 2WPIS 1GI4A 2G00A 3PRBA 2HLDD 1V2WT 2HVXA 4ZKOU 1Y3YA 4CRGA 1TRNA 2ANYA 2BQ7B 2V3MA 3HGNA 5DG6A 7GCHG 1IQLA 5J4SA 3T5FH 1DXPA 1TRMA 1ESTA 1W12U 2VVVA 3SV2H 1H8HD 2KCOA 3VG8A 4D76A 1WXRA 4FUEA 2VVCA 4ABJA 1TX8A 2LNCA 2GMTC 5JBTA 1LTOA 5C17A 3TNTA 1O34A 2FYRA 2UWLA 3QWCH 2GKVE 4BAKB 3BTQE 1V2VT 1P57B 3SZEA 1KXAA 3QTVH 1ELBA 2CGAA 3HKIB 1QA0A 4A92A 1XXFA 3M7UA 1UVPA 1A46H 3M36A 2G5VA 1MKWH 1NROH 3K6YA 3EE7A 5FHTA 1GMHG 2PSXA 2Z94A 1HAVA 1GCDA 1DY9A 2ZU2A 1TMTH 2GJGA 3QLPH 4P00A 2P59A 2UUJB 3H7TA 1MU8B 2GZ8A 6GCHG 1A5HA 1UMAH 1PPHE 2WUCA 1OOKB 1OWIA 1E37B 2NWNA 3E6PH 5I46H 4H6SB 1XUIA 3N7OA 2JETC 1W0YH 2BY5X 3SUGA 1DY8A 3UR6A 3W1EA 2QYIA 2LELA 3TJNA 2NU4E 5L2YH 2PP6A 3AK5A 2OBOA 3LIWA 3QGJA 1JIMA 2OC7A 3CS7A 1NU7B 4K2YA 3KQ5A 1HFDA 2ZCKP 3I29A 3UWJH 4X0WU 3UOPA 1GWAA 1FIZA 1S6HA 1BBRH 1SLWB 2AYWA 1AUTC 4I8GA 1D3QB 5DPAA 4ESTE 4IC5A 3ZZ5A 1NT1A 3LJJA 5K0HA 1TGBA 1K0HA 1JRSA 1HXEH 1PFXC 1UVOA 1XUGA 3SHAH 1O3HA 3RC6A 3ATMA 1O2ZA 2V3HH 1NN6A 4AYVB 1S6FA 1GVZA 4IS5A 2BY7X 1SOTA 2JIZD 4B71A 1SLVB 1QA7A 2YNBA 3PM3A 5F03A 1Y3UA 2FPZA 2XTTB 3DSPA 1AWFH 1OKXA 1RRKA 2BM2A 2P95A 1MTVA 4IN2A 4TY7A 1E36B 2IOTA 4AG2A 1BT7A 4AFZA 3O8RA 5DP6A 1OWDA 1PYTD 3PTNA 1PPZA 1L1JA 3T2NA 4IC6A 4UE7H 1UTNA 4JK6A 1ELTA 3QN7A 1GDQA 1NRSH 3FOAA 2BQWB 4YM9A 1O3GA 5C2ZA 5JBCS 1BBRE 1HUTH 1OP2A 5E0GA 1DPOA 3ESTA 4B2AA 2SNVA 2W5EA 2VIPA 1H1BA 2ZPQA 2QY0B 2BYAX 4OS2A 1DLKB 5FXLA 1O3MA 1HLTH 2J95A 1DXWA 1FI8A 1HIAB 4ABFA 3NRLA 4OS4A 2EQNA 3AVZA 4FU9A 1SQOA 1ACBE 2CK3D 1K1NA 3PO1B 1OWHA 3SQEE 3EDXB 1C1TA 1O2YA 1G3CA 5AFZH 4D8NA 1NM6A 1ANBA 4RN6A 3BTHE 1PPEE 4FETA 1SKYE 2H6MA 1COWD 1WTGH 2WYGA 1WQSA 1HJAB 1WOFA 2BDGA 4ASUD 3TPIZ 1TRYA 1AB9C 1FPCH 5BRRE 3RUOA 3VXFH 4I7YH 4JYVH 3A8AA 3QO6A 3RXTA 4BAOB 1V2NT 1S5SA 2Z6BD 3FP7E 4OGYA 4FUHA 4GPGA 4TWWA 1A0LA 1ZPZA 2CJIA 2P93A 3A7VA 3SNCA 1MTUA 1Y5UT 3F9GA 3GCHC 2SGDE 5I25A 1GJCB 1XUKA 2GCHG 1HPGA 1L4ZA 2C90B 1VCQA 1ETRH 1Z1JA 4TY6A 3LT3A 1GI8B 3LGIA 3OY6U 4BOHA 2W3KA 1BTXA 3U69H 5C1XA 1KXFA 1RS0A 2C8WB 3Q77A 1XKAC 4I31A 3LH1A 2ZFPH 2J2UA 1DANH 3M5MA 4ACBA 1NBMD 3F9HA 3SU2A 1C5SA 6GCHF 2XBWA 3ELAH 1CA0B 1SGQE 3OEED 4E7RG 2H9TH 1B0EA 1K22H 4AN7A 2ZQ2A 2JH6D 2F43B 5GXPA 3SU0A 4YESB 2ZU4A 4GSOA 1FONA 3T26A 1P8VC 3JZ2B 1MBMA 1GMCG 1W0JD 3SNDA 3V7TA 2PFEA 3EYDA 2FXRA 1AZ8A 2PGBB 4NGAH 1TPAE 2UUKB 1EJMA 1QIXB 5C3NA 1V2TT 2ZGXH 3RMLH 1TX7A 1L0ZA 2ZWLH 4X1SU 1O2JA 1KTSB 2BQ6B 1B0FA 1TWXB 3UR9A 3SOSA 2FOMB 1ZLRA 2VWNA 1KXCA 1VCPA 1LVOA 1QURH 2GCTB 2ULLA 2BOKA 1ANEA 1HDTH 3S9AA 1P10A 2WINI 5DSFA 1VITF 1F0UA 3PV4A 1GI2A 2KCYA 3AW1A 2QF0A 5DKMA 1YKTA 4I8JA 2ZDNA 3QGNB 1FY1A 1V2PT 2ESTE 2B5TB 3B9FH 2R0KA 3GY4A 2FOEA 1Z8IB 1N8OC 1OYTH 4MTBA 4BAMB 1DUAA 1QRWA 3OFND 5CHAC 2O8WA 1C5WB 4JCNA 1H9HE 4ISIH 3VFEA 3UUZA 1MAYA 4Q80A 1Z6EA 3EE0B 4AB9A 4BNRA 4LOYH 1O5EH 2EA3A 1CHOG 2BLOA 4Q7ZA 2GV6A 3OU0A 3F1SB 3UPEA 3KL6A 1W0KD 2G52A 5EQSA 3SUFA 1H8IH 4Y76A 1CBWC 1S82A 2QGRA 5EOKA 4F48B 9ESTA 1BTHH 1KMHB 2G81E 1C4V2 4ISOA 5EQRA 3MU4A 2QA9E 1GHZA 2Q1JA 4K5ZA 3SU4A 5EW1H 3KGPA 3O8BA 2FLRH 5F6MA 1IHTH 5FPTA 1N6YA 1GBAA 1S0RA 4ABHA 1DSUA 4AGJA 1FQ3A 1C1PA 1ZRKA 2BLVA 1YCPK 5EU8A 1O3KA 5GPIB 2TIOA 4B2BA 1W8BH 1P9UA 3RXPA 3RXQA 2Z9KA 1FPHH 3PWCA 3TK9A 2UWOA 3BIUH 4XOJA 1WV7H 1ZPBA 2GDEH 1H8DH 2GT8A 3MU5A 4Q4LA 2WV5A 2QXJA 3VEQB 1QJ6B 2ZDMA 2SGAA 1MH0A 1GJ6A 2H2ZA 5A8YA 2QAAA 1C4Y2 1ELCA 1FN8A 4FUDA 1EZUC 5CMXH 4BTTB 3PRDA 3MH4A 3URCA 2PW8H 1CT4E 3PROA 4KELA 4CHAC 1SGTA 1O2OA 1A3EH 1VZQH 5A8XA 1SR5C 2EY4C 3C27B 3ZZ8A 3UIRA 5FAHA 2CHAC 3QUMP 6LPRA 2VIDA 4ZCNA 1YLCA 2BVSH 1TA2A 3RU4D 1M9UA 1GI5A 4VGCB 5AVDA 4DGJA 2VB0A 2V7QD 2FS9A 2FTLE 5DP7A 3K2UA 1AIXH 1YPMH 1INCA 1FAKH 5TJXA 1C5NH 2FESH 4E7NA 1GHXH 2FS8A 3DFLA 1MD7A 1O5BB 1O3PB 5EGMA 3MU8A 1OP0A 3RXHA 3LH3A 1O2XA 3UAIC 4A6LA 3C1KA 2GX4A 1AVGH 1BRUP 1O5CB 3GICB 1E38B 2BHGA 1GBIA 1PQ7A 5EJZA 1Y5BT 1O2GH 2KFWA 1DVAH 4CRAA 2PGQB 4DCDA 4ZAEA 2TRMA 1MKXK 1KIGH 3TITA 2P8OC 1TNIA 2Y80A 2GP9B 3RXKA 3TK5A 4AFQA 4LK4A 2WPKS 2DE8A 2F9PA 3ZVEA 1EXFA 3E0NB 2ZFRH 1LVBA 3ZVBA 2F9VA 5F53A 1SGRE 3URDA 2ZNKH 1A7SA 2H5DA 4X8TH 1HAVB 3M5OA 4ZKSU 1MBQA 3H5CB 1GBHA 2F83A 4UFEH 3VB6A 1QJ1B 1TE0A 5A2MH 3NUMA 1G37A 5SGAE 1TNJA 1UK3A 1BRCE 5TCCA 4ZHLU 1L1NA 1SQTA 5FBEA 4X6NA 1W7GH 3W94A 1A5IA 3BEIB 1TPSA 1HV7A 4FUIA 1NPMA 1VGCB 1AFEH 2BD7A 1FMGA 1O3CA 1RTKA 3K65B 1TABE 1WCZA 3E90B 1F2SE 3A85A 3ZZ7A 4UEHH 2R0LA 3A8BA 2YMSD 2H9EH 5A0BA 2QF4A 2QE7D 3F3BA 1FXYA 4X2VA 3SU3A 4UFGH 1BMNH 2AERH 1A1RA 2RA0A 3U98H 1ABIH 1ZZZA 5G4BA 3VGCC 1Z7KA 1G30B 3SI4H 1LKBA 2D8WA 5T1VA 3A7YA 4E06H 1O37A 1Z6JH 1GVLA 2XC4A 2HNTF 2PUXB 1F92A 4TT3D 5IK2D 1KLJH 1RTLA 3HK3B 3HPTB 2F3CE 3RXIA 2V0BA 3MO6A 1ZMLA 2CF9H 1O2TA 2BZAA 2Z3DA 1EQ9A 2AIPA 1HNEE 5C5OA 3STIA 2PUQH 2WPLS 4KGAA 1C9PA 4A1TA 4BTIB 1BMFD 1KYNA 2ZU3A 1OWKA 1V2ST 1G3BA 1C2KA 2W7UA 1ZOMA 1TA6A 4B6EA 2STAE 4OM9A 3W95A 3TGIE 4ZH8A 2XBXA 2F9BH 1AQ7A 2NU3E 2FO9A 3S7HB 1ESAA 1KTTB 2R2MB 4RKJB 1BUIA 1TBZH 3A7ZA 1C1RA 1TQ0B 1LPZB 5H4IB 1XUFA 4TPIZ 1OHHD 3M35A 1UCYH 4MLFB 3ZVCA 2ZDAH 2GMTB 2WPMS 4AGKA 2YMSB 2C93B 3LGYA 2BDIA 1EP5A 4TSFD 3RXEA 3VPKA 3ZZ6A 4AG1A 1O0DH 3PLKA 1C5YB 1MTNC 1WBGB 1TALA 5HYOA 3SJIA 2VIVA 2BZ6H 1ELDE 1SQRA 2FEQH 1BZXE 1RFNA 1YM0A 2VJ1A 1NRRH 3TIUA 3ZYEA 4BXSA 1O3JA 2FM2A 2L6OA 3UOUA 4ABIA 1AZZA 3BTTE 1P3CA 3BTME 3FN8A 1V2QT 3MNSA 4KTCA 1TLDA 2BB4A 3RM2H 2Y81A 4CH2B 3ZIAD 1EB2A 3BG4C 2FI4E 1IQJA 2TGTA 4FXGH 1K1OA 1MAXA 3UNQA 4DIIH 3QK1A 1ELEE 4TWYA 1D9IA 2F91A 3U1JB 2JETB 4Z1MD 1V2MT 3A7WA 1O33A 1TAWA 4B73A 2BD8A 1T8MA 4A1VA 1AY6H 3P92A 3P70B 1HCGA 3ATKA 2ZKSA 3KYFA 1HAHH 1MZDA 3H7OA 4Y7AA 3P6ZB 2W7SA 1SSXA 1UCYE 8LPRA 1IQEA 1MCTA 2XYAA 3BEFB 2KX4A 3SHCH 1HJ8A 1QGFA 1EP6A 4IMQA 1OPHB 2FTMA 4ZUHA 5F8ZA 1VKYA 5DP9A 2XOKD 1FDPA 1O39A 1QFKH 3FZDA 5KGOA 3RC4A 1EJNA 3D62A 3TK6A 3G01A 1BHXB 1OXGA 1GJ5H 1ELGA 1GJBB 1SB1H 1IOEA 1DWEH 1L4DA 2ZU5A 4ZXYH 1SMFE 2WHXA 1F5LA 2BMGB 3NCLA 3PYHA 1YPEH 2NU1E 1GCTC 3TH4H 4JYUH 1SGPE 3A82A 4NWKA 4A5TS 4E05H 2H9HA 3RMMH 4CBOA 4UFDH 5JBBS 1ORFA 1IQGA 3A80A 2VH0A 2XWBI 3ZVDA 1OYQA 2ZGHA 4I33A 2XWAA 4B1TA 1GMDG 1P12E 5EJ1A 3FP6E 2ZHQH 2HALA 2J92A 3RXRA 1VJ9U 3STJA 1P06A 5AFYH 3ZZAA 2VWLA 4YO9A 1DX5M 3V3MA 3BTGE 1C5UA 1JMOH 1EB1H 3A88A 1LHGH 1DSTA 1UTQA 2AMPA 3DA9B 4I32A 5T6FA 3SU6A 2ZDLA 1SGNE 4BAQB 2PKSC 3BTEE 2FOCA 2BXTH 3LGTA 2YNAA 1K28D 1K21H 1DITH 1ELVA 5LPFA 1A4WH 4MNXA 3F6UH 1JIRA 2V6NA 4LZ4B 2W6JD 2RA3A 4X6MA 4Z0KA 1VITG 1F0TA 2Y7XA 3GS9A 1SG8B 1V2LT 2BD5A 2BVRH 2OC0A 1DFPA 3RXSA 1NRNH 5ESTE 1T4VH 1CGHA 4INLA 4IMZA 2BDBA 3SW2B 2EI8A 2F9UA 2SGEE 5E8EH 5T3HA 1BB0B 1SLXB 3LKWA 2FZZA 2ZA5A 2A7HA 1AGJA 4ASHA 3WWFA 5C5NA 2VGCC 2C4FH 4IW4E 1YPKH 1D3PB 4Y7BA 2CN0H 4K3JA 1AB9B 1MQ5A 3M61U 2SFAA 3MMGA 3PWBA 3IG6B 1GGDC 1EX3A 5FBIA 2GZ7A 2WPHS 2J98A 5HKKD 1EZSC 5KEDA 2PR3A 1ARCA 3GCHB 4XRNA 1FV9A 2BD2A 3K9XB 3MNBA 5TCAA 4ZROA 1L1GA 2ZC9H 1MUEB 1NY22 3RXOA 4MPXA 1AO5A 1THSH 2A0QB 1PPCE 1EAUA 3A83A 3R0FA 4MNYA 2VNTA 1O31A 4MDSA 4JYTA 1BTWA 1BMLA 2BLQA 3GCNA 1G2MA 1C2FA 2NU0E 1YP9A 1D3TB 1ANCA 1LKAA 1LVMA 1RD3B 2Q6FA 4K1EA 3SUDA 2B7DH 3JZ1B 2OLGA 2IPQX 2M2AA 1GJ8B 3Q00A 5C1YA 4K60A 1LHCH 4XFQA 5ESBA 1ETSH 1CA8B 3DHKH 3KYGA 1NFUA 1U6QA 2XXLA 1EAWA 2PSYA 5CDFE 2P3FH 4WH6A 4X1QU 5DJ7A 1JOUB 2A4RA 4F49A 1V2RT 1PQAA 2FOAA 1O2VA 1ZRBA 2XBYA 1CE5A 1AU8A 2QV1A 1WTHD 1V6DA 1Z8GA 4P02A 4FUGA 3RLYH 2PTNA 4O3UA 1X7AC 2EC9H 2A4OA 2HNTC 4R0IA 3UQVA 1O2PA 3MWIU 2HOBA 1PJPA 1K2I1 1C5VA 2Y5FA 4O97A 1UHBB 3EQ0H 2HVYB 1ESBA 1N6XA 3OYPA 1H4WA 3SV6A 2J34A 2Y82A 3GCOA 4WH8A 1LO6A 1UK2A 1BOQA 2ANWA 1XMNB 1EPTC 2PLXA 3ZYDA 1AUJA 1THRH 1O5FH 4X1PU 5L6NH 1Y59T 4GHTA 3FZZA 3VXEH 3TGJE 2SGFE 4AC9A 1GBBA 1UTJA 4OS7A 1QR3E 4AOQA 2LP6A 3A86A 3MH5A 4NIWA 1O5DH 1N8OB 1V2OT 1GMDF 2HNTE 4RI0A 1Y3WA 5CHAB 4KP0A 4B75A 4YTAA 4WVPE 2BX4A 2Z9IA 2Z3CA 3TJVA 3T25A 1MD8A 1MCVA 2K1QA 1CO7E 1P9SA 1T31A 3SNBA 1GG6C 1V3XA 4XSKU 2BOHB 4UDWH 2GD4B 2OQ5A 3ZVGA 4M7GA 1J17T 4AB8A 1QHRB 2FOHA 1P05A 3S7KB 1SGDE 5B6LA 5FX5A 2R3YA 4Q7YA 3OAAD 1P2IA 3UY9A 1YC0A 1CBWB 1S0QA 4YT6H 1P2JA 1SQAA 2ZECA 1GJ7B 2AH4X 2W26A 4CH8B 1UW7A 1WYKA 3QX5H 2D26C 2OK5A 5EPYA 4X6PA 1E0FD 1XX9A 3N7EA 2QN5T 5FCRA 3MTYA 1AHTH 4H4FA 1QQUA 2KCAA 3TU7H 2BDYA 3E91A 2ZFFH 2ZQ1A 3BV9B 2HRVA 2B9LA 2ZPRA 2PHBA 1J16A 1RGQA 3U28C 1P09A 2WUBA 1W13U 1O2QA 5LPEA 4X8SH 1BA8B 1O3DA 1P04A 3SI3H 4XBDA 2BY9X 2LPRA 1J15A 4X2YA 1PPBH 1YLNA 4Q63A 1DWDH 4NZQA 1ABJH 1GI9B 4ABGA 1NFXA 4PROA 1BTYA 5HMAA 3GY6A 2A5IA 2A7CA 1SHYA 2VU8E 4MQAA 1G2LA 8ESTE 2IJD1 1A61H 2GGVB 4I8KA 1MU6B 4Q2KA 2VVUA 4ISLA 1AFQC 3QDZB 1O2SA 5GDSH 3KF2A 4ISHH 2PV9B 4WWYA 4CHAB 1IAUA 6CHAC 4ABBA 5EXLA 5LGOA 3MO3A 1DE7H 1FNIA 3ZZBA 1FLEE 1IQMA 1DM4B 3PB1E 2VWOA 1YF4A 2CHAB 4FUFA 3U8OH 1NU9A 2RDLA 3UREA 1P2KA 1EAXA 1HIAA 1EPTA 1SFIA 2R3UA 1A0JA 4WXVA 1DUEA 1TIOA 3LC5A 3SV7A 4WY3A 1WAYB 3SU1A 2Y6TA 4ABAA 1GI1A 2XC0A 1FUJA 1GPZA 3D23A 2DUCA 1W0ZU 4A1XA 1QCPA 2WV4A 3MO9A 2AGEX 4FU7A 2ZFSA 3RXVA 1G36A 1O3IA 2XC5A 2AFQB 1EUFA 4YOIA 3RXUA 1HGTH 4I86A 4Y8ZA 4HZHA 3SV8A 3DSGA 4ZKNU 3LU9B 3P8FA 2AHME 3MH6A 1D6RA 1GHWH 1ARBA 1C1SA 3RXJA 4FVDA 4Y6DA 3SJ8A 1WU1A 3A84A 1QBNA 3BTKE 4MNWA 1O5AB 2BDAA 2H5CA 1C5XB 3MNXA 1Y5AT 1ZR0A 1ELAA 2P8OB 3GY2A 1PQ5A 2B8OH 5F8XA 4IBLH 3BSQA 1HAOH 2SGPE 3ZZ9A 4CRFA 1MKWK 5C67A 1E1QD 1AE5A 3ZZ3A 1EAIA 1O3LA 4YXWD 8GCHF 2OD3B 3P8NA 3PLBA 1OWJA 1P2QA 4Y79A 1OWEA 1H9LB 1TMUH 4H42U 1EATA 1GVKB 4K1SA 2OC1A 2Q6DA 1TNGA 3TLOA 3LPRA 3KNXA 1LDTT 3BIVH 3FFGA 2XNDD 1WDIA 2RDEA 4GVUA 1VR1H 5L30H 1QBVH 1GBMA 4M9FA 1DWBH 2QCYA 3RXCA 2FMJA 3F0OA 5L2ZH 4WMEA 2KAIA 1CGIE 4Y10E 4IN1A 3UFAA 1GBKA 1GJ9B 1C2LA 3RXMA 1TPPA 3MYWA 1ID5H 1PPGE 3DSOA 1DOJA 1ZMNA 3ZV9A 2Z9GA 1NZQH 1T7CA 3PLPA 1BBRK 1TBQH 4GLYA 1O32A 5JBAS 1A5GH 3BG8A 5EXMA 1BIOA 3VGCB 2QF5A 2BXUH 3MHWU 3M5LA 2A45B 1GBDA 3QZQA 4OGXA 4NSVA 3UTUH 2BLWA 1V2JT 2W6ID 3M3VA 1CGJE 3CENA 3MOCA 1MTWA 1UTKA 1DS2E 1TNHA 1QBOA 3LOXA 4BXWA 1C2IA 4ABDA 1HJ9A 3ATWA 1YPHC 5F8TA 1KXDA 1TYNA 3SNEA 3LGUA 3GYLB 5FL7D 2ZTZA 2I6QA 3OE7D 1C2GA 1G9IE 3LGVA 1E35B 2O9QA 3PV2A 4F55A 3RMOH 3DUXH 2C8ZB 1HAYB 1ZYOA 2ZCHP 3AASA 3SN8A 2Y7ZA 4AFSA 1Z8JB 2WV9A 3A8DA 1XUHA 2WYJA 4AYYB 3PMBB 4I8LA 2ZDKA 4NIXA 1QQ4A 3S9CA 2TGPZ 1C1UH 1GDUA 2O8LA 4NSYA 3MH7A 2ANKH 2PKAA 3SQHE 4KTSA 3KIDU 3U8TH 1YPHE 3FANA 3MFJA 3Q76A 3SUEA 4INKA 5E0JA 1QL9A 1MTNB 1W14U 4O03A 3RM0H 2ALPA 2QIQA 1SFQB 2BD9A 1CT2E 5DK1A 1ETTH 4LXBH 1P03A 2G51A 1GI6A 4JZFH 1GBLA 2BY6X 1RIWC 1C5QA 3F0PA 4J2YB 3S0NA 1ZHMA 1XUJA 3AAVA 1ZTLA 4RT1A 5GWZA 1P2NA 3BTDE 4MPWA 1UJ1A 3MI4A 4FUJA 1KDQA 5KECA 1C5TA 1LQDB 2Z9LA 1EZQA 2OXSA 5HXFA 4ACAA 1T4UH 3BG4B 3BTWE 3TJUA 5IYTA 1C1OA 2RCEA 3ZZ4A 1C9TA 1SGIB 1TGCA 2OCVB 4XDEA 1DWCH 5JB8S 2OINA 4SGAE 3A89A 1YPJH 1Z71A 2K8IA 1AWHB 3SJKA 5A09A 1YWUA 2J97A 3SJ9A 3M7QA 5HGGA 1CT0E 3HKJB 1C5ZB 1WQVH 4GUXA 1SGFA 2ZGJA 3SNAA 2J98B 1O2NA 2O8TA 1ZHRA 2HPQH 3HK6B 1BRAA 1UTMA 4NIYA 4MVNA 3ATLA 1IQHA 2FWWA 1T32A 1ANDA 1TGNA 3LONA 4MNVA 1BMAA 1KSNA 4JZEH 3CNRA 1DDJA 1E79D 3KN2A 4A7IB 1GCTB 5LPRA 3M3TA 4Y8YA 1TOCB 2JDID 3RU4E 4DY7B 2ZFTA 3H09A 1HXFH 4XE4A 4DURA 1B5GH 1SHHB 4JZIA 2D1JA 2BVXH 5HM2A 3TJOA 5FPSA 2UUFB 1GHBF 1JBUH 1EASA 1THPB 4CRDA 1YCPH 3M7TA 1KLIH 1SLUB 1QJ7B 4SGBE 4AZ2B 3SGQE 2FLBH 1BTZA 1OP8A 1E1RD 1KLTA 3GY3A 3GYMA 5CE1A 3RU4T 3TVJB 3KEEA 3ODDA 1GHAF 3T27A 1C5RA 3M3SA 1QL8A 2F9NA 5LH8A 1IQKA 3L33A 1PQ8A 2A7JA 1UO6A 2OP9A 4ISNA 1JRTA 2PKSB 4D9RA 1GL1A 2P3UB 5JDUB 1ZGIA 1EZXC 5AHGH 4J1YA 4LZ1H 1BITA 1ZJDA 2YMSC 4K8YA 3BF6H 1ELFA 2KCPA 5GJ4B 2O8MA 4CR9A 4HTCH 1O2KA 4B74A 3RMNH 4YOGA 1K1JA 2FP7B 3AW0A 5A0CA 1Z8RA 4ABEA 4B6FA 1C4U2 4WXIA 1A3BH 1BDAA 3ZVFA 4DVAU 1NRQH 1HAPH 2AGIX 3SZNA 5DP4A 4GCHF 1YY3A 1OSSA 2KR7A 2CXVA 3GISB 2V3OH 1FY5A 4OS6A 2VGCB 2NU2E 1VJAU 4YLUA 5FPYA 3DFJA 3CS0A 1YGCH 5E2PA 4UONA 1GGDB 1GI7B 3P17H 1S83A 4YOJA 5AF9H 1SBWA 3GDSA 3R3GB 4K8BA 7ESTE 3GCTG 3IWMA 4OS1A 4DIHH 3RLWH 4XD7D 2BTCE 1KXEA 1FX0B 1T8OA 3F2GA 2FIRH 3RXAA 9LPRA 4YLQH 1O36A 2XBVA 1XVOA 1CHGA 1AVXA 1O3EA 2A1DB 2A5AA 3NWUA 4BAHB 1MKXH 3OTJE 1CVWH 5C20A 5C1UA 3U8RH 3MNCA 1K1PA 1Z1IA 1TGSZ 2FOGA 2Z3EA 1C1NA 1J9CH 4DG4A 3BEUA 3CP7A 3PMAB 1O2WA 2OBQA 4Y0ZE 1Q2WA 1ZSJA 2AS9A 3V13A 2Q6GA 1G3EA 1ZPCA 4WJG2 1HAZB 1ZSLA 3GOVB 1IQIA 3EA7A 2EEKA 4O9VA 2JH0D 2WPJS 3RC5A 1LPKB 1K1LA 3KQEA 2IJOB 4AORA 2ZHWH 1TOMH 3E3TA 1N1LA 1GJAB 1C5LH 1O35A 1KY9A 1P0SH 3OTPA 5DP3A 2BDHA 3K6ZA 1FN6A 4X8VH 5E2OA 3MU1A 4Y8XA 3GDVA 1AKSA 2FOBA 4Y0YE 1P2MA 3OY5U 4KKDA 2J38A 5J4QA 1EKBB 1QL7A 1BJVA 4QT8C 3T28A 5PTPA 4NG9H 1SGEE 2UUYA 4TYDA 4JMYA 2WZQA 2W3IA 4CRCA 1HRTH 3NKKA 1TNKA 1NFYA 4GAWA 1S6LA 1OS8A 4NZLA 3B8JA 5K7RA 1ZGVA 3MQKC 7LPRA 3FVFB 1SVPA 4TPYA 1TB6H 4Q7XA 1DICA 1O3AA 2ZTXA 4DT4A 1EPTB 1O3NA 2PTCE 2EI7A 4U2WA 2ODPA 3TNSA 5GCHG 5FX6A 1NS3A 1OX1A 5GNDA 1SC8U 5ETXA 1TGTA 1NFWA 2P16A 4NFEA 3S9BA 1BTPA 2ZG0H 2G5NA 1RXPA 3A7TA 1IHSH 1P2OA 1TPOA 2GT7A 1GI0A 5A8ZA 4ZXXH 1QY6A 2FX6A 1TONA 1MTSA 4DT7B 4ZHAA 2A2QH 1GG6B 1S81A 2PWXA 4OS5A 5T6DA 3EA9A 3I78A 1HAIH 4BTUB 3NPSA 1O30A 1TFXA 7GCHF 4MPVA 5JB9S 5DO4H 1TMBH 1XKBC 3N7DA 2A31A 8GCHG 1B7XB 2WSSD 1P3EA 1E34B 2FOFA 1AI8H 1ZJKA 1C2HA 3E8LA 1UVSH 2A4QA 2P3TB 5C0UA 3NXPA 3PMHB 3E16B 2ODQA 3PO1C 1QZ8A 3RP2A 1HAXB 1EOJA 2G4TA 4WF8A 1S85A 2B0FA 1SPJA 1GMHF 1LHFH 1C5OH 3EAJA 1O3FA 4HG6A 1JWTA 1NRPH 4X1NU 3Q3KA 1H9IE 2ZO3H 5EXNA 1J14A 2KAIB 1QRXA 1W10U 1F7ZA 1LVYA 5EJLA 1GBCA 1HJAC 1PYTC 2ZHDA 1G32B 1LPGB 2F4LA 2HPPH 1C1QA 3GCTF 5HM9A 2P94A 1AFQB 1T8LA 1TQ7B 1XM1A 6CHAB 3RXFA 4D7GA 4KTUA 3PTBA 1BMMH 2AGGX 3U9AH 3RXGA 3VB7A 3WWBA 3PV5A 1SGCA 5DP8A 1C5PA 3RDZA 2TGAA 4GHQA 6ESTA 2XRCA 1UTPA 4D7FA 4ZHMU 3A7XA 3ENSB 1FY8E 1SL3A 2G8TA 4NCYA 1NTPA 1FY4A 5EQQA 2R9PA 2J4IA 1GBEA 4B2CA 2ZHEH 1LQEA 4I8HA 1YPGH 4X2WA 3RXDA 1W2KH 2GTBA 2AIQA 1ZHPA 2QC2A 2ZPSA 2L74A 4X8UH 5HIZA 4NIVA 1UVTH 1CA0C 1UK4A 2XW9A 2VIQA 4JZ1A 1BTUA 1GBTA 2FYQA 1C1VH 3L6PA 3NZIA 3KHVA 5T6GA 1EJAA 1UCYK 2FDAA 4Y11E 1Q31A 3P8OA 3LGWA 3E1XB 3MU0A 1C1WH 2WPDD 3BTFE 4H6TA 1QNJA 4HI3A 4CREA 3E0PB 1ZTJA 1YPLH 2PKAB 1IQNA 2HLCA 1O5GH 4DOQA 3RXBA 1QB1A 1AVWA 1IQFA 1AMHA 2ZCLP 5ABWA 3HGPA 2G4UA 5JPMH 5BPEA 2EI6A 4K1TA 1HYLA 3HATH 3LJOA 2STBE 2V35A 1TBRH 4FUCA 1P11E 2F9OA 4X1RU 1MMJN 2ASUB 1LHEH 2AEIH 2BD4A 3IITA 3I77A 1D6WA 3WY8A 4CRBA 1CQQA 3AAUA 1KDQB 2TGDA 2GCTC 4IGDA 5GIBA 1FIWA 1F0SA 1K1MA 1O2MA 3KCGH 4JZDH 1YLDA 1BRBE 2QXGA 2HWLB 3QTOH 4RKOB 5GCHF 2ZIQH 2JH5D 1ZSKA 1ZMJA 4F4OC 1NO9H 1S84A 1F5RA 2ZDVH 1LCYA 4Y71A 1AE8H 3F2HA 1RJXB 1H8ED 4U01A 2AMQA 3N99A 3OSYA 1V2UT 1F0RA 4MPUA 2D2DA 1C5MD 2QXHA 4WMDA 2IN2A 5A0AE 3KQDA 4U32A 1ZTKA 2ZFQH 3A87A 2BX3A 1GHYH 3EA8A 1O38A 1L2EA 3SU5A 2ZZUH 3GY8A 1GHVH 1HAGE 4Z6AH 4FOUC 3D49H 1LMWB 3BN9A 1NBME 1TX6A 3F68H 2THFB 2ZI2H 3UWIA 1WSSH 3ZZCA 3VB5A 1GDNA 3LDXH 2GCHF 1BHXF 2JKHA 2BD3A 1GHBG 1UHBA 3KQBA 4NFFA 2ZHFH 2JJ1D 3ITIA 3SORA 1SGYE 3UB0A 1O2HA 2XCNA 2J5UA 3B23B 4UD9H 3M37A 2G55A 2VINA 8KME2 5EIYA 1XXDA 4U30A 1HBTH 3PMJA 4CR5A 1GHAG 1PPFE 1V2KT 4O3TA 1D3DB 2OTVA 2I6SA 2HGTH 1W7XH 1WUNH 2QF3A 3M5NA 2GVFA 1HB0B 3ZVAA 1T8NA 4FU8A 4UFFH 3NK8A 1K9OE 3A8CA 5E0HA 3SV9A 3FAOA 2UWPA 2J94A 2ZF0H 3ZZDA 4R8TB 1O2RA 1J8AA 3TH2H 1GMCF 3WW7A 1K1IA 3P95A 3EGKH 3V0XA 1YYY1 4NA9H 2XCFA 2C8YB 1RIWB 2BDCA 4INHA 3SGBE 1GJ4H 2FI3E 3L3TA 2YOLA 3SGAE 1CSOE 2SNWA 2VIWA 5FCKA 2VH6A 2ALVA 3RXLA 1A0HB 2VIOA 3VB3A 3LC3A 2GV7A 1NC6A 4GCHG 4AX9H 1C2MA 1Y3VA 2C3SA 1UTOA 3ODFA 1QTFA 2BY8X 3U1IB 3VB4A 2RFKC 2ZEBA 2M5TA 2DE9A 1UTLM 1W11U 5DGJA 4DJZB 1GBJA 2AMDA 3P8GA 4B76A 3O8DA 3TGKE 4VGCC 3T62A 3OX7U 3FO8D 1SOZA 2Y5HA 5HIYA 2JJ2D 3SJOA 2CV3A 2GDDA 3KQCA 2J9NA 3F2FA 5DN6D 3Q3YA 2OQUA 1QB6A 2O8UA 1GI3A 1DT2A 2OUAA 1F5KU 2RG3A 4JK5A 7KMEH 4FUBA 4NA8A 2ANMH 1O3OA 1QRZA 1SI5H 5JYIA 3D65E 4X2XA 1QB9A 1CHOF 3T29A 2FI5E 1W3CA 1MQ6A 2QXIA 4NWLA 4AFUA 3Q3XA 1P01A 1Q3XA 1KXBA 1C2JA 3DCLA 1LHDH 1BJUA 1DLEA 1G3DA 4CBNA 1JXPA 3F9FA 3A81A 2FX4A 2Y5GA
chains in the Genus database with same CATH topology
3V12A 2A2XH 3DD2H 4YT7H 3GY7A 3O8CA 2ZP0H 4MG3A 1O2LA 1P02A 3GDUA 3ATIA 3ZV8A 2H1UA 2CF8H 2ILNA 1MZAA 2FODA 2ZGBH 2ZU1A 2C8XB 3DT0H 2CMYA 1FZZA 3UQOA 1YBWA 4ZKRU 2GZ9A 1O2UA 2SGQE 5DP5A 1VGCC 2R2WU 3SO3A 1SGFG 4HFPB 4THNH 5B6OA 4XBCA 4X6OA 3QZRA 2A4GA 1BCUH 1AKSB 4XBBA 1Y3XA 1TNLA 4ZMAH 2TBSA 1FAXA 4YZUA 3UNSA 1VITH 1C1MA 2A5KA 1XVMA 2Z7FE 1GJDB 5EG4A 3S69A 1AN1E 3FP8E 1D4PB 2TPIZ 1EOLA 4BANB 4K69A 4FVBA 3GY5A 1FY3A 1O3BA 1NESE 4DW2U 1Y8TA 5EPNA 1O2IA 4D9QA 1BQYA 1RTFB 1FJSA 2ZTYA 1C2EA 2OC8A 3TH3H 5EW2H 2ZGCA 2IPHA 2XNIA 2A32A 3UNRA 1UVUH 1C2DA 1GL0E 4WMFA 4NA7A 1GBFA 1A2CH 2VWMA 4RSPA 2Z9JA 3F9EA 1CU1A 3SBKA 1VCWA 2ODYB 5IDKA 1AD8H 4HGCA 1YCPM 5EODA 2WPIS 1GI4A 2G00A 2HVXA 1V2WT 4ZKOU 1Y3YA 4CRGA 1TRNA 2ANYA 2BQ7B 3HGNA 5DG6A 7GCHG 5J4SA 1IQLA 3T5FH 1DXPA 1TRMA 1ESTA 1W12U 2VVVA 3SV2H 4D76A 4FUEA 2VVCA 4ABJA 1TX8A 2LNCA 2GMTC 5JBTA 1LTOA 3TNTA 1O34A 2FYRA 2UWLA 3QWCH 2GKVE 4BAKB 3BTQE 1V2VT 1P57B 1KXAA 3QTVH 1ELBA 2CGAA 3HKIB 1QA0A 4A92A 1XXFA 3M7UA 1UVPA 1A46H 3M36A 2G5VA 1MKWH 1NROH 3K6YA 5FHTA 1GMHG 2PSXA 2Z94A 1HAVA 1GCDA 1DY9A 2ZU2A 1TMTH 3QLPH 2P59A 2UUJB 3H7TA 1MU8B 2GZ8A 6GCHG 1A5HA 1UMAH 1PPHE 2WUCA 1OOKB 1OWIA 1E37B 2NWNA 3E6PH 5I46H 4H6SB 1XUIA 3N7OA 2JETC 1W0YH 2BY5X 3SUGA 1DY8A 3UR6A 2QYIA 3TJNA 2NU4E 5L2YH 2OBOA 3LIWA 3QGJA 1JIMA 2OC7A 3CS7A 1NU7B 4K2YA 1HFDA 2ZCKP 3I29A 3UWJH 4X0WU 3UOPA 1GWAA 1FIZA 1S6HA 1BBRH 1SLWB 2AYWA 1AUTC 4I8GA 1D3QB 5DPAA 4ESTE 4IC5A 3ZZ5A 1NT1A 3LJJA 5K0HA 1TGBA 1JRSA 1HXEH 1PFXC 1UVOA 1XUGA 3SHAH 1O3HA 3RC6A 3ATMA 1O2ZA 2V3HH 1NN6A 4AYVB 1S6FA 1GVZA 4IS5A 2BY7X 1SOTA 4B71A 1SLVB 1QA7A 2YNBA 3PM3A 5F03A 1Y3UA 2FPZA 2XTTB 1AWFH 1OKXA 1RRKA 2BM2A 2P95A 1MTVA 4IN2A 4TY7A 1E36B 2IOTA 4AG2A 1BT7A 4AFZA 3O8RA 5DP6A 1OWDA 1PYTD 3PTNA 1PPZA 1L1JA 3T2NA 4IC6A 4UE7H 1UTNA 4JK6A 1ELTA 3QN7A 1GDQA 1NRSH 2BQWB 4YM9A 1O3GA 5C2ZA 5JBCS 1BBRE 1HUTH 1OP2A 5E0GA 1DPOA 3ESTA 4B2AA 2SNVA 2W5EA 2VIPA 1H1BA 2ZPQA 2QY0B 2BYAX 4OS2A 1DLKB 5FXLA 1O3MA 1HLTH 2J95A 1DXWA 1FI8A 1HIAB 4ABFA 4OS4A 3AVZA 4FU9A 1SQOA 1ACBE 1K1NA 3PO1B 1OWHA 3SQEE 3EDXB 1C1TA 1O2YA 1G3CA 5AFZH 4D8NA 1NM6A 1ANBA 4RN6A 3BTHE 1PPEE 2H6MA 1WTGH 2WYGA 1WQSA 1HJAB 1WOFA 2BDGA 3TPIZ 1TRYA 1AB9C 1FPCH 5BRRE 3RUOA 3VXFH 4I7YH 4JYVH 3A8AA 3QO6A 3RXTA 4BAOB 1V2NT 1S5SA 2Z6BD 3FP7E 4OGYA 4FUHA 4GPGA 4TWWA 1A0LA 1ZPZA 2CJIA 2P93A 3A7VA 3SNCA 1MTUA 1Y5UT 3F9GA 3GCHC 2SGDE 5I25A 1GJCB 1XUKA 2GCHG 1HPGA 1L4ZA 2C90B 1VCQA 1ETRH 1Z1JA 4TY6A 3LT3A 1GI8B 3LGIA 3OY6U 4BOHA 2W3KA 1BTXA 3U69H 5C1XA 1KXFA 1RS0A 2C8WB 3Q77A 1XKAC 4I31A 3LH1A 2ZFPH 2J2UA 1DANH 3M5MA 3F9HA 3SU2A 1C5SA 6GCHF 2XBWA 3ELAH 1CA0B 1SGQE 4E7RG 2H9TH 1B0EA 1K22H 4AN7A 2ZQ2A 2JH6D 5GXPA 3SU0A 4YESB 2ZU4A 4GSOA 1FONA 3T26A 1P8VC 3JZ2B 1MBMA 1GMCG 3SNDA 3V7TA 2PFEA 3EYDA 2FXRA 1AZ8A 2PGBB 4NGAH 1TPAE 2UUKB 1EJMA 1QIXB 5C3NA 1V2TT 2ZGXH 3RMLH 1TX7A 1L0ZA 2ZWLH 4X1SU 1O2JA 1KTSB 2BQ6B 1B0FA 1TWXB 3UR9A 3SOSA 2FOMB 1ZLRA 2VWNA 1KXCA 1VCPA 1LVOA 1QURH 2GCTB 2ULLA 2BOKA 1ANEA 1HDTH 3S9AA 1P10A 2WINI 1VITF 1F0UA 3PV4A 1GI2A 3AW1A 2QF0A 5DKMA 1YKTA 4I8JA 2ZDNA 3QGNB 1FY1A 1V2PT 2ESTE 2B5TB 3B9FH 2R0KA 3GY4A 2FOEA 1Z8IB 1N8OC 1OYTH 4MTBA 4BAMB 1DUAA 1QRWA 5CHAC 2O8WA 1C5WB 4JCNA 1H9HE 4ISIH 3VFEA 3UUZA 1MAYA 4Q80A 1Z6EA 3EE0B 4AB9A 4BNRA 4LOYH 1O5EH 2EA3A 1CHOG 2BLOA 4Q7ZA 2GV6A 3OU0A 3F1SB 3UPEA 3KL6A 2G52A 5EQSA 3SUFA 1H8IH 4Y76A 1CBWC 1S82A 2QGRA 5EOKA 9ESTA 1BTHH 2G81E 1C4V2 4ISOA 5EQRA 3MU4A 2QA9E 1GHZA 2Q1JA 4K5ZA 3SU4A 5EW1H 3KGPA 3O8BA 2FLRH 5F6MA 1IHTH 5FPTA 1N6YA 1GBAA 1S0RA 4ABHA 1DSUA 4AGJA 1FQ3A 1C1PA 1ZRKA 2BLVA 1YCPK 5EU8A 1O3KA 5GPIB 2TIOA 4B2BA 1W8BH 1P9UA 3RXPA 3RXQA 2Z9KA 1FPHH 3PWCA 3TK9A 2UWOA 3BIUH 4XOJA 1WV7H 1ZPBA 2GDEH 1H8DH 2GT8A 3MU5A 2WV5A 2QXJA 3VEQB 1QJ6B 2ZDMA 2SGAA 1MH0A 1GJ6A 2H2ZA 5A8YA 2QAAA 1C4Y2 1ELCA 1FN8A 4FUDA 1EZUC 5CMXH 4BTTB 3URCA 3MH4A 2PW8H 1CT4E 3PROA 4KELA 4CHAC 1SGTA 1O2OA 1A3EH 1VZQH 5A8XA 1SR5C 3C27B 3ZZ8A 3UIRA 5FAHA 2CHAC 3QUMP 6LPRA 2VIDA 1YLCA 2BVSH 1TA2A 3RU4D 1M9UA 1GI5A 4VGCB 5AVDA 4DGJA 2VB0A 2FS9A 2FTLE 5DP7A 3K2UA 1AIXH 1YPMH 1INCA 1FAKH 5TJXA 1C5NH 2FESH 4E7NA 1GHXH 2FS8A 3DFLA 1MD7A 1O5BB 1O3PB 5EGMA 3MU8A 1OP0A 3RXHA 3LH3A 1O2XA 4A6LA 3C1KA 2GX4A 1AVGH 1BRUP 1O5CB 3GICB 1E38B 2BHGA 1GBIA 1PQ7A 1Y5BT 1O2GH 1DVAH 4CRAA 2PGQB 4DCDA 4ZAEA 2TRMA 1MKXK 1KIGH 3TITA 2P8OC 1TNIA 2Y80A 2GP9B 3RXKA 3TK5A 4AFQA 4LK4A 2WPKS 2DE8A 2F9PA 3ZVEA 1EXFA 3E0NB 2ZFRH 1LVBA 3ZVBA 2F9VA 1SGRE 3URDA 2ZNKH 1A7SA 2H5DA 4X8TH 1HAVB 3M5OA 4ZKSU 1MBQA 3H5CB 1GBHA 2F83A 4UFEH 3VB6A 1QJ1B 1TE0A 5A2MH 3NUMA 1G37A 5SGAE 1TNJA 1UK3A 1BRCE 5TCCA 4ZHLU 1L1NA 1SQTA 5FBEA 4X6NA 1W7GH 3W94A 1A5IA 3BEIB 1TPSA 1HV7A 4FUIA 1NPMA 1VGCB 1AFEH 2BD7A 1FMGA 1O3CA 1RTKA 3K65B 1TABE 1WCZA 3E90B 1F2SE 3A85A 3ZZ7A 4UEHH 2R0LA 3A8BA 2H9EH 5A0BA 1FXYA 4X2VA 3SU3A 4UFGH 1BMNH 2AERH 1A1RA 2RA0A 3U98H 1ABIH 1ZZZA 5G4BA 3VGCC 1Z7KA 1G30B 3SI4H 1LKBA 2D8WA 3A7YA 4E06H 1O37A 1Z6JH 1GVLA 2XC4A 2HNTF 2PUXB 1F92A 1KLJH 1RTLA 3HK3B 3HPTB 2F3CE 3RXIA 2V0BA 3MO6A 1ZMLA 2CF9H 1O2TA 2BZAA 2Z3DA 1EQ9A 2AIPA 1HNEE 5C5OA 3STIA 2PUQH 2WPLS 4KGAA 1C9PA 4A1TA 4BTIB 1KYNA 2ZU3A 1OWKA 1V2ST 1G3BA 1C2KA 2W7UA 1ZOMA 1TA6A 2STAE 3W95A 3TGIE 4ZH8A 2XBXA 1AQ7A 2F9BH 2NU3E 2FO9A 3S7HB 1ESAA 1KTTB 2R2MB 4RKJB 1BUIA 1TBZH 3A7ZA 1C1RA 1TQ0B 1LPZB 5H4IB 1XUFA 4TPIZ 3M35A 1UCYH 4MLFB 3ZVCA 2ZDAH 2GMTB 2WPMS 4AGKA 2C93B 3LGYA 2BDIA 1EP5A 3VPKA 3RXEA 3ZZ6A 4AG1A 1O0DH 3PLKA 1C5YB 1MTNC 1WBGB 1TALA 5HYOA 3SJIA 2VIVA 2BZ6H 1ELDE 2FEQH 1BZXE 1RFNA 1YM0A 2VJ1A 1NRRH 3TIUA 3ZYEA 4BXSA 1O3JA 2FM2A 3UOUA 4ABIA 1AZZA 3BTTE 1P3CA 3BTME 3MNSA 1V2QT 4KTCA 3RM2H 1TLDA 2BB4A 2Y81A 4CH2B 1EB2A 3BG4C 2FI4E 1IQJA 2TGTA 4FXGH 1K1OA 1MAXA 3UNQA 4DIIH 3QK1A 1ELEE 4TWYA 1D9IA 2F91A 3U1JB 2JETB 1V2MT 3A7WA 1O33A 1TAWA 4B73A 2BD8A 1T8MA 4A1VA 1AY6H 3P92A 3P70B 1HCGA 3ATKA 2ZKSA 1HAHH 1MZDA 3H7OA 4Y7AA 3P6ZB 2W7SA 1SSXA 1UCYE 8LPRA 1IQEA 1MCTA 2XYAA 3BEFB 3SHCH 1HJ8A 1QGFA 1EP6A 4IMQA 1OPHB 2FTMA 4ZUHA 5F8ZA 5DP9A 1FDPA 1O39A 1QFKH 3FZDA 3RC4A 1EJNA 3D62A 3TK6A 3G01A 1BHXB 1OXGA 1GJ5H 1ELGA 1GJBB 1SB1H 1IOEA 1DWEH 1L4DA 2ZU5A 4ZXYH 1SMFE 1F5LA 2BMGB 3NCLA 3PYHA 1YPEH 2NU1E 1GCTC 3TH4H 4JYUH 1SGPE 3A82A 4NWKA 4A5TS 4E05H 2H9HA 3RMMH 4CBOA 4UFDH 5JBBS 1ORFA 1IQGA 3A80A 2VH0A 2XWBI 3ZVDA 1OYQA 2ZGHA 4I33A 2XWAA 4B1TA 1GMDG 1P12E 3FP6E 2ZHQH 2HALA 2J92A 3RXRA 1VJ9U 3STJA 1P06A 5AFYH 3ZZAA 2VWLA 4YO9A 1DX5M 3V3MA 3BTGE 1C5UA 1JMOH 1EB1H 3A88A 1LHGH 1DSTA 1UTQA 2AMPA 3DA9B 4I32A 5T6FA 3SU6A 2ZDLA 1SGNE 4BAQB 2PKSC 3BTEE 2FOCA 2BXTH 3LGTA 2YNAA 1K28D 1K21H 1DITH 1ELVA 5LPFA 1A4WH 4MNXA 3F6UH 1JIRA 2V6NA 4LZ4B 2RA3A 4X6MA 4Z0KA 1VITG 1F0TA 2Y7XA 1SG8B 1V2LT 2BD5A 2BVRH 2OC0A 1DFPA 3RXSA 1NRNH 5ESTE 1T4VH 1CGHA 4INLA 4IMZA 2BDBA 3SW2B 2EI8A 2F9UA 2SGEE 5E8EH 5T3HA 1BB0B 1SLXB 3LKWA 2FZZA 2ZA5A 2A7HA 1AGJA 4ASHA 5C5NA 2VGCC 2C4FH 4IW4E 1YPKH 1D3PB 4Y7BA 2CN0H 4K3JA 1AB9B 1MQ5A 3M61U 2SFAA 3MMGA 3PWBA 3IG6B 1GGDC 1EX3A 5FBIA 2GZ7A 2WPHS 1EZSC 2PR3A 1ARCA 3GCHB 1FV9A 2BD2A 3K9XB 3MNBA 5TCAA 4ZROA 1L1GA 2ZC9H 1MUEB 1NY22 3RXOA 4MPXA 1AO5A 1THSH 2A0QB 1PPCE 1EAUA 3A83A 3R0FA 4MNYA 2VNTA 1O31A 4MDSA 4JYTA 1BTWA 1BMLA 2BLQA 3GCNA 1G2MA 1C2FA 2NU0E 1YP9A 1D3TB 1ANCA 1LKAA 1LVMA 1RD3B 2Q6FA 4K1EA 3SUDA 2B7DH 3JZ1B 2OLGA 1GJ8B 3Q00A 5C1YA 4K60A 1LHCH 4XFQA 5ESBA 1ETSH 1CA8B 3DHKH 1NFUA 1U6QA 2XXLA 1EAWA 2PSYA 2P3FH 4WH6A 4X1QU 5DJ7A 1JOUB 2A4RA 4F49A 1V2RT 1PQAA 2FOAA 1O2VA 1ZRBA 2XBYA 1CE5A 1AU8A 2QV1A 1WTHD 1V6DA 1Z8GA 4FUGA 3RLYH 2PTNA 4O3UA 1X7AC 2EC9H 2A4OA 2HNTC 4R0IA 3UQVA 1O2PA 3MWIU 2HOBA 1PJPA 1K2I1 1C5VA 2Y5FA 4O97A 1UHBB 3EQ0H 1ESBA 1N6XA 3OYPA 1H4WA 3SV6A 2J34A 2Y82A 3GCOA 4WH8A 1LO6A 1UK2A 1BOQA 2ANWA 1XMNB 1EPTC 2PLXA 3ZYDA 1AUJA 1THRH 1O5FH 4X1PU 5L6NH 1Y59T 4GHTA 3FZZA 3VXEH 3TGJE 2SGFE 1GBBA 1UTJA 4OS7A 1QR3E 4AOQA 3A86A 3MH5A 4NIWA 1O5DH 1N8OB 1V2OT 1GMDF 2HNTE 1Y3WA 5CHAB 4KP0A