3RXSA

Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine (f04 and a06, cocktail experiment)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA02
2FP7B 3U1IB 1XKBC 3OY5U 2ANKH 3E91A 3KQEA 3P8FA 3S0NA 3FVFB 1EAXA 1S81A 1O3EA 4BAQB 3HATH 1TFXA 1QBOA 2UUKB 4ABEA 1DWBH 1EJMA 2PUQH 2P93A 3OY6U 4NSYA 7ESTE 5HM9A 1O2XA 3H7OA 1BMAA 2BXTH 4X6PA 4AYVB 2WUCA 3L3TA 1KXEA 4ABHA 2ESTE 1ETSH 3D49H 4Q7XA 1TOMH 1VCPA 4UD9H 5C2ZA 4K1EA 1ESTA 1AKSB 1O3PB 2G5NA 3M3SA 4AFUA 1B7XB 1C5LH 1E36B 4UFDH 2QF3A 1L1JA 2SFAA 2WPMS 2FX4A 2BZAA 4CREA 1NM6A 3VB4A 4ZKNU 3A7VA 2G00A 3VEQB 1TGTA 1FY3A 3HK6B 3SNEA 1GBKA 2NU3E 1QBNA 2BB4A 4A92A 3EA7A 4JZIA 6LPRA 3SV8A 5EW2H 3P8GA 4DOQA 2A7JA 3KN2A 3M5OA 2G55A 1GJ8B 1CA8B 4D9RA 3S9AA 2HALA 1O3OA 1OWJA 4FUIA 3K6YA 2O8WA 2OD3B 3WY8A 3K65B 3B9FH 1ELVA 3TU7H 3BG4B 4CH2B 1LO6A 3I29A 3B8JA 3M5MA 2EEKA 5GCHG 4UONA 5B6OA 4ZH8A 1MTNB 1YBWA 1LHFH 1W12U 3PV4A 2A5IA 1HRTH 1QY6A 1A1RA 4DJZB 1IQFA 1F5KU 1O3FA 1TNJA 1WYKA 1H8DH 4KGAA 6GCHG 2ILNA 6CHAC 3P8OA 1O38A 1QR3E 2Z9GA 2IN2A 3A8DA 1NN6A 3RMNH 1CT0E 1V2PT 4Y71A 3ZYDA 3OSYA 3KQBA 4FUHA 2PR3A 3MU4A 1FXYA 1U6QA 1NRNH 1XUHA 4K1TA 3UNQA 2BQ6B 5GXPA 3CS0A 5JB9S 1ANBA 2FOGA 5FX6A 2G51A 3UY9A 1O3HA 1GBAA 1PPBH 1ELTA 2ZDVH 1TNKA 4LOYH 1GBIA 1W8BH 4B74A 2O8UA 1Y8TA 1GHAF 1BTXA 1NROH 3RXHA 1EAIA 2Z9KA 2F9PA 4A7IB 4X8VH 5TCAA 4YOGA 1O36A 1O2IA 1HAZB 1O2JA 1QNJA 3KNXA 5CMXH 3RMOH 3A82A 4I8KA 1GI5A 1T8NA 2ZFSA 2SGQE 4AFZA 1GBDA 1ZSJA 1BCUH 1H9LB 1THPB 3UWJH 1C5SA 4ZHMU 1OKXA 2WYJA 1MQ6A 1BOQA 1LQEA 2JH6D 4UEHH 1F0SA 2FOMB 1P11E 3MH4A 5ESTE 1HGTH 3KL6A 1P57B 2XBVA 3NXPA 3UQOA 3RM2H 2IJOB 1KTTB 1BHXF 2ZU4A 2VGCC 2GZ7A 3IG6B 1NFUA 1AFEH 2PKAB 5GJ4B 1DX5M 2Z9JA 3R0FA 1TBQH 3BG8A 4JYUH 1EB1H 3NPSA 3RXEA 3STIA 2BTCE 4IMZA 2AMPA 2H1UA 2QXIA 1ELGA 2J2UA 4Y0ZE 5DJ7A 2FZZA 3GYMA 3EDXB 4FVDA 5E2OA 3JZ2B 2ZF0H 3BTKE 4O97A 3I77A 3LT3A 2KAIA 2BD7A 3E16B 1HUTH 1ZTKA 3M7TA 9LPRA 1SGRE 5LPRA 3BTGE 1ZZZA 3ZZ6A 1BTUA 1TBZH 2VIOA 2WV4A 3MU1A 3PYHA 4JYTA 3RC5A 5F8XA 1C5TA 1DOJA 1EASA 2EC9H 5DP8A 1TPPA 3GY2A 1QJ1B 2ZFFH 3E8LA 1GJ5H 2A5KA 1K1MA 3QO6A 3MU0A 1H1BA 3QX5H 3UIRA 3M36A 1GGDB 2CF9H 3BTWE 3K6ZA 1IQMA 3LIWA 2ZFTA 3U8TH 3H7TA 3KEEA 1VZQH 2G4UA 4TYDA 1O35A 3D23A 2FPZA 3RXAA 2Y7ZA 3UOPA 2DE9A 4AB8A 1YP9A 4K1SA 3EE0B 1DITH 3BIVH 1KDQB 2R3YA 3FP8E 1O3MA 4BAOB 2DUCA 4X2XA 3D65E 2J34A 1GJ9B 3ZZAA 1O3KA 3K2UA 1AUJA 4ZKSU 1UTOA 5L2YH 1GI7B 3I78A 2H9EH 1KLIH 2BY8X 5DP5A 2XCNA 2AERH 5LPFA 1A0HB 2QV1A 1O37A 2Y6TA 2BY5X 1FIWA 1O31A 4NZLA 1T31A 1SFIA 2FESH 3TNSA 2HNTF 4DCDA 4MNVA 3RXJA 1V6DA 3ZZDA 2ANYA 4E7NA 2CGAA 1E0FD 3S69A 3LGWA 1FUJA 1N8OB 5FBEA 2QIQA 2XW9A 2GCTC 4BTIB 3T26A 1ZMLA 1HAPH 2FODA 1CA0C 2ZU2A 4BTUB 1MH0A 1HJ9A 1FONA 1ZGIA 2EA3A 1P04A 1G32B 4INLA 2WPIS 1A61H 2ZGXH 3RXSA 2ALVA 2WV5A 4J2YB 1F7ZA 4WH6A 1IQIA 1K9OE 1S0RA 4R0IA 3AW0A 5E2PA 4NGAH 4FUFA 1BMMH 3LU9B 4WXVA 2A31A 5GCHF 2C90B 4INKA 1F5LA 4CR5A 3KIDU 1NC6A 4B1TA 1K22H 5GDSH 4IMQA 1GMHG 3BTEE 1TRNA 4KP0A 1C9PA 2THFB 1W3CA 6GCHF 2BD5A 1AVXA 4CRDA 1G36A 1YCPM 2BLWA 3BTFE 4TWYA 3VXFH 2UWLA 3ZZ4A 2HVXA 1QTFA 3SV7A 1SLXB 1GGDC 4WXIA 4OGXA 4X2YA 1ORFA 4Q7ZA 1UVUH 3RU4E 3S9BA 1BRUP 3BTHE 1ZHMA 1C2JA 2OQ5A 1FJSA 3RM0H 2FOHA 5JPMH 2AIPA 2PHBA 1UK4A 4CRGA 1HAHH 4B2BA 2ZPSA 3SV2H 1PQ5A 1GG6B 1VJAU 1WBGB 4OS6A 4XFQA 5DP9A 3A7XA 1Z6EA 3AVZA 1VGCB 2ZFQH 2ODYB 2ZQ1A 2OP9A 1P2QA 1Z1IA 3TGIE 2ZDMA 1MZAA 2QXGA 4PROA 2SGFE 1DXPA 3G01A 4UFGH 1DY8A 2GGVB 1G3EA 2C3SA 1BZXE 1QRWA 3HPTB 5EQSA 1YPMH 3SU6A 5DG6A 5JB8S 4ZHLU 3RXCA 2JH5D 2GCHG 3A84A 2B8OH 2QGRA 1K21H 1GJAB 1SOTA 1KTSB 3CP7A 5DP6A 5FPSA 2BD3A 1VITH 4MNXA 1GCTB 3KQCA 5LPEA 1IQNA 3CS7A 1MCTA 4ISOA 5F8ZA 1QB6A 1GI4A 2SNWA 1TX8A 1TMUH 5C1UA 2A0QB 5E8EH 1A0LA 2G5VA 1OX1A 2BMGB 1CBWB 3O8BA 4JK6A 3SHCH 1C5QA 3T5FH 3ATIA 1RD3B 1F5RA 3OX7U 5J4QA 4RSPA 1E35B 1G3CA 2ZHDA 2ALPA 3RUOA 3FP7E 3GY7A 2GZ8A 1SVPA 1UVSH 1C4U2 1OYQA 2OC7A 2XNIA 4MPVA 1YPJH 3LGYA 1BMNH 1MAXA 5EPYA 3SU4A 1RJXB 1ZR0A 3QWCH 2XC0A 2CJIA 1V3XA 2ZI2H 5JDUB 1IQKA 1G2LA 3MH6A 2A4GA 1HAIH 1QQUA 3E0NB 2B0FA 3BV9B 1THRH 1FIZA 3MTYA 1TB6H 5GIBA 3ATWA 1TAWA 4ZROA 1LPKB 1O2MA 2BD4A 2O8LA 1B0EA 2VWLA 1YPHE 1D3TB 1T8LA 3KHVA 2OC0A 3FFGA 7GCHG 1DY9A 2XYAA 1GVKB 1GHWH 3S7KB 4CRCA 5A0BA 2O8TA 1LHCH 1BBRK 2BVRH 3SO3A 1MKXK 4FU9A 5DO4H 1BT7A 2FMJA 3RXOA 1LVBA 3NK8A 4VGCB 1TPAE 1V2RT 3MH5A 3A8CA 1C1TA 3GY3A 4BAMB 4IBLH 1DDJA 3SHAH 3QLPH 1S5SA 1RXPA 2GMTB 2CHAC 2KAIB 4OS2A 2G81E 2AGIX 4I8GA 4HTCH 3ZZ9A 1GL1A 1BTHH 2F91A 1GBTA 2SGEE 1LVOA 3RXFA 1C5VA 1XXDA 3M7QA 2HNTE 1TBRH 3GCTG 1ZPCA 3Q3YA 1WOFA 4Y8XA 1HAYB 4Q2KA 1GCTC 3LJJA 1B5GH 2PGQB 1QRXA 4NA9H 5PTPA 1W2KH 1F0UA 1OOKB 2AMDA 4D8NA 4AYYB 4OS7A 2ZHEH 1GDNA 3Q3KA 1KSNA 2ZCHP 1FPHH 1V2MT 2HRVA 8ESTE 1CU1A 3ELAH 1KLJH 4X1NU 3SU5A 1GJCB 1NESE 3ATLA 4ZKRU 1GWAA 2FIRH 1TABE 4NSVA 4WMEA 1V2LT 1ID5H 2VB0A 2Q6DA 3EA8A 3EGKH 5HMAA 2V3OH 3VPKA 1CGIE 3C27B 2YNBA 1GJBB 1XKAC 1XXFA 1EQ9A 1EOLA 4GUXA 1WUNH 1V2QT 1BTZA 1DE7H 3F68H 5ESBA 1A4WH 1NPMA 2BD8A 2Y80A 2TGDA 1A2CH 1NO9H 3RXTA 1GMHF 1AHTH 4TPYA 2VH6A 1D3DB 3DA9B 3DFJA 5FBIA 3BN9A 5A0CA 2HOBA 2Z94A 1WAYB 1GCDA 3V7TA 4AORA 3U8OH 2SGDE 4TY7A 2FX6A 3F1SB 3SU0A 1LHDH 1SQAA 8LPRA 1PJPA 2RA0A 1HJ8A 3TIUA 5G4BA 4MPXA 1B0FA 4AOQA 1UTMA 3LPRA 2R3UA 2VNTA 1YM0A 1H9IE 2PKSB 2WPLS 3QUMP 2BVXH 1GBCA 2ZFPH 1Y3XA 1P2IA 6CHAB 1ZGVA 2ODPA 3E90B 1MKWK 5FPYA 5AVDA 2GX4A 1SQOA 3P95A 4U32A 1GBBA 1IAUA 3U98H 3GY8A 4X0WU 1C5YB 1EX3A 1UTPA 9ESTA 1SLVB 2H6MA 2BHGA 2CMYA 2ZO3H 2XC5A 4ABJA 1C5NH 1UO6A 4X6NA 3U8RH 2FM2A 1WQVH 1EP6A 3TGJE 3P70B 2GCHF 1NTPA 1VCQA 5FHTA 3RXGA 4B2AA 1LTOA 1F2SE 1XUJA 5FX5A 1GHXH 4I31A 3SNDA 3QN7A 3P92A 3E6PH 3S9CA 1XM1A 4YT6H 1TNIA 3HKIB 4MNYA 5FCRA 2Q1JA 2RG3A 4FUJA 1AWHB 3ZVDA 1DUEA 1YLDA 3Q3XA 2A7CA 2V6NA 4I8JA 3GY5A 1P2OA 2H5CA 4MDSA 3RXBA 4U01A 4YTAA 5JBCS 2A2QH 1QRZA 2VVCA 1UTKA 2RCEA 1OS8A 3O8CA 5AF9H 4K60A 2BDHA 5EG4A 1XVMA 5C3NA 1FAKH 5AFZH 1L4DA 3E1XB 1MD7A 2BD9A 1EB2A 3BTME 1DXWA 1EOJA 2TGAA 1CHOG 3MI4A 1F0RA 1O3DA 1PQ7A 2VGCB 4K5ZA 3PM3A 2XXLA 7LPRA 1A5HA 2CV3A 4Z0KA 3TK9A 3QDZB 1JIMA 1ZMJA 3HGPA 3RC6A 1GJ7B 1YPGH 2HPPH 3W95A 2FTMA 1AFQB 1T8OA 1E38B 2ZTZA 2V3HH 3RXLA 3SNAA 4X6MA 2ASUB 7GCHF 1HDTH 3SJ9A 2H9HA 2CN0H 1F0TA 1AB9C 5EXMA 3RXPA 5DP3A 3GICB 1SMFE 3TJVA 2EI8A 2PKSC 4IN2A 1SGNE 3TK6A 4LXBH 2OXSA 1C2FA 4ZMAH 1EJAA 4Q7YA 2GDDA 5J4SA 5C5NA 1G3BA 3IITA 1YC0A 4BNRA 1T32A 2PFEA 5H4IB 2VVVA 1LVYA 1GHZA 4IC5A 1IQGA 1EZSC 3RU4T 4CHAC 1YCPK 3F9GA 5A8XA 2QCYA 1GI0A 4BXWA 1LHGH 5EW1H 3PO1B 4HZHA 4ISLA 1HIAA 3UWIA 3MH7A 4CBOA 3GCTF 2A45B 3SJOA 1G30B 1K1IA 2VINA 1EP5A 2OC1A 2H9TH 1D4PB 1BTWA 3A89A 2BOHB 2PGBB 1ZOMA 3M3TA 4ZXYH 1Z1JA 1T4UH 2UWOA 1SLWB 2BD2A 1OWDA 2UUFB 3RDZA 3MO3A 1GHYH 3NUMA 4GHTA 4DIIH 3E3TA 4UFEH 1AQ7A 2VWMA 2BYAX 3GCHC 1P3EA 2D2DA 1MTVA 4D76A 1FY5A 1BBRH 1MKXH 3SV6A 1DPOA 4AFSA 1SHHB 3EQ0H 2FLBH 4BXSA 3A85A 2OBOA 2FYQA 1HLTH 1TRYA 2VIWA 3LC3A 1GBLA 4JZDH 1RS0A 1O2PA 1V2VT 2GCTB 3SUGA 1H9HE 5JBBS 1OWHA 4M7GA 1TMTH 1CA0B 3NWUA 4YOJA 2C4FH 1GI9B 3OTJE 4B73A 1TRMA 1VITG 2Y5GA 1AU8A 2BM2A 2GD4B 4DW2U 4O9VA 1AFQC 3A7ZA 4Y8YA 2P95A 3SU3A 1TNGA 2P3FH 3PMAB 1RTFB 1LPZB 1Y5UT 5F03A 1X7AC 3MO6A 1Z8GA 1BJVA 1O2WA 3A86A 2R0LA 3U1JB 2ZCLP 1NZQH 2ZIQH 8KME2 2ZTYA 5L2ZH 5C5OA 3UFAA 1UK3A 2QC2A 2ZP0H 3RXDA 2AEIH 2NU1E 4DT7B 1SHYA 3RXQA 4RN6A 2JETC 1Z6JH 3TH3H 1K1LA 3GDSA 4HI3A 1P2KA 2Q6GA 1HXFH 2Y7XA 3H5CB 2FLRH 1L4ZA 4FVBA 1SGYE 1KY9A 1LVMA 1EPTC 1J17T 2ZDNA 1NFWA 3PO1C 4NFFA 1ZRKA 4FUCA 4QT8C 4ZXXH 5GWZA 2GT7A 4OS4A 4XE4A 3A8AA 1TLDA 1BQYA 1W10U 1TNHA 4HGCA 2A4RA 3TJOA 4Y7AA 4D7FA 3SI4H 1OP0A 3U9AH 1HAGE 1BHXB 1SSXA 2BY7X 2HWLB 2WPJS 4X1QU 3MU5A 1HAVA 1C5PA 1GVZA 4CRAA 4IN1A 3URCA 1PQAA 1W0YH 2I6SA 4SGBE 3UTUH 3A8BA 3FANA 1W7XH 4A6LA 4U2WA 1O33A 3ZYEA 1PPGE 2XCFA 2ZU1A 1V2ST 2C8YB 2UWPA 1RTKA 3QGJA 1MD8A 2C8WB 3DHKH 1LKAA 3KF2A 3PB1E 3QZRA 4NZQA 7KMEH 1C2IA 5EQRA 3L33A 3SNCA 1MKWH 2BZ6H 4KTSA 5BRRE 2Z7FE 1FV9A 1J8AA 4MPWA 4K2YA 1THSH 2Y5HA 1FQ3A 4AFQA 1ELAA 1GJ4H 3BEIB 3O8RA 4WVPE 1ETRH 4Y8ZA 1VJ9U 1OXGA 2J92A 1ELEE 2RDLA 3T28A 1O3NA 1O5FH 2GVFA 3LDXH 1D3QB 2VIVA 3SGBE 1O2HA 4E7RG 2BY9X 3PMHB 5GPIB 3M37A 1UTNA 5E0HA 2FS8A 4GSOA 3MNXA 2FI5E 3M5LA 4BOHA 1IQJA 1CQQA 1AMHA 3K9XB 4JZEH 3LH1A 2VWNA 1BDAA 2ZDLA 1AE8H 3ODDA 4XOJA 1BUIA 5DPAA 1NU9A 4U30A 1WU1A 4F49A 1ARCA 3NKKA 3P17H 1C1OA 1NU7B 2Z3CA 1DM4B 5DP7A 3EYDA 1TALA 3FAOA 5EU8A 4NFEA 5F6MA 3V13A 4A5TS 2AIQA 5A8ZA 1SB1H 1C2KA 2CHAB 3V0XA 1T4VH 1SG8B 1IQHA 3EAJA 2GT8A 4DY7B 1RRKA 4ZKOU 1XMNB 1CO7E 1C2MA 1GBHA 1OWEA 2LNCA 4CRBA 1QIXB 4IC6A 5IDKA 1GDUA 1OYTH 3LC5A 3STJA 1M9UA 2TGTA 3PMBB 3PROA 3ODFA 1Y59T 2BDAA 1HB0B 1JOUB 4UFFH 3UQVA 1W11U 2FOAA 1C5UA 5T6FA 2OLGA 4R8TB 3RC4A 2BLQA 4A1VA 3A81A 3SUEA 1EZXC 2VJ1A 1UVPA 4X6OA 1HV7A 1SC8U 2GV6A 4TPIZ 1HIAB 1GBJA 1YPEH 3MNSA 1BBRE 4NA7A 3TJUA 1T8MA 1A46H 3PTNA 1YCPH 2H5DA 1VITF 2XRCA 1YPLH 2FOBA 2ZHWH 1CE5A 4I33A 1FY8E 1CSOE 3UR6A 1SGTA 2BDYA 1RTLA 3HK3B 4ZUHA 4ABAA 1ESAA 1C9TA 1P02A 2A2XH 1YPHC 2ZPRA 1PFXC 1OP8A 2GKVE 1GBEA 5T6GA 4Z6AH 1VCWA 2XBXA 4DIHH 2ZU5A 1DWDH 1G2MA 1OWIA 3BIUH 2HGTH 5SGAE 1FMGA 2FYRA 1TGSZ 3P8NA 4OS5A 1MBMA 5K7RA 4GVUA 4NIVA 4YO9A 1PYTC 1QA7A 2FXRA 4F4OC 1GDQA 3RXRA 1AD8H 1SGFG 1NFXA 1EPTA 1L0ZA 1RGQA 4WY3A 2J95A 4GLYA 1A5IA 1VR1H 3LOXA 4Y79A 2FDAA 4CRFA 5C20A 2OBQA 3PWBA 1JRSA 1E34B 3ZZ8A 1S85A 2F3CE 3QGNB 1NT1A 1XUIA 2G8TA 1O5AB 3FZDA 1C1NA 1MQ5A 1PPEE 4JK5A 2HNTC 3ITIA 1EUFA 3ZVGA 1ARBA 3M5NA 1GI1A 3GISB 1C5XB 1BIOA 5IYTA 1LQDB 3GY6A 5EOKA 4FUDA 2WYGA 3KCGH 4Y6DA 2BX4A 1F92A 3MNBA 2V0BA 1P9SA 1NY22 1RIWB 4KELA 2FOFA 4E06H 1C2GA 4AX9H 3ZVAA 2BLVA 4MG3A 1DFPA 2BDIA 2ZEBA 2W26A 4ABDA 4BANB 5EODA 1N6XA 1SI5H 2ZA5A 3SW2B 4I8LA 1TGNA 1SQTA 3SV9A 2GP9B 1KXBA 1ZRBA 2J94A 4NIWA 4H6SB 2QXHA 2PLXA 4RKJB 1OPHB 3M35A 3FZZA 1ANEA 4MPUA 1MTUA 3GDUA 2A5AA 3RXMA 1KIGH 3RXIA 1Z8IB 4I8HA 4AG2A 1XUKA 2FOEA 1FZZA 3ESTA 1MBQA 2WPKS 1ELCA 2AMQA 2QY0B 5FCKA 1D9IA 3OYPA 5ETXA 5HYOA 1CHGA 1HAVB 1O5CB 4THNH 1UHBA 2OQUA 1QHRB 2ZGBH 3AAUA 4GHQA 1TA2A 1EATA 4NCYA 5HGGA 1TGCA 3VB3A 1JRTA 3AW1A 1IHTH 2RA3A 3QK1A 2GDEH 3SU2A 1DANH 1MCVA 1WQSA 2OC8A 1TMBH 1D6RA 1C5MD 1GI8B 4ESTE 1G9IE 5EGMA 1S6HA 2PWXA 3A7WA 4WMFA 1G37A 1JWTA 1AB9B 4X1SU 2G4TA 1UK2A 4ISIH 3F9EA 3ZZBA 1TX6A 2CXVA 4WWYA 4DURA 5HM2A 3ZZ3A 5K0HA 2PSYA 3ZVFA 2PTNA 2BOKA 3SJIA 1BRBE 3D62A 1AIXH 1K28D 1Q31A 2J4IA 4UDWH 1HJAB 3BTTE 3BF6H 1W7GH 1QQ4A 1IQEA 2AGGX 1WTHD 1TQ7B 1O2ZA 3M3VA 1FN6A 2HLCA 4CHAB 2NU4E 4FUEA 3ZV8A 1LHEH 1UVTH 2R0KA 2WPHS 4Y76A 3F9HA 1RIWC 1ZHPA 2HPQH 2GZ9A 1QGFA 2NU0E 3MO9A 2Y82A 4FU7A 1HPGA 1J15A 1QL8A 1EZUC 3ZZCA 3LGUA 3TLOA 1O2LA 2VWOA 1C1VH 5A09A 1P9UA 2BDBA 2XC4A 3TH2H 1C1SA 2O8MA 1C1RA 1O2QA 3DUXH 2QYIA 1P2MA 4BTTB 2BLOA 2F9UA 1K2I1 1CT2E 5AFYH 2OCVB 3QZQA 4WMDA 2BY6X 1TGBA 1ZJDA 3GCHB 1Y5BT 2TBSA 1ELDE 4XDEA 2EI7A 3MHWU 4INHA 2ZHFH 2B7DH 1XX9A 1K1NA 1ZPBA 2SGPE 1O3BA 1YLCA 1TQ0B 2BVSH 2W7UA 1TONA 4D7GA 2W3KA 1E37B 1ZSKA 1FI8A 3RLWH 1Q2WA 2ZTXA 3ZZ5A 1UCYK 4WF8A 4AG1A 2EI6A 4Y11E 1PQ8A 4UE7H 2Y81A 2CF8H 1ZLRA 1A3EH 1P05A 1P2JA 3A80A 1IOEA 3O8DA 4AZ2B 1P10A 6ESTA 3F9FA 3CENA 2A1DB 1OWKA 3RP2A 5AHGH 4KTUA 1C5ZB 5CE1A 3P6ZB 2STAE 2ULLA 2YOLA 3TH4H 4ABGA 1Z8JB 5TCCA 1Z7KA 1Y3YA 4MQAA 1O2TA 2ZPQA 2WUBA 1HYLA 4DGJA 2OUAA 2W5EA 2V35A 3SUFA 2ZWLH 1HJAC 1GJDB 3ZV9A 1FNIA 1CGJE 2JETB 1ACBE 3RU4D 2R2MB 3C1KA 4CR9A 3VGCC 3JZ1B 1AZ8A 2Z6BD 1TX7A 1S83A 5A8YA 4MNWA 4NA8A 1AVWA 2JKHA 8GCHG 5DGJA 2PSXA 1ANDA 2ZG0H 1EPTB 1ELFA 1W13U 1YPKH 1Y3WA 1CGHA 1TA6A 1DSTA 2XBWA 1SR5C 3TJNA 2UUJB 3B23B 3R3GB 4CBNA 2FI4E 2ZGJA 3UNRA 3L6PA 1Y3UA 4BAHB 3Q77A 2D1JA 3EA9A 4LK4A 2B5TB 4AB9A 1V2TT 1C1PA 1C2LA 2C8XB 3A7YA 1GI3A 1CVWH 2C93B 2QAAA 3OU0A 1NRQH 3Q00A 4LZ1H 1QL9A 1DUAA 1INCA 3M7UA 1SOZA 1GHBG 2VVUA 1ZPZA 1NS3A 3F6UH 1C1WH 1EJNA 2XTTB 1SFQB 2F9VA 4H6TA 1SLUB 3KGPA 1XVOA 1P03A 2P16A 5C1YA 2LPRA 1TPSA 1A5GH 1HBTH 3LJOA 1GBMA 1LDTT 1O5EH 1BTPA 4ABFA 3LH3A 2G52A 1O3AA 1QB1A 1WSSH 3DFLA 1QFKH 1O5GH 1LCYA 1HFDA 2VIDA 4KTCA 2P8OB 1C5RA 2FOCA 2P59A 1WV7H 1V2JT 1HXEH 1BITA 1SPJA 1FPCH 1DSUA 2PUXB 3ATKA 2AGEX 3T27A 1QBVH 1TWXB 2QN5T 3NCLA 1GJ6A 2ODQA 3SJKA 2QF0A 3AASA 1IHSH 3ENSB 1O2YA 1ESBA 3SGQE 4JMYA 5A0AE 1GHVH 3MYWA 4NWKA 3T29A 1BRAA 2F9BH 1DICA 1AVGH 5JBTA 4A1TA 2W3IA 1T7CA 5EQQA 1JIRA 4IGDA 4J1YA 2F83A 3AAVA 3E0PB 3BG4C 3GDVA 1W14U 1O2UA 1C4Y2 1UHBB 1OSSA 4OGYA 1SGDE 1ANCA 1UTJA 1EKBB 1P06A 1MTNC 1L1NA 1Q3XA 1WTGH 1ZMNA 1P09A 3LGTA 1O3CA 3KQDA 4H4FA 3ZZ7A 4JZ1A 1GMCG 3RMLH 1C2DA 1A3BH 2QA9E 3VXEH 3VB7A 1PYTD 1C5WB 2VIQA 2WINI 3MMGA 1BRCE 1TOCB 1DWEH 4MVNA 2SGAA 4XBBA 5EPNA 2Z3DA 3ATMA 3PLBA 3TITA 4KKDA 4TWWA 1D6WA 2TRMA 3VB6A 1WCZA 1O2KA 1BMLA 3VFEA 1PPCE 1AY6H 4TY6A 2IPHA 3BTQE 1MTSA 4LZ4B 1K1OA 1HNEE 1ZHRA 3PTBA 4X2VA 2I6QA 4Q80A 3BEFB 1PPFE 1C4V2 2XBYA 1HAOH 1QB9A 2ANMH 1HCGA 5C1XA 2D26C 1FY4A 4AGKA 2H2ZA 1LPGB 1O39A 3LGIA 1P2NA 4E05H 4GCHG 2PW8H 3TVJB 2IOTA 3GCOA 1QL7A 3V3MA 3M61U 1NRPH 1C5OH 1CHOF 2FO9A 2P8OC 3SBKA 4YLUA 5DP4A 1O2OA 4Y7BA 3SZNA 4B76A 5E0JA 4WH8A 1V2KT 4OS1A 1BTYA 4K69A 5DKMA 1MZDA 4D9QA 1DLEA 2P3UB 1MTWA 3BSQA 4X8UH 1O3IA 1SBWA 1V2UT 1J16A 4I32A 1UTLM 4WJG2 1AUTC 2QXJA 3LGVA 1O3GA 4JYVH 1AO5A 2ZCKP 1A7SA 1PPZA 3NZIA 3QTOH 2A4OA 5JYIA 1UTQA 2OTVA 1DWCH 1YF4A 2FI3E 1SGEE 4X1RU 2FEQH 1EZQA 4NG9H 1QCPA 4GPGA 3TNTA 5TJXA 2ZGCA 2ZHQH 1P01A 2VU8E 2ZKSA 3T62A 1KLTA 4YZUA 2ZDKA 1H8IH 5JBAS 2ZZUH 3UR9A 8GCHF 3LKWA 3PWCA 4O3UA 3TPIZ 1KXAA 4CH8B 1C2EA 1AWFH 1NFYA 3VB5A 3SGAE 3SUDA 4YESB 1JXPA 4DVAU 1S84A 2F9NA 2K1QA 3PLPA 4I7YH 1TNLA 3TK5A 1V2NT 1UCYH 1C1QA 3GY4A 1QURH 1P8VC 1ZJKA 4YLQH 1MU6B 2D8WA 5CHAB 5FAHA 1AI8H 2ZC9H 3RXUA 1ZSLA 1L2EA 2GTBA 3SU1A 4FUGA 2A4QA 2P3TB 2VIPA 3GOVB 1O0DH 3SI3H 1J14A 1ZTJA 1C1MA 4Y10E 1AKSA 1GHBF 1C1UH 1ELBA 4ZAEA 2NWNA 1AN1E 2Z9LA 3ZVEA 1BJUA 5BPEA 3HGNA 1O32A 3GYLB 1H4WA 1KXCA 1JBUH 1GMDG 4AGJA 3A87A 1YKTA 4X8SH 4BAKB 1UMAH 2FTLE 1TIOA 2FWWA 1PPHE 2Z3EA 2M5TA 2A7HA 2XWAA 3ZVBA 1DS2E 1MU8B 3V12A 4ABIA 1FLEE 5T6DA 2TPIZ 3UUZA 3RXKA 2ZFRH 2JH0D 3DD2H 1QJ6B 1Y5AT 3ZVCA 1P3CA 3T25A 1DVAH 1N8OC 3A7TA 2YNAA 5EXLA 1EAUA 1K1PA 1V2WT 2A32A 5A2MH 1J9CH 3RXVA 4GAWA 2AFQB 1N6YA 4ASHA 1N1LA 4SGAE 3T2NA 1K1JA 1FY1A 1JMOH 2DE8A 1FDPA 1NRRH 4DG4A 2ZGHA 3U69H 1O30A 3SQHE 1AGJA 1O2NA 3MNCA 3W94A 4XSKU 1EAWA 4RKOB 3S7HB 2F9OA 4O3TA 2PTCE 4A1XA 1GMCF 2ZQ2A 2ANWA 2BDCA 2J38A 1ZTLA 1GVLA 2BDGA 2J9NA 1KXFA 1YYY1 3A88A 3QTVH 5E0GA 4Y0YE 2C8ZB 4ABBA 4JCNA 2VH0A 1GPZA 5LGOA 4ISHH 1O34A 3PLKA 3URDA 1A0JA 3SJ8A 2R2WU 1MAYA 2STBE 3SNBA 2P94A 4YT7H 1O2RA 5CHAC 1SGFA 1GL0E 3RMMH 1Z8RA 3MWIU 3A83A 1GI2A 1QJ7B 3GCNA 1TYNA 1C2HA 2BQ7B 3UOUA 1ETTH 1GG6C 1HAXB 1BA8B 1W0ZU 4B71A 1AE5A 1SL3A 1UJ1A 4FU8A 2NU2E 1VGCC 4NIXA 5I46H 4X2WA 3SQEE 1V2OT 3SOSA 1EXFA 2O9QA 1KYNA 4GCHF 5I25A 1TPOA 1FN8A 2ZNKH 1MUEB 3FP6E 2UUYA 3DT0H 1QA0A 2Y5FA 1LMWB 4MTBA 4ISNA 5DK1A 1OP2A 2B9LA 1O2VA 1CT4E 2BXUH 2ZDAH 4ZHAA 1GHAG 2ZU3A 3UREA 4K8BA 2PKAA 2Z9IA 3UNSA 3UPEA 1Z71A 4NWLA 4X1PU 3MU8A 5C67A 2Q6FA 5FXLA 3TGKE 4IS5A 1CBWC 3BEUA 5HXFA 1SGIB 1KXDA 1P12E 5FPTA 1O3LA 2SNVA 1NRSH 4X8TH 1O3JA 3LONA 5F8TA 1S82A 1SGQE 1FAXA 1ABJH 2OINA 4XBCA 3MFJA 1IQLA 1O2SA 4NIYA 5L30H 3BTDE 4H42U 1LKBA 1XUGA 1P0SH 2XWBI 2PV9B 1XUFA 5EXNA 1TE0A 3N7OA 2AYWA 1MMJN 2W7SA 2TGPZ 1D3PB 4FXGH 5LH8A 4IW4E 3SN8A 1GI6A 4B2CA 1O5BB 3Q76A 2TIOA 2ZECA 1L1GA 2AH4X 3SORA 1RFNA 2BQWB 1GBFA 1ZYOA 3RLYH 5ABWA 1KDQA 3VGCB 1G3DA 1O2GH 1Y3VA 4O03A 4YOIA 4FUBA 1ABIH 1BB0B 4B75A 1SGPE 3IWMA 3HKJB 1UVOA 2GV7A 4JZFH 2R9PA 1SGCA 2AS9A 2BX3A 3MOCA 5L6NH 4XBDA 1UCYE 4K8YA 1S0QA 4VGCC 4HFPB 1DT2A 1AZZA 5T3HA 1YGCH 4YM9A 3PMJA 4MLFB 1S6FA 2GMTC 4K3JA 2FS9A 1DLKB 1GMDF 1O5DH 4AN7A
chains in the Genus database with same CATH superfamily
2FP7B 3U1IB 1XKBC 3OY5U 2ANKH 3E91A 3KQEA 3P8FA 3S0NA 3FVFB 1EAXA 1S81A 1O3EA 4BAQB 3HATH 1TFXA 1QBOA 2UUKB 4ABEA 1DWBH 1EJMA 2PUQH 2P93A 3OY6U 4NSYA 7ESTE 5HM9A 1O2XA 3H7OA 1BMAA 2BXTH 4X6PA 4AYVB 2WUCA 3L3TA 1KXEA 4ABHA 2ESTE 1ETSH 3D49H 4Q7XA 1TOMH 1VCPA 4UD9H 5C2ZA 4K1EA 5T1VA 1ESTA 1AKSB 1O3PB 2YMSB 2G5NA 3M3SA 4AFUA 1B7XB 1C5LH 1E36B 4UFDH 2QF3A 1L1JA 3WWBA 2SFAA 3FKSD 2WPMS 2FX4A 2BZAA 4CREA 1NM6A 3VB4A 4ZKNU 3A7VA 4B6EA 3OTPA 2G00A 3VEQB 1TGTA 1FY3A 3HK6B 3SNEA 1GBKA 2NU3E 1QBNA 2BB4A 4A92A 3EA7A 4JZIA 1VKYA 6LPRA 3SV8A 5EW2H 3P8GA 4DOQA 2A7JA 3KN2A 3M5OA 2G55A 1GJ8B 1CA8B 3F2GA 4D9RA 3S9AA 2HALA 1O3OA 1OWJA 4FUIA 3K6YA 2O8WA 2OD3B 3WY8A 3K65B 3B9FH 1ELVA 3TU7H 3BG4B 4CH2B 1LO6A 3I29A 3B8JA 3M5MA 2EEKA 5GCHG 4UONA 5B6OA 4ZH8A 1MTNB 1YBWA 1LHFH 1W12U 3PV4A 2A5IA 2QF4A 1HRTH 1QY6A 1A1RA 4DJZB 1IQFA 1F5KU 1O3FA 1TNJA 1WYKA 1H8DH 1W0KD 4KGAA 6GCHG 2ILNA 6CHAC 3P8OA 1O38A 1QR3E 2Z9GA 2IN2A 5C94A 3A8DA 1NN6A 3RMNH 1CT0E 2IJD1 3OFND 1V2PT 4Y71A 3ZYDA 3OSYA 3KQBA 4FUHA 2PR3A 3MU4A 1FXYA 1U6QA 1NRNH 1XUHA 4K1TA 3UNQA 2BQ6B 5GXPA 3CS0A 5JB9S 1ANBA 2FOGA 5FX6A 2G51A 3UY9A 1O3HA 1GBAA 1PPBH 1ELTA 2ZDVH 1TNKA 4LOYH 1GBIA 1W8BH 4B74A 2O8UA 1Y8TA 1GHAF 1BTXA 1NROH 3RXHA 1EAIA 2Z9KA 2F9PA 4A7IB 4X8VH 5TCAA 4YOGA 1O36A 1O2IA 1HAZB 1O2JA 1QNJA 3KNXA 5CMXH 3RMOH 3A82A 4I8KA 1GI5A 1T8NA 2ZFSA 2SGQE 4AFZA 5C17A 1GBDA 1ZSJA 1BCUH 1H9LB 1THPB 3UWJH 1C5SA 4ZHMU 1OKXA 2WYJA 1MQ6A 1BOQA 1LQEA 2JH6D 4UEHH 1F0SA 2FOMB 4YXWD 1P11E 3MH4A 5C0TA 4P02A 5ESTE 1HGTH 3KL6A 1P57B 2XBVA 3NXPA 3UQOA 3RM2H 2IJOB 1KTTB 1BHXF 2ZU4A 2VGCC 2GZ7A 3IG6B 1NFUA 1AFEH 2PKAB 5GJ4B 1DX5M 2Z9JA 3R0FA 1TBQH 3BG8A 4JYUH 1EB1H 3NPSA 3RXEA 3STIA 2BTCE 4IMZA 2AMPA 2H1UA 2QXIA 1ELGA 2J2UA 4Y0ZE 5DJ7A 2FZZA 3GYMA 3EDXB 4FVDA 5E2OA 3JZ2B 2ZF0H 3BTKE 4O97A 3I77A 3LT3A 2KAIA 2BD7A 3E16B 1HUTH 1ZTKA 3M7TA 4Q4LA 9LPRA 1SGRE 5LPRA 3BTGE 1ZZZA 3ZZ6A 1BTUA 1TBZH 2VIOA 2WV4A 3MU1A 3PYHA 4JYTA 3RC5A 5F8XA 1C5TA 1DOJA 1EASA 2EC9H 5DP8A 1TPPA 3GY2A 1QJ1B 2ZFFH 3E8LA 1GJ5H 2A5KA 1K1MA 3QO6A 3MU0A 1H1BA 3QX5H 3UIRA 3M36A 1GGDB 2CF9H 3BTWE 1E79D 3K6ZA 1IQMA 3ZIAD 3LIWA 2ZFTA 3U8TH 3H7TA 3KEEA 1VZQH 2G4UA 4TYDA 1O35A 3D23A 2FPZA 3RXAA 2Y7ZA 3UOPA 2DE9A 4AB8A 2KCOA 1YP9A 4K1SA 3EE0B 1DITH 3BIVH 1KDQB 2R3YA 3FP8E 1O3MA 4BAOB 2DUCA 4X2XA 3D65E 1YLNA 2J34A 1GJ9B 3ZZAA 1O3KA 2AHME 3K2UA 1AUJA 4ZKSU 1UTOA 5L2YH 1GI7B 3I78A 2H9EH 1KLIH 2BY8X 2QE7D 2XCNA 2AERH 5DP5A 5LPFA 1A0HB 2QV1A 1O37A 2Y6TA 2BY5X 1FIWA 1O31A 4NZLA 1T31A 1SFIA 2FESH 3TNSA 2HNTF 4DCDA 4MNVA 3RXJA 1V6DA 3ZZDA 2ANYA 4E7NA 1YWUA 2CGAA 1E0FD 3S69A 3FOAA 3LGWA 1FUJA 1N8OB 5FBEA 1WXRA 2QIQA 2XW9A 2GCTC 4BTIB 3T26A 1ZMLA 1HAPH 2FODA 1CA0C 2ZU2A 4BTUB 1MH0A 1HJ9A 1FONA 1ZGIA 2EA3A 1P04A 1G32B 4INLA 2WPIS 1A61H 2ZGXH 3RXSA 2ALVA 2WV5A 4J2YB 1F7ZA 4WH6A 1IQIA 1K9OE 1S0RA 4R0IA 3AW0A 5E2PA 4NGAH 2KM0A 2RFKC 4FUFA 1BMMH 3LU9B 4WXVA 2A31A 5GCHF 2C90B 4INKA 1F5LA 4CR5A 3KIDU 1NC6A 4B1TA 1K22H 5GDSH 4IMQA 1GMHG 3BTEE 1TRNA 4KP0A 1C9PA 2THFB 1W3CA 6GCHF 2BD5A 1AVXA 4CRDA 1G36A 1YCPM 2BLWA 3BTFE 4TWYA 3VXFH 2UWLA 2M2AA 3ZZ4A 2HVXA 1QTFA 3SV7A 1SLXB 1H8ED 1GGDC 4WXIA 4OGXA 4X2YA 3SYJA 1ORFA 4Q7ZA 1UVUH 3RU4E 3S9BA 1BRUP 3BTHE 1ZHMA 1C2JA 2OQ5A 1FJSA 5GNDA 5HIZA 3F3BA 2FOHA 3RM0H 5JPMH 2AIPA 2PHBA 1UK4A 4CRGA 1HAHH 4B2BA 2ZPSA 3SV2H 1PQ5A 1GG6B 1VJAU 2EQNA 2XNDD 1WBGB 4OS6A 4XFQA 5HIYA 1NBMD 5DP9A 3A7XA 1Z6EA 3AVZA 1VGCB 2ZFQH 2ODYB 2ZQ1A 2OP9A 1P2QA 1Z1IA 3TGIE 2ZDMA 1MZAA 2QXGA 4PROA 3AK5A 2SGFE 1DXPA 3U28C 3G01A 4UFGH 1DY8A 2GGVB 2OK5A 1G3EA 2C3SA 1BZXE 1QRWA 3HPTB 5EQSA 1YPMH 3PRBA 3SU6A 5DG6A 5JB8S 4ZHLU 3RXCA 2JH5D 2GCHG 3A84A 2B8OH 2QGRA 1K21H 1GJAB 1SOTA 1KTSB 3CP7A 5DP6A 5FPSA 2BD3A 1VITH 3N99A 4MNXA 1GCTB 3KQCA 5LPEA 1IQNA 3CS7A 1MCTA 4ISOA 3F0PA 2WZQA 1QB6A 5F8ZA 1GI4A 2SNWA 1TX8A 1TMUH 5C1UA 2A0QB 5E8EH 1A0LA 2G5VA 1OX1A 2BMGB 1CBWB 3O8BA 4JK6A 3SHCH 1C5QA 3T5FH 3ATIA 1RD3B 3KQ5A 1F5RA 3OX7U 5J4QA 4RSPA 1E35B 1G3CA 2ZHDA 2ALPA 4P00A 3RUOA 3FP7E 3GY7A 2GZ8A 1SVPA 1UVSH 1C4U2 1OYQA 2OC7A 2XNIA 4MPVA 1YPJH 3LGYA 1BMNH 1MAXA 5EPYA 3SU4A 1RJXB 1ZR0A 3QWCH 2V3MA 2XC0A 2CJIA 1V3XA 2ZI2H 5JDUB 1IQKA 1G2LA 3MH6A 2A4GA 1HAIH 1QQUA 3E0NB 2B0FA 3BV9B 1THRH 1FIZA 3MTYA 1TB6H 5GIBA 3ATWA 1TAWA 4ZROA 1LPKB 1O2MA 2BD4A 2O8LA 1B0EA 2VWLA 1YPHE 1D3TB 1T8LA 3KHVA 2OC0A 3FFGA 7GCHG 1DY9A 2XYAA 1GVKB 1GHWH 4RT1A 3MQKC 3S7KB 4CRCA 5A0BA 2O8TA 1LHCH 1BBRK 2BVRH 3SO3A 1MKXK 3OEED 4FU9A 5DO4H 1BT7A 2FMJA 3RXOA 1LVBA 3NK8A 4VGCB 1TPAE 1V2RT 3MH5A 3A8CA 1C1TA 3GY3A 4BAMB 4IBLH 1DDJA 3SHAH 3QLPH 1S5SA 1RXPA 2GMTB 2CHAC 2KAIB 4OS2A 2G81E 2AGIX 3KYFA 4I8GA 4HTCH 3ZZ9A 2IPQX 1GL1A 1BTHH 2F91A 1GBTA 2SGEE 1LVOA 3RXFA 4HG6A 1C5VA 1XXDA 3M7QA 2HNTE 1TBRH 3GCTG 1ZPCA 3Q3YA 1WOFA 4Y8XA 1HAYB 4Q2KA 1GCTC 3LJJA 1B5GH 2PGQB 1QRXA 4NA9H 5PTPA 1W2KH 1F0UA 1OOKB 2AMDA 4D8NA 4AYYB 4OS7A 2ZHEH 1GDNA 3Q3KA 1KSNA 2ZCHP 1FPHH 1V2MT 2HRVA 4TSFD 8ESTE 1CU1A 3ELAH 1KLJH 2KCPA 4X1NU 3SU5A 1GJCB 1NESE 3ATLA 4ZKRU 1GWAA 2FIRH 1TABE 4NSVA 4WMEA 1V2LT 1ID5H 2VB0A 2KR7A 2Q6DA 3EA8A 3EGKH 5HMAA 2V3OH 3VPKA 5B6LA 1CGIE 3C27B 2YNBA 1GJBB 1XKAC 1XXFA 1EQ9A 1EOLA 4GUXA 1WUNH 1V2QT 1BTZA 1DE7H 3F68H 5ESBA 1A4WH 1NPMA 2BD8A 2Y80A 2TGDA 1A2CH 1NO9H 3RXTA 1GMHF 1AHTH 4TPYA 2PP6A 2VH6A 1D3DB 3DA9B 3DFJA 5FBIA 2K0QA 3BN9A 5A0CA 2HOBA 2Z94A 1WAYB 1GCDA 3V7TA 4AORA 3U8OH 2SGDE 4TY7A 2FX6A 3F1SB 3SU0A 1LHDH 1SQAA 8LPRA 1PJPA 2RA0A 1HJ8A 3TIUA 5G4BA 4MPXA 1B0FA 4AOQA 1UTMA 3LPRA 4F48B 2R3UA 2VNTA 1YM0A 1H9IE 1SKYE 2PKSB 2WPLS 3QUMP 2BVXH 1GBCA 2ZFPH 1Y3XA 1P2IA 6CHAB 1ZGVA 2ODPA 3E90B 3N7DA 4ASUD 1MKWK 5FPYA 5AVDA 2GX4A 1SQOA 3P95A 4U32A 1GBBA 1IAUA 3U98H 5CHBA 3GY8A 4X0WU 1C5YB 1EFRD 1EX3A 1UTPA 9ESTA 1SLVB 2H6MA 2BHGA 1WDIA 2CMYA 2ZO3H 2XC5A 4ABJA 5F53A 1C5NH 1UO6A 4X6NA 3DSOA 3U8RH 2FM2A 1WQVH 1EP6A 3TGJE 3PRDA 3P70B 2GCHF 1NTPA 1VCQA 5FHTA 3RXGA 4B2AA 1LTOA 1F2SE 1XUJA 5FX5A 1GHXH 4I31A 1BMFD 3SNDA 3QN7A 3P92A 3E6PH 3S9CA 1XM1A 4YT6H 1TNIA 3HKIB 4MNYA 5FCRA 3EE7A 2Q1JA 2RG3A 4FUJA 1AWHB 3ZVDA 1DUEA 1YLDA 3Q3XA 2A7CA 2V6NA 4I8JA 3GY5A 1P2OA 2H5CA 4MDSA 3OEHD 3RXBA 4U01A 4YTAA 5JBCS 2A2QH 1QRZA 2VVCA 1UTKA 2RCEA 1OS8A 3O8CA 5AF9H 4K60A 2BDHA 5EG4A 1XVMA 2WSSD 5C3NA 1FAKH 5AFZH 1L4DA 3E1XB 5EIYA 1MD7A 2BD9A 1EB2A 1OHHD 3BTME 1DXWA 1EOJA 2TGAA 1CHOG 3MI4A 1F0RA 1O3DA 1PQ7A 2VGCB 4K5ZA 3PM3A 2XXLA 7LPRA 1A5HA 2CV3A 4Z0KA 3TK9A 3QDZB 1JIMA 1ZMJA 3HGPA 3RC6A 1GJ7B 1YPGH 2HPPH 3W95A 2FTMA 1AFQB 1T8OA 1E38B 2ZTZA 2V3HH 3RXLA 3SNAA 4X6MA 2ASUB 7GCHF 1HDTH 3SJ9A 2H9HA 2CN0H 1F0TA 1AB9C 5EXMA 3RXPA 5DP3A 5KGOA 3GICB 1SMFE 3TJVA 2EI8A 2PKSC 4IN2A 1SGNE 3TK6A 4LXBH 2F4LA 2OXSA 1C2FA 4ZMAH 1EJAA 4Q7YA 2GDDA 5J4SA 5C5NA 1G3BA 3IITA 1YC0A 4BNRA 1T32A 2PFEA 5H4IB 2VVVA 1LVYA 1GHZA 4IC5A 1IQGA 1EZSC 3RU4T 4CHAC 1YCPK 3F9GA 5A8XA 2QCYA 1GI0A 4BXWA 1LHGH 5EW1H 3PO1B 4HZHA 4ISLA 1HIAA 3UWIA 3MH7A 4CBOA 3GCTF 2A45B 3SJOA 1G30B 1K1IA 2VINA 1EP5A 2OC1A 2H9TH 1D4PB 1BTWA 3A89A 2BOHB 2PGBB 1ZOMA 3M3TA 4ZXYH 1Z1JA 1T4UH 2UWOA 1SLWB 1E1RD 2BD2A 1OWDA 2UUFB 3RDZA 3MO3A 1GHYH 3NUMA 4GHTA 4DIIH 3E3TA 4UFEH 1AQ7A 2VWMA 2BYAX 3GCHC 1P3EA 2D2DA 1MTVA 2KCYA 4D76A 1FY5A 1BBRH 1MKXH 4RI0A 1DPOA 4AFSA 3SV6A 1SHHB 3EQ0H 2FLBH 4BXSA 3A85A 2OBOA 2FYQA 2WHXA 1HLTH 1TRYA 2VIWA 3LC3A 1GBLA 4JZDH 1RS0A 1O2PA 1V2VT 2GCTB 3SUGA 1H9HE 5JBBS 1OWHA 4M7GA 1TMTH 1CA0B 3NWUA 4YOJA 2C4FH 1GI9B 3OTJE 4B73A 1TRMA 1VITG 2Y5GA 1AU8A 2BM2A 2GD4B 4DW2U 3F0OA 4O9VA 1AFQC 3A7ZA 4Y8YA 2P95A 3SU3A 1TNGA 2P3FH 3PMAB 1RTFB 1LPZB 1Y5UT 5F03A 1X7AC 3MO6A 1Z8GA 1BJVA 2J97A 1O2WA 3A86A 2R0LA 3U1JB 2ZCLP 1NZQH 2ZIQH 8KME2 2ZTYA 5L2ZH 5C5OA 3UFAA 1UK3A 2QC2A 2ZP0H 3RXDA 2AEIH 2NU1E 4DT7B 1SHYA 3RXQA 4RN6A 3UAIC 2JETC 1Z6JH 3TH3H 1K1LA 3GDSA 2XOKD 4HI3A 1P2KA 3OE7D 2Q6GA 1HXFH 2Y7XA 3H5CB 2FLRH 1L4ZA 4FVBA 1SGYE 1KY9A 1LVMA 4ACAA 1EPTC 3DSPA 1J17T 2ZDNA 1NFWA 3PO1C 4NFFA 1ZRKA 4FUCA 4QT8C 4ZXXH 5GWZA 2GT7A 4OS4A 4XE4A 3A8AA 1TLDA 1BQYA 1W10U 1TNHA 2VBCA 4HGCA 2A4RA 3TJOA 4Y7AA 4D7FA 3SI4H 1OP0A 3U9AH 1HAGE 1BHXB 1SSXA 3GS9A 2BY7X 2HWLB 2WPJS 4FETA 4X1QU 3MU5A 1HAVA 1C5PA 1GVZA 4CRAA 4IN1A 3URCA 1PQAA 1W0YH 2I6SA 4SGBE 3UTUH 3A8BA 3FANA 1W7XH 4A6LA 4U2WA 1O33A 3ZYEA 1PPGE 2XCFA 2ZU1A 1V2ST 2C8YB 2KX4A 2UWPA 1RTKA 3QGJA 1MD8A 2C8WB 3DHKH 1LKAA 3KF2A 3PB1E 2KFWA 2L74A 3UB0A 3QZRA 4NZQA 7KMEH 1C2IA 5EQRA 3L33A 3SNCA 1MKWH 2BZ6H 4KTSA 5BRRE 2Z7FE 1FV9A 1J8AA 4MPWA 4K2YA 1THSH 2Y5HA 1FQ3A 4AFQA 1ELAA 4B6FA 1GJ4H 3BEIB 3O8RA 4WVPE 1ETRH 4Y8ZA 1VJ9U 1OXGA 2J92A 3H09A 1ELEE 2RDLA 3T28A 1O3NA 1O5FH 2GVFA 3LDXH 1D3QB 2VIVA 3SGBE 1O2HA 2LELA 4E7RG 2BY9X 3PV5A 3PMHB 5GPIB 3M37A 2J98B 1UTNA 5E0HA 2FS8A 4GSOA 3MNXA 2FI5E 3M5LA 4BOHA 1IQJA 1CQQA 1AMHA 3K9XB 4JZEH 3LH1A 2VWNA 1BDAA 2ZDLA 1AE8H 3ODDA 4XOJA 1BUIA 5DPAA 1NU9A 4U30A 1WU1A 2K8IA 4F49A 1ARCA 3NKKA 3P17H 1C1OA 1NU7B 2Z3CA 1DM4B 2KCAA 5DP7A 3EYDA 1TALA 3FAOA 5EU8A 4NFEA 5F6MA 3V13A 4A5TS 2AIQA 5A8ZA 1SB1H 1C2KA 2CHAB 3V0XA 1T4VH 1SG8B 1IQHA 1MABB 3EAJA 2GT8A 4DY7B 1RRKA 4ZKOU 1XMNB 1CO7E 1C2MA 1GBHA 1OWEA 2LNCA 4CRBA 1QIXB 4IC6A 5IDKA 5KECA 1GDUA 1OYTH 3LC5A 3STJA 5EJ1A 1M9UA 2TGTA 3PMBB 3PROA 3ODFA 1Y59T 2BDAA 1HB0B 1JOUB 4UFFH 3UQVA 1W11U 2FOAA 1C5UA 5T6FA 2OLGA 4R8TB 3RC4A 2BLQA 4A1VA 1YY3A 3A81A 4F55A 3SUEA 1EZXC 2VJ1A 3N7EA 4ACBA 1UVPA 4X6OA 1HV7A 1SC8U 2GV6A 4TPIZ 1HIAB 1GBJA 1YPEH 3MNSA 1BBRE 4NA7A 3TJUA 1T8MA 1A46H 3PTNA 1YCPH 2H5DA 3VG8A 1VITF 2XRCA 1YPLH 2FOBA 2ZHWH 1CE5A 4I33A 5IK2D 1FY8E 1CSOE 3UR6A 1SGTA 2BDYA 1RTLA 3HK3B 4ZUHA 4ABAA 1ESAA 1C9TA 1P02A 2A2XH 1YPHC 2ZPRA 1PFXC 1OP8A 2GKVE 1GBEA 5T6GA 4Z6AH 2WV9A 1VCWA 2XBXA 4DIHH 2ZU5A 1DWDH 1G2MA 1OWIA 3BIUH 3DCLA 2HGTH 1SQRA 1FMGA 5SGAE 2FYRA 1TGSZ 3P8NA 4OS5A 1MBMA 5K7RA 4GVUA 4NIVA 4YO9A 1PYTC 1QA7A 2FXRA 4F4OC 1GDQA 3RXRA 3FN8A 1AD8H 1SGFG 1NFXA 1EPTA 1L0ZA 1RGQA 4WY3A 2J95A 4GLYA 1A5IA 1VR1H 3LOXA 3DSGA 4Y79A 2FDAA 4CRFA 5C20A 2OBQA 3PWBA 1JRSA 1E34B 3ZZ8A 1S85A 2F3CE 3QGNB 1NT1A 1XUIA 2G8TA 1O5AB 3FZDA 1C1NA 1MQ5A 1PPEE 4JK5A 2HNTC 3NRLA 3ITIA 1EUFA 2W6JD 3ZVGA 1ARBA 3M5NA 1GI1A 3GISB 1C5XB 1BIOA 5IYTA 1LQDB 3GY6A 5EOKA 4FUDA 2WYGA 3KCGH 4Y6DA 2BX4A 1F92A 3MNBA 2V0BA 1P9SA 1NY22 1RIWB 4KELA 2FOFA 4M9FA 4E06H 1C2GA 4AX9H 3ZVAA 2BLVA 4MG3A 1DFPA 2BDIA 2ZEBA 2W26A 4ABDA 4BANB 5EODA 1N6XA 1SI5H 2ZA5A 3SW2B 4I8LA 1TGNA 1SQTA 3SV9A 2GP9B 1KXBA 1ZRBA 2J94A 4I86A 4TT3D 4NIWA 3FO8D 4H6SB 2QXHA 2PLXA 4RKJB 1OPHB 3M35A 3FZZA 1ANEA 4MPUA 1MTUA 3GDUA 2A5AA 3RXMA 1KIGH 3RXIA 1Z8IB 4I8HA 4AG2A 1XUKA 2FOEA 1FZZA 3ESTA 1MBQA 2WPKS 1ELCA 2AMQA 2QY0B 5FCKA 1D9IA 3OYPA 5ETXA 5HYOA 1CHGA 1HAVB 1O5CB 4THNH 1UHBA 2OQUA 1QHRB 2ZGBH 3AAUA 4GHQA 1TA2A 1UW7A 1EATA 4NCYA 5HGGA 1TGCA 3VB3A 5KEDA 1JRTA 3AW1A 1IHTH 2RA3A 3QK1A 2GDEH 3SU2A 1DANH 1MCVA 1WQSA 2OC8A 1TMBH 1D6RA 1C5MD 1GI8B 4ESTE 1G9IE 2EY4C 5EGMA 1S6HA 2PWXA 3A7WA 4WMFA 1G37A 1JWTA 1AB9B 4X1SU 2G4TA 1UK2A 4ISIH 3F9EA 3ZZBA 1TX6A 2CXVA 4WWYA 4DURA 5HM2A 3ZZ3A 5K0HA 2PSYA 3ZVFA 2PTNA 2BOKA 3SJIA 1BRBE 3D62A 2QF5A 1AIXH 1K28D 1Q31A 2J4IA 2WPDD 4UDWH 1HJAB 3BTTE 3BF6H 1W7GH 1QQ4A 1IQEA 2AGGX 1WTHD 1TQ7B 1O2ZA 3M3VA 1FN6A 2HLCA 3WWFA 4CHAB 2NU4E 4FUEA 3ZV8A 1LHEH 1UVTH 2R0KA 2WPHS 4Y76A 3F9HA 1RIWC 1ZHPA 2HPQH 2GZ9A 1QGFA 2NU0E 3MO9A 2Y82A 4FU7A 1HPGA 1J15A 1QL8A 1EZUC 3ZZCA 3LGUA 3TLOA 1O2LA 2VWOA 1C1VH 5A09A 1P9UA 1NBME 2BDBA 2XC4A 3TH2H 1C1SA 2O8MA 1C1RA 1O2QA 3DUXH 2QYIA 1P2MA 4BTTB 2BLOA 2F9UA 1K2I1 1CT2E 5AFYH 2OCVB 3QZQA 4WMDA 2BY6X 1W0JD 1TGBA 1ZJDA 3GCHB 2LP6A 1Y5BT 2TBSA 1ELDE 4XDEA 3SZEA 2EI7A 3MHWU 2J98A 4INHA 2ZHFH 2B7DH 1XX9A 3F2FA 1K1NA 1ZPBA 2SGPE 1O3BA 1YLCA 1TQ0B 2BVSH 2W7UA 1TONA 1E1QD 4D7GA 2W3KA 1E37B 1K0HA 1ZSKA 1FI8A 3RLWH 1Q2WA 2ZTXA 3ZZ5A 1UCYK 4WF8A 4AG1A 2EI6A 1S6LA 1PQ8A 4UE7H 4Y11E 2Y81A 2CF8H 1ZLRA 1A3EH 1P05A 1P2JA 3A80A 1IOEA 3O8DA 4AZ2B 1P10A 6ESTA 3F9FA 3CENA 2A1DB 1OWKA 3RP2A 5AHGH 4KTUA 1C5ZB 5CE1A 1FX0B 3P6ZB 2STAE 2ULLA 2YOLA 3TH4H 4ABGA 2J5UA 1Z8JB 5TCCA 1Z7KA 1Y3YA 4MQAA 1O2TA 2ZPQA 2WUBA 1HYLA 4DGJA 2OUAA 2W5EA 2V35A 3SUFA 2JJ2D 1HJAC 2ZWLH 1GJDB 3ZV9A 1FNIA 1CGJE 2JETB 1ACBE 3RU4D 2R2MB 3C1KA 4CR9A 5CDFE 3VGCC 3JZ1B 1AZ8A 2Z6BD 1TX7A 1S83A 5A8YA 4MNWA 4NA8A 1AVWA 2JKHA 8GCHG 5DGJA 2PSXA 1ANDA 2ZG0H 1EPTB 1ELFA 1W13U 1YPKH 1Y3WA 4XD7D 1CGHA 1TA6A 1DSTA 2XBWA 1SR5C 3TJNA 2UUJB 3B23B 3R3GB 4CBNA 2FI4E 2ZGJA 3UNRA 3L6PA 1Y3UA 4BAHB 3Q77A 2D1JA 3EA9A 4LK4A 2B5TB 4AB9A 1V2TT 1C1PA 1C2LA 2C8XB 3A7YA 1GI3A 1CVWH 2C93B 2QAAA 3OU0A 1NRQH 3Q00A 4LZ1H 1QL9A 1DUAA 1INCA 3M7UA 2L6OA 1SOZA 1GHBG 2VVUA 1ZPZA 1NS3A 3F6UH 1C1WH 1EJNA 2V7QD 2XTTB 1SFQB 2F9VA 4H6TA 1SLUB 4Q63A 3KGPA 1XVOA 1P03A 2P16A 5C1YA 2LPRA 3CNRA 1TPSA 1A5GH 1HBTH 3LJOA 1GBMA 1LDTT 1O5EH 1BTPA 4ABFA 2YMSC 3LH3A 2G52A 1O3AA 1QB1A 1WSSH 3DFLA 1QFKH 1O5GH 1LCYA 1HFDA 2VIDA 4KTCA 2P8OB 1C5RA 2FOCA 4RT0A 2P59A 1WV7H 1V2JT 1HXEH 1BITA 1SPJA 1FPCH 1DSUA 2PUXB 3ATKA 2AGEX 3T27A 1QBVH 1TWXB 2QN5T 3NCLA 1GJ6A 2ODQA 3SJKA 2QF0A 3AASA 1IHSH 3ENSB 1O2YA 1ESBA 3SGQE 4JMYA 5A0AE 1GHVH 3MYWA 4NWKA 3T29A 1BRAA 2F9BH 1DICA 1AVGH 5JBTA 4A1TA 2W3IA 1T7CA 5EQQA 1JIRA 4IGDA 4J1YA 1COWD 2F83A 3AAVA 3E0PB 3BG4C 3GDVA 1W14U 1O2UA 1C4Y2 1UHBB 1OSSA 4OGYA 1SGDE 1ANCA 1UTJA 1EKBB 1P06A 1MTNC 1L1NA 1Q3XA 1WTGH 1ZMNA 1P09A 3LGTA 1O3CA 3KQDA 4H4FA 3ZZ7A 4JZ1A 1GMCG 3RMLH 1C2DA 1A3BH 2QA9E 3VXEH 3VB7A 1PYTD 1C5WB 2VIQA 2WINI 3MMGA 1BRCE 1TOCB 1DWEH 4MVNA 2SGAA 4XBBA 5EPNA 2Z3DA 3ATMA 3PLBA 3TITA 4KKDA 4TWWA 1D6WA 2TRMA 3VB6A 1WCZA 1O2KA 1BMLA 3VFEA 1PPCE 1AY6H 4TY6A 2IPHA 3BTQE 1MTSA 4LZ4B 1K1OA 1HNEE 5EJZA 1ZHRA 3PTBA 4X2VA 2I6QA 4Q80A 3BEFB 1PPFE 1C4V2 2XBYA 1HAOH 2RDEA 1QB9A 2ANMH 1HCGA 5C1XA 2D26C 1FY4A 4AGKA 2H2ZA 1LPGB 1O39A 3LGIA 1P2NA 4E05H 4GCHG 2PW8H 3TVJB 4ZCNA 2IOTA 3GCOA 1QL7A 3V3MA 3M61U 1NRPH 5FL7D 1C5OH 1CHOF 2FO9A 2P8OC 2CK3D 3SBKA 4YLUA 5DP4A 1O2OA 4Y7BA 3SZNA 4B76A 5E0JA 4WH8A 1V2KT 4OS1A 1BTYA 4K69A 5DKMA 1MZDA 4D9QA 1DLEA 2F43B 2P3UB 1MTWA 3BSQA 4X8UH 4AC9A 1O3IA 1SBWA 1V2UT 1J16A 4XRNA 4I32A 1UTLM 4WJG2 5HKKD 1AUTC 2QXJA 3LGVA 1O3GA 4JYVH 1AO5A 2ZCKP 1A7SA 1PPZA 3NZIA 3QTOH 2A4OA 5JYIA 1UTQA 2OTVA 1DWCH 1YF4A 2FI3E 1SGEE 4X1RU 2FEQH 1EZQA 4NG9H 1QCPA 4GPGA 3TNTA 5TJXA 2ZGCA 3OAAD 4OM9A 2ZHQH 1P01A 2VU8E 2ZKSA 3T62A 1KLTA 4YZUA 5DN6D 2ZDKA 1H8IH 1QZ8A 5JBAS 2ZZUH 3UR9A 8GCHF 3LKWA 3PWCA 4O3UA 3TPIZ 1KXAA 4CH8B 1C2EA 1AWFH 3F2HA 1NFYA 3VB5A 3SGAE 3SUDA 4YESB 1JXPA 4DVAU 1S84A 2F9NA 2K1QA 3W1EA 3PLPA 4I7YH 1TNLA 3TK5A 1V2NT 1UCYH 1C1QA 3GY4A 1QURH 1P8VC 1ZJKA 4YLQH 1MU6B 2D8WA 5CHAB 5FAHA 1AI8H 2ZC9H 3RXUA 1ZSLA 1L2EA 2GTBA 3SU1A 4FUGA 2A4QA 2P3TB 2VIPA 3GOVB 1O0DH 3SI3H 1J14A 1ZTJA 1C1MA 4Y10E 1AKSA 1GHBF 4DT4A 1C1UH 1ELBA 4ZAEA 2NWNA 1AN1E 2Z9LA 3ZVEA 1BJUA 5BPEA 3HGNA 1O32A 3GYLB 1H4WA 1KXCA 1JBUH 1GMDG 4AGJA 3A87A 1YKTA 4X8SH 2KZ4A 4BAKB 1UMAH 2FTLE 1TIOA 2FWWA 1PPHE 2Z3EA 2M5TA 2A7HA 2XWAA 3ZVBA 1DS2E 1MU8B 3V12A 4ABIA 1FLEE 5T6DA 2TPIZ 3UUZA 3RXKA 2ZFRH 2JH0D 3WW7A 4FOUC 3DD2H 4Z1MD 1QJ6B 1Y5AT 3ZVCA 1P3CA 3T25A 1DVAH 1N8OC 3A7TA 2YNAA 5EXLA 1EAUA 1K1PA 1H8HD 1V2WT 2A32A 5A2MH 1J9CH 3RXVA 4GAWA 2AFQB 1N6YA 4ASHA 1N1LA 4SGAE 3T2NA 1K1JA 1FY1A 1JMOH 2DE8A 1FDPA 1NRRH 4DG4A 2ZGHA 3U69H 1O30A 3SQHE 1AGJA 1O2NA 3MNCA 3W94A 4XSKU 2JIZD 1EAWA 4RKOB 3S7HB 1KMHB 2F9OA 4O3TA 2PTCE 5EJLA 4A1XA 1GMCF 2ZQ2A 2ANWA 2BDCA 2J38A 1ZTLA 1GVLA 2BDGA 2J9NA 1KXFA 1YYY1 3A88A 3QTVH 5E0GA 4Y0YE 2C8ZB 2W6ID 4JCNA 4ABBA 2VH0A 1GPZA 5LGOA 4ISHH 1O34A 3PLKA 3URDA 2GJGA 1A0JA 3SJ8A 2R2WU 1MAYA 2STBE 3SNBA 2P94A 4YT7H 1O2RA 5CHAC 1SGFA 1GL0E 3RMMH 1Z8RA 3MWIU 3A83A 1GI2A 1QJ7B 3GCNA 2JJ1D 5C0UA 1TYNA 1C2HA 2BQ7B 3UOUA 1ETTH 1GG6C 1HAXB 1BA8B 1W0ZU 4B71A 1AE5A 1SL3A 1UJ1A 2HLDD 4FU8A 2NU2E 1VGCC 4NIXA 5I46H 4X2WA 3SQEE 1V2OT 3SOSA 1EXFA 2O9QA 1KYNA 4GCHF 5I25A 1TPOA 1FN8A 2ZNKH 1MUEB 3FP6E 2UUYA 3DT0H 1QA0A 2Y5FA 1LMWB 4MTBA 4ISNA 5DK1A 1OP2A 2B9LA 1O2VA 1CT4E 2BXUH 2ZDAH 4ZHAA 1GHAG 2ZU3A 3UREA 4K8BA 2PKAA 2Z9IA 3UNSA 3UPEA 1Z71A 4NWLA 4X1PU 3MU8A 5C67A 2Q6FA 5FXLA 3TGKE 4IS5A 1CBWC 3BEUA 5HXFA 1SGIB 3PV2A 1KXDA 1P12E 5FPTA 1O3LA 2SNVA 1NRSH 4X8TH 1O3JA 3LONA 5F8TA 1S82A 1SGQE 3KYGA 1FAXA 1ABJH 2OINA 4XBCA 3MFJA 1IQLA 2HVYB 1O2SA 2JDID 2YMSD 4NIYA 5L30H 3BTDE 4H42U 1LKBA 1XUGA 5DSFA 1P0SH 2XWBI 2PV9B 1XUFA 5EXNA 1TE0A 3N7OA 2AYWA 1MMJN 2W7SA 2TGPZ 1D3PB 4FXGH 5LH8A 4IW4E 3SN8A 1GI6A 4B2CA 1O5BB 3Q76A 2TIOA 2ZECA 1L1GA 2AH4X 3SORA 1RFNA 2BQWB 1GBFA 1ZYOA 3RLYH 5ABWA 1KDQA 3VGCB 1G3DA 1O2GH 1Y3VA 4O03A 4YOIA 4FUBA 1ABIH 1BB0B 4B75A 1SGPE 3IWMA 3HKJB 1UVOA 2GV7A 4JZFH 2R9PA 1SGCA 2AS9A 2BX3A 3MOCA 5L6NH 4XBDA 1UCYE 4K8YA 1S0QA 4VGCC 4HFPB 1DT2A 1AZZA 5T3HA 1YGCH 4YM9A 3PMJA 4MLFB 1S6FA 2GMTC 4K3JA 2FS9A 1DLKB 1GMDF 1O5DH 4AN7A
chains in the Genus database with same CATH topology
2FP7B 3U1IB 1XKBC 3OY5U 2ANKH 3E91A 3KQEA 3P8FA 3S0NA 3FVFB 1EAXA 1S81A 1O3EA 4BAQB 3HATH 1TFXA 1QBOA 2UUKB 4ABEA 1DWBH 1EJMA 2PUQH 2P93A 3OY6U 4NSYA 7ESTE 5HM9A 1O2XA 3H7OA 1BMAA 2BXTH 4X6PA 4AYVB 2WUCA 3L3TA 1KXEA 4ABHA 2ESTE 1ETSH 3D49H 4Q7XA 1TOMH 1VCPA 4UD9H 5C2ZA 4K1EA 1ESTA 1AKSB 1O3PB 2G5NA 3M3SA 4AFUA 1B7XB 1C5LH 1E36B 4UFDH 2QF3A 1L1JA 2SFAA 2WPMS 2FX4A 2BZAA 4CREA 1NM6A 3VB4A 4ZKNU 3A7VA 2G00A 3VEQB 1TGTA 1FY3A 3HK6B 3SNEA 1GBKA 2NU3E 1QBNA 2BB4A 4A92A 3EA7A 4JZIA 6LPRA 3SV8A 5EW2H 3P8GA 4DOQA 2A7JA 3KN2A 3M5OA 2G55A 1GJ8B 1CA8B 4D9RA 3S9AA 2HALA 1O3OA 1OWJA 4FUIA 3K6YA 2O8WA 2OD3B 3WY8A 3K65B 3B9FH 1ELVA 3TU7H 3BG4B 4CH2B 1LO6A 3I29A 3B8JA 3M5MA 2EEKA 5GCHG 4UONA 5B6OA 4ZH8A 1MTNB 1YBWA 1LHFH 1W12U 3PV4A 2A5IA 1HRTH 1QY6A 1A1RA 4DJZB 1IQFA 1F5KU 1O3FA 1TNJA 1WYKA 1H8DH 4KGAA 6GCHG 2ILNA 6CHAC 3P8OA 1O38A 1QR3E 2Z9GA 2IN2A 3A8DA 1NN6A 3RMNH 1CT0E 1V2PT 4Y71A 3ZYDA 3OSYA 3KQBA 4FUHA 2PR3A 3MU4A 1FXYA 1U6QA 1NRNH 1XUHA 4K1TA 3UNQA 2BQ6B 5GXPA 3CS0A 5JB9S 1ANBA 2FOGA 5FX6A 2G51A 3UY9A 1O3HA 1GBAA 1PPBH 1ELTA 2ZDVH 1TNKA 4LOYH 1GBIA 1W8BH 4B74A 2O8UA 1Y8TA 1GHAF 1BTXA 1NROH 3RXHA 1EAIA 2Z9KA 2F9PA 4A7IB 4X8VH 5TCAA 4YOGA 1O36A 1O2IA 1HAZB 1O2JA 1QNJA 3KNXA 5CMXH 3RMOH 3A82A 4I8KA 1GI5A 1T8NA 2ZFSA 2SGQE 4AFZA 1GBDA 1ZSJA 1BCUH 1H9LB 1THPB 3UWJH 1C5SA 4ZHMU 1OKXA 2WYJA 1MQ6A 1BOQA 1LQEA 2JH6D 4UEHH 1F0SA 2FOMB 1P11E 3MH4A 5ESTE 1HGTH 3KL6A 1P57B 2XBVA 3NXPA 3UQOA 3RM2H 2IJOB 1KTTB 1BHXF 2ZU4A 2VGCC 2GZ7A 3IG6B 1NFUA 1AFEH 2PKAB 5GJ4B 1DX5M 2Z9JA 3R0FA 1TBQH 3BG8A 4JYUH 1EB1H 3NPSA 3RXEA 3STIA 2BTCE 4IMZA 2AMPA 2H1UA 2QXIA 1ELGA 2J2UA 4Y0ZE 5DJ7A 2FZZA 3GYMA 3EDXB 4FVDA 5E2OA 3JZ2B 2ZF0H 3BTKE 4O97A 3I77A 3LT3A 2KAIA 2BD7A 3E16B 1HUTH 1ZTKA 3M7TA 9LPRA 1SGRE 5LPRA 3BTGE 1ZZZA 3ZZ6A 1BTUA 1TBZH 2VIOA 2WV4A 3MU1A 3PYHA 4JYTA 3RC5A 5F8XA 1C5TA 1DOJA 1EASA 2EC9H 5DP8A 1TPPA 3GY2A 1QJ1B 2ZFFH 3E8LA 1GJ5H 2A5KA 1K1MA 3QO6A 3MU0A 1H1BA 3QX5H 3UIRA 3M36A 1GGDB 2CF9H 3BTWE 3K6ZA 1IQMA 3LIWA 2ZFTA 3U8TH 3H7TA 3KEEA 1VZQH 2G4UA 4TYDA 1O35A 3D23A 2FPZA 3RXAA 2Y7ZA 3UOPA 2DE9A 4AB8A 1YP9A 4K1SA 3EE0B 1DITH 3BIVH 1KDQB 2R3YA 3FP8E 1O3MA 4BAOB 2DUCA 4X2XA 3D65E 2J34A 1GJ9B 3ZZAA 1O3KA 3K2UA 1AUJA 4ZKSU 1UTOA 5L2YH 1GI7B 3I78A 2H9EH 1KLIH 2BY8X 5DP5A 2XCNA 2AERH 5LPFA 1A0HB 2QV1A 1O37A 2Y6TA 2BY5X 1FIWA 1O31A 4NZLA 1T31A 1SFIA 2FESH 3TNSA 2HNTF 4DCDA 4MNVA 3RXJA 1V6DA 3ZZDA 2ANYA 4E7NA 2CGAA 1E0FD 3S69A 3LGWA 1FUJA 1N8OB 5FBEA 2QIQA 2XW9A 2GCTC 4BTIB 3T26A 1ZMLA 1HAPH 2FODA 1CA0C 2ZU2A 4BTUB 1MH0A 1HJ9A 1FONA 1ZGIA 2EA3A 1P04A 1G32B 4INLA 2WPIS 1A61H 2ZGXH 3RXSA 2ALVA 2WV5A 4J2YB 1F7ZA 4WH6A 1IQIA 1K9OE 1S0RA 4R0IA 3AW0A 5E2PA 4NGAH 4FUFA 1BMMH 3LU9B 4WXVA 2A31A 5GCHF 2C90B 4INKA 1F5LA 4CR5A 3KIDU 1NC6A 4B1TA 1K22H 5GDSH 4IMQA 1GMHG 3BTEE 1TRNA 4KP0A 1C9PA 2THFB 1W3CA 6GCHF 2BD5A 1AVXA 4CRDA 1G36A 1YCPM 2BLWA 3BTFE 4TWYA 3VXFH 2UWLA 3ZZ4A 2HVXA 1QTFA 3SV7A 1SLXB 1GGDC 4WXIA 4OGXA 4X2YA 1ORFA 4Q7ZA 1UVUH 3RU4E 3S9BA 1BRUP 3BTHE 1ZHMA 1C2JA 2OQ5A 1FJSA 3RM0H 2FOHA 5JPMH 2AIPA 2PHBA 1UK4A 4CRGA 1HAHH 4B2BA 2ZPSA 3SV2H 1PQ5A 1GG6B 1VJAU 1WBGB 4OS6A 4XFQA 5DP9A 3A7XA 1Z6EA 3AVZA 1VGCB 2ZFQH 2ODYB 2ZQ1A 2OP9A 1P2QA 1Z1IA 3TGIE 2ZDMA 1MZAA 2QXGA 4PROA 2SGFE 1DXPA 3G01A 4UFGH 1DY8A 2GGVB 1G3EA 2C3SA 1BZXE 1QRWA 3HPTB 5EQSA 1YPMH 3SU6A 5DG6A 5JB8S 4ZHLU 3RXCA 2JH5D 2GCHG 3A84A 2B8OH 2QGRA 1K21H 1GJAB 1SOTA 1KTSB 3CP7A 5DP6A 5FPSA 2BD3A 1VITH 4MNXA 1GCTB 3KQCA 5LPEA 1IQNA 3CS7A 1MCTA 4ISOA 5F8ZA 1QB6A 1GI4A 2SNWA 1TX8A 1TMUH 5C1UA 2A0QB 5E8EH 1A0LA 2G5VA 1OX1A 2BMGB 1CBWB 3O8BA 4JK6A 3SHCH 1C5QA 3T5FH 3ATIA 1RD3B 1F5RA 3OX7U 5J4QA 4RSPA 1E35B 1G3CA 2ZHDA 2ALPA 3RUOA 3FP7E 3GY7A 2GZ8A 1SVPA 1UVSH 1C4U2 1OYQA 2OC7A 2XNIA 4MPVA 1YPJH 3LGYA 1BMNH 1MAXA 5EPYA 3SU4A 1RJXB 1ZR0A 3QWCH 2XC0A 2CJIA 1V3XA 2ZI2H 5JDUB 1IQKA 1G2LA 3MH6A 2A4GA 1HAIH 1QQUA 3E0NB 2B0FA 3BV9B 1THRH 1FIZA 3MTYA 1TB6H 5GIBA 3ATWA 1TAWA 4ZROA 1LPKB 1O2MA 2BD4A 2O8LA 1B0EA 2VWLA 1YPHE 1D3TB 1T8LA 3KHVA 2OC0A 3FFGA 7GCHG 1DY9A 2XYAA 1GVKB 1GHWH 3S7KB 4CRCA 5A0BA 2O8TA 1LHCH 1BBRK 2BVRH 3SO3A 1MKXK 4FU9A 5DO4H 1BT7A 2FMJA 3RXOA 1LVBA 3NK8A 4VGCB 1TPAE 1V2RT 3MH5A 3A8CA 1C1TA 3GY3A 4BAMB 4IBLH 1DDJA 3SHAH 3QLPH 1S5SA 1RXPA 2GMTB 2CHAC 2KAIB 4OS2A 2G81E 2AGIX 4I8GA 4HTCH 3ZZ9A 1GL1A 1BTHH 2F91A 1GBTA 2SGEE 1LVOA 3RXFA 1C5VA 1XXDA 3M7QA 2HNTE 1TBRH 3GCTG 1ZPCA 3Q3YA 1WOFA 4Y8XA 1HAYB 4Q2KA 1GCTC 3LJJA 1B5GH 2PGQB 1QRXA 4NA9H 5PTPA 1W2KH 1F0UA 1OOKB 2AMDA 4D8NA 4AYYB 4OS7A 2ZHEH 1GDNA 3Q3KA 1KSNA 2ZCHP 1FPHH 1V2MT 2HRVA 8ESTE 1CU1A 3ELAH 1KLJH 4X1NU 3SU5A 1GJCB 1NESE 3ATLA 4ZKRU 1GWAA 2FIRH 1TABE 4NSVA 4WMEA 1V2LT 1ID5H 2VB0A 2Q6DA 3EA8A 3EGKH 5HMAA 2V3OH 3VPKA 1CGIE 3C27B 2YNBA 1GJBB 1XKAC 1XXFA 1EQ9A 1EOLA 4GUXA 1WUNH 1V2QT 1BTZA 1DE7H 3F68H 5ESBA 1A4WH 1NPMA 2BD8A 2Y80A 2TGDA 1A2CH 1NO9H 3RXTA 1GMHF 1AHTH 4TPYA 2VH6A 1D3DB 3DA9B 3DFJA 5FBIA 3BN9A 5A0CA 2HOBA 2Z94A 1WAYB 1GCDA 3V7TA 4AORA 3U8OH 2SGDE 4TY7A 2FX6A 3F1SB 3SU0A 1LHDH 1SQAA 8LPRA 1PJPA 2RA0A 1HJ8A 3TIUA 5G4BA 4MPXA 1B0FA 4AOQA 1UTMA 3LPRA 2R3UA 2VNTA 1YM0A 1H9IE 2PKSB 2WPLS 3QUMP 2BVXH 1GBCA 2ZFPH 1Y3XA 1P2IA 6CHAB 1ZGVA 2ODPA 3E90B 1MKWK 5FPYA 5AVDA 2GX4A 1SQOA 3P95A 4U32A 1GBBA 1IAUA 3U98H 3GY8A 4X0WU 1C5YB 1EX3A 1UTPA 9ESTA 1SLVB 2H6MA 2BHGA 2CMYA 2ZO3H 2XC5A 4ABJA 1C5NH 1UO6A 4X6NA 3U8RH 2FM2A 1WQVH 1EP6A 3TGJE 3P70B 2GCHF 1NTPA 1VCQA 5FHTA 3RXGA 4B2AA 1LTOA 1F2SE 1XUJA 5FX5A 1GHXH 4I31A 3SNDA 3QN7A 3P92A 3E6PH 3S9CA 1XM1A 4YT6H 1TNIA 3HKIB 4MNYA 5FCRA 2Q1JA 2RG3A 4FUJA 1AWHB 3ZVDA 1DUEA 1YLDA 3Q3XA 2A7CA 2V6NA 4I8JA 3GY5A 1P2OA 2H5CA 4MDSA 3RXBA 4U01A 4YTAA 5JBCS 2A2QH 1QRZA 2VVCA 1UTKA 2RCEA 1OS8A 3O8CA 5AF9H 4K60A 2BDHA 5EG4A 1XVMA 5C3NA 1FAKH 5AFZH 1L4DA 3E1XB 1MD7A 2BD9A 1EB2A 3BTME 1DXWA 1EOJA 2TGAA 1CHOG 3MI4A 1F0RA 1O3DA 1PQ7A 2VGCB 4K5ZA 3PM3A 2XXLA 7LPRA 1A5HA 2CV3A 4Z0KA 3TK9A 3QDZB 1JIMA 1ZMJA 3HGPA 3RC6A 1GJ7B 1YPGH 2HPPH 3W95A 2FTMA 1AFQB 1T8OA 1E38B 2ZTZA 2V3HH 3RXLA 3SNAA 4X6MA 2ASUB 7GCHF 1HDTH 3SJ9A 2H9HA 2CN0H 1F0TA 1AB9C 5EXMA 3RXPA 5DP3A 3GICB 1SMFE 3TJVA 2EI8A 2PKSC 4IN2A 1SGNE 3TK6A 4LXBH 2OXSA 1C2FA 4ZMAH 1EJAA 4Q7YA 2GDDA 5J4SA 5C5NA 1G3BA 3IITA 1YC0A 4BNRA 1T32A 2PFEA 5H4IB 2VVVA 1LVYA 1GHZA 4IC5A 1IQGA 1EZSC 3RU4T 4CHAC 1YCPK 3F9GA 5A8XA 2QCYA 1GI0A 4BXWA 1LHGH 5EW1H 3PO1B 4HZHA 4ISLA 1HIAA 3UWIA 3MH7A 4CBOA 3GCTF 2A45B 3SJOA 1G30B 1K1IA 2VINA 1EP5A 2OC1A 2H9TH 1D4PB 1BTWA 3A89A 2BOHB 2PGBB 1ZOMA 3M3TA 4ZXYH 1Z1JA 1T4UH 2UWOA 1SLWB 2BD2A 1OWDA 2UUFB 3RDZA 3MO3A 1GHYH 3NUMA 4GHTA 4DIIH 3E3TA 4UFEH 1AQ7A 2VWMA 2BYAX 3GCHC 1P3EA 2D2DA 1MTVA 4D76A 1FY5A 1BBRH 1MKXH 3SV6A 1DPOA 4AFSA 1SHHB 3EQ0H 2FLBH 4BXSA 3A85A 2OBOA 2FYQA 1HLTH 1TRYA 2VIWA 3LC3A 1GBLA 4JZDH 1RS0A 1O2PA 1V2VT 2GCTB 3SUGA 1H9HE 5JBBS 1OWHA 4M7GA 1TMTH 1CA0B 3NWUA 4YOJA 2C4FH 1GI9B 3OTJE 4B73A 1TRMA 1VITG 2Y5GA 1AU8A 2BM2A 2GD4B 4DW2U 4O9VA 1AFQC 3A7ZA 4Y8YA 2P95A 3SU3A 1TNGA 2P3FH 3PMAB 1RTFB 1LPZB 1Y5UT 5F03A 1X7AC 3MO6A 1Z8GA 1BJVA 1O2WA 3A86A 2R0LA 3U1JB 2ZCLP 1NZQH 2ZIQH 8KME2 2ZTYA 5L2ZH 5C5OA 3UFAA 1UK3A 2QC2A 2ZP0H 3RXDA 2AEIH 2NU1E 4DT7B 1SHYA 3RXQA 4RN6A 2JETC 1Z6JH 3TH3H 1K1LA 3GDSA 4HI3A 1P2KA 2Q6GA 1HXFH 2Y7XA 3H5CB 2FLRH 1L4ZA 4FVBA 1SGYE 1KY9A 1LVMA 1EPTC 1J17T 2ZDNA 1NFWA 3PO1C 4NFFA 1ZRKA 4FUCA 4QT8C 4ZXXH 5GWZA 2GT7A 4OS4A 4XE4A 3A8AA 1TLDA 1BQYA 1W10U 1TNHA 4HGCA 2A4RA 3TJOA 4Y7AA 4D7FA 3SI4H 1OP0A 3U9AH 1HAGE 1BHXB 1SSXA 2BY7X 2HWLB 2WPJS 4X1QU 3MU5A 1HAVA 1C5PA 1GVZA 4CRAA 4IN1A 3URCA 1PQAA 1W0YH 2I6SA 4SGBE 3UTUH 3A8BA 3FANA 1W7XH 4A6LA 4U2WA 1O33A 3ZYEA 1PPGE 2XCFA 2ZU1A 1V2ST 2C8YB 2UWPA 1RTKA 3QGJA 1MD8A 2C8WB 3DHKH 1LKAA 3KF2A 3PB1E 3QZRA 4NZQA 7KMEH 1C2IA 5EQRA 3L33A 3SNCA 1MKWH 2BZ6H 4KTSA 5BRRE 2Z7FE 1FV9A 1J8AA 4MPWA 4K2YA 1THSH 2Y5HA 1FQ3A 4AFQA 1ELAA 1GJ4H 3BEIB 3O8RA 4WVPE 1ETRH 4Y8ZA 1VJ9U 1OXGA 2J92A 1ELEE 2RDLA 3T28A 1O3NA 1O5FH 2GVFA 3LDXH