3RXSA

Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine (f04 and a06, cocktail experiment)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA02
1DLKB 1PPHE 2PGBB 2ZDLA 1NRNH 2F9PA 2ZHQH 3PV4A 1WYKA 2YNBA 3VXFH 2FDAA 4RSPA 1GBCA 1TWXB 1WSSH 3A86A 1TONA 1L1GA 1SHYA 1W13U 3ATKA 2FOGA 1GI2A 1MU6B 4K1SA 4TYDA 6GCHG 2BLQA 2ZDMA 3M5MA 5FCRA 3D49H 1MTNC 1EZQA 1FUJA 4X1PU 1Y5BT 2QXIA 3R3GB 2Z9IA 1O2HA 1BTUA 1C4U2 1A1RA 1C5OH 1TPOA 2GP9B 4K1EA 4IW4E 4A1XA 1GCTB 5F8TA 2ZNKH 1L2EA 1GBTA 2VWNA 3SUDA 2J38A 3M5NA 4GPGA 6GCHF 1A61H 1QBOA 1A0JA 2WV5A 1HB0B 1LHEH 1C2DA 5C2ZA 1HBTH 3JZ2B 1GG6B 1C5TA 2K1QA 3SGBE 1V2UT 1GHAG 2O8MA 2OD3B 4O9VA 2PGQB 1FY8E 1GJ6A 1EOJA 2ZPQA 2GCHG 2CJIA 1QL8A 1OKXA 2VIQA 1GMDF 1P04A 3RXAA 1NROH 1MMJN 4UDWH 3GY7A 1EB2A 3FP8E 2IOTA 1ETRH 1TNIA 3QK1A 4AB9A 1MKXH 1HIAB 4D9QA 1ZRBA 1FNIA 5L2YH 3I78A 1TNJA 1VITH 1N6YA 4GLYA 3BIUH 4YM9A 2AIPA 2C8XB 2ZKSA 1EAWA 1YBWA 2OC7A 2R3UA 3ZZ8A 2Z3DA 4GUXA 1SBWA 1T8MA 1XUJA 3PMAB 3ODDA 3FVFB 1ELDE 1QA0A 2FOAA 2ODYB 1DICA 4BAHB 3V13A 4AB8A 1N8OB 3P92A 1KXCA 2HNTE 1L1NA 1QL7A 3SJOA 2HLCA 1JMOH 3LC3A 2BY7X 3UQVA 2CF8H 1AE8H 1A0HB 3BEIB 3C1KA 3SJ9A 1AB9B 1G32B 2VH6A 3ZZAA 3FANA 3GCTF 3SV7A 3TNSA 1XKAC 1QNJA 1V2LT 4DCDA 1P2MA 1DXWA 4CHAC 2XYAA 5EW1H 1O2PA 2AYWA 5FPSA 5DK1A 2VIPA 8GCHF 5DGJA 1QTFA 1ELTA 3LH3A 3MO3A 2AGIX 1OX1A 2H5CA 2XCNA 2WV4A 1INCA 1F5KU 1Z8RA 1O2SA 3ZVBA 1YYY1 2ZHFH 1GI6A 4CH8B 1QRWA 4U2WA 3KQBA 4FUIA 2A4OA 1ABJH 5PTPA 4OGYA 1UJ1A 2XBYA 1GJBB 2ALPA 4SGBE 1DE7H 1D9IA 1EZXC 1TALA 3RXSA 4I8GA 1GHXH 4XE4A 5DP4A 3A87A 1GJAB 1QIXB 3VB3A 1GMHG 1OWEA 5GCHG 2BZAA 1UO6A 3RLYH 3RXPA 1L4DA 1AFQB 1SGEE 1E36B 1Y8TA 4YESB 2SGAA 3GDVA 1KXEA 1F5LA 1VITG 1Z6JH 2WUBA 2FPZA 1QRZA 4RKJB 3RUOA 1Y3UA 2Q6GA 4MPXA 2ZDNA 1TNHA 3VPKA 1THPB 1O2QA 1EOLA 1W7GH 1K1JA 1AFEH 2AIQA 1TMTH 1O3FA 5A09A 1C9TA 1GVZA 1L0ZA 1K22H 1YPLH 3UY9A 2A7CA 2XBXA 2XC0A 5L6NH 3U8OH 4MNWA 1GHBF 1P2IA 3N7OA 4Y11E 2PW8H 4JZEH 5E0HA 4JMYA 4ZAEA 3E91A 5T3HA 1GHYH 2HNTC 1YCPK 2EC9H 3CS0A 2TIOA 2TGPZ 4YT6H 2H9HA 1T4VH 3MNBA 2XC5A 5F8ZA 4NG9H 2HGTH 3SQEE 1XUIA 2ZFPH 3NKKA 4TWYA 2ZU5A 1QHRB 1AWFH 1GDUA 1IQEA 3TNTA 3AAUA 3RU4E 1P0SH 4KTSA 1UTLM 1O2IA 2QN5T 2DE9A 1ELAA 2PV9B 2Y81A 1VGCB 1ESAA 3RC4A 2QA9E 1IAUA 2OP9A 3RXLA 1BRUP 1ZHMA 1ELGA 4JK5A 1TBZH 4UFDH 3C27B 3SJIA 3TU7H 1EZSC 2BDBA 2ZQ2A 2LPRA 4BXWA 5LGOA 2DUCA 3A7XA 2HNTF 4ZXYH 4HI3A 1GJCB 1O3AA 1TAWA 4OS5A 1GCTC 3MO6A 3A85A 1BBRE 3VB5A 1O2WA 2SGQE 1S83A 1A46H 3MH5A 2R9PA 4MNYA 1EUFA 2CXVA 3A82A 5I46H 4YZUA 6CHAB 1F0TA 5K7RA 2O8UA 1BDAA 1F0SA 3A7TA 3QZQA 4MDSA 4Q7YA 3BTQE 4E06H 1ELBA 1B5GH 3LDXH 1QJ7B 2FMJA 2Y5FA 5C3NA 1WUNH 4I33A 2VWMA 3OTJE 4I31A 3SU6A 1BTXA 3MU0A 1K1OA 1V6DA 2FOCA 1GDNA 2GCHF 1SC8U 1J16A 1HNEE 1VJ9U 2WYGA 2OCVB 3PTNA 3PWCA 3AW0A 4HFPB 2QGRA 2BM2A 1NRPH 3DA9B 3BTHE 1ZR0A 1ARCA 1C2GA 3PM3A 3RXIA 3MU8A 3RXHA 3UTUH 5FCKA 1O3DA 2B9LA 2PR3A 2H9TH 4FUEA 3SW2B 5L2ZH 1PQAA 1XVMA 1P06A 4K2YA 1SPJA 1DDJA 4GSOA 1CGJE 1AE5A 3GY2A 2R0KA 1LCYA 1Y3YA 3PMHB 1EP6A 4MNVA 1O5EH 2BOKA 1NZQH 3UOPA 4X1QU 4ABEA 2GMTC 3ESTA 3LKWA 3AAVA 3P17H 2V3OH 1NU9A 1PPBH 1EJNA 1UVPA 1QQ4A 1GBIA 1TNKA 1C4V2 2BLOA 4X6OA 2C3SA 3PYHA 1Z1IA 1BA8B 1V2MT 2ZTXA 2GX4A 3OYPA 5HYOA 1C1VH 1LPKB 3QUMP 1W0YH 3OY6U 3A84A 3H7OA 2GV7A 1K1LA 1GGDC 5JB8S 4BANB 5T6GA 1KTSB 4BAMB 2Y80A 1AU8A 3SGQE 3S9AA 4MQAA 5E2OA 1D3PB 1N1LA 2ZWLH 4YT7H 2BDYA 3PO1C 1NFWA 2CV3A 3FAOA 4CRFA 1SQOA 4GHTA 1CT4E 3HPTB 2G8TA 5DP6A 1DSUA 4AX9H 4OS1A 1C5VA 2VU8E 3KQDA 4NZLA 4AG2A 1W0ZU 3MOCA 3RDZA 3TITA 1O3PB 1RTKA 1HRTH 4ZKRU 1C2HA 3TJNA 4XOJA 1RRKA 3D62A 3KGPA 2QXGA 2SGDE 3ZZ5A 1TPPA 1BBRK 1IQGA 2CHAC 3L3TA 5EW2H 1OWHA 2ZGHA 2FS8A 8GCHG 1SGYE 1NC6A 1HJ9A 1RD3B 5C1YA 3D23A 5FAHA 4FU7A 3BTTE 4FUJA 1UHBA 1V2RT 1UMAH 1VR1H 1NRSH 1LVYA 1ZLRA 3UNSA 5C1XA 1JWTA 1HYLA 1O3CA 4X2VA 3S7HB 5LPFA 3RXUA 4HGCA 1SQTA 3VGCC 3UR9A 1A3EH 3PLPA 1GHVH 1NRRH 2YNAA 1Q3XA 3KQCA 2PLXA 4X2XA 1KLIH 3FP7E 4FVDA 1GHWH 5T6DA 3GDUA 3Q3YA 3M3TA 1G30B 2FI3E 1WBGB 1NRQH 2UWLA 1CQQA 4IMQA 3PLBA 4ABHA 4NA9H 5IDKA 3KQEA 1IQHA 1C1SA 1MD8A 1ANBA 1Z1JA 2QCYA 2ZDVH 4KP0A 4TPYA 1Z8IB 3A7WA 2WPMS 2QY0B 4NZQA 1O5CB 1O39A 1PFXC 2J95A 2OQUA 1DSTA 4CRAA 1EAIA 2C8WB 4NGAH 1MKWH 2BD4A 4BNRA 4ZKNU 4Y8YA 4X6NA 1IQLA 1DVAH 2GZ8A 4NSVA 4Y7AA 3SNAA 1S5SA 3BEFB 3HK6B 3SJ8A 1O36A 4J1YA 1V2KT 4CRBA 4ZMAH 4AG1A 4AGKA 1GJ4H 1HJAB 2GCTB 3UIRA 2CN0H 1LVBA 1GWAA 2V6NA 1F0UA 1GMCG 4AGJA 4Y7BA 1K1IA 4B76A 1NPMA 3NCLA 1HAVB 2OQ5A 4WY3A 1DY9A 1YCPH 3ZVEA 1CA0B 2BHGA 1GBFA 2Y7XA 2G5VA 5C67A 2FS9A 2ZFFH 1ANEA 1TOMH 5HXFA 1SGFG 1JBUH 1JRTA 1MTNB 5FX6A 2VVUA 1EP5A 3BEUA 3BIVH 1HPGA 1DT2A 2OXSA 1FN8A 4UD9H 1E0FD 3TJUA 1PPFE 2RA3A 4XBBA 5F03A 1XXFA 2PSYA 1WCZA 4IN2A 4GCHF 4M7GA 5EXNA 4Y76A 1SI5H 1GG6C 1BBRH 2NU0E 1CBWC 1WAYB 1XX9A 1IQNA 2UUFB 1OWKA 1C2KA 1XUGA 2J9NA 4OGXA 1RIWC 5JBCS 1NFUA 1W3CA 1TLDA 1BT7A 2ZCHP 3TGIE 4UONA 2I6SA 1O2NA 1P11E 4YO9A 5A8YA 4H4FA 5G4BA 3BTDE 1KXDA 2GT7A 1NT1A 4MPVA 1FZZA 3B8JA 1BRBE 2FYQA 2A1DB 1WQSA 1BTHH 1YCPM 4B75A 3GISB 5GXPA 1TA6A 3DFJA 5F8XA 1KIGH 4FUHA 1W8BH 1O3BA 1ZPCA 1IOEA 1F0RA 1OP2A 2QF3A 2VVVA 3A80A 3P95A 1S6FA 3GICB 1Y3XA 1SGIB 1FMGA 1TX6A 3E3TA 3HK3B 4BAQB 2HWLB 5FXLA 4WJG2 1C5UA 1GGDB 3SU5A 1C1NA 1HAPH 4H6TA 1ZZZA 1KY9A 1FIWA 3STJA 1H8IH 2P8OB 1AVGH 2AEIH 4XFQA 1PPGE 1G2MA 2G81E 3SU0A 4MVNA 4ZROA 1OP0A 3NPSA 2FI5E 1Z8JB 4O3TA 1C9PA 3K2UA 1CGHA 1MUEB 4NWKA 1TGBA 3BTFE 1YGCH 4YOJA 2ZGCA 1O3LA 1AKSB 4O03A 2Y82A 3TGKE 3EQ0H 1ESTA 1GI9B 1HFDA 2JH5D 4NSYA 1ZSLA 1FAKH 1ANCA 4ISOA 3H5CB 4DVAU 5A8XA 1QBVH 2P95A 1O35A 4Z6AH 1EJAA 1MZAA 3ZV8A 1W2KH 2AFQB 1ZHPA 3A8AA 1QGFA 2A5AA 1IHTH 1MTUA 1V2TT 3A83A 2CHAB 1S82A 2QYIA 2SGEE 3LGTA 3RC6A 1BMAA 4X6PA 4WH6A 4NCYA 4K3JA 3SV2H 3MO9A 3RXVA 3TPIZ 3VXEH 2J4IA 1HAYB 2UUKB 4DIHH 1KSNA 2ZHEH 1TRMA 1T8LA 1C1OA 1O3HA 1CA0C 1V2VT 1TGTA 1UK4A 4Q80A 3RMNH 4H6SB 2Y5GA 1EQ9A 1ID5H 1D6RA 1PQ7A 1P03A 1BTZA 4RKOB 1A5GH 1YPHC 2BY8X 1MBQA 1ZGVA 5A0BA 3MWIU 2XBVA 4Y0YE 1NESE 4VGCC 1OWDA 1G3BA 5JBTA 1TA2A 1GJ9B 4D7FA 3QLPH 1JXPA 4ESTE 3UFAA 4CREA 2EEKA 3VB7A 1GJ8B 1LQEA 3A7VA 3F9FA 1DPOA 3GY8A 2A5KA 2BVXH 1EAUA 2WPKS 1C5QA 1SLVB 3URCA 1ANDA 3LPRA 1FJSA 2IPHA 2ZQ1A 3O8DA 1HJAC 2GCTC 2BXTH 3S69A 1ETTH 4LZ1H 1A2CH 1H8DH 1JRSA 1P12E 1D4PB 5B6OA 2UWPA 2VJ1A 4ABBA 5DP8A 4IS5A 5J4QA 3K9XB 4K60A 4KGAA 4DG4A 1DS2E 1V2WT 1D3DB 4VGCB 1O2OA 2ALVA 3GDSA 4GAWA 1BMLA 1WOFA 2ZTZA 1SB1H 3CP7A 3RXFA 1GL0E 3M7QA 4B2BA 1TYNA 2SGFE 1A5IA 1DANH 1UK3A 2FM2A 1AGJA 2J92A 1O2UA 1UHBB 1ESBA 3TJVA 3PLKA 3RMMH 3SNDA 2VIDA 4NA7A 5C5NA 1O2LA 3A8CA 3ZZBA 3DD2H 2A2XH 2UUJB 2ZGJA 2PFEA 3LH1A 4WMDA 3GY4A 4A6LA 5LPRA 4MNXA 3EE0B 3P70B 3FFGA 1BZXE 2AMPA 3OU0A 2IN2A 3MNSA 7GCHF 1P8VC 2OUAA 2ZFRH 2O9QA 2BQ7B 4ZHAA 3Q3XA 2P3FH 1YPHE 1O3NA 1P3EA 1O5DH 1SR5C 3BN9A 1AUTC 1UVUH 1GI1A 4Y10E 3MH7A 2VINA 2Y5HA 4I7YH 1ELCA 4Y79A 5HMAA 1TNGA 1PYTD 3IWMA 4JYTA 3EAJA 2ZU3A 2M5TA 2EI6A 1NU7B 1GJ5H 2GZ9A 1QBNA 1YPKH 1ZOMA 3EYDA 1H9HE 1V2JT 2BD5A 1ARBA 1DWEH 1C5YB 1FY3A 1QB9A 1T4UH 1EB1H 1WTHD 4B2AA 3OY5U 3DHKH 1P3CA 1FPCH 5EGMA 5AVDA 5TJXA 1ZJDA 2O8TA 4HTCH 3GCHC 3B9FH 4X1SU 4BOHA 4KTUA 1AZ8A 5E0GA 3QN7A 2W7SA 2ZO3H 2BQ6B 3M5LA 2F83A 4Q7XA 3T29A 2F9BH 1EJMA 4I8LA 5EQSA 1OOKB 5JPMH 1C5PA 3LGUA 2BDGA 1HV7A 2ANKH 1RXPA 3RXEA 5HM9A 3LT3A 1HUTH 2OINA 3VB4A 2HOBA 2ULLA 4RN6A 1DLEA 1W10U 1TFXA 1O2VA 4NIVA 1UCYE 3RXQA 1TX7A 3F9EA 2HRVA 3ZZ3A 1BCUH 4SGAE 2ZG0H 1ETSH 2ZC9H 3QGNB 1KLTA 2ZHDA 2Z3EA 1RIWB 3VB6A 2RG3A 7LPRA 3ATMA 3K6ZA 2B8OH 3AW1A 2ANWA 1Q2WA 3ITIA 4MPUA 1L4ZA 2OC1A 2UUYA 5GJ4B 3TGJE 4BAOB 2W26A 1GPZA 3GYMA 5DO4H 1O3KA 4K69A 1GMDG 4MG3A 4B2CA 2ESTE 2W7UA 3LONA 2ZA5A 3ZZ4A 1LTOA 3F9HA 4CH2B 3Q3KA 4JZFH 2P93A 3E0NB 1FONA 4NFEA 2A4GA 2H5DA 4U32A 3UOUA 3BTGE 1GL1A 4Y71A 2FXRA 3KCGH 1K9OE 2DE8A 4AFSA 4X2WA 1C2JA 1TRNA 4D8NA 2KAIB 3VFEA 1AI8H 2ZP0H 2YOLA 3PMBB 4DW2U 1NO9H 3GYLB 2FOMB 2BD9A 1C2MA 1OXGA 1O2RA 4CRDA 6ESTA 1DWDH 1AKSA 4U01A 1FI8A 2H9EH 1MZDA 1CU1A 2F9OA 1MTWA 1FQ3A 1MU8B 1UTPA 1XUKA 2C8YB 1XUFA 1SOTA 2BY6X 2H1UA 3NZIA 1BMNH 5HGGA 1ZHRA 1LQDB 4WWYA 1CA8B 2AH4X 3ZVAA 2A4QA 1LVOA 3LOXA 1EKBB 2TRMA 1CHOF 1ABIH 3F68H 1OSSA 1V2QT 2Z9LA 3K6YA 1O2YA 1O5BB 2VVCA 1P57B 2NU2E 1MQ6A 2D26C 1DOJA 3CENA 2ZGBH 1UTQA 2BVRH 1YC0A 2BB4A 3T62A 4ASHA 1CO7E 3LGWA 1PPEE 1TABE 4NWLA 2FP7B 2PKAA 2QXHA 3M7TA 2FOHA 2ZU1A 1J9CH 4AYYB 5F6MA 5A0CA 3S7KB 5JYIA 2RCEA 1PJPA 5L30H 3MHWU 4ISIH 1C5MD 1TX8A 1UTKA 1GBJA 2G55A 3FP6E 7KMEH 2QXJA 1P2QA 3BG4C 3SU3A 4MPWA 4JCNA 4ZUHA 1CBWB 2ZFSA 3TIUA 4DIIH 1K1NA 4Y0ZE 2ASUB 3MMGA 2QF0A 1SQAA 1ZTLA 3SN8A 4XBCA 4K1TA 1KXBA 3SNCA 2ZU2A 1DX5M 1QB1A 1C1TA 1YKTA 1SGRE 3JZ1B 1A5HA 1GJDB 1THRH 2ZF0H 4ISHH 3M3SA 1EAXA 1BJUA 3QX5H 2P8OC 2OBOA 1QR3E 1S85A 3RXJA 5E8EH 4A7IB 1LKAA 3W95A 4YLUA 2F3CE 2JETC 1D3TB 3MTYA 1HAGE 1LO6A 1ZRKA 1NN6A 4X1NU 1N8OC 4GHQA 3KN2A 3RXBA 1BMMH 5DP5A 4JZ1A 5T6FA 4AFUA 3CS7A 2TPIZ 1YP9A 1MTVA 2BDIA 2THFB 4K8YA 1ELEE 2FO9A 1C5NH 1TGCA 1Z8GA 4FXGH 2ZCKP 1P01A 1ZYOA 4ZKOU 4AOQA 2ZGXH 1F2SE 3ATWA 3A8DA 3S0NA 3Q76A 1T7CA 1O3EA 4H42U 1J17T 2ZHWH 1UTMA 1WTGH 1SMFE 4ZH8A 1S6HA 4FUBA 4IC6A 3ZZ9A 2AGEX 2VGCC 4JZIA 4FUDA 1QRXA 1TRYA 2VWOA 5BPEA 1C1PA 1BOQA 4THNH 1K21H 8ESTE 2ZIQH 1PYTC 2JETB 2ZFTA 4O97A 3A7YA 1AO5A 5K0HA 4PROA 1FY1A 5TCAA 1BHXF 3QTOH 1BQYA 2P16A 2P3TB 3PO1B 1O2ZA 1Z7KA 4R0IA 4CHAB 4I8KA 1S81A 3V12A 1TNLA 1C2IA 3A7ZA 1C5XB 1TQ7B 1P09A 1LHDH 3EDXB 5FBEA 1TMBH 3P8GA 5DPAA 4DURA 5AFZH 4X0WU 3ZVCA 1HAXB 3Q00A 2Z9GA 4ABFA 2XW9A 3TK6A 1C1UH 4E05H 2BY9X 1FN6A 2Z3CA 1UK2A 1FIZA 2FI4E 1W12U 3I77A 4ZXXH 2OC0A 3BTWE 2PKAB 1TBQH 2VIOA 1FAXA 5JDUB 1RGQA 4NIXA 2NU3E 3T2NA 2NU4E 2R2WU 9ESTA 2ZDAH 4INLA 5JB9S 3NK8A 5DG6A 2A31A 1DWCH 2ZDKA 1O3IA 1G3DA 2CMYA 1IHSH 2OTVA 5SGAE 3RXKA 3LC5A 3RXOA 1VJAU 4R8TB 3F1SB 1H9IE 1SVPA 4X8TH 6LPRA 1Y5AT 1AD8H 2B5TB 3RP2A 3M36A 2BLVA 1MD7A 2RDLA 1UCYH 1UVSH 4JK6A 2PHBA 1O5FH 2PTNA 1GBHA 3HGNA 3OSYA 2ANYA 3D65E 1MCVA 1LHGH 3TJOA 4ABAA 3QGJA 3ZZDA 1O34A 3NXPA 3V0XA 1LPGB 1O3OA 4IC5A 3MU5A 3A89A 3SI4H 2C4FH 4F4OC 4ABGA 4Z0KA 2BD7A 3SBKA 2NWNA 1TE0A 1HGTH 2Z9JA 1HLTH 1P2NA 1SOZA 2FOEA 2XC4A 2R0LA 2GZ7A 2SGPE 2FX4A 2ZPRA 5EU8A 3UUZA 2A4RA 1HXFH 3KHVA 1O3MA 1XUHA 1SGTA 2H2ZA 2O8WA 2GTBA 1PQ8A 2FWWA 1FXYA 1YLCA 3T25A 2AMDA 3E16B 3ZZCA 4FUCA 4JYVH 3T5FH 1MCTA 2FEQH 1VCQA 1K28D 2GDEH 1C2FA 1A3BH 1P9SA 4MLFB 2ODQA 1SFIA 2FLBH 4K5ZA 1CT2E 1QJ1B 2G4UA 5FPTA 1H9LB 4KELA 1AN1E 1B0EA 1E38B 1SGQE 5AHGH 3STIA 5LH8A 3QDZB 1T32A 4IMZA 3MU1A 2W3KA 1H1BA 1OWIA 1P02A 1Y3WA 1GMCF 2JH6D 2FTMA 1BRCE 1O2KA 4BTUB 4Q7ZA 2BOHB 1A7SA 5EOKA 1OPHB 2QC2A 1C5ZB 5EQRA 4DT7B 3U9AH 1ZMNA 1BTPA 1NFYA 1HCGA 1K1MA 2B7DH 1HJ8A 1UTJA 1A4WH 1SGDE 4OS7A 1GBDA 1Z6EA 3P8NA 1JOUB 1BTYA 4D9RA 3E1XB 2D1JA 3MNXA 2G52A 1SHHB 4F49A 3P8OA 4TY6A 1W11U 1AZZA 1B0FA 2WINI 1QFKH 1MQ5A 1YPMH 8LPRA 4JZDH 1GI7B 3IITA 5AF9H 2FYRA 5CMXH 2ZPSA 1JIMA 2Y7ZA 4X1RU 2HVXA 4KTCA 4OS2A 1CT0E 1FV9A 1PPZA 4IBLH 2V35A 3FZDA 1QL9A 3SHCH 1K2I1 1IQJA 1P10A 3FZZA 1G37A 1C4Y2 1BB0B 1GI0A 1F7ZA 3M7UA 1AHTH 4CR9A 1V2NT 2VWLA 4ABJA 2XCFA 1UCYK 2GVFA 3SOSA 1GBEA 3PROA 3UNQA 1AMHA 1QJ6B 2Q6FA 3RMOH 2OLGA 2BZ6H 1CHGA 3O8CA 3T28A 2PUXB 2Z94A 2AERH 3QTVH 5GCHF 2QIQA 3E8LA 4WXIA 4KKDA 3RC5A 5BRRE 1DY8A 4AN7A 2I6QA 4GCHG 2WYJA 2A7JA 2XRCA 3SU4A 1AY6H 3TK9A 1SGCA 4I32A 1O38A 1SGFA 1GI8B 4ABIA 1DUAA 2ZCLP 1V2OT 5DP9A 2XXLA 3GCTG 3KIDU 4CBNA 1C5LH 1XXDA 2BQWB 3UREA 2AS9A 2G4TA 1NTPA 3SU2A 1NY22 2FOFA 3HGPA 1GVKB 3HKJB 3V7TA 2PWXA 2A5IA 4ZKSU 1OYQA 3SUGA 2SNVA 3LJJA 2CF9H 3HKIB 4QT8C 4WMEA 4LXBH 1OP8A 1W7XH 2STAE 3RMLH 5ETXA 2WPJS 1C1QA 1UVTH 3DUXH 2P59A 3QZRA 4CRCA 4WH8A 1OYTH 3M5OA 3TH4H 1RTFB 1C5SA 1MAXA 4LK4A 1RJXB 1WQVH 4JYUH 3DFLA 2ZTYA 1O30A 3RXTA 2GT8A 5A0AE 4UFGH 2BD8A 2EA3A 4GVUA 1EPTA 1MTSA 1LMWB 2BD3A 3KEEA 1CGIE 3UQOA 2P94A 1GHBG 1XM1A 2O8LA 4XBDA 2XBWA 2W3IA 2GD4B 3H7TA 2FODA 4WVPE 2G5NA 2FESH 2ZFQH 1YF4A 4FUFA 1TPAE 4TPIZ 2VB0A 3U8TH 3GCNA 4FU8A 3A8BA 5EXMA 1GHAF 1THSH 3NUMA 1SGPE 5I25A 1MAYA 4TWWA 2A0QB 1C5RA 2BMGB 1HXEH 3T26A 3U8RH 2P3UB 3MYWA 2WUCA 4AORA 1KXFA 1O33A 4FVBA 2LNCA 1T31A 3ATIA 4ISLA 1KXAA 1LHFH 3U1IB 5EG4A 3I29A 3UWIA 1M9UA 1XKBC 2PSXA 1P2OA 4NA8A 3AVZA 3SV8A 1AVXA 3BG8A 3EGKH 1HAOH 5FPYA 1BHXB 2HALA 3PWBA 1EX3A 2SFAA 5DKMA 4X2YA 3TLOA 3LIWA 1CHOG 3SGAE 1MBMA 4FUGA 5FHTA 3E90B 4O3UA 2BDAA 5EPYA 1HAVA 1Y5UT 4B71A 1FY5A 4B1TA 3T27A 1P9UA 1QA7A 2KAIA 4WXVA 1PQ5A 3UR6A 4CRGA 2BX4A 1HDTH 1AUJA 1Z71A 2G00A 4U30A 3PB1E 1O32A 4X6MA 2G51A 3F9GA 2BYAX 4B73A 4DGJA 3ZV9A 3P8FA 5GIBA 1ZTKA 3MFJA 1EXFA 2Y6TA 1UTOA 1O5AB 3BG4B 1DITH 3PMJA 3EA9A 1TBRH 4I8HA 5C1UA 1F5RA 3AASA 1DUEA 3TH3H 2PKSB 3SHAH 1GDQA 1MKWK 4I8JA 3TK5A 1WV7H 1O37A 3M61U 4K8BA 1SLXB 5E0JA 2Z7FE 1ZMJA 3M37A 1SLWB 1IQKA 2BLWA 4DY7B 4D76A 1O2TA 1Q31A 3A81A 1CVWH 1ZSJA 2J94A 1V2ST 4BXSA 3EA7A 8KME2 2F9NA 1GBMA 1EZUC 2WPLS 4OS4A 4AFQA 1T8NA 1IQFA 4XSKU 5ABWA 1O2GH 4LZ4B 1J8AA 1GBBA 1S84A 1ZSKA 2CGAA 1ACBE 3GCOA 1YPGH 1WU1A 2ODPA 1KDQA 3LJOA 1AIXH 3MH6A 3QO6A 3V3MA 4D7GA 3RXDA 2AMQA 2ZI2H 1S0RA 3GCHB 3SQHE 2FX6A 1AFQC 4B74A 2BX3A 3SUFA 1GCDA 1O5GH 3O8BA 4FU9A 1IQIA 3IG6B 5EQQA 1DFPA 1AVWA 3ELAH 4E7RG 2V0BA 3BF6H 1TGSZ 4UE7H 3WY8A 4UFEH 3RXRA 1JIRA 1NS3A 1UTNA 2BXUH 1O2XA 1TMUH 3GY3A 2ZEBA 4DOQA 1QCPA 2TBSA 3PTBA 4BTIB 1RFNA 1EASA 4HZHA 4WMFA 3RU4D 5ESTE 2F91A 2PTCE 1O31A 1SFQB 3RM2H 2GKVE 3R0FA 2A32A 3SJKA 2STBE 1VITF 5TCCA 2WPHS 2Q6DA 1E34B 1QQUA 3K65B 3MNCA 5JBAS 5HM2A 2BY5X 5A8ZA 1V2PT 1J15A 3MI4A 1HAHH 4IGDA 2Z6BD 1GJ7B 2C90B 1G2LA 3DT0H 4A1VA 2V3HH 5GPIB 4TY7A 3UPEA 1DXPA 3ZZ6A 1UVOA 5EODA 2VNTA 1GBAA 1L1JA 3MU4A 4Y8XA 2BDHA 1LKBA 3E6PH 1KDQB 3ZVFA 5GWZA 1IQMA 3RXCA 1FPHH 5CHAC 3GY6A 2GV6A 1P2KA 3UNRA 4CBOA 3E0PB 3BV9B 1KYNA 3L33A 2VH0A 1PPCE 1SG8B 4NFFA 3LGVA 1OWJA 3VEQB 2BD2A 1XMNB 1ZJKA 1LVMA 4CR5A 1TOCB 3A88A 5DJ7A 4YOGA 5FX5A 1RS0A 3SO3A 5IYTA 1J14A 4Y8ZA 2WPIS 1ZGIA 4J2YB 2VIVA 1VZQH 1V3XA 4UFFH 4A1TA 2SNWA 1A0LA 3OX7U 2GGVB 3ATLA 2AGGX 1P05A 3S9CA 1BTWA 2BTCE 3BTME 3M35A 2JKHA 1DWBH 3RXGA 2RA0A 2W5EA 1RTLA 3L6PA 1LPZB 1FY4A 3TVJB 2Q1JA 1G3CA 1X7AC 1O0DH 2TGAA 3SZNA 1G9IE 1C1RA 1C1WH 3BTKE 3LGIA 3ODFA 3MH4A 1Y59T 2FIRH 2B0FA 5CHAB 1EPTB 2UWOA 2ILNA 1C5WB 1U6QA 3RU4T 3ENSB 2VIWA 3HATH 4ZHMU 1HIAA 3ZYDA 1YPJH 2QV1A 2GMTB 4A5TS 1GI3A 1S0QA 2PUQH 5DP3A 1LDTT 3W94A 2ZZUH 1OS8A 1VCWA 1EPTC 4DJZB 3VGCB 1GBKA 1ELVA 3SV9A 3U98H 1T8OA 4ZHLU 1YM0A 3BSQA 2OBQA 1D3QB 2FOBA 3KL6A 4BAKB 3ZVDA 9LPRA 1ORFA 1EATA 2NU1E 3U1JB 1FLEE 4MTBA 1H4WA 2FZZA 3GY5A 1NFXA 4YTAA 1D6WA 2ZECA 2IJOB 6CHAC 3ZVGA 3O8RA 4YLQH 4OS6A 4INHA 1B7XB 1ELFA 1O2JA 2XTTB 3SUEA 2PKSC 2F9VA 2EI8A 1C2LA 3ZZ7A 2EI7A 1YLDA 4X8VH 3S9BA 5E2PA 1GHZA 1O3GA 3LGYA 3P6ZB 1TQ0B 2C93B 3F6UH 3SI3H 7GCHG 1GMHF 1SGNE 1HAIH 1QURH 2D8WA 1FDPA 1TIOA 3BTEE 4IN1A 2HPQH 3RM0H 3SU1A 1C1MA 5H4IB 1ZMLA 4BTTB 4X8UH 1P2JA 5C5OA 1TB6H 1W14U 3LU9B 1ZPBA 3G01A 5LPEA 3Q77A 3KNXA 2QAAA 3TH2H 4E7NA 4XDEA 1SL3A 1G3EA 1GI4A 1NM6A 5FBIA 2XWBI 2R3YA 1VCPA 3EA8A 3GOVB 4INKA 2BDCA 3RLWH 1E37B 1AQ7A 2ANMH 4LOYH 1BIOA 2VGCB 4Q2KA 5A2MH 1CE5A 5CE1A 1GVLA 3SORA 1BUIA 1GI5A 1C2EA 1VGCC 2J34A 1ZTJA 2GDDA 4AYVB 5AFYH 5C20A 2FTLE 2HPPH 2OC8A 2R2MB 1MKXK 3SNBA 1N6XA 3RXMA 4WF8A 3UWJH 1BJVA 1O2MA 1G36A 2C8ZB 3KF2A 1CSOE 4X8SH 3NWUA 4NIYA 4AZ2B 4ABDA 2FLRH 4Y6DA 1XVOA 2ZU4A 1AB9C 1KLJH 1QB6A 1HAZB 1SSXA 2A45B 4ISNA 4NIWA 7ESTE 3ZYEA 5GDSH 2Z9KA 1SLUB 1LHCH 2TGTA 3SNEA 1AWHB 3M3VA 2F9UA 2BVSH 1E35B 5ESBA 3URDA 3SV6A 1KTTB 1QY6A 2J2UA 4YOIA 1TGNA 3U69H 1TPSA 1BITA 3B23B 1GBLA 1YPEH 4A92A 1MH0A 2D2DA 1ZPZA 1BRAA 5EXLA 5J4SA 1Y3VA 2H6MA 2A2QH 2A7HA 1O3JA 5JBBS 1DM4B 4UEHH 5EPNA 1F92A 1K1PA 5DP7A 2JH0D 2XNIA 3QWCH 2TGDA 4AFZA 2XWAA
chains in the Genus database with same CATH superfamily
1DLKB 1PPHE 2PGBB 2ZDLA 1NRNH 2F9PA 2ZHQH 3PV4A 1WYKA 2YNBA 3VXFH 2FDAA 4RSPA 1GBCA 1TWXB 1WSSH 3A86A 1TONA 1L1GA 1SHYA 1W13U 3ATKA 2FOGA 1GI2A 1MU6B 4K1SA 4TYDA 6GCHG 3GS9A 2BLQA 2ZDMA 3M5MA 5FCRA 3D49H 1MTNC 1EZQA 1FUJA 4X1PU 1Y5BT 2QXIA 3R3GB 2Z9IA 1O2HA 1BTUA 1C4U2 1A1RA 1C5OH 1TPOA 2GP9B 4K1EA 4IW4E 4A1XA 1GCTB 5F8TA 2ZNKH 1L2EA 1GBTA 2VWNA 3SUDA 2J38A 3M5NA 4GPGA 6GCHF 1A61H 1QBOA 1A0JA 2WV5A 1HB0B 1LHEH 1C2DA 5C2ZA 1HBTH 3JZ2B 3KYGA 1GG6B 1C5TA 2K1QA 3SGBE 1V2UT 1GHAG 2O8MA 2OD3B 4O9VA 2PGQB 1FY8E 1GJ6A 2L74A 2J98A 1EOJA 2ZPQA 2GCHG 2CJIA 1QL8A 1OKXA 2VIQA 1GMDF 1P04A 4XRNA 3RXAA 1NROH 1MMJN 4UDWH 3GY7A 1EB2A 3FP8E 2IOTA 1ETRH 1TNIA 3QK1A 5DSFA 4AB9A 2KFWA 1MKXH 1HIAB 4D9QA 3PV5A 1ZRBA 1FNIA 2YMSC 5L2YH 2AHME 3I78A 1TNJA 1VITH 1N6YA 4GLYA 3BIUH 4YM9A 2AIPA 2C8XB 2ZKSA 1EAWA 1YBWA 2OC7A 2R3UA 3ZZ8A 2Z3DA 4GUXA 1SBWA 1T8MA 1XUJA 3PMAB 3ODDA 3FVFB 1ELDE 1QA0A 2FOAA 2ODYB 1DICA 4BAHB 3V13A 4AB8A 1N8OB 3P92A 1KXCA 2HNTE 1L1NA 1QL7A 3SJOA 2HLCA 1JMOH 3LC3A 2BY7X 3W1EA 2CF8H 1AE8H 3UQVA 1A0HB 3BEIB 3C1KA 3SJ9A 1AB9B 1G32B 2VH6A 3ZZAA 3FANA 3GCTF 3SV7A 3TNSA 1XKAC 5C17A 1QNJA 1V2LT 4DCDA 1P2MA 1DXWA 4CHAC 2XYAA 5EW1H 1O2PA 2AYWA 5FPSA 5DK1A 2VIPA 8GCHF 2OK5A 5DGJA 1QTFA 1ELTA 3LH3A 3MO3A 2AGIX 1OX1A 2H5CA 2XCNA 2WV4A 1INCA 1F5KU 1Z8RA 1O2SA 3ZVBA 1YYY1 2ZHFH 1GI6A 4CH8B 1QRWA 4U2WA 3KQBA 4FUIA 2A4OA 1ABJH 5PTPA 4OGYA 1UJ1A 2XBYA 1GJBB 2ALPA 4SGBE 1DE7H 1D9IA 1EZXC 1TALA 3RXSA 4I8GA 1GHXH 4XE4A 2GJGA 5DP4A 4YXWD 3A87A 1GJAB 1QIXB 3OE7D 3VB3A 1GMHG 1OWEA 5GCHG 2BZAA 1UO6A 3RLYH 3RXPA 1L4DA 1AFQB 1SGEE 3SZEA 1E36B 1Y8TA 4YESB 2HLDD 2SGAA 3GDVA 1KXEA 1F5LA 1VITG 1Z6JH 2WUBA 2FPZA 1QRZA 4RKJB 3RUOA 1Y3UA 2Q6GA 4MPXA 2ZDNA 1TNHA 3VPKA 1THPB 1O2QA 1EOLA 1W7GH 1K1JA 1AFEH 2AIQA 1TMTH 2WV9A 1O3FA 5A09A 1C9TA 1GVZA 1L0ZA 1K22H 1YPLH 3UY9A 2A7CA 2XBXA 2XC0A 5L6NH 3U8OH 4MNWA 5B6LA 1GHBF 1P2IA 3N7OA 4Y11E 2PW8H 4JZEH 5E0HA 4JMYA 4ZAEA 3E91A 5T3HA 1GHYH 2HNTC 1YCPK 2EC9H 3CS0A 2TIOA 2TGPZ 4YT6H 2H9HA 4B6FA 1T4VH 3MNBA 2XC5A 5F8ZA 4NG9H 2HGTH 3SQEE 1XUIA 2ZFPH 3NKKA 4TWYA 2ZU5A 1QHRB 1AWFH 1GDUA 1IQEA 3TNTA 3AAUA 3RU4E 1P0SH 4KTSA 1UTLM 1O2IA 2QN5T 2DE9A 1ELAA 2PV9B 2Y81A 1VGCB 1ESAA 3RC4A 2QA9E 2CK3D 1IAUA 2OP9A 3RXLA 1BRUP 1ZHMA 1ELGA 4JK5A 1TBZH 4UFDH 3C27B 2EQNA 3SJIA 3TU7H 1EZSC 2BDBA 2ZQ2A 2LPRA 4BXWA 5LGOA 2DUCA 3A7XA 2HNTF 2PP6A 4ZXYH 4HI3A 1GJCB 1O3AA 1TAWA 4OS5A 1GCTC 3MO6A 3A85A 1BBRE 3VB5A 1O2WA 2SGQE 1S83A 1A46H 3MH5A 2R9PA 4MNYA 1EUFA 2CXVA 3A82A 5I46H 3OEHD 4YZUA 2J5UA 6CHAB 1F0TA 5K7RA 2O8UA 1BDAA 4Q63A 1F0SA 3A7TA 3QZQA 4MDSA 4Q7YA 3BTQE 4E06H 1ELBA 5FL7D 5C94A 1B5GH 3LDXH 1QJ7B 2FMJA 2Y5FA 5C3NA 1WUNH 4I33A 2VWMA 3OTJE 4I31A 3SU6A 1BTXA 3MU0A 1K1OA 1V6DA 2FOCA 1GDNA 2GCHF 1SC8U 1J16A 1HNEE 1VJ9U 2WYGA 2OCVB 3PTNA 3PWCA 3AW0A 4HFPB 2QGRA 2BM2A 1NRPH 3DA9B 3BTHE 1ZR0A 1ARCA 1C2GA 3FN8A 3PM3A 1OHHD 3RXIA 3MU8A 3RXHA 3UTUH 5FCKA 1O3DA 2B9LA 2PR3A 2H9TH 4FUEA 3SW2B 1K0HA 5L2ZH 1PQAA 1XVMA 1P06A 4K2YA 1SPJA 1DDJA 4GSOA 1CGJE 1AE5A 3GY2A 2R0KA 1LCYA 1Y3YA 3PMHB 1EP6A 4MNVA 1O5EH 2BOKA 1NZQH 3UOPA 4X1QU 4ABEA 2GMTC 3ESTA 3LKWA 3AAVA 3P17H 3DSPA 2YMSD 2V3OH 2F43B 1NU9A 1PPBH 1EJNA 1UVPA 1QQ4A 1GBIA 1TNKA 1C4V2 2BLOA 4X6OA 2C3SA 3PYHA 5HKKD 1Z1IA 1BA8B 5EJ1A 1V2MT 1FX0B 2ZTXA 2GX4A 3OYPA 5HYOA 1C1VH 1LPKB 4Q4LA 3QUMP 1W0YH 3OY6U 3A84A 3H7OA 2GV7A 1K1LA 1GGDC 5JB8S 4BANB 5T6GA 1KTSB 4BAMB 2Y80A 1AU8A 3KQ5A 3SGQE 3S9AA 4MQAA 5E2OA 1D3PB 1N1LA 2L6OA 2ZWLH 4YT7H 2BDYA 3PO1C 1NFWA 2CV3A 3FAOA 4CRFA 1SQOA 4GHTA 4DT4A 1CT4E 3HPTB 2G8TA 5DP6A 5T1VA 1DSUA 4AX9H 4OS1A 1C5VA 2VU8E 3KQDA 4NZLA 4AG2A 1W0ZU 3MOCA 3RDZA 3TITA 1O3PB 1RTKA 1HRTH 4ZKRU 1C2HA 3TJNA 4XOJA 1RRKA 3D62A 3KGPA 2QXGA 2SGDE 3ZZ5A 1TPPA 1BBRK 1IQGA 2CHAC 3L3TA 2J97A 3EE7A 5EW2H 1OWHA 2ZGHA 2KZ4A 2FS8A 8GCHG 1SGYE 1NC6A 1HJ9A 1RD3B 5C1YA 3D23A 5FAHA 4FU7A 3BTTE 4FUJA 1UHBA 1V2RT 1UMAH 1VR1H 3PV2A 1NRSH 1LVYA 1ZLRA 3UNSA 5C1XA 1W0KD 1JWTA 1HYLA 1O3CA 4X2VA 3S7HB 5LPFA 3RXUA 4HGCA 1SQTA 3PRBA 3UR9A 1A3EH 3VGCC 3PLPA 1GHVH 1NRRH 2YNAA 1COWD 1Q3XA 3KQCA 2PLXA 4X2XA 1KLIH 2V7QD 3FP7E 4FVDA 1GHWH 5T6DA 3GDUA 3Q3YA 3M3TA 1G30B 2FI3E 1WBGB 1NRQH 2UWLA 1CQQA 4IMQA 3PLBA 4ABHA 4NA9H 5IDKA 3KQEA 1IQHA 1C1SA 1MD8A 1ANBA 1Z1JA 2QCYA 2ZDVH 4KP0A 4TPYA 1Z8IB 3A7WA 2QY0B 2WPMS 4NZQA 1O5CB 1O39A 1PFXC 2J95A 2OQUA 1DSTA 4CRAA 1EAIA 2C8WB 4NGAH 1MKWH 2BD4A 4BNRA 4ZKNU 4Y8YA 4X6NA 1IQLA 1DVAH 2GZ8A 2WSSD 4NSVA 1E79D 4Y7AA 3SNAA 1S5SA 3BEFB 3HK6B 3SJ8A 1O36A 4J1YA 1V2KT 4CRBA 2KCPA 4ZMAH 4AG1A 4AGKA 1GJ4H 1HJAB 2GCTB 3UIRA 2CN0H 1LVBA 1GWAA 2V6NA 1F0UA 1GMCG 3N99A 4AGJA 4Y7BA 1K1IA 4B76A 1S6LA 1NPMA 3NCLA 1HAVB 2OQ5A 4WY3A 2RFKC 1DY9A 1YCPH 1QZ8A 3ZVEA 1CA0B 2BHGA 1GBFA 2Y7XA 2G5VA 5C67A 2FS9A 2ZFFH 1ANEA 1TOMH 5HXFA 1SGFG 1JBUH 1JRTA 1MTNB 5FX6A 2VVUA 1EP5A 3BEUA 3BIVH 1HPGA 1DT2A 2OXSA 1FN8A 4UD9H 1E0FD 3TJUA 1PPFE 3OTPA 2RA3A 4XBBA 5F03A 1XXFA 2PSYA 1WCZA 4IN2A 4GCHF 4M7GA 5EXNA 4Y76A 1SI5H 1GG6C 1BBRH 2NU0E 1CBWC 1WAYB 1XX9A 1IQNA 2UUFB 2HVYB 1OWKA 1C2KA 1XUGA 2J9NA 4OGXA 1RIWC 5JBCS 1NFUA 1W3CA 1TLDA 1BT7A 2ZCHP 3TGIE 4UONA 2I6SA 1O2NA 1P11E 4YO9A 5A8YA 4H4FA 5G4BA 3BTDE 1KXDA 2GT7A 1NT1A 4MPVA 1FZZA 3B8JA 1BRBE 3ZIAD 2FYQA 4RI0A 2A1DB 1WQSA 1BTHH 1YCPM 4B75A 3GISB 5GXPA 1TA6A 3DFJA 5F8XA 1KIGH 4FUHA 1W8BH 1O3BA 1ZPCA 1IOEA 1F0RA 1OP2A 2QF3A 2VVVA 3A80A 3N7EA 3P95A 1S6FA 2KX4A 3GICB 1Y3XA 1SGIB 1FMGA 1TX6A 3E3TA 3HK3B 4BAQB 2HWLB 5FXLA 4WJG2 1C5UA 1GGDB 3SU5A 1C1NA 3F2GA 1HAPH 4H6TA 4AC9A 1ZZZA 1KY9A 1FIWA 3STJA 1H8IH 2P8OB 1AVGH 2AEIH 2JDID 4XFQA 1PPGE 1G2MA 2G81E 3SU0A 4MVNA 4ZROA 1OP0A 3NPSA 2FI5E 1Z8JB 4O3TA 1C9PA 3K2UA 1CGHA 1MUEB 4NWKA 1TGBA 3BTFE 2XOKD 1YGCH 4YOJA 2ZGCA 4HG6A 1O3LA 1AKSB 4O03A 2Y82A 3TGKE 3EQ0H 1ESTA 1GI9B 1HFDA 2JH5D 4NSYA 1ZSLA 1FAKH 1ANCA 4ISOA 3H5CB 4DVAU 5A8XA 2K8IA 1QBVH 2P95A 1O35A 4Z6AH 1EJAA 1MZAA 3ZV8A 1W2KH 2AFQB 1ZHPA 3H09A 3A8AA 1QGFA 2A5AA 1IHTH 1MTUA 2QF4A 1V2TT 3A83A 2CHAB 1S82A 2QYIA 2SGEE 3LGTA 3RC6A 1BMAA 4X6PA 4WH6A 4NCYA 4K3JA 3SV2H 3MO9A 3RXVA 3TPIZ 3VXEH 2J4IA 1HAYB 2UUKB 4DIHH 1KSNA 2ZHEH 1TRMA 1T8LA 1C1OA 1O3HA 1CA0C 1V2VT 1TGTA 1UK4A 4Q80A 3RMNH 5C0TA 4H6SB 2Y5GA 1EQ9A 1ID5H 1D6RA 1PQ7A 1P03A 1BTZA 4RKOB 1A5GH 1YPHC 2BY8X 1MBQA 1ZGVA 5A0BA 3MWIU 2XBVA 4Y0YE 1NESE 4VGCC 1OWDA 1G3BA 5JBTA 1TA2A 1GJ9B 4D7FA 3QLPH 1JXPA 4ESTE 3UFAA 4CREA 2EEKA 3VB7A 1GJ8B 1LQEA 3A7VA 3WW7A 3F9FA 5HIYA 1DPOA 3GY8A 2A5KA 2BVXH 1EAUA 2WPKS 1C5QA 1SLVB 3URCA 1ANDA 3LPRA 1FJSA 2IPHA 2ZQ1A 3O8DA 1HJAC 2GCTC 2BXTH 3S69A 1ETTH 4LZ1H 1A2CH 1H8DH 1JRSA 1P12E 1D4PB 5B6OA 2UWPA 2VJ1A 4RT1A 4ABBA 5DP8A 4IS5A 5J4QA 3K9XB 4K60A 4KGAA 4DG4A 1DS2E 1V2WT 1D3DB 4VGCB 1O2OA 2ALVA 3GDSA 4GAWA 1BMLA 1WOFA 2ZTZA 1SB1H 3CP7A 3RXFA 1GL0E 3M7QA 4B2BA 1TYNA 2SGFE 1A5IA 1DANH 1UK3A 2FM2A 1AGJA 2J92A 1O2UA 1UHBB 1ESBA 3TJVA 3PLKA 3RMMH 3SNDA 2VIDA 4NA7A 5C5NA 1O2LA 3A8CA 3ZZBA 3DD2H 2A2XH 2UUJB 2ZGJA 2PFEA 3LH1A 4RT0A 4WMDA 3GY4A 4A6LA 5LPRA 4MNXA 3EE0B 3P70B 3FFGA 1BZXE 2AMPA 3OU0A 2IN2A 3MNSA 7GCHF 1P8VC 2OUAA 2ZFRH 2O9QA 2BQ7B 4ZHAA 3Q3XA 2P3FH 1YPHE 1O3NA 1P3EA 1O5DH 1SR5C 3BN9A 1AUTC 1UVUH 1GI1A 4Y10E 3MH7A 2VINA 2Y5HA 4I7YH 1ELCA 4Y79A 5HMAA 1TNGA 1PYTD 3IWMA 4JYTA 3EAJA 1YLNA 2ZU3A 2M2AA 2M5TA 2EI6A 1NU7B 3F2FA 1GJ5H 2GZ9A 1QBNA 1YPKH 5HIZA 1ZOMA 2JJ1D 3EYDA 1H9HE 1V2JT 2BD5A 1ARBA 1DWEH 1C5YB 1FY3A 1QB9A 1T4UH 1EB1H 1WTHD 2JJ2D 2KCYA 3OY5U 4B2AA 3DHKH 1P3CA 1FPCH 5EGMA 5AVDA 5TJXA 1ZJDA 2O8TA 4HTCH 3GCHC 4P02A 3B9FH 4X1SU 1WXRA 4BOHA 4KTUA 1AZ8A 5E0GA 3QN7A 2W7SA 2ZO3H 2BQ6B 3M5LA 2F83A 4Q7XA 3T29A 2F9BH 1EJMA 4I8LA 5EQSA 1OOKB 5JPMH 1C5PA 3LGUA 2BDGA 1HV7A 2ANKH 2V3MA 1RXPA 3RXEA 5HM9A 1NBMD 3LT3A 1HUTH 2OINA 3VB4A 2HOBA 2ULLA 4RN6A 1DLEA 1W10U 1TFXA 1O2VA 4NIVA 1UCYE 3RXQA 1TX7A 2KM0A 3F9EA 2HRVA 3ZZ3A 1BCUH 4SGAE 2ZG0H 1ETSH 2ZC9H 3QGNB 1KLTA 2ZHDA 4I86A 2Z3EA 1RIWB 3VB6A 2RG3A 7LPRA 3ATMA 3K6ZA 2B8OH 3AW1A 2ANWA 1Q2WA 3ITIA 4MPUA 1L4ZA 2OC1A 2UUYA 5GJ4B 3TGJE 4BAOB 2W26A 1GPZA 3GYMA 5DO4H 1O3KA 4K69A 1GMDG 4MG3A 4B2CA 2ESTE 2W7UA 3LONA 2ZA5A 3ZZ4A 1LTOA 3F9HA 4CH2B 3Q3KA 4JZFH 2P93A 3E0NB 1FONA 4NFEA 2A4GA 2H5DA 4U32A 3UOUA 3BTGE 1GL1A 4Y71A 2FXRA 3KCGH 1K9OE 2DE8A 4AFSA 4X2WA 1C2JA 1TRNA 4D8NA 2KAIB 3VFEA 1AI8H 1YWUA 2ZP0H 2YOLA 3PMBB 4DW2U 1NO9H 3GYLB 2FOMB 2BD9A 1C2MA 1OXGA 1O2RA 4CRDA 6ESTA 1DWDH 1AKSA 4U01A 1FI8A 2H9EH 1MZDA 1CU1A 2F9OA 1MTWA 1FQ3A 1MU8B 1UTPA 1XUKA 2C8YB 1XUFA 1SOTA 2BY6X 2H1UA 3NZIA 4OM9A 1BMNH 5HGGA 1ZHRA 1LQDB 4WWYA 1CA8B 2AH4X 1BMFD 3ZVAA 2A4QA 1LVOA 3LOXA 1EKBB 4XD7D 2TRMA 1CHOF 1ABIH 3F68H 1OSSA 1V2QT 2Z9LA 3K6YA 1O2YA 1O5BB 2VVCA 1P57B 2NU2E 1MQ6A 2D26C 1DOJA 3CENA 2ZGBH 1UTQA 2BVRH 1YC0A 2BB4A 3T62A 4ASHA 1E1QD 1CO7E 3LGWA 1PPEE 1TABE 4NWLA 2FP7B 2PKAA 2QXHA 3M7TA 3MQKC 2LP6A 2FOHA 2ZU1A 1J9CH 4AYYB 5F6MA 3SYJA 5A0CA 3S7KB 5JYIA 2RCEA 1PJPA 5L30H 3MHWU 4ISIH 1C5MD 1TX8A 1UTKA 3NRLA 1GBJA 2G55A 3FP6E 7KMEH 2QXJA 1P2QA 3BG4C 3SU3A 4MPWA 4JCNA 4ZUHA 1CBWB 2ZFSA 3TIUA 4DIIH 1K1NA 4Y0ZE 2ASUB 3MMGA 2QF0A 1SQAA 1ZTLA 3SN8A 4XBCA 4K1TA 1KXBA 3SNCA 2ZU2A 1DX5M 1QB1A 1C1TA 5EJLA 1YKTA 1SGRE 3JZ1B 1A5HA 4F55A 1GJDB 1THRH 2ZF0H 4ISHH 3M3SA 1EAXA 1BJUA 3QX5H 2P8OC 2OBOA 1QR3E 1S85A 3RXJA 5E8EH 4A7IB 1LKAA 4ACBA 3W95A 4YLUA 2F3CE 2JETC 1D3TB 3MTYA 1HAGE 1LO6A 1ZRKA 1NN6A 4X1NU 1N8OC 4GHQA 3KN2A 3RXBA 1BMMH 5DP5A 4JZ1A 5T6FA 4AFUA 3CS7A 2TPIZ 1YP9A 1MTVA 2BDIA 2THFB 4K8YA 1ELEE 2FO9A 1C5NH 1TGCA 1Z8GA 4FXGH 2ZCKP 1P01A 1ZYOA 4ZKOU 4AOQA 1UW7A 2ZGXH 1F2SE 3ATWA 3A8DA 3S0NA 3Q76A 1T7CA 1O3EA 4H42U 1J17T 2ZHWH 1UTMA 1WTGH 1SMFE 4ZH8A 5GNDA 1S6HA 4FUBA 1EFRD 4IC6A 3ZZ9A 2AGEX 2VGCC 4JZIA 4FUDA 1QRXA 1TRYA 2VWOA 5BPEA 1C1PA 1BOQA 5KGOA 4THNH 1K21H 8ESTE 2ZIQH 1PYTC 2JETB 2ZFTA 4O97A 3A7YA 1AO5A 5K0HA 4PROA 1FY1A 5TCAA 1BHXF 3QTOH 1VKYA 1BQYA 2KCAA 2P16A 1WDIA 2P3TB 3PO1B 1O2ZA 1Z7KA 4R0IA 4CHAB 2IJD1 4I8KA 4ASUD 1S81A 3V12A 1TNLA 3WWBA 1C2IA 3A7ZA 1C5XB 1TQ7B 1P09A 1LHDH 3EDXB 5FBEA 1TMBH 3P8GA 5DPAA 4DURA 5AFZH 4X0WU 3ZVCA 1HAXB 3Q00A 2Z9GA 1YY3A 4ABFA 2XW9A 3TK6A 5F53A 1C1UH 4E05H 2BY9X 1FN6A 3DCLA 2Z3CA 1UK2A 1FIZA 2FI4E 1W12U 3I77A 4ZXXH 2OC0A 3BTWE 2PKAB 1TBQH 2VIOA 1FAXA 5JDUB 1RGQA 4NIXA 2NU3E 3T2NA 2NU4E 2R2WU 9ESTA 2ZDAH 4INLA 5JB9S 3NK8A 5DG6A 2A31A 1DWCH 2ZDKA 1O3IA 1G3DA 2CMYA 1IHSH 2OTVA 5SGAE 3RXKA 3LC5A 3RXOA 1VJAU 4R8TB 3F1SB 1H9IE 1SVPA 4X8TH 6LPRA 1Y5AT 1AD8H 2B5TB 3RP2A 3M36A 2BLVA 1MD7A 2RDLA 1UCYH 1UVSH 2VBCA 4JK6A 2PHBA 1O5FH 2PTNA 1GBHA 3HGNA 3OSYA 2ANYA 3D65E 1MCVA 5KEDA 1LHGH 3TJOA 4ABAA 3QGJA 3ZZDA 1O34A 3NXPA 3V0XA 1LPGB 1O3OA 4IC5A 3MU5A 3A89A 3SI4H 2C4FH 4F4OC 4ABGA 3CNRA 2BD7A 4Z0KA 2QE7D 3SBKA 2NWNA 3WWFA 4B6EA 1TE0A 1HGTH 2Z9JA 1HLTH 1P2NA 1SOZA 2FOEA 2XC4A 2R0LA 2GZ7A 2SGPE 2FX4A 2ZPRA 5EU8A 3UUZA 2A4RA 2K0QA 1HXFH 3KHVA 1O3MA 1XUHA 1SGTA 2H2ZA 2O8WA 5DN6D 2GTBA 1PQ8A 2FWWA 1FXYA 1YLCA 3T25A 2AMDA 3E16B 3OAAD 4FUCA 3ZZCA 4JYVH 3T5FH 1MCTA 2FEQH 1VCQA 1K28D 2GDEH 2WPDD 1C2FA 1A3BH 1P9SA 2J98B 4MLFB 2ODQA 1SFIA 2FLBH 4K5ZA 1CT2E 1QJ1B 2G4UA 5FPTA 1H9LB 4KELA 1AN1E 1B0EA 1NBME 1E38B 1SGQE 5AHGH 4ACAA 3STIA 5LH8A 3QDZB 4P00A 1T32A 4IMZA 3MU1A 2W3KA 1H1BA 1OWIA 1P02A 1Y3WA 1GMCF 2JH6D 2FTMA 1BRCE 1O2KA 4BTUB 4Q7ZA 2BOHB 1A7SA 5EOKA 1OPHB 2QC2A 1C5ZB 5EQRA 4DT7B 3U9AH 1ZMNA 1BTPA 1NFYA 1HCGA 3UAIC 1K1MA 2B7DH 1HJ8A 1UTJA 1A4WH 1SGDE 4OS7A 1GBDA 1Z6EA 3P8NA 1JOUB 1BTYA 4D9RA 3E1XB 2D1JA 3MNXA 2G52A 1SHHB 3FOAA 4F49A 3P8OA 4TY6A 1W11U 1AZZA 1B0FA 2WINI 1QFKH 1MQ5A 1YPMH 8LPRA 4JZDH 1GI7B 3IITA 5AF9H 2FYRA 5CMXH 2ZPSA 1JIMA 2Y7ZA 4X1RU 2HVXA 4KTCA 4OS2A 1CT0E 1FV9A 1PPZA 4IBLH 2V35A 3FZDA 1QL9A 3SHCH 1K2I1 1IQJA 1P10A 3FZZA 1G37A 1C4Y2 1BB0B 1GI0A 1F7ZA 3M7UA 1AHTH 4CR9A 1V2NT 2VWLA 4ABJA 2XCFA 1UCYK 2GVFA 3SOSA 1GBEA 3PROA 3UNQA 1AMHA 1QJ6B 2Q6FA 3RMOH 2OLGA 2BZ6H 1CHGA 3O8CA 2W6JD 3T28A 2JIZD 2PUXB 2Z94A 2AERH 3QTVH 5GCHF 2QIQA 3E8LA 4WXIA 4KKDA 3DSOA 3RC5A 5BRRE 1DY8A 4AN7A 2I6QA 4GCHG 2WYJA 2A7JA 2XRCA 3SU4A 1AY6H 3TK9A 1SGCA 4I32A 1O38A 1SGFA 1GI8B 4ABIA 1DUAA 2ZCLP 1V2OT 2XNDD 5DP9A 2XXLA 3GCTG 3KIDU 4CBNA 1C5LH 1XXDA 2BQWB 3F0PA 2IPQX 3UREA 2AS9A 2G4TA 1NTPA 3SU2A 1NY22 2FOFA 3HGPA 1GVKB 3HKJB 3V7TA 1W0JD 4TT3D 2PWXA 2A5IA 4ZKSU 1OYQA 3SUGA 2SNVA 3LJJA 2CF9H 3AK5A 3HKIB 4QT8C 4WMEA 3OFND 2RDEA 4LXBH 1OP8A 1W7XH 3VG8A 2STAE 3RMLH 5ETXA 2WPJS 1C1QA 1UVTH 3DUXH 2P59A 3QZRA 4CRCA 4WH8A 1OYTH 3M5OA 3TH4H 1RTFB 1C5SA 1MAXA 4LK4A 1RJXB 1WQVH 4JYUH 3DFLA 2ZTYA 1O30A 3RXTA 2GT8A 5A0AE 4UFGH 2BD8A 2EA3A 4GVUA 1EPTA 1MTSA 1LMWB 2BD3A 3KEEA 3UB0A 1CGIE 3UQOA 2P94A 1H8HD 1GHBG 1XM1A 2O8LA 3KYFA 4XBDA 2XBWA 2W3IA 2GD4B 3H7TA 2FODA 2KR7A 2G5NA 2FESH 2ZFQH 1YF4A 4FUFA 4WVPE 1TPAE 4TPIZ 2VB0A 3U8TH 3GCNA 1KMHB 1SQRA 4FU8A 3A8BA 5EXMA 1GHAF 1THSH 3NUMA 1SGPE 5I25A 1MAYA 4TWWA 2A0QB 5EIYA 5EJZA 1C5RA 2BMGB 1HXEH 5CDFE 3T26A 3U8RH 2P3UB 3MYWA 2WUCA 4AORA 1KXFA 1O33A 4FVBA 2LNCA 3F3BA 1T31A 3ATIA 4ISLA 1KXAA 1LHFH 3U1IB 5EG4A 3I29A 3UWIA 1M9UA 1XKBC 2PSXA 1P2OA 4NA8A 3AVZA 3SV8A 1AVXA 4Z1MD 3BG8A 3EGKH 1HAOH 5FPYA 1BHXB 2HALA 3PWBA 1EX3A 2SFAA 5DKMA 4X2YA 3TLOA 3LIWA 1CHOG 3SGAE 1MBMA 4FUGA 5FHTA 3E90B 4O3UA 2BDAA 5CHBA 5EPYA 3F0OA 1HAVA 1Y5UT 4B71A 1FY5A 4B1TA 3T27A 1P9UA 1QA7A 2KAIA 4WXVA 3U28C 1PQ5A 3UR6A 4CRGA 2BX4A 1HDTH 1AUJA 1Z71A 2G00A 4U30A 3PB1E 1O32A 4X6MA 2G51A 3F9GA 2BYAX 4B73A 4DGJA 3ZV9A 3P8FA 5GIBA 1ZTKA 3MFJA 2YMSB 1EXFA 2Y6TA 1UTOA 1O5AB 3BG4B 5KECA 1DITH 3PMJA 3EA9A 1TBRH 2W6ID 4I8HA 5C1UA 1F5RA 3AASA 3N7DA 1DUEA 3TH3H 2PKSB 3SHAH 1GDQA 1MKWK 4I8JA 3TK5A 1WV7H 1O37A 3M61U 4K8BA 1SLXB 2F4LA 5E0JA 2Z7FE 1ZMJA 3M37A 1SLWB 1IQKA 2BLWA 4DY7B 4D76A 1O2TA 1Q31A 3A81A 1CVWH 1ZSJA 2J94A 1V2ST 4BXSA 3EA7A 8KME2 2F9NA 1GBMA 1EZUC 2WPLS 4OS4A 4AFQA 1T8NA 1IQFA 1E1RD 4XSKU 1O2GH 5ABWA 4LZ4B 1J8AA 1GBBA 1S84A 1ZSKA 2CGAA 1ACBE 3GCOA 1YPGH 1WU1A 2ODPA 1KDQA 3LJOA 1AIXH 3MH6A 3QO6A 3V3MA 4D7GA 3RXDA 2AMQA 2ZI2H 1S0RA 3GCHB 3SQHE 2FX6A 1AFQC 4B74A 2BX3A 3SUFA 1GCDA 1O5GH 3O8BA 4FU9A 1IQIA 3IG6B 1SKYE 5EQQA 1DFPA 1AVWA 2WHXA 3ELAH 4E7RG 2V0BA 3BF6H 1TGSZ 4UE7H 3WY8A 4M9FA 4UFEH 3RXRA 1JIRA 1NS3A 4TSFD 1UTNA 2BXUH 1O2XA 1TMUH 3GY3A 3OEED 2ZEBA 4DOQA 1QCPA 2TBSA 3PTBA 4BTIB 1RFNA 1EASA 4HZHA 4WMFA 3RU4D 5ESTE 2F91A 2PTCE 1O31A 3DSGA 1SFQB 3RM2H 2GKVE 3R0FA 2A32A 3SJKA 2STBE 1VITF 5TCCA 2WPHS 2Q6DA 1E34B 1QQUA 3K65B 3MNCA 5JBAS 5HM2A 2BY5X 5A8ZA 1V2PT 1J15A 3MI4A 1HAHH 4IGDA 2Z6BD 1GJ7B 2C90B 1G2LA 3DT0H 4A1VA 2V3HH 5GPIB 4TY7A 4F48B 3UPEA 1DXPA 3ZZ6A 1UVOA 5EODA 2VNTA 1GBAA 1L1JA 3MU4A 4Y8XA 2BDHA 1LKBA 3E6PH 1KDQB 3ZVFA 5GWZA 1IQMA 3RXCA 1FPHH 5CHAC 3GY6A 2GV6A 1P2KA 3UNRA 4CBOA 3E0PB 3BV9B 1KYNA 3L33A 2VH0A 1PPCE 1SG8B 4NFFA 3PRDA 3LGVA 1OWJA 3VEQB 2BD2A 2QF5A 1XMNB 1ZJKA 1LVMA 4CR5A 1TOCB 3A88A 5DJ7A 4YOGA 5FX5A 1RS0A 3SO3A 5IYTA 1J14A 4Y8ZA 2WPIS 1ZGIA 4J2YB 2VIVA 1VZQH 1V3XA 4UFFH 4A1TA 2SNWA 1A0LA 3OX7U 2GGVB 3ATLA 2AGGX 1P05A 3S9CA 1BTWA 2BTCE 3BTME 3M35A 2JKHA 1DWBH 3RXGA 2RA0A 2W5EA 1RTLA 3L6PA 1LPZB 1FY4A 3TVJB 2Q1JA 1G3CA 1X7AC 2WZQA 4FOUC 3F2HA 1O0DH 2TGAA 3SZNA 1G9IE 1C1RA 1C1WH 3BTKE 3LGIA 3ODFA 3MH4A 1Y59T 2FIRH 2B0FA 5CHAB 1EPTB 2UWOA 2ILNA 1C5WB 1U6QA 3RU4T 3ENSB 2VIWA 3HATH 4ZHMU 1HIAA 3ZYDA 1YPJH 2QV1A 2GMTB 4A5TS 5C0UA 1GI3A 1S0QA 2PUQH 5DP3A 1LDTT 3W94A 2ZZUH 1OS8A 1VCWA 1EPTC 3FO8D 4DJZB 3VGCB 1GBKA 1ELVA 3SV9A 3U98H 1T8OA 4ZHLU 1YM0A 3BSQA 2OBQA 1D3QB 2FOBA 3KL6A 4BAKB 3ZVDA 9LPRA 1ORFA 1EATA 2NU1E 3U1JB 1FLEE 4MTBA 1H4WA 2FZZA 3GY5A 1NFXA 4YTAA 1D6WA 2ZECA 2IJOB 6CHAC 3ZVGA 3O8RA 2LELA 4YLQH 4OS6A 4INHA 3FKSD 1B7XB 1ELFA 1O2JA 2XTTB 3SUEA 2PKSC 2F9VA 2EI8A 1C2LA 3ZZ7A 2EI7A 1YLDA 4X8VH 3S9BA 5E2PA 1GHZA 1O3GA 3LGYA 3P6ZB 1TQ0B 2C93B 3F6UH 3SI3H 7GCHG 1GMHF 1SGNE 1HAIH 1QURH 2D8WA 1FDPA 1TIOA 3BTEE 4IN1A 2HPQH 3RM0H 3SU1A 1C1MA 5H4IB 1ZMLA 4BTTB 4X8UH 1P2JA 5C5OA 1TB6H 1W14U 3LU9B 1ZPBA 3G01A 5LPEA 3Q77A 3KNXA 2QAAA 3TH2H 4E7NA 4XDEA 1SL3A 1G3EA 1GI4A 1NM6A 5FBIA 2XWBI 4FETA 1MABB 2R3YA 1VCPA 3EA8A 3GOVB 4INKA 2BDCA 3RLWH 1E37B 1AQ7A 2ANMH 4LOYH 1BIOA 2VGCB 4Q2KA 5A2MH 1CE5A 5CE1A 1GVLA 4ZCNA 3SORA 1BUIA 1GI5A 1C2EA 1VGCC 2J34A 1ZTJA 2GDDA 4AYVB 5AFYH 5C20A 2FTLE 2HPPH 2OC8A 2R2MB 1MKXK 3SNBA 1N6XA 3RXMA 4WF8A 1H8ED 3UWJH 1BJVA 1O2MA 1G36A 2C8ZB 3KF2A 1CSOE 5IK2D 4X8SH 3NWUA 4NIYA 4AZ2B 4ABDA 2FLRH 4Y6DA 1XVOA 2ZU4A 1AB9C 1KLJH 1QB6A 1HAZB 1SSXA 2A45B 4ISNA 4NIWA 7ESTE 3ZYEA 5GDSH 2Z9KA 1SLUB 1LHCH 2TGTA 3SNEA 1AWHB 3M3VA 2F9UA 2BVSH 1E35B 5ESBA 3URDA 3SV6A 1KTTB 1QY6A 2J2UA 4YOIA 1TGNA 3U69H 1TPSA 1BITA 3B23B 1GBLA 1YPEH 4A92A 1MH0A 2D2DA 1ZPZA 1BRAA 5EXLA 5J4SA 1Y3VA 2H6MA 2A2QH 2A7HA 2KCOA 1O3JA 5JBBS 2EY4C 1DM4B 4UEHH 5EPNA 1F92A 1K1PA 5DP7A 2JH0D 2XNIA 3QWCH 2TGDA 4AFZA 2XWAA
chains in the Genus database with same CATH topology
1DLKB 1PPHE 2PGBB 2ZDLA 1NRNH 2F9PA 2ZHQH 3PV4A 1WYKA 2YNBA 3VXFH 2FDAA 4RSPA 1GBCA 1TWXB 1WSSH 3A86A 1TONA 1L1GA 1SHYA 1W13U 3ATKA 2FOGA 1GI2A 1MU6B 4K1SA 4TYDA 6GCHG 2BLQA 2ZDMA 3M5MA 5FCRA 3D49H 1MTNC 1EZQA 1FUJA 4X1PU 1Y5BT 2QXIA 3R3GB 2Z9IA 1O2HA 1BTUA 1C4U2 1A1RA 1C5OH 1TPOA 2GP9B 4K1EA 4IW4E 4A1XA 1GCTB 5F8TA 2ZNKH 1L2EA 1GBTA 2VWNA 3SUDA 2J38A 3M5NA 4GPGA 6GCHF 1A61H 1QBOA 1A0JA 2WV5A 1HB0B 1LHEH 1C2DA 5C2ZA 1HBTH 3JZ2B 1GG6B 1C5TA 2K1QA 3SGBE 1V2UT 1GHAG 2O8MA 2OD3B 4O9VA 2PGQB 1FY8E 1GJ6A 1EOJA 2ZPQA 2GCHG 2CJIA 1QL8A 1OKXA 2VIQA 1GMDF 1P04A 3RXAA 1NROH 1MMJN 4UDWH 3GY7A 1EB2A 3FP8E 2IOTA 1ETRH 1TNIA 3QK1A 4AB9A 1MKXH 1HIAB 4D9QA 1ZRBA 1FNIA 5L2YH 3I78A 1TNJA 1VITH 1N6YA 4GLYA 3BIUH 4YM9A 2AIPA 2C8XB 2ZKSA 1EAWA 1YBWA 2OC7A 2R3UA 3ZZ8A 2Z3DA 4GUXA 1SBWA 1T8MA 1XUJA 3PMAB 3ODDA 3FVFB 1ELDE 1QA0A 2FOAA 2ODYB 1DICA 4BAHB 3V13A 4AB8A 1N8OB 3P92A 1KXCA 2HNTE 1L1NA 1QL7A 3SJOA 2HLCA 1JMOH 3LC3A 2BY7X 3UQVA 2CF8H 1AE8H 1A0HB 3BEIB 3C1KA 3SJ9A 1AB9B 1G32B 2VH6A 3ZZAA 3FANA 3GCTF 3SV7A 3TNSA 1XKAC 1QNJA 1V2LT 4DCDA 1P2MA 1DXWA 4CHAC 2XYAA 5EW1H 1O2PA 2AYWA 5FPSA 5DK1A 2VIPA 8GCHF 5DGJA 1QTFA 1ELTA 3LH3A 3MO3A 2AGIX 1OX1A 2H5CA 2XCNA 2WV4A 1INCA 1F5KU 1Z8RA 1O2SA 3ZVBA 1YYY1 2ZHFH 1GI6A 4CH8B 1QRWA 4U2WA 3KQBA 4FUIA 2A4OA 1ABJH 5PTPA 4OGYA 1UJ1A 2XBYA 1GJBB 2ALPA 4SGBE 1DE7H 1D9IA 1EZXC 1TALA 3RXSA 4I8GA 1GHXH 4XE4A 5DP4A 3A87A 1GJAB 1QIXB 3VB3A 1GMHG 1OWEA 5GCHG 2BZAA 1UO6A 3RLYH 3RXPA 1L4DA 1AFQB 1SGEE 1E36B 1Y8TA 4YESB 2SGAA 3GDVA 1KXEA 1F5LA 1VITG 1Z6JH 2WUBA 2FPZA 1QRZA 4RKJB 3RUOA 1Y3UA 2Q6GA 4MPXA 2ZDNA 1TNHA 3VPKA 1THPB 1O2QA 1EOLA 1W7GH 1K1JA 1AFEH 2AIQA 1TMTH 1O3FA 5A09A 1C9TA 1GVZA 1L0ZA 1K22H 1YPLH 3UY9A 2A7CA 2XBXA 2XC0A 5L6NH 3U8OH 4MNWA 1GHBF 1P2IA 3N7OA 4Y11E 2PW8H 4JZEH 5E0HA 4JMYA 4ZAEA 3E91A 5T3HA 1GHYH 2HNTC 1YCPK 2EC9H 3CS0A 2TIOA 2TGPZ 4YT6H 2H9HA 1T4VH 3MNBA 2XC5A 5F8ZA 4NG9H 2HGTH 3SQEE 1XUIA 2ZFPH 3NKKA 4TWYA 2ZU5A 1QHRB 1AWFH 1GDUA 1IQEA 3TNTA 3AAUA 3RU4E 1P0SH 4KTSA 1UTLM 1O2IA 2QN5T 2DE9A 1ELAA 2PV9B 2Y81A 1VGCB 1ESAA 3RC4A 2QA9E 1IAUA 2OP9A 3RXLA 1BRUP 1ZHMA 1ELGA 4JK5A 1TBZH 4UFDH 3C27B 3SJIA 3TU7H 1EZSC 2BDBA 2ZQ2A 2LPRA 4BXWA 5LGOA 2DUCA 3A7XA 2HNTF 4ZXYH 4HI3A 1GJCB 1O3AA 1TAWA 4OS5A 1GCTC 3MO6A 3A85A 1BBRE 3VB5A 1O2WA 2SGQE 1S83A 1A46H 3MH5A 2R9PA 4MNYA 1EUFA 2CXVA 3A82A 5I46H 4YZUA 6CHAB 1F0TA 5K7RA 2O8UA 1BDAA 1F0SA 3A7TA 3QZQA 4MDSA 4Q7YA 3BTQE 4E06H 1ELBA 1B5GH 3LDXH 1QJ7B 2FMJA 2Y5FA 5C3NA 1WUNH 4I33A 2VWMA 3OTJE 4I31A 3SU6A 1BTXA 3MU0A 1K1OA 1V6DA 2FOCA 1GDNA 2GCHF 1SC8U 1J16A 1HNEE 1VJ9U 2WYGA 2OCVB 3PTNA 3PWCA 3AW0A 4HFPB 2QGRA 2BM2A 1NRPH 3DA9B 3BTHE 1ZR0A 1ARCA 1C2GA 3PM3A 3RXIA 3MU8A 3RXHA 3UTUH 5FCKA 1O3DA 2B9LA 2PR3A 2H9TH 4FUEA 3SW2B 5L2ZH 1PQAA 1XVMA 1P06A 4K2YA 1SPJA 1DDJA 4GSOA 1CGJE 1AE5A 3GY2A 2R0KA 1LCYA 1Y3YA 3PMHB 1EP6A 4MNVA 1O5EH 2BOKA 1NZQH 3UOPA 4X1QU 4ABEA 2GMTC 3ESTA 3LKWA 3AAVA 3P17H 2V3OH 1NU9A 1PPBH 1EJNA 1UVPA 1QQ4A 1GBIA 1TNKA 1C4V2 2BLOA 4X6OA 2C3SA 3PYHA 1Z1IA 1BA8B 1V2MT 2ZTXA 2GX4A 3OYPA 5HYOA 1C1VH 1LPKB 3QUMP 1W0YH 3OY6U 3A84A 3H7OA 2GV7A 1K1LA 1GGDC 5JB8S 4BANB 5T6GA 1KTSB 4BAMB 2Y80A 1AU8A 3SGQE 3S9AA 4MQAA 5E2OA 1D3PB 1N1LA 2ZWLH 4YT7H 2BDYA 3PO1C 1NFWA 2CV3A 3FAOA 4CRFA 1SQOA 4GHTA 1CT4E 3HPTB 2G8TA 5DP6A 1DSUA 4AX9H 4OS1A 1C5VA 2VU8E 3KQDA 4NZLA 4AG2A 1W0ZU 3MOCA 3RDZA 3TITA 1O3PB 1RTKA 1HRTH 4ZKRU 1C2HA 3TJNA 4XOJA 1RRKA 3D62A 3KGPA 2QXGA 2SGDE 3ZZ5A 1TPPA 1BBRK 1IQGA 2CHAC 3L3TA 5EW2H 1OWHA 2ZGHA 2FS8A 8GCHG 1SGYE 1NC6A 1HJ9A 1RD3B 5C1YA 3D23A 5FAHA 4FU7A 3BTTE 4FUJA 1UHBA 1V2RT 1UMAH 1VR1H 1NRSH 1LVYA 1ZLRA 3UNSA 5C1XA 1JWTA 1HYLA 1O3CA 4X2VA 3S7HB 5LPFA 3RXUA 4HGCA 1SQTA 3VGCC 3UR9A 1A3EH 3PLPA 1GHVH 1NRRH 2YNAA 1Q3XA 3KQCA 2PLXA 4X2XA 1KLIH 3FP7E 4FVDA 1GHWH 5T6DA 3GDUA 3Q3YA 3M3TA 1G30B 2FI3E 1WBGB 1NRQH 2UWLA 1CQQA 4IMQA 3PLBA 4ABHA 4NA9H 5IDKA 3KQEA 1IQHA 1C1SA 1MD8A 1ANBA 1Z1JA 2QCYA 2ZDVH 4KP0A 4TPYA 1Z8IB 3A7WA 2WPMS 2QY0B 4NZQA 1O5CB 1O39A 1PFXC 2J95A 2OQUA 1DSTA 4CRAA 1EAIA 2C8WB 4NGAH 1MKWH 2BD4A 4BNRA 4ZKNU 4Y8YA 4X6NA 1IQLA 1DVAH 2GZ8A 4NSVA 4Y7AA 3SNAA 1S5SA 3BEFB 3HK6B 3SJ8A 1O36A 4J1YA 1V2KT 4CRBA 4ZMAH 4AG1A 4AGKA 1GJ4H 1HJAB 2GCTB 3UIRA 2CN0H 1LVBA 1GWAA 2V6NA 1F0UA 1GMCG 4AGJA 4Y7BA 1K1IA 4B76A 1NPMA 3NCLA 1HAVB 2OQ5A 4WY3A 1DY9A 1YCPH 3ZVEA 1CA0B 2BHGA 1GBFA 2Y7XA 2G5VA 5C67A 2FS9A 2ZFFH 1ANEA 1TOMH 5HXFA 1SGFG 1JBUH 1JRTA 1MTNB 5FX6A 2VVUA 1EP5A 3BEUA 3BIVH 1HPGA 1DT2A 2OXSA 1FN8A 4UD9H 1E0FD 3TJUA 1PPFE 2RA3A 4XBBA 5F03A 1XXFA 2PSYA 1WCZA 4IN2A 4GCHF 4M7GA 5EXNA 4Y76A 1SI5H 1GG6C 1BBRH 2NU0E 1CBWC 1WAYB 1XX9A 1IQNA 2UUFB 1OWKA 1C2KA 1XUGA 2J9NA 4OGXA 1RIWC 5JBCS 1NFUA 1W3CA 1TLDA 1BT7A 2ZCHP 3TGIE 4UONA 2I6SA 1O2NA 1P11E 4YO9A 5A8YA 4H4FA 5G4BA 3BTDE 1KXDA 2GT7A 1NT1A 4MPVA 1FZZA 3B8JA 1BRBE 2FYQA 2A1DB 1WQSA 1BTHH 1YCPM 4B75A 3GISB 5GXPA 1TA6A 3DFJA 5F8XA 1KIGH 4FUHA 1W8BH 1O3BA 1ZPCA 1IOEA 1F0RA 1OP2A 2QF3A 2VVVA 3A80A 3P95A 1S6FA 3GICB 1Y3XA 1SGIB 1FMGA 1TX6A 3E3TA 3HK3B 4BAQB 2HWLB 5FXLA 4WJG2 1C5UA 1GGDB 3SU5A 1C1NA 1HAPH 4H6TA 1ZZZA 1KY9A 1FIWA 3STJA 1H8IH 2P8OB 1AVGH 2AEIH 4XFQA 1PPGE 1G2MA 2G81E 3SU0A 4MVNA 4ZROA 1OP0A 3NPSA 2FI5E 1Z8JB 4O3TA 1C9PA 3K2UA 1CGHA 1MUEB 4NWKA 1TGBA 3BTFE 1YGCH 4YOJA 2ZGCA 1O3LA 1AKSB 4O03A 2Y82A 3TGKE 3EQ0H 1ESTA 1GI9B 1HFDA 2JH5D 4NSYA 1ZSLA 1FAKH 1ANCA 4ISOA 3H5CB 4DVAU 5A8XA 1QBVH 2P95A 1O35A 4Z6AH 1EJAA 1MZAA 3ZV8A 1W2KH 2AFQB 1ZHPA 3A8AA 1QGFA 2A5AA 1IHTH 1MTUA 1V2TT 3A83A 2CHAB 1S82A 2QYIA 2SGEE 3LGTA 3RC6A 1BMAA 4X6PA 4WH6A 4NCYA 4K3JA 3SV2H 3MO9A 3RXVA 3TPIZ 3VXEH 2J4IA 1HAYB 2UUKB 4DIHH 1KSNA 2ZHEH 1TRMA 1T8LA 1C1OA 1O3HA 1CA0C 1V2VT 1TGTA 1UK4A 4Q80A 3RMNH 4H6SB 2Y5GA 1EQ9A 1ID5H 1D6RA 1PQ7A 1P03A 1BTZA 4RKOB 1A5GH 1YPHC 2BY8X 1MBQA 1ZGVA 5A0BA 3MWIU 2XBVA 4Y0YE 1NESE 4VGCC 1OWDA 1G3BA 5JBTA 1TA2A 1GJ9B 4D7FA 3QLPH 1JXPA 4ESTE 3UFAA 4CREA 2EEKA 3VB7A 1GJ8B 1LQEA 3A7VA 3F9FA 1DPOA 3GY8A 2A5KA 2BVXH 1EAUA 2WPKS 1C5QA 1SLVB 3URCA 1ANDA 3LPRA 1FJSA 2IPHA 2ZQ1A 3O8DA 1HJAC 2GCTC 2BXTH 3S69A 1ETTH 4LZ1H 1A2CH 1H8DH 1JRSA 1P12E 1D4PB 5B6OA 2UWPA 2VJ1A 4ABBA 5DP8A 4IS5A 5J4QA 3K9XB 4K60A 4KGAA 4DG4A 1DS2E 1V2WT 1D3DB 4VGCB 1O2OA 2ALVA 3GDSA 4GAWA 1BMLA 1WOFA 2ZTZA 1SB1H 3CP7A 3RXFA 1GL0E 3M7QA 4B2BA 1TYNA 2SGFE 1A5IA 1DANH 1UK3A 2FM2A 1AGJA 2J92A 1O2UA 1UHBB 1ESBA 3TJVA 3PLKA 3RMMH 3SNDA 2VIDA 4NA7A 5C5NA 1O2LA 3A8CA 3ZZBA 3DD2H 2A2XH 2UUJB 2ZGJA 2PFEA 3LH1A 4WMDA 3GY4A 4A6LA 5LPRA 4MNXA 3EE0B 3P70B 3FFGA 1BZXE 2AMPA 3OU0A 2IN2A 3MNSA 7GCHF 1P8VC 2OUAA 2ZFRH 2O9QA 2BQ7B 4ZHAA 3Q3XA 2P3FH 1YPHE 1O3NA 1P3EA 1O5DH 1SR5C 3BN9A 1AUTC 1UVUH 1GI1A 4Y10E 3MH7A 2VINA 2Y5HA 4I7YH 1ELCA 4Y79A 5HMAA 1TNGA 1PYTD 3IWMA 4JYTA 3EAJA 2ZU3A 2M5TA 2EI6A 1NU7B 1GJ5H 2GZ9A 1QBNA 1YPKH 1ZOMA 3EYDA 1H9HE 1V2JT 2BD5A 1ARBA 1DWEH 1C5YB 1FY3A 1QB9A 1T4UH 1EB1H 1WTHD 4B2AA 3OY5U 3DHKH 1P3CA 1FPCH 5EGMA 5AVDA 5TJXA 1ZJDA 2O8TA 4HTCH 3GCHC 3B9FH 4X1SU 4BOHA 4KTUA 1AZ8A 5E0GA 3QN7A 2W7SA 2ZO3H 2BQ6B 3M5LA 2F83A 4Q7XA 3T29A 2F9BH 1EJMA 4I8LA 5EQSA 1OOKB 5JPMH 1C5PA 3LGUA 2BDGA 1HV7A 2ANKH 1RXPA 3RXEA 5HM9A 3LT3A 1HUTH 2OINA 3VB4A 2HOBA 2ULLA 4RN6A 1DLEA 1W10U 1TFXA 1O2VA 4NIVA 1UCYE 3RXQA 1TX7A 3F9EA 2HRVA 3ZZ3A 1BCUH 4SGAE 2ZG0H 1ETSH 2ZC9H 3QGNB 1KLTA 2ZHDA 2Z3EA 1RIWB 3VB6A 2RG3A 7LPRA 3ATMA 3K6ZA 2B8OH 3AW1A 2ANWA 1Q2WA 3ITIA 4MPUA 1L4ZA 2OC1A 2UUYA 5GJ4B 3TGJE 4BAOB 2W26A 1GPZA 3GYMA 5DO4H 1O3KA 4K69A 1GMDG 4MG3A 4B2CA 2ESTE 2W7UA 3LONA 2ZA5A 3ZZ4A 1LTOA 3F9HA 4CH2B 3Q3KA 4JZFH 2P93A 3E0NB 1FONA 4NFEA 2A4GA 2H5DA 4U32A 3UOUA 3BTGE 1GL1A 4Y71A 2FXRA 3KCGH 1K9OE 2DE8A 4AFSA 4X2WA 1C2JA 1TRNA 4D8NA 2KAIB 3VFEA 1AI8H 2ZP0H 2YOLA 3PMBB 4DW2U 1NO9H 3GYLB 2FOMB 2BD9A 1C2MA 1OXGA 1O2RA 4CRDA 6ESTA 1DWDH 1AKSA 4U01A 1FI8A 2H9EH 1MZDA 1CU1A 2F9OA 1MTWA 1FQ3A 1MU8B 1UTPA 1XUKA 2C8YB 1XUFA 1SOTA 2BY6X 2H1UA 3NZIA 1BMNH 5HGGA 1ZHRA 1LQDB 4WWYA 1CA8B 2AH4X 3ZVAA 2A4QA