3RXSA

Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine (f04 and a06, cocktail experiment)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxsA02
1Y3UA 5AFZH 1C5OH 4JZIA 4YOIA 4AFUA 1SGTA 1LKBA 2TBSA 3RMLH 2C4FH 1AWFH 1OWEA 1H9IE 4R0IA 2FPZA 1FPHH 1Z6JH 5HM9A 2G5NA 1C5TA 3P70B 1G3DA 3LT3A 2V6NA 2VIOA 2I6QA 2QXGA 4KGAA 4B2BA 2IJOB 4WXVA 4WF8A 3TITA 1BB0B 1SLUB 4FXGH 4FUGA 4HI3A 4UFDH 4FUHA 3NPSA 1QURH 1SG8B 4GAWA 1FI8A 5C5NA 1FONA 4RKJB 5DGJA 2ZP0H 1TFXA 3LPRA 3SU5A 4I8HA 5EG4A 2HPQH 3RM0H 4NWKA 1J14A 1GBFA 4NIXA 1UK4A 1C1RA 4ISNA 4FUBA 3KNXA 1EJAA 5GPIB 1O3FA 3BF6H 1SQOA 4Y8ZA 4ABGA 1SMFE 1KXCA 1LKAA 3QK1A 2JKHA 4FVBA 1FY8E 1YLCA 4YOGA 1KDQA 3DA9B 5FHTA 1TNHA 1IQFA 1P11E 4PROA 2SGDE 2XBXA 4AGKA 1XX9A 1OWDA 3ZVAA 3L6PA 6ESTA 2BD5A 1P2OA 4THNH 4R8TB 1AFQC 1ZPBA 4ZKRU 1C5XB 4Q80A 1V2JT 1P02A 2GT7A 1ELDE 1MU8B 1UTPA 3MTYA 1EOJA 3VXEH 1T4UH 4D9QA 3D65E 2FI5E 3U1JB 1O2VA 1O2TA 3GCTG 3RLWH 3V3MA 1A4WH 2ZFRH 1SGNE 3RXJA 1C4U2 3MOCA 1FY3A 2ZHFH 4JYVH 2QIQA 2FLBH 2A5AA 1HAVA 2Z9GA 1OP2A 1CT0E 1JRSA 1TWXB 4AG1A 4BTIB 1D6RA 2GMTC 4CRGA 2IPHA 1EX3A 1N6XA 1GI6A 4YOJA 4UFFH 4BNRA 4E7NA 1QJ7B 3P17H 1O2MA 5C1XA 4ISHH 3BTQE 2PKSC 4BAHB 1YPHC 1Y3WA 2WYJA 2OQUA 1O31A 5E2OA 4X6MA 1O2UA 1SGIB 2Z6BD 3PMHB 1OWHA 1S6FA 4RSPA 3RXSA 3K9XB 5TCAA 3T25A 3SHCH 2BX4A 1GBAA 3Q00A 4NZQA 3GCTF 1AUTC 1Z1IA 2FX4A 3H7TA 1NZQH 1W13U 2ZHEH 3RXKA 1TGNA 1HB0B 1EP5A 3ELAH 1EUFA 2W7SA 1TX8A 2UWPA 4NSYA 2WYGA 4B2CA 2Y82A 1EZXC 4GLYA 5EXNA 1XKAC 4YT6H 1O5AB 1SGQE 2AGGX 1UVOA 1VR1H 1FIWA 1HBTH 2GTBA 1GBBA 2GZ7A 1KXFA 2IN2A 4ZKOU 1D3DB 1PFXC 2O8MA 2F9PA 5BRRE 2SNWA 2XTTB 3AW0A 3I77A 3RXMA 2ZWLH 2HNTC 2ZTZA 1ZHMA 2BVXH 1AHTH 1TGCA 1OSSA 1C1UH 4ABBA 1GL1A 1C1TA 2OLGA 5HGGA 1V2UT 1GBHA 4NG9H 3MYWA 1ZJKA 4TWYA 2A2QH 2O8UA 2DUCA 2RG3A 3HPTB 4E06H 4Y7BA 3AAUA 1IQIA 3QUMP 4TYDA 3SU3A 2ZU1A 5DP4A 3KN2A 4D7FA 3ZZDA 1GVLA 2O8LA 1MTNB 5A8ZA 4HGCA 1ESBA 1SGRE 1NPMA 4NSVA 2KAIB 3T28A 3LGWA 2C90B 7ESTE 2QXHA 2V0BA 3LH3A 1MQ5A 1GJ6A 1OP8A 1E34B 4A1VA 1C2HA 5HXFA 1CGIE 2ZTYA 1LHEH 1H1BA 1ELCA 4IMZA 5FX6A 1TPSA 2BB4A 1BRCE 1GCTB 5EOKA 1UTLM 4A7IB 2ZU5A 1QBVH 1BOQA 2BXUH 1NRRH 1C9TA 3QTVH 1FAKH 1CGHA 1GJ9B 1DFPA 1GWAA 1V6DA 5GDSH 1UTKA 2YOLA 3QO6A 1GGDB 1C4V2 2C8YB 3RXUA 5DO4H 1BA8B 2OBQA 1ETTH 2ZU2A 2ODYB 4X1PU 5GCHF 4FVDA 1WBGB 2H9TH 2ZGHA 1V2RT 2Y5GA 4O3UA 2NU2E 1O2WA 2WPKS 1O2ZA 3BTWE 2B7DH 3F68H 4UE7H 4O3TA 1EKBB 1TA2A 8KME2 1FPCH 2R0LA 2Z9JA 1XM1A 1XUHA 4I8LA 3TIUA 1BQYA 2SGEE 2VGCB 5EQQA 3SGQE 4ESTE 2ZF0H 3TH3H 1EP6A 5JBTA 1QR3E 1WCZA 3T62A 1N8OB 2QF3A 3UFAA 3SV6A 4DG4A 3AASA 1DUEA 2P95A 2BY6X 1LDTT 3SW2B 3RXCA 1ZRKA 1QCPA 1AN1E 3M7UA 1GMDG 5K0HA 3S7HB 1A0HB 2A1DB 1D4PB 1EJMA 2BD9A 3U8RH 1GI2A 3SJKA 2ZGJA 4X8VH 4Y11E 1RIWB 1DUAA 3TJOA 1O2IA 1GI4A 5EU8A 3SUFA 1GBEA 1SLWB 5FAHA 1OXGA 1WAYB 1P0SH 2PR3A 2BLVA 5FBEA 1EZQA 1A61H 1JIRA 1IQMA 3BG4C 1BJVA 3MI4A 2UUFB 1C2GA 4WH6A 1CBWC 1SGFA 1ARCA 5DK1A 1GBMA 3E0NB 1J17T 1MBMA 3SNDA 1J8AA 1UK3A 4INLA 2TGDA 4CREA 2HNTF 3LONA 3QX5H 1P2NA 4KKDA 1ETRH 1GG6C 4YLQH 4IBLH 2D1JA 5E2PA 1B0FA 1GMDF 1L2EA 3LJJA 2CGAA 4AFSA 1KXEA 3MH5A 2VH0A 5L30H 1PYTC 1H4WA 2R9PA 4NIWA 4Y6DA 4B73A 3BTGE 4Y10E 2AEIH 2Z9LA 2ZFSA 1O3PB 1SC8U 1YP9A 1C5UA 2OQ5A 1BZXE 2VH6A 1AB9B 2PGQB 1QGFA 3UQOA 2OCVB 2P3UB 3LC5A 2BDHA 1JXPA 3LIWA 4IMQA 1B7XB 1TMBH 1T8NA 2CF8H 2VVUA 1O5GH 1QRXA 4J1YA 3UR9A 4YT7H 1BMLA 1GBJA 2FODA 1JOUB 3SI3H 3IWMA 1LHDH 5ETXA 3M7TA 1MMJN 4BXSA 1ELBA 1BITA 1LVYA 1O5EH 2ESTE 4JCNA 3ZZ8A 2H6MA 5J4SA 4ABJA 1KTSB 1C2LA 4INKA 2EEKA 3MNXA 1K21H 2G00A 1A5GH 3S7KB 9LPRA 1GJ7B 4DY7B 1ZSLA 2GP9B 3ATIA 1SGFG 2D2DA 1NN6A 3TGKE 3C27B 1L1NA 2CHAB 1SL3A 2WUCA 4GCHF 1K1OA 1CGJE 2VB0A 1MZAA 1QB9A 1ZTKA 2G51A 2Y5FA 4AB9A 1IHSH 3L3TA 4YTAA 1BHXB 1G3CA 5DP7A 1L1JA 3GY4A 1UCYK 1KDQB 2Z3CA 3HKJB 1AVGH 2KAIA 3IG6B 1AO5A 2FI3E 9ESTA 1S83A 5T6FA 2WPJS 3LGVA 1PPZA 1QTFA 4NGAH 1LPKB 4WJG2 5FBIA 3RXEA 1L1GA 1GCTC 1HAZB 2ZKSA 1O2NA 1AE5A 1BDAA 1EZSC 1MKWH 2A4GA 1KLTA 4IGDA 1C2IA 1C5RA 1WTGH 1F5KU 1YCPH 5GIBA 1XXFA 5DJ7A 3RXFA 1HAVB 4UFGH 1K1NA 2VIVA 4DIHH 1HRTH 2GV7A 2J34A 1AIXH 1NC6A 6CHAB 2QA9E 3FZDA 1UTMA 2XC0A 1JWTA 3UOUA 1GI5A 2BD2A 2AFQB 3V0XA 4CH8B 3PTNA 1AU8A 1P2KA 2FOBA 1TOMH 3FAOA 4LZ4B 2EC9H 3BTTE 2VGCC 3C1KA 1C1SA 1P01A 3E8LA 2W3IA 3MO3A 5LPEA 4CR9A 4Y0ZE 4B75A 2VWOA 2ZC9H 4AZ2B 2FI4E 1UVTH 3RU4E 1J9CH 3A7WA 2PLXA 1P2QA 5LPFA 1YPMH 3RXRA 2TPIZ 1IQKA 1ZPCA 4AYYB 5HM2A 1FJSA 1A0JA 1AY6H 1FNIA 2PSYA 1P3EA 1O2OA 1NRNH 1RD3B 5DPAA 1RIWC 3S9BA 1ZZZA 1DXPA 2VWLA 5E0JA 3U8OH 1ZHRA 4ABAA 1ABJH 2ZDAH 2G81E 4UEHH 2BVRH 3ZZ9A 3STIA 5DKMA 4X8SH 1MU6B 3M3TA 2A4RA 1ZMLA 1C5QA 2HRVA 2AMDA 1ANBA 1E38B 4FU7A 5E0GA 3QLPH 5HYOA 2Q6GA 4FUEA 2A7HA 4B76A 3A7TA 3G01A 2FYRA 3UIRA 2HPPH 4MPVA 2R2WU 1KY9A 3NZIA 3BEFB 4YLUA 3S9CA 1DSUA 1BTHH 2FX6A 5DP5A 3RC5A 2FDAA 1PQ8A 1NTPA 1FLEE 1DS2E 1ZLRA 2ZZUH 1PPEE 2CV3A 4BTUB 3BG8A 3ZVCA 2FOHA 1S84A 4QT8C 4ABEA 5JDUB 5L2ZH 1O2JA 3QZRA 3LJOA 2A4QA 5C20A 2ZCHP 3VB6A 3RMMH 1Z1JA 4IN2A 4RN6A 1EJNA 1TRNA 1Z71A 3BEIB 2J2UA 5FCKA 3MH4A 5DG6A 1AB9C 1RTFB 3TJUA 2WINI 3PB1E 1TX6A 2G52A 2TGPZ 4LZ1H 1MTUA 1Y8TA 2ZEBA 4DIIH 1GBCA 1SBWA 2VNTA 4HZHA 1V2OT 1ZSKA 1RRKA 3ESTA 4NIYA 2P93A 1YYY1 1LHFH 1DWEH 2VIPA 1QL8A 1V2WT 4X1NU 3RMNH 3BEUA 1ZMNA 1K28D 3U9AH 1EB1H 3E90B 1Z8RA 1LHCH 3A86A 1DM4B 1O39A 3RP2A 3ODFA 4DT7B 3OYPA 1NFUA 1XUIA 4AFQA 1TE0A 2CHAC 4ISLA 1TNKA 1O2RA 1ANCA 1B5GH 1HAYB 4H4FA 2C93B 3M35A 4DVAU 1V2QT 3K6ZA 1W12U 2UUJB 4JZFH 1INCA 3TLOA 2OBOA 3SU4A 1ORFA 3WY8A 3UNRA 1GJCB 5JBAS 1P9SA 3UTUH 3UNQA 1BRAA 3MMGA 4WMEA 3UUZA 2ZDVH 1W2KH 3UWJH 5H4IB 3URDA 1QBNA 4B2AA 3NXPA 1V2KT 2VIQA 1O37A 3SJ8A 3T29A 2OXSA 1YPGH 4GHQA 1EZUC 1VCPA 3SV2H 1P09A 1SHYA 1CT4E 1GJDB 4IN1A 4NFFA 3RXBA 5JBCS 3W95A 1JIMA 1F92A 5DP6A 2HALA 4A6LA 3LGTA 1S5SA 2ZPSA 1TNJA 3M3SA 2FOCA 2XCNA 2BD3A 1TRYA 1NFWA 3DT0H 4DURA 1LCYA 1GL0E 1C2EA 3A7VA 2PUQH 3Q3XA 6CHAC 2XRCA 3SNBA 2QXJA 3KL6A 3BG4B 2ZFQH 2ANMH 4AX9H 5EODA 1O5DH 2PTCE 2FOMB 3SNCA 5AHGH 1CBWB 1G30B 3GICB 2PFEA 2DE9A 2Q6DA 3SUDA 1QJ6B 3TPIZ 3RXLA 1C2MA 2QV1A 1BTWA 1NRPH 1PPBH 3F9GA 3ZZAA 3KCGH 1GG6B 2B8OH 5FCRA 3MO6A 2H5CA 1KXAA 1C1MA 1B0EA 5ABWA 3UNSA 2XBWA 3UR6A 1HAHH 5ESTE 3S9AA 1BBRH 4I8GA 3H5CB 3T5FH 1C1VH 1FN6A 1WQVH 1G2MA 3RXDA 1K1JA 4FU8A 4ABHA 2A7CA 1V2NT 4CHAB 3M5LA 4K69A 1PPFE 5K7RA 1RGQA 1O2QA 2ANWA 5A0AE 4K5ZA 3A81A 3I78A 2VWNA 1ZHPA 3A83A 1QFKH 4JZEH 1UTNA 1IQNA 2Z3DA 1THPB 1HYLA 1MAXA 3MNCA 3M5NA 3RU4D 3H7OA 1XMNB 2A5IA 4ISOA 1G9IE 4TY7A 5JB9S 2BHGA 1OYTH 2ZCKP 5AFYH 2ZFTA 2Z3EA 1MD8A 1G2LA 1T8OA 2PHBA 4U32A 4XE4A 1LQDB 2PGBB 1EAXA 3A89A 5HMAA 1Y5AT 5F8ZA 2LPRA 2O9QA 1P3CA 2ZFFH 2JH5D 1LVMA 3PV4A 2RA3A 5C67A 4CBOA 3TJVA 3PO1C 4NFEA 2UWLA 2ZGBH 3FANA 1BHXF 1C5PA 1O38A 3U1IB 3MU0A 1O3NA 1P06A 1HAGE 2OD3B 1GHAG 4IW4E 4WXIA 4SGAE 5F8XA 3D23A 1BCUH 3M5MA 1GJAB 1H8IH 4UFEH 4WH8A 3VB4A 2O8TA 1Z7KA 5IYTA 5FX5A 3GOVB 3P92A 1UO6A 1C2DA 2OUAA 3FVFB 2FESH 4A1XA 3RXTA 4X6PA 5C2ZA 3KIDU 1SVPA 3PROA 4BANB 3BIVH 3SU2A 1O2PA 2EI6A 1O3HA 2Z7FE 1TPOA 1QBOA 3M5OA 3A8BA 3CP7A 3U98H 3MHWU 1GDUA 1WU1A 1TQ0B 2H9HA 2GCHG 4B71A 1J15A 4MQAA 1GHAF 4I31A 2C8ZB 3RXVA 1GHXH 3QN7A 2CN0H 2FEQH 2PV9B 5JBBS 1GDNA 3KQEA 1MTVA 4ASHA 3SBKA 1AD8H 1ETSH 3KHVA 1TX7A 2JETB 5F6MA 1THRH 1A5HA 2STBE 2H5DA 1SQTA 1GBDA 1EOLA 1CQQA 1UVUH 3BTKE 4BAOB 1QNJA 1V2VT 2PKAA 1N1LA 2EI7A 4I8KA 1BTUA 1YLDA 1VCWA 3RXGA 3F9FA 3ZVBA 4TPYA 4YO9A 1KIGH 2ZDLA 2J95A 1V2LT 3SGBE 1ABIH 1TQ7B 1ANEA 1QQ4A 4O9VA 2BDYA 1GVZA 1CA0C 2A2XH 4MPWA 3GYLB 2GCHF 1QIXB 1V2PT 5GJ4B 3SI4H 3DHKH 3ZYDA 2GZ9A 1G3BA 2ODPA 4DJZB 1Q2WA 4E7RG 1YPHE 2BDIA 1ELEE 6GCHG 2P8OC 5C1YA 1AUJA 3JZ2B 3UY9A 5T6DA 2QGRA 5FPTA 1MKWK 5B6OA 2HLCA 4K1SA 1T4VH 1WOFA 4U2WA 1GHVH 2ZQ2A 2QAAA 1YCPK 1IQJA 1OP0A 3QGNB 3VPKA 1DLEA 5FXLA 1MTWA 1EQ9A 5EXMA 4X1RU 2AMQA 2UUYA 1ZMJA 4AYVB 4K1TA 1CHGA 1O3OA 2XWBI 1C2KA 1TBQH 1W0YH 1UCYE 3PMJA 5LH8A 1TRMA 1AI8H 1WYKA 2GGVB 2QC2A 1YPLH 2AERH 1C5VA 2BVSH 1ELTA 2J92A 2M5TA 1TGBA 2H9EH 1G37A 4FUJA 2XW9A 3A8CA 1HAIH 1BUIA 5FPSA 4K8YA 5EXLA 3EQ0H 3V12A 3LGUA 2C8WB 1OOKB 3K2UA 1GBKA 1XUJA 4CHAC 1ZYOA 2EA3A 1LO6A 2WPHS 4MNVA 3BSQA 4NA9H 1TONA 3M61U 1P04A 2YNAA 1TPAE 5FPYA 1A1RA 3ZZ4A 7KMEH 2BQ6B 4ZMAH 1XXDA 2HNTE 6GCHF 3VGCB 3LGYA 1NRQH 3ZZ3A 3HK6B 1P8VC 2CJIA 2ZECA 4KP0A 1C1OA 5A8XA 4Y8XA 2FOEA 2GCTB 2FIRH 3E1XB 2OP9A 4ZHMU 1QRWA 1THSH 4WMDA 1MKXH 1O2HA 1BTYA 4CRFA 2A5KA 2VU8E 3A85A 2W3KA 1DX5M 1JBUH 1LPZB 1FY4A 3UOPA 2FWWA 3A8AA 3RLYH 1P2MA 1A5IA 3MNSA 2D26C 4U01A 2A7JA 2ZO3H 4INHA 3RXQA 4BOHA 4RKOB 1BMAA 1HLTH 2G4UA 2NU4E 1Y3XA 2PW8H 1H8DH 2UWOA 4ISIH 1ESAA 1F5LA 3RM2H 3ATKA 1YGCH 1MCTA 3TK6A 1KLIH 2ZQ1A 5GWZA 2GZ8A 3TK9A 1DPOA 1FZZA 1C5ZB 2FP7B 2XXLA 3NCLA 2OTVA 2PSXA 3E6PH 4E05H 1XUGA 1BMMH 1RXPA 4CBNA 2OINA 3EE0B 2ILNA 2WPMS 4F4OC 1GCDA 3PM3A 2BY7X 4FUFA 2Q1JA 4ZHAA 5JB8S 4Y7AA 1PPGE 4ZAEA 3O8RA 4Q7YA 3ZZCA 5C5OA 2BMGB 3SHAH 3LGIA 3SQHE 4JK6A 3GY3A 3QZQA 4NCYA 1C2JA 3B8JA 5A09A 2AYWA 4ZH8A 2BDGA 3ODDA 1O2SA 2R0KA 3UQVA 1Y3VA 2LNCA 1DWDH 2FTLE 3U69H 5GXPA 1HJAC 4OGXA 1YBWA 1H9LB 2ZPQA 2F83A 3HGPA 4ZUHA 3T2NA 1LVBA 2GT8A 1ACBE 2PUXB 2SFAA 1GMCG 2JH0D 5L2YH 4YESB 1HXEH 1GHBG 1DE7H 2FOAA 3BN9A 4X2WA 1ZR0A 5PTPA 1VGCC 2P59A 3TK5A 2JETC 3AAVA 2CMYA 1EPTC 1MUEB 3GDSA 1DLKB 1F0SA 1SGCA 4TY6A 5DP9A 2WV4A 2BY8X 1GI8B 5CMXH 1F0RA 1OWJA 1FV9A 1P12E 3ZZ5A 4H42U 1EPTA 1PQ5A 2ODQA 3PWCA 4UD9H 2SGAA 3SORA 5A0CA 1AKSB 2ZNKH 3MU8A 3SU1A 1HIAB 4WY3A 1MTSA 4AORA 4D76A 3O8CA 3S0NA 1EXFA 1UHBB 2G55A 2Z94A 1GBLA 3EDXB 3RXPA 1VJAU 1VZQH 3A7YA 1PPHE 3HGNA 1DXWA 1A0LA 4X2XA 2XBYA 3SV9A 4ABIA 1GMCF 4GSOA 2GD4B 1F2SE 1QHRB 3SNEA 3VFEA 3RU4T 1GHYH 1NT1A 1ARBA 1O30A 2J9NA 5EQSA 3OY5U 4XSKU 1SHHB 1GHBF 1LVOA 4GHTA 5T6GA 1T7CA 3F9EA 3FP6E 1IHTH 1FQ3A 4I33A 1GI7B 1QA0A 4X1QU 2PWXA 1TGSZ 1NROH 3EYDA 3E0PB 4Y0YE 1FMGA 2BLWA 1PQAA 3STJA 3OU0A 4MDSA 1DDJA 1M9UA 1TNGA 1DICA 1P57B 3LU9B 4KTSA 3VEQB 2H1UA 1TLDA 2XC4A 3RC4A 1O3BA 1NU7B 1TMUH 4LXBH 4A5TS 2I6SA 1D6WA 1H9HE 1MD7A 3EAJA 3GY8A 3M36A 2BY9X 3PO1B 1DWBH 1GDQA 3K6YA 1SFIA 3B23B 2BM2A 4H6TA 1K1LA 3VGCC 1EB2A 1C9PA 1O2GH 4MNYA 1S0RA 1WSSH 1YPEH 3ATLA 1TMTH 2BX3A 1G3EA 2GCTC 4NA7A 4NA8A 4FUDA 3A87A 4WWYA 1BBRK 1OYQA 1O5CB 3GDUA 4IS5A 3KQCA 3RXAA 3V13A 2BD4A 1O2YA 1JMOH 1NFXA 2ZA5A 2FS9A 2QYIA 3KEEA 1HV7A 5AF9H 1TAWA 3L33A 1C1PA 1XUKA 3R3GB 1HXFH 5EGMA 4NZLA 1ZJDA 3OTJE 1Z8IB 4MLFB 2TRMA 4Q2KA 3O8DA 3HATH 1SGPE 1SI5H 1C5NH 2F9VA 1OX1A 3TH4H 1T8LA 1BMNH 1O5BB 2FZZA 3RUOA 4YM9A 1Y59T 4Z0KA 1W14U 4ZROA 1HGTH 1S81A 1MAYA 3A7XA 1LHGH 2SGFE 3BTME 1O3IA 2QN5T 4KELA 2NWNA 4K60A 1GJ8B 2SGPE 3DFLA 3CS0A 5DP3A 1YM0A 2PKAB 3BIUH 2XC5A 3KF2A 1IQEA 1TGTA 2R3YA 5F8TA 2FO9A 2VJ1A 3HK3B 1C5MD 2QF0A 3VB7A 1GI9B 2P94A 3QWCH 1HPGA 2QCYA 4XOJA 1S0QA 4MTBA 5EQRA 1GBTA 4Y8YA 3PTBA 2BQWB 4X1SU 1OKXA 1BJUA 2ZI2H 1SGDE 2AIPA 5L6NH 2THFB 5EPNA 1RTLA 1ZSJA 1LMWB 1O2LA 4D8NA 2ZGCA 1YCPM 4BTTB 3SJIA 1CA0B 1W7GH 4AG2A 6LPRA 2ZTXA 3FFGA 4Z6AH 1RS0A 2FOGA 1C1QA 2FLRH 2XCFA 3SV7A 3KQDA 1VJ9U 1X7AC 3SQEE 4OS1A 5BPEA 2CXVA 2P8OB 4KTUA 1C1NA 1L0ZA 1ZTLA 2GDDA 1HJ9A 1Z8GA 4O97A 1L4DA 1C5WB 2FS8A 3SOSA 1RFNA 1BRUP 1A46H 3TGJE 3V7TA 2ALPA 1AE8H 1UVPA 1KLJH 2B5TB 3NWUA 1KYNA 4H6SB 2W5EA 3ITIA 1AWHB 1KSNA 3P8NA 1GJ5H 2OC1A 4AN7A 2FM2A 1O3AA 1AKSA 2STAE 1HIAA 1HFDA 2XWAA 2ALVA 2GX4A 4ABFA 8LPRA 1UHBA 1NY22 3MU4A 1ELAA 2YNBA 1GJ4H 1W3CA 2QXIA 1TBZH 2BOHB 3BTHE 3O8BA 1C5YB 1O3LA 8ESTE 1P03A 1BTPA 1ZGVA 1ZRBA 1W8BH 1EAWA 1TOCB 5CHAC 2ZHQH 1P10A 1HCGA 3MH6A 4CR5A 4XDEA 3P8GA 3TJNA 2WUBA 1SPJA 1CO7E 2F3CE 1RJXB 3ZZBA 3RXIA 2WPLS 4MPUA 1A2CH 1QY6A 2ZDNA 1GI1A 5AVDA 1K1MA 5G4BA 7GCHG 3RXOA 4DGJA 1QRZA 2HVXA 2ANYA 4AGJA 2BOKA 4X0WU 2AMPA 3ENSB 1D3PB 1C4Y2 3RXHA 1TNLA 1O2XA 1O3MA 3E3TA 2Y7XA 1JRTA 3BV9B 2SNVA 4Y79A 4AFZA 1ELVA 3PLBA 7LPRA 2ZFPH 3M3VA 3HKIB 3VB5A 1FY5A 4OS2A 2BYAX 3BTDE 3VXFH 2TGAA 3GDVA 2ASUB 1PYTD 4OS4A 1UMAH 4ZXXH 3LOXA 3ZVDA 8GCHG 1Z6EA 4LOYH 2C3SA 5GCHG 2GV6A 3OSYA 3RMOH 3D62A 3N7OA 1LQEA 4MVNA 4ABDA 1MQ6A 1AFEH 2AGIX 2R2MB 1KTTB 3VB3A 1T32A 4CRDA 5IDKA 7GCHF 2UUKB 1CVWH 2F91A 4F49A 4D9RA 1QJ1B 1D3TB 2BZAA 2ULLA 1TPPA 1HAOH 2Y5HA 2WPIS 4I7YH 2VIWA 1C5SA 5A2MH 1HJAB 1V2ST 1BIOA 3D49H 3GCNA 3SU6A 1YPJH 1AGJA 4CRBA 1FDPA 2ZGXH 1P9UA 1Q31A 1VITH 2BTCE 5CE1A 1E35B 4HFPB 3I29A 1MKXK 1K22H 1SGEE 2NU0E 1UTJA 1G32B 4WMFA 3Q3KA 4NIVA 4Q7ZA 3SU0A 1CSOE 1VGCB 1SGYE 1W11U 3ZYEA 1BT7A 1SLVB 5SGAE 5T3HA 1EPTB 3A80A 1O2KA 1C2FA 8GCHF 1MBQA 2FTMA 2FYQA 5ESBA 4VGCB 1QA7A 1O3EA 1ELGA 1O36A 2ZPRA 2TIOA 3QTOH 3AVZA 1G36A 1WTHD 1YF4A 2AH4X 1XKBC 2ZU3A 3GISB 1O3KA 1XVMA 5TJXA 1TB6H 2Y80A 1SQAA 1FAXA 1WV7H 2BXTH 2OC8A 4GPGA 1GJBB 2PTNA 1LPGB 5JPMH 5JYIA 3F6UH 1GI3A 4TPIZ 2BDCA 4J2YB 2Q6FA 1CHOG 2BDAA 3LC3A 2GDEH 4D7GA 4I8JA 1BTXA 2AGEX 2HOBA 5EW1H 1K1PA 1ID5H 1DT2A 2WV5A 1XUFA 1XVOA 4JZDH 2QY0B 4K2YA 1QL7A 1O34A 4MG3A 4IC5A 1ZPZA 1NM6A 1O33A 2RA0A 2FMJA 2BY5X 2K1QA 3GCHB 3DD2H 3MNBA 5EPYA 1UTOA 2ZIQH 4CRCA 4GVUA 3QGJA 1LTOA 3ZVGA 1J16A 1SB1H 1RTKA 3KQBA 1F5RA 1L4ZA 1S6HA 1SLXB 1K9OE 3CS7A 3PLPA 3DUXH 3MFJA 4NWLA 5A8YA 4K8BA 5I46H 1NS3A 1TABE 1P2JA 2D8WA 1K1IA 3UREA 2ZCLP 1S85A 1ZGIA 1F0TA 1KXBA 5A0BA 1HNEE 2G8TA 2B9LA 1CHOF 1YC0A 2Z9IA 3ATMA 2VVVA 3KGPA 3Q3YA 4OS5A 3Q76A 1QL9A 2BD7A 3R0FA 2GVFA 4FUCA 4AOQA 3NK8A 1E37B 2DE8A 4JYUH 1WQSA 2A32A 1P2IA 3ATWA 1A3BH 1WUNH 2VINA 3SJ9A 3SV8A 3TVJB 2SGQE 2XBVA 1K2I1 1MZDA 4X8TH 4Y76A 3ZVFA 1UK2A 2BQ7B 3PLKA 3W94A 1FY1A 4MNWA 3ZV8A 4X2VA 3PMBB 4IC6A 4XFQA 2Z9KA 4GCHG 1GPZA 3RDZA 1PQ7A 2F9BH 1DOJA 1YPKH 4UONA 2R3UA 3E91A 1UTQA 2NU3E 3S69A 5EW2H 2AIQA 3QDZB 2AS9A 2FXRA 2Y7ZA 2ZDMA 4AB8A 2ZDKA 1ELFA 4DCDA 2BD8A 1A7SA 2ZHWH 1O5FH 4OGYA 4O03A 1NO9H 3FP8E 4GUXA 1TIOA 3CENA 3SUEA 1U6QA 3GYMA 4HTCH 1HUTH 1TALA 2A0QB 2F9NA 3UPEA 4UDWH 1NRSH 3A82A 1T31A 1DITH 2ZHDA 1QB6A 2V35A 1HJ8A 2OC0A 5DP8A 2ANKH 1W10U 1CA8B 3BTFE 1DWCH 3EGKH 4WVPE 3OY6U 3F9HA 1O3GA 1OS8A 2Y81A 3SGAE 1GI0A 1DVAH 4OS6A 4X8UH 1AMHA 1EAUA 3Q77A 3JZ1B 1MTNC 2O8WA 3SUGA 3U8TH 4LK4A 3PYHA 3EA7A 1O35A 2J38A 3RC6A 4X2YA 1IOEA 3F1SB 2NU1E 3NKKA 3TH2H 1VCQA 1PPCE 2F9OA 3SNAA 1IAUA 1V2TT 4FU9A 1GVKB 4OS7A 2RCEA 3GY2A 3GY7A 2JH6D 3FP7E 1C5LH 1BTZA 3GY5A 4A92A 1TNIA 1ZOMA 2HGTH 4A1TA 2XYAA 2ZU4A 3TGIE 1AVXA 2VWMA 3IITA 1CT2E 1D9IA 4KTCA 1IQHA 3K65B 1AFQB 1A3EH 3M37A 1ANDA 5E8EH 1DY9A 1AZ8A 1DANH 1V2MT 3A84A 3P8OA 4K3JA 2J4IA 3GCOA 1SFQB 1AVWA 1GGDC 4FUIA 5LPRA 4X6NA 3MO9A 2IOTA 1NU9A 3EA9A 1Z8JB 4VGCC 4JMYA 2F9UA 5I25A 1QQUA 4B74A 4U30A 4JK5A 3LKWA 4ZHLU 3A88A 1Y3YA 5J4QA 2FOFA 2P16A 4I32A 1F7ZA 1O3CA 1FUJA 5TCCA 3OX7U 4JZ1A 3P8FA 2BZ6H 1CE5A 3MU5A 4XBDA 1EAIA 2ZG0H 1O32A 1FIZA 3NUMA 1BBRE 3TNTA 2GMTB 2A31A 1D3QB 3BTEE 4BAMB 1UJ1A 1IQGA 1N8OC 3SO3A 1T8MA 1UVSH 4JYTA 1E0FD 4M7GA 2XNIA 4DW2U 1C1WH 1TA6A 3ZZ7A 2BLQA 1Y5UT 3MH7A 3PMAB 2PKSB 2P3FH 2G4TA 1OWKA 1GBIA 1MH0A 3GCHC 1SOZA 4ZXYH 3B9FH 3LDXH 1Q3XA 3E16B 4ZKSU 3A7ZA 1VITG 1QB1A 2TGTA 4K1EA 1YKTA 1GMHG 5CHAB 3TU7H 1Y5BT 2VVCA 3ZZ6A 1GHZA 1O0DH 3GY6A 1W0ZU 2W7UA 2Y6TA 1HAXB 1FN8A 1NESE 3MWIU 1SOTA 3SN8A 4CRAA 5LGOA 3URCA 4Y71A 4BAKB 1OWIA 4X6OA 2A4OA 2W26A 1HDTH 1CU1A 1S82A 4MNXA 3SJOA 3T27A 4CH2B 3TNSA 3M7QA 1EATA 1W7XH 1O3DA 2BLOA 3EA8A 2VIDA 4DOQA 1SSXA 4MPXA 2G5VA 3P95A 4ZKNU 5C3NA 5C1UA 4BXWA 2B0FA 4BAQB 1ESTA 4SGBE 4B1TA 2A45B 2J94A 1ZTJA 3LH1A 2C8XB 1DSTA 1TBRH 1N6YA 1F0UA 1BRBE 1UCYH 2HWLB 1AQ7A 1O3JA 3T26A 1PJPA 1V3XA 3AW1A 5F03A 1AZZA 1P05A 1E36B 3UWIA 2GKVE 1VITF 3MU1A 1GHWH 4YZUA 1GMHF 2CF9H 1EASA 2OC7A 2P3TB 2BDBA 3DFJA 1MCVA 3ZV9A 5E0HA 2RDLA 4XBCA 3P6ZB 2EI8A 2V3OH 2V3HH 4XBBA 1SR5C 3A8DA 4TWWA 4Q7XA 3SZNA 1KXDA 3ZVEA 1NFYA 3PWBA 1IQLA 1DY8A 1OPHB 2H2ZA 3FZZA 1HAPH 1TYNA 1FXYA
chains in the Genus database with same CATH superfamily
1Y3UA 5AFZH 1C5OH 2J5UA 4JZIA 4YOIA 4AFUA 1SGTA 1LKBA 2TBSA 3RMLH 2C4FH 1AWFH 1OWEA 1H9IE 4R0IA 2FPZA 3CNRA 1FPHH 1Z6JH 5HM9A 2G5NA 1C5TA 3P70B 1G3DA 3LT3A 2V6NA 3SYJA 2VIOA 2I6QA 2QXGA 4KGAA 4B2BA 2IJOB 4WXVA 4WF8A 3TITA 1BB0B 1SLUB 4FXGH 4FUGA 4HI3A 4UFDH 4FUHA 3NPSA 1QURH 1SG8B 4GAWA 1FI8A 5C5NA 1FONA 4RKJB 5DGJA 2ZP0H 1TFXA 3LPRA 3SU5A 4I8HA 5EG4A 2HPQH 3RM0H 4NWKA 1J14A 1GBFA 4NIXA 1UK4A 1C1RA 4ISNA 4FUBA 3KNXA 1EJAA 5GPIB 1O3FA 3BF6H 1SQOA 4Y8ZA 4ABGA 1SMFE 1KXCA 4ASUD 1LKAA 3QK1A 2JKHA 4FVBA 3FOAA 1FY8E 1YLCA 4Q4LA 4YOGA 1KDQA 3DA9B 5FHTA 1TNHA 1IQFA 1P11E 4PROA 2SGDE 2XBXA 4AGKA 1XX9A 2K8IA 1OWDA 3ZVAA 3L6PA 6ESTA 2BD5A 1P2OA 4THNH 4R8TB 1AFQC 1ZPBA 4ZKRU 1C5XB 4Q80A 1V2JT 1P02A 2GT7A 1ELDE 1MU8B 1UTPA 3MTYA 1EOJA 3VXEH 1T4UH 4D9QA 3D65E 2FI5E 3U1JB 1O2VA 1O2TA 3GCTG 3RLWH 3V3MA 1A4WH 2ZFRH 1SGNE 3RXJA 1C4U2 3MOCA 1FY3A 2ZHFH 4JYVH 2QIQA 2FLBH 2A5AA 1HAVA 2Z9GA 1OP2A 1CT0E 1JRSA 1TWXB 4AG1A 2RFKC 4BTIB 1D6RA 2GMTC 4CRGA 2IPHA 1EX3A 1N6XA 1GI6A 4YOJA 4UFFH 4XD7D 4BNRA 4E7NA 1QJ7B 3P17H 1O2MA 5C1XA 4ISHH 3BTQE 2PKSC 4BAHB 1YPHC 1Y3WA 2WYJA 2OQUA 1O31A 5E2OA 4X6MA 1O2UA 1SGIB 2Z6BD 3PMHB 1OWHA 1S6FA 3OEED 4RSPA 3RXSA 3K9XB 5TCAA 3T25A 3SHCH 2BX4A 1GBAA 3Q00A 4NZQA 3GCTF 1AUTC 1Z1IA 2FX4A 3H7TA 5EJLA 1NZQH 1W13U 2ZHEH 3RXKA 1TGNA 1HB0B 1EP5A 3ELAH 1EUFA 2W7SA 1TX8A 2UWPA 4NSYA 2WYGA 4AC9A 4B2CA 2Y82A 1EZXC 4GLYA 5EXNA 1XKAC 4YT6H 1O5AB 1SGQE 3U28C 2AGGX 1UVOA 1VR1H 1FIWA 1HBTH 2GTBA 1GBBA 2GZ7A 1KXFA 2IN2A 4ZKOU 1D3DB 1PFXC 2O8MA 2F9PA 2W6JD 5BRRE 2SNWA 2XTTB 3AW0A 3I77A 3RXMA 2ZWLH 2HNTC 2ZTZA 1ZHMA 2BVXH 1WXRA 4P02A 1AHTH 1TGCA 1OSSA 1C1UH 4ABBA 1GL1A 1C1TA 2OLGA 5HGGA 1V2UT 1GBHA 4NG9H 3MYWA 1ZJKA 4TWYA 2A2QH 2O8UA 2DUCA 2RG3A 3HPTB 4E06H 1H8HD 4Y7BA 3AAUA 1IQIA 3QUMP 4TYDA 3SU3A 2ZU1A 5DP4A 3KN2A 4D7FA 3ZZDA 1GVLA 2O8LA 2JIZD 1MTNB 5A8ZA 4HGCA 1ESBA 1SGRE 1NPMA 4NSVA 2KAIB 3T28A 3LGWA 2C90B 7ESTE 2QXHA 2V0BA 3LH3A 1MQ5A 3F0OA 1GJ6A 1OP8A 1E34B 4A1VA 1C2HA 5HXFA 1CGIE 2ZTYA 1LHEH 1H1BA 1ELCA 4IMZA 5FX6A 1TPSA 1BMFD 2BB4A 1BRCE 4ACBA 1GCTB 5EOKA 1UTLM 4A7IB 2ZU5A 1QBVH 3OAAD 1BOQA 2BXUH 1NRRH 1C9TA 2IJD1 3QTVH 1FAKH 1CGHA 1GJ9B 1DFPA 1GWAA 1V6DA 5GDSH 1UTKA 2YOLA 3QO6A 1W0JD 1GGDB 1C4V2 2C8YB 2W6ID 3RXUA 5DO4H 1BA8B 2OBQA 1ETTH 2ZU2A 2ODYB 4X1PU 5GCHF 4FVDA 1WBGB 2H9TH 2ZGHA 1V2RT 2Y5GA 4O3UA 2NU2E 3VG8A 1O2WA 2WPKS 1O2ZA 3BTWE 2B7DH 3F68H 2RDEA 4UE7H 4O3TA 1EKBB 1TA2A 8KME2 1FPCH 2R0LA 2Z9JA 1XM1A 1XUHA 4I8LA 3TIUA 1BQYA 2SGEE 2VGCB 5EQQA 3SGQE 4ESTE 2ZF0H 3TH3H 1EP6A 5JBTA 1QR3E 1WCZA 3T62A 1N8OB 2QF3A 3UFAA 3SV6A 4DG4A 3AASA 1DUEA 2P95A 2BY6X 1LDTT 3SW2B 3RXCA 1ZRKA 1QCPA 1AN1E 3M7UA 1GMDG 5K0HA 3S7HB 1A0HB 2A1DB 1D4PB 1EJMA 2BD9A 5HIZA 3U8RH 1GI2A 3SJKA 2ZGJA 4X8VH 4Y11E 1RIWB 1DUAA 2KX4A 1O2IA 3TJOA 1GI4A 5EU8A 3SUFA 1GBEA 1SLWB 5FAHA 4RT1A 1OXGA 1WAYB 1P0SH 2PR3A 2BLVA 5FBEA 1EZQA 1A61H 1JIRA 1IQMA 3BG4C 1BJVA 3MI4A 2UUFB 1C2GA 4WH6A 1CBWC 1SGFA 2QF4A 1ARCA 5DK1A 1GBMA 3E0NB 1J17T 1MBMA 3SNDA 1J8AA 1UK3A 4INLA 2TGDA 4CREA 2HNTF 3LONA 3QX5H 1P2NA 4KKDA 1ETRH 1GG6C 4YLQH 4IBLH 2D1JA 2JJ2D 3WW7A 5E2PA 1B0FA 1GMDF 1L2EA 3LJJA 2CGAA 4AFSA 1KXEA 3MH5A 2VH0A 5L30H 1PYTC 1H4WA 2R9PA 4NIWA 4Y6DA 4B73A 3BTGE 4Y10E 2AEIH 2Z9LA 2ZFSA 1O3PB 1SC8U 1YP9A 1C5UA 2OQ5A 1BZXE 2VH6A 1AB9B 2PGQB 1QGFA 3UQOA 2OCVB 2P3UB 3LC5A 2BDHA 1JXPA 3LIWA 4IMQA 1B7XB 1TMBH 1T8NA 2CF8H 2VVUA 1O5GH 1QRXA 4J1YA 3UR9A 4YT7H 1BMLA 1GBJA 2FODA 1JOUB 3SI3H 3IWMA 1LHDH 5ETXA 3M7TA 1MMJN 4BXSA 2YMSC 1ELBA 1BITA 1LVYA 1O5EH 2ESTE 4JCNA 3ZZ8A 2H6MA 5J4SA 4ABJA 1KTSB 1C2LA 4INKA 5EJ1A 2EEKA 3MNXA 1K21H 2G00A 1A5GH 3S7KB 2LP6A 9LPRA 1GJ7B 4DY7B 1ZSLA 2GP9B 3ATIA 1SGFG 2D2DA 1NN6A 3TGKE 3C27B 1L1NA 2CHAB 1SL3A 2WUCA 4GCHF 1K1OA 1CGJE 2VB0A 1MZAA 1QB9A 1ZTKA 2G51A 2Y5FA 4AB9A 1IHSH 3L3TA 4YTAA 1BHXB 1G3CA 5DP7A 1L1JA 3GY4A 1UCYK 1KDQB 2Z3CA 3HKJB 1AVGH 2KAIA 3IG6B 1AO5A 2FI3E 9ESTA 1S83A 5T6FA 2WPJS 3LGVA 1PPZA 1QTFA 4NGAH 1LPKB 4WJG2 5FBIA 3RXEA 1L1GA 1GCTC 1HAZB 2ZKSA 1O2NA 1AE5A 5CHBA 1BDAA 1EZSC 1MKWH 2A4GA 1KLTA 4IGDA 1C2IA 1C5RA 1WTGH 4YXWD 1F5KU 1YCPH 5GIBA 1XXFA 5DJ7A 3RXFA 1HAVB 4UFGH 1K1NA 2VIVA 4DIHH 1HRTH 3H09A 2GV7A 2J34A 1AIXH 1NC6A 6CHAB 2QA9E 3FZDA 1UTMA 2XC0A 1JWTA 3UOUA 1GI5A 2BD2A 2AFQB 3V0XA 4CH8B 3PTNA 1AU8A 1P2KA 2FOBA 3N7EA 1TOMH 3FAOA 4LZ4B 2EC9H 3BTTE 2VGCC 3C1KA 1C1SA 1P01A 3E8LA 2W3IA 3MO3A 5LPEA 4M9FA 4CR9A 4Y0ZE 4B75A 2VWOA 2ZC9H 4AZ2B 2FI4E 1UVTH 3RU4E 1J9CH 3A7WA 2PLXA 1P2QA 5LPFA 1YPMH 3WWBA 3RXRA 2TPIZ 1IQKA 1ZPCA 4AYYB 5HM2A 1FJSA 1A0JA 1AY6H 1FNIA 2PSYA 1P3EA 1O2OA 1VKYA 1NRNH 1RD3B 5DPAA 1RIWC 3S9BA 1ZZZA 1DXPA 5EIYA 2KCPA 2VWLA 5E0JA 3U8OH 1ZHRA 4ABAA 1ABJH 2ZDAH 2G81E 4UEHH 2BVRH 3ZZ9A 3STIA 5DKMA 4X8SH 1MU6B 3M3TA 2A4RA 1ZMLA 1C5QA 2HRVA 2AMDA 1ANBA 1E38B 4FU7A 5E0GA 3QLPH 5HYOA 2Q6GA 4FUEA 2A7HA 4B76A 3A7TA 3G01A 2FYRA 3UIRA 2HPPH 3UAIC 1UW7A 2R2WU 4MPVA 1KY9A 3NZIA 3BEFB 4YLUA 3S9CA 1DSUA 1BTHH 2FX6A 5DP5A 3RC5A 2FDAA 1PQ8A 1NTPA 1FLEE 3OEHD 1DS2E 1ZLRA 2ZZUH 1PPEE 2CV3A 4BTUB 3BG8A 3ZVCA 2FOHA 1S84A 1KMHB 4QT8C 4ABEA 2KCOA 5JDUB 5L2ZH 4ACAA 1O2JA 3QZRA 3LJOA 2A4QA 5C20A 2ZCHP 3VB6A 3RMMH 1Z1JA 4IN2A 4RN6A 1EJNA 1TRNA 1Z71A 3BEIB 2J2UA 5FCKA 3MH4A 5DG6A 1AB9C 1RTFB 3TJUA 2WINI 3PB1E 1TX6A 2G52A 2TGPZ 4LZ1H 1MTUA 1Y8TA 2ZEBA 4DIIH 1GBCA 1SBWA 2VNTA 4HZHA 1V2OT 1ZSKA 1RRKA 3ESTA 4NIYA 2P93A 1YYY1 1LHFH 1DWEH 2VIPA 1QL8A 1V2WT 4X1NU 3RMNH 3BEUA 1ZMNA 1K28D 3U9AH 1EB1H 3E90B 1Z8RA 1LHCH 3A86A 1DM4B 1O39A 5B6LA 3RP2A 3ODFA 4DT7B 3OYPA 1NFUA 1XUIA 4AFQA 1TE0A 4Q63A 2CHAC 4ISLA 1TNKA 1O2RA 1ANCA 1B5GH 1HAYB 4H4FA 2C93B 3M35A 4DVAU 1V2QT 3K6ZA 1W12U 1EFRD 2UUJB 1INCA 4JZFH 3TLOA 2OBOA 3SU4A 1ORFA 3WY8A 3UNRA 1GJCB 5JBAS 1P9SA 3UTUH 3UNQA 1BRAA 3GS9A 3MMGA 4WMEA 3UUZA 2ZDVH 1W2KH 3FKSD 3UWJH 5H4IB 3URDA 1QBNA 4B2AA 3NXPA 1V2KT 5T1VA 2XNDD 2VIQA 1O37A 3SJ8A 3T29A 2OXSA 1YPGH 4GHQA 1EZUC 1VCPA 3SV2H 1P09A 1SHYA 1CT4E 1GJDB 4IN1A 4NFFA 3RXBA 5JBCS 3W95A 1JIMA 3PV2A 1F92A 5DP6A 2HALA 5HIYA 3LGTA 4A6LA 1S5SA 2ZPSA 1TNJA 3M3SA 2FOCA 2XCNA 2BD3A 1TRYA 1NFWA 3DT0H 4DURA 1LCYA 1GL0E 1C2EA 3A7VA 2PUQH 3Q3XA 6CHAC 2XRCA 3SNBA 2QXJA 2JJ1D 3KL6A 3BG4B 2ZFQH 2ANMH 4AX9H 5EODA 1O5DH 2PTCE 2FOMB 3SNCA 4RT0A 5AHGH 1CBWB 1G30B 3GICB 2PFEA 2DE9A 2Q6DA 3SUDA 1QJ6B 3TPIZ 3RXLA 1C2MA 2QV1A 1BTWA 1NRPH 3N99A 1PPBH 3F9GA 3ZZAA 3KCGH 1GG6B 2B8OH 5FCRA 3MO6A 2H5CA 1KXAA 1C1MA 1B0EA 5ABWA 3UNSA 2XBWA 3UR6A 1HAHH 5ESTE 3S9AA 1BBRH 4I8GA 3H5CB 3T5FH 3W1EA 1C1VH 1FN6A 5C0UA 1WQVH 1G2MA 3RXDA 1K1JA 4FU8A 4ABHA 1QZ8A 2A7CA 1S6LA 1V2NT 4CHAB 3M5LA 5DN6D 4K69A 1PPFE 5K7RA 1RGQA 1O2QA 2ANWA 5A0AE 4K5ZA 3A81A 3I78A 2VWNA 1ZHPA 3A83A 1QFKH 4JZEH 1UTNA 1IQNA 2Z3DA 1THPB 1HYLA 1MAXA 3MNCA 3M5NA 3RU4D 3H7OA 1XMNB 2A5IA 4ISOA 1G9IE 4TY7A 5JB9S 2BHGA 1OYTH 2ZCKP 5AFYH 2ZFTA 4ZCNA 2YMSB 2Z3EA 1MD8A 1G2LA 1T8OA 2PHBA 4U32A 4XE4A 1LQDB 2PGBB 1EAXA 3A89A 5HMAA 1Y5AT 5F8ZA 2LPRA 2O9QA 1P3CA 2ZFFH 2JH5D 1LVMA 3PV4A 2RA3A 5C67A 4CBOA 3TJVA 3PO1C 4NFEA 2UWLA 2ZGBH 3FANA 1BHXF 1C5PA 1O38A 3U1IB 3MU0A 1O3NA 2GJGA 1P06A 1HAGE 2OD3B 1GHAG 4IW4E 4WXIA 4SGAE 5F8XA 3D23A 1BCUH 3M5MA 3N7DA 1GJAB 2HVYB 1H8IH 4UFEH 4WH8A 3VB4A 2O8TA 1Z7KA 5IYTA 5FX5A 3GOVB 3P92A 1UO6A 1C2DA 2OUAA 3FVFB 2FESH 4A1XA 3RXTA 4X6PA 5C2ZA 3KIDU 1SVPA 3PROA 4BANB 3BIVH 3SU2A 1O2PA 2EI6A 1O3HA 2Z7FE 1TPOA 1QBOA 3M5OA 3A8BA 5KGOA 3CP7A 3U98H 3MHWU 1GDUA 1WU1A 1TQ0B 2H9HA 2GCHG 4B71A 1J15A 4MQAA 1GHAF 4I31A 2C8ZB 3RXVA 1GHXH 3QN7A 2CN0H 2KCAA 2FEQH 3F2GA 2PV9B 5JBBS 1GDNA 3KQEA 3F3BA 1MTVA 4ASHA 3SBKA 1AD8H 1ETSH 3KHVA 1TX7A 2JETB 5KECA 5F6MA 5HKKD 1THRH 1A5HA 2STBE 2H5DA 1SQTA 1GBDA 2KFWA 1EOLA 1CQQA 1UVUH 3BTKE 4BAOB 1QNJA 1V2VT 2PKAA 1N1LA 2EI7A 4I8KA 1BTUA 1YLDA 1VCWA 3RXGA 3F9FA 3ZVBA 4TPYA 4YO9A 1KIGH 2ZDLA 2J95A 1V2LT 3SGBE 1ABIH 1TQ7B 1ANEA 1QQ4A 4O9VA 2BDYA 5DSFA 1GVZA 1CA0C 2A2XH 4MPWA 3GYLB 2GCHF 1QIXB 1V2PT 5GJ4B 3SI4H 3DHKH 2WHXA 2GZ9A 4P00A 3ZYDA 1G3BA 2ODPA 4DJZB 1Q2WA 4E7RG 3F0PA 1YPHE 2BDIA 1ELEE 6GCHG 2P8OC 5C1YA 1AUJA 3JZ2B 3UY9A 5T6DA 2QGRA 5FPTA 1MKWK 5B6OA 2HLCA 4K1SA 1T4VH 1WOFA 4U2WA 1GHVH 2ZQ2A 2QAAA 1YCPK 1IQJA 1OP0A 3SZEA 3QGNB 3VPKA 1DLEA 5FXLA 4Z1MD 1MTWA 3ZIAD 1EQ9A 5EXMA 4X1RU 2AMQA 2UUYA 1ZMJA 4AYVB 4K1TA 1CHGA 1O3OA 2XWBI 1C2KA 1TBQH 1W0YH 1UCYE 3PMJA 5LH8A 1TRMA 1AI8H 1WYKA 2GGVB 2QC2A 1YPLH 2AERH 1C5VA 2BVSH 1ELTA 2J92A 2M5TA 5C94A 1TGBA 2H9EH 1G37A 4FUJA 2XW9A 3A8CA 1HAIH 1BUIA 5FPSA 4K8YA 5EXLA 3EQ0H 3V12A 3LGUA 2C8WB 1OOKB 3K2UA 1GBKA 1XUJA 4CHAC 1ZYOA 2EA3A 1LO6A 2WPHS 4MNVA 3BSQA 4NA9H 1TONA 3M61U 1P04A 2YNAA 1TPAE 5FPYA 1A1RA 3ZZ4A 7KMEH 2BQ6B 4ZMAH 1XXDA 2HNTE 6GCHF 3VGCB 1OHHD 1NRQH 3LGYA 3ZZ3A 3HK6B 1P8VC 2CJIA 2ZECA 4KP0A 1C1OA 5A8XA 4Y8XA 2FOEA 2GCTB 2FIRH 3E1XB 3KYFA 2OP9A 4ZHMU 1QRWA 1THSH 2J98A 4WMDA 5F53A 2OK5A 1MKXH 1O2HA 1BTYA 3AK5A 4CRFA 2A5KA 2VU8E 3A85A 2W3KA 1DX5M 1JBUH 1LPZB 1FY4A 3UOPA 2FWWA 3A8AA 3RLYH 1P2MA 1A5IA 3MNSA 2L74A 2D26C 4U01A 2A7JA 2ZO3H 4INHA 3RXQA 4BOHA 4RKOB 1BMAA 1HLTH 2G4UA 2NU4E 1Y3XA 2PW8H 1H8DH 2UWOA 4ISIH 1ESAA 1F5LA 1MABB 3RM2H 3ATKA 1YGCH 1MCTA 3TK6A 1KLIH 2ZQ1A 5GWZA 2GZ8A 1K0HA 3TK9A 1DPOA 1FZZA 1C5ZB 2FP7B 2XXLA 3NCLA 2OTVA 2PSXA 3E6PH 4E05H 1XUGA 1BMMH 1RXPA 4CBNA 2OINA 3EE0B 2ILNA 2WPMS 4F4OC 1GCDA 3PM3A 2BY7X 4FUFA 2Q1JA 4ZHAA 5JB8S 4Y7AA 1PPGE 4ZAEA 3O8RA 4Q7YA 3ZZCA 5C5OA 2BMGB 3SHAH 3LGIA 3SQHE 4JK6A 3GY3A 3QZQA 4NCYA 1C2JA 3B8JA 5A09A 2AYWA 4ZH8A 2BDGA 3ODDA 1O2SA 2R0KA 4F48B 3UQVA 1Y3VA 2LNCA 1DWDH 2FTLE 3U69H 5GXPA 1HJAC 4OGXA 1YBWA 1H9LB 2ZPQA 2F83A 3HGPA 4ZUHA 3T2NA 1LVBA 2GT8A 1ACBE 1NBME 2PUXB 2SFAA 1GMCG 2JH0D 5L2YH 4YESB 1HXEH 4XRNA 1GHBG 3FO8D 1DE7H 2FOAA 3BN9A 4X2WA 1ZR0A 5PTPA 1VGCC 2P59A 3TK5A 2JETC 3AAVA 2CMYA 1EPTC 1MUEB 3GDSA 1DLKB 1F0SA 1SGCA 4TY6A 5DP9A 2WV4A 2BY8X 1GI8B 5CMXH 1F0RA 1OWJA 1FV9A 1P12E 3ZZ5A 4H42U 1EPTA 1PQ5A 2ODQA 3PWCA 4UD9H 2SGAA 3SORA 1W0KD 5A0CA 1AKSB 2ZNKH 3MU8A 3SU1A 1HIAB 4WY3A 1MTSA 4AORA 4D76A 3O8CA 2V7QD 3S0NA 1EXFA 1UHBB 2G55A 2Z94A 1GBLA 3EDXB 3RXPA 1VJAU 1VZQH 3A7YA 1PPHE 3HGNA 1DXWA 1A0LA 2V3MA 4X2XA 2XBYA 3SV9A 4ABIA 1GMCF 4GSOA 2GD4B 1F2SE 1QHRB 3SNEA 3VFEA 3RU4T 1GHYH 1NT1A 1ARBA 1O30A 2J9NA 5EQSA 2EY4C 3OY5U 4XSKU 1SHHB 1GHBF 1LVOA 4GHTA 5T6GA 1T7CA 3F9EA 3FP6E 1IHTH 1FQ3A 4I33A 1GI7B 1QA0A 4X1QU 2PWXA 1TGSZ 3OFND 1NROH 3EYDA 3E0PB 4Y0YE 1FMGA 2BLWA 3DCLA 3F2FA 1PQAA 1E1RD 3STJA 3OU0A 4MDSA 1DDJA 1M9UA 1TNGA 1DICA 1P57B 3LU9B 4KTSA 3VEQB 2H1UA 1TLDA 2XC4A 3F2HA 3RC4A 1O3BA 1NU7B 1TMUH 4LXBH 4A5TS 2I6SA 1D6WA 1H9HE 1MD7A 3EAJA 3GY8A 3M36A 2BY9X 3PO1B 1DWBH 1GDQA 3K6YA 3KYGA 1SFIA 3B23B 2BM2A 4H6TA 1K1LA 3VGCC 1EB2A 1C9PA 1O2GH 4MNYA 1S0RA 1WSSH 1YPEH 3ATLA 1TMTH 2BX3A 1G3EA 2GCTC 4NA7A 4NA8A 4FUDA 3A87A 4WWYA 1BBRK 1OYQA 1O5CB 3GDUA 4IS5A 2M2AA 3KQCA 3RXAA 3V13A 2BD4A 1O2YA 1JMOH 1NFXA 2ZA5A 2FS9A 2QYIA 3KEEA 1HV7A 5AF9H 1TAWA 3L33A 1C1PA 1XUKA 3R3GB 1HXFH 5EGMA 4NZLA 1ZJDA 3OTJE 1Z8IB 4MLFB 2TRMA 4Q2KA 3O8DA 3HATH 1SGPE 1SI5H 1C5NH 2F9VA 1OX1A 3TH4H 1T8LA 1BMNH 1O5BB 2FZZA 3RUOA 4YM9A 1Y59T 1SQRA 4Z0KA 1W14U 4ZROA 1HGTH 1S81A 1MAYA 3A7XA 1H8ED 1LHGH 2SGFE 3BTME 1O3IA 2QN5T 4KELA 2NWNA 4K60A 1GJ8B 2SGPE 3DFLA 3CS0A 5DP3A 1YM0A 2PKAB 3BIUH 2XC5A 3KF2A 1IQEA 1TGTA 2R3YA 5F8TA 2FO9A 2VJ1A 3OE7D 3HK3B 1C5MD 2QF0A 3VB7A 1GI9B 2P94A 3QWCH 1HPGA 2QCYA 4XOJA 1S0QA 4MTBA 5EQRA 1GBTA 4Y8YA 3PTBA 2BQWB 4X1SU 1OKXA 1BJUA 2ZI2H 1SGDE 2AIPA 5L6NH 2THFB 5EPNA 2K0QA 1RTLA 1ZSJA 1LMWB 1O2LA 4D8NA 2ZGCA 1YCPM 4BTTB 3SJIA 1CA0B 1W7GH 4AG2A 6LPRA 2ZTXA 3FFGA 1E79D 2WSSD 4Z6AH 1RS0A 2FOGA 1C1QA 2FLRH 2XCFA 3SV7A 3KQDA 1VJ9U 1X7AC 3SQEE 4OS1A 5BPEA 2CXVA 2P8OB 4KTUA 1C1NA 1L0ZA 1ZTLA 2GDDA 1HJ9A 1Z8GA 2KR7A 4O97A 4RI0A 1L4DA 1C5WB 2FS8A 3SOSA 1RFNA 1BRUP 1A46H 3TGJE 3V7TA 2ALPA 1AE8H 1UVPA 1KLJH 2B5TB 3NWUA 1KYNA 3PRBA 4H6SB 2W5EA 3ITIA 1AWHB 1KSNA 3P8NA 1GJ5H 2OC1A 4AN7A 2FM2A 1O3AA 1AKSA 2STAE 1HIAA 1HFDA 3WWFA 2XWAA 1NBMD 2ALVA 2GX4A 4ABFA 8LPRA 1UHBA 2QF5A 1NY22 3MU4A 1ELAA 2YNBA 1GJ4H 1W3CA 2QXIA 1TBZH 2BOHB 3BTHE 3O8BA 1C5YB 2QE7D 1O3LA 8ESTE 1P03A 1BTPA 1ZGVA 1ZRBA 1W8BH 1EAWA 1TOCB 5CHAC 2ZHQH 1P10A 1WDIA 1HCGA 3MH6A 4CR5A 4XDEA 2J98B 3P8GA 4FETA 3TJNA 1YLNA 2WUBA 1SPJA 1CO7E 2F3CE 1RJXB 3ZZBA 3RXIA 2WPLS 4MPUA 1A2CH 1QY6A 2ZDNA 1GI1A 5AVDA 1K1MA 5G4BA 7GCHG 2LELA 3RXOA 4DGJA 1QRZA 2HVXA 2ANYA 4AGJA 2BOKA 4X0WU 3EE7A 2AMPA 3ENSB 1D3PB 1C4Y2 3RXHA 1TNLA 1O2XA 1O3MA 3E3TA 2Y7XA 3KQ5A 1JRTA 3BV9B 2SNVA 4Y79A 4AFZA 1ELVA 3PLBA 7LPRA 2VBCA 2ZFPH 4F55A 3M3VA 3HKIB 3VB5A 1FY5A 2AHME 4OS2A 2BYAX 3BTDE 3VXFH 2TGAA 3GDVA 2ASUB 1PYTD 4OS4A 1UMAH 4ZXXH 3LOXA 3ZVDA 8GCHG 1Z6EA 4LOYH 5CDFE 2C3SA 5GCHG 2GV6A 3OSYA 3RMOH 3D62A 3N7OA 1LQEA 4MVNA 4ABDA 1MQ6A 1AFEH 2AGIX 2R2MB 1KTTB 3VB3A 1T32A 4CRDA 5IDKA 7GCHF 2UUKB 1CVWH 2F91A 4F49A 4D9RA 1QJ1B 1D3TB 2BZAA 2ULLA 1TPPA 1HAOH 2Y5HA 2WPIS 4I7YH 2VIWA 1C5SA 5A2MH 1HJAB 1V2ST 1BIOA 3D49H 3GCNA 3SU6A 1YPJH 1AGJA 4CRBA 2YMSD 1FDPA 2ZGXH 4TSFD 3NRLA 1P9UA 1Q31A 1VITH 2BTCE 5CE1A 1E35B 4HFPB 3I29A 1MKXK 1K22H 1SGEE 2NU0E 2WV9A 1UTJA 1G32B 4WMFA 3Q3KA 4FOUC 4NIVA 4Q7ZA 3SU0A 1CSOE 1VGCB 1SGYE 1W11U 3ZYEA 1BT7A 1SLVB 5SGAE 5T3HA 1EPTB 3A80A 1O2KA 1C2FA 8GCHF 1MBQA 2FTMA 2FYQA 5ESBA 4VGCB 1QA7A 1O3EA 1ELGA 1O36A 2ZPRA 2TIOA 3QTOH 3AVZA 1G36A 1WTHD 1YF4A 2AH4X 1XKBC 2ZU3A 3GISB 1O3KA 1XVMA 5TJXA 1TB6H 2Y80A 1SQAA 1FAXA 1WV7H 2BXTH 2OC8A 4GPGA 1GJBB 2PTNA 1LPGB 5JPMH 5JYIA 3F6UH 1GI3A 4TPIZ 2BDCA 4J2YB 1E1QD 1CHOG 2BDAA 2Q6FA 3LC3A 2GDEH 4D7GA 4I8JA 1BTXA 2AGEX 2HOBA 5EW1H 1K1PA 1ID5H 1DT2A 2WV5A 1XUFA 1XVOA 4JZDH 2QY0B 4K2YA 1QL7A 1O34A 4MG3A 4IC5A 2WZQA 1ZPZA 1NM6A 1O33A 2RA0A 2FMJA 3PRDA 2BY5X 2K1QA 2F43B 3GCHB 3DD2H 3MNBA 5EPYA 3FN8A 1UTOA 2ZIQH 4CRCA 4GVUA 3QGJA 1LTOA 3ZVGA 2KZ4A 1J16A 1SB1H 1RTKA 3KQBA 1F5RA 1L4ZA 1S6HA 1SLXB 1K9OE 3CS7A 3PLPA 3DUXH 3MFJA 4NWLA 5A8YA 4K8BA 5I46H 1NS3A 1TABE 1P2JA 2D8WA 1K1IA 3UREA 4DT4A 2ZCLP 1S85A 1ZGIA 1F0TA 1KXBA 5A0BA 1HNEE 4B6EA 1FX0B 4I86A 2EQNA 2G8TA 2B9LA 1CHOF 1YC0A 2Z9IA 3ATMA 2VVVA 3KGPA 3Q3YA 4OS5A 3Q76A 1QL9A 2BD7A 3R0FA 2GVFA 4FUCA 4AOQA 2JDID 3NK8A 1E37B 2DE8A 4JYUH 1WQSA 2A32A 2CK3D 1P2IA 3ATWA 1A3BH 1WUNH 4B6FA 2VINA 3SJ9A 3SV8A 3TVJB 2SGQE 2XBVA 1K2I1 1MZDA 4X8TH 4Y76A 3ZVFA 1UK2A 2BQ7B 3PLKA 3W94A 1FY1A 4MNWA 3ZV8A 4X2VA 3PMBB 4IC6A 4XFQA 2Z9KA 4GCHG 1GPZA 3RDZA 1PQ7A 2F9BH 5FL7D 1DOJA 3MQKC 1YPKH 4UONA 2R3UA 3E91A 1UTQA 2NU3E 3S69A 5EW2H 2AIQA 3QDZB 2AS9A 2FXRA 2Y7ZA 2ZDMA 4AB8A 2ZDKA 1ELFA 4DCDA 2BD8A 1A7SA 2J97A 2ZHWH 1O5FH 4OGYA 3DSGA 4O03A 1NO9H 3FP8E 4GUXA 1TIOA 3CENA 3SUEA 1U6QA 5C0TA 3GYMA 4HTCH 1HUTH 1TALA 2A0QB 2F9NA 4OM9A 4TT3D 3UPEA 4UDWH 1NRSH 3A82A 1T31A 1DITH 2ZHDA 1QB6A 2V35A 1HJ8A 2OC0A 5DP8A 2ANKH 1W10U 1CA8B 3BTFE 1DWCH 3EGKH 4WVPE 3OY6U 3F9HA 1O3GA 1OS8A 5GNDA 2Y81A 3SGAE 1GI0A 1DVAH 4OS6A 4X8UH 2XOKD 1AMHA 1EAUA 3Q77A 3JZ1B 1MTNC 2O8WA 5IK2D 3SUGA 2WPDD 3U8TH 4LK4A 3PYHA 3EA7A 1O35A 2J38A 3RC6A 1COWD 4X2YA 1IOEA 3F1SB 2NU1E 3NKKA 5KEDA 3TH2H 1VCQA 1PPCE 2F9OA 3SNAA 1IAUA 1V2TT 4FU9A 1GVKB 4OS7A 2RCEA 3GY2A 3GY7A 2L6OA 2JH6D 3FP7E 1C5LH 1BTZA 3GY5A 4A92A 1TNIA 1YWUA 1ZOMA 2HGTH 1YY3A 4A1TA 2XYAA 2ZU4A 3TGIE 1AVXA 2VWMA 3IITA 1CT2E 1D9IA 4KTCA 1IQHA 3K65B 1AFQB 1A3EH 3M37A 1ANDA 5E8EH 1DY9A 1AZ8A 1DANH 1V2MT 2HLDD 3A84A 3P8OA 4K3JA 2J4IA 1SKYE 3GCOA 1SFQB 1AVWA 1GGDC 4FUIA 5LPRA 4X6NA 3MO9A 2IOTA 1NU9A 2KCYA 3EA9A 1Z8JB 4VGCC 4JMYA 2F9UA 5I25A 1QQUA 4B74A 4U30A 4JK5A 3LKWA 4ZHLU 3A88A 1Y3YA 5J4QA 2FOFA 2P16A 4I32A 1F7ZA 1O3CA 1FUJA 5TCCA 3DSOA 3OX7U 4JZ1A 3P8FA 2BZ6H 1CE5A 3MU5A 4XBDA 1EAIA 2ZG0H 5C17A 1O32A 1FIZA 3NUMA 1BBRE 3TNTA 2GMTB 2A31A 1D3QB 3BTEE 4BAMB 1UJ1A 1IQGA 1N8OC 3SO3A 1T8MA 1UVSH 4JYTA 1E0FD 4M7GA 2XNIA 2KM0A 4DW2U 1C1WH 1TA6A 3ZZ7A 2BLQA 1Y5UT 3MH7A 3PMAB 2PKSB 2P3FH 3UB0A 2G4TA 1OWKA 1GBIA 1MH0A 3GCHC 1SOZA 4ZXYH 3B9FH 3LDXH 1Q3XA 3E16B 4ZKSU 3A7ZA 1VITG 1QB1A 2TGTA 4K1EA 1YKTA 1GMHG 5CHAB 3TU7H 1Y5BT 2F4LA 2VVCA 3ZZ6A 1GHZA 1O0DH 3GY6A 1W0ZU 2W7UA 2Y6TA 1HAXB 1FN8A 1NESE 3MWIU 1SOTA 3SN8A 4CRAA 5LGOA 3URCA 4Y71A 4BAKB 1OWIA 4X6OA 2A4OA 2W26A 1HDTH 3PV5A 1CU1A 1S82A 4MNXA 3SJOA 3DSPA 3T27A 4CH2B 3TNSA 3M7QA 1EATA 1W7XH 1O3DA 2BLOA 3EA8A 2VIDA 4DOQA 1SSXA 4MPXA 2G5VA 3P95A 4ZKNU 5C3NA 5C1UA 4BXWA 2B0FA 4BAQB 1ESTA 4SGBE 4B1TA 2A45B 2J94A 1ZTJA 3LH1A 2C8XB 1DSTA 1TBRH 1N6YA 1F0UA 1BRBE 1UCYH 2HWLB 1AQ7A 1O3JA 3T26A 1PJPA 1V3XA 3AW1A 5F03A 2IPQX 1AZZA 1P05A 1E36B 3OTPA 2GKVE 3UWIA 1VITF 3MU1A 1GHWH 4YZUA 1GMHF 2CF9H 1EASA 5EJZA 2OC7A 2P3TB 2BDBA 3DFJA 4HG6A 1MCVA 3ZV9A 5E0HA 2RDLA 4XBCA 3P6ZB 2EI8A 2V3OH 2V3HH 4XBBA 1SR5C 3A8DA 4TWWA 4Q7XA 3SZNA 1KXDA 3ZVEA 1NFYA 3PWBA 1IQLA 1DY8A 1OPHB 2H2ZA 2PP6A 3FZZA 1HAPH 1TYNA 1FXYA
chains in the Genus database with same CATH topology
1Y3UA 5AFZH 1C5OH 4JZIA 4YOIA 4AFUA 1SGTA 1LKBA 2TBSA 3RMLH 2C4FH 1AWFH 1OWEA 1H9IE 4R0IA 2FPZA 1FPHH 1Z6JH 5HM9A 2G5NA 1C5TA 3P70B 1G3DA 3LT3A 2V6NA 2VIOA 2I6QA 2QXGA 4KGAA 4B2BA 2IJOB 4WXVA 4WF8A 3TITA 1BB0B 1SLUB 4FXGH 4FUGA 4HI3A 4UFDH 4FUHA 3NPSA 1QURH 1SG8B 4GAWA 1FI8A 5C5NA 1FONA 4RKJB 5DGJA 2ZP0H 1TFXA 3LPRA 3SU5A 4I8HA 5EG4A 2HPQH 3RM0H 4NWKA 1J14A 1GBFA 4NIXA 1UK4A 1C1RA 4ISNA 4FUBA 3KNXA 1EJAA 5GPIB 1O3FA 3BF6H 1SQOA 4Y8ZA 4ABGA 1SMFE 1KXCA 1LKAA 3QK1A 2JKHA 4FVBA 1FY8E 1YLCA 4YOGA 1KDQA 3DA9B 5FHTA 1TNHA 1IQFA 1P11E 4PROA 2SGDE 2XBXA 4AGKA 1XX9A 1OWDA 3ZVAA 3L6PA 6ESTA 2BD5A 1P2OA 4THNH 4R8TB 1AFQC 1ZPBA 4ZKRU 1C5XB 4Q80A 1V2JT 1P02A 2GT7A 1ELDE 1MU8B 1UTPA 3MTYA 1EOJA 3VXEH 1T4UH 4D9QA 3D65E 2FI5E 3U1JB 1O2VA 1O2TA 3GCTG 3RLWH 3V3MA 1A4WH 2ZFRH 1SGNE 3RXJA 1C4U2 3MOCA 1FY3A 2ZHFH 4JYVH 2QIQA 2FLBH 2A5AA 1HAVA 2Z9GA 1OP2A 1CT0E 1JRSA 1TWXB 4AG1A 4BTIB 1D6RA 2GMTC 4CRGA 2IPHA 1EX3A 1N6XA 1GI6A 4YOJA 4UFFH 4BNRA 4E7NA 1QJ7B 3P17H 1O2MA 5C1XA 4ISHH 3BTQE 2PKSC 4BAHB 1YPHC 1Y3WA 2WYJA 2OQUA 1O31A 5E2OA 4X6MA 1O2UA 1SGIB 2Z6BD 3PMHB 1OWHA 1S6FA 4RSPA 3RXSA 3K9XB 5TCAA 3T25A 3SHCH 2BX4A 1GBAA 3Q00A 4NZQA 3GCTF 1AUTC 1Z1IA 2FX4A 3H7TA 1NZQH 1W13U 2ZHEH 3RXKA 1TGNA 1HB0B 1EP5A 3ELAH 1EUFA 2W7SA 1TX8A 2UWPA 4NSYA 2WYGA 4B2CA 2Y82A 1EZXC 4GLYA 5EXNA 1XKAC 4YT6H 1O5AB 1SGQE 2AGGX 1UVOA 1VR1H 1FIWA 1HBTH 2GTBA 1GBBA 2GZ7A 1KXFA 2IN2A 4ZKOU 1D3DB 1PFXC 2O8MA 2F9PA 5BRRE 2SNWA 2XTTB 3AW0A 3I77A 3RXMA 2ZWLH 2HNTC 2ZTZA 1ZHMA 2BVXH 1AHTH 1TGCA 1OSSA 1C1UH 4ABBA 1GL1A 1C1TA 2OLGA 5HGGA 1V2UT 1GBHA 4NG9H 3MYWA 1ZJKA 4TWYA 2A2QH 2O8UA 2DUCA 2RG3A 3HPTB 4E06H 4Y7BA 3AAUA 1IQIA 3QUMP 4TYDA 3SU3A 2ZU1A 5DP4A 3KN2A 4D7FA 3ZZDA 1GVLA 2O8LA 1MTNB 5A8ZA 4HGCA 1ESBA 1SGRE 1NPMA 4NSVA 2KAIB 3T28A 3LGWA 2C90B 7ESTE 2QXHA 2V0BA 3LH3A 1MQ5A 1GJ6A 1OP8A 1E34B 4A1VA 1C2HA 5HXFA 1CGIE 2ZTYA 1LHEH 1H1BA 1ELCA 4IMZA 5FX6A 1TPSA 2BB4A 1BRCE 1GCTB 5EOKA 1UTLM 4A7IB 2ZU5A 1QBVH 1BOQA 2BXUH 1NRRH 1C9TA 3QTVH 1FAKH 1CGHA 1GJ9B 1DFPA 1GWAA 1V6DA 5GDSH 1UTKA 2YOLA 3QO6A 1GGDB 1C4V2 2C8YB 3RXUA 5DO4H 1BA8B 2OBQA 1ETTH 2ZU2A 2ODYB 4X1PU 5GCHF 4FVDA 1WBGB 2H9TH 2ZGHA 1V2RT 2Y5GA 4O3UA 2NU2E 1O2WA 2WPKS 1O2ZA 3BTWE 2B7DH 3F68H 4UE7H 4O3TA 1EKBB 1TA2A 8KME2 1FPCH 2R0LA 2Z9JA 1XM1A 1XUHA 4I8LA 3TIUA 1BQYA 2SGEE 2VGCB 5EQQA 3SGQE 4ESTE 2ZF0H 3TH3H 1EP6A 5JBTA 1QR3E 1WCZA 3T62A 1N8OB 2QF3A 3UFAA 3SV6A 4DG4A 3AASA 1DUEA 2P95A 2BY6X 1LDTT 3SW2B 3RXCA 1ZRKA 1QCPA 1AN1E 3M7UA 1GMDG 5K0HA 3S7HB 1A0HB 2A1DB 1D4PB 1EJMA 2BD9A 3U8RH 1GI2A 3SJKA 2ZGJA 4X8VH 4Y11E 1RIWB 1DUAA 3TJOA 1O2IA 1GI4A 5EU8A 3SUFA 1GBEA 1SLWB 5FAHA 1OXGA 1WAYB 1P0SH 2PR3A 2BLVA 5FBEA 1EZQA 1A61H 1JIRA 1IQMA 3BG4C 1BJVA 3MI4A 2UUFB 1C2GA 4WH6A 1CBWC 1SGFA 1ARCA 5DK1A 1GBMA 3E0NB 1J17T 1MBMA 3SNDA 1J8AA 1UK3A 4INLA 2TGDA 4CREA 2HNTF 3LONA 3QX5H 1P2NA 4KKDA 1ETRH 1GG6C 4YLQH 4IBLH 2D1JA 5E2PA 1B0FA 1GMDF 1L2EA 3LJJA 2CGAA 4AFSA 1KXEA 3MH5A 2VH0A 5L30H 1PYTC 1H4WA 2R9PA 4NIWA 4Y6DA 4B73A 3BTGE 4Y10E 2AEIH 2Z9LA 2ZFSA 1O3PB 1SC8U 1YP9A 1C5UA 2OQ5A 1BZXE 2VH6A 1AB9B 2PGQB 1QGFA 3UQOA 2OCVB 2P3UB 3LC5A 2BDHA 1JXPA 3LIWA 4IMQA 1B7XB 1TMBH 1T8NA 2CF8H 2VVUA 1O5GH 1QRXA 4J1YA 3UR9A 4YT7H 1BMLA 1GBJA 2FODA 1JOUB 3SI3H 3IWMA 1LHDH 5ETXA 3M7TA 1MMJN 4BXSA 1ELBA 1BITA 1LVYA 1O5EH 2ESTE 4JCNA 3ZZ8A 2H6MA 5J4SA 4ABJA 1KTSB 1C2LA 4INKA 2EEKA 3MNXA 1K21H 2G00A 1A5GH 3S7KB 9LPRA 1GJ7B 4DY7B 1ZSLA 2GP9B 3ATIA 1SGFG 2D2DA 1NN6A 3TGKE 3C27B 1L1NA 2CHAB 1SL3A 2WUCA 4GCHF 1K1OA 1CGJE 2VB0A 1MZAA 1QB9A 1ZTKA 2G51A 2Y5FA 4AB9A 1IHSH 3L3TA 4YTAA 1BHXB 1G3CA 5DP7A 1L1JA 3GY4A 1UCYK 1KDQB 2Z3CA 3HKJB 1AVGH 2KAIA 3IG6B 1AO5A 2FI3E 9ESTA 1S83A 5T6FA 2WPJS 3LGVA 1PPZA 1QTFA 4NGAH 1LPKB 4WJG2 5FBIA 3RXEA 1L1GA 1GCTC 1HAZB 2ZKSA 1O2NA 1AE5A 1BDAA 1EZSC 1MKWH 2A4GA 1KLTA 4IGDA 1C2IA 1C5RA 1WTGH 1F5KU 1YCPH 5GIBA 1XXFA 5DJ7A 3RXFA 1HAVB 4UFGH 1K1NA 2VIVA 4DIHH 1HRTH 2GV7A 2J34A 1AIXH 1NC6A 6CHAB 2QA9E 3FZDA 1UTMA 2XC0A 1JWTA 3UOUA 1GI5A 2BD2A 2AFQB 3V0XA 4CH8B 3PTNA 1AU8A 1P2KA 2FOBA 1TOMH 3FAOA 4LZ4B 2EC9H 3BTTE 2VGCC 3C1KA 1C1SA 1P01A 3E8LA 2W3IA 3MO3A 5LPEA 4CR9A 4Y0ZE 4B75A 2VWOA 2ZC9H 4AZ2B 2FI4E 1UVTH 3RU4E 1J9CH 3A7WA 2PLXA 1P2QA 5LPFA 1YPMH 3RXRA 2TPIZ 1IQKA 1ZPCA 4AYYB 5HM2A 1FJSA 1A0JA 1AY6H 1FNIA 2PSYA 1P3EA 1O2OA 1NRNH 1RD3B 5DPAA 1RIWC 3S9BA 1ZZZA 1DXPA 2VWLA 5E0JA 3U8OH 1ZHRA 4ABAA 1ABJH 2ZDAH 2G81E 4UEHH 2BVRH 3ZZ9A 3STIA 5DKMA 4X8SH 1MU6B 3M3TA 2A4RA 1ZMLA 1C5QA 2HRVA 2AMDA 1ANBA 1E38B 4FU7A 5E0GA 3QLPH 5HYOA 2Q6GA 4FUEA 2A7HA 4B76A 3A7TA 3G01A 2FYRA 3UIRA 2HPPH 4MPVA 2R2WU 1KY9A 3NZIA 3BEFB 4YLUA 3S9CA 1DSUA 1BTHH 2FX6A 5DP5A 3RC5A 2FDAA 1PQ8A 1NTPA 1FLEE 1DS2E 1ZLRA 2ZZUH 1PPEE 2CV3A 4BTUB 3BG8A 3ZVCA 2FOHA 1S84A 4QT8C 4ABEA 5JDUB 5L2ZH 1O2JA 3QZRA 3LJOA 2A4QA 5C20A 2ZCHP 3VB6A 3RMMH 1Z1JA 4IN2A 4RN6A 1EJNA 1TRNA 1Z71A 3BEIB 2J2UA 5FCKA 3MH4A 5DG6A 1AB9C 1RTFB 3TJUA 2WINI 3PB1E 1TX6A 2G52A 2TGPZ 4LZ1H 1MTUA 1Y8TA 2ZEBA 4DIIH 1GBCA 1SBWA 2VNTA 4HZHA 1V2OT 1ZSKA 1RRKA 3ESTA 4NIYA 2P93A 1YYY1 1LHFH 1DWEH 2VIPA 1QL8A 1V2WT 4X1NU 3RMNH 3BEUA 1ZMNA 1K28D 3U9AH 1EB1H 3E90B 1Z8RA 1LHCH 3A86A 1DM4B 1O39A 3RP2A 3ODFA 4DT7B 3OYPA 1NFUA 1XUIA 4AFQA 1TE0A 2CHAC 4ISLA 1TNKA 1O2RA 1ANCA 1B5GH 1HAYB 4H4FA 2C93B 3M35A 4DVAU 1V2QT 3K6ZA 1W12U 2UUJB 4JZFH 1INCA 3TLOA 2OBOA 3SU4A 1ORFA 3WY8A 3UNRA 1GJCB 5JBAS 1P9SA 3UTUH 3UNQA 1BRAA 3MMGA 4WMEA 3UUZA 2ZDVH 1W2KH 3UWJH 5H4IB 3URDA 1QBNA 4B2AA 3NXPA 1V2KT 2VIQA 1O37A 3SJ8A 3T29A 2OXSA 1YPGH 4GHQA 1EZUC 1VCPA 3SV2H 1P09A 1SHYA 1CT4E 1GJDB 4IN1A 4NFFA 3RXBA 5JBCS 3W95A 1JIMA 1F92A 5DP6A 2HALA 4A6LA 3LGTA 1S5SA 2ZPSA 1TNJA 3M3SA 2FOCA 2XCNA 2BD3A 1TRYA 1NFWA 3DT0H 4DURA 1LCYA 1GL0E 1C2EA 3A7VA 2PUQH 3Q3XA 6CHAC 2XRCA 3SNBA 2QXJA 3KL6A 3BG4B 2ZFQH 2ANMH 4AX9H 5EODA 1O5DH 2PTCE 2FOMB 3SNCA 5AHGH 1CBWB 1G30B 3GICB 2PFEA 2DE9A 2Q6DA 3SUDA 1QJ6B 3TPIZ 3RXLA 1C2MA 2QV1A 1BTWA 1NRPH 1PPBH 3F9GA 3ZZAA 3KCGH 1GG6B 2B8OH 5FCRA 3MO6A 2H5CA 1KXAA 1C1MA 1B0EA 5ABWA 3UNSA 2XBWA 3UR6A 1HAHH 5ESTE 3S9AA 1BBRH 4I8GA 3H5CB 3T5FH 1C1VH 1FN6A 1WQVH 1G2MA 3RXDA 1K1JA 4FU8A 4ABHA 2A7CA 1V2NT 4CHAB 3M5LA 4K69A 1PPFE 5K7RA 1RGQA 1O2QA 2ANWA 5A0AE 4K5ZA 3A81A 3I78A 2VWNA 1ZHPA 3A83A 1QFKH 4JZEH 1UTNA 1IQNA 2Z3DA 1THPB 1HYLA 1MAXA 3MNCA 3M5NA 3RU4D 3H7OA 1XMNB 2A5IA 4ISOA 1G9IE 4TY7A 5JB9S 2BHGA 1OYTH 2ZCKP 5AFYH 2ZFTA 2Z3EA 1MD8A 1G2LA 1T8OA 2PHBA 4U32A 4XE4A 1LQDB 2PGBB 1EAXA 3A89A 5HMAA 1Y5AT 5F8ZA 2LPRA 2O9QA 1P3CA 2ZFFH 2JH5D 1LVMA 3PV4A 2RA3A 5C67A 4CBOA 3TJVA 3PO1C 4NFEA 2UWLA 2ZGBH 3FANA 1BHXF 1C5PA 1O38A 3U1IB 3MU0A 1O3NA 1P06A 1HAGE 2OD3B 1GHAG 4IW4E 4WXIA 4SGAE 5F8XA 3D23A 1BCUH 3M5MA 1GJAB 1H8IH 4UFEH 4WH8A 3VB4A 2O8TA 1Z7KA 5IYTA 5FX5A 3GOVB 3P92A 1UO6A 1C2DA 2OUAA 3FVFB 2FESH 4A1XA 3RXTA 4X6PA 5C2ZA 3KIDU 1SVPA 3PROA 4BANB 3BIVH 3SU2A 1O2PA 2EI6A 1O3HA 2Z7FE 1TPOA 1QBOA 3M5OA 3A8BA 3CP7A 3U98H 3MHWU 1GDUA 1WU1A 1TQ0B 2H9HA 2GCHG 4B71A 1J15A 4MQAA 1GHAF 4I31A 2C8ZB 3RXVA 1GHXH 3QN7A 2CN0H 2FEQH 2PV9B 5JBBS 1GDNA 3KQEA 1MTVA 4ASHA 3SBKA 1AD8H 1ETSH 3KHVA 1TX7A 2JETB 5F6MA 1THRH 1A5HA 2STBE 2H5DA 1SQTA 1GBDA 1EOLA 1CQQA 1UVUH 3BTKE 4BAOB 1QNJA 1V2VT 2PKAA 1N1LA 2EI7A 4I8KA 1BTUA 1YLDA 1VCWA 3RXGA 3F9FA 3ZVBA 4TPYA 4YO9A 1KIGH 2ZDLA 2J95A 1V2LT 3SGBE 1ABIH 1TQ7B 1ANEA 1QQ4A 4O9VA 2BDYA 1GVZA 1CA0C 2A2XH 4MPWA 3GYLB 2GCHF 1QIXB 1V2PT 5GJ4B 3SI4H 3DHKH 3ZYDA 2GZ9A 1G3BA 2ODPA 4DJZB 1Q2WA 4E7RG 1YPHE 2BDIA 1ELEE 6GCHG 2P8OC 5C1YA 1AUJA 3JZ2B 3UY9A 5T6DA 2QGRA 5FPTA 1MKWK 5B6OA 2HLCA 4K1SA 1T4VH 1WOFA 4U2WA 1GHVH 2ZQ2A 2QAAA 1YCPK 1IQJA 1OP0A 3QGNB 3VPKA 1DLEA 5FXLA 1MTWA 1EQ9A 5EXMA 4X1RU 2AMQA 2UUYA 1ZMJA 4AYVB 4K1TA 1CHGA 1O3OA 2XWBI 1C2KA 1TBQH 1W0YH 1UCYE 3PMJA 5LH8A 1TRMA 1AI8H 1WYKA 2GGVB 2QC2A 1YPLH 2AERH 1C5VA 2BVSH 1ELTA 2J92A 2M5TA 1TGBA 2H9EH 1G37A 4FUJA 2XW9A 3A8CA 1HAIH 1BUIA 5FPSA 4K8YA 5EXLA 3EQ0H 3V12A 3LGUA 2C8WB 1OOKB 3K2UA 1GBKA 1XUJA