1ESBA

Direct structure observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Direct structural observation of an acyl-enzyme intermediate in the hydrolysis of an ester substrate by elastase.
pubmed doi rcsb
source organism Sus scrofa
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1esbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1esbA01
1RTFB 1A0JA 1LPZB 1TGNA 1P2MA 3P92A 5K7RA 3S9CA 4ZHAA 3CENA 1TQ0B 3LU9B 1C9PA 2VVCA 3QDZB 2GCHF 1VGCB 4MPVA 4AB8A 3S7HB 1G3CA 4WMDA 3GDSA 1C2EA 3M37A 3VXEH 4NA8A 2FO9A 2FYRA 4AGJA 1GMDF 5EQRA 2H5DA 3SJKA 3VXFH 3L6PA 3MNBA 4A1TA 1RGQA 2F9PA 1D4PB 3KHVA 3URCA 5TJXA 3MWIU 3E3TA 3IITA 3LGVA 4AFZA 1QY6A 1A0HB 4R0IA 4X8UH 1OX1A 1ZSJA 1JMOH 1O0DH 1BHXF 2ZPSA 1DOJA 2BLQA 1P06A 1GBHA 3A7TA 5A0BA 1HIAA 1S84A 2XNIA 2ZHFH 1AFEH 2A32A 1G3DA 3U8RH 5GCHF 4JK5A 2OC0A 1O3EA 2BD7A 3PTBA 5E2PA 2FOAA 4CR5A 1S81A 2ZI2H 1AZZA 3GCOA 1UVPA 1YPMH 3GDVA 4FU7A 4AZ2B 3VGCB 3RM2H 1BIOA 3BG8A 7ESTE 4MPUA 9ESTA 4X8TH 5C5OA 1P01A 1RIWB 3BIUH 2G00A 3TH4H 1SOZA 3A86A 3A8DA 4MNWA 5EW2H 3TK5A 3SO3A 2TIOA 8GCHF 1VITH 2R9PA 2ZU3A 4B74A 3KQEA 3EGKH 3FZZA 1AKSB 1SLVB 2F9BH 1SGCA 1ZSKA 3HGPA 1A7SA 1MD8A 1D3PB 1GBCA 4I33A 5SGAE 2V3HH 2ZGJA 1VGCC 2ZA5A 1QB6A 3B23B 2ODPA 1W11U 3SUDA 3IWMA 1BITA 1XKBC 2OC7A 3GOVB 2BD2A 5BRRE 4UFGH 1F92A 3F9EA 3M7TA 2QGRA 1O36A 1SHYA 3O8CA 1JIMA 1SR5C 1AKSA 1IQKA 4MNXA 2ZGCA 1P2IA 3M5MA 4LXBH 3FFGA 1EJAA 3E0PB 1RD3B 1LTOA 2TGPZ 5AFZH 1BQYA 3SGAE 2JETC 3LGUA 2AGGX 2QIQA 2F9UA 2ZDNA 4B71A 1GJ4H 4WMEA 4XSKU 5EOKA 1BTZA 1AQ7A 1TBZH 1UO6A 2G51A 4CBOA 1HYLA 2BQ6B 5GDSH 3LC3A 1TGBA 1C5SA 8ESTE 1GCTB 4JCNA 1HDTH 1BBRH 3RMLH 5LH8A 2ZGHA 4TWWA 4AGKA 3KQCA 2AH4X 1C1PA 4LZ1H 4NG9H 4OS6A 4B2CA 1GMHG 2DUCA 2CV3A 1A3BH 2PSYA 3UFAA 1K1LA 2PTCE 2PFEA 1C1OA 1J17T 2F9OA 1CVWH 1DWEH 3M5NA 5FPTA 4DIHH 2CMYA 1HPGA 4OS1A 4O97A 3FZDA 2QYIA 3BG4C 1W14U 3C27B 3DFLA 3TJVA 3RXSA 4BAMB 3ATLA 1V2UT 1DUAA 1C5XB 4HGCA 5GXPA 1TPSA 3A81A 2FOMB 4U2WA 1ETRH 3GY5A 1FLEE 3ZZ8A 1GBBA 1UTKA 3LJOA 3GCHB 3GY8A 1GBTA 4XDEA 2GZ9A 2WPJS 3TJNA 2BDHA 3AAUA 1K1JA 3V12A 1OWDA 1SVPA 2B7DH 2ASUB 4VGCB 2NU3E 4WXIA 1PQ8A 1ZOMA 3M3VA 4NSYA 1C5NH 4Q7XA 5EU8A 3S9AA 3W94A 1G9IE 5A8XA 6LPRA 4HTCH 2C8ZB 4X2VA 5FPSA 1AU8A 1QCPA 1T8MA 3EA9A 3RXIA 3GY2A 1AN1E 1UK2A 3FANA 1P2KA 4Q80A 1MKXK 2AMDA 5FXLA 1TX7A 4AFSA 4B73A 2ZQ1A 2BDAA 4TWYA 1V2QT 1BTWA 1EP5A 1LVBA 1YPEH 3IG6B 4ISLA 3PWBA 3ZZ6A 1H1BA 2M5TA 5JPMH 4AB9A 3TJUA 1C5RA 2OBOA 1O3IA 2A4GA 2H9TH 4FUIA 2PW8H 6CHAC 5LGOA 1W8BH 4MQAA 1DDJA 1QL9A 1GGDC 2D1JA 3PV4A 5F8ZA 3RXDA 2WYJA 4I8HA 3RLWH 3RXEA 1IAUA 2G8TA 2P94A 4OS5A 4BAOB 1TWXB 5GWZA 1MKWK 1VCPA 2XW9A 4JYTA 3RU4E 5J4QA 1UCYH 1V6DA 1P02A 1H9HE 2V0BA 3SJ8A 4FU9A 1FJSA 1C5LH 1UTJA 2ZGXH 3PO1C 1CBWB 1JIRA 1EX3A 1TRYA 1ARCA 1C4Y2 5C3NA 4D8NA 3MH6A 1TONA 3GY6A 1ABJH 2BD4A 2F9NA 1SGTA 3GCHC 1NROH 1GI9B 4ZKOU 2A2XH 3S0NA 5A8ZA 3RM0H 1BBRE 3A87A 1V2RT 1FIZA 1Z71A 4DG4A 3UR9A 1K1NA 4TY6A 1TLDA 4GCHF 2IOTA 1BMMH 1PPHE 1PPBH 1QL8A 3AW1A 1O2OA 1QTFA 4X1NU 2VGCC 1K21H 1J14A 3LH1A 4FUDA 1OP8A 2XCNA 4WWYA 1FAXA 1CGJE 3PMBB 1QGFA 4Z0KA 1S0RA 3DUXH 1KDQB 1SGNE 2VB0A 1QB9A 1MH0A 1V2ST 1HJ8A 2PLXA 5DKMA 2J9NA 2V3OH 2C93B 2J92A 1NT1A 1H9LB 1ELCA 3OSYA 5A0CA 3TGKE 2ODYB 3V7TA 1BTPA 1BHXB 4FUFA 3SUFA 6GCHG 1GBKA 1VITF 2A4RA 4K8BA 2Y5FA 2GTBA 5FCRA 2R3UA 1KDQA 1T4VH 2F83A 1Y5BT 2NU4E 2ZQ2A 2ZHDA 1VCWA 3OTJE 5G4BA 3TLOA 1QR3E 1AHTH 3EAJA 4JK6A 5DP6A 1CBWC 3ZYDA 2QF3A 1BTHH 1O3KA 2Y80A 2VWOA 1S83A 1TMBH 2VIVA 3E90B 3T25A 3RUOA 1F0TA 3HKJB 4DJZB 1GVZA 2GCTC 1IHTH 5AF9H 3SNCA 2QA9E 3RC4A 1OS8A 2BY5X 1A61H 1KXAA 2VH6A 4O9VA 2BHGA 1O2GH 4IN2A 1O37A 2UUKB 4CH8B 1XUGA 1ZPZA 2B9LA 2WPHS 4A92A 3F68H 1ELTA 1GMCG 2BVXH 4X8SH 4HI3A 1GBJA 1D3DB 1PPFE 4Y0YE 2CHAC 1QJ6B 2J2UA 1GL0E 1SQOA 1D3QB 1W2KH 1QQUA 4E7RG 4Y8XA 2J94A 5ESTE 1MD7A 2WV4A 1UCYE 1YPKH 5TCCA 2ALVA 1RTLA 4UEHH 3RMMH 2FMJA 3SU2A 3F9FA 3CS0A 3RXJA 4IC6A 1EOJA 1GPZA 1A5IA 1TMUH 4ISNA 1Q3XA 1ZHPA 2RA0A 1HV7A 3MOCA 1HAPH 1FN8A 3SNAA 2R2WU 1EP6A 3DFJA 2PKSC 3BTWE 2ZHQH 2BXTH 1AY6H 2A4OA 3UOPA 2VIOA 1H9IE 2OLGA 1SG8B 5CHAC 5T3HA 2DE8A 1P9SA 3G01A 2XXLA 1W12U 1BMNH 1OP2A 1TX8A 1C5MD 9LPRA 1G32B 3SQEE 1C5TA 3FAOA 1ORFA 1O5AB 3AVZA 3RXUA 1PJPA 2KAIA 1FPCH 3AASA 4ABAA 3MI4A 4INHA 2BZAA 3T29A 3SI3H 2PV9B 2QY0B 1Y5AT 2GV6A 5JYIA 2QV1A 4OS7A 4I8KA 4UFDH 1MQ6A 1V2NT 2BLVA 1C2HA 1P10A 1CHOG 1TAWA 1F5RA 1E38B 3SW2B 4X1PU 2Y81A 4ABBA 1FNIA 1YPLH 4B1TA 2QCYA 4A1XA 4DOQA 3NXPA 2VVUA 4I8LA 5T6DA 4LK4A 4SGAE 1O3NA 1P57B 4B2AA 1TBRH 1O2JA 3MU1A 2G55A 1FONA 3DD2H 4Y7BA 1AFQB 3A80A 4IN1A 3ZZCA 2GGVB 4D9QA 1AWHB 1XUKA 2PGBB 1GBLA 3M7QA 4NCYA 5JB9S 4NFFA 4HFPB 1NN6A 1KXBA 1SL3A 1EXFA 1XM1A 2Z9LA 3M3SA 1AUJA 1F0RA 4INKA 8KME2 1Z6EA 1B7XB 3GCTG 2Z3EA 5FPYA 3U1IB 2FOHA 1YC0A 4Q2KA 1AO5A 1YLDA 2DE9A 1CT2E 5PTPA 2BB4A 3D65E 1GI8B 1O3PB 2VVVA 2ZWLH 4BNRA 1SMFE 5A0AE 3SJ9A 1ELEE 3QZQA 1GJ9B 3SU5A 1DICA 1Y8TA 1J9CH 1C1NA 1NTPA 2ZZUH 4ZUHA 3QN7A 4WH8A 5E2OA 1W7XH 1GJBB 1MQ5A 4K2YA 2TBSA 5F8XA 1BJVA 2FI3E 4A6LA 1GI0A 1UTOA 1AE5A 2HLCA 4HZHA 3SV9A 3M3TA 2BTCE 3O8RA 1E36B 3PM3A 2G5NA 1AWFH 1GVLA 1MKWH 2ZFPH 1MTUA 4I32A 4NIVA 1C2GA 1TGSZ 3UTUH 1PPEE 1QB1A 1IQJA 1DSTA 1QURH 2TGDA 5EGMA 3A89A 5AHGH 3ZZ5A 4ZHLU 3LGWA 2RG3A 3D49H 3DT0H 2O9QA 1TA2A 3Q3KA 1LKBA 1NFWA 3GYLB 4JZDH 4YT6H 4AORA 4CHAB 2BX4A 1S6FA 3ELAH 1VR1H 1LHFH 2Z3DA 2GV7A 1KYNA 3UPEA 1IOEA 1HXEH 2AMQA 3MO6A 2Y5GA 1UCYK 2A5KA 3UQOA 1NS3A 1O2TA 3KNXA 1C2LA 1SBWA 7LPRA 2R3YA 4JZ1A 1SLWB 1O5DH 3Q3XA 3V13A 1TRNA 4MPWA 1P3CA 1TFXA 4GSOA 1KLTA 2P95A 2QAAA 3BEUA 2BQ7B 1MZDA 3ITIA 1QL7A 1NFUA 2QN5T 4WJG2 1JRSA 2SFAA 1EZXC 3MO3A 1RXPA 2HOBA 4DT7B 4ZXYH 4BTUB 1V2TT 3B8JA 3KQDA 2C90B 1UTMA 4XBBA 5LPEA 1BA8B 1WSSH 4J2YB 1LQEA 1FY8E 5DP4A 1KXCA 5GJ4B 5EXNA 1TNLA 4GLYA 1HAYB 1CSOE 1EPTB 2ZDKA 4BANB 1O2LA 4Q7YA 2ZDLA 4UDWH 1FV9A 2A5AA 4I7YH 4JZEH 2J95A 3UREA 1LPGB 1SGRE 4IBLH 1C5ZB 2PSXA 2GMTC 3MHWU 4UFEH 1SPJA 4NGAH 1TNGA 3MH7A 1GBEA 1O33A 1PPGE 3TGJE 1F0SA 1L4ZA 2V35A 2GCHG 1XX9A 5DP7A 4XBDA 3P8GA 1QRWA 1SGEE 1AZ8A 3SI4H 2TRMA 2ZF0H 1XUIA 1HJAC 2A5IA 2BD5A 1KLIH 3MU8A 3O8DA 3RMNH 1AB9B 1GMDG 4QT8C 3LGTA 1WU1A 1WV7H 4DURA 1GHAG 1TNHA 1EASA 1OPHB 2HGTH 3EYDA 4YOIA 3I29A 3D23A 1IHSH 3R0FA 1LHDH 2FEQH 5E0HA 4YT7H 3LT3A 3ZVDA 1WUNH 2ZFSA 4FXGH 3SNEA 3Q3YA 5J4SA 4ZMAH 3QLPH 1NU7B 2GDEH 2JKHA 1ZMJA 3S69A 1ARBA 3RXVA 5GPIB 3KF2A 4A1VA 1OYQA 3VB4A 2UWOA 4FUEA 5GCHG 3PWCA 4UD9H 4I8GA 1WOFA 4X1SU 4A5TS 2BLWA 1T8LA 1P2OA 1Y3VA 4DVAU 3UQVA 1SFQB 1HAOH 3A8AA 3RXBA 1N8OB 2WUBA 2ZTYA 5T6FA 1ELFA 3GY3A 1P2JA 1Z8JB 5DO4H 1QBVH 1TALA 3BSQA 1C1UH 2F3CE 4INLA 1CT4E 3SNBA 1T4UH 1ZR0A 3H7TA 2HNTC 3STIA 5A2MH 3MMGA 3P8NA 1F5KU 2GZ7A 1HAVB 4GAWA 4H6SB 8GCHG 2OQUA 4K69A 4AG1A 1P03A 1C2KA 1LVOA 1FMGA 2XRCA 1G3BA 3W95A 1O3FA 1O3HA 1GBMA 2GX4A 3QZRA 4CREA 3BTME 3P8FA 1DFPA 3RXLA 1ANBA 2ZU5A 2FIRH 1AB9C 2OD3B 1P9UA 3E91A 5JBCS 1ETTH 1SGQE 3CP7A 3RXOA 1SGIB 3VGCC 1L1JA 2P8OB 4GPGA 1SLXB 3P6ZB 4H42U 2EEKA 5JDUB 4TPIZ 1O2SA 1RIWC 4ABFA 3MU5A 3JZ1B 3NCLA 1DITH 3SHCH 4CR9A 4Y7AA 4YOJA 3V0XA 1SSXA 2XC4A 5EW1H 2O8UA 3LC5A 3RP2A 2THFB 5DJ7A 1EZSC 1AGJA 2WUCA 3BTQE 1NY22 3KEEA 1O3OA 2FOFA 4NIYA 3NWUA 2A1DB 4X6MA 2CN0H 1C2FA 5ETXA 1KTSB 1XUJA 4CH2B 4NA7A 1DX5M 5C20A 1IQMA 4OS2A 3UR6A 1A2CH 8LPRA 1QFKH 4ISIH 1XVOA 4U30A 2C4FH 1N8OC 1O2HA 1O3DA 3F6UH 3SGBE 1EUFA 4YO9A 2B8OH 3KCGH 1O2QA 1FI8A 1GHZA 1ZTJA 1UVOA 3RXGA 1C5PA 1O2IA 1YLCA 4K1EA 4I8JA 1PPCE 5C1XA 1HAXB 1RFNA 1P2QA 1OKXA 4X8VH 1KTTB 4MNYA 4MDSA 1V2WT 2VJ1A 2HNTE 3TNTA 3SQHE 1XXFA 1GCTC 4FUCA 4X2YA 1F0UA 5L2YH 1EKBB 3LGIA 3KN2A 3LGYA 1GHWH 2R0LA 1O34A 4IMQA 3PTNA 1C2JA 2B5TB 1FQ3A 1TOMH 1G37A 1LPKB 1D3TB 4F49A 1Y5UT 1OOKB 2VWNA 1GBFA 2Z94A 3ZVEA 2WPMS 2SGAA 3GY4A 3PLKA 1TOCB 1C2MA 2PHBA 3Q76A 3BTGE 3UIRA 2W3IA 3BEFB 1A0LA 4Z6AH 1V2MT 2WPIS 2ZDVH 2ZNKH 1PPZA 1AVGH 3ODDA 3HPTB 1L4DA 3NKKA 4ABDA 3PB1E 5DP5A 1YPJH 1LO6A 2AS9A 1DLEA 2FOCA 1ETSH 2Q6GA 3VFEA 3SJOA 5CE1A 3PMJA 4IW4E 1WTGH 5DPAA 2ZFTA 4VGCC 3AAVA 4YZUA 4X6NA 4D7FA 3P8OA 1VJAU 1ZHMA 4FUHA 1E34B 1SHHB 3AW0A 1MTWA 1ZJKA 1FZZA 2VIQA 3K9XB 1KSNA 1ZMNA 3UWIA 4IGDA 1ELVA 2A45B 2AFQB 1C4V2 1HBTH 1HAIH 2W5EA 4ISOA 3DHKH 3ESTA 1YP9A 2H6MA 3KL6A 3UNRA 3CS7A 4CRFA 4RSPA 1FY3A 2PKAB 1QHRB 4B75A 1EZQA 4U32A 1V2OT 3PMHB 3P70B 1PYTD 3MO9A 1UTPA 3M7UA 4O3TA 1UHBB 3ZVBA 2C8WB 4XBCA 3TNSA 2P3FH 1K1PA 4CBNA 1C1RA 1F2SE 2Y82A 3T62A 4DCDA 1V3XA 3BTFE 3ATWA 1F5LA 1FN6A 1L1GA 1UVTH 4Y0ZE 1LVYA 2H5CA 2JH0D 1ABIH 3KIDU 4MNVA 2IPHA 3MNCA 4J1YA 1V2KT 2ZU4A 3E0NB 4K1TA 1BB0B 2UWPA 2AERH 4GVUA 1Z1JA 4GHTA 1GMCF 2RA3A 4X6PA 5HM9A 3S9BA 3ATMA 3N7OA 5L2ZH 2PGQB 1L1NA 2Q1JA 3EQ0H 1ZMLA 2ZFRH 5EQSA 1FY4A 1O3GA 1ACBE 3VB5A 1LHGH 1NRPH 2K1QA 3SNDA 1SOTA 4CRDA 4UONA 2BQWB 2YOLA 2Q6FA 2ZGBH 1NRNH 1VITG 2O8WA 1UTNA 3HK6B 4WMFA 7GCHF 4NWKA 1LCYA 1TBQH 4AFQA 3A8CA 1QRZA 1ZGVA 2SGEE 1C2DA 4B2BA 4KGAA 1ZRKA 1EOLA 3RDZA 1ESAA 4FU8A 5F6MA 4BAKB 5EODA 2ZDMA 3GCNA 4Y76A 3RXQA 2Y6TA 1C4U2 3MTYA 1BTYA 1A4WH 2G4TA 4BXWA 1OWKA 2ZEBA 2WPLS 3T27A 1OXGA 1MCVA 3ZZBA 4ASHA 2QXJA 2P93A 4ZXXH 1H8DH 1MTNB 1YYY1 1P09A 2CGAA 2VNTA 1E37B 2UUJB 4M7GA 3LJJA 2BOHB 1MTVA 2YNBA 5EPYA 4O3UA 1O32A 3HATH 3LONA 1Z8GA 3MYWA 3OY5U 3TU7H 4X2WA 3A88A 1DWCH 1CHOF 2Z7FE 4NIWA 4YLQH 1QBOA 5H4IB 1O2RA 3OX7U 2ZTZA 2EA3A 3BN9A 1O2YA 1T31A 1NO9H 1XUHA 2BD3A 3HK3B 1LHEH 5CMXH 3A7VA 3KQBA 5DGJA 2EI7A 2IN2A 2HALA 1GBIA 5IYTA 1DT2A 3RMOH 3GYMA 4RN6A 3FP6E 5DK1A 1PQ5A 3T26A 4AFUA 4JZIA 2O8MA 1ESBA 5HGGA 4IS5A 1MAXA 3URDA 1IQFA 3EA8A 1AVWA 2P59A 4E7NA 4JYVH 2O8TA 3U69H 1SQTA 1GHBG 1GJ7B 1CA0B 1NFXA 1B0EA 3VPKA 2PR3A 1MAYA 1ZRBA 2ZHEH 4GUXA 4ZKSU 5C5NA 1T8OA 4K60A 2Z9KA 1CT0E 2BVSH 4NZLA 5AFYH 4Q7ZA 1VJ9U 1GI3A 5L30H 3UNSA 2OTVA 3LH3A 1MU8B 3TJOA 2IJOB 1UJ1A 3TK9A 4BAHB 2ZHWH 4Y10E 1O2WA 4O03A 1G36A 3STJA 5E8EH 3VEQB 2ESTE 1SB1H 1TA6A 4NIXA 2OXSA 4K1SA 1MUEB 3SV8A 2LNCA 1UTQA 2C8XB 1MMJN 1K22H 1N1LA 2R0KA 1ZPCA 3LIWA 3SOSA 5JBAS 1O5EH 1DWBH 1SFIA 2FLBH 2Y5HA 2SNVA 1ID5H 5I46H 2QC2A 1NRQH 1SGPE 1IQEA 2BOKA 4NA9H 3PYHA 3M35A 3I78A 3EE0B 1Z8RA 3RC5A 2VWMA 1ELGA 4BTIB 3BTEE 2ZCKP 2FWWA 3FP7E 2BDCA 3T2NA 4NSVA 1QA7A 4WVPE 1GVKB 2G81E 1CA0C 1TABE 1O2UA 3ZVAA 1O2NA 1O2VA 3H7OA 1O5GH 3A83A 3PLPA 3QO6A 1QRXA 3MU4A 1AFQC 1P12E 2SGQE 3NK8A 1H4WA 3QWCH 1G2MA 3TK6A 2BLOA 2BX3A 1K28D 2OQ5A 3LDXH 4MVNA 4UFFH 2BY7X 2C3SA 1C1SA 1ZZZA 1HB0B 3ZZ3A 1C5UA 1GHYH 3V3MA 4DGJA 1BMAA 2ZDAH 2HPPH 1HFDA 1YPHC 1X7AC 3RU4D 2FOEA 3QTVH 4XE4A 1LKAA 1HAZB 4U01A 3VB7A 2A4QA 1SQAA 1O2MA 2B0FA 2G4UA 4LZ4B 1O2XA 3SU1A 3T28A 1W7GH 2ZKSA 1TMTH 1GBAA 1TIOA 1GI4A 1Z7KA 1GG6B 3ZVCA 1ZYOA 1O30A 3L33A 3ZZDA 2EI8A 1QNJA 2ZPQA 1C5WB 2TGAA 1ZSLA 4ESTE 1JWTA 1LHCH 3E6PH 3TGIE 3SU3A 1A5GH 1TPAE 1GL1A 1L2EA 3SUGA 2BDIA 2QXIA 1ZLRA 2P3UB 3GY7A 1MU6B 3M36A 3UY9A 1IQLA 1HIAB 5HM2A 1C9TA 1GHAF 2BM2A 1Y59T 3DA9B 1GJ6A 2Z9JA 5DP3A 4BXSA 4B76A 1EQ9A 1EPTA 4F4OC 2XYAA 2ZFQH 2CXVA 2W7SA 3Q77A 4CHAC 2H9HA 2RDLA 1GJDB 4MPXA 2JETB 2VINA 1GJ8B 4CRBA 1U6QA 5EQQA 4PROA 2ZFFH 4SGBE 3RXTA 4ABJA 3K6YA 2SNWA 1H8IH 4JMYA 2BY9X 4THNH 2Y7ZA 2AGEX 1MCTA 4X1QU 4D9RA 3MNXA 1Z1IA 4ABGA 5FAHA 2ZC9H 1ZHRA 2PUXB 1FY1A 3ZV8A 2FTMA 4XOJA 2UUFB 2A7HA 2HPQH 1ZGIA 2GDDA 3RXCA 1NRRH 4AYVB 1RS0A 3BTKE 2G5VA 1ZTKA 3JZ2B 2ANYA 3TH2H 2V6NA 1BRAA 3SU4A 1O3JA 1WAYB 4BOHA 1TB6H 1EAUA 5L6NH 3SV2H 1JOUB 1A5HA 1DY9A 1ZPBA 2HWLB 2OCVB 1QJ7B 1FIWA 4D76A 1IQGA 1XKAC 1GG6C 1UMAH 1W0YH 3BG4B 3M5LA 2NU2E 2FPZA 1YPHE 1O35A 3ZZ9A 2VIWA 4ZKNU 1ANCA 2WYGA 4CRAA 4YTAA 1TQ7B 3QK1A 1EPTC 1JRTA 3VB3A 2FZZA 2TPIZ 5LPFA 3LPRA 4RKJB 3MU0A 2F9VA 1ZJDA 1C5YB 1BDAA 1KXEA 5T6GA 3BEIB 2QF0A 3U8TH 1P11E 2XC0A 1XUFA 1BRCE 4OGYA 2Z6BD 1DANH 1RRKA 1THPB 1ELAA 1C5VA 1S5SA 1W0ZU 1HJ9A 2XBVA 1GMHF 3ZZ7A 1GJ5H 4Y71A 1O38A 1GHVH 4FVBA 1K1OA 1TPOA 2ANMH 2OUAA 5FCKA 3SUEA 1C2IA 4JZFH 1CE5A 1HAVA 5GIBA 2FYQA 5C2ZA 2UUYA 2BZ6H 4ABIA 3R3GB 5K0HA 2SGPE 1P3EA 1G3EA 3M61U 5HYOA 1FUJA 1DM4B 4H4FA 1HAGE 1TGTA 3RU4T 1XVMA 1YM0A 2FODA 3OU0A 2OC8A 3RXRA 1LQDB 1AIXH 1SC8U 1TNKA 5A09A 2FOBA 3RXFA 4OGXA 1A1RA 5EXLA 4AG2A 3NZIA 1DY8A 4AOQA 1BJUA 3L3TA 1BRUP 2ZU2A 3D62A 6CHAB 3F9HA 4ZHMU 5EPNA 2Y7XA 1DSUA 2WV5A 1YCPK 1IQIA 1GGDB 1RJXB 1NESE 3ATIA 3E1XB 1P04A 1DLKB 2VIPA 1IQHA 3A82A 1Q31A 2EI6A 1TPPA 3F9GA 4TPYA 1WCZA 1C1VH 3QX5H 2FX4A 1UVSH 1O3AA 2GT8A 4K3JA 4BTTB 3H5CB 1O3LA 2ZCLP 3PO1B 5HXFA 1O2ZA 4YLUA 5I25A 1Y3WA 1SI5H 1Z6JH 1V2VT 1O39A 1MTSA 3BTTE 2XBYA 1Q2WA 3ZVFA 1C1QA 1GDUA 3EA7A 1QIXB 2FOGA 1O3BA 1W3CA 1Z8IB 2BD8A 2PWXA 4MLFB 2QXHA 1WQSA 1O3CA 1DXPA 5ABWA 3A7WA 1EJNA 1KXFA 1S0QA 1SGFG 3HGNA 1JXPA 4UE7H 3SZNA 4ZH8A 3SHAH 1BTXA 2AIPA 3RXHA 1DWDH 3E16B 1YKTA 3SV6A 4X0WU 1ZTLA 1AE8H 1C5OH 1OP0A 1F7ZA 2VGCB 2ULLA 2J38A 2P8OC 1Y3YA 1YF4A 1NM6A 2OP9A 2TGTA 1CGIE 3BIVH 3RLYH 4K5ZA 2A2QH 2I6SA 2ODQA 1S85A 4X6OA 2OBQA 1BUIA 2F91A 3BTDE 3TPIZ 2BMGB 1P2NA 2AEIH 2BY6X 2A7JA 1BRBE 2AGIX 1UK3A 1OWJA 3SBKA 1GI1A 3SU0A 1YPGH 1HNEE 4TYDA 1TYNA 1HUTH 4H6TA 4JYUH 3A7XA 2H2ZA 2ZPRA 3GDUA 4YM9A 1W10U 4DW2U 1GHXH 1T8NA 5EXMA 3RXPA 1C5QA 3OY6U 1O5CB 3RXAA 2GVFA 5LPRA 1YBWA 2O8LA 1B0FA 1PQ7A 1DXWA 4FVDA 3UOUA 4ZKRU 1FDPA 2A31A 4MTBA 2ZG0H 3A8BA 3I77A 3O8BA 2FS9A 1HCGA 1ESTA 3UWJH 1XMNB 3MNSA 2D26C 2FXRA 2ZU1A 1BMLA 3E8LA 3K2UA 5BPEA 1EJMA 2GCTB 2A0QB 4KP0A 3F1SB 2EC9H 2FESH 2W3KA 5E0JA 1CGHA 2FI4E 3SGQE 2GZ8A 1EAWA 5FX6A 1TE0A 1KXDA 3SV7A 3P17H 1BCUH 5A8YA 1EB1H 1HLTH 4KTSA 3TVJB 1Y3XA 6GCHF 4I31A 4K8YA 4YESB 3SN8A 2CHAB 1D6RA 1GBDA 3UNQA 3A7ZA 3WY8A 1KLJH 5FX5A 2FX6A 1AVXA 3A7YA 1ANDA 4MG3A 5DP9A 1TGCA 1Y3UA 2ANWA 3BV9B 2AYWA 2C8YB 5F8TA 4GCHG 1OWIA 1NC6A 3RC6A 4NWLA 3ENSB 2PKAA 5EG4A 2PTNA 3T5FH 1S6HA 1J8AA 1EB2A 4NZQA 1UHBA 4WY3A 2PKSB 2HNTF 3QTOH 3TIUA 1OSSA 1BZXE 1T32A 4A7IB 3OYPA 3Q00A 1WYKA 2R2MB 4ZROA 2D2DA 5CHAB 1KIGH 4AYYB 5C1UA 2VU8E 1DPOA 1UVUH 2SGFE 1HRTH 5ESBA 1DVAH 1SGDE 1QA0A 4ABEA 1B5GH 1CO7E 1KY9A 2NWNA 4BAQB 1G30B 2VH0A 4FUGA 1LVMA 2RCEA 3SJIA 2P16A 3U9AH 1GJCB 2FLRH 5B6OA 1O31A 2ILNA 1NU9A 1P0SH 4Y6DA 2Z3CA 2J4IA 4CRGA 5DG6A 4XFQA 1TRMA 2CJIA 5FHTA 2H1UA 1NRSH 3LKWA 4KTUA 3PLBA 3MH5A 2XWAA 1SGYE 1NPMA 2XTTB 1UK4A 4IMZA 4Y8ZA 1EZUC 2ZCHP 5DP8A 4ABHA 4KELA 3ZV9A 1FY5A 4LOYH 1GI2A 1MBMA 1O3MA 1GI5A 1VCQA 2Q6DA 1BTUA 1W13U 1E0FD 1E35B 1FPHH 1DS2E 1OWHA 4YOGA 1EATA 1O5BB 3QGJA 4KTCA 1CA8B 2NU0E 2W26A 7KMEH 1GDNA 1P05A 2XBXA 2PUQH 3ZYEA 4KKDA 3U98H 1QJ1B 1RTKA 1V2LT 5C67A 3ODFA 2JH5D 1AMHA 2FS8A 2SGDE 3S7KB 2GP9B 4E06H 3GICB 1C1MA 7GCHG 1CQQA 1O2PA 4AN7A 5TCAA 1OWEA 1DE7H 2STAE 5E0GA 1SLUB 2KAIB 3GISB 2XBWA 1A3EH 2G52A 5AVDA 4OS4A 1DUEA 1FXYA 1J16A 1GHBF 3RXKA 1N6YA 1HAHH 3TH3H 1JBUH 2BYAX 2W7UA 4X2XA 5FBIA 4AX9H 1YCPH 1EAIA 4E05H 1QBNA 2BXUH 3EDXB 2OINA 5JB8S 2HRVA 2ANKH 1LDTT 2FTLE 2ZECA 2FM2A 1TX6A 4FUJA 6ESTA 4RKOB 4WXVA 4X1RU 1GI7B 1D6WA 3KGPA 1C1WH 3GCTF 4GHQA 4CRCA 4DIIH 2CF8H 5HMAA 3P95A 5IDKA 4FUBA 2Z9GA 3A85A 1O2KA 3BTHE 1QQ4A 2BD9A 2BDGA 2JH6D 1WQVH 2XWBI 4TY7A 1INCA 1BBRK 1D9IA 1S82A 2STBE 2ZO3H 1NZQH 5JBBS 5JBTA 1AUTC 2FI5E 1PYTC 2WPKS 2D8WA 2ZP0H 3PROA 2FDAA 2XCFA 1SGFA 1WBGB 3ZZ4A 2HVXA 2Z9IA 1K1IA 1HXFH 5C1YA 1G2LA 1YGCH 2H9EH 4D7GA 1GI6A 2BDYA 1MTNC 3ZZAA 3C1KA 1THRH 1L0ZA 1VZQH 3QGNB 1TNJA 3NPSA 2J34A 1AI8H 1IQNA 1LMWB 4WF8A 1GWAA 1CU1A 1FAKH 2ALPA 1ELBA 1MKXH 2AIQA 1M9UA 1THSH 1A46H 2GKVE 1GDQA 1BOQA 3SU6A 1P8VC 4Y11E 2VWLA 2NU1E 2QXGA 2I6QA 3U1JB 2ZIQH 1ANEA 4DY7B 1GCDA 1AD8H 4Y79A 1WTHD 3BF6H 3SORA 3K6ZA 3PMAB 2YNAA 1BT7A 1J15A 3NUMA 2VIDA 3UUZA 3A84A 1C1TA 2GT7A 1K2I1 3HKIB 1OYTH 1MBQA 1V2PT 3B9FH 3TITA 1EAXA 2AMPA 2ZTXA 2BDBA 1K9OE 4Y8YA 2A7CA 1CHGA 1YCPM 2OC1A 4ZAEA 1GJAB 2GMTB 1MZAA 4IC5A 2XC5A 1HGTH 3M5OA 4R8TB 3QUMP 3FVFB 3LOXA 1PFXC 1UTLM 3VB6A 5FBEA 2UWLA 2P3TB 4NFEA 3RXMA 1PQAA 3ATKA 3U8OH 2WINI 1HJAB 3FP8E 1N6XA 1V2JT 3MH4A 1XXDA 3ZVGA 1K1MA 4WH6A 3K65B 3MFJA 5F03A 1T7CA 2GD4B 1NFYA 2BVRH 2FP7B 1O5FH 2CF9H 4ISHH 1TNIA 2LPRA 1ELDE 2BY8X
chains in the Genus database with same CATH superfamily
1YY3A 1RTFB 2KCYA 1A0JA 1LPZB 1TGNA 1P2MA 3P92A 5K7RA 3S9CA 4ZHAA 3CENA 1TQ0B 3LU9B 1C9PA 2VVCA 3QDZB 2GCHF 1VGCB 4MPVA 4AB8A 3S7HB 1G3CA 2HVYB 4WMDA 4M9FA 3GDSA 1C2EA 3M37A 3VXEH 4NA8A 2V3MA 2FO9A 2FYRA 4AGJA 1GMDF 5EQRA 2H5DA 3SJKA 3VXFH 3L6PA 3MNBA 4A1TA 1RGQA 1VKYA 1D4PB 2F9PA 3KHVA 3URCA 5TJXA 3MWIU 3E3TA 3IITA 3LGVA 4AFZA 1QY6A 1A0HB 4R0IA 4X8UH 1OX1A 1ZSJA 1JMOH 1O0DH 1BHXF 2ZPSA 3OE7D 1DOJA 2BLQA 1P06A 1GBHA 3A7TA 5A0BA 1HIAA 1S84A 2XNIA 2ZHFH 1AFEH 2A32A 1G3DA 3U8RH 5GCHF 4JK5A 2OC0A 1O3EA 2BD7A 3PTBA 4XD7D 5E2PA 2FOAA 4CR5A 1S81A 2ZI2H 1AZZA 3GCOA 1UVPA 1YPMH 3FN8A 3GDVA 4FU7A 4AZ2B 3VGCB 3RM2H 1BIOA 3BG8A 7ESTE 4MPUA 9ESTA 4X8TH 5C5OA 1P01A 1RIWB 2J97A 3BIUH 2G00A 3TH4H 1SOZA 3A86A 1YLNA 3A8DA 4MNWA 5EW2H 3TK5A 3SO3A 2TIOA 8GCHF 1VITH 2R9PA 2ZU3A 4B74A 3KQEA 3EGKH 3FZZA 1AKSB 1SLVB 2F9BH 1SGCA 1ZSKA 3HGPA 1A7SA 1MD8A 1D3PB 1GBCA 4I33A 5SGAE 2V3HH 2ZGJA 1VGCC 2ZA5A 1QB6A 3B23B 3FOAA 2ODPA 1W11U 3SUDA 3IWMA 1BITA 1XKBC 2OC7A 3GOVB 2BD2A 2LELA 5BRRE 4UFGH 1F92A 3F9EA 3M7TA 2QGRA 1O36A 1SHYA 3O8CA 4P02A 1JIMA 2QF4A 1SR5C 1AKSA 3DSGA 3OAAD 1IQKA 4MNXA 2ZGCA 1P2IA 3M5MA 4LXBH 3FFGA 1EJAA 3E0PB 1RD3B 1LTOA 2TGPZ 5AFZH 1BQYA 3SGAE 2JETC 3LGUA 2AGGX 2QIQA 2F9UA 2ZDNA 4B71A 1GJ4H 4WMEA 2L74A 4XSKU 5EOKA 1BTZA 4FETA 1AQ7A 1TBZH 1UO6A 2G51A 4CBOA 4RI0A 1EFRD 1HYLA 2BQ6B 5GDSH 3LC3A 1TGBA 1C5SA 8ESTE 1GCTB 4JCNA 1HDTH 2YMSC 1BBRH 3RMLH 5LH8A 2ZGHA 4TWWA 4AGKA 3KQCA 2AH4X 1C1PA 4LZ1H 4NG9H 4OS6A 4B2CA 1GMHG 2DUCA 2CV3A 1A3BH 2PSYA 3UFAA 1K1LA 2PTCE 2PFEA 1C1OA 1J17T 2F9OA 1CVWH 1DWEH 3M5NA 5FPTA 4DIHH 2CMYA 1HPGA 3NRLA 4OS1A 4O97A 4RT0A 3FZDA 2QYIA 3BG4C 1W14U 3C27B 3DFLA 3TJVA 3RXSA 4BAMB 3ATLA 1V2UT 2L6OA 1DUAA 1C5XB 4HGCA 5GXPA 1TPSA 3A81A 2FOMB 4U2WA 1ETRH 3GY5A 1FLEE 3ZZ8A 1GBBA 1UTKA 1QZ8A 3LJOA 3GCHB 3GY8A 1GBTA 4XDEA 2GZ9A 2WPJS 3TJNA 2BDHA 3AAUA 1K1JA 3V12A 1OWDA 1SVPA 2B7DH 2ASUB 1E1QD 4VGCB 2NU3E 4WXIA 1PQ8A 1ZOMA 3M3VA 4NSYA 1C5NH 4Q7XA 5EU8A 3S9AA 3W94A 1G9IE 5A8XA 6LPRA 4HTCH 5KECA 2C8ZB 4X2VA 5FPSA 1AU8A 1QCPA 1T8MA 3EA9A 3RXIA 3GY2A 5IK2D 5T1VA 1AN1E 1UK2A 3FANA 1P2KA 4Q80A 1MKXK 2AMDA 5FXLA 1TX7A 4AFSA 4B73A 2ZQ1A 2BDAA 4TWYA 1V2QT 1BTWA 1EP5A 1LVBA 1YPEH 3IG6B 4ISLA 3PWBA 3ZZ6A 1H1BA 2M5TA 5JPMH 4AB9A 3TJUA 1C5RA 2OBOA 1O3IA 2A4GA 2H9TH 4YXWD 4FUIA 2PW8H 6CHAC 5LGOA 1W8BH 4MQAA 1DDJA 1QL9A 1GGDC 2D1JA 3PV4A 5F8ZA 3RXDA 2WYJA 4I8HA 3RLWH 3RXEA 1IAUA 2G8TA 2P94A 4OS5A 4BAOB 1TWXB 5GWZA 1MKWK 1VCPA 2XW9A 4JYTA 3RU4E 5J4QA 1UCYH 1V6DA 1P02A 1H9HE 2V0BA 3SJ8A 4FU9A 1FJSA 1C5LH 1UTJA 2ZGXH 3PO1C 1CBWB 2KR7A 1JIRA 1EX3A 1TRYA 1ARCA 1C4Y2 5C3NA 4D8NA 3MH6A 1TONA 3GY6A 1ABJH 2BD4A 2F9NA 1SGTA 3GCHC 1NROH 1GI9B 4ZKOU 2A2XH 3S0NA 5A8ZA 3RM0H 1BBRE 3A87A 3F0PA 1V2RT 1FIZA 1Z71A 4DG4A 3UR9A 1K1NA 4TY6A 1TLDA 2EQNA 4GCHF 2IOTA 1BMMH 1PPHE 1PPBH 1QL8A 3AW1A 1O2OA 1QTFA 4X1NU 2VGCC 1K21H 4XRNA 1J14A 3LH1A 4FUDA 1OP8A 2XCNA 4WWYA 1FAXA 3OEHD 1CGJE 3PMBB 1QGFA 4Z0KA 1S0RA 3DUXH 1KDQB 1SGNE 2VB0A 1QB9A 1MH0A 1V2ST 1HJ8A 2PLXA 5DKMA 2J9NA 2V3OH 3H09A 2C93B 2J92A 1NT1A 1H9LB 1ELCA 3OSYA 5A0CA 3TGKE 2ODYB 3V7TA 1BTPA 1BHXB 4FUFA 3SUFA 6GCHG 1GBKA 1VITF 2A4RA 4K8BA 2Y5FA 5HIZA 2GTBA 5FCRA 2R3UA 1KDQA 1T4VH 2F83A 1Y5BT 2NU4E 2ZQ2A 2ZHDA 1VCWA 3OTJE 5G4BA 3TLOA 1QR3E 1AHTH 3EAJA 4JK6A 5DP6A 1CBWC 3ZYDA 2QF3A 1BTHH 1O3KA 2Y80A 2VWOA 1S83A 1TMBH 2VIVA 3E90B 3T25A 3RUOA 1S6LA 1F0TA 1K0HA 3HKJB 4DJZB 1GVZA 2GCTC 1IHTH 5AF9H 3SNCA 2QA9E 3RC4A 1OS8A 2BY5X 1A61H 1KXAA 2VH6A 4O9VA 2BHGA 1O2GH 4IN2A 1NBME 1O37A 2UUKB 4CH8B 1XUGA 1ZPZA 2B9LA 2WPHS 4A92A 3F68H 1ELTA 1GMCG 2BVXH 4X8SH 4HI3A 1GBJA 1D3DB 1PPFE 4Y0YE 2CHAC 1QJ6B 2J2UA 1GL0E 1SQOA 4ACBA 1D3QB 1W2KH 1QQUA 4E7RG 4Y8XA 2J94A 5ESTE 1MD7A 2WV4A 1UCYE 1YPKH 5TCCA 1SQRA 2ALVA 1RTLA 4UEHH 3RMMH 2FMJA 3SU2A 3F9FA 3CS0A 3OTPA 3RXJA 4IC6A 1EOJA 1GPZA 1A5IA 1TMUH 4ISNA 3F2HA 1Q3XA 1ZHPA 2RA0A 1HV7A 3MOCA 1HAPH 1FN8A 3SNAA 2R2WU 1EP6A 3DFJA 2PKSC 3BTWE 2ZHQH 2BXTH 1AY6H 2A4OA 3UOPA 2VIOA 1H9IE 2OLGA 1SG8B 5CHAC 5T3HA 2DE8A 1P9SA 3G01A 2XXLA 1W12U 3CNRA 1BMNH 1OP2A 1TX8A 1C5MD 9LPRA 1G32B 3SQEE 1C5TA 3FAOA 1ORFA 1O5AB 3AVZA 3N7EA 3RXUA 1PJPA 2KAIA 1FPCH 3AASA 4ABAA 3MI4A 4INHA 2BZAA 3T29A 3SI3H 2PV9B 2QY0B 1Y5AT 3PRDA 2GV6A 5JYIA 2QV1A 4OS7A 4I8KA 4UFDH 1MQ6A 1V2NT 2BLVA 1C2HA 1P10A 1CHOG 2QE7D 1TAWA 3SYJA 1F5RA 1E38B 3SW2B 4X1PU 2Y81A 4ABBA 1FNIA 1YPLH 4B1TA 2QCYA 4A1XA 4DOQA 3NXPA 2VVUA 4I8LA 5T6DA 4LK4A 4SGAE 1O3NA 1P57B 3FKSD 4B2AA 1TBRH 1O2JA 3MU1A 2G55A 1FONA 3DD2H 4Y7BA 1AFQB 3A80A 4IN1A 3ZZCA 2GGVB 4D9QA 1AWHB 1XUKA 2PGBB 1GBLA 3M7QA 4NCYA 5JB9S 2RFKC 4NFFA 4HFPB 1NN6A 1KXBA 1SL3A 1EXFA 1XM1A 2Z9LA 3M3SA 1AUJA 1F0RA 4INKA 8KME2 1Z6EA 1B7XB 3GCTG 2Z3EA 5FPYA 3U1IB 2FOHA 1YC0A 4Q2KA 1AO5A 1YLDA 2DE9A 1CT2E 2J98B 5PTPA 2BB4A 3D65E 1GI8B 1O3PB 2VVVA 2ZWLH 4BNRA 1SMFE 5A0AE 3SJ9A 1ELEE 3QZQA 1GJ9B 3PV5A 1DICA 1Y8TA 3SU5A 1J9CH 1C1NA 1NTPA 2ZZUH 4ZUHA 3QN7A 4WH8A 5E2OA 1W7XH 2IJD1 1GJBB 1MQ5A 4K2YA 2TBSA 5F8XA 2J98A 1BJVA 2FI3E 4A6LA 1GI0A 1UTOA 1AE5A 2HLCA 4HZHA 3SV9A 3M3TA 2BTCE 3O8RA 1E36B 3PM3A 2G5NA 1AWFH 1GVLA 1MKWH 2ZFPH 1MTUA 1SKYE 4I32A 4NIVA 1C2GA 1TGSZ 3UTUH 1PPEE 1QB1A 1IQJA 1DSTA 1QURH 2TGDA 5EGMA 3A89A 5AHGH 3ZZ5A 4ZHLU 3LGWA 2RG3A 3D49H 3DT0H 2O9QA 1TA2A 3Q3KA 1LKBA 1NFWA 3GYLB 4JZDH 4YT6H 4AORA 4CHAB 2BX4A 1W0JD 1S6FA 3ELAH 1VR1H 1LHFH 2Z3DA 2GV7A 1KYNA 3UPEA 1WXRA 1IOEA 1HXEH 2AMQA 3MO6A 2Y5GA 2AHME 1UCYK 2A5KA 3UQOA 1NS3A 1O2TA 3KNXA 1C2LA 1SBWA 7LPRA 2R3YA 4JZ1A 1SLWB 5HIYA 1O5DH 3Q3XA 3V13A 1TRNA 4MPWA 1P3CA 1TFXA 4GSOA 1KLTA 2P95A 2QAAA 2QF5A 3BEUA 2BQ7B 1MZDA 3ITIA 1QL7A 1NFUA 2QN5T 4WJG2 1JRSA 2SFAA 1EZXC 3MO3A 1RXPA 2HOBA 4DT7B 3PV2A 4ZXYH 4BTUB 2WHXA 1V2TT 3B8JA 2KCPA 3KQDA 2C90B 1UTMA 4XBBA 5LPEA 1BA8B 1WSSH 4J2YB 1LQEA 1KMHB 1FY8E 5DP4A 1KXCA 5GJ4B 5EXNA 1TNLA 4GLYA 1HAYB 1CSOE 1EPTB 2ZDKA 4BANB 1O2LA 4Q7YA 2ZDLA 4UDWH 1FV9A 2A5AA 4I7YH 4JZEH 2J95A 3UREA 1LPGB 1SGRE 4IBLH 5C94A 1C5ZB 2PSXA 2GMTC 2CK3D 3MHWU 4UFEH 1SPJA 4NGAH 1TNGA 3MH7A 1GBEA 1O33A 1PPGE 3TGJE 1F0SA 1L4ZA 2V35A 2GCHG 1XX9A 5DP7A 4XBDA 3P8GA 1QRWA 1SGEE 1AZ8A 3SI4H 2TRMA 2ZF0H 1XUIA 1HJAC 2A5IA 2BD5A 1KLIH 3MU8A 3O8DA 3RMNH 1AB9B 1GMDG 4QT8C 3LGTA 1WU1A 1WV7H 4DURA 1GHAG 1TNHA 4Q63A 3WW7A 1EASA 1OPHB 2HGTH 3EYDA 4YOIA 3I29A 2KCOA 3D23A 1IHSH 3R0FA 1LHDH 2FEQH 5E0HA 4YT7H 3LT3A 3ZVDA 3KQ5A 1WUNH 4I86A 2ZFSA 4FXGH 3SNEA 3Q3YA 5J4SA 4ZMAH 3QLPH 1NU7B 2GDEH 2JKHA 1ZMJA 3S69A 1ARBA 3RXVA 5GPIB 3KF2A 4A1VA 1OYQA 3VB4A 2UWOA 4FUEA 5GCHG 3PWCA 4UD9H 4I8GA 1WOFA 4X1SU 4A5TS 2BLWA 1T8LA 1P2OA 1Y3VA 4DVAU 3UQVA 1SFQB 1HAOH 3F3BA 3A8AA 3RXBA 1N8OB 2WUBA 2ZTYA 5T6FA 1ELFA 3GY3A 1P2JA 1Z8JB 5DO4H 1QBVH 1NBMD 1TALA 1C1UH 2F3CE 3BSQA 1CT4E 4INLA 3SNBA 1T4UH 1ZR0A 3H7TA 2HNTC 3STIA 5A2MH 3MMGA 3P8NA 1F5KU 2GZ7A 1HAVB 4GAWA 5EJLA 4H6SB 8GCHG 2OQUA 4K69A 4AG1A 1P03A 2KFWA 1C2KA 1LVOA 1FMGA 2XRCA 1G3BA 3GS9A 3W95A 1O3FA 1O3HA 1GBMA 2GX4A 2JIZD 3QZRA 4CREA 3BTME 3P8FA 1DFPA 3RXLA 1ANBA 2ZU5A 2FIRH 1AB9C 2OD3B 1P9UA 3E91A 5JBCS 1ETTH 1SGQE 3CP7A 3RXOA 1SGIB 3VGCC 1L1JA 2P8OB 4GPGA 1SLXB 3P6ZB 4H42U 2EEKA 5JDUB 4TPIZ 1O2SA 1RIWC 4ABFA 3WWFA 3MU5A 3JZ1B 3NCLA 1DITH 3SHCH 1FX0B 4Y7AA 4CR9A 4YOJA 3V0XA 3F0OA 1SSXA 2XC4A 5EW1H 2O8UA 3LC5A 3RP2A 2THFB 5DJ7A 1EZSC 3DCLA 1AGJA 2WUCA 3BTQE 1NY22 2KZ4A 3KEEA 1O3OA 2FOFA 4NIYA 4AC9A 3NWUA 2A1DB 4X6MA 2CN0H 1C2FA 5ETXA 1KTSB 1XUJA 4CH2B 4NA7A 1DX5M 5C20A 1IQMA 4OS2A 3UR6A 4Z1MD 1A2CH 8LPRA 1QFKH 4ISIH 1XVOA 4U30A 2C4FH 1N8OC 1O2HA 1O3DA 3F6UH 3SGBE 1EUFA 4YO9A 2B8OH 2KX4A 3KCGH 2JJ1D 1O2QA 1FI8A 1GHZA 2RDEA 1ZTJA 1UVOA 3RXGA 1C5PA 1O2IA 1YLCA 4K1EA 4I8JA 1PPCE 5C1XA 1HAXB 3MQKC 1RFNA 1P2QA 1OKXA 4X8VH 1KTTB 4MNYA 4MDSA 1V2WT 2VJ1A 2HNTE 3TNTA 3SQHE 1XXFA 1GCTC 4FUCA 4X2YA 1F0UA 5L2YH 1WDIA 1EKBB 2F4LA 3LGIA 3KN2A 3LGYA 1GHWH 2R0LA 1O34A 4IMQA 3PTNA 1C2JA 2B5TB 1FQ3A 1TOMH 1G37A 1LPKB 1D3TB 4F49A 1Y5UT 1OOKB 2VWNA 1GBFA 2Z94A 2V7QD 3ZVEA 2WPMS 2SGAA 3GY4A 3PLKA 1TOCB 1C2MA 2PHBA 3Q76A 3BTGE 3UIRA 2W3IA 2XOKD 3BEFB 1A0LA 4Z6AH 1V2MT 2WPIS 2ZDVH 2ZNKH 1PPZA 1AVGH 3ODDA 3HPTB 1L4DA 3NKKA 4ABDA 3PB1E 5DP5A 1YPJH 1LO6A 2AS9A 1DLEA 2FOCA 1ETSH 2Q6GA 3VFEA 3SJOA 5CE1A 3PMJA 4IW4E 1WTGH 5DPAA 2ZFTA 4VGCC 3AAVA 4YZUA 4X6NA 4D7FA 3P8OA 1VJAU 1ZHMA 4FUHA 1E34B 1SHHB 3AW0A 1MTWA 1ZJKA 1FZZA 2VIQA 3K9XB 1KSNA 2VBCA 1ZMNA 3UWIA 4IGDA 1ELVA 2A45B 2AFQB 1C4V2 1HBTH 1HAIH 2W5EA 4ISOA 3DHKH 3ESTA 1YP9A 2H6MA 3KL6A 3UNRA 3CS7A 4CRFA 4RSPA 1FY3A 2PKAB 1QHRB 4B75A 1EZQA 4U32A 1V2OT 3PMHB 3P70B 1PYTD 3MO9A 1UTPA 3M7UA 4TSFD 4O3TA 1UHBB 3ZVBA 2C8WB 4XBCA 3TNSA 2P3FH 1K1PA 4CBNA 1C1RA 1F2SE 3VG8A 2Y82A 3T62A 4DCDA 1V3XA 3BTFE 3ATWA 1F5LA 1FN6A 1L1GA 1UVTH 4TT3D 4Y0ZE 2WPDD 1LVYA 2H5CA 3N7DA 2JH0D 1ABIH 3KIDU 4MNVA 2IPHA 3MNCA 4J1YA 5KEDA 1V2KT 2ZU4A 3E0NB 4K1TA 1BB0B 2UWPA 2AERH 4GVUA 1Z1JA 4GHTA 1GMCF 2RA3A 1COWD 4X6PA 5HM9A 3S9BA 3ATMA 5DN6D 3N7OA 5L2ZH 2PGQB 1L1NA 2K8IA 2Q1JA 3EQ0H 1ZMLA 2ZFRH 5EQSA 1FY4A 1O3GA 1ACBE 3VB5A 1LHGH 1NRPH 2K1QA 3SNDA 1W0KD 1SOTA 4CRDA 4UONA 2BQWB 2YOLA 2Q6FA 2ZGBH 1NRNH 1VITG 2O8WA 1UTNA 3HK6B 4WMFA 4Q4LA 7GCHF 4NWKA 1LCYA 1TBQH 4AFQA 3A8CA 4B6EA 1QRZA 1ZGVA 2SGEE 1C2DA 3OFND 4B2BA 4KGAA 1ZRKA 1EOLA 3RDZA 1ESAA 4FU8A 5F6MA 4BAKB 5EODA 2ZDMA 3GCNA 4Y76A 3RXQA 2Y6TA 1C4U2 3MTYA 1BTYA 1A4WH 2G4TA 4BXWA 1OWKA 2ZEBA 2WPLS 3T27A 1OXGA 1MCVA 3ZZBA 4ASHA 2QXJA 2P93A 4ZXXH 1H8DH 3F2FA 1MTNB 1YYY1 1P09A 2CGAA 2VNTA 1E37B 2UUJB 4M7GA 3LJJA 2BOHB 1MTVA 2YNBA 5EPYA 4O3UA 1O32A 3HATH 3LONA 1Z8GA 3MYWA 3OY5U 3TU7H 4X2WA 3A88A 1DWCH 1CHOF 2Z7FE 4NIWA 4YLQH 1QBOA 5H4IB 1O2RA 3OX7U 2ZTZA 2EA3A 3BN9A 1O2YA 1T31A 1NO9H 2IPQX 1XUHA 2BD3A 3HK3B 1LHEH 5CMXH 3A7VA 3KQBA 5DGJA 2EI7A 2IN2A 2HALA 1GBIA 5IYTA 1DT2A 3RMOH 3GYMA 4RN6A 3FP6E 5DK1A 1PQ5A 3T26A 4AFUA 4JZIA 2O8MA 1ESBA 5HGGA 4ACAA 4IS5A 1MAXA 3URDA 1IQFA 3EA8A 3N99A 1AVWA 2P59A 4E7NA 4JYVH 2O8TA 3U69H 1SQTA 1GHBG 1GJ7B 1CA0B 1NFXA 1B0EA 3VPKA 2PR3A 1MAYA 1ZRBA 2ZHEH 4GUXA 4ZKSU 5C5NA 1T8OA 4K60A 2Z9KA 1CT0E 2BVSH 4NZLA 5AFYH 4Q7ZA 1VJ9U 2JDID 1GI3A 5L30H 4P00A 3UNSA 2OTVA 3LH3A 1MU8B 3TJOA 2IJOB 1UJ1A 3TK9A 4BAHB 2ZHWH 4Y10E 1O2WA 4O03A 1G36A 3STJA 5E8EH 3VEQB 2ESTE 1SB1H 1TA6A 4NIXA 3W1EA 2OXSA 4K1SA 1MUEB 3SV8A 2LNCA 1UTQA 2C8XB 1MMJN 1K22H 1N1LA 2R0KA 1ZPCA 3LIWA 3SOSA 5JBAS 1O5EH 1DWBH 3EE7A 1SFIA 2FLBH 2Y5HA 2SNVA 1ID5H 5I46H 2QC2A 1NRQH 1SGPE 1IQEA 2BOKA 4NA9H 3PYHA 3M35A 3I78A 3EE0B 1Z8RA 3RC5A 2VWMA 1ELGA 4BTIB 3BTEE 2ZCKP 2FWWA 3FP7E 2BDCA 3T2NA 4NSVA 1QA7A 4WVPE 1GVKB 2G81E 1CA0C 1TABE 1O2UA 3KYFA 3ZVAA 1O2NA 1O2VA 3H7OA 1O5GH 3A83A 3PLPA 3QO6A 1QRXA 3MU4A 1AFQC 1P12E 2SGQE 3NK8A 1H4WA 3QWCH 1G2MA 3TK6A 3DSPA 2BLOA 2BX3A 5KGOA 1K28D 2OQ5A 3LDXH 4MVNA 4UFFH 2BY7X 2C3SA 1C1SA 4DT4A 1ZZZA 1HB0B 3ZZ3A 5EJZA 1C5UA 1GHYH 3V3MA 1OHHD 2WZQA 4DGJA 1BMAA 2ZDAH 2HPPH 1HFDA 1YPHC 1X7AC 3RU4D 2FOEA 3QTVH 4XE4A 2YMSD 1LKAA 1HAZB 4U01A 3VB7A 2A4QA 2W6ID 1SQAA 1O2MA 2B0FA 2G4UA 4LZ4B 1O2XA 3SU1A 3T28A 1W7GH 2ZKSA 1TMTH 1GBAA 1TIOA 1GI4A 1Z7KA 1GG6B 4HG6A 3ZVCA 1ZYOA 1O30A 3L33A 3ZZDA 2EI8A 1QNJA 2ZPQA 1C5WB 2TGAA 1ZSLA 4ESTE 1JWTA 1LHCH 3E6PH 3TGIE 3SU3A 1A5GH 1TPAE 1GL1A 1L2EA 3SUGA 2BDIA 2QXIA 1ZLRA 4ASUD 2P3UB 3GY7A 1MU6B 3M36A 3UY9A 1IQLA 1HIAB 5HM2A 5CDFE 1C9TA 1GHAF 2BM2A 1Y59T 3DA9B 1GJ6A 2Z9JA 5DP3A 4BXSA 4B76A 1EQ9A 1EPTA 4F4OC 2XYAA 2ZFQH 2CXVA 3PRBA 3Q77A 2W7SA 2H9HA 2RDLA 4CHAC 1GJDB 4MPXA 2JETB 2VINA 1GJ8B 4CRBA 1U6QA 5EQQA 4PROA 2ZFFH 4SGBE 3RXTA 4ABJA 3K6YA 2SNWA 1H8IH 4JMYA 2BY9X 4THNH 4ZCNA 2Y7ZA 2AGEX 1MCTA 4X1QU 4D9RA 2GJGA 3MNXA 1Z1IA 4ABGA 5FAHA 2ZC9H 1ZHRA 2PUXB 1FY1A 3ZV8A 2FTMA 4XOJA 2UUFB 2A7HA 2HPQH 1ZGIA 2GDDA 3RXCA 1NRRH 4AYVB 1RS0A 1E1RD 3BTKE 2G5VA 1ZTKA 3JZ2B 2ANYA 3TH2H 2YMSB 2V6NA 1BRAA 3SU4A 1O3JA 1WAYB 4BOHA 1TB6H 1EAUA 5L6NH 3SV2H 1JOUB 1A5HA 1DY9A 1ZPBA 2HWLB 2OCVB 1QJ7B 1FIWA 4D76A 1IQGA 1XKAC 1GG6C 1UMAH 1W0YH 3BG4B 3M5LA 2NU2E 2FPZA 5EIYA 1YPHE 1O35A 3ZZ9A 2VIWA 4ZKNU 1ANCA 2WYGA 4CRAA 4YTAA 1TQ7B 3QK1A 1EPTC 1JRTA 3VB3A 2FZZA 2TPIZ 5LPFA 3LPRA 4RKJB 2KCAA 3MU0A 2F9VA 1ZJDA 1C5YB 1BDAA 1KXEA 5T6GA 3BEIB 2QF0A 3U8TH 1P11E 2JJ2D 1XUFA 1BRCE 2XC0A 4OGYA 2Z6BD 1DANH 1RRKA 1THPB 1ELAA 1C5VA 1S5SA 1W0ZU 3ZIAD 1HJ9A 2XBVA 1GMHF 3ZZ7A 1GJ5H 4Y71A 1O38A 1GHVH 4FVBA 1K1OA 1TPOA 2ANMH 2OUAA 5FCKA 3SUEA 1C2IA 4JZFH 1CE5A 1HAVA 5GIBA 2FYQA 5C2ZA 2UUYA 2BZ6H 2J5UA 4ABIA 3R3GB 5K0HA 2SGPE 1P3EA 1G3EA 3M61U 5HYOA 1FUJA 1DM4B 4H4FA 1HAGE 1TGTA 3RU4T 1XVMA 4F55A 1YM0A 2FODA 3OU0A 2OC8A 3RXRA 1LQDB 1AIXH 1SC8U 1TNKA 5A09A 2FOBA 3RXFA 4OGXA 4F48B 1A1RA 5EXLA 4AG2A 3NZIA 1DY8A 4AOQA 5DSFA 1BJUA 3L3TA 1BRUP 2ZU2A 3D62A 6CHAB 3F9HA 4ZHMU 5EPNA 2Y7XA 1DSUA 2WV5A 1YCPK 1IQIA 1GGDB 1RJXB 1NESE 3ATIA 3E1XB 1P04A 3KYGA 1DLKB 2VIPA 1IQHA 3A82A 1Q31A 2EI6A 1TPPA 3F9GA 4TPYA 1WCZA 1C1VH 3QX5H 3UAIC 2FX4A 1UVSH 1O3AA 2GT8A 4K3JA 4BTTB 4RT1A 3H5CB 1O3LA 2ZCLP 3PO1B 5HXFA 1O2ZA 4YLUA 5I25A 1Y3WA 2M2AA 1SI5H 1Z6JH 5CHBA 1V2VT 1O39A 1MTSA 3BTTE 2XBYA 1Q2WA 3ZVFA 3F2GA 1C1QA 1GDUA 3EA7A 1QIXB 2FOGA 2HLDD 1O3BA 1W3CA 1Z8IB 2BD8A 2PWXA 4MLFB 2LP6A 1WQSA 1O3CA 1DXPA 2QXHA 5ABWA 3A7WA 1EJNA 1KXFA 1S0QA 1SGFG 3HGNA 1JXPA 4UE7H 3SZNA 4ZH8A 3SHAH 1BTXA 2AIPA 3RXHA 1DWDH 3E16B 1YKTA 3SV6A 4X0WU 1ZTLA 1AE8H 1C5OH 1OP0A 1F7ZA 2PP6A 2ULLA 2F43B 2VGCB 2J38A 1Y3YA 1YF4A 2P8OC 1NM6A 2OP9A 2TGTA 1CGIE 3BIVH 3RLYH 4K5ZA 2A2QH 2I6SA 2ODQA 1S85A 4X6OA 2OBQA 1BUIA 2XNDD 2F91A 3BTDE 3TPIZ 2BMGB 1P2NA 2AEIH 1MABB 2A7JA 2BY6X 1BRBE 2AGIX 1E79D 1UK3A 1OWJA 3SBKA 1GI1A 3SU0A 1YPGH 1HNEE 4TYDA 1TYNA 1HUTH 4H6TA 3WWBA 4JYUH 3A7XA 2H2ZA 2ZPRA 3GDUA 4YM9A 1W10U 4DW2U 1GHXH 1T8NA 5EXMA 3RXPA 1C5QA 3OY6U 1O5CB 3RXAA 3U28C 2GVFA 5LPRA 1YBWA 2O8LA 1B0FA 1PQ7A 5GNDA 1DXWA 4FVDA 3UOUA 4ZKRU 1FDPA 2A31A 4MTBA 2ZG0H 3A8BA 3I77A 3O8BA 2FS9A 1HCGA 1ESTA 3UWJH 1XMNB 3MNSA 2D26C 2FXRA 2ZU1A 1BMLA 3E8LA 3K2UA 5BPEA 1EJMA 2GCTB 2A0QB 4KP0A 3F1SB 2EC9H 2FESH 2W3KA 5E0JA 1CGHA 2FI4E 3SGQE 2GZ8A 1EAWA 5FX6A 1TE0A 1KXDA 3SV7A 3P17H 1BCUH 3AK5A 5A8YA 1EB1H 1HLTH 4KTSA 3TVJB 1Y3XA 6GCHF 4I31A 4K8YA 4YESB 3SN8A 2CHAB 1D6RA 1GBDA 3UNQA 3A7ZA 3WY8A 1KLJH 5HKKD 5FX5A 2FX6A 1AVXA 3A7YA 1ANDA 4MG3A 5DP9A 1TGCA 1Y3UA 3OEED 2WSSD 2ANWA 3BV9B 2AYWA 3FO8D 2C8YB 5F8TA 4GCHG 1OWIA 1NC6A 3RC6A 4NWLA 3ENSB 2PKAA 5EG4A 2PTNA 3T5FH 1S6HA 1J8AA 1EB2A 4NZQA 1UHBA 4B6FA 4WY3A 2PKSB 2HNTF 3QTOH 3TIUA 1OSSA 1BZXE 1T32A 4A7IB 3OYPA 3Q00A 1WYKA 2R2MB 4ZROA 1YWUA 2D2DA 1KIGH 5CHAB 4AYYB 5C1UA 1UW7A 2VU8E 1DPOA 1UVUH 2SGFE 1HRTH 5ESBA 1DVAH 1SGDE 1QA0A 4ABEA 1B5GH 1CO7E 1KY9A 2NWNA 4BAQB 1G30B 2VH0A 4FUGA 1LVMA 2RCEA 3SJIA 2P16A 3U9AH 4OM9A 1GJCB 2FLRH 5B6OA 1O31A 2ILNA 1NU9A 1P0SH 4Y6DA 2EY4C 2Z3CA 2J4IA 4CRGA 5DG6A 4XFQA 1TRMA 2CJIA 5FHTA 2H1UA 1NRSH 3LKWA 4KTUA 3PLBA 3MH5A 2XWAA 1SGYE 1NPMA 2XTTB 1UK4A 4IMZA 4Y8ZA 1EZUC 2ZCHP 5DP8A 4ABHA 4KELA 3ZV9A 1FY5A 4LOYH 1GI2A 1MBMA 1O3MA 1GI5A 1VCQA 2Q6DA 1BTUA 1W13U 1E0FD 1E35B 1FPHH 1DS2E 1OWHA 4YOGA 1EATA 1O5BB 3QGJA 4KTCA 1CA8B 2NU0E 2W26A 7KMEH 1GDNA 1H8ED 1P05A 2XBXA 2PUQH 3ZYEA 4KKDA 3U98H 1QJ1B 1RTKA 1V2LT 5C67A 3ODFA 2JH5D 1AMHA 2FS8A 2SGDE 3S7KB 2GP9B 4E06H 3GICB 1C1MA 7GCHG 1CQQA 1O2PA 4AN7A 5TCAA 1OWEA 1DE7H 2OK5A 2STAE 5E0GA 1SLUB 2KAIB 3GISB 2XBWA 1A3EH 2G52A 5AVDA 4OS4A 1DUEA 1FXYA 1J16A 1GHBF 3RXKA 1N6YA 1HAHH 3TH3H 1JBUH 4FOUC 3SZEA 2BYAX 2W7UA 4X2XA 5FBIA 2WV9A 5F53A 4AX9H 1YCPH 1EAIA 4E05H 1QBNA 2BXUH 3EDXB 2OINA 5C0TA 5JB8S 2HRVA 2ANKH 1LDTT 2FTLE 2ZECA 2FM2A 1TX6A 4FUJA 6ESTA 4RKOB 4WXVA 4X1RU 1GI7B 1D6WA 3KGPA 5B6LA 1C1WH 3GCTF 4GHQA 4CRCA 4DIIH 2CF8H 5HMAA 3P95A 5IDKA 4FUBA 2Z9GA 3A85A 1O2KA 3BTHE 1QQ4A 2BD9A 2BDGA 2JH6D 1WQVH 2XWBI 4TY7A 1INCA 1BBRK 1D9IA 1S82A 2STBE 2ZO3H 1NZQH 5JBBS 5JBTA 1AUTC 2FI5E 1PYTC 2WPKS 2D8WA 2ZP0H 3PROA 2FDAA 2XCFA 1SGFA 1WBGB 3ZZ4A 2HVXA 2Z9IA 1K1IA 1HXFH 5C1YA 1G2LA 1YGCH 2H9EH 3DSOA 4D7GA 1GI6A 2BDYA 1MTNC 3ZZAA 3C1KA 1THRH 1L0ZA 1VZQH 3QGNB 1TNJA 3NPSA 2J34A 1AI8H 1IQNA 1LMWB 4WF8A 5EJ1A 1GWAA 1CU1A 1FAKH 2ALPA 1ELBA 1MKXH 2AIQA 1M9UA 1THSH 1A46H 2GKVE 1GDQA 1BOQA 3SU6A 1P8VC 1BMFD 1H8HD 4Y11E 2VWLA 2NU1E 2QXGA 2I6QA 3U1JB 2KM0A 1ANEA 2ZIQH 4DY7B 1GCDA 1AD8H 4Y79A 1WTHD 3BF6H 3SORA 3K6ZA 3PMAB 2YNAA 1BT7A 1J15A 3NUMA 2VIDA 3UUZA 3A84A 1C1TA 2GT7A 1K2I1 5C17A 3HKIB 1OYTH 1MBQA 1V2PT 3B9FH 3TITA 1EAXA 2AMPA 2ZTXA 2BDBA 2W6JD 1K9OE 4Y8YA 2A7CA 1CHGA 1YCPM 2OC1A 4ZAEA 1GJAB 2GMTB 1MZAA 4IC5A 2XC5A 1HGTH 3M5OA 4R8TB 3QUMP 3FVFB 3LOXA 1PFXC 1UTLM 3VB6A 5FBEA 2UWLA 2P3TB 4NFEA 3RXMA 1PQAA 3ATKA 3U8OH 2WINI 5FL7D 1HJAB 2K0QA 3FP8E 1N6XA 1V2JT 3MH4A 1XXDA 3ZVGA 1K1MA 4WH6A 3K65B 3MFJA 5F03A 5C0UA 1T7CA 3UB0A 2GD4B 1NFYA 2BVRH 2FP7B 1O5FH 2CF9H 4ISHH 1TNIA 2LPRA 1ELDE 2BY8X
chains in the Genus database with same CATH topology
1RTFB 1A0JA 1LPZB 1TGNA 1P2MA 3P92A 5K7RA 3S9CA 4ZHAA 3CENA 1TQ0B 3LU9B 1C9PA 2VVCA 3QDZB 2GCHF 1VGCB 4MPVA 4AB8A 3S7HB 1G3CA 4WMDA 3GDSA 1C2EA 3M37A 3VXEH 4NA8A 2FO9A 2FYRA 4AGJA 1GMDF 5EQRA 2H5DA 3SJKA 3VXFH 3L6PA 3MNBA 4A1TA 1RGQA 2F9PA 1D4PB 3KHVA 3URCA 5TJXA 3MWIU 3E3TA 3IITA 3LGVA 4AFZA 1QY6A 1A0HB 4R0IA 4X8UH 1OX1A 1ZSJA 1JMOH 1O0DH 1BHXF 2ZPSA 1DOJA 2BLQA 1P06A 1GBHA 3A7TA 5A0BA 1HIAA 1S84A 2XNIA 2ZHFH 1AFEH 2A32A 1G3DA 3U8RH 5GCHF 4JK5A 2OC0A 1O3EA 2BD7A 3PTBA 5E2PA 2FOAA 4CR5A 1S81A 2ZI2H 1AZZA 3GCOA 1UVPA 1YPMH 3GDVA 4FU7A 4AZ2B 3VGCB 3RM2H 1BIOA 3BG8A 7ESTE 4MPUA 9ESTA 4X8TH 5C5OA 1P01A 1RIWB 3BIUH 2G00A 3TH4H 1SOZA 3A86A 3A8DA 4MNWA 5EW2H 3TK5A 3SO3A 2TIOA 8GCHF 1VITH 2R9PA 2ZU3A 4B74A 3KQEA 3EGKH 3FZZA 1AKSB 1SLVB 2F9BH 1SGCA 1ZSKA 3HGPA 1A7SA 1MD8A 1D3PB 1GBCA 4I33A 5SGAE 2V3HH 2ZGJA 1VGCC 2ZA5A 1QB6A 3B23B 2ODPA 1W11U 3SUDA 3IWMA 1BITA 1XKBC 2OC7A 3GOVB 2BD2A 5BRRE 4UFGH 1F92A 3F9EA 3M7TA 2QGRA 1O36A 1SHYA 3O8CA 1JIMA 1SR5C 1AKSA 1IQKA 4MNXA 2ZGCA 1P2IA 3M5MA 4LXBH 3FFGA 1EJAA 3E0PB 1RD3B 1LTOA 2TGPZ 5AFZH 1BQYA 3SGAE 2JETC 3LGUA 2AGGX 2QIQA 2F9UA 2ZDNA 4B71A 1GJ4H 4WMEA 4XSKU 5EOKA 1BTZA 1AQ7A 1TBZH 1UO6A 2G51A 4CBOA 1HYLA 2BQ6B 5GDSH 3LC3A 1TGBA 1C5SA 8ESTE 1GCTB 4JCNA 1HDTH 1BBRH 3RMLH 5LH8A 2ZGHA 4TWWA 4AGKA 3KQCA 2AH4X 1C1PA 4LZ1H 4NG9H 4OS6A 4B2CA 1GMHG 2DUCA 2CV3A 1A3BH 2PSYA 3UFAA 1K1LA 2PTCE 2PFEA 1C1OA 1J17T 2F9OA 1CVWH 1DWEH 3M5NA 5FPTA 4DIHH 2CMYA 1HPGA 4OS1A 4O97A 3FZDA 2QYIA 3BG4C 1W14U 3C27B 3DFLA 3TJVA 3RXSA 4BAMB 3ATLA 1V2UT 1DUAA 1C5XB 4HGCA 5GXPA 1TPSA 3A81A 2FOMB 4U2WA 1ETRH 3GY5A 1FLEE 3ZZ8A 1GBBA 1UTKA 3LJOA 3GCHB 3GY8A 1GBTA 4XDEA 2GZ9A 2WPJS 3TJNA 2BDHA 3AAUA 1K1JA 3V12A 1OWDA 1SVPA 2B7DH 2ASUB 4VGCB 2NU3E 4WXIA 1PQ8A 1ZOMA 3M3VA 4NSYA 1C5NH 4Q7XA 5EU8A 3S9AA 3W94A 1G9IE 5A8XA 6LPRA 4HTCH 2C8ZB 4X2VA 5FPSA 1AU8A 1QCPA 1T8MA 3EA9A 3RXIA 3GY2A 1AN1E 1UK2A 3FANA 1P2KA 4Q80A 1MKXK 2AMDA 5FXLA 1TX7A 4AFSA 4B73A 2ZQ1A 2BDAA 4TWYA 1V2QT 1BTWA 1EP5A 1LVBA 1YPEH 3IG6B 4ISLA 3PWBA 3ZZ6A 1H1BA 2M5TA 5JPMH 4AB9A 3TJUA 1C5RA 2OBOA 1O3IA 2A4GA 2H9TH 4FUIA 2PW8H 6CHAC 5LGOA 1W8BH 4MQAA 1DDJA 1QL9A 1GGDC 2D1JA 3PV4A 5F8ZA 3RXDA 2WYJA 4I8HA 3RLWH 3RXEA 1IAUA 2G8TA 2P94A 4OS5A 4BAOB 1TWXB 5GWZA 1MKWK 1VCPA 2XW9A 4JYTA 3RU4E 5J4QA 1UCYH 1V6DA 1P02A 1H9HE 2V0BA 3SJ8A 4FU9A 1FJSA 1C5LH 1UTJA 2ZGXH 3PO1C 1CBWB 1JIRA 1EX3A 1TRYA 1ARCA 1C4Y2 5C3NA 4D8NA 3MH6A 1TONA 3GY6A 1ABJH 2BD4A 2F9NA 1SGTA 3GCHC 1NROH 1GI9B 4ZKOU 2A2XH 3S0NA 5A8ZA 3RM0H 1BBRE 3A87A 1V2RT 1FIZA 1Z71A 4DG4A 3UR9A 1K1NA 4TY6A 1TLDA 4GCHF 2IOTA 1BMMH 1PPHE 1PPBH 1QL8A 3AW1A 1O2OA 1QTFA 4X1NU 2VGCC 1K21H 1J14A 3LH1A 4FUDA 1OP8A 2XCNA 4WWYA 1FAXA 1CGJE 3PMBB 1QGFA 4Z0KA 1S0RA 3DUXH 1KDQB 1SGNE 2VB0A 1QB9A 1MH0A 1V2ST 1HJ8A 2PLXA 5DKMA 2J9NA 2V3OH 2C93B 2J92A 1NT1A 1H9LB 1ELCA 3OSYA 5A0CA 3TGKE 2ODYB 3V7TA 1BTPA 1BHXB 4FUFA 3SUFA 6GCHG 1GBKA 1VITF 2A4RA 4K8BA 2Y5FA 2GTBA 5FCRA 2R3UA 1KDQA 1T4VH 2F83A 1Y5BT 2NU4E 2ZQ2A 2ZHDA 1VCWA 3OTJE 5G4BA 3TLOA 1QR3E 1AHTH 3EAJA 4JK6A 5DP6A 1CBWC 3ZYDA 2QF3A 1BTHH 1O3KA 2Y80A 2VWOA 1S83A 1TMBH 2VIVA 3E90B 3T25A 3RUOA 1F0TA 3HKJB 4DJZB 1GVZA 2GCTC 1IHTH 5AF9H 3SNCA 2QA9E 3RC4A 1OS8A 2BY5X 1A61H 1KXAA 2VH6A 4O9VA 2BHGA 1O2GH 4IN2A 1O37A 2UUKB 4CH8B 1XUGA 1ZPZA 2B9LA 2WPHS 4A92A 3F68H 1ELTA 1GMCG 2BVXH 4X8SH 4HI3A 1GBJA 1D3DB 1PPFE 4Y0YE 2CHAC 1QJ6B 2J2UA 1GL0E 1SQOA 1D3QB 1W2KH 1QQUA 4E7RG 4Y8XA 2J94A 5ESTE 1MD7A 2WV4A 1UCYE 1YPKH 5TCCA 2ALVA 1RTLA 4UEHH 3RMMH 2FMJA 3SU2A 3F9FA 3CS0A 3RXJA 4IC6A 1EOJA 1GPZA 1A5IA 1TMUH 4ISNA 1Q3XA 1ZHPA 2RA0A 1HV7A 3MOCA 1HAPH 1FN8A 3SNAA 2R2WU 1EP6A 3DFJA 2PKSC 3BTWE 2ZHQH 2BXTH 1AY6H 2A4OA 3UOPA 2VIOA 1H9IE 2OLGA 1SG8B 5CHAC 5T3HA 2DE8A 1P9SA 3G01A 2XXLA 1W12U 1BMNH 1OP2A 1TX8A 1C5MD 9LPRA 1G32B 3SQEE 1C5TA 3FAOA 1ORFA 1O5AB 3AVZA 3RXUA 1PJPA 2KAIA 1FPCH 3AASA 4ABAA 3MI4A 4INHA 2BZAA 3T29A 3SI3H 2PV9B 2QY0B 1Y5AT 2GV6A 5JYIA 2QV1A 4OS7A 4I8KA 4UFDH 1MQ6A 1V2NT 2BLVA 1C2HA 1P10A 1CHOG 1TAWA 1F5RA 1E38B 3SW2B 4X1PU 2Y81A 4ABBA 1FNIA 1YPLH 4B1TA 2QCYA 4A1XA 4DOQA 3NXPA 2VVUA 4I8LA 5T6DA 4LK4A 4SGAE 1O3NA 1P57B 4B2AA 1TBRH 1O2JA 3MU1A 2G55A 1FONA 3DD2H 4Y7BA 1AFQB 3A80A 4IN1A 3ZZCA 2GGVB 4D9QA 1AWHB 1XUKA 2PGBB 1GBLA 3M7QA 4NCYA 5JB9S 4NFFA 4HFPB 1NN6A 1KXBA 1SL3A 1EXFA 1XM1A 2Z9LA 3M3SA 1AUJA 1F0RA 4INKA 8KME2 1Z6EA 1B7XB 3GCTG 2Z3EA 5FPYA 3U1IB 2FOHA 1YC0A 4Q2KA 1AO5A 1YLDA 2DE9A 1CT2E 5PTPA 2BB4A 3D65E 1GI8B 1O3PB 2VVVA 2ZWLH 4BNRA 1SMFE 5A0AE 3SJ9A 1ELEE 3QZQA 1GJ9B 3SU5A 1DICA 1Y8TA 1J9CH 1C1NA 1NTPA 2ZZUH 4ZUHA 3QN7A 4WH8A 5E2OA 1W7XH 1GJBB 1MQ5A 4K2YA 2TBSA 5F8XA 1BJVA 2FI3E 4A6LA 1GI0A 1UTOA 1AE5A 2HLCA 4HZHA 3SV9A 3M3TA 2BTCE 3O8RA 1E36B 3PM3A 2G5NA 1AWFH 1GVLA 1MKWH 2ZFPH 1MTUA 4I32A 4NIVA 1C2GA 1TGSZ 3UTUH 1PPEE 1QB1A 1IQJA 1DSTA 1QURH 2TGDA 5EGMA 3A89A 5AHGH 3ZZ5A 4ZHLU 3LGWA 2RG3A 3D49H 3DT0H 2O9QA 1TA2A 3Q3KA 1LKBA 1NFWA 3GYLB 4JZDH 4YT6H 4AORA 4CHAB 2BX4A 1S6FA 3ELAH 1VR1H 1LHFH 2Z3DA 2GV7A 1KYNA 3UPEA 1IOEA 1HXEH 2AMQA 3MO6A 2Y5GA 1UCYK 2A5KA 3UQOA 1NS3A 1O2TA 3KNXA 1C2LA 1SBWA 7LPRA 2R3YA 4JZ1A 1SLWB 1O5DH 3Q3XA 3V13A 1TRNA 4MPWA 1P3CA 1TFXA 4GSOA 1KLTA 2P95A 2QAAA 3BEUA 2BQ7B 1MZDA 3ITIA 1QL7A 1NFUA 2QN5T 4WJG2 1JRSA 2SFAA 1EZXC 3MO3A 1RXPA 2HOBA 4DT7B 4ZXYH 4BTUB 1V2TT 3B8JA 3KQDA 2C90B 1UTMA 4XBBA 5LPEA 1BA8B 1WSSH 4J2YB 1LQEA 1FY8E 5DP4A 1KXCA 5GJ4B 5EXNA 1TNLA 4GLYA 1HAYB 1CSOE 1EPTB 2ZDKA 4BANB 1O2LA 4Q7YA 2ZDLA 4UDWH 1FV9A 2A5AA 4I7YH 4JZEH 2J95A 3UREA 1LPGB 1SGRE 4IBLH 1C5ZB 2PSXA 2GMTC 3MHWU 4UFEH 1SPJA 4NGAH 1TNGA 3MH7A 1GBEA 1O33A 1PPGE 3TGJE 1F0SA 1L4ZA 2V35A 2GCHG 1XX9A 5DP7A 4XBDA 3P8GA 1QRWA 1SGEE 1AZ8A 3SI4H 2TRMA 2ZF0H 1XUIA 1HJAC 2A5IA 2BD5A 1KLIH 3MU8A 3O8DA 3RMNH 1AB9B 1GMDG 4QT8C 3LGTA 1WU1A 1WV7H 4DURA 1GHAG 1TNHA 1EASA 1OPHB 2HGTH 3EYDA 4YOIA 3I29A 3D23A 1IHSH 3R0FA 1LHDH 2FEQH 5E0HA 4YT7H 3LT3A 3ZVDA 1WUNH 2ZFSA 4FXGH 3SNEA 3Q3YA 5J4SA 4ZMAH 3QLPH 1NU7B 2GDEH 2JKHA 1ZMJA 3S69A 1ARBA 3RXVA 5GPIB 3KF2A 4A1VA 1OYQA 3VB4A 2UWOA 4FUEA 5GCHG 3PWCA 4UD9H 4I8GA 1WOFA 4X1SU 4A5TS 2BLWA 1T8LA 1P2OA 1Y3VA 4DVAU 3UQVA 1SFQB 1HAOH 3A8AA 3RXBA 1N8OB 2WUBA 2ZTYA 5T6FA 1ELFA 3GY3A 1P2JA 1Z8JB 5DO4H 1QBVH 1TALA 3BSQA 1C1UH 2F3CE 4INLA 1CT4E 3SNBA 1T4UH 1ZR0A 3H7TA 2HNTC 3STIA 5A2MH 3MMGA 3P8NA 1F5KU 2GZ7A 1HAVB 4GAWA 4H6SB 8GCHG 2OQUA 4K69A 4AG1A 1P03A 1C2KA 1LVOA 1FMGA 2XRCA 1G3BA 3W95A 1O3FA 1O3HA 1GBMA 2GX4A 3QZRA 4CREA 3BTME 3P8FA 1DFPA 3RXLA 1ANBA 2ZU5A 2FIRH 1AB9C 2OD3B 1P9UA 3E91A 5JBCS 1ETTH 1SGQE 3CP7A 3RXOA 1SGIB 3VGCC 1L1JA 2P8OB 4GPGA 1SLXB 3P6ZB 4H42U 2EEKA 5JDUB 4TPIZ 1O2SA 1RIWC 4ABFA 3MU5A 3JZ1B 3NCLA 1DITH 3SHCH 4CR9A 4Y7AA 4YOJA 3V0XA 1SSXA 2XC4A 5EW1H 2O8UA 3LC5A 3RP2A 2THFB 5DJ7A 1EZSC 1AGJA 2WUCA 3BTQE 1NY22 3KEEA 1O3OA 2FOFA 4NIYA 3NWUA 2A1DB 4X6MA 2CN0H 1C2FA 5ETXA 1KTSB 1XUJA 4CH2B 4NA7A 1DX5M 5C20A 1IQMA 4OS2A 3UR6A 1A2CH 8LPRA 1QFKH 4ISIH 1XVOA 4U30A 2C4FH 1N8OC 1O2HA 1O3DA 3F6UH 3SGBE 1EUFA 4YO9A 2B8OH 3KCGH 1O2QA 1FI8A 1GHZA 1ZTJA 1UVOA 3RXGA 1C5PA 1O2IA 1YLCA 4K1EA 4I8JA 1PPCE 5C1XA 1HAXB 1RFNA 1P2QA 1OKXA 4X8VH 1KTTB 4MNYA 4MDSA 1V2WT 2VJ1A 2HNTE 3TNTA 3SQHE 1XXFA 1GCTC 4FUCA 4X2YA 1F0UA 5L2YH 1EKBB 3LGIA 3KN2A 3LGYA 1GHWH 2R0LA 1O34A 4IMQA 3PTNA 1C2JA 2B5TB 1FQ3A 1TOMH 1G37A 1LPKB 1D3TB 4F49A 1Y5UT 1OOKB 2VWNA 1GBFA 2Z94A 3ZVEA 2WPMS 2SGAA 3GY4A 3PLKA 1TOCB 1C2MA 2PHBA 3Q76A 3BTGE 3UIRA 2W3IA 3BEFB 1A0LA 4Z6AH 1V2MT 2WPIS 2ZDVH 2ZNKH 1PPZA 1AVGH 3ODDA 3HPTB 1L4DA 3NKKA 4ABDA 3PB1E 5DP5A 1YPJH 1LO6A 2AS9A 1DLEA 2FOCA 1ETSH 2Q6GA 3VFEA 3SJOA 5CE1A 3PMJA 4IW4E 1WTGH 5DPAA 2ZFTA 4VGCC 3AAVA 4YZUA 4X6NA 4D7FA 3P8OA 1VJAU 1ZHMA 4FUHA 1E34B 1SHHB 3AW0A 1MTWA 1ZJKA 1FZZA 2VIQA 3K9XB 1KSNA 1ZMNA 3UWIA 4IGDA 1ELVA 2A45B 2AFQB 1C4V2 1HBTH 1HAIH 2W5EA 4ISOA 3DHKH 3ESTA 1YP9A 2H6MA 3KL6A 3UNRA 3CS7A 4CRFA 4RSPA 1FY3A 2PKAB 1QHRB 4B75A 1EZQA 4U32A 1V2OT 3PMHB