4XOJA

Structure of bovine trypsin in complex with analogues of sunflower inhibitor 1 (sfti-1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigation of Serine-Proteinase-Catalyzed Peptide Splicing in Analogues of Sunflower Trypsin Inhibitor 1 (SFTI-1).
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA02
2NU3E 1IQJA 1GBLA 3SGAE 2A31A 1TOMH 1W12U 4AGJA 5DGJA 5G4BA 1C2MA 2QYIA 2PWXA 4X1NU 1CBWB 1V3XA 2VIQA 4H42U 4O03A 1V2VT 2TIOA 1EPTA 3E16B 2O8LA 2WPLS 2ZU5A 1UMAH 4CR9A 1K1IA 1O37A 7KMEH 2W3IA 1OPHB 2XC4A 1N6XA 4K8YA 3BTME 2GDDA 4WXVA 3MH7A 1BIOA 1TGCA 2HWLB 4E7RG 2ASUB 1FXYA 2Y7ZA 1XUIA 4KKDA 3QLPH 1SGQE 1C2GA 4I32A 5GCHG 1TX6A 2ZG0H 1C9PA 1TOCB 2AFQB 4UFDH 2ZO3H 5HM2A 2A2QH 3O8BA 5C5NA 1E35B 1IAUA 5C2ZA 1TLDA 3OY5U 1ZSLA 1SBWA 1TNGA 4AB9A 1C5QA 4CRGA 3KHVA 1C2JA 5FBIA 3JZ2B 1QL9A 2SGQE 1TPAE 1ELFA 4OS2A 4AYVB 1FONA 2ODYB 2W7SA 5JBBS 3RM2H 1LVOA 2R9PA 4I8KA 1SR5C 2Q6FA 5L2YH 1OWDA 3A8AA 3EDXB 1GI0A 2Z7FE 3KL6A 1AN1E 1O3PB 1O3JA 5L30H 2ZC9H 2AERH 4QT8C 3V12A 1W8BH 3GCTF 1NS3A 2Z3EA 2F83A 3Q3KA 3LC5A 4X8TH 3BF6H 1C4V2 1SGFA 1PQAA 3SOSA 2AGEX 3ZVEA 1CHGA 3ATIA 5L6NH 4KP0A 1HUTH 1FAXA 4O97A 4M7GA 4HGCA 3GDUA 1LVMA 3VPKA 1RRKA 1D3DB 3SW2B 1KXEA 2ZECA 3BG4B 4CR5A 1SOTA 1A2CH 2B0FA 3LGWA 2NU2E 3K6YA 2SFAA 4K3JA 1SGRE 3LKWA 5EOKA 3E0NB 3EA8A 2ODQA 5LPRA 1GBCA 1O2KA 2HRVA 1TRYA 2V6NA 4JZDH 4GLYA 1Q31A 2ANWA 1KXBA 1A5IA 1ZMLA 1F0RA 2ZDAH 4DOQA 2A7CA 1SMFE 2FOHA 3T26A 2QXHA 4ZAEA 4FUGA 1AZ8A 1YP9A 1GHBF 2ANMH 1YLDA 3SJOA 4AOQA 2A2XH 2DE9A 1CO7E 1KDQB 3TJOA 4D9QA 1ZTKA 4KTCA 4HTCH 3W95A 3ZZ9A 4K5ZA 4NZLA 1VITH 3ZV9A 1P04A 3QWCH 1QJ1B 1Z1JA 1O3CA 5AF9H 3PV4A 4B2AA 3EAJA 1O3MA 3CS7A 1HAIH 3D23A 2ZFSA 4A5TS 5C1XA 1ETTH 1MMJN 1OWHA 1ABIH 2I6QA 1UHBB 1V2QT 1B0EA 2XBWA 5C5OA 2FM2A 3CS0A 8ESTE 1O2WA 3NWUA 4B74A 3N7OA 2P16A 1C2DA 1Y3XA 1Y5AT 4XDEA 1N8OB 1YC0A 2R0LA 1D3QB 5HMAA 1Z8GA 3M5MA 4XFQA 1PQ8A 6LPRA 5B6OA 1TAWA 2QXIA 3A80A 2P8OC 4XOJA 2SNWA 3RLYH 3HKJB 1C5XB 2BD9A 1TRMA 1O5CB 3PB1E 1FLEE 1GVLA 2FTMA 2VIDA 2P3TB 1P01A 3STJA 3TH3H 3C27B 3GOVB 1V2WT 3AASA 3A7XA 3GY4A 1O3LA 3NUMA 1GJ5H 1VCQA 4ZXYH 1CSOE 1CU1A 1LDTT 1C1SA 1NFYA 3PMBB 2ZU3A 3UPEA 1DOJA 2PSXA 1HGTH 3FVFB 2FI4E 3VXFH 1LPZB 4ABHA 4NIXA 6GCHG 1FN8A 3VB6A 4X0WU 2JH6D 2AS9A 1ELGA 4Y7AA 3RXFA 1FIZA 3UUZA 2FO9A 2PUQH 4AGKA 5DKMA 3QGNB 1O3NA 3U8OH 1AB9C 1MTWA 3SNDA 1DWDH 3C1KA 2GV7A 1VJ9U 2ZFFH 1YCPH 4FU9A 4Q7XA 4INLA 4BTUB 1NU7B 1MBMA 3RXHA 2TGDA 1BBRK 2BD4A 5FAHA 4ISOA 3SV7A 1CT4E 2XWBI 2SGDE 4H6TA 4NZQA 3LIWA 1NO9H 3T2NA 4BAOB 1GHBG 3ZYDA 1ESAA 4FUIA 2CF9H 3TLOA 6ESTA 2C8WB 1LKAA 2BLWA 1NROH 1ZMJA 2KAIA 4WMFA 1THPB 1HXFH 2ZU2A 3HGNA 3V13A 5GJ4B 1V2NT 1WQSA 1O2LA 2Z9IA 4UD9H 2HNTE 3RU4D 5BRRE 3GY6A 2QA9E 2FOCA 4JCNA 5ESTE 4RN6A 5CHAB 4U30A 6CHAB 5EXNA 3GY5A 5EXLA 3ZVBA 2R2MB 1O38A 2O8MA 1SLUB 1JBUH 2FOMB 4I33A 3BTKE 1L0ZA 2IOTA 1S82A 3T62A 3M3SA 1OP0A 2B9LA 3UTUH 5DG6A 3SBKA 1IQFA 3ITIA 4YO9A 1WAYB 4NWLA 5K0HA 1S5SA 1IQIA 1ANEA 4FVDA 3TITA 1OP8A 1V2RT 4WY3A 5JBAS 5AFYH 2QCYA 3UY9A 1O2OA 4AFSA 5EQRA 1GPZA 2PUXB 3LH3A 1GGDC 4CH2B 1HLTH 3P70B 4Y8XA 1BMLA 2BD5A 2BX4A 2HPQH 4LOYH 1A7SA 4X6NA 4IN2A 1GJ8B 2WYGA 4X8SH 3RXOA 1UTQA 2C4FH 4GVUA 1NM6A 3BV9B 4YLUA 1QR3E 2BVSH 2FMJA 3ATKA 1C4Y2 2ZEBA 2A4RA 1BHXF 2FOFA 2QXJA 3GY7A 2RG3A 5DJ7A 1C2LA 2BDBA 1DX5M 2KAIB 1AUTC 4THNH 3RUOA 1Y59T 1QA0A 3F1SB 4GHTA 4VGCB 4IC5A 1S0RA 1IQNA 4GCHF 3NK8A 4MDSA 1C5MD 3FP8E 4ZROA 1P2KA 5CHAC 3MWIU 6CHAC 5C1YA 3SUDA 4Y0YE 3I29A 3RU4E 1EAXA 4DIIH 2FZZA 2WPIS 3K65B 3BEFB 5I25A 1JXPA 3UWJH 2GCTB 1F5KU 1TMBH 4Z0KA 4U2WA 2BD8A 1GJAB 2YNAA 2J38A 2UWLA 1O2RA 4MTBA 5A0CA 2CGAA 3SJKA 1HAHH 4K2YA 1L4ZA 3AW0A 1NN6A 1BJVA 1GBAA 3RU4T 3OSYA 1YPKH 3SV2H 5DP8A 5E8EH 1ZJDA 1TA6A 2OBOA 5T6GA 1XUJA 2BD3A 5FPSA 1UCYE 1FY3A 1KTSB 4DCDA 2XTTB 1TGSZ 1BTZA 7ESTE 4XBCA 2P94A 3OY6U 4TY6A 3HKIB 7LPRA 1L2EA 4AG1A 2BTCE 1ELDE 2FP7B 1C5VA 4OGYA 1QL7A 3MNSA 1GJCB 2C8XB 4A1XA 1O3BA 1SVPA 4XBBA 2Z9LA 3PM3A 4Q2KA 1Y3YA 1C4U2 3A86A 1SQAA 2PTCE 4D8NA 2BX3A 3LPRA 1C5OH 4ZKOU 4YLQH 2FIRH 2ZDLA 1FMGA 3ELAH 1QB1A 2OUAA 1EXFA 1XMNB 1LVBA 1VGCB 3TNSA 1O36A 2ANKH 2ZIQH 1MD8A 2FXRA 3LT3A 1GMDF 4MPWA 1WCZA 4AFQA 5TCCA 5EW2H 2P3FH 1O2MA 4VGCC 2A4OA 1O39A 1O5FH 1P12E 2VGCB 3GDSA 3U8RH 3MTYA 1DY9A 1MKXH 1GDNA 1TNJA 2GVFA 2QV1A 3ODFA 1V6DA 1KDQA 4O3UA 3E90B 3LGUA 5A2MH 3SHCH 2F91A 1BBRE 3UNRA 1F5LA 8GCHF 3F9GA 4UONA 3EA9A 1LTOA 8LPRA 1OSSA 1DANH 1EQ9A 4I31A 4NCYA 1YCPK 1L4DA 4MNXA 1J8AA 2AH4X 1W0ZU 2CJIA 1GBMA 2BYAX 4I8GA 5DP3A 2IN2A 2B7DH 4J1YA 1CA0B 4J2YB 1DFPA 4HFPB 4FUHA 1VITF 5C20A 2ZHWH 3EA7A 1WQVH 1CHOF 3SV8A 1TNIA 3Q00A 1XUFA 2ZGHA 1TMUH 1A4WH 1CHOG 1MKXK 1O2VA 2PR3A 3LJJA 2YNBA 1AHTH 4AG2A 1C5RA 3QO6A 1ZOMA 1HNEE 1O3EA 1YBWA 4U01A 3M61U 1GHXH 3BSQA 2WV4A 3M5OA 1MZDA 2JH0D 1SGPE 1QJ6B 2WV5A 1GBBA 1C2FA 1F7ZA 1GI1A 4DJZB 2D2DA 1O3FA 1O5AB 1K1MA 1F92A 1P10A 1QURH 2BD7A 2Y6TA 4RKOB 2ZU1A 2V0BA 3D62A 3U9AH 1TBQH 2OINA 3PMHB 2FS8A 4PROA 3RXCA 2A5IA 1W14U 1NPMA 3B9FH 1OOKB 3Q3XA 1JWTA 3P6ZB 1EUFA 7GCHG 1U6QA 1ZLRA 2ESTE 2G52A 3MNBA 5JB9S 3ZVGA 4H4FA 5DP4A 4NA9H 4YTAA 1JRTA 1XM1A 2FOBA 1UVOA 1L1JA 3I78A 1KTTB 4NA8A 1HXEH 1E0FD 3GCOA 1G36A 1K2I1 1QTFA 3U8TH 5FCRA 4WMEA 3QZQA 3RMMH 1AI8H 1S85A 2P93A 1E36B 1EJMA 2PW8H 2BXUH 2BQWB 5FBEA 1MU8B 1SPJA 4MNVA 4JYTA 1INCA 2TGAA 3P95A 3P8FA 1BTUA 3IG6B 2QGRA 5J4SA 1BTXA 1LQDB 1TYNA 1AFQC 1O2SA 1YCPM 2BZ6H 2Q6DA 4FUBA 3BTGE 3SNAA 3NCLA 3LH1A 1RJXB 3BTEE 3KF2A 2ILNA 1O32A 3PO1B 2OQUA 2BHGA 1E37B 1D9IA 1JOUB 2BZAA 5EQSA 5K7RA 1QQUA 3RXJA 1AY6H 2V3OH 2A5AA 1K22H 1IQGA 1J15A 5IDKA 1O5GH 4B76A 3BEUA 2BDYA 1G3EA 1RTLA 2ZTZA 2A45B 1QRWA 3PLBA 1KY9A 3SO3A 1SHYA 3PLKA 1C1RA 1EKBB 3QUMP 2BVRH 3SGQE 2ODPA 2ZKSA 3PWBA 1MUEB 1YPLH 1QBNA 5JPMH 2A32A 3CENA 1DDJA 1M9UA 1OWEA 2G4TA 1DLKB 1B0FA 3F6UH 5TJXA 1FV9A 1C5WB 4Y79A 1UO6A 5GIBA 1MCTA 2ZPQA 3BTTE 2BY5X 1HDTH 4DIHH 1HJAC 1SFQB 1A3BH 2Y81A 2DUCA 2VNTA 3PTBA 4ZKNU 2HALA 3KGPA 3SU5A 1T8NA 2OC7A 3SJIA 2XNIA 1TB6H 3SUEA 5E2PA 3QN7A 3H5CB 1SFIA 1W7GH 1P57B 3GCHB 1GHYH 1GVKB 2PFEA 1ZSJA 1LCYA 2VIWA 4CHAB 1AQ7A 3PO1C 4JK5A 4WH8A 3U69H 1A46H 1V2PT 4Z6AH 1YPMH 1K1LA 1W2KH 2TPIZ 2ZCHP 1FPHH 1NRRH 1BHXB 1TONA 2H5DA 2UUKB 1XVOA 1S6HA 1W11U 2VINA 3RMNH 3TJUA 4X2YA 3OYPA 2ZQ1A 2ZF0H 3ZZ6A 5DP7A 3RXQA 1DY8A 2CXVA 3RXVA 2BXTH 4X1QU 1WSSH 3A7YA 4BXWA 1WOFA 1HIAA 1A1RA 4WMDA 1A0JA 1S84A 3A8CA 1YGCH 1PPCE 2HPPH 1BZXE 5JB8S 1JIRA 1HCGA 1NY22 4JMYA 2PGQB 5DK1A 2PHBA 1H1BA 1HAYB 2AGIX 1F2SE 1GI5A 3L3TA 1AGJA 5FXLA 1DITH 4BTTB 3A82A 1C5TA 1DM4B 3IITA 2G51A 4ABFA 1TNHA 3B8JA 4X2WA 3BTDE 3MFJA 3SUFA 4B71A 4Y8ZA 2IPHA 3FP7E 1SG8B 4OS7A 3RM0H 1AB9B 4FUCA 3GCTG 4Q7YA 1QHRB 4RSPA 3AVZA 2PTNA 2ZFQH 2ZHDA 4MNWA 4X6OA 3TGJE 1MH0A 4X2VA 4HZHA 5ESBA 1GBFA 1D3PB 1QA7A 1TGTA 2Z6BD 2J34A 1A3EH 1KXFA 2F9UA 3DD2H 2GP9B 4I8HA 2K1QA 5EXMA 2P59A 1D3TB 1OXGA 2ZGBH 1C5LH 1FUJA 1GBKA 1Z6JH 2GDEH 4YOGA 3S69A 2FEQH 1W7XH 4JZFH 3BIVH 1SLVB 1ETSH 3SQEE 1ELVA 1L1GA 1VITG 1C1QA 5BPEA 1TFXA 1W13U 3T5FH 4ZKRU 4KGAA 1D6RA 1H9LB 3LGTA 2BQ7B 3RXBA 1GG6C 2STAE 4Y11E 2WINI 1GHAG 1IOEA 1TA2A 4FUEA 1BOQA 1H8DH 1O35A 1O2JA 3ZVCA 3GYMA 4FUJA 2GCHF 2VIPA 2EI7A 1V2TT 1DUEA 4MNYA 4A92A 4KELA 3A7VA 4XSKU 2FI3E 5ETXA 1QIXB 1AVGH 2C3SA 2FODA 1P2QA 3ZZ3A 2RA3A 2QN5T 2CN0H 1BCUH 3UNQA 4FXGH 1RFNA 4SGBE 4BANB 1RIWC 2AIQA 2G4UA 1Y3UA 2V3HH 1GL0E 1PPBH 3VGCB 1E38B 2OC8A 2H9EH 2GV6A 1GI7B 3SU0A 1V2JT 1FQ3A 3AW1A 3S9BA 1GI3A 1O30A 5DPAA 3RXIA 2PKAA 2WPMS 2SGAA 2O9QA 1LHDH 2GZ8A 1GI6A 2VB0A 1PQ7A 3T28A 4BAKB 2Z3CA 1IQKA 4A1TA 3E8LA 5J4QA 1CE5A 3ATWA 2OD3B 1TPSA 2ZGCA 4X1SU 1LPKB 1QL8A 4SGAE 3UOPA 5AHGH 3NXPA 2BLVA 2J94A 1SI5H 1GJ4H 1GG6B 1UTMA 3TVJB 2SNVA 1PFXC 1YPGH 4Q80A 4FU7A 3LONA 3T25A 1O3OA 3MI4A 2PGBB 4B2BA 1P05A 4ABDA 2OP9A 1MZAA 1GI2A 9ESTA 2FWWA 1BA8B 1KYNA 1K28D 1MAXA 5AVDA 1V2MT 1XVMA 1RD3B 2ZHEH 1MAYA 1ZJKA 1EAWA 3RC6A 2UWPA 3ENSB 1T8OA 3EE0B 3ZVDA 1LHCH 2OBQA 1MQ5A 1O3HA 1TX7A 4IBLH 1OWJA 1QRXA 1C5PA 3D65E 5EQQA 3MYWA 3GDVA 4B2CA 1UTPA 4X2XA 4E7NA 4CHAC 5AFZH 2BM2A 4JZEH 3L33A 3CP7A 1ETRH 2WPJS 1PPZA 1ID5H 1G32B 3B23B 1T32A 3MU8A 5E0HA 5DP9A 3A8DA 1GJ6A 5PTPA 1BTWA 1GWAA 4NIWA 4B1TA 4DG4A 1T7CA 3ZZ4A 1RS0A 2BVXH 3QX5H 3GY3A 1Q3XA 5C1UA 4TWWA 1ZMNA 3S0NA 3SGBE 3TH2H 1DWBH 5SGAE 2ZGJA 1UTNA 3GY8A 4CRCA 1SLWB 5IYTA 3MO6A 1KXDA 2G00A 3KQDA 4AYYB 3RXEA 3V3MA 1G3CA 1SQTA 2WUBA 1V2KT 1VZQH 1FZZA 5FCKA 2VJ1A 1VGCC 3M35A 3QTVH 1QRZA 3LC3A 3RXLA 1YF4A 3KQCA 3SV9A 1GL1A 1QGFA 3M3TA 2ZDKA 3QTOH 4IS5A 1CGHA 3UREA 2VGCC 1W0YH 1AE8H 2Y82A 2QY0B 3NPSA 2FOEA 2ZI2H 1HPGA 4CRDA 3AAVA 3MOCA 5EODA 1Q2WA 1P9SA 2BLQA 1WTHD 5F03A 3UNSA 4RKJB 1PQ5A 4UE7H 2EI8A 2GTBA 4ISNA 3AAUA 1ZHPA 1B7XB 2AMQA 1PYTC 3PMJA 3R3GB 4CBOA 5GPIB 1UVUH 4WH6A 3A81A 3HK6B 1TE0A 3PWCA 1OKXA 3ZZ8A 1P2NA 4TPYA 4I7YH 2AGGX 3IWMA 3F9HA 2ZFTA 3E1XB 4X6PA 1DICA 3RXMA 1H9IE 2Z9KA 1GMCF 2GT8A 2J95A 3BG8A 3SORA 1EAIA 1CVWH 4NFFA 1FAKH 4JZ1A 2P95A 4WVPE 1Z7KA 3MH6A 3TK5A 2ZNKH 1TALA 4IN1A 2WPHS 5F8TA 3KNXA 1AWHB 1FDPA 1EJNA 1EASA 1AU8A 1GCTC 2A7JA 3RLWH 1PPHE 2FPZA 2VIVA 2VWOA 1AE5A 4BXSA 5FPYA 1EZQA 3M7QA 1GMHG 1G30B 1O0DH 2W26A 4JK6A 5EPNA 1Z8JB 1LKBA 2HNTC 1QJ7B 1K1OA 5DO4H 4MQAA 3TIUA 4YM9A 2AIPA 1SGCA 2A7HA 1EAUA 1C2EA 1DWEH 4E06H 3PMAB 1GHVH 1HJAB 3URDA 1FY1A 1BITA 1HRTH 4NGAH 4TY7A 2XXLA 3GISB 1WYKA 2GCTC 3RP2A 1NC6A 1P03A 4DGJA 4GHQA 5HYOA 2XCFA 1EP6A 3UIRA 1F0UA 1ZYOA 1YPJH 3FP6E 1P0SH 3GCHC 2AEIH 1GHWH 2Z94A 1P3EA 1IHTH 1WBGB 4YOIA 4CREA 3PYHA 1AUJA 1SOZA 1H4WA 3VB7A 1UVPA 1GI8B 1VJAU 4A1VA 2UUYA 1O2YA 1P06A 3BTFE 1AIXH 1QFKH 2ZDMA 4OGXA 1H8IH 1O34A 1GJ9B 1GVZA 1QBOA 4ZHAA 5FX6A 1QY6A 1GJDB 5L2ZH 2HVXA 3E91A 2GZ7A 1LHEH 1TBZH 1TMTH 4LZ4B 3F9EA 1K1PA 1O2ZA 2XBYA 1EB2A 4IMZA 1T8MA 1XUKA 1VCWA 4IMQA 3MO9A 1O2IA 3ZZ5A 3KN2A 5T6DA 2ANYA 3A7ZA 3SN8A 1YPEH 5H4IB 1YKTA 4GAWA 3QZRA 4NIVA 1YYY1 3WY8A 1HBTH 2ZWLH 3RXTA 5C3NA 3S7HB 1MTNB 3VEQB 1A61H 1S0QA 3F9FA 1GCTB 3U1JB 4KTSA 2ALPA 5CMXH 1C1UH 1GMHF 1N6YA 3VB5A 1TRNA 3RXRA 1BQYA 5GDSH 2J9NA 4WJG2 4WXIA 1CGJE 4Q7ZA 4X8UH 1G2LA 3SQHE 5GXPA 1JMOH 2BOKA 1FY4A 2D26C 2Y5HA 2H1UA 2SGPE 4ZH8A 2XWAA 4ISIH 2PLXA 7GCHF 5TCAA 1BRCE 2JETC 2FLBH 2ZFPH 2NU1E 1OWKA 5E0GA 3HPTB 4FUFA 3KCGH 1AD8H 1ZPBA 4ZXXH 3ZVAA 2ZGXH 4ASHA 1RTFB 4A6LA 1TQ0B 3TNTA 1K21H 2THFB 2NWNA 2FX6A 2BY7X 2GCHG 1TNKA 2VVCA 1BMAA 1P2MA 1CT0E 1FI8A 1PJPA 1UCYH 2G55A 3P92A 5HM9A 1A0LA 4GSOA 2F9BH 1GGDB 3Q3YA 2UWOA 1C1OA 1EOLA 2ZP0H 2F9OA 2SGEE 1MQ6A 1DXWA 2HGTH 3LGIA 1VCPA 2H5CA 2PV9B 3TPIZ 2TGTA 4NIYA 4DY7B 1GBDA 3TH4H 1MCVA 3RMLH 3RXAA 4CRFA 3A7WA 1DLEA 1LQEA 4B75A 1TGNA 2H2ZA 3RXUA 1ZGVA 3SZNA 5F8ZA 1RGQA 3SNCA 2QXGA 1AVWA 1ANCA 2F3CE 2XW9A 1BT7A 4E05H 4UDWH 4F49A 3RMOH 1RTKA 3SU2A 1KXAA 1O3AA 4IW4E 4UEHH 2IJOB 2G81E 1CA8B 5EGMA 5E0JA 3DHKH 2VVVA 1YPHE 2BQ6B 3EYDA 1EATA 2ZZUH 3EQ0H 3ESTA 2BDGA 1MTUA 1O31A 1Z1IA 1ELBA 3FAOA 1LO6A 1TABE 3DUXH 5LH8A 1BTPA 2AMPA 1DUAA 2ZPSA 1ACBE 3Q76A 2ZU4A 3VGCC 3KQEA 2ZTXA 4K8BA 2OC1A 1GBTA 1SGTA 1MKWH 3U98H 1FY5A 4ABEA 4INHA 4D76A 1DS2E 1P2JA 3OTJE 1C1PA 1C5SA 3GICB 1W10U 2ZDNA 1NTPA 1P2OA 4Y76A 4JZIA 1GJBB 1GDQA 4INKA 1O33A 1J17T 2GD4B 2UUFB 3M5LA 1C5NH 2AYWA 3LGYA 4AORA 4DURA 1SB1H 1XKAC 2ALVA 4AZ2B 2C90B 1C1MA 1IQLA 3SNBA 4BTIB 3FZZA 1N8OC 3UWIA 4AFZA 3A84A 3UR9A 1ELAA 3QGJA 1GBIA 3MO3A 3VB3A 1UK4A 1AMHA 2VWLA 1T8LA 1UK2A 1V2OT 3L6PA 1O2XA 4F4OC 2J2UA 3KQBA 4AFUA 2GGVB 1A0HB 5JBTA 1V2UT 2QF3A 3V7TA 2XBXA 3A89A 4MG3A 1B5GH 2EI6A 1LVYA 5ABWA 1ZSKA 2DE8A 4K69A 2PSYA 4R8TB 3JZ1B 1EJAA 1PPFE 2BY8X 3RC4A 2C8ZB 3RXDA 1AO5A 2FOGA 5A8XA 2BB4A 2D1JA 4WF8A 2XBVA 3LDXH 4FU8A 4ZUHA 2RDLA 4CRBA 1ZPCA 3LGVA 1HIAB 3LU9B 5EU8A 1NRNH 3SHAH 2HLCA 2CMYA 4D9RA 2OC0A 4Y7BA 1H9HE 2VWMA 3TJVA 4YESB 1J14A 1ANBA 1C5YB 3O8DA 2VU8E 2AMDA 1HAPH 4X8VH 5T3HA 1ZHMA 3BTHE 3ZZDA 1DE7H 1O2PA 1EPTC 3RXKA 1QB6A 1O3DA 1GHZA 2G5NA 1SGFG 1PPGE 8KME2 1C9TA 2TGPZ 1O5EH 5CE1A 4ISLA 3G01A 3BEIB 3UR6A 1WV7H 1UHBA 1XXDA 5JYIA 1F0TA 1JRSA 1KLIH 4BAQB 3RXPA 1Z6EA 3SNEA 1MBQA 3TU7H 4FUDA 4MLFB 1EB1H 1HFDA 1Z71A 2A4GA 3ZVFA 2W7UA 4ZMAH 2LNCA 3A85A 1MKWK 2HNTF 2QC2A 2A0QB 2CV3A 3TJNA 2VH6A 2ZCKP 1KSNA 1O2NA 2JH5D 2FESH 3BG4C 1DSUA 1NFXA 1P8VC 3MH4A 1P2IA 3A8BA 2PKSB 2R3YA 3S9AA 4K60A 1WU1A 2B8OH 1LHFH 3M5NA 3RXGA 4MPXA 2F9PA 2FX4A 2STBE 8GCHG 2CHAB 1NRSH 5FPTA 1SC8U 1CGIE 3A87A 3BTWE 4X6MA 3A88A 1HAZB 3OU0A 3M36A 1SSXA 1HAGE 2OTVA 3PLPA 2R3UA 2RCEA 1SLXB 1ELCA 3UQOA 5LGOA 1L1NA 3NZIA 1K1JA 4AB8A 3P8OA 2XC0A 1CT2E 2JKHA 3SV6A 1ELEE 4YOJA 2YOLA 1T4UH 1IHSH 1DSTA 2GKVE 1QCPA 2GMTB 3HGPA 1UK3A 2HOBA 3SU3A 1TWXB 1C5UA 3STIA 4IC6A 4DT7B 3MNCA 5HXFA 3SUGA 1O2QA 2GX4A 2BDHA 1ZTJA 1XXFA 3HK3B 1V2ST 1V2LT 1GJ7B 2ZDVH 3R0FA 3SJ8A 1GI9B 2BMGB 4K1EA 4UFFH 1O3GA 2ZHQH 1O2HA 3MU1A 4MPUA 1ARCA 1CA0C 2GZ9A 1QBVH 5HGGA 1WTGH 1THSH 2FOAA 4ESTE 3UFAA 2WPKS 2OQ5A 1ZZZA 3HATH 3KEEA 4NSVA 4A7IB 3FZDA 2FDAA 2OLGA 1LMWB 2QIQA 1HJ8A 3LOXA 4ABJA 2FYRA 3NKKA 1MD7A 1LHGH 2Z9JA 3S9CA 1SGEE 1ELTA 4D7FA 1D6WA 3K9XB 2VVUA 4O9VA 1SHHB 1KLTA 2R2WU 2PKAB 3K6ZA 4BOHA 2GT7A 2R0KA 4X1RU 3BIUH 1OX1A 2Y5FA 1TNLA 3SI4H 1ZRBA 4JYUH 1G2MA 1BRBE 1EP5A 1FY8E 2FYQA 2WYJA 3MU4A 3ZYEA 2XYAA 4XE4A 3TGIE 2PKSC 4KTUA 1TPPA 5JDUB 4Y0ZE 1ESTA 1UTLM 1TQ7B 1SGIB 2GMTC 1XX9A 3E6PH 1ABJH 4ABIA 1TX8A 1OP2A 5GCHF 2G5VA 1GHAF 2OCVB 4YT6H 1UTKA 2A5KA 1P09A 2BY6X 4CBNA 1T4VH 5T6FA 1G3BA 2Y7XA 4OS4A 1OS8A 1BMMH 2ZFRH 3V0XA 1S81A 2TRMA 1FPCH 1O5DH 1E34B 4GPGA 2Y5GA 4LK4A 1TIOA 4BAMB 1GBJA 4OS6A 3FFGA 1K9OE 2ULLA 4TWYA 2D8WA 4JYVH 3A7TA 1F0SA 4I8LA 4OS1A 1K1NA 1ARBA 1KIGH 2BDCA 4ZKSU 1FJSA 3O8RA 1JIMA 1HAVB 5C67A 1SQOA 3DT0H 2H9HA 2VWNA 3M3VA 1MTNC 3M37A 1TPOA 4CRAA 5A0AE 1FIWA 4XBDA 5A8ZA 1NESE 1P3CA 5F8XA 1O3KA 1A5HA 2P3UB 1GMCG 2O8WA 2O8TA 1AZZA 2UUJB 3W94A 2BLOA 1BTYA 1Z8IB 1MTVA 3SI3H 1O3IA 3Q77A 4ZHLU 3H7TA 4UFGH 3ATMA 2H9TH 2JETB 1O2GH 1UCYK 1AKSB 5EW1H 3SU4A 2BOHB 1ESBA 4TPIZ 1BMNH 2VIOA 1BB0B 1XUGA 4H6SB 1NU9A 1NT1A 1IQEA 1T31A 1YM0A 3DA9B 1C2KA 2C8YB 1P11E 3O8CA 5JBCS 3LJOA 1J9CH 1C1TA 4GCHG 2B5TB 3SU1A 1EOJA 1J16A 4DW2U 3MH5A 3P8NA 1BBRH 3DFJA 4UFEH 4NWKA 3E0PB 1G37A 3URCA 2F9VA 2ZA5A 1O2TA 2W3KA 3FANA 1C5ZB 3MU0A 3OX7U 3S7KB 1C1WH 1HJ9A 4FVBA 1SL3A 1EZXC 3RXSA 2FS9A 1C1NA 4D7GA 2FLRH 4CH8B 4BNRA 1UTOA 5FX5A 4ZHMU 1KXCA 2Y80A 9LPRA 2SGFE 4ABAA 1CQQA 3A83A 3ZV8A 3H7OA 1O2UA 1YPHC 1UJ1A 1A5GH 1ZHRA 2BDAA 1ZPZA 3ZZ7A 3SJ9A 1HYLA 1XKBC 3ZZAA 5A0BA 2BD2A 2QF0A 1Z8RA 4Y8YA 3M7TA 4ABBA 1AKSA 1DVAH 4ISHH 2ZPRA 3UOUA 2EC9H 4NG9H 4Y6DA 1TGBA 3VB4A 1OYQA 1HAXB 5DP6A 2CHAC 3GY2A 3TK9A 3BN9A 3GCNA 1UVSH 1QNJA 2BDIA 1XUHA 2EEKA 1BDAA 3UQVA 1S83A 3SU6A 3VXEH 1C2IA 1DXPA 1BUIA 3M7UA 3KIDU 4DVAU 3E3TA 2NU4E 5A09A 4YT7H 3QDZB 4NFEA 4U32A 1Y5BT 3MU5A 3MMGA 1UTJA 3TK6A 5GWZA 5LPFA 1EZUC 2CF8H 1OYTH 1HV7A 1FNIA 3ATLA 5DP5A 1HB0B 1GBEA 2WUCA 4ABGA 3TGKE 1C1VH 4IGDA 2W5EA 2J4IA 1O5BB 3GYLB 3PTNA 2VH0A 3ZZCA 4AX9H 1SGDE 1N1LA 5A8YA 1NZQH 4R0IA 1WUNH 1DPOA 5I46H 4LXBH 2XC5A 1YLCA 1Y3WA 1W3CA 3RC5A 2BY9X 1NRPH 2Q6GA 4B73A 4I8JA 3MNXA 4WWYA 1DWCH 3BTQE 3F68H 3I77A 1PYTD 1EZSC 1GMDG 1RXPA 2A4QA 3EGKH 1HAOH 4NA7A 1ANDA 1BTHH 2ZCLP 1P9UA 4OS5A 1AFQB 1Y5UT 2OXSA 1LPGB 3QK1A 1HAVA 1GCDA 1ZTLA 1SGNE 2V35A 1ZGIA 2F9NA 1G3DA 3VFEA 1Y8TA 2NU0E 3K2UA 3P8GA 5EG4A 1Y3VA 2Z9GA 4HI3A 2ZQ2A 2ZHFH 1SGYE 1KLJH 1QB9A 1D4PB 1ZRKA 1AWFH 1NFWA 2A1DB 6GCHF 1GI4A 2I6SA 1C2HA 4BAHB 4Y71A 2ZTYA 2C93B 1F5RA 1CBWC 5F6MA 3D49H 3ZZBA 4MPVA 3U1IB 1AFEH 1NRQH 1BRUP 5EPYA 2P8OB 3DFLA 1TBRH 1ORFA 4O3TA 1EPTB 1PPEE 2RA0A 2FTLE 4LZ1H 2G8TA 2H6MA 1DT2A 1S6FA 1NFUA 1MU6B 1BJUA 2J92A 4TYDA 2XRCA 4YZUA 3PROA 5FHTA 1GDUA 3T27A 4GUXA 4NSYA 3ODDA 1G9IE 1UVTH 4X1PU 2TBSA 1VR1H 1P02A 2LPRA 1X7AC 4K1TA 1IQMA 2M5TA 5E2OA 3P17H 1BRAA 2FI5E 2O8UA 1MTSA 4Y10E 1THRH 2QAAA 1GBHA 2XCNA 1RIWB 1QQ4A 1IQHA 2Q1JA 4MVNA 3T29A 5LPEA 1ZR0A 3RDZA 4AN7A 3MHWU 4K1SA 2EA3A 1OWIA 1FN6A 1AVXA 1EX3A 2Z3DA
chains in the Genus database with same CATH superfamily
2NU3E 1IQJA 1GBLA 3SGAE 2A31A 1TOMH 1W12U 4AGJA 5DGJA 5G4BA 1C2MA 2QYIA 2PWXA 4X1NU 1CBWB 1V3XA 2VIQA 4H42U 4O03A 1V2VT 2TIOA 1EPTA 3E16B 2O8LA 5FL7D 2WPLS 2ZU5A 1UMAH 4CR9A 1K1IA 1O37A 7KMEH 2W3IA 1OPHB 2XC4A 1N6XA 4K8YA 3BTME 2GDDA 4WXVA 3MH7A 1BIOA 2J97A 2PP6A 1TGCA 2HWLB 4E7RG 2ASUB 1FXYA 2Y7ZA 1XUIA 4KKDA 3QLPH 1SGQE 1C2GA 4I32A 5GCHG 1TX6A 2ZG0H 3PRBA 1C9PA 1TOCB 2AFQB 4UFDH 2ZO3H 5HM2A 2A2QH 3O8BA 5C5NA 1E35B 1IAUA 5C2ZA 1TLDA 3OY5U 1ZSLA 1SBWA 2YMSB 1TNGA 4AB9A 1C5QA 4CRGA 3KHVA 2RFKC 1C2JA 5FBIA 3JZ2B 1QL9A 2SGQE 1TPAE 1ELFA 4OS2A 4AYVB 1FONA 2ODYB 2W7SA 5JBBS 3RM2H 1LVOA 2R9PA 4I8KA 1SR5C 2Q6FA 5L2YH 1OWDA 3A8AA 3EDXB 1GI0A 2Z7FE 3KL6A 1AN1E 1O3PB 1O3JA 5L30H 2ZC9H 4F55A 2AERH 4QT8C 3V12A 1W8BH 3GCTF 1NS3A 2Z3EA 2KCPA 2F83A 2GJGA 2V3MA 3Q3KA 3LC5A 4X8TH 3BF6H 1C4V2 1SGFA 1PQAA 3SOSA 3UB0A 2AGEX 3ZVEA 1CHGA 3ATIA 5L6NH 4KP0A 4ACBA 1HUTH 1FAXA 1OHHD 4M7GA 4O97A 4HGCA 3GDUA 1LVMA 3VPKA 1RRKA 1D3DB 3SW2B 1KXEA 2ZECA 3BG4B 4CR5A 1SOTA 1A2CH 2B0FA 3LGWA 2NU2E 3K6YA 2SFAA 4K3JA 1SGRE 3LKWA 5EOKA 3E0NB 3EA8A 2ODQA 5LPRA 1GBCA 1O2KA 2HRVA 1TRYA 2V6NA 4JZDH 4GLYA 1Q31A 2ANWA 1KXBA 1A5IA 1ZMLA 1F0RA 2ZDAH 4DOQA 2A7CA 1SMFE 2FOHA 3T26A 2QXHA 3OFND 4ZAEA 4FUGA 1AZ8A 1YP9A 1GHBF 2ANMH 1YLDA 3SJOA 4AOQA 3W1EA 2A2XH 2DE9A 1CO7E 1KDQB 5T1VA 3TJOA 4D9QA 2KCYA 1ZTKA 4KTCA 4HTCH 2KR7A 3W95A 4XD7D 3ZZ9A 4K5ZA 4NZLA 1VITH 3ZV9A 1P04A 3QWCH 1QJ1B 1Z1JA 1O3CA 5AF9H 3PV4A 4B2AA 1EFRD 3EAJA 1O3MA 3CS7A 1HAIH 3D23A 2ZFSA 4A5TS 5C1XA 1ETTH 1MMJN 1OWHA 1ABIH 2I6QA 1UHBB 1V2QT 1B0EA 2XBWA 5C5OA 2FM2A 3CS0A 8ESTE 1O2WA 3NWUA 4B74A 3N7OA 2P16A 1C2DA 1Y3XA 1Y5AT 4XDEA 1N8OB 3OAAD 1YC0A 2R0LA 1D3QB 5HMAA 1NBMD 1Z8GA 3M5MA 4XFQA 1PQ8A 6LPRA 5B6OA 1TAWA 2QXIA 3A80A 2K8IA 2P8OC 4XOJA 2SNWA 3RLYH 3HKJB 1C5XB 2BD9A 1TRMA 1O5CB 3PB1E 1FLEE 1GVLA 2FTMA 2EQNA 2VIDA 2P3TB 1P01A 3STJA 3TH3H 3C27B 3GOVB 1V2WT 3AASA 3A7XA 3GY4A 1O3LA 3NUMA 1GJ5H 1VCQA 4ZXYH 1CSOE 1NBME 3DSOA 1CU1A 4RT1A 1LDTT 1C1SA 1NFYA 3PMBB 2ZU3A 3UPEA 1DOJA 2PSXA 1HGTH 2L6OA 3FVFB 2FI4E 3VXFH 1LPZB 5F53A 4ABHA 4NIXA 6GCHG 1FN8A 3VB6A 4X0WU 2JH6D 3F3BA 2AS9A 1ELGA 4Y7AA 2KZ4A 3RXFA 1FIZA 3UUZA 2FO9A 2PUQH 3OTPA 4AGKA 5DKMA 3QGNB 1O3NA 3U8OH 2HLDD 2QE7D 1AB9C 1MTWA 3SNDA 1DWDH 3C1KA 2GV7A 1VJ9U 2ZFFH 1YCPH 4FU9A 4Q7XA 4INLA 4BTUB 1NU7B 1MBMA 3RXHA 2TGDA 1BBRK 2BD4A 5FAHA 4ISOA 3SV7A 1CT4E 2XWBI 2SGDE 4H6TA 4NZQA 4RT0A 3LIWA 1NO9H 3T2NA 4BAOB 5B6LA 1GHBG 3ZYDA 1ESAA 2L74A 4FUIA 2CF9H 3TLOA 6ESTA 2C8WB 1LKAA 2BLWA 1NROH 1ZMJA 2KAIA 4WMFA 1THPB 1HXFH 2ZU2A 3HGNA 3V13A 5GJ4B 1V2NT 1WQSA 1O2LA 2Z9IA 4UD9H 2HNTE 3RU4D 5BRRE 3GY6A 2QA9E 2FOCA 4JCNA 5ESTE 4RN6A 5CHAB 4U30A 6CHAB 4HG6A 5EXNA 3GY5A 5EXLA 3ZVBA 2R2MB 1O38A 2O8MA 1SLUB 1JBUH 2FOMB 4I33A 3BTKE 1L0ZA 2IOTA 1S82A 3T62A 1W0JD 3M3SA 1OP0A 2B9LA 5CHBA 3UTUH 5DG6A 3SBKA 1IQFA 1E79D 3ITIA 4YO9A 1WAYB 4NWLA 5K0HA 1S5SA 2F4LA 1IQIA 1ANEA 4FVDA 2KFWA 3TITA 1OP8A 1V2RT 4WY3A 5JBAS 5AFYH 2QCYA 3UY9A 1O2OA 4AFSA 5EQRA 1GPZA 2PUXB 3LH3A 1GGDC 4CH2B 1HLTH 3P70B 4Y8XA 1BMLA 2BD5A 2BX4A 2HPQH 4LOYH 1A7SA 4X6NA 4IN2A 1GJ8B 2WYGA 4X8SH 3RXOA 3WW7A 4B6EA 3ZIAD 1UTQA 2C4FH 2JIZD 1NM6A 4GVUA 3BV9B 4YLUA 1QR3E 2BVSH 2FMJA 3ATKA 1C4Y2 2ZEBA 2A4RA 2XOKD 1BHXF 2FOFA 2QXJA 3GY7A 2RG3A 5DJ7A 1C2LA 2BDBA 1DX5M 2KAIB 1AUTC 4THNH 3RUOA 2HVYB 1Y59T 1QA0A 3F1SB 4GHTA 4VGCB 4IC5A 1S0RA 1IQNA 4GCHF 3NK8A 4MDSA 1C5MD 3FP8E 4ZROA 1P2KA 5CHAC 3MWIU 6CHAC 5C1YA 3SUDA 4Y0YE 3I29A 3RU4E 1EAXA 4DIIH 2FZZA 2WPIS 3K65B 5HIZA 3BEFB 5I25A 1JXPA 3UWJH 2GCTB 1F5KU 1TMBH 4Z0KA 4P02A 4U2WA 2BD8A 1GJAB 2YNAA 2J38A 2UWLA 1O2RA 4MTBA 5A0CA 2CGAA 3SJKA 1HAHH 4K2YA 1L4ZA 3AW0A 1NN6A 1BJVA 1GBAA 3RU4T 3OSYA 1YPKH 3SV2H 5DP8A 5E8EH 1ZJDA 1TA6A 2OBOA 5T6GA 1XUJA 2BD3A 5FPSA 1UCYE 1FY3A 1KMHB 1KTSB 4DCDA 2XTTB 1TGSZ 1BTZA 7ESTE 4XBCA 2P94A 3OY6U 4TY6A 3HKIB 7LPRA 1L2EA 4AG1A 2BTCE 1ELDE 2FP7B 1C5VA 3F2FA 4OGYA 1QL7A 3MNSA 1GJCB 2C8XB 4A1XA 1O3BA 1SVPA 4XBBA 2Z9LA 3PM3A 5KGOA 4Q2KA 1Y3YA 1C4U2 3A86A 1SQAA 2PTCE 4D8NA 2BX3A 3LPRA 1C5OH 4ZKOU 4YLQH 2FIRH 2ZDLA 1FMGA 3ELAH 1QB1A 2OUAA 1EXFA 1XMNB 5DSFA 1LVBA 1VGCB 3TNSA 1O36A 2ANKH 2ZIQH 1MD8A 2FXRA 3LT3A 1GMDF 4MPWA 1WCZA 4AFQA 2OK5A 5TCCA 5EW2H 2P3FH 1O2MA 4VGCC 2A4OA 1O39A 1O5FH 1P12E 2VGCB 3GDSA 3U8RH 3MTYA 1DY9A 1MKXH 1GDNA 1TNJA 2GVFA 2QV1A 3ODFA 1V6DA 1KDQA 4O3UA 3E90B 3LGUA 5A2MH 3SHCH 2F91A 1BBRE 3UNRA 1F5LA 8GCHF 3F9GA 3KYFA 4UONA 1YY3A 3EA9A 1YLNA 1LTOA 8LPRA 1OSSA 1DANH 1EQ9A 4I31A 4NCYA 1YCPK 2YMSD 1L4DA 4MNXA 3WWFA 1J8AA 2AH4X 1W0ZU 2CJIA 2IJD1 1GBMA 2BYAX 4I8GA 5DP3A 2IN2A 2B7DH 4J1YA 1CA0B 4J2YB 1DFPA 4HFPB 4FUHA 1VITF 5C20A 2ZHWH 3EA7A 1WQVH 1CHOF 3SV8A 1TNIA 3Q00A 1XUFA 2ZGHA 1TMUH 1A4WH 1CHOG 1MKXK 1O2VA 2PR3A 3LJJA 2YNBA 1AHTH 4AG2A 4M9FA 1C5RA 3QO6A 1ZOMA 1HNEE 1O3EA 1YBWA 4U01A 3M61U 5CDFE 1GHXH 3BSQA 2WV4A 3M5OA 1MZDA 2JH0D 1SGPE 3OE7D 1QJ6B 2WV5A 1GBBA 1C2FA 1F7ZA 1GI1A 4DJZB 2D2DA 1O3FA 1O5AB 1K1MA 1F92A 1P10A 1QURH 1SKYE 2BD7A 2Y6TA 2F43B 4RKOB 2ZU1A 2V0BA 3H09A 3D62A 3U9AH 1TBQH 2OINA 3PMHB 2FS8A 4PROA 3RXCA 2A5IA 1W14U 1NPMA 3B9FH 1OOKB 3Q3XA 1JWTA 3P6ZB 1EUFA 7GCHG 1U6QA 1ZLRA 2ESTE 2G52A 3MNBA 5JB9S 3ZVGA 4H4FA 5DP4A 4NA9H 4YTAA 1JRTA 1XM1A 2FOBA 1UVOA 1L1JA 3GS9A 3I78A 1KTTB 1MABB 4NA8A 1HXEH 1E0FD 3GCOA 1G36A 1K2I1 1QTFA 3U8TH 5FCRA 4WMEA 3QZQA 3RMMH 1AI8H 1S85A 2P93A 1E36B 1EJMA 2PW8H 2BXUH 2BQWB 5FBEA 1MU8B 1SPJA 4MNVA 4JYTA 1INCA 2TGAA 3P95A 3P8FA 1BTUA 3IG6B 2QGRA 5J4SA 1BTXA 1LQDB 1TYNA 1AFQC 1O2SA 1YCPM 2BZ6H 2Q6DA 4FUBA 3BTGE 3SNAA 3NCLA 3LH1A 1RJXB 3BTEE 3KF2A 2ILNA 1O32A 3PO1B 2OQUA 2BHGA 1E37B 1D9IA 1JOUB 2BZAA 5EQSA 5K7RA 1QQUA 3RXJA 1AY6H 2V3OH 2A5AA 1K22H 1IQGA 1J15A 5IDKA 1O5GH 4B76A 3BEUA 2BDYA 1G3EA 1RTLA 2ZTZA 2A45B 1QRWA 3PLBA 1KY9A 5EJLA 3SO3A 1K0HA 1SHYA 3PLKA 4ZCNA 1C1RA 1EKBB 3QUMP 2BVRH 3SGQE 2ODPA 2ZKSA 3PWBA 1BMFD 1MUEB 1YPLH 1QBNA 5JPMH 2A32A 3CENA 1DDJA 1M9UA 1OWEA 2G4TA 3F0OA 1DLKB 1B0FA 3F6UH 5TJXA 1FV9A 1C5WB 4Y79A 1UO6A 5GIBA 1MCTA 2ZPQA 3BTTE 2BY5X 1HDTH 4DIHH 1HJAC 1SFQB 1A3BH 2Y81A 2DUCA 2VNTA 3PTBA 4ZKNU 2HALA 3KGPA 3SU5A 1T8NA 2OC7A 3SJIA 2XNIA 1TB6H 3SUEA 5E2PA 3QN7A 3H5CB 1SFIA 1E1QD 1W7GH 4F48B 1P57B 3GCHB 1GHYH 1GVKB 2PFEA 1WDIA 1ZSJA 1LCYA 2VIWA 4CHAB 1AQ7A 3PO1C 4JK5A 4WH8A 3U69H 1A46H 1V2PT 4Z6AH 1YPMH 1K1LA 1W2KH 2TPIZ 2ZCHP 3FO8D 1FPHH 1NRRH 1BHXB 1TONA 2H5DA 2UUKB 1XVOA 1S6HA 1W11U 2VINA 3RMNH 3SYJA 3TJUA 4X2YA 3OYPA 2ZQ1A 2ZF0H 3ZZ6A 5DP7A 3RXQA 1DY8A 2CXVA 3RXVA 2BXTH 4X1QU 1WSSH 3A7YA 4TT3D 4BXWA 1WOFA 1HIAA 1A1RA 4WMDA 1A0JA 1S84A 3A8CA 1YGCH 1PPCE 2HPPH 1BZXE 5JB8S 1JIRA 1HCGA 1NY22 4JMYA 2PGQB 5DK1A 2PHBA 1H1BA 1HAYB 2AGIX 5C0TA 1F2SE 1GI5A 3L3TA 1AGJA 5FXLA 5C94A 1WXRA 1DITH 4BTTB 3A82A 1C5TA 1FX0B 1DM4B 3IITA 3PRDA 2G51A 4ABFA 1TNHA 3B8JA 4X2WA 3BTDE 3MFJA 3SUFA 4B71A 4Y8ZA 2IPHA 3FP7E 2KM0A 4Q4LA 1SG8B 4OS7A 3RM0H 1AB9B 4FUCA 3GCTG 4Q7YA 1QHRB 1H8ED 4RSPA 3AVZA 2PTNA 2ZFQH 2ZHDA 4MNWA 4X6OA 3TGJE 1MH0A 4X2VA 4HZHA 5ESBA 1GBFA 1D3PB 1QA7A 1TGTA 2Z6BD 2J34A 1A3EH 1KXFA 2F9UA 3DD2H 2GP9B 4I8HA 2K1QA 5EXMA 2P59A 1D3TB 1OXGA 2ZGBH 1C5LH 1FUJA 1GBKA 1Z6JH 2GDEH 4YOGA 4YXWD 3S69A 2FEQH 1W7XH 5IK2D 4JZFH 3BIVH 1SLVB 1ETSH 3SQEE 1ELVA 1L1GA 3KYGA 1VITG 1C1QA 5BPEA 1TFXA 1W13U 3T5FH 4ZKRU 4KGAA 1D6RA 1H9LB 2KX4A 3LGTA 2BQ7B 3RXBA 1GG6C 2STAE 4Y11E 2WINI 1GHAG 1IOEA 1TA2A 4FUEA 1BOQA 1H8DH 1O35A 1O2JA 3ZVCA 3GYMA 4FUJA 2GCHF 2VIPA 2IPQX 2K0QA 2EI7A 1V2TT 1DUEA 4MNYA 4A92A 4KELA 3A7VA 4XSKU 2FI3E 5ETXA 1QIXB 1AVGH 2C3SA 2FODA 1P2QA 3ZZ3A 2RA3A 2QN5T 2CN0H 1BCUH 3UNQA 4FXGH 1RFNA 4SGBE 4BANB 1RIWC 2AIQA 2G4UA 1Y3UA 2V3HH 1GL0E 1PPBH 3VGCB 1E38B 2OC8A 2H9EH 2GV6A 1GI7B 3SU0A 1V2JT 1FQ3A 3AW1A 3S9BA 1GI3A 1O30A 5DPAA 3RXIA 2PKAA 2WPMS 5C0UA 2SGAA 2O9QA 1LHDH 2GZ8A 1GI6A 2VB0A 4AC9A 1PQ7A 3T28A 4BAKB 2Z3CA 1IQKA 2WSSD 3E8LA 4A1TA 5J4QA 1CE5A 3ATWA 2OD3B 1TPSA 2ZGCA 4FOUC 4X1SU 1LPKB 1QL8A 4SGAE 3UOPA 5AHGH 3NXPA 2BLVA 2J94A 1SI5H 1GJ4H 1GG6B 1UTMA 3TVJB 2SNVA 1PFXC 1YPGH 4Q80A 4FU7A 3LONA 3T25A 2XNDD 1O3OA 3MI4A 2PGBB 4B2BA 1P05A 4ABDA 5HKKD 2QF4A 2OP9A 1MZAA 1GI2A 9ESTA 2FWWA 1BA8B 1KYNA 1K28D 1MAXA 5AVDA 1V2MT 1XVMA 1RD3B 2ZHEH 1MAYA 1ZJKA 1EAWA 3RC6A 2UWPA 3F2HA 3ENSB 1T8OA 3EE0B 3ZVDA 1LHCH 2OBQA 1MQ5A 1O3HA 1TX7A 4IBLH 1OWJA 1QRXA 1C5PA 3D65E 5EQQA 3MYWA 3GDVA 4B2CA 1UTPA 4X2XA 4E7NA 4CHAC 5AFZH 2BM2A 4JZEH 3L33A 3CP7A 1ETRH 3WWBA 2WPJS 1PPZA 1ID5H 1G32B 3B23B 1T32A 3MU8A 5E0HA 5DP9A 3A8DA 1GJ6A 5PTPA 1BTWA 1GWAA 4NIWA 4B1TA 2KCAA 4DG4A 1T7CA 3ZZ4A 1RS0A 2BVXH 3QX5H 3GY3A 1Q3XA 5C1UA 4TWWA 1ZMNA 3S0NA 3SGBE 3TH2H 1DWBH 5SGAE 2ZGJA 1UTNA 3GY8A 4CRCA 1SLWB 5IYTA 3MO6A 1KXDA 2G00A 3KQDA 4AYYB 3F0PA 3RXEA 3V3MA 1G3CA 5KEDA 1SQTA 1H8HD 2WUBA 1V2KT 1VZQH 3SZEA 1FZZA 5FCKA 2QF5A 2VJ1A 1VGCC 3M35A 3QTVH 1QRZA 3LC3A 3RXLA 1YF4A 3KQCA 3SV9A 1GL1A 1QGFA 3M3TA 2ZDKA 3QTOH 4IS5A 1CGHA 3UREA 2VGCC 1W0YH 1AE8H 2Y82A 2QY0B 3NPSA 2FOEA 2ZI2H 1HPGA 4CRDA 3AAVA 3MOCA 5EODA 1Q2WA 1P9SA 2BLQA 1WTHD 5F03A 3UNSA 4RKJB 1PQ5A 4UE7H 2EI8A 2GTBA 4ISNA 3AAUA 1ZHPA 1B7XB 2AMQA 1PYTC 3PMJA 3R3GB 4CBOA 5GPIB 1UVUH 4WH6A 3A81A 3HK6B 1TE0A 3PWCA 1OKXA 3ZZ8A 1P2NA 4TPYA 4I7YH 2AGGX 3IWMA 1YWUA 3F9HA 2ZFTA 3E1XB 4X6PA 1DICA 3RXMA 1H9IE 2Z9KA 1GMCF 2GT8A 2J95A 3BG8A 3SORA 1EAIA 1CVWH 4NFFA 1FAKH 4JZ1A 2P95A 4WVPE 1Z7KA 3MH6A 5EJZA 2ZNKH 3TK5A 1TALA 4IN1A 2WPHS 5F8TA 3KNXA 1AWHB 1FDPA 1EJNA 1EASA 1AU8A 1GCTC 2A7JA 3RLWH 1PPHE 2FPZA 2VIVA 2VWOA 1AE5A 4BXSA 5FPYA 1EZQA 2LELA 3M7QA 1GMHG 1G30B 1O0DH 2W26A 4JK6A 5EPNA 1Z8JB 1LKBA 2HNTC 1QJ7B 1K1OA 5DO4H 4MQAA 3TIUA 2WPDD 4YM9A 2AIPA 2M2AA 1SGCA 2A7HA 1EAUA 1C2EA 1DWEH 4E06H 3PMAB 1GHVH 1HJAB 3URDA 1FY1A 1BITA 1HRTH 4NGAH 4TY7A 2XXLA 3GISB 1WYKA 2GCTC 3RP2A 1NC6A 1P03A 4DGJA 4GHQA 5HYOA 2XCFA 1EP6A 3UIRA 1F0UA 1ZYOA 1YPJH 3FP6E 1P0SH 3GCHC 2AEIH 1GHWH 2Z94A 1P3EA 1IHTH 1WBGB 4YOIA 4CREA 3PYHA 1AUJA 1SOZA 1H4WA 3VB7A 1UVPA 1GI8B 1VJAU 4A1VA 2UUYA 1O2YA 1P06A 3BTFE 1AIXH 1QFKH 2ZDMA 4OGXA 1H8IH 1O34A 1GJ9B 1GVZA 1QBOA 4ZHAA 5FX6A 1QY6A 1GJDB 5L2ZH 2HVXA 3E91A 2GZ7A 1LHEH 1TBZH 2LP6A 1TMTH 4LZ4B 3F9EA 3PV2A 1K1PA 1O2ZA 2XBYA 1EB2A 4IMZA 1T8MA 1XUKA 1VCWA 4IMQA 3MO9A 1O2IA 3ZZ5A 3KN2A 5T6DA 2ANYA 3A7ZA 3SN8A 1YPEH 5H4IB 1YKTA 4GAWA 3QZRA 4NIVA 1YYY1 3WY8A 1HBTH 2ZWLH 3RXTA 5C3NA 3S7HB 1MTNB 3VEQB 1A61H 1S0QA 3F9FA 1GCTB 3U1JB 4KTSA 2ALPA 5CMXH 1C1UH 1GMHF 1N6YA 3VB5A 1TRNA 3RXRA 1BQYA 1QZ8A 5GDSH 1COWD 2J9NA 4WJG2 4WXIA 4I86A 1CGJE 4Q7ZA 4X8UH 1G2LA 3SQHE 5GXPA 1JMOH 2BOKA 1FY4A 2D26C 2SGPE 2H1UA 2Y5HA 4ZH8A 2XWAA 4ISIH 2PLXA 7GCHF 5TCAA 1BRCE 2JETC 2FLBH 2ZFPH 2NU1E 1OWKA 5E0GA 3HPTB 4FUFA 3KCGH 1AD8H 1ZPBA 4ZXXH 3ZVAA 2ZGXH 4ASHA 1RTFB 4A6LA 1TQ0B 3TNTA 1K21H 2THFB 2NWNA 2FX6A 2BY7X 2GCHG 1TNKA 2VVCA 1BMAA 3MQKC 1P2MA 1CT0E 1FI8A 1PJPA 1UCYH 2G55A 3P92A 5HM9A 1A0LA 4GSOA 2F9BH 1GGDB 3Q3YA 2UWOA 1C1OA 1EOLA 2ZP0H 3N7EA 2F9OA 2SGEE 4Z1MD 1MQ6A 1DXWA 2HGTH 3LGIA 1VCPA 2H5CA 4FETA 2PV9B 3TPIZ 2TGTA 4B6FA 4NIYA 4DY7B 1GBDA 3TH4H 1MCVA 3RMLH 3RXAA 4CRFA 3A7WA 1DLEA 1E1RD 1LQEA 4B75A 1TGNA 2H2ZA 3RXUA 1ZGVA 3SZNA 5F8ZA 1RGQA 3SNCA 2QXGA 1AVWA 1ANCA 2F3CE 2XW9A 1BT7A 4E05H 4UDWH 4F49A 3RMOH 1RTKA 3SU2A 1KXAA 1O3AA 4IW4E 5GNDA 4UEHH 2IJOB 2G81E 1CA8B 5EGMA 5E0JA 3DHKH 2VVVA 1YPHE 2BQ6B 3EYDA 1EATA 2ZZUH 3EQ0H 3ESTA 2BDGA 1MTUA 1O31A 1Z1IA 3OEHD 1ELBA 3FAOA 1LO6A 1TABE 3OEED 5EIYA 3DUXH 5LH8A 1BTPA 2AMPA 1DUAA 2ZPSA 1ACBE 3Q76A 2ZU4A 3VGCC 4ACAA 3KQEA 2ZTXA 4K8BA 2OC1A 1GBTA 1SGTA 1MKWH 3U98H 1FY5A 4ABEA 1S6LA 4INHA 4D76A 1DS2E 1P2JA 3OTJE 1C1PA 1C5SA 3GICB 1W10U 2ZDNA 1NTPA 1P2OA 4Y76A 4JZIA 1GJBB 1SQRA 1GDQA 2V7QD 4INKA 1O33A 1J17T 2GD4B 2UUFB 3M5LA 1C5NH 2AYWA 3LGYA 4AORA 4DURA 1SB1H 1XKAC 2ALVA 4AZ2B 2C90B 1C1MA 1IQLA 3SNBA 4BTIB 3FZZA 1N8OC 3UWIA 2VBCA 4AFZA 3A84A 3UR9A 1ELAA 3QGJA 1GBIA 3MO3A 3VB3A 1UK4A 1AMHA 2VWLA 1T8LA 1UK2A 1V2OT 3L6PA 2WHXA 1O2XA 4F4OC 2J2UA 3KQBA 4AFUA 2GGVB 1A0HB 5JBTA 1V2UT 1W0KD 2QF3A 3V7TA 3KQ5A 2XBXA 3A89A 4MG3A 1B5GH 2EI6A 1LVYA 3NRLA 5ABWA 1ZSKA 2DE8A 4K69A 2PSYA 4R8TB 2EY4C 3JZ1B 1EJAA 1PPFE 2BY8X 3RC4A 2C8ZB 3RXDA 1AO5A 2FOGA 5A8XA 2BB4A 2D1JA 4WF8A 2XBVA 3LDXH 4FU8A 4ZUHA 2RDLA 4CRBA 1ZPCA 3LGVA 1HIAB 3LU9B 5EU8A 1NRNH 3SHAH 2HLCA 2CMYA 4D9RA 2OC0A 4Y7BA 1H9HE 2VWMA 3TJVA 4YESB 1J14A 1ANBA 1C5YB 3O8DA 2VU8E 2AMDA 1HAPH 4X8VH 5T3HA 1ZHMA 3BTHE 3ZZDA 1DE7H 1O2PA 1EPTC 3RXKA 1QB6A 1O3DA 1GHZA 2G5NA 1SGFG 1PPGE 8KME2 1C9TA 2TGPZ 1O5EH 5CE1A 4ISLA 3G01A 3BEIB 3UR6A 1WV7H 1UHBA 1XXDA 5JYIA 1F0TA 1JRSA 1KLIH 4BAQB 3RXPA 1Z6EA 3SNEA 3U28C 1MBQA 3DSPA 3TU7H 4FUDA 4MLFB 1EB1H 1HFDA 1Z71A 2A4GA 3ZVFA 2W7UA 4ZMAH 2LNCA 3A85A 1MKWK 2HNTF 2QC2A 2A0QB 2CV3A 3TJNA 2J5UA 3UAIC 2VH6A 2ZCKP 1KSNA 1O2NA 2JH5D 2FESH 3BG4C 1DSUA 1NFXA 1P8VC 3MH4A 1P2IA 3A8BA 2PKSB 2R3YA 3S9AA 4K60A 1WU1A 2B8OH 1LHFH 3M5NA 3RXGA 4MPXA 2F9PA 2FX4A 2STBE 8GCHG 2CHAB 1NRSH 5FPTA 1SC8U 1CGIE 3A87A 3BTWE 4X6MA 3A88A 1HAZB 3OU0A 3M36A 1VKYA 1SSXA 2JDID 1HAGE 2OTVA 3PLPA 2R3UA 3N99A 2RCEA 1SLXB 1ELCA 3UQOA 5LGOA 1L1NA 3NZIA 1K1JA 4AB8A 3P8OA 2XC0A 1CT2E 2JKHA 3SV6A 1ELEE 4YOJA 4XRNA 2YOLA 1T4UH 1IHSH 1DSTA 2GKVE 1QCPA 2GMTB 3HGPA 1UK3A 2HOBA 3SU3A 1TWXB 1C5UA 2J98A 3STIA 4IC6A 4DT7B 3MNCA 5HXFA 3SUGA 1O2QA 2GX4A 2BDHA 1ZTJA 1XXFA 3HK3B 1V2ST 1V2LT 1GJ7B 2ZDVH 3R0FA 3SJ8A 4ASUD 4P00A 1GI9B 2W6ID 2BMGB 4K1EA 4UFFH 1O3GA 2RDEA 3DSGA 2ZHQH 1O2HA 3MU1A 4MPUA 1ARCA 1CA0C 2GZ9A 1QBVH 5HGGA 1WTGH 1THSH 2CK3D 2FOAA 4ESTE 3UFAA 2WPKS 2OQ5A 1ZZZA 3HATH 3KEEA 4NSVA 4A7IB 3FZDA 2FDAA 2OLGA 1LMWB 2QIQA 1HJ8A 3LOXA 4ABJA 2FYRA 3NKKA 1MD7A 1LHGH 2Z9JA 3S9CA 1SGEE 1ELTA 4D7FA 4DT4A 1D6WA 3K9XB 2VVUA 4O9VA 1SHHB 1KLTA 2R2WU 2PKAB 3K6ZA 4BOHA 2GT7A 2R0KA 4X1RU 3BIUH 1OX1A 2Y5FA 1TNLA 3PV5A 3SI4H 1ZRBA 4JYUH 1G2MA 1BRBE 1EP5A 1FY8E 2FYQA 2WYJA 3MU4A 3ZYEA 2XYAA 4XE4A 3TGIE 2PKSC 4KTUA 1TPPA 5JDUB 4Y0ZE 1ESTA 1UTLM 1TQ7B 1SGIB 2GMTC 1XX9A 3E6PH 1ABJH 4ABIA 1TX8A 1OP2A 5GCHF 2G5VA 5HIYA 1GHAF 2OCVB 4YT6H 1UTKA 2A5KA 1P09A 2BY6X 2YMSC 4CBNA 1T4VH 5T6FA 1G3BA 2Y7XA 4OS4A 1OS8A 1BMMH 2ZFRH 3V0XA 1S81A 2TRMA 1FPCH 1O5DH 1E34B 4GPGA 4TSFD 2Y5GA 4LK4A 4OM9A 1TIOA 4BAMB 1GBJA 3FKSD 4OS6A 3FFGA 1K9OE 2ULLA 4TWYA 2D8WA 4JYVH 3A7TA 1F0SA 4I8LA 4OS1A 1K1NA 1ARBA 1KIGH 2BDCA 4ZKSU 1FJSA 3O8RA 1JIMA 1HAVB 5C67A 1SQOA 3DT0H 2H9HA 2VWNA 3M3VA 1MTNC 3M37A 1TPOA 4CRAA 5A0AE 1FIWA 4XBDA 5A8ZA 1NESE 1P3CA 5F8XA 1O3KA 1A5HA 2P3UB 1GMCG 2O8WA 2O8TA 1AZZA 2UUJB 3W94A 2BLOA 1BTYA 1Z8IB 1MTVA 3SI3H 1O3IA 3Q77A 4ZHLU 3H7TA 4UFGH 3ATMA 2H9TH 1UW7A 2JETB 5KECA 1O2GH 1UCYK 1AKSB 5EW1H 3SU4A 2BOHB 1ESBA 4TPIZ 1BMNH 3N7DA 2VIOA 1BB0B 2KCOA 1XUGA 4H6SB 1NU9A 1NT1A 1IQEA 1T31A 1YM0A 3CNRA 3DA9B 1C2KA 2C8YB 1P11E 3O8CA 5JBCS 3LJOA 1J9CH 1C1TA 4GCHG 2B5TB 3SU1A 1EOJA 3FOAA 1J16A 4DW2U 3MH5A 3P8NA 1BBRH 3DFJA 4UFEH 4NWKA 3E0PB 1G37A 3URCA 2F9VA 2ZA5A 1O2TA 2W3KA 3FANA 1C5ZB 3MU0A 3OX7U 5C17A 3F2GA 1C1WH 3S7KB 1HJ9A 4FVBA 1SL3A 1EZXC 2WV9A 4RI0A 3RXSA 2FS9A 1C1NA 4D7GA 2AHME 2FLRH 4CH8B 2J98B 4BNRA 1UTOA 5FX5A 4ZHMU 1KXCA 2Y80A 9LPRA 2SGFE 4ABAA 1CQQA 3A83A 3ZV8A 3H7OA 1O2UA 1YPHC 1UJ1A 1A5GH 1ZHRA 2BDAA 1ZPZA 3ZZ7A 3SJ9A 1HYLA 1XKBC 3ZZAA 5A0BA 2BD2A 2QF0A 1Z8RA 4Y8YA 3M7TA 4ABBA 1AKSA 1DVAH 4ISHH 2ZPRA 3UOUA 2EC9H 4NG9H 4Y6DA 1TGBA 3VB4A 1OYQA 1HAXB 5DP6A 2CHAC 3GY2A 3TK9A 3BN9A 3GCNA 1UVSH 1QNJA 2BDIA 1XUHA 2EEKA 1BDAA 3UQVA 1S83A 3SU6A 3VXEH 1C2IA 1DXPA 1BUIA 3M7UA 3KIDU 2WZQA 3E3TA 2NU4E 4DVAU 5A09A 4YT7H 3QDZB 4NFEA 4U32A 1Y5BT 3MU5A 3MMGA 1UTJA 3TK6A 5GWZA 5LPFA 1EZUC 2CF8H 1OYTH 1HV7A 1FNIA 3ATLA 5DP5A 1HB0B 1GBEA 2WUCA 2W6JD 4ABGA 3TGKE 1C1VH 4IGDA 2W5EA 2J4IA 1O5BB 3GYLB 2JJ1D 3PTNA 2VH0A 3ZZCA 4AX9H 1SGDE 1N1LA 5A8YA 1NZQH 4R0IA 1WUNH 1DPOA 5I46H 3FN8A 4LXBH 2XC5A 5EJ1A 1YLCA 1Y3WA 3VG8A 1W3CA 3RC5A 2BY9X 1NRPH 2Q6GA 4B73A 4I8JA 3MNXA 4WWYA 1DWCH 5DN6D 3BTQE 3F68H 3I77A 1PYTD 1EZSC 1GMDG 1RXPA 2A4QA 3EGKH 1HAOH 4NA7A 1ANDA 1BTHH 2ZCLP 1P9UA 4OS5A 1AFQB 1Y5UT 2OXSA 1LPGB 3QK1A 1HAVA 1GCDA 1ZTLA 1SGNE 2V35A 1ZGIA 2F9NA 1G3DA 3VFEA 1Y8TA 2NU0E 3K2UA 3P8GA 5EG4A 1Y3VA 2Z9GA 4HI3A 2ZQ2A 2ZHFH 1SGYE 1KLJH 1QB9A 1D4PB 1ZRKA 1AWFH 1NFWA 2A1DB 6GCHF 1GI4A 2I6SA 1C2HA 4BAHB 4Y71A 2ZTYA 2C93B 1F5RA 1CBWC 5F6MA 3D49H 3ZZBA 4MPVA 3U1IB 1AFEH 1NRQH 1BRUP 5EPYA 2P8OB 3DFLA 1TBRH 4Q63A 1ORFA 4O3TA 1EPTB 1PPEE 2RA0A 2FTLE 4LZ1H 2G8TA 2H6MA 1DT2A 1S6FA 1NFUA 1MU6B 1BJUA 2J92A 4TYDA 2XRCA 4YZUA 3PROA 5FHTA 1GDUA 3T27A 4GUXA 2JJ2D 4NSYA 3ODDA 1G9IE 1UVTH 4X1PU 2TBSA 1VR1H 1P02A 2LPRA 1X7AC 3EE7A 4K1TA 1IQMA 2M5TA 5E2OA 3P17H 1BRAA 2FI5E 2O8UA 1MTSA 3AK5A 4Y10E 1THRH 2QAAA 1GBHA 2XCNA 1RIWB 1QQ4A 1IQHA 2Q1JA 4MVNA 3T29A 5LPEA 1ZR0A 3RDZA 4AN7A 3MHWU 4K1SA 3DCLA 2EA3A 1OWIA 1FN6A 1AVXA 1EX3A 2Z3DA
chains in the Genus database with same CATH topology
2NU3E 1IQJA 1GBLA 3SGAE 2A31A 1TOMH 1W12U 4AGJA 5DGJA 5G4BA 1C2MA 2QYIA 2PWXA 4X1NU 1CBWB 1V3XA 2VIQA 4H42U 4O03A 1V2VT 2TIOA 1EPTA 3E16B 2O8LA 2WPLS 2ZU5A 1UMAH 4CR9A 1K1IA 1O37A 7KMEH 2W3IA 1OPHB 2XC4A 1N6XA 4K8YA 3BTME 2GDDA 4WXVA 3MH7A 1BIOA 1TGCA 2HWLB 4E7RG 2ASUB 1FXYA 2Y7ZA 1XUIA 4KKDA 3QLPH 1SGQE 1C2GA 4I32A 5GCHG 1TX6A 2ZG0H 1C9PA 1TOCB 2AFQB 4UFDH 2ZO3H 5HM2A 2A2QH 3O8BA 5C5NA 1E35B 1IAUA 5C2ZA 1TLDA 3OY5U 1ZSLA 1SBWA 1TNGA 4AB9A 1C5QA 4CRGA 3KHVA 1C2JA 5FBIA 3JZ2B 1QL9A 2SGQE 1TPAE 1ELFA 4OS2A 4AYVB 1FONA 2ODYB 2W7SA 5JBBS 3RM2H 1LVOA 2R9PA 4I8KA 1SR5C 2Q6FA 5L2YH 1OWDA 3A8AA 3EDXB 1GI0A 2Z7FE 3KL6A 1AN1E 1O3PB 1O3JA 5L30H 2ZC9H 2AERH 4QT8C 3V12A 1W8BH 3GCTF 1NS3A 2Z3EA 2F83A 3Q3KA 3LC5A 4X8TH 3BF6H 1C4V2 1SGFA 1PQAA 3SOSA 2AGEX 3ZVEA 1CHGA 3ATIA 5L6NH 4KP0A 1HUTH 1FAXA 4O97A 4M7GA 4HGCA 3GDUA 1LVMA 3VPKA 1RRKA 1D3DB 3SW2B 1KXEA 2ZECA 3BG4B 4CR5A 1SOTA 1A2CH 2B0FA 3LGWA 2NU2E 3K6YA 2SFAA 4K3JA 1SGRE 3LKWA 5EOKA 3E0NB 3EA8A 2ODQA 5LPRA 1GBCA 1O2KA 2HRVA 1TRYA 2V6NA 4JZDH 4GLYA 1Q31A 2ANWA 1KXBA 1A5IA 1ZMLA 1F0RA 2ZDAH 4DOQA 2A7CA 1SMFE 2FOHA 3T26A 2QXHA 4ZAEA 4FUGA 1AZ8A 1YP9A 1GHBF 2ANMH 1YLDA 3SJOA 4AOQA 2A2XH 2DE9A 1CO7E 1KDQB 3TJOA 4D9QA 1ZTKA 4KTCA 4HTCH 3W95A 3ZZ9A 4K5ZA 4NZLA 1VITH 3ZV9A 1P04A 3QWCH 1QJ1B 1Z1JA 1O3CA 5AF9H 3PV4A 4B2AA 3EAJA 1O3MA 3CS7A 1HAIH 3D23A 2ZFSA 4A5TS 5C1XA 1ETTH 1MMJN 1OWHA 1ABIH 2I6QA 1UHBB 1V2QT 1B0EA 2XBWA 5C5OA 2FM2A 3CS0A 8ESTE 1O2WA 3NWUA 4B74A 3N7OA 2P16A 1C2DA 1Y3XA 1Y5AT 4XDEA 1N8OB 1YC0A 2R0LA 1D3QB 5HMAA 1Z8GA 3M5MA 4XFQA 1PQ8A 6LPRA 5B6OA 1TAWA 2QXIA 3A80A 2P8OC 4XOJA 2SNWA 3RLYH 3HKJB 1C5XB 2BD9A 1TRMA 1O5CB 3PB1E 1FLEE 1GVLA 2FTMA 2VIDA 2P3TB 1P01A 3STJA 3TH3H 3C27B 3GOVB 1V2WT 3AASA 3A7XA 3GY4A 1O3LA 3NUMA 1GJ5H 1VCQA 4ZXYH 1CSOE 1CU1A 1LDTT 1C1SA 1NFYA 3PMBB 2ZU3A 3UPEA 1DOJA 2PSXA 1HGTH 3FVFB 2FI4E 3VXFH 1LPZB 4ABHA 4NIXA 6GCHG 1FN8A 3VB6A 4X0WU 2JH6D 2AS9A 1ELGA 4Y7AA 3RXFA 1FIZA 3UUZA 2FO9A 2PUQH 4AGKA 5DKMA 3QGNB 1O3NA 3U8OH 1AB9C 1MTWA 3SNDA 1DWDH 3C1KA 2GV7A 1VJ9U 2ZFFH 1YCPH 4FU9A 4Q7XA 4INLA 4BTUB 1NU7B 1MBMA 3RXHA 2TGDA 1BBRK 2BD4A 5FAHA 4ISOA 3SV7A 1CT4E 2XWBI 2SGDE 4H6TA 4NZQA 3LIWA 1NO9H 3T2NA 4BAOB 1GHBG 3ZYDA 1ESAA 4FUIA 2CF9H 3TLOA 6ESTA 2C8WB 1LKAA 2BLWA 1NROH 1ZMJA 2KAIA 4WMFA 1THPB 1HXFH 2ZU2A 3HGNA 3V13A 5GJ4B 1V2NT 1WQSA 1O2LA 2Z9IA 4UD9H 2HNTE 3RU4D 5BRRE 3GY6A 2QA9E 2FOCA 4JCNA 5ESTE 4RN6A 5CHAB 4U30A 6CHAB 5EXNA 3GY5A 5EXLA 3ZVBA 2R2MB 1O38A 2O8MA 1SLUB 1JBUH 2FOMB 4I33A 3BTKE 1L0ZA 2IOTA 1S82A 3T62A 3M3SA 1OP0A 2B9LA 3UTUH 5DG6A 3SBKA 1IQFA 3ITIA 4YO9A 1WAYB 4NWLA 5K0HA 1S5SA 1IQIA 1ANEA 4FVDA 3TITA 1OP8A 1V2RT 4WY3A 5JBAS 5AFYH 2QCYA 3UY9A 1O2OA 4AFSA 5EQRA 1GPZA 2PUXB 3LH3A 1GGDC 4CH2B 1HLTH 3P70B 4Y8XA 1BMLA 2BD5A 2BX4A 2HPQH 4LOYH 1A7SA 4X6NA 4IN2A 1GJ8B 2WYGA 4X8SH 3RXOA 1UTQA 2C4FH 4GVUA 1NM6A 3BV9B 4YLUA 1QR3E 2BVSH 2FMJA 3ATKA 1C4Y2 2ZEBA 2A4RA 1BHXF 2FOFA 2QXJA 3GY7A 2RG3A 5DJ7A 1C2LA 2BDBA 1DX5M 2KAIB 1AUTC 4THNH 3RUOA 1Y59T 1QA0A 3F1SB 4GHTA 4VGCB 4IC5A 1S0RA 1IQNA 4GCHF 3NK8A 4MDSA 1C5MD 3FP8E 4ZROA 1P2KA 5CHAC 3MWIU 6CHAC 5C1YA 3SUDA 4Y0YE 3I29A 3RU4E 1EAXA 4DIIH 2FZZA 2WPIS 3K65B 3BEFB 5I25A 1JXPA 3UWJH 2GCTB 1F5KU 1TMBH 4Z0KA 4U2WA 2BD8A 1GJAB 2YNAA 2J38A 2UWLA 1O2RA 4MTBA 5A0CA 2CGAA 3SJKA 1HAHH 4K2YA 1L4ZA 3AW0A 1NN6A 1BJVA 1GBAA 3RU4T 3OSYA 1YPKH 3SV2H 5DP8A 5E8EH 1ZJDA 1TA6A 2OBOA 5T6GA 1XUJA 2BD3A 5FPSA 1UCYE 1FY3A 1KTSB 4DCDA 2XTTB 1TGSZ 1BTZA 7ESTE 4XBCA 2P94A 3OY6U 4TY6A 3HKIB 7LPRA 1L2EA 4AG1A 2BTCE 1ELDE 2FP7B 1C5VA 4OGYA 1QL7A 3MNSA 1GJCB 2C8XB 4A1XA 1O3BA 1SVPA 4XBBA 2Z9LA 3PM3A 4Q2KA 1Y3YA 1C4U2 3A86A 1SQAA 2PTCE 4D8NA 2BX3A 3LPRA 1C5OH 4ZKOU 4YLQH 2FIRH 2ZDLA 1FMGA 3ELAH 1QB1A 2OUAA 1EXFA 1XMNB 1LVBA 1VGCB 3TNSA 1O36A 2ANKH 2ZIQH 1MD8A 2FXRA 3LT3A 1GMDF 4MPWA 1WCZA 4AFQA 5TCCA 5EW2H 2P3FH 1O2MA 4VGCC 2A4OA 1O39A 1O5FH 1P12E 2VGCB 3GDSA 3U8RH 3MTYA 1DY9A 1MKXH 1GDNA 1TNJA 2GVFA 2QV1A 3ODFA 1V6DA 1KDQA 4O3UA 3E90B 3LGUA 5A2MH 3SHCH 2F91A 1BBRE 3UNRA 1F5LA 8GCHF 3F9GA 4UONA 3EA9A 1LTOA 8LPRA 1OSSA 1DANH 1EQ9A 4I31A 4NCYA 1YCPK 1L4DA 4MNXA 1J8AA 2AH4X 1W0ZU 2CJIA 1GBMA 2BYAX 4I8GA 5DP3A 2IN2A 2B7DH 4J1YA 1CA0B 4J2YB 1DFPA 4HFPB 4FUHA 1VITF 5C20A 2ZHWH 3EA7A 1WQVH 1CHOF 3SV8A 1TNIA 3Q00A 1XUFA 2ZGHA 1TMUH 1A4WH 1CHOG 1MKXK 1O2VA 2PR3A 3LJJA 2YNBA 1AHTH 4AG2A 1C5RA 3QO6A 1ZOMA 1HNEE 1O3EA 1YBWA 4U01A 3M61U 1GHXH 3BSQA 2WV4A 3M5OA 1MZDA 2JH0D 1SGPE 1QJ6B 2WV5A 1GBBA 1C2FA 1F7ZA 1GI1A 4DJZB 2D2DA 1O3FA 1O5AB 1K1MA 1F92A 1P10A 1QURH 2BD7A 2Y6TA 4RKOB 2ZU1A 2V0BA 3D62A 3U9AH 1TBQH 2OINA 3PMHB 2FS8A 4PROA 3RXCA 2A5IA 1W14U 1NPMA 3B9FH 1OOKB 3Q3XA 1JWTA 3P6ZB 1EUFA 7GCHG 1U6QA 1ZLRA 2ESTE 2G52A 3MNBA 5JB9S 3ZVGA 4H4FA 5DP4A 4NA9H 4YTAA 1JRTA 1XM1A 2FOBA 1UVOA 1L1JA 3I78A 1KTTB 4NA8A 1HXEH 1E0FD 3GCOA 1G36A 1K2I1 1QTFA 3U8TH 5FCRA 4WMEA 3QZQA 3RMMH 1AI8H 1S85A 2P93A 1E36B 1EJMA 2PW8H 2BXUH 2BQWB 5FBEA 1MU8B 1SPJA 4MNVA 4JYTA 1INCA 2TGAA 3P95A 3P8FA 1BTUA 3IG6B 2QGRA 5J4SA 1BTXA 1LQDB 1TYNA 1AFQC 1O2SA 1YCPM 2BZ6H 2Q6DA 4FUBA 3BTGE 3SNAA 3NCLA 3LH1A 1RJXB 3BTEE 3KF2A 2ILNA 1O32A 3PO1B 2OQUA 2BHGA 1E37B 1D9IA 1JOUB 2BZAA 5EQSA 5K7RA 1QQUA 3RXJA 1AY6H 2V3OH 2A5AA 1K22H 1IQGA 1J15A 5IDKA 1O5GH 4B76A 3BEUA 2BDYA 1G3EA 1RTLA 2ZTZA 2A45B 1QRWA 3PLBA 1KY9A 3SO3A 1SHYA 3PLKA 1C1RA 1EKBB 3QUMP 2BVRH 3SGQE 2ODPA 2ZKSA 3PWBA 1MUEB 1YPLH 1QBNA 5JPMH 2A32A 3CENA 1DDJA 1M9UA 1OWEA 2G4TA 1DLKB 1B0FA 3F6UH 5TJXA 1FV9A 1C5WB 4Y79A 1UO6A 5GIBA 1MCTA 2ZPQA 3BTTE 2BY5X 1HDTH 4DIHH 1HJAC 1SFQB 1A3BH 2Y81A 2DUCA 2VNTA 3PTBA 4ZKNU 2HALA 3KGPA 3SU5A 1T8NA 2OC7A 3SJIA 2XNIA 1TB6H 3SUEA 5E2PA 3QN7A 3H5CB 1SFIA 1W7GH 1P57B 3GCHB 1GHYH 1GVKB 2PFEA 1ZSJA 1LCYA 2VIWA 4CHAB 1AQ7A 3PO1C 4JK5A 4WH8A 3U69H 1A46H 1V2PT 4Z6AH 1YPMH 1K1LA 1W2KH 2TPIZ 2ZCHP 1FPHH 1NRRH 1BHXB 1TONA 2H5DA 2UUKB 1XVOA 1S6HA 1W11U 2VINA 3RMNH 3TJUA 4X2YA 3OYPA 2ZQ1A 2ZF0H 3ZZ6A 5DP7A 3RXQA 1DY8A 2CXVA 3RXVA 2BXTH 4X1QU 1WSSH 3A7YA 4BXWA 1WOFA 1HIAA 1A1RA 4WMDA 1A0JA 1S84A 3A8CA 1YGCH 1PPCE 2HPPH 1BZXE 5JB8S 1JIRA 1HCGA 1NY22 4JMYA 2PGQB 5DK1A 2PHBA 1H1BA 1HAYB 2AGIX 1F2SE 1GI5A 3L3TA 1AGJA 5FXLA 1DITH 4BTTB 3A82A 1C5TA 1DM4B 3IITA 2G51A 4ABFA 1TNHA 3B8JA 4X2WA 3BTDE 3MFJA 3SUFA 4B71A 4Y8ZA 2IPHA 3FP7E 1SG8B 4OS7A 3RM0H 1AB9B 4FUCA 3GCTG 4Q7YA 1QHRB 4RSPA 3AVZA 2PTNA 2ZFQH 2ZHDA 4MNWA 4X6OA 3TGJE 1MH0A 4X2VA 4HZHA 5ESBA 1GBFA 1D3PB 1QA7A 1TGTA 2Z6BD 2J34A 1A3EH 1KXFA 2F9UA 3DD2H 2GP9B 4I8HA 2K1QA 5EXMA 2P59A 1D3TB 1OXGA 2ZGBH 1C5LH 1FUJA 1GBKA 1Z6JH 2GDEH 4YOGA 3S69A 2FEQH 1W7XH 4JZFH 3BIVH 1SLVB 1ETSH 3SQEE 1ELVA 1L1GA 1VITG 1C1QA 5BPEA 1TFXA 1W13U 3T5FH 4ZKRU 4KGAA 1D6RA 1H9LB 3LGTA 2BQ7B 3RXBA 1GG6C 2STAE 4Y11E 2WINI 1GHAG 1IOEA 1TA2A 4FUEA 1BOQA 1H8DH 1O35A 1O2JA 3ZVCA 3GYMA 4FUJA 2GCHF 2VIPA 2EI7A 1V2TT 1DUEA 4MNYA 4A92A 4KELA 3A7VA 4XSKU 2FI3E 5ETXA 1QIXB 1AVGH 2C3SA 2FODA 1P2QA 3ZZ3A 2RA3A 2QN5T 2CN0H 1BCUH 3UNQA 4FXGH 1RFNA 4SGBE 4BANB 1RIWC 2AIQA 2G4UA 1Y3UA 2V3HH 1GL0E 1PPBH 3VGCB 1E38B 2OC8A 2H9EH 2GV6A 1GI7B 3SU0A 1V2JT 1FQ3A 3AW1A 3S9BA 1GI3A 1O30A 5DPAA 3RXIA 2PKAA 2WPMS 2SGAA 2O9QA 1LHDH 2GZ8A 1GI6A 2VB0A 1PQ7A 3T28A 4BAKB 2Z3CA 1IQKA 4A1TA 3E8LA 5J4QA 1CE5A 3ATWA 2OD3B 1TPSA 2ZGCA 4X1SU 1LPKB 1QL8A 4SGAE 3UOPA 5AHGH 3NXPA 2BLVA 2J94A 1SI5H 1GJ4H 1GG6B 1UTMA 3TVJB 2SNVA 1PFXC 1YPGH 4Q80A 4FU7A 3LONA 3T25A 1O3OA 3MI4A 2PGBB 4B2BA 1P05A 4ABDA 2OP9A 1MZAA 1GI2A 9ESTA 2FWWA 1BA8B 1KYNA 1K28D 1MAXA 5AVDA 1V2MT 1XVMA 1RD3B 2ZHEH 1MAYA 1ZJKA 1EAWA 3RC6A 2UWPA 3ENSB 1T8OA 3EE0B 3ZVDA 1LHCH 2OBQA 1MQ5A 1O3HA 1TX7A 4IBLH 1OWJA 1QRXA 1C5PA 3D65E 5EQQA 3MYWA 3GDVA 4B2CA 1UTPA 4X2XA 4E7NA 4CHAC 5AFZH 2BM2A 4JZEH 3L33A 3CP7A 1ETRH 2WPJS 1PPZA 1ID5H 1G32B 3B23B 1T32A 3MU8A 5E0HA 5DP9A 3A8DA 1GJ6A 5PTPA 1BTWA 1GWAA 4NIWA 4B1TA 4DG4A 1T7CA 3ZZ4A 1RS0A 2BVXH 3QX5H 3GY3A 1Q3XA 5C1UA 4TWWA 1ZMNA 3S0NA 3SGBE 3TH2H 1DWBH 5SGAE 2ZGJA