4XOJA

Structure of bovine trypsin in complex with analogues of sunflower inhibitor 1 (sfti-1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Investigation of Serine-Proteinase-Catalyzed Peptide Splicing in Analogues of Sunflower Trypsin Inhibitor 1 (SFTI-1).
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA02
1VCPA 3PMJA 1UCYE 2J9NA 4I8LA 3MU4A 2J2UA 3A7VA 3BTFE 4CH8B 3SNBA 4Q7ZA 1G9IE 3OYPA 4E7RG 1Q2WA 1UCYK 3NWUA 1NRRH 3BTKE 3ZZDA 2FDAA 3RXJA 1P2KA 1C1QA 4B2CA 2G52A 1OP0A 4NIYA 1TPOA 1ZMJA 1MCTA 3O8BA 4Q7YA 1O35A 2PW8H 4NCYA 1GMCG 1DWDH 1TNJA 1WCZA 1VITH 2VIVA 1KXCA 1O2OA 1C5LH 1GDNA 5FX6A 2GZ9A 4A7IB 2BDAA 3TK6A 1OYTH 2GMTC 4YM9A 1W10U 2FI4E 3U69H 1O0DH 1BTXA 4YLQH 3T2NA 1SQTA 2BOKA 1O2IA 1VR1H 1P57B 1AVGH 2AGIX 1YLDA 1C9PA 4WY3A 3RXUA 1C5UA 1FV9A 1BMLA 1C5YB 4X2VA 4KKDA 1Z6JH 2GV7A 1FY8E 3SV8A 5LPRA 1OWKA 1UVOA 1RTKA 3ZVGA 4BXSA 1EB1H 3JZ2B 7KMEH 1RIWC 4FUEA 1YCPH 3MU8A 5I25A 5L2YH 1YPHE 1HIAA 3QWCH 1NRSH 3MH5A 1TRYA 1IQIA 1LPZB 3RMNH 1O2PA 3GICB 1J9CH 1C5VA 1CO7E 5DJ7A 2VH0A 2Z9JA 2ZO3H 3M5MA 4OS2A 1T8MA 1F0UA 1O3LA 2K1QA 2F3CE 4GCHG 1MQ5A 2XBVA 3LGYA 2FESH 5EPYA 3BEUA 2QXIA 5HGGA 4K1EA 1B0EA 1GBIA 1SGFG 3MO3A 3GOVB 4K3JA 3RM2H 1Q31A 1GI9B 2UUKB 4AG2A 1WOFA 3M7UA 5C1XA 4H42U 1JWTA 4JCNA 1IOEA 2ZTXA 2OBQA 3QK1A 4AN7A 1TNGA 1SLUB 1TGNA 3QN7A 1O2SA 4ABEA 6ESTA 2VVCA 3L6PA 3LU9B 1S85A 5FPSA 4Z0KA 1P8VC 5LGOA 3FZDA 3SU0A 1JBUH 3F9HA 3VGCC 2ANMH 5E0HA 1NROH 2O8TA 1G3CA 2OC1A 2QXHA 1NESE 2HVXA 3S7KB 2V0BA 1BIOA 1OPHB 5E2PA 2BLWA 5ABWA 1LKAA 2A7HA 2PUQH 4Z6AH 5C67A 5A0CA 1AHTH 3D49H 1P03A 2GDEH 1TX7A 3KQBA 1ANBA 4JK5A 2TIOA 1WUNH 1HDTH 4NA9H 2ZDKA 1O3CA 1YPJH 2EEKA 2G55A 2ZWLH 3BEFB 1MTNC 4AOQA 2JETB 1FMGA 1LHFH 1MD7A 1O3FA 3LJJA 4WXIA 1Y5UT 1DY9A 1UK3A 4XBCA 1RD3B 3M35A 4GHQA 3E90B 2VWOA 3L3TA 1T4VH 1TABE 1UMAH 1TAWA 5ETXA 1WQSA 1GGDB 2ZU1A 1ELVA 5BPEA 3SU3A 1K28D 2Q6GA 1C5SA 3GDVA 3SUEA 3TH2H 4FU8A 1EKBB 4UE7H 1QB9A 1Z8IB 1YP9A 1RTLA 4CBOA 2ODPA 1TYNA 3BTDE 3DFLA 2W3KA 5FX5A 5B6OA 4KTSA 2G5NA 3P8OA 4NGAH 4X6PA 1AO5A 2UWOA 1E35B 2FYQA 1Z8RA 1ELFA 2GZ7A 3HKIB 1NFYA 2VNTA 4X2XA 1O36A 1GJ7B 1P2IA 1WSSH 8LPRA 3P8GA 1BCUH 1XUIA 3BTGE 2A5IA 2FO9A 3SUFA 1TPAE 4BAKB 3BIUH 1JIMA 4JMYA 1QRZA 4MPUA 2H5CA 5JPMH 2VWLA 5DP3A 5DP9A 3K6YA 3GCOA 2B8OH 3KHVA 3MMGA 2FX4A 1ETRH 2H9EH 1FI8A 3SNCA 1CA0C 4R0IA 2ANKH 3ZVFA 5DO4H 4CBNA 1GBCA 1ELEE 5DPAA 1EASA 1EJNA 1CU1A 1K1PA 4RKJB 1FIZA 4A1XA 5E2OA 4ASHA 1FN8A 4PROA 4X6MA 3QO6A 1BRBE 4YLUA 4ZXYH 2P3UB 4GUXA 3SUGA 1K1OA 5F8XA 4RN6A 1DUEA 2BD9A 1QNJA 1GI0A 2BZ6H 1ELTA 2C3SA 1OWJA 1O2GH 1HCGA 1DWEH 1GI2A 1AIXH 1LCYA 1UVTH 3PWBA 2ZTYA 3A8BA 1EAUA 1MKWH 3EA8A 2Y5FA 1QA0A 2C8ZB 3O8CA 4Y6DA 1O3HA 3SU6A 1ZRBA 2W7SA 2Y81A 1N8OC 3T26A 3A7TA 1MMJN 5LPEA 1BBRE 2DE8A 4DIIH 1DY8A 1HAYB 1SB1H 5DG6A 4Y0ZE 3ZZ8A 1E38B 2BHGA 1BBRK 2JH6D 5EODA 9LPRA 1QB6A 4D7GA 1O2HA 2ZDNA 3E0PB 1BQYA 2ILNA 4B71A 3M61U 1SOZA 2CHAB 5F03A 1XUJA 4THNH 4Y7BA 1CGIE 1S6HA 2VVUA 2QAAA 1OP8A 5EG4A 1TFXA 2ZIQH 2O8WA 1C1MA 4XSKU 1GBFA 2ZGXH 1M9UA 2OP9A 1XM1A 2PSYA 4FUCA 3L33A 1UTJA 4BOHA 1L4DA 1SOTA 3R3GB 2ZU5A 1GDUA 1IHTH 2FS8A 1KDQB 3SOSA 2GCHG 1KYNA 4KGAA 1EPTC 4D7FA 1EZUC 4WVPE 3ZZBA 1NU9A 1GJCB 1MTSA 1AWHB 2FTMA 1AFEH 1ZSLA 3KN2A 4CR5A 3UPEA 1ELAA 1E34B 4ZKOU 1C1VH 1GMCF 2FMJA 2Y80A 1XUGA 1OP2A 3JZ1B 2ZPRA 3RXCA 4HI3A 1F5RA 1AB9C 4GSOA 1A5GH 1TMUH 3PO1B 4B1TA 4FUIA 3E6PH 1KLJH 3U98H 1NTPA 2HNTC 3FZZA 1KDQA 2SGAA 1HPGA 1W12U 2XC0A 2QY0B 3E0NB 3UR6A 1C2DA 4AG1A 1NFXA 2NU3E 5AFYH 1GCTC 1PPBH 1DM4B 1DLEA 1TQ7B 1RJXB 3A89A 2C4FH 1B5GH 3RXEA 4AB9A 3ATWA 1C9TA 2O9QA 4OS1A 4Q2KA 2HPPH 1BB0B 1C1SA 3O8DA 2ZHWH 1C2JA 1JRSA 1V2PT 1Y8TA 1O5AB 1EJAA 1LVYA 1ZHRA 2XC5A 1IAUA 4ESTE 1AFQC 1GVLA 2ODQA 1AY6H 1UVPA 2O8UA 3MTYA 3B9FH 2BQWB 3LGVA 3PLKA 3NCLA 1YPKH 1V2ST 2AH4X 2QYIA 4CRCA 1EX3A 4DVAU 1UK2A 2VU8E 1W11U 4AFUA 1MUEB 3QGNB 2FIRH 5GCHG 2AGEX 1GL1A 1KLTA 4JZEH 4GCHF 1SGIB 1DVAH 2OD3B 4WWYA 5HYOA 3GY5A 4NSVA 2SGPE 2VWNA 1K1NA 4MNXA 4I8HA 3KCGH 1PPFE 2RDLA 3DT0H 3W94A 1Y3YA 3ZZ5A 1O2JA 3PLBA 1ESAA 1S0QA 3SJ9A 1IQJA 2LPRA 1XVOA 2ZFSA 3MNXA 2F83A 3PWCA 4ABGA 1HAXB 1J15A 4NA8A 3Q3XA 2H6MA 5DGJA 2NWNA 2EC9H 2TGAA 1W13U 4BAOB 5GDSH 4FUFA 8ESTE 1QFKH 2FX6A 1MU6B 3QGJA 2RA0A 3QZQA 1FY5A 1Z6EA 4UFFH 3S9CA 2ZF0H 2XTTB 2G81E 3Q77A 5EQQA 4NFFA 3PMHB 2SGEE 5GPIB 1HBTH 5A8YA 1PYTC 2WYJA 5C20A 1F92A 1A5HA 1RXPA 1SHYA 1Z8JB 4DOQA 3MO9A 1F0TA 2VGCB 4ABBA 1J8AA 4MNYA 1QRXA 4TYDA 3U8RH 2A7JA 2BY7X 4Y0YE 3AW0A 4Q80A 4WXVA 1GDQA 2QA9E 2GTBA 4BAHB 1DXWA 1ZSKA 1ANDA 4H6SB 1NPMA 1EZSC 3AAUA 5AFZH 1HAPH 2WPJS 1EAIA 3RXHA 4H6TA 2NU4E 2I6SA 3E16B 4NA7A 4ISLA 1KTTB 3MU1A 4ABDA 1WU1A 1TPSA 2OBOA 4AYVB 5HM9A 1TLDA 3MNBA 2ZFPH 4DURA 1S84A 3PB1E 1SGPE 3T5FH 1ZSJA 4NZLA 4J2YB 3UIRA 5T6FA 4LZ1H 3SV6A 5T3HA 2ZHQH 4ZUHA 2FLRH 1TA2A 2BM2A 2PV9B 5EXLA 2FTLE 1GHZA 4X1QU 1NRQH 4BTUB 3RC6A 2PR3A 1DSTA 5FCRA 5GXPA 3MHWU 3EGKH 1C5PA 2HALA 3EDXB 3E8LA 1O5FH 1O34A 4ZKSU 2P95A 5C5OA 3ZVBA 5EGMA 1A7SA 2H9TH 3SNDA 1O3MA 1LPGB 1QJ6B 1ZLRA 1HAIH 2OC8A 3LONA 3K65B 1TBZH 6CHAC 3A82A 3ZZ6A 4NSYA 1WYKA 2R9PA 4NIXA 3ZZ3A 1QY6A 2FLBH 3VB7A 4IGDA 2ZHDA 1S82A 4FXGH 3SU1A 1MCVA 1TNLA 3SV7A 2FP7B 1TWXB 4AFQA 2EI8A 2Z94A 3ZZAA 3TNTA 1ARCA 3A88A 4MPXA 3U9AH 3T27A 3F9FA 1GBKA 1QBOA 5J4QA 4Y11E 1DPOA 4DY7B 1O5GH 4UDWH 1YF4A 1O2MA 2Z9GA 4UONA 3MH4A 1CHOG 1FN6A 2XBWA 1CBWC 3LKWA 2BLOA 2P94A 3HGPA 2PKAB 4OS5A 3KQDA 2HRVA 3B8JA 2GCTC 1O3AA 2PGBB 3UTUH 1DITH 2FOBA 2OTVA 4A1VA 5F6MA 1S6FA 4GHTA 3FP7E 1QBVH 5ESTE 4MTBA 1ZPZA 4OS7A 1L1JA 1C1TA 1HIAB 1ELCA 1O3PB 1IQHA 1UVSH 2D1JA 4YOGA 1P02A 1LQEA 1L0ZA 3RXFA 1EB2A 5A8ZA 1DOJA 3WY8A 3TIUA 1ZZZA 1DLKB 1W7XH 1ZR0A 1GI4A 1FQ3A 1F2SE 4XBDA 1S83A 3M3VA 1O2WA 2GDDA 5K7RA 1GBHA 1K2I1 4X8UH 4AYYB 2PKAA 1YPEH 3MOCA 5AHGH 3SO3A 5F8ZA 1SI5H 1C1WH 2G5VA 4UFGH 1H8IH 1MU8B 1TBRH 3SNEA 1OXGA 1O2ZA 3TGIE 1DFPA 1A46H 1BRCE 1OX1A 2ZU2A 1GBLA 4LZ4B 4ISOA 4I31A 1D9IA 3M37A 3SORA 3CENA 3NK8A 4K1SA 4NIWA 1CSOE 3SJIA 1GJ5H 2TBSA 3T29A 3SZNA 1TQ0B 3SW2B 3GCHC 1P09A 1N1LA 1UO6A 1ESBA 1ZPCA 1C5ZB 3H7OA 4I8GA 2W3IA 1T4UH 5A0AE 2QF3A 4F49A 3I78A 1MD8A 3SN8A 2PKSB 1E37B 3R0FA 2TPIZ 3LJOA 3NZIA 4DG4A 1IQLA 2PUXB 1HAOH 2GCHF 4GPGA 5FBEA 2Y5GA 4Y8XA 2ZGHA 1CQQA 1QIXB 3C27B 1FY4A 2AIQA 4AGKA 4ABHA 2TGPZ 1MBMA 1GBAA 3A7XA 1EAWA 4LXBH 3LDXH 2WINI 2QXGA 2OC0A 1P2QA 1ZJKA 3VB3A 3LGUA 3MU5A 1ELGA 3BG8A 2BYAX 2THFB 3SUDA 1TE0A 1K1LA 1G2MA 5LPFA 1ZOMA 2ZNKH 1NS3A 3LH1A 1FJSA 2OLGA 5G4BA 1ZJDA 1BZXE 2F91A 1AVXA 1A61H 4ZHAA 1ID5H 2GMTB 2WPMS 1BRAA 3QTOH 1P04A 1PPCE 2R2MB 1O5DH 3AVZA 5PTPA 4DT7B 2XC4A 1GG6C 2B7DH 4X6OA 4AGJA 5JB9S 8KME2 2RA3A 3SQEE 1OWDA 3BTME 1HXEH 2QC2A 2SGFE 3A8CA 1TX8A 1GJ4H 4IS5A 3HKJB 1P3CA 5IYTA 5E0GA 1SLWB 1O2XA 3VB5A 4FU7A 2ZFTA 1DSUA 1MAYA 1MTWA 1YCPM 3GISB 2AERH 3S9AA 2Q6FA 1O3IA 2H1UA 1YCPK 3M5NA 3P92A 1A4WH 1RIWB 2FOAA 3F1SB 1GHAG 4ZMAH 1YGCH 1D3TB 3GY4A 2F9UA 2ASUB 2Y5HA 2Z3EA 1FAKH 1T7CA 3KQCA 1GBEA 3VPKA 1B7XB 1CHGA 2UWPA 1ZMLA 2ZHEH 3ATKA 1SVPA 3RC4A 1NRNH 3ZV8A 3ELAH 1GBBA 4MQAA 1MKXK 5GCHF 3VFEA 3GCTG 3TNSA 2A4OA 4ISNA 4IW4E 2XBYA 2FZZA 3ENSB 2ANYA 3PTBA 3TITA 1HUTH 2RG3A 2C8XB 1XX9A 2IN2A 1V2WT 3F9EA 4X8TH 5CHAC 1N6YA 4JZ1A 1G37A 1QJ7B 3GDUA 1AKSB 2R0KA 4MDSA 1EP5A 3V12A 5DK1A 1O39A 2VB0A 1QQUA 3UNQA 3LIWA 1Z8GA 2PTCE 3ESTA 2V3HH 1O32A 5CE1A 2BQ6B 4B76A 1WV7H 1C1PA 4BAQB 1HAVA 1TBQH 2BX4A 4SGAE 3PTNA 1P06A 1W0YH 3TH3H 4A92A 3BG4C 3VGCB 5K0HA 2ZQ2A 4HZHA 5DP7A 3VEQB 1YKTA 5LH8A 1KIGH 1BMMH 3ATIA 4QT8C 2DUCA 2J34A 4B75A 3GY7A 1XXFA 2GT7A 4SGBE 2STAE 1TGSZ 1AKSA 1V6DA 1XUKA 4HTCH 4MPVA 3K6ZA 4K8BA 1O3OA 2ZKSA 1GVKB 1NC6A 1T8LA 4A5TS 5GJ4B 3BSQA 2EI6A 3TK9A 4AORA 5TCCA 2BOHB 4HGCA 4CR9A 4OS6A 3GY3A 1VGCC 3MH6A 2BLVA 1P9SA 1MTNB 1LDTT 2TGTA 1QR3E 3BEIB 1KXBA 1AI8H 1O3DA 2GKVE 7GCHG 1TOCB 4NZQA 1BTWA 1O5BB 5E8EH 2JH5D 4JZIA 2F9OA 2GT8A 1W3CA 1E0FD 1FONA 2PWXA 1G3BA 4CRAA 1V2TT 1NFWA 3F6UH 3SI4H 9ESTA 4WF8A 1P3EA 1WQVH 4K69A 4YESB 4K60A 1EOJA 2CF8H 2Z6BD 4VGCC 3QTVH 4I7YH 1GI5A 1LO6A 3TGKE 2G4UA 3RU4D 2J95A 3BF6H 3ZZ7A 4ABJA 3UR9A 5JB8S 1FDPA 1A0LA 1YPGH 4X1SU 4E05H 2CV3A 1QQ4A 3M3TA 1C5TA 3E3TA 4U32A 1OKXA 1HJAC 1NZQH 1ACBE 1UK4A 1T31A 2BD2A 4Y10E 1UTLM 1GMHG 1TX6A 2A5AA 4B2AA 1HAHH 3QZRA 4IN2A 2A4GA 5CMXH 2P8OC 4Y8YA 1QB1A 2ZGCA 3BN9A 1GJ8B 2PSXA 1ZTKA 3SV9A 5SGAE 4MG3A 1G2LA 1F5KU 4FVBA 2CGAA 1J14A 2BY9X 2ZCKP 3A85A 1HGTH 1CA0B 1DANH 1MTUA 2FOGA 3EYDA 1EQ9A 1P10A 1BOQA 3U1IB 3RU4E 1SGQE 4ZH8A 2ZC9H 1TONA 1YPMH 1GHVH 1C5WB 1QCPA 4Y7AA 5JBCS 1GI3A 1GJ6A 2ULLA 4JYTA 5EW1H 2BLQA 1FUJA 1P0SH 1CHOF 4GAWA 1VCQA 2W26A 4JK6A 4AX9H 1AN1E 1F0RA 3RXTA 3Q76A 2UUFB 1V2QT 1KXEA 2A4QA 1KXAA 1LHDH 1MKWK 4K1TA 3MNCA 1QBNA 1AU8A 3V3MA 6GCHG 4I8JA 4X1PU 1QGFA 3A81A 1E36B 3LPRA 2ZFFH 3RXAA 4TPYA 1H4WA 1HV7A 2G4TA 2GP9B 3ITIA 1SMFE 2ZG0H 3OY5U 5C1UA 1N8OB 3LOXA 1QJ1B 1UTKA 2STBE 3A8AA 1FNIA 1PFXC 3UNSA 2BXUH 3QDZB 4Y76A 1NT1A 2G51A 2OINA 3ZVAA 3KGPA 2F9PA 5T6GA 3S69A 5EXNA 3DA9B 4YZUA 2ZECA 1BTHH 1CT0E 5C3NA 1ELBA 3RXQA 4WJG2 3BV9B 1Z1IA 4YT6H 1GBDA 2A2XH 3UREA 3K2UA 1THSH 1MTVA 1IQFA 1Z7KA 4BNRA 1IQKA 1QL9A 3A7YA 3ZYDA 1SFIA 4D8NA 4E06H 1AE5A 1AGJA 2G8TA 2VGCC 4XOJA 2AMPA 2OC7A 4UFEH 3RXGA 2PGQB 2YNBA 4YOJA 4DW2U 1WTHD 2SNVA 3UWIA 1L1GA 1BA8B 3M3SA 1W0ZU 3ODFA 1P9UA 1GHBG 4OGXA 2IOTA 2ZHFH 4FUDA 3PMBB 4K2YA 2ODYB 1EPTB 5T6DA 1GHWH 2XRCA 4FUJA 2J94A 3RXIA 3TJUA 1BHXB 1HJ9A 2HWLB 1P12E 1C2MA 4X2WA 1BTPA 2M5TA 4TWWA 1L1NA 4CHAC 1JXPA 1BUIA 2W7UA 1XXDA 1DICA 3ZVCA 1Y5BT 1O2YA 3F9GA 1N6XA 4ISIH 5FAHA 3V7TA 3D23A 3RXOA 3RXPA 1AB9B 1MBQA 3LC5A 3TLOA 3RM0H 2YNAA 3DD2H 1C4U2 5AVDA 1PQ8A 5DKMA 1GBTA 1XVMA 1CVWH 2AS9A 1P05A 1P2JA 3GY2A 2C93B 1EPTA 1ZHMA 2ZU3A 1GCTB 5GWZA 1DDJA 1GJAB 1O2NA 1W14U 3N7OA 2DE9A 3FVFB 2R3YA 3LC3A 4BANB 1RS0A 2HNTE 1NO9H 1EAXA 1O2UA 1EXFA 1D4PB 3UQVA 1LKBA 1ABJH 1Y3UA 2GVFA 1O3JA 1H9LB 4AFSA 4CH2B 1O37A 3KQEA 1AFQB 1GHAF 2AEIH 5EU8A 1GBJA 1SGDE 3P6ZB 3SJKA 1X7AC 4ZKRU 3E91A 1TB6H 2A4RA 1QL7A 4WMFA 5IDKA 2BY6X 3M7TA 1K1MA 5L30H 1O3BA 1TPPA 2F9VA 1ZGIA 1UCYH 1HYLA 3GCTF 3U1JB 2D26C 1Y3WA 2GV6A 2Z9IA 3HPTB 4O9VA 2SFAA 1GPZA 4ISHH 4ZROA 2UUJB 1GWAA 4D9RA 4CRGA 2LNCA 3B23B 1BDAA 1BTYA 1AUJA 4E7NA 1PJPA 3Q00A 1A3EH 1TA6A 2QXJA 2Z3CA 2CMYA 3TVJB 3CS7A 2WUBA 3PM3A 2H5DA 1SSXA 2ZCLP 1LVMA 5L2ZH 1SLXB 2VH6A 2YOLA 3Q3KA 1GJ9B 3AAVA 1PYTD 3RXKA 2BDIA 5C1YA 3NUMA 2Q1JA 1ZRKA 4FVDA 2OQUA 5FPTA 1JOUB 5HMAA 4A6LA 2KAIB 5DP6A 3CS0A 1YPHC 5BRRE 3O8RA 4FUBA 4NWLA 1TMTH 2D8WA 2VVVA 3TJVA 1CT4E 1EUFA 1WAYB 1O3EA 2ZDMA 3SGBE 1YBWA 2BDBA 1GVZA 3TU7H 2AMDA 1AD8H 1V2JT 1TOMH 2Z7FE 3QUMP 1GL0E 2IJOB 1ZPBA 1GHXH 4X8SH 2PFEA 4LOYH 3RDZA 4A1TA 1IQMA 1MZDA 2OCVB 2KAIA 4CREA 2PTNA 2OQ5A 1UTQA 3MH7A 1FY1A 3C1KA 1TGTA 4MNWA 2D2DA 1P2OA 4AB8A 2HLCA 2AYWA 2ZP0H 1VJAU 4NIVA 2JKHA 4XBBA 3G01A 4U2WA 1PQ5A 1ETSH 4R8TB 2BD4A 5EOKA 1HLTH 3IWMA 4GVUA 2FEQH 4RKOB 1BJUA 3ZVDA 4NFEA 3RMMH 1GMDG 5DP8A 1NFUA 1L2EA 2QF0A 1BT7A 1UTOA 3A87A 2GD4B 1SGFA 2TRMA 1EATA 1GMHF 1SPJA 1V2MT 2GX4A 1J16A 2PHBA 1D3DB 3RXMA 3H7TA 1GHYH 1RRKA 1XUHA 1TRMA 2FXRA 2FYRA 3MO6A 5FHTA 3A84A 1XUFA 1JMOH 2BZAA 1OOKB 1KLIH 1CGJE 3SHCH 2XBXA 1A3BH 2XYAA 2VIDA 2A45B 4H4FA 3SV2H 3PV4A 1S0RA 6CHAB 5ESBA 1K22H 1ZTJA 5E0JA 1AWFH 2JETC 2FWWA 4D9QA 1CE5A 2O8LA 1U6QA 1P2MA 4J1YA 3ZV9A 4X2YA 2BY5X 3K9XB 1D3QB 3AW1A 2BMGB 4B74A 3PLPA 3TH4H 1BMNH 4F4OC 2I6QA 2QGRA 1FY3A 1GGDC 4I33A 8GCHG 1EZQA 1SBWA 4O03A 1XKAC 1ARBA 1O2RA 1O33A 2XNIA 1CGHA 2BB4A 2Z9LA 3SU4A 1PPZA 1O2KA 1MKXH 1Y3XA 2VJ1A 3HK3B 1CBWB 1Y59T 1DWCH 1K9OE 2P16A 1Y3VA 6GCHF 2GCTB 3U8TH 4JYUH 4ZAEA 2ZEBA 3RXLA 2V6NA 3PROA 4CRDA 1AUTC 3NPSA 2WPKS 4OGYA 1SGTA 3ODDA 1QA7A 3OX7U 2Y7ZA 1GI8B 2CXVA 4WMEA 1C1RA 1PQAA 1C1UH 1EJMA 1KSNA 3BIVH 5L6NH 4XFQA 1G3EA 1RGQA 3T28A 2BTCE 3RMLH 4XDEA 3E1XB 4O97A 3EA7A 1W8BH 1NN6A 4TWYA 1SG8B 4YO9A 1ORFA 2ZGBH 1F5LA 1KXFA 7ESTE 3GYMA 1SL3A 1ESTA 1YYY1 5FPYA 2ZA5A 3AASA 1AE8H 1DUAA 3LGWA 2ZDLA 3S7HB 2R3UA 4INKA 1TNKA 4WH6A 1GJBB 1V2VT 2ZDVH 2FOEA 4O3UA 3RP2A 1EZXC 1HAVB 3RXVA 3GCHB 1BITA 2Y7XA 1V2NT 3A83A 2UUYA 1SGYE 1T8OA 1UTPA 2BDGA 3RXDA 6LPRA 3ZZ4A 1FZZA 1C2IA 2ZPQA 1VITG 3RMOH 4BAMB 1GHBF 1C2LA 5JDUB 1C5QA 1Q3XA 3GDSA 3NXPA 4AZ2B 3A7ZA 4FUHA 1UJ1A 2VIPA 1O38A 2BD3A 3RLWH 3URCA 4BTTB 1GBMA 1LHCH 3SJ8A 3BTTE 1THPB 4UFDH 4MLFB 2XXLA 2OUAA 3A80A 4ZKNU 3RC5A 2OXSA 4DJZB 4I32A 4OS4A 2UWLA 4UD9H 3UY9A 1IQNA 3M36A 1OYQA 1QL8A 1HJ8A 3KEEA 2P3TB 2TGDA 1LMWB 2C90B 1BBRH 1QRWA 3VB4A 3VXFH 4BTIB 3LH3A 4TY7A 3DFJA 3M7QA 2BD5A 2EI7A 1HXFH 4JZDH 3V13A 2CHAC 4K5ZA 4IC5A 2AGGX 3D62A 2BDCA 1GG6B 1QURH 1BTZA 2P59A 5HXFA 1ANEA 2ANWA 2ZU4A 4IMQA 3IG6B 4IMZA 4IN1A 4ABFA 1KXDA 5I46H 2B9LA 2XWBI 1TIOA 5FBIA 2Y82A 2O8MA 1FLEE 3SI3H 3UNRA 2FI5E 1O2TA 2JH0D 1PPHE 3UOUA 3SHAH 4ZHMU 2XWAA 1C5XB 3MYWA 1C2FA 1BTUA 1V2RT 4ZHLU 2Z3DA 1K1JA 3SU2A 1NM6A 2FOHA 1YPLH 2IPHA 3GY6A 1L4ZA 4FU9A 1A0JA 1A1RA 2PLXA 4MVNA 2ESTE 1TGBA 5C2ZA 3ZZ9A 5JBTA 4LK4A 2ZZUH 1LQDB 1JIRA 4RSPA 3STIA 1O31A 3A86A 4KTUA 5CHAB 2C8WB 1BRUP 3CP7A 1GI7B 3PO1C 2QCYA 4MPWA 1C4V2 5F8TA 3T62A 3BTEE 1BHXF 1SQAA 1KTSB 3UOPA 5A09A 4INLA 1ZGVA 1UHBB 3T25A 3F68H 1BMAA 1C5OH 2J92A 1FIWA 3KIDU 1HB0B 3FP6E 3M5OA 1EOLA 1OS8A 3HGNA 3RXRA 1P11E 1O3GA 2GGVB 3P95A 4IBLH 4MNVA 3FP8E 3BG4B 1NU7B 1OWHA 3M5LA 4DGJA 1GCDA 4WH8A 1LHEH 2HNTF 1WBGB 2ZCHP 1O5CB 3GCNA 1HFDA 2R2WU 3RUOA 3V0XA 2B5TB 2R0LA 1AQ7A 2WV4A 2AMQA 1TRNA 1PPEE 1YLCA 3PYHA 3QLPH 3A7WA 2BVXH 2SGQE 1UHBA 2BX3A 2ZFRH 3KF2A 5A8XA 4Q7XA 3EA9A 4U01A 5JBBS 2FOFA 4I8KA 2BDYA 2C8YB 1LVOA 2NU2E 1VGCB 3DHKH 2WUCA 1A0HB 5A0BA 1GI6A 1G30B 4Y8ZA 1GJDB 1HAZB 1VCWA 2BD7A 5JBAS 2WV5A 1V3XA 1F7ZA 1F0SA 2FPZA 5FCKA 1S81A 4FUGA 1H9HE 2FODA 1B0FA 2Z9KA 3P8FA 1WTGH 2V35A 3RU4T 4TPIZ 1NY22 4K8YA 3TK5A 3Q3YA 4O3TA 2NU0E 2A32A 1AMHA 1SHHB 1LPKB 2A31A 5H4IB 2EA3A 2QIQA 4VGCB 1FPHH 2FS9A 4U30A 1V2LT 5DP5A 2RCEA 2W5EA 2VWMA 1GMDF 1SR5C 1MZAA 1OWIA 2Y6TA 2AFQB 3MFJA 1SGCA 3KNXA 1C2HA 4TY6A 1O3KA 4NWKA 1HRTH 2FOCA 3UWJH 1CT2E 1G32B 1S5SA 1TNHA 1HJAB 1UTMA 2ZQ1A 1BJVA 3GYLB 1INCA 3I29A 5EQRA 2B0FA 3UUZA 5EPNA 3VXEH 1LVBA 1DXPA 4JZFH 2P8OB 1AZ8A 4YT7H 3P8NA 1T8NA 3OSYA 1QHRB 4KELA 2F9BH 3U8OH 4CRFA 1SFQB 1GI1A 4Y79A 3RXBA 3SQHE 1ABIH 1C1NA 2ALPA 1TALA 2ZDAH 2AIPA 3TJOA 1YM0A 3TJNA 1FXYA 4NG9H 1C2GA 3LT3A 2P93A 3GY8A 2ZGJA 2ALVA 3SBKA 1H1BA 1FPCH 3OU0A 1ELDE 1D6WA 1G36A 2H9HA 3UQOA 1DWBH 3LGIA 2BD8A 5JYIA 3BTWE 1C5NH 1SQOA 2FOMB 1NRPH 2VIOA 8GCHF 1XMNB 3A8DA 4WMDA 1K1IA 1V2KT 3VB6A 3BTQE 7LPRA 1D6RA 3ZYEA 1O30A 2A1DB 4INHA 2F9NA 3MU0A 1PPGE 1OWEA 1LHGH 1VZQH 1O2VA 2CJIA 1T32A 5HM2A 1DT2A 1G3DA 1O3NA 1O2LA 3SU5A 1SGNE 1FAXA 4AFZA 3PMAB 4GLYA 2J38A 4UEHH 1DE7H 2Q6DA 2A2QH 2BVRH 3MNSA 2V3OH 1C5RA 1DX5M 2A0QB 1Z1JA 3UFAA 1MQ6A 1H9IE 2BDHA 1ANCA 1W2KH 2HGTH 4YTAA 4CRBA 4DCDA 3MWIU 4X8VH 4B73A 1C5MD 2FM2A 2GZ8A 1OSSA 2CF9H 1KY9A 3TPIZ 2XCNA 3NKKA 4JYVH 5J4SA 5FXLA 1C1OA 2QN5T 1MAXA 1PQ7A 3I77A 1QTFA 1TMBH 2P3FH 3FAOA 2NU1E 1O5EH 5TJXA 3SGQE 1SC8U 1AVWA 2VIWA 3RLYH 1O2QA 1SGEE 1D3PB 1Z71A 2J4IA 1W7GH 1IQGA 1RTFB 1P01A 3D65E 2XCFA 1K21H 1TNIA 1C2KA 2A7CA 3H5CB 4HFPB 1IQEA 4X1NU 5AF9H 3DUXH 3URDA 1IHSH 2WYGA 1VITF 2BXTH 2ZPSA 2CN0H 1ZMNA 1VJ9U 3ATMA 3W95A 3P17H 1JRTA 3BTHE 1J17T 2ZTZA 1H8DH 1EP6A 2ZI2H 1UTNA 3TGJE 2BY8X 1SGRE 3EE0B 4ABAA 1THRH 2WPIS 3KL6A 3OY6U 3STJA 3HK6B 3ZZCA 5EQSA 3ATLA 3MI4A 2SNWA 1ZTLA 3EAJA 2A5KA 3FFGA 2SGDE 4CHAB 2HPQH 3IITA 4Y71A 1XKBC 1Y5AT 1P2NA 1CA8B 1HNEE 2G00A 4X0WU 2QV1A 1TGCA 1UVUH 2FI3E 5C5NA 5EW2H 2WPHS 3OTJE 2VIQA 2H2ZA 5TCAA 3FANA 4IC6A 4YOIA 4B2BA 3P70B 3S0NA 1MH0A 2WPLS 4BXWA 2BQ7B 1A2CH 1C2EA 3SNAA 3EQ0H 1ZYOA 1AZZA 4X1RU 4D76A 4ABIA 1C4Y2 4XE4A 3ZVEA 1DS2E 4X6NA 1SLVB 2ZFQH 1ZHPA 4KP0A 4ZXXH 1LTOA 1RFNA 4KTCA 1A5IA 4DIHH 1HAGE 4M7GA 3RXSA 2VINA 5DP4A 5GIBA 5A2MH 3LGTA 5EXMA 1V2UT 2XW9A 3HATH 3SGAE 3S9BA 2BVSH 1YC0A 3SJOA 2HOBA 3QX5H 1V2OT 2PKSC 1ETTH 7GCHF
chains in the Genus database with same CATH superfamily
1VCPA 3PMJA 1SQRA 1UCYE 2J9NA 4I8LA 3MU4A 2J2UA 3A7VA 3BTFE 4CH8B 3SNBA 1E1QD 4Q7ZA 1G9IE 3OYPA 4E7RG 1Q2WA 1UCYK 3NWUA 1NRRH 3BTKE 3ZZDA 2FDAA 3RXJA 1P2KA 1C1QA 4B2CA 2G52A 1OP0A 4NIYA 1TPOA 1ZMJA 1MCTA 3O8BA 4Q7YA 1O35A 2PW8H 4NCYA 1GMCG 1DWDH 1TNJA 1WCZA 1VITH 2VIVA 1KXCA 1O2OA 1C5LH 1GDNA 5FX6A 2GZ9A 4A7IB 2BDAA 3TK6A 1OYTH 2GMTC 4YM9A 1W10U 2CK3D 2FI4E 3U69H 1O0DH 1BTXA 4YLQH 3T2NA 1SQTA 2W6ID 2BOKA 1O2IA 1VR1H 1P57B 3DSPA 1AVGH 2AGIX 1YLDA 1C9PA 4WY3A 3RXUA 1C5UA 1FV9A 1BMLA 1C5YB 4X2VA 4KKDA 1Z6JH 2GV7A 1FY8E 3SV8A 2VBCA 5LPRA 1OWKA 1UVOA 1RTKA 3ZVGA 3F2HA 4BXSA 1EB1H 3CNRA 3ZIAD 3JZ2B 7KMEH 1RIWC 5DSFA 4FUEA 1YCPH 3MU8A 5I25A 5L2YH 1YPHE 1HIAA 3QWCH 1NRSH 3MH5A 1TRYA 1IQIA 1LPZB 3RMNH 1O2PA 3GICB 1J9CH 1C5VA 1CO7E 5DJ7A 2VH0A 2Z9JA 2ZO3H 3M5MA 4OS2A 1T8MA 1F0UA 1O3LA 2K1QA 2F3CE 4GCHG 1MQ5A 2XBVA 3LGYA 2FESH 5EPYA 3BEUA 2QXIA 5HGGA 3U28C 4K1EA 1B0EA 1GBIA 1SGFG 3MO3A 3GOVB 4K3JA 3RM2H 1Q31A 1GI9B 2UUKB 3WWBA 4AG2A 1WOFA 3M7UA 5C1XA 4H42U 1JWTA 4JCNA 1IOEA 2ZTXA 2OBQA 3QK1A 4AN7A 1TNGA 1SLUB 1TGNA 3QN7A 1O2SA 4ABEA 6ESTA 2VVCA 3L6PA 3LU9B 1S85A 5FPSA 5EJ1A 4Z0KA 1P8VC 5LGOA 3FZDA 3SU0A 1JBUH 3F9HA 3VGCC 3KYFA 2ANMH 5E0HA 1NROH 2O8TA 1G3CA 2OC1A 2QXHA 1NESE 2HVXA 3S7KB 2V0BA 1BIOA 1OPHB 5E2PA 2BLWA 5ABWA 1LKAA 2A7HA 2PUQH 4Z6AH 5C67A 5A0CA 1AHTH 3D49H 1P03A 2AHME 2GDEH 5KEDA 1TX7A 3KQBA 3FN8A 1ANBA 4JK5A 2TIOA 1WUNH 4ACBA 3OFND 1HDTH 4NA9H 2ZDKA 1O3CA 1YPJH 2EEKA 2G55A 2ZWLH 3BEFB 1MTNC 4AOQA 2JETB 1FMGA 1LHFH 1MD7A 1O3FA 3LJJA 4WXIA 1Y5UT 1DY9A 1UK3A 4XBCA 1RD3B 3M35A 4GHQA 3E90B 2VWOA 3L3TA 1T4VH 1TABE 1UMAH 1TAWA 5ETXA 1WQSA 1GGDB 2ZU1A 1ELVA 5BPEA 3SU3A 1K28D 2Q6GA 1C5SA 3GDVA 3SUEA 3TH2H 4FU8A 1EKBB 4UE7H 1QB9A 1Z8IB 3EE7A 1YP9A 1RTLA 3OAAD 4CBOA 2ODPA 1TYNA 3BTDE 3DFLA 2W3KA 5FX5A 5B6OA 4KTSA 2G5NA 3P8OA 4NGAH 4X6PA 1AO5A 2UWOA 1E35B 2FYQA 1Z8RA 1ELFA 2GZ7A 3HKIB 3MQKC 1NFYA 2VNTA 4X2XA 1O36A 1GJ7B 1P2IA 1WSSH 8LPRA 3P8GA 1BCUH 1XUIA 3BTGE 2A5IA 2FO9A 3SUFA 1TPAE 2K8IA 4BAKB 3BIUH 1JIMA 4JMYA 1QRZA 4MPUA 2H5CA 5JPMH 2VWLA 2RDEA 5DP3A 5DP9A 3K6YA 5B6LA 3GCOA 2B8OH 3KHVA 3MMGA 2FX4A 1K0HA 1ETRH 2H9EH 1FI8A 3SNCA 1CA0C 4R0IA 2ANKH 3ZVFA 5DO4H 4CBNA 1GBCA 1ELEE 5DPAA 1EASA 1EJNA 1CU1A 1K1PA 4RKJB 1FIZA 4A1XA 5E2OA 4ASHA 1FN8A 4PROA 4X6MA 3QO6A 1BMFD 1BRBE 4YLUA 4ZXYH 2P3UB 4GUXA 3SUGA 1K1OA 5F8XA 4RN6A 1DUEA 2BD9A 1QNJA 1GI0A 4FETA 2BZ6H 1ELTA 2C3SA 1OWJA 1O2GH 1HCGA 1DWEH 1GI2A 1AIXH 1LCYA 1UVTH 3PWBA 2ZTYA 3A8BA 1EAUA 1MKWH 3EA8A 2Y5FA 1QA0A 2C8ZB 3O8CA 4Y6DA 1O3HA 3SU6A 1ZRBA 2W7SA 2Y81A 1N8OC 3T26A 3A7TA 1MMJN 5LPEA 1BBRE 2DE8A 4DIIH 1DY8A 1HAYB 1SB1H 5DG6A 4Y0ZE 3ZZ8A 1E38B 2BHGA 1BBRK 2JH6D 3FKSD 5EODA 9LPRA 1QB6A 4D7GA 1O2HA 2ZDNA 3E0PB 1BQYA 2ILNA 4B71A 1WXRA 3M61U 1SOZA 2CHAB 5F03A 2J98B 1W0KD 1XUJA 3FOAA 4THNH 1COWD 4Y7BA 1CGIE 1S6HA 2VVUA 2QAAA 4F55A 1OP8A 5EG4A 1TFXA 2ZIQH 2O8WA 1C1MA 4XSKU 1GBFA 2ZGXH 1M9UA 2OP9A 1EFRD 1XM1A 2WZQA 2PSYA 4FUCA 3L33A 1UTJA 4BOHA 1L4DA 1SOTA 3R3GB 2ZU5A 5C0UA 1GDUA 1IHTH 2FS8A 1KDQB 3SOSA 2GCHG 1KYNA 4KGAA 2J98A 1EPTC 4D7FA 1EZUC 4WVPE 3ZZBA 1NU9A 1GJCB 1MTSA 4TSFD 1AWHB 2FTMA 1AFEH 1ZSLA 3KN2A 4CR5A 3UPEA 1ELAA 2KCYA 1E34B 4RT0A 4ZKOU 1C1VH 1GMCF 2FMJA 2Y80A 1XUGA 1OP2A 3JZ1B 2ZPRA 3RXCA 4HI3A 1F5RA 1AB9C 4HG6A 4GSOA 1A5GH 1TMUH 3PO1B 4B1TA 4FUIA 3E6PH 1KLJH 3U98H 1NTPA 2HNTC 3FZZA 1KDQA 2SGAA 1HPGA 1W12U 2XC0A 2QY0B 3E0NB 3UR6A 1C2DA 4AG1A 1NFXA 2NU3E 5AFYH 1GCTC 1PPBH 1DM4B 4F48B 1DLEA 1TQ7B 1RJXB 3A89A 2C4FH 1B5GH 5HIYA 3RXEA 4AB9A 3ATWA 2YMSD 1C9TA 2O9QA 4OS1A 5C17A 4Q2KA 2HPPH 1BB0B 1C1SA 3O8DA 2ZHWH 1C2JA 1JRSA 1V2PT 1Y8TA 1O5AB 3F3BA 1EJAA 1LVYA 1ZHRA 2XC5A 1IAUA 4ESTE 1AFQC 1GVLA 2ODQA 1AY6H 1UVPA 2O8UA 3MTYA 3B9FH 2BQWB 3LGVA 3PLKA 3NCLA 1YPKH 2K0QA 1V2ST 2AH4X 2QYIA 4CRCA 1EX3A 4DVAU 1UK2A 2VU8E 1W11U 4AFUA 1MUEB 3QGNB 2FIRH 5GCHG 2AGEX 1GL1A 1KLTA 4JZEH 4GCHF 1SGIB 1DVAH 2OD3B 4WWYA 5HYOA 2KX4A 3GY5A 3AK5A 4NSVA 2SGPE 2VWNA 1K1NA 4MNXA 4I8HA 3KCGH 1PPFE 2RDLA 3DT0H 3W94A 1Y3YA 3ZZ5A 1O2JA 3PLBA 1ESAA 1S0QA 3SJ9A 1IQJA 1YY3A 1XVOA 2LPRA 2ZFSA 2F83A 3MNXA 3PWCA 4ABGA 1HAXB 1J15A 4NA8A 3Q3XA 2H6MA 5DGJA 2NWNA 2EC9H 2TGAA 1W13U 4BAOB 5GDSH 4FUFA 8ESTE 1QFKH 2FX6A 1MU6B 3QGJA 2RA0A 3QZQA 2LELA 1FY5A 1Z6EA 4UFFH 3S9CA 2ZF0H 2XTTB 2G81E 3Q77A 5EQQA 4NFFA 3PMHB 2SGEE 5GPIB 1HBTH 5A8YA 1PYTC 2WYJA 5C20A 1F92A 1A5HA 1RXPA 1SHYA 1Z8JB 4DOQA 3MO9A 1F0TA 2VGCB 4ABBA 1J8AA 4MNYA 1QRXA 4TYDA 3U8RH 2A7JA 2BY7X 4Y0YE 3AW0A 4Q80A 4WXVA 1GDQA 2QA9E 2GTBA 4BAHB 1DXWA 1ZSKA 1ANDA 2KCOA 4H6SB 1NPMA 1EZSC 3AAUA 5AFZH 1HAPH 2WPJS 1EAIA 3RXHA 1W0JD 4H6TA 2NU4E 2I6SA 3E16B 4NA7A 4ISLA 1KTTB 3MU1A 4ABDA 1WU1A 1TPSA 2OBOA 4AYVB 5HM9A 1TLDA 3MNBA 2ZFPH 4DURA 1S84A 3PB1E 1SGPE 3T5FH 1ZSJA 4NZLA 4J2YB 3UIRA 5T6FA 4LZ1H 3SV6A 5T3HA 2ZHQH 4ZUHA 2FLRH 1TA2A 2BM2A 2PV9B 5EXLA 2FTLE 1GHZA 4X1QU 1NRQH 4BTUB 3RC6A 2PR3A 1DSTA 5FCRA 5GXPA 3MHWU 3EGKH 1C5PA 2HALA 3EDXB 3E8LA 1O5FH 1O34A 4ZKSU 2P95A 2QE7D 5C5OA 3ZVBA 5EGMA 1A7SA 2H9TH 3SNDA 1O3MA 1LPGB 1QJ6B 1ZLRA 1E1RD 1HAIH 2OC8A 3LONA 3K65B 1TBZH 6CHAC 5KECA 3A82A 3ZZ6A 4NSYA 1WYKA 2R9PA 4NIXA 3ZZ3A 1QY6A 2FLBH 3VB7A 4IGDA 2ZHDA 1S82A 4FXGH 3SU1A 1MCVA 1TNLA 3SV7A 2FP7B 1TWXB 4AFQA 2EI8A 2Z94A 3ZZAA 3TNTA 1ARCA 3A88A 4MPXA 3U9AH 3T27A 3F9FA 1GBKA 1QBOA 5J4QA 4Y11E 1DPOA 4DY7B 1O5GH 4UDWH 1YF4A 1O2MA 2Z9GA 3PV5A 4UONA 5CDFE 2F43B 3MH4A 1CHOG 1FN6A 2XBWA 1CBWC 3LKWA 2BLOA 2P94A 3HGPA 2PKAB 4OS5A 3KQDA 2HRVA 3B8JA 2GCTC 5CHBA 1O3AA 2PGBB 3UTUH 1DITH 2FOBA 2OTVA 4A1VA 5F6MA 1S6FA 4GHTA 3FP7E 1QBVH 5ESTE 4MTBA 1ZPZA 4OS7A 1L1JA 1C1TA 1HIAB 1ELCA 1O3PB 1IQHA 1UVSH 2D1JA 4YOGA 1P02A 1LQEA 1L0ZA 3RXFA 1EB2A 5A8ZA 1DOJA 3WY8A 3TIUA 1ZZZA 1DLKB 1W7XH 1ZR0A 1GI4A 1FQ3A 1F2SE 4XBDA 2QF5A 1S83A 3M3VA 1O2WA 2GDDA 5K7RA 3WWFA 1GBHA 1K2I1 4X8UH 4AYYB 2PKAA 1YPEH 2V3MA 3MOCA 5AHGH 3SO3A 5F8ZA 1SI5H 1C1WH 2G5VA 4UFGH 1H8IH 1MU8B 1TBRH 3SNEA 1OXGA 1O2ZA 3TGIE 1DFPA 1A46H 1BRCE 1OX1A 2ZU2A 1GBLA 3GS9A 2J97A 4ISOA 4LZ4B 4I31A 1D9IA 3M37A 3SORA 3CENA 3NK8A 4K1SA 4NIWA 1CSOE 3SJIA 1GJ5H 2TBSA 3T29A 3SZNA 1TQ0B 3SW2B 3GCHC 1P09A 5IK2D 1N1LA 1UO6A 1ESBA 1ZPCA 1C5ZB 3H7OA 4I8GA 2W3IA 1YLNA 1T4UH 5A0AE 2QF3A 4F49A 3I78A 1MD8A 3SN8A 2PKSB 1E37B 3R0FA 2TPIZ 3LJOA 3NZIA 4DG4A 1IQLA 2PUXB 1HAOH 2GCHF 2KR7A 4GPGA 5FBEA 2Y5GA 4Y8XA 2ZGHA 1CQQA 1QIXB 3C27B 1FY4A 2AIQA 4AGKA 4ABHA 2TGPZ 1MBMA 1GBAA 3A7XA 1EAWA 4LXBH 3LDXH 2WINI 2QXGA 2OC0A 1P2QA 2HVYB 1ZJKA 3VB3A 3LGUA 3MU5A 1ELGA 3BG8A 2BYAX 2THFB 3SUDA 1TE0A 1K1LA 1G2MA 5LPFA 1ZOMA 2ZNKH 1NS3A 3LH1A 1FJSA 2OLGA 5G4BA 1ZJDA 1BZXE 2F91A 2HLDD 1AVXA 1A61H 4ZHAA 1ID5H 2GMTB 2WPMS 1BRAA 3QTOH 1P04A 1PPCE 2R2MB 1O5DH 3AVZA 5PTPA 4DT7B 2XC4A 1GG6C 2B7DH 4X6OA 4AGJA 5JB9S 8KME2 2RA3A 3SQEE 1OWDA 3VPKA 3BTME 1HXEH 2QC2A 2SGFE 3A8CA 5KGOA 1TX8A 1GJ4H 4IS5A 3HKJB 1P3CA 5IYTA 5E0GA 1SLWB 1O2XA 3VB5A 4FU7A 2ZFTA 1DSUA 1MAYA 1MTWA 1YCPM 3GISB 5T1VA 2AERH 3S9AA 2Q6FA 1O3IA 2H1UA 3PRBA 1YCPK 3M5NA 3P92A 1A4WH 1RIWB 2FOAA 3F1SB 1GHAG 4ZMAH 1YGCH 1D3TB 3GY4A 2F9UA 2ASUB 2Y5HA 2Z3EA 1FAKH 1T7CA 2JIZD 1GBEA 3KQCA 1B7XB 1CHGA 2UWPA 1ZMLA 2ZHEH 3ATKA 1SVPA 3RC4A 1NRNH 3ZV8A 3ELAH 1GBBA 4MQAA 1MKXK 5GCHF 3VFEA 3DSOA 3GCTG 3TNSA 2A4OA 4ISNA 4IW4E 2XBYA 2FZZA 2IJD1 2ANYA 3ENSB 3PTBA 3TITA 2RG3A 2C8XB 1HUTH 1XX9A 2IN2A 1V2WT 3F9EA 4X8TH 5CHAC 1N6YA 4JZ1A 1G37A 1QJ7B 3GDUA 1AKSB 2R0KA 4MDSA 1EP5A 3V12A 5DK1A 3PRDA 1O39A 2VB0A 1QQUA 3UNQA 3LIWA 1Z8GA 2PTCE 3ESTA 2V3HH 1O32A 5CE1A 2BQ6B 4B76A 1WV7H 1C1PA 4BAQB 1HAVA 1TBQH 2BX4A 2WHXA 4SGAE 3PTNA 1P06A 1W0YH 3TH3H 4A92A 3BG4C 3VGCB 5K0HA 2ZQ2A 4HZHA 5DP7A 3VEQB 1YKTA 5LH8A 1KIGH 1BMMH 3ATIA 4QT8C 2DUCA 2J34A 4B75A 3GY7A 1XXFA 2GT7A 4SGBE 2STAE 3UB0A 1TGSZ 1AKSA 1V6DA 1XUKA 4HTCH 4MPVA 3K6ZA 4K8BA 2OK5A 1O3OA 2ZKSA 1GVKB 1NC6A 1T8LA 4A5TS 5GJ4B 3BSQA 2EI6A 3TK9A 3W1EA 4AORA 5TCCA 2BOHB 2XOKD 4HGCA 4CR9A 4OS6A 3GY3A 1VGCC 3MH6A 2BLVA 1P9SA 1MTNB 1LDTT 2TGTA 1QR3E 3BEIB 1KXBA 1AI8H 1O3DA 2GKVE 7GCHG 1TOCB 4NZQA 1BTWA 1O5BB 5E8EH 2JH5D 4JZIA 2F9OA 2GT8A 1W3CA 1E0FD 1FONA 2PWXA 1G3BA 4CRAA 1V2TT 1NFWA 3F6UH 3SI4H 9ESTA 1SKYE 4WF8A 1P3EA 1WQVH 4K69A 4YESB 4K60A 1EOJA 2CF8H 2Z6BD 4VGCC 3QTVH 4I7YH 1GI5A 1LO6A 3TGKE 2G4UA 3RU4D 2J95A 3BF6H 3ZZ7A 4ABJA 3UR9A 5JB8S 1FDPA 1A0LA 1YPGH 4X1SU 4E05H 2CV3A 1QQ4A 3M3TA 1C5TA 3E3TA 4P00A 4U32A 1H8ED 1OKXA 1HJAC 1NZQH 1ACBE 1UK4A 1T31A 2BD2A 2JJ1D 4Y10E 1UTLM 1GMHG 1TX6A 2A5AA 4B2AA 1HAHH 3QZRA 4IN2A 2A4GA 5CMXH 2P8OC 4Y8YA 1QB1A 2ZGCA 3BN9A 1GJ8B 2PSXA 1ZTKA 3SV9A 5SGAE 4MG3A 1G2LA 1F5KU 4FVBA 2CGAA 1J14A 2BY9X 2ZCKP 3A85A 1HGTH 1CA0B 1DANH 1MTUA 2FOGA 3EYDA 3OEED 1EQ9A 4YXWD 1P10A 1BOQA 3U1IB 3RU4E 1E79D 1SGQE 4ZH8A 2ZC9H 4I86A 1TONA 1YPMH 1GHVH 1C5WB 1QCPA 4Y7AA 5JBCS 1GI3A 1GJ6A 2ULLA 2YMSC 4JYTA 5EW1H 2BLQA 1FUJA 1P0SH 1CHOF 4GAWA 2IPQX 1VCQA 2JDID 2JJ2D 2W26A 4JK6A 4AX9H 1AN1E 1F0RA 3RXTA 3Q76A 2UUFB 1V2QT 1KXEA 2A4QA 1KXAA 3PV2A 1LHDH 1MKWK 4K1TA 3MNCA 1QBNA 1AU8A 1YWUA 3V3MA 6GCHG 4I8JA 4X1PU 1QGFA 3A81A 1E36B 3LPRA 2ZFFH 3RXAA 4TPYA 1H4WA 1HV7A 1UW7A 2G4TA 2GP9B 3ITIA 1SMFE 1QZ8A 2ZG0H 5DN6D 3OY5U 5C1UA 1N8OB 3LOXA 1QJ1B 1UTKA 2STBE 3A8AA 4RI0A 1FNIA 1PFXC 3UNSA 2BXUH 3QDZB 4Y76A 1NT1A 2G51A 2OINA 3ZVAA 4P02A 3KGPA 2F9PA 5T6GA 3S69A 5EXNA 3DA9B 4YZUA 2ZECA 1BTHH 1CT0E 5C3NA 1ELBA 3RXQA 4WJG2 3BV9B 1Z1IA 4YT6H 1GBDA 2A2XH 2GJGA 3UREA 3K2UA 1THSH 1MTVA 1IQFA 1Z7KA 3SYJA 4BNRA 1IQKA 1QL9A 3A7YA 3ZYDA 1SFIA 4D8NA 4E06H 1AE5A 1AGJA 2G8TA 2VGCC 4XOJA 2AMPA 2OC7A 4UFEH 3RXGA 2PGQB 2YNBA 4YOJA 4DW2U 1WTHD 2SNVA 3UWIA 1L1GA 1BA8B 3M3SA 1W0ZU 3ODFA 1P9UA 1GHBG 4OGXA 2IOTA 2ZHFH 4FUDA 3PMBB 4K2YA 2ODYB 1EPTB 5T6DA 1GHWH 2XRCA 4FUJA 2J94A 3RXIA 3TJUA 1BHXB 1HJ9A 2HWLB 1P12E 1C2MA 4X2WA 1BTPA 5GNDA 2M5TA 4TWWA 1L1NA 4CHAC 1JXPA 1BUIA 2W7UA 1XXDA 1DICA 3ZVCA 1Y5BT 1O2YA 3F9GA 1N6XA 4ISIH 5FAHA 3V7TA 3D23A 3RXOA 3RXPA 1AB9B 5HKKD 1MBQA 3LC5A 3TLOA 3RM0H 2YNAA 3DD2H 1C4U2 5AVDA 1PQ8A 5DKMA 1GBTA 3UAIC 1XVMA 1CVWH 2AS9A 1P05A 1P2JA 3GY2A 2LP6A 2C93B 1EPTA 1ZHMA 2ZU3A 1GCTB 5GWZA 1DDJA 1GJAB 1O2NA 1W14U 3N7OA 2DE9A 3FVFB 2R3YA 2WSSD 3LC3A 4BANB 1RS0A 2HNTE 1NO9H 1EAXA 1O2UA 1EXFA 1D4PB 3UQVA 1LKBA 1ABJH 1Y3UA 2GVFA 1O3JA 1H9LB 4AFSA 4CH2B 1O37A 3KQEA 1AFQB 1GHAF 2AEIH 5EU8A 1GBJA 1SGDE 2WPDD 3P6ZB 3SJKA 1X7AC 4ZKRU 4ASUD 3E91A 1TB6H 2A4RA 1QL7A 4WMFA 5IDKA 2M2AA 2BY6X 3M7TA 1K1MA 5L30H 1O3BA 1TPPA 2F9VA 1ZGIA 1UCYH 1HYLA 3GCTF 3U1JB 2D26C 1Y3WA 2GV6A 2Z9IA 3HPTB 4O9VA 2SFAA 1GPZA 4ISHH 4ZROA 2UUJB 1GWAA 4D9RA 4CRGA 2LNCA 3B23B 1BDAA 3OE7D 4B6FA 1BTYA 1AUJA 4E7NA 1PJPA 3Q00A 1A3EH 3SZEA 1TA6A 2QXJA 2Z3CA 2CMYA 3TVJB 3CS7A 2WUBA 3PM3A 2H5DA 1SSXA 2ZCLP 1LVMA 5L2ZH 1SLXB 2VH6A 2YOLA 3Q3KA 1GJ9B 3AAVA 1PYTD 3RXKA 2BDIA 5C1YA 3NUMA 2Q1JA 1ZRKA 4FVDA 2OQUA 5FPTA 1JOUB 5HMAA 4A6LA 2KAIB 5DP6A 3CS0A 1YPHC 5BRRE 3O8RA 4FUBA 4NWLA 1TMTH 2D8WA 2VVVA 3TJVA 1CT4E 1EUFA 1WAYB 1O3EA 2ZDMA 3DSGA 3SGBE 1YBWA 2BDBA 1GVZA 3TU7H 2AMDA 1AD8H 1V2JT 1TOMH 2Z7FE 3QUMP 1GL0E 2IJOB 1ZPBA 3KYGA 1GHXH 4X8SH 2PFEA 4LOYH 3RDZA 4A1TA 1IQMA 1MZDA 2OCVB 2KAIA 4CREA 5HIZA 2PTNA 2OQ5A 1UTQA 3MH7A 1FY1A 3C1KA 1TGTA 3OTPA 4MNWA 2D2DA 1P2OA 4AB8A 2HLCA 2AYWA 2ZP0H 1VJAU 4NIVA 2JKHA 4XBBA 3G01A 4U2WA 1PQ5A 1ETSH 4R8TB 2BD4A 5EOKA 1HLTH 3IWMA 4GVUA 2FEQH 4RKOB 1BJUA 3ZVDA 4NFEA 3RMMH 2RFKC 1GMDG 5DP8A 1NFUA 1L2EA 2QF0A 1BT7A 1UTOA 3A87A 3F2GA 2GD4B 1SGFA 2EQNA 2TRMA 1EATA 1GMHF 1SPJA 1V2MT 2GX4A 1J16A 2PHBA 1D3DB 3RXMA 3H7TA 1GHYH 1RRKA 1XUHA 1TRMA 2FXRA 2FYRA 3MO6A 5FHTA 3A84A 1XUFA 1JMOH 2BZAA 1OOKB 1KLIH 1CGJE 3SHCH 2XBXA 1A3BH 2XYAA 2VIDA 2A45B 4H4FA 3SV2H 3PV4A 1S0RA 6CHAB 5C94A 5ESBA 1K22H 1ZTJA 5E0JA 1AWFH 2JETC 2KM0A 2FWWA 4D9QA 1CE5A 2O8LA 1U6QA 1P2MA 4J1YA 3ZV9A 4X2YA 2BY5X 3K9XB 1D3QB 3AW1A 2BMGB 4B74A 3PLPA 3TH4H 1BMNH 4F4OC 4Q4LA 2I6QA 2QGRA 1FY3A 1GGDC 4I33A 8GCHG 1EZQA 1SBWA 4O03A 1XKAC 1ARBA 1O2RA 1O33A 2XNIA 1CGHA 2BB4A 2Z9LA 3SU4A 1PPZA 1O2KA 1MKXH 1Y3XA 2VJ1A 3HK3B 1CBWB 1Y59T 1DWCH 1K9OE 2P16A 1Y3VA 6GCHF 2GCTB 5C0TA 3U8TH 4JYUH 4ZAEA 2ZEBA 3RXLA 2V6NA 3PROA 4CRDA 1AUTC 3NPSA 2WPKS 4OGYA 4DT4A 1SGTA 3ODDA 1QA7A 3OX7U 2Y7ZA 1GI8B 2CXVA 4WMEA 5EJLA 1C1RA 1PQAA 1C1UH 1OHHD 1EJMA 1KSNA 3BIVH 5L6NH 4XFQA 1G3EA 1RGQA 3T28A 2BTCE 3RMLH 3KQ5A 4XDEA 3E1XB 4O97A 3EA7A 1W8BH 1NN6A 4TWYA 1SG8B 4YO9A 1ORFA 2ZGBH 1F5LA 1KXFA 7ESTE 3GYMA 1SL3A 1ESTA 1YYY1 5FPYA 2ZA5A 3AASA 1AE8H 1DUAA 2KCPA 3LGWA 2ZDLA 3S7HB 2R3UA 3N7DA 4INKA 1TNKA 4WH6A 1GJBB 1V2VT 2ZDVH 2FOEA 4O3UA 3RP2A 1EZXC 1HAVB 3RXVA 3GCHB 4Z1MD 1BITA 2Y7XA 1V2NT 3A83A 2UUYA 1SGYE 1T8OA 1UTPA 2BDGA 3RXDA 6LPRA 3ZZ4A 1FZZA 1C2IA 2ZPQA 1VITG 4M9FA 3RMOH 4BAMB 1GHBF 1C2LA 5JDUB 1C5QA 1Q3XA 3GDSA 3NXPA 4AZ2B 3A7ZA 4FUHA 1UJ1A 2VIPA 1O38A 2BD3A 3RLWH 3URCA 4BTTB 1GBMA 1LHCH 3SJ8A 3BTTE 1THPB 4UFDH 4MLFB 2XXLA 2J5UA 2OUAA 3A80A 4ZKNU 3RC5A 2OXSA 4DJZB 4I32A 4OS4A 2UWLA 4UD9H 3UY9A 1IQNA 3M36A 1OYQA 1QL8A 1HJ8A 3KEEA 2P3TB 2TGDA 1LMWB 3N99A 2C90B 1BBRH 1QRWA 3VB4A 3VXFH 4BTIB 3LH3A 4TY7A 3DFJA 3M7QA 2BD5A 2EI7A 1HXFH 4JZDH 3V13A 2CHAC 4K5ZA 4IC5A 4B6EA 2AGGX 3D62A 2BDCA 1GG6B 1QURH 1BTZA 2P59A 5HXFA 1ANEA 2ANWA 2ZU4A 4IMQA 3IG6B 4IMZA 4IN1A 4ABFA 1KXDA 5I46H 2B9LA 2XWBI 1TIOA 5FBIA 2Y82A 2O8MA 1FLEE 3SI3H 3UNRA 2FI5E 1O2TA 2JH0D 1PPHE 3UOUA 3SHAH 4ZHMU 2XWAA 1C5XB 3MYWA 1C2FA 1BTUA 1V2RT 4ZHLU 2Z3DA 1K1JA 3SU2A 4AC9A 1NM6A 2FOHA 1YPLH 2IPHA 3GY6A 5EIYA 1L4ZA 4FU9A 1A0JA 1A1RA 2PLXA 4MVNA 2ESTE 1TGBA 5C2ZA 3ZZ9A 5JBTA 4LK4A 2ZZUH 1LQDB 3F0OA 1JIRA 4RSPA 3STIA 1O31A 3A86A 4KTUA 3OEHD 5CHAB 2C8WB 1BRUP 3CP7A 1GI7B 4OM9A 3PO1C 2QCYA 4MPWA 1C4V2 5F8TA 3T62A 3BTEE 1BHXF 1SQAA 1KTSB 3UOPA 5A09A 4INLA 1ZGVA 3H09A 1UHBB 3T25A 3F68H 1BMAA 1C5OH 2J92A 1FIWA 3KIDU 1HB0B 3FP6E 3M5OA 1EOLA 1MABB 1OS8A 3HGNA 3RXRA 1P11E 1O3GA 3N7EA 2GGVB 3P95A 4IBLH 4MNVA 3FP8E 3BG4B 1NU7B 1OWHA 3M5LA 4RT1A 1GCDA 4DGJA 3F2FA 4WH8A 1LHEH 2HNTF 1WBGB 2ZCHP 1O5CB 3GCNA 1HFDA 2R2WU 3RUOA 3V0XA 2B5TB 2R0LA 1AQ7A 2WV4A 2AMQA 1TRNA 2PP6A 1PPEE 1YLCA 3PYHA 3QLPH 3A7WA 2BVXH 2SGQE 1UHBA 5EJZA 2BX3A 2ZFRH 3KF2A 5A8XA 4Q7XA 3EA9A 4U01A 5JBBS 2FOFA 2KFWA 4I8KA 2BDYA 2C8YB 1LVOA 2NU2E 1VGCB 3DHKH 2WUCA 1A0HB 2L74A 5A0BA 1GI6A 1G30B 4Y8ZA 4FOUC 1GJDB 1HAZB 1VCWA 2BD7A 5JBAS 2WV5A 1V3XA 1F7ZA 1F0SA 2FPZA 5FCKA 1S81A 4FUGA 1H9HE 2FODA 1B0FA 2Z9KA 3P8FA 3VG8A 1WTGH 2V35A 3RU4T 4TPIZ 1NY22 4K8YA 3TK5A 3Q3YA 4O3TA 2F4LA 2NU0E 2A32A 1AMHA 1SHHB 1LPKB 4Q63A 2A31A 5H4IB 2QF4A 2EA3A 2QIQA 4VGCB 1FPHH 2FS9A 4U30A 1V2LT 5DP5A 2RCEA 2W5EA 2VWMA 1GMDF 1SR5C 3WW7A 1MZAA 1OWIA 2Y6TA 2AFQB 3MFJA 1SGCA 3KNXA 1C2HA 4TY6A 1O3KA 4NWKA 1HRTH 2FOCA 3UWJH 1CT2E 1G32B 1S5SA 1TNHA 1HJAB 1UTMA 2W6JD 2ZQ1A 1BJVA 3GYLB 1INCA 3I29A 5EQRA 2B0FA 3UUZA 5EPNA 3VXEH 1LVBA 1DXPA 4JZFH 2P8OB 1S6LA 1AZ8A 4YT7H 3P8NA 2KZ4A 1T8NA 3OSYA 1QHRB 4KELA 2F9BH 3U8OH 4CRFA 1SFQB 1GI1A 4Y79A 3FO8D 3RXBA 3SQHE 1ABIH 1C1NA 2ALPA 1TALA 2ZDAH 2AIPA 3TJOA 1YM0A 3TJNA 1FXYA 2XNDD 4NG9H 1C2GA 3LT3A 2P93A 3GY8A 2ZGJA 3DCLA 2ALVA 3SBKA 1H1BA 1FPCH 3OU0A 1ELDE 1D6WA 1G36A 2H9HA 3UQOA 1DWBH 3LGIA 2BD8A 5JYIA 3BTWE 1C5NH 1SQOA 2FOMB 1NRPH 2VIOA 3F0PA 8GCHF 2YMSB 1XMNB 3A8DA 4WMDA 1K1IA 1V2KT 3VB6A 2KCAA 3BTQE 7LPRA 1D6RA 3ZYEA 1O30A 2A1DB 4INHA 2F9NA 3MU0A 1PPGE 1NBMD 1OWEA 1LHGH 1VZQH 4XD7D 1O2VA 2CJIA 1T32A 5HM2A 1DT2A 1G3DA 1O3NA 1O2LA 3SU5A 1SGNE 1FAXA 4AFZA 3PMAB 4GLYA 2J38A 4UEHH 1DE7H 4XRNA 2Q6DA 2A2QH 2BVRH 3MNSA 3NRLA 2V3OH 2WV9A 1WDIA 1C5RA 1DX5M 2A0QB 1H8HD 1Z1JA 3UFAA 1MQ6A 1H9IE 2BDHA 1ANCA 1W2KH 2HGTH 4YTAA 4CRBA 4DCDA 3MWIU 4X8VH 4B73A 1C5MD 2FM2A 2GZ8A 1OSSA 2CF9H 1KY9A 3TPIZ 2XCNA 3NKKA 4JYVH 1FX0B 4ZCNA 5J4SA 5FXLA 1C1OA 2QN5T 1NBME 1MAXA 1PQ7A 3I77A 1QTFA 1TMBH 2P3FH 3FAOA 2NU1E 1O5EH 5TJXA 3SGQE 1VKYA 1SC8U 1AVWA 2VIWA 3RLYH 1O2QA 1SGEE 1D3PB 1Z71A 2J4IA 1W7GH 1IQGA 1RTFB 1P01A 3D65E 2XCFA 1K21H 1TNIA 1C2KA 2A7CA 3H5CB 4HFPB 1IQEA 4X1NU 5AF9H 3DUXH 3URDA 1IHSH 2WYGA 1VITF 2BXTH 5FL7D 4TT3D 2ZPSA 2CN0H 1ZMNA 1VJ9U 3ATMA 3W95A 3P17H 1JRTA 3BTHE 1J17T 1KMHB 2ZTZA 1H8DH 1EP6A 2ZI2H 1UTNA 3TGJE 2BY8X 1SGRE 3EE0B 4ABAA 1THRH 2WPIS 3KL6A 3OY6U 2EY4C 3STJA 3HK6B 3ZZCA 5EQSA 3ATLA 3MI4A 2SNWA 4ACAA 1ZTLA 3EAJA 2A5KA 3FFGA 2SGDE 4CHAB 2HPQH 3IITA 4Y71A 1XKBC 1Y5AT 1P2NA 1CA8B 1HNEE 2G00A 4X0WU 2QV1A 1TGCA 1UVUH 2FI3E 5C5NA 5EW2H 2WPHS 3OTJE 2VIQA 2H2ZA 5TCAA 3FANA 4IC6A 4YOIA 4B2BA 3P70B 3S0NA 1MH0A 2WPLS 4BXWA 2BQ7B 1A2CH 1C2EA 3SNAA 3EQ0H 1ZYOA 1AZZA 4X1RU 5F53A 4D76A 4ABIA 1C4Y2 2L6OA 4XE4A 3ZVEA 1DS2E 4X6NA 1SLVB 2ZFQH 1ZHPA 4KP0A 4ZXXH 1LTOA 1RFNA 4KTCA 1A5IA 4DIHH 1HAGE 4M7GA 3RXSA 2VINA 5DP4A 5GIBA 5A2MH 3LGTA 5EXMA 1V2UT 2XW9A 3HATH 3SGAE 3S9BA 2BVSH 1YC0A 3SJOA 2HOBA 3QX5H 1V2OT 2PKSC 1ETTH 2V7QD 7GCHF
chains in the Genus database with same CATH topology
1VCPA 3PMJA 1UCYE 2J9NA 4I8LA 3MU4A 2J2UA 3A7VA 3BTFE 4CH8B 3SNBA 4Q7ZA 1G9IE 3OYPA 4E7RG 1Q2WA 1UCYK 3NWUA 1NRRH 3BTKE 3ZZDA 2FDAA 3RXJA 1P2KA 1C1QA 4B2CA 2G52A 1OP0A 4NIYA 1TPOA 1ZMJA 1MCTA 3O8BA 4Q7YA 1O35A 2PW8H 4NCYA 1GMCG 1DWDH 1TNJA 1WCZA 1VITH 2VIVA 1KXCA 1O2OA 1C5LH 1GDNA 5FX6A 2GZ9A 4A7IB 2BDAA 3TK6A 1OYTH 2GMTC 4YM9A 1W10U 2FI4E 3U69H 1O0DH 1BTXA 4YLQH 3T2NA 1SQTA 2BOKA 1O2IA 1VR1H 1P57B 1AVGH 2AGIX 1YLDA 1C9PA 4WY3A 3RXUA 1C5UA 1FV9A 1BMLA 1C5YB 4X2VA 4KKDA 1Z6JH 2GV7A 1FY8E 3SV8A 5LPRA 1OWKA 1UVOA 1RTKA 3ZVGA 4BXSA 1EB1H 3JZ2B 7KMEH 1RIWC 4FUEA 1YCPH 3MU8A 5I25A 5L2YH 1YPHE 1HIAA 3QWCH 1NRSH 3MH5A 1TRYA 1IQIA 1LPZB 3RMNH 1O2PA 3GICB 1J9CH 1C5VA 1CO7E 5DJ7A 2VH0A 2Z9JA 2ZO3H 3M5MA 4OS2A 1T8MA 1F0UA 1O3LA 2K1QA 2F3CE 4GCHG 1MQ5A 2XBVA 3LGYA 2FESH 5EPYA 3BEUA 2QXIA 5HGGA 4K1EA 1B0EA 1GBIA 1SGFG 3MO3A 3GOVB 4K3JA 3RM2H 1Q31A 1GI9B 2UUKB 4AG2A 1WOFA 3M7UA 5C1XA 4H42U 1JWTA 4JCNA 1IOEA 2ZTXA 2OBQA 3QK1A 4AN7A 1TNGA 1SLUB 1TGNA 3QN7A 1O2SA 4ABEA 6ESTA 2VVCA 3L6PA 3LU9B 1S85A 5FPSA 4Z0KA 1P8VC 5LGOA 3FZDA 3SU0A 1JBUH 3F9HA 3VGCC 2ANMH 5E0HA 1NROH 2O8TA 1G3CA 2OC1A 2QXHA 1NESE 2HVXA 3S7KB 2V0BA 1BIOA 1OPHB 5E2PA 2BLWA 5ABWA 1LKAA 2A7HA 2PUQH 4Z6AH 5C67A 5A0CA 1AHTH 3D49H 1P03A 2GDEH 1TX7A 3KQBA 1ANBA 4JK5A 2TIOA 1WUNH 1HDTH 4NA9H 2ZDKA 1O3CA 1YPJH 2EEKA 2G55A 2ZWLH 3BEFB 1MTNC 4AOQA 2JETB 1FMGA 1LHFH 1MD7A 1O3FA 3LJJA 4WXIA 1Y5UT 1DY9A 1UK3A 4XBCA 1RD3B 3M35A 4GHQA 3E90B 2VWOA 3L3TA 1T4VH 1TABE 1UMAH 1TAWA 5ETXA 1WQSA 1GGDB 2ZU1A 1ELVA 5BPEA 3SU3A 1K28D 2Q6GA 1C5SA 3GDVA 3SUEA 3TH2H 4FU8A 1EKBB 4UE7H 1QB9A 1Z8IB 1YP9A 1RTLA 4CBOA 2ODPA 1TYNA 3BTDE 3DFLA 2W3KA 5FX5A 5B6OA 4KTSA 2G5NA 3P8OA 4NGAH 4X6PA 1AO5A 2UWOA 1E35B 2FYQA 1Z8RA 1ELFA 2GZ7A 3HKIB 1NFYA 2VNTA 4X2XA 1O36A 1GJ7B 1P2IA 1WSSH 8LPRA 3P8GA 1BCUH 1XUIA 3BTGE 2A5IA 2FO9A 3SUFA 1TPAE 4BAKB 3BIUH 1JIMA 4JMYA 1QRZA 4MPUA 2H5CA 5JPMH 2VWLA 5DP3A 5DP9A 3K6YA 3GCOA 2B8OH 3KHVA 3MMGA 2FX4A 1ETRH 2H9EH 1FI8A 3SNCA 1CA0C 4R0IA 2ANKH 3ZVFA 5DO4H 4CBNA 1GBCA 1ELEE 5DPAA 1EASA 1EJNA 1CU1A 1K1PA 4RKJB 1FIZA 4A1XA 5E2OA 4ASHA 1FN8A 4PROA 4X6MA 3QO6A 1BRBE 4YLUA 4ZXYH 2P3UB 4GUXA 3SUGA 1K1OA 5F8XA 4RN6A 1DUEA 2BD9A 1QNJA 1GI0A 2BZ6H 1ELTA 2C3SA 1OWJA 1O2GH 1HCGA 1DWEH 1GI2A 1AIXH 1LCYA 1UVTH 3PWBA 2ZTYA 3A8BA 1EAUA 1MKWH 3EA8A 2Y5FA 1QA0A 2C8ZB 3O8CA 4Y6DA 1O3HA 3SU6A 1ZRBA 2W7SA 2Y81A 1N8OC 3T26A 3A7TA 1MMJN 5LPEA 1BBRE 2DE8A 4DIIH 1DY8A 1HAYB 1SB1H 5DG6A 4Y0ZE 3ZZ8A 1E38B 2BHGA 1BBRK 2JH6D 5EODA 9LPRA 1QB6A 4D7GA 1O2HA 2ZDNA 3E0PB 1BQYA 2ILNA 4B71A 3M61U 1SOZA 2CHAB 5F03A 1XUJA 4THNH 4Y7BA 1CGIE 1S6HA 2VVUA 2QAAA 1OP8A 5EG4A 1TFXA 2ZIQH 2O8WA 1C1MA 4XSKU 1GBFA 2ZGXH 1M9UA 2OP9A 1XM1A 2PSYA 4FUCA 3L33A 1UTJA 4BOHA 1L4DA 1SOTA 3R3GB 2ZU5A 1GDUA 1IHTH 2FS8A 1KDQB 3SOSA 2GCHG 1KYNA 4KGAA 1EPTC 4D7FA 1EZUC 4WVPE 3ZZBA 1NU9A 1GJCB 1MTSA 1AWHB 2FTMA 1AFEH 1ZSLA 3KN2A 4CR5A 3UPEA 1ELAA 1E34B 4ZKOU 1C1VH 1GMCF 2FMJA 2Y80A 1XUGA 1OP2A 3JZ1B 2ZPRA 3RXCA 4HI3A 1F5RA 1AB9C 4GSOA 1A5GH 1TMUH 3PO1B 4B1TA 4FUIA 3E6PH 1KLJH 3U98H 1NTPA 2HNTC 3FZZA 1KDQA 2SGAA 1HPGA 1W12U 2XC0A 2QY0B 3E0NB 3UR6A 1C2DA 4AG1A 1NFXA 2NU3E 5AFYH 1GCTC 1PPBH 1DM4B 1DLEA 1TQ7B 1RJXB 3A89A 2C4FH 1B5GH 3RXEA 4AB9A 3ATWA 1C9TA 2O9QA 4OS1A 4Q2KA 2HPPH 1BB0B 1C1SA 3O8DA 2ZHWH 1C2JA 1JRSA 1V2PT 1Y8TA 1O5AB 1EJAA 1LVYA 1ZHRA 2XC5A 1IAUA 4ESTE 1AFQC 1GVLA 2ODQA 1AY6H 1UVPA 2O8UA 3MTYA 3B9FH 2BQWB 3LGVA 3PLKA 3NCLA 1YPKH 1V2ST 2AH4X 2QYIA 4CRCA 1EX3A 4DVAU 1UK2A 2VU8E 1W11U 4AFUA 1MUEB 3QGNB 2FIRH 5GCHG 2AGEX 1GL1A 1KLTA 4JZEH 4GCHF 1SGIB 1DVAH 2OD3B 4WWYA 5HYOA 3GY5A 4NSVA 2SGPE 2VWNA 1K1NA 4MNXA 4I8HA 3KCGH 1PPFE 2RDLA 3DT0H 3W94A 1Y3YA 3ZZ5A 1O2JA 3PLBA 1ESAA 1S0QA 3SJ9A 1IQJA 2LPRA 1XVOA 2ZFSA 3MNXA 2F83A 3PWCA 4ABGA 1HAXB 1J15A 4NA8A 3Q3XA 2H6MA 5DGJA 2NWNA 2EC9H 2TGAA 1W13U 4BAOB 5GDSH 4FUFA 8ESTE 1QFKH 2FX6A 1MU6B 3QGJA 2RA0A 3QZQA 1FY5A 1Z6EA 4UFFH 3S9CA 2ZF0H 2XTTB 2G81E 3Q77A 5EQQA 4NFFA 3PMHB 2SGEE 5GPIB 1HBTH 5A8YA 1PYTC 2WYJA 5C20A 1F92A 1A5HA 1RXPA 1SHYA 1Z8JB 4DOQA 3MO9A 1F0TA 2VGCB 4ABBA 1J8AA 4MNYA 1QRXA 4TYDA 3U8RH 2A7JA 2BY7X 4Y0YE 3AW0A 4Q80A 4WXVA 1GDQA 2QA9E 2GTBA 4BAHB 1DXWA 1ZSKA 1ANDA 4H6SB 1NPMA 1EZSC 3AAUA 5AFZH 1HAPH 2WPJS 1EAIA 3RXHA 4H6TA 2NU4E 2I6SA 3E16B 4NA7A 4ISLA 1KTTB 3MU1A 4ABDA 1WU1A 1TPSA 2OBOA 4AYVB 5HM9A 1TLDA 3MNBA 2ZFPH 4DURA 1S84A 3PB1E 1SGPE 3T5FH 1ZSJA 4NZLA 4J2YB 3UIRA 5T6FA 4LZ1H 3SV6A 5T3HA 2ZHQH 4ZUHA 2FLRH 1TA2A 2BM2A 2PV9B 5EXLA 2FTLE 1GHZA 4X1QU 1NRQH 4BTUB 3RC6A 2PR3A 1DSTA 5FCRA 5GXPA 3MHWU 3EGKH 1C5PA 2HALA 3EDXB 3E8LA 1O5FH 1O34A 4ZKSU 2P95A 5C5OA 3ZVBA 5EGMA 1A7SA 2H9TH 3SNDA 1O3MA 1LPGB 1QJ6B 1ZLRA 1HAIH 2OC8A 3LONA 3K65B 1TBZH 6CHAC 3A82A 3ZZ6A 4NSYA 1WYKA 2R9PA 4NIXA 3ZZ3A 1QY6A 2FLBH 3VB7A 4IGDA 2ZHDA 1S82A 4FXGH 3SU1A 1MCVA 1TNLA 3SV7A 2FP7B 1TWXB 4AFQA 2EI8A 2Z94A 3ZZAA 3TNTA 1ARCA 3A88A 4MPXA 3U9AH 3T27A 3F9FA 1GBKA 1QBOA 5J4QA 4Y11E 1DPOA 4DY7B 1O5GH 4UDWH 1YF4A 1O2MA 2Z9GA 4UONA 3MH4A 1CHOG 1FN6A 2XBWA 1CBWC 3LKWA 2BLOA 2P94A 3HGPA 2PKAB 4OS5A 3KQDA 2HRVA 3B8JA 2GCTC 1O3AA 2PGBB 3UTUH 1DITH 2FOBA 2OTVA 4A1VA 5F6MA 1S6FA 4GHTA 3FP7E 1QBVH 5ESTE 4MTBA 1ZPZA 4OS7A 1L1JA 1C1TA 1HIAB 1ELCA 1O3PB 1IQHA 1UVSH 2D1JA 4YOGA 1P02A 1LQEA 1L0ZA 3RXFA 1EB2A 5A8ZA 1DOJA 3WY8A 3TIUA 1ZZZA 1DLKB 1W7XH 1ZR0A 1GI4A 1FQ3A 1F2SE 4XBDA 1S83A 3M3VA 1O2WA 2GDDA 5K7RA 1GBHA 1K2I1 4X8UH 4AYYB 2PKAA 1YPEH 3MOCA 5AHGH 3SO3A 5F8ZA 1SI5H 1C1WH 2G5VA 4UFGH 1H8IH 1MU8B 1TBRH 3SNEA 1OXGA 1O2ZA 3TGIE 1DFPA 1A46H 1BRCE 1OX1A 2ZU2A 1GBLA 4LZ4B 4ISOA 4I31A 1D9IA 3M37A 3SORA 3CENA 3NK8A 4K1SA 4NIWA 1CSOE 3SJIA 1GJ5H 2TBSA 3T29A 3SZNA 1TQ0B 3SW2B 3GCHC 1P09A 1N1LA 1UO6A 1ESBA 1ZPCA 1C5ZB 3H7OA 4I8GA 2W3IA 1T4UH 5A0AE 2QF3A 4F49A 3I78A 1MD8A 3SN8A 2PKSB 1E37B 3R0FA 2TPIZ 3LJOA 3NZIA 4DG4A 1IQLA 2PUXB 1HAOH 2GCHF 4GPGA 5FBEA 2Y5GA 4Y8XA 2ZGHA 1CQQA 1QIXB 3C27B 1FY4A 2AIQA 4AGKA 4ABHA 2TGPZ 1MBMA 1GBAA 3A7XA 1EAWA 4LXBH 3LDXH 2WINI 2QXGA 2OC0A 1P2QA 1ZJKA 3VB3A 3LGUA 3MU5A 1ELGA 3BG8A 2BYAX 2THFB 3SUDA 1TE0A 1K1LA 1G2MA 5LPFA 1ZOMA 2ZNKH 1NS3A 3LH1A 1FJSA 2OLGA 5G4BA 1ZJDA 1BZXE 2F91A 1AVXA 1A61H 4ZHAA 1ID5H 2GMTB 2WPMS 1BRAA 3QTOH 1P04A 1PPCE 2R2MB 1O5DH 3AVZA 5PTPA 4DT7B 2XC4A 1GG6C 2B7DH 4X6OA 4AGJA 5JB9S 8KME2 2RA3A 3SQEE 1OWDA 3BTME 1HXEH 2QC2A 2SGFE 3A8CA 1TX8A 1GJ4H 4IS5A 3HKJB 1P3CA 5IYTA 5E0GA 1SLWB 1O2XA 3VB5A 4FU7A 2ZFTA 1DSUA 1MAYA 1MTWA 1YCPM 3GISB 2AERH 3S9AA 2Q6FA 1O3IA 2H1UA 1YCPK 3M5NA 3P92A 1A4WH 1RIWB 2FOAA 3F1SB 1GHAG 4ZMAH 1YGCH 1D3TB 3GY4A 2F9UA 2ASUB 2Y5HA 2Z3EA 1FAKH 1T7CA 3KQCA 1GBEA 3VPKA 1B7XB 1CHGA 2UWPA 1ZMLA 2ZHEH 3ATKA 1SVPA 3RC4A 1NRNH 3ZV8A 3ELAH 1GBBA 4MQAA 1MKXK 5GCHF 3VFEA 3GCTG 3TNSA 2A4OA 4ISNA 4IW4E 2XBYA 2FZZA 3ENSB 2ANYA 3PTBA 3TITA 1HUTH 2RG3A 2C8XB 1XX9A 2IN2A 1V2WT 3F9EA 4X8TH 5CHAC 1N6YA 4JZ1A 1G37A 1QJ7B 3GDUA 1AKSB 2R0KA 4MDSA 1EP5A 3V12A 5DK1A 1O39A 2VB0A 1QQUA 3UNQA 3LIWA 1Z8GA 2PTCE 3ESTA 2V3HH 1O32A 5CE1A 2BQ6B 4B76A 1WV7H 1C1PA 4BAQB 1HAVA 1TBQH 2BX4A 4SGAE 3PTNA 1P06A 1W0YH 3TH3H 4A92A 3BG4C 3VGCB 5K0HA 2ZQ2A 4HZHA 5DP7A 3VEQB 1YKTA 5LH8A 1KIGH 1BMMH 3ATIA 4QT8C 2DUCA 2J34A 4B75A 3GY7A 1XXFA 2GT7A 4SGBE 2STAE 1TGSZ 1AKSA 1V6DA 1XUKA 4HTCH 4MPVA 3K6ZA 4K8BA 1O3OA 2ZKSA 1GVKB 1NC6A 1T8LA 4A5TS 5GJ4B 3BSQA 2EI6A 3TK9A 4AORA 5TCCA 2BOHB 4HGCA 4CR9A 4OS6A 3GY3A 1VGCC 3MH6A 2BLVA 1P9SA 1MTNB 1LDTT 2TGTA 1QR3E 3BEIB 1KXBA 1AI8H 1O3DA 2GKVE 7GCHG 1TOCB 4NZQA 1BTWA 1O5BB 5E8EH 2JH5D 4JZIA 2F9OA 2GT8A 1W3CA 1E0FD 1FONA 2PWXA 1G3BA 4CRAA 1V2TT 1NFWA 3F6UH 3SI4H 9ESTA 4WF8A 1P3EA 1WQVH 4K69A 4YESB 4K60A 1EOJA 2CF8H 2Z6BD 4VGCC 3QTVH 4I7YH 1GI5A 1LO6A 3TGKE 2G4UA 3RU4D 2J95A 3BF6H 3ZZ7A 4ABJA 3UR9A 5JB8S 1FDPA 1A0LA 1YPGH 4X1SU 4E05H 2CV3A 1QQ4A 3M3TA 1C5TA 3E3TA 4U32A 1OKXA 1HJAC 1NZQH 1ACBE 1UK4A 1T31A 2BD2A 4Y10E 1UTLM 1GMHG 1TX6A 2A5AA 4B2AA 1HAHH 3QZRA 4IN2A 2A4GA 5CMXH 2P8OC 4Y8YA 1QB1A 2ZGCA