4XOJA

Structure of bovine trypsin in complex with analogues of sunflower inhibitor 1 (sfti-1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigation of Serine-Proteinase-Catalyzed Peptide Splicing in Analogues of Sunflower Trypsin Inhibitor 1 (SFTI-1).
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA02
1Z8GA 4CRDA 1PQ8A 3BTWE 1Q31A 2FODA 1D3QB 4LXBH 4NGAH 5EG4A 2SNWA 3UQOA 1O3GA 2W3KA 1OYQA 3KQEA 1ZRBA 3TITA 1S0QA 1OWKA 4BXSA 1TFXA 4ABEA 3SU6A 1P01A 1GCDA 3A87A 1Z8RA 1ESTA 2SGQE 1GBJA 4MNWA 3P8OA 2Q6FA 1C1OA 4E7RG 1HFDA 3NPSA 2BQ7B 1W3CA 2TPIZ 5BRRE 2ZFRH 2Q6DA 3AAVA 3RC5A 4WWYA 5A2MH 3S0NA 3A8AA 1BCUH 1VGCB 1RD3B 2OP9A 1H4WA 2SFAA 3LGVA 5E0HA 2GP9B 1P12E 4RN6A 2JH6D 1ELFA 1PPGE 1TX8A 1O2GH 3PO1C 4KKDA 4DVAU 2G5NA 3EAJA 1GMCF 5E0JA 3U9AH 1GMDF 3HK6B 2OLGA 1JRTA 1S85A 3DFJA 2VIVA 1WAYB 2PSXA 1L1NA 1GDQA 1NRPH 2GTBA 4X8UH 5CE1A 1XVMA 1W14U 3IG6B 4INLA 1MKWK 4OGYA 1QFKH 1K1JA 3KQBA 1AO5A 3L3TA 1ZYOA 3H5CB 3SUGA 5A0AE 1TBZH 1ESBA 3RXSA 3U8OH 4JCNA 1WYKA 1SQAA 2ZA5A 1K28D 2GZ7A 1SGPE 3GY4A 1E38B 5GDSH 1MKXH 3RXEA 1O2SA 1QNJA 2WPHS 4CR5A 3QUMP 3SU4A 4ABDA 1L4ZA 4D8NA 1HAHH 3SJ8A 3LH1A 2FOGA 3UTUH 2HOBA 1C4U2 3GICB 1SLUB 4FVDA 2OBQA 3LGTA 1F5KU 5L6NH 4ASHA 1P10A 3PWBA 4JZEH 2XYAA 2ODPA 1YLCA 2C93B 1LHEH 3ZVBA 1NU9A 5DK1A 2J9NA 2A5IA 2HNTC 1C5TA 2QY0B 1MTVA 2FLBH 2ZHFH 3SJ9A 1Y5BT 2R2WU 5HM9A 1ZJDA 2Z9GA 5C5NA 1UCYE 2VNTA 1NFXA 4E05H 1T31A 1IOEA 1P2IA 2G5VA 4Y71A 3SORA 4H4FA 2W3IA 2PLXA 1KTTB 4QT8C 4ABBA 4TWYA 1ANEA 3RMOH 2Y7XA 1GI8B 1GBMA 1UMAH 4YT6H 1E36B 5CHAB 1GJCB 3HK3B 3B8JA 1AZ8A 1BUIA 3PMHB 1C5RA 3A80A 2BY8X 2GV6A 3SZNA 1F0SA 2ZQ1A 2PKSB 5JBBS 3LONA 1S0RA 1O38A 2V0BA 2H5CA 1SFIA 1TGNA 1WBGB 1O5EH 4Y10E 3MTYA 3AASA 3Q00A 1C1SA 1DICA 1YPGH 3TNTA 1SQTA 1GDUA 1QL7A 3NXPA 2FOBA 1W13U 4ABHA 2WUBA 5A8XA 4JYTA 1HXEH 1C4Y2 1XM1A 1T8MA 1C1NA 2BDGA 3O8DA 4XBDA 2QV1A 1SG8B 3HKJB 4BTIB 1O2OA 4K1TA 3A88A 2THFB 1JWTA 1NTPA 3GYMA 3ITIA 1O0DH 1RXPA 1WU1A 1KSNA 2AFQB 4K5ZA 3CS7A 4BAQB 4X1NU 5HGGA 1C9PA 1G3DA 3SV2H 5DPAA 2J94A 4NSYA 3LKWA 1GMHF 1V2MT 3ATWA 3RC6A 3E6PH 3ZZ6A 3BEIB 2FI4E 2UWPA 1UVOA 1NT1A 3SI4H 9ESTA 4Y76A 3M3VA 5GCHG 2A7HA 2JH5D 2G52A 1DANH 1QBOA 2WYGA 2VH6A 1GI7B 2BZ6H 4UFGH 1TGTA 2A32A 2TBSA 3ESTA 3GCNA 4NSVA 2EA3A 3D62A 4CH2B 2XTTB 3VB4A 5K7RA 3SHCH 1EJAA 3SU1A 1C5MD 1OP8A 2O9QA 3TJVA 1GVKB 4ZKRU 4NFFA 3MFJA 4JMYA 1THPB 1DDJA 3ZV9A 1EB1H 2QF3A 2TGPZ 2A4RA 1LMWB 2G4TA 5DP7A 1HCGA 1INCA 4U01A 1NU7B 2NU0E 2V3OH 1BZXE 2V6NA 1P2QA 2ZHEH 3UY9A 5FCRA 3T2NA 2TRMA 1EQ9A 2B9LA 2EC9H 4ZMAH 5L2ZH 1F5RA 5FCKA 4GSOA 3TGIE 5T3HA 1ZSLA 3LJOA 1B5GH 2KAIA 1ZGVA 1CHOG 4OS1A 2IJOB 4UD9H 1MTNB 3SNEA 1QURH 2D8WA 4ABJA 4NA9H 3QGJA 2BQWB 2WYJA 4X2XA 2SNVA 3MHWU 1O3HA 2NWNA 2XC4A 4B1TA 2PUQH 5TCAA 4AX9H 4AG2A 4YO9A 3GY5A 2GZ8A 2BLOA 1SGCA 3UPEA 4O3TA 1CGHA 2PGBB 2Z6BD 1V2PT 2J92A 5ESBA 1D9IA 4NA8A 3SI3H 4BAKB 2ESTE 3PWCA 1ZHRA 3LC3A 1MMJN 1DXPA 1JRSA 1CHOF 2VIQA 2CGAA 2GD4B 2FS9A 1JIMA 1W0YH 2BLQA 2GCHG 2PUXB 1V2KT 3RXUA 4AFSA 3ZYDA 3SV8A 1VGCC 2H1UA 1AWFH 4OGXA 1ZTJA 2P93A 1FUJA 1L1GA 4RSPA 1TX7A 2BD3A 4YT7H 2R0KA 4UE7H 1XKBC 3SV6A 1HNEE 3A89A 1GI2A 1J17T 4B73A 1O3DA 4BXWA 1EZSC 1OSSA 1ETSH 5H4IB 1WUNH 2ZU2A 3TGJE 1AE8H 1C1RA 2ZU3A 1FN6A 5CMXH 2QGRA 4CHAB 2HNTF 4LOYH 2CF8H 8GCHG 2OTVA 3TK9A 1C5SA 1D6WA 3M5OA 3BTFE 2AEIH 3SW2B 1GHBF 2A31A 5FPYA 3BEFB 1XUGA 2OCVB 3D23A 1BJVA 1TNKA 4CBOA 1EZUC 1PPFE 2ZU1A 3RLWH 3TIUA 4HTCH 1GMCG 2ZGXH 1OYTH 4LK4A 3ZZCA 3EA7A 2GDEH 3DA9B 3GYLB 1FY1A 3S69A 5LPRA 2VB0A 2AS9A 2A4GA 2W7UA 2FOHA 1KIGH 4ABAA 1QY6A 1HV7A 4F4OC 3NKKA 1OWDA 1AVXA 1SOTA 1UVTH 1ZTKA 2A1DB 4XBBA 1AY6H 1S6HA 2R3YA 1G30B 1HAIH 1MD8A 2WPKS 2ODYB 2QC2A 1QL9A 3TNSA 4IN1A 3UR9A 1SSXA 1ID5H 2C4FH 2VGCB 1JIRA 1P57B 1TRYA 1RS0A 1RTLA 3Q76A 4KGAA 1A61H 4FUJA 4IN2A 4D9RA 3TPIZ 5EODA 3UWJH 2BD4A 2J38A 1TRMA 2ZZUH 2QXIA 2A4OA 2ZFQH 4PROA 3ZZ4A 3B23B 1OX1A 2ZIQH 3SV9A 4DURA 2ZDAH 1P9SA 1MBQA 2Z3EA 2DE9A 1A5IA 3BN9A 2V35A 4CBNA 1LQEA 1ESAA 1O3CA 3E0NB 1AE5A 1C2IA 1DY9A 3M5LA 1YPHC 1UCYK 1NZQH 3O8BA 1O2MA 1Z71A 1WCZA 5C5OA 3BEUA 1ZSKA 1G3CA 2VWMA 1OPHB 4ESTE 4VGCC 1FXYA 3GY7A 1LPGB 2Y6TA 1GBLA 2VIWA 4K3JA 2GT7A 2PKSC 1UK4A 4FUFA 1O5DH 2PW8H 3BF6H 4KTSA 5A09A 1SR5C 3GY6A 1GHAG 4FXGH 2BLWA 2UUFB 1QRXA 3EE0B 4K2YA 1PPBH 5I25A 1VJ9U 5TJXA 4BAOB 1N8OC 2BVSH 4MNXA 1QTFA 3E90B 4YOJA 3G01A 1FN8A 1DPOA 1VR1H 4YOGA 3OSYA 4GHQA 4X8TH 2BD2A 3FAOA 1ELEE 2BZAA 3F9HA 3QO6A 4TY7A 1ZMLA 3FZZA 3OYPA 1EAXA 2QIQA 1SMFE 1C4V2 4YTAA 1TALA 3TH3H 1Z8IB 1F0TA 1A0LA 2C3SA 1W7GH 5ABWA 5GJ4B 2G4UA 3VB6A 5HYOA 1IQLA 1Z6EA 1DLKB 2DUCA 4YOIA 2PGQB 4OS6A 1BQYA 2WV5A 5AFZH 3BTKE 1O2KA 1QB6A 2ZNKH 3LC5A 1C2LA 2ILNA 1UJ1A 1WQSA 1MCTA 5HXFA 4X6PA 1D3DB 2TGDA 3STIA 5GXPA 1YCPK 5FXLA 1AN1E 2QYIA 4Y7BA 3SNBA 1TONA 3BTQE 1O5AB 3AW1A 3K6ZA 3U8TH 1SGFA 6GCHG 2ZC9H 1P03A 1PPCE 1BITA 4NWLA 5PTPA 1Y3XA 1BTPA 2F9OA 1TPAE 4HI3A 1LO6A 1GBAA 3UOUA 2ZWLH 1CBWC 2OQ5A 3D65E 2GDDA 2ZECA 1ZHPA 4I31A 1QL8A 4J2YB 3D49H 3TK5A 1WSSH 2Q6GA 1YBWA 2ZHQH 4X6OA 1GBDA 1G36A 1K1MA 4ZUHA 1H9IE 3T5FH 1YF4A 4MPUA 4X6NA 3BSQA 2O8TA 1KXDA 3MWIU 3M7TA 3BIUH 2Y5FA 1FJSA 1QRWA 1DUAA 2V3HH 1O2ZA 4ABIA 1AHTH 1O3NA 3A7WA 1LQDB 5A8ZA 3GY3A 5EW1H 3SN8A 4TWWA 4MG3A 2P95A 4AORA 3P70B 1FPHH 1BDAA 1ETRH 4MPWA 1V2OT 2OXSA 1MD7A 3KN2A 2BD5A 1GHXH 3UOPA 1TWXB 2WPLS 1O5GH 1J16A 6ESTA 3PV4A 4X1QU 2BYAX 3MI4A 2LNCA 2ZDLA 4DJZB 2G81E 1HDTH 2GZ9A 2PFEA 4K1SA 1XKAC 4ISLA 3ZZBA 1DWDH 1AZZA 3PMAB 1FIZA 1D6RA 1MTUA 6GCHF 1C5VA 3GCHC 1XUKA 2W7SA 1Z6JH 3RXQA 1HAOH 3LGUA 1TQ7B 1GL1A 1J9CH 1ANBA 4X8SH 2B0FA 3T29A 3PB1E 2BOHB 1P2JA 2FM2A 3KQCA 1GHBG 4OS5A 1AIXH 3MNXA 4I8KA 1SVPA 4A1TA 1C2GA 4WVPE 1T4UH 3FVFB 3PMBB 4KTCA 3QWCH 1HYLA 5FAHA 1P2NA 2F9NA 2F83A 4MNVA 3CENA 6CHAC 1C1PA 4E06H 5EQQA 2ZPRA 1O2TA 3M3SA 3URDA 4ISIH 2VWLA 3RM0H 4NFEA 5J4QA 4CHAC 1ANDA 1O2WA 1O3IA 4UFFH 1AD8H 1KTSB 5FBEA 1Q2WA 1V2UT 4O3UA 4XOJA 2G51A 3BG4B 3NK8A 4AYYB 1UTMA 3F9EA 2H9TH 1VITG 2SGEE 1AUJA 2GCHF 2UUKB 1YC0A 2PWXA 5DP5A 1O2UA 1DS2E 2CV3A 1C2EA 1RIWB 1C5NH 3RXRA 3NZIA 3TVJB 2K1QA 1DLEA 3SJOA 2H9HA 1S82A 3GCTG 3FANA 1GHWH 4BAMB 2RG3A 1D3PB 1IQNA 2A5KA 3UUZA 2ZFPH 3GDVA 4AB9A 2H9EH 5DKMA 2ZO3H 4CRFA 4FUCA 4GVUA 2FOEA 1HAYB 4B74A 3IITA 4BNRA 1W11U 3RXLA 1OWEA 2VGCC 2XBXA 2R0LA 2F91A 2GT8A 3T25A 4D7GA 3ODDA 4BAHB 1LVMA 2W5EA 2C90B 1YPKH 1NRQH 1PPZA 4K8BA 1ELCA 2I6QA 2BXTH 4YESB 1WTGH 2UUJB 5EGMA 4M7GA 3RUOA 1CA0B 2XRCA 2ZFSA 1FNIA 2B8OH 1GI0A 4DT7B 1IQKA 3I77A 4ZKNU 1FAXA 1TRNA 4X1SU 3SQHE 1H8IH 3LGYA 2FO9A 1AKSA 2BX4A 4U30A 5DJ7A 1O2PA 2GMTC 2VJ1A 2FP7B 4A7IB 2BDBA 1OP2A 2FYQA 2XNIA 3ZVGA 3MH7A 3JZ2B 1E37B 3M5MA 4TPIZ 1HAXB 3HGPA 2BD8A 3WY8A 1P09A 1F2SE 3ELAH 1QCPA 1Y8TA 4OS2A 2ZGHA 1A3EH 4UEHH 1PYTC 4U32A 1EJNA 1C2DA 3RXHA 1XX9A 2FDAA 1ELTA 1HJ8A 1T8LA 4IC6A 2O8WA 3TH4H 1F92A 1V2LT 4AGJA 1P11E 3JZ1B 4H6SB 5C1YA 3PTBA 3V7TA 3C27B 1O2NA 1EOLA 4I33A 5FX6A 2RCEA 1SLWB 3PROA 1IQJA 1AFQC 3L6PA 1C5YB 2BDYA 1TOCB 1AFEH 1ABJH 1WQVH 2NU3E 2JH0D 3A82A 1XUJA 2A2XH 2PKAB 3MU8A 3RMNH 2J95A 1YPEH 1GPZA 1TGSZ 1FV9A 3FFGA 2OINA 3L33A 4R8TB 2IOTA 1QQUA 4ABFA 1O2IA 3NCLA 2ZGJA 1BIOA 3A85A 5EU8A 1SBWA 2XBYA 2FX6A 3RXJA 3RC4A 2BDIA 4RKOB 1TBQH 4ZXXH 3E8LA 4K8YA 1TPPA 1LKAA 1PFXC 5AFYH 5EQRA 5EPNA 3W95A 1GDNA 1O5BB 3SNAA 2EI7A 4K69A 3R3GB 1FZZA 5C1UA 2VH0A 2HVXA 4FU8A 5F6MA 3LIWA 1GHVH 1ETTH 4WMFA 1CGJE 2ZHWH 1V2JT 3CP7A 2SGDE 1L2EA 3I78A 3QZRA 1IQIA 1Z1IA 1VJAU 3UQVA 6LPRA 1TPSA 1YPJH 2HLCA 2ZDNA 3DHKH 3OX7U 4CREA 4K60A 1NPMA 2CN0H 4NIYA 1CSOE 1OWJA 1NY22 1LHGH 1GI5A 1GGDB 4MVNA 1O3EA 2TGTA 3F68H 4INKA 1Y59T 1LVYA 2Z9IA 5HMAA 2R3UA 1B0FA 3M7QA 1V6DA 3PLKA 5DP8A 3RXKA 1GJ4H 4Q7ZA 1P04A 1MKXK 5A0BA 4GCHF 1Q3XA 1KXAA 1FAKH 2ZI2H 1GWAA 3RXTA 3U98H 3UNRA 1P05A 1GVLA 1MBMA 2OC1A 5C20A 1S6FA 3S9BA 3M7UA 2AMDA 1G3EA 3U1IB 4X1PU 2BXUH 2FXRA 1O2RA 4KELA 4AG1A 1BBRK 1O3KA 1FY3A 3A86A 1P3CA 2GCTB 1V2VT 5DG6A 2Y81A 1W8BH 4ZHLU 4Y0YE 2AMPA 4SGAE 4A1XA 1EPTC 2ZP0H 3GCOA 1Y3VA 1DT2A 1Y5UT 2XWBI 3H7TA 3R0FA 2BTCE 1CT0E 1SHYA 1AKSB 4WXIA 4D9QA 3VPKA 5EXNA 4X1RU 3SQEE 2BY7X 5B6OA 3RXOA 2I6SA 3GCHB 2VVVA 5J4SA 2FOMB 1WV7H 2W26A 1KXFA 1KDQA 1K1IA 1XXFA 1YM0A 3MU1A 3ZZ7A 1GCTB 2AIQA 1IQEA 1AMHA 1JOUB 1Y5AT 2ZDKA 3ZZ9A 1UHBB 2BMGB 1RTFB 1QIXB 3VB7A 3O8RA 1O2YA 3KEEA 4Y79A 1BRBE 4X6MA 3TK6A 2FWWA 4IGDA 3RMLH 4CRCA 1SLXB 5C1XA 1AVGH 1HAVB 5DP9A 1L0ZA 2PTCE 3S7KB 3T62A 4Y8YA 3V0XA 1GMHG 3SJKA 1EAUA 1ZPZA 1K1NA 3EDXB 1RRKA 3KF2A 1QHRB 1K2I1 1GJ7B 2O8LA 3ZZDA 1SLVB 1O2VA 1EJMA 4YLQH 3Q3YA 3RP2A 1UTLM 4UFDH 1D4PB 2P16A 4WXVA 3RXPA 2HPQH 1OP0A 1W2KH 4I8HA 3H7OA 5T6GA 4D7FA 2XC0A 5DP4A 2J34A 1C5XB 3PTNA 5C3NA 4CR9A 2HALA 1HJAC 2FOFA 1KLJH 1RGQA 1GL0E 3MO6A 1NN6A 4XSKU 1BTZA 1UTPA 3ATIA 3ZVEA 3M61U 1EKBB 4NZLA 1ABIH 3VB3A 2AIPA 2XCNA 4I7YH 1KY9A 3SU2A 4FUBA 1ELAA 4Z0KA 2F9VA 1C5WB 3A84A 1HAPH 3RM2H 3BIVH 1GBBA 2Y7ZA 1EP6A 1G2MA 8ESTE 1FY5A 2Y5HA 4CRAA 2ANKH 1E35B 2HRVA 4Q2KA 4E7NA 1GJ9B 2GGVB 1C5OH 2P3FH 1FQ3A 5E8EH 1CE5A 1YP9A 1K1OA 1U6QA 4MPVA 1BMNH 4Y8ZA 7GCHG 7LPRA 1BT7A 2PV9B 2ZFTA 1LPKB 4MPXA 3C1KA 1MQ5A 2RDLA 3AAUA 2H2ZA 3DD2H 2ANWA 3PLPA 4IBLH 1C1VH 1C2HA 1S81A 2BDCA 4BTUB 1K22H 3V3MA 4ISNA 6CHAB 5C2ZA 1V2ST 2WPIS 3EGKH 1OS8A 1ZSJA 1TA6A 2BY9X 3TJNA 1CA0C 1TBRH 4Y8XA 5F8XA 3ZVFA 3MU0A 2EEKA 1SGDE 2RA3A 7GCHF 2ZF0H 3A8CA 4DGJA 1PQ5A 4ZHMU 2QF0A 3TJOA 1SGRE 4H6TA 1GBTA 4VGCB 1AQ7A 5AVDA 4ZH8A 1EX3A 1ELBA 1HGTH 1FLEE 3BTTE 1CBWB 2ZDMA 1FPCH 2QXGA 2HGTH 1K1LA 1O2HA 1O3BA 2G8TA 4SGBE 3KNXA 1FY4A 3BTGE 2BM2A 5GWZA 1AB9B 1TA2A 3E91A 5K0HA 3RXFA 2WINI 3PM3A 1SOZA 1NROH 3GY8A 3M5NA 1O32A 1G2LA 1SGNE 4NIVA 1CGIE 4X8VH 3LGWA 1O3LA 5JBTA 2CJIA 3QTOH 2A2QH 2Z7FE 2ZCHP 2ZPSA 1O36A 1LHCH 1GJBB 2PTNA 2ZU5A 1ZRKA 1ZPBA 1MAXA 3SGQE 3RXBA 1H8DH 3SUDA 2WV4A 2Y5GA 1SGQE 3TGKE 1TQ0B 1QA0A 1UHBA 3ENSB 3N7OA 1MTWA 3ZZ3A 4AFZA 5JYIA 1NRSH 1TMBH 2WPMS 3VEQB 1HXFH 2ZCLP 1QJ1B 2Y82A 1FY8E 3PLBA 3EA9A 1CA8B 3EQ0H 5FX5A 4Y7AA 2O8MA 3M36A 1GMDG 1NO9H 4OS4A 1T4VH 4AZ2B 3DUXH 1EASA 1TABE 3ZYEA 4B76A 1ZHMA 3KCGH 2P8OB 2QCYA 4BOHA 3QN7A 4ZAEA 3SNDA 3M35A 3NWUA 3HGNA 1ZJKA 2IN2A 4JZIA 1ZZZA 1NFUA 3BTME 1CQQA 2BVXH 3E0PB 1AWHB 3IWMA 4ZROA 1DOJA 1NC6A 1OOKB 3FZDA 3MO9A 2VWOA 4AOQA 3E16B 3MU4A 1O5CB 4IMQA 4KTUA 1BRAA 2OQUA 4ZKSU 1QQ4A 1BTXA 1ZOMA 5TCCA 1O30A 4B75A 1BOQA 4NWKA 2HPPH 3ODFA 1EZXC 3OTJE 1C1TA 1LVBA 4IMZA 3ATLA 1GBHA 3QDZB 2VVUA 5IDKA 1P2KA 2H6MA 1GBIA 4O97A 1YPHE 2FEQH 2NU4E 3LGIA 2JETC 5GPIB 1O31A 1NESE 1A5HA 2TGAA 1NM6A 2A5AA 1GHAF 3OY5U 2QAAA 1MKWH 2QN5T 1AI8H 1C5PA 3ZVAA 3VXFH 2AMQA 2ALPA 4Y11E 1GI9B 3UIRA 5FPTA 1C5LH 2M5TA 1DVAH 1C1QA 1RIWC 1QR3E 1T8OA 1YCPH 2BD7A 5JB9S 8GCHF 2OC8A 4HZHA 4JZDH 1MU6B 3KHVA 4GLYA 2R9PA 1O33A 3FP7E 1BTUA 1GJAB 3ATKA 3SUFA 3T28A 4IC5A 4Z6AH 2LPRA 1HAZB 1TNJA 1A3BH 1NS3A 3SO3A 1SHHB 4CH8B 3M37A 2UUYA 3LPRA 3P17H 1Y3YA 1DY8A 1P06A 4IW4E 2BHGA 4TY6A 1EP5A 2GKVE 2ZU4A 2BDAA 2NU2E 4ZHAA 1YLDA 1TMTH 1ZMJA 1P9UA 1SGFG 3MO3A 3QLPH 1ELGA 1EXFA 3P8GA 2QXJA 3LH3A 1A46H 1HB0B 1UVUH 2ANMH 2VIOA 4WMEA 1TGBA 2GVFA 1TE0A 1KYNA 2F3CE 3KQDA 1QJ6B 2YNAA 2VIDA 3UWIA 1OWHA 5F03A 4YZUA 1EPTA 1T32A 1AVWA 4Q7YA 1DSTA 2FI3E 1BMMH 3GDSA 3KIDU 4NCYA 8LPRA 3BG4C 1A1RA 1TNIA 1O2JA 2FPZA 4WMDA 1G3BA 4DG4A 2ZGCA 2AERH 1BRUP 2DE8A 3QX5H 4Q80A 1QRZA 4DY7B 2ALVA 3RMMH 5ETXA 1C2MA 4XBCA 4HFPB 1EPTB 1A0HB 1TOMH 3Q77A 2P3TB 4MQAA 3GOVB 3RXVA 4O9VA 1V2QT 2A7JA 1J8AA 2FESH 2PSYA 3MH5A 3MYWA 1LTOA 4INHA 3SJIA 1C1UH 4U2WA 1SB1H 2ANYA 1G9IE 1SGYE 4LZ4B 2BLVA 2OC7A 1SGTA 1QJ7B 4ZKOU 1BMLA 1LHDH 2CHAB 3QTVH 2Z3DA 2SGPE 2BY5X 1MZDA 1TB6H 5E2PA 1S5SA 3PO1B 2XC5A 2XWAA 2FTMA 3URCA 1VCQA 3V13A 1TGCA 1UK3A 3E1XB 1O3AA 3W94A 4DCDA 1DUEA 4TYDA 4MNYA 1F7ZA 2PKAA 1W7XH 4Q7XA 1FI8A 1UK2A 3RXIA 5JPMH 2D1JA 4RKJB 4AYVB 1ANCA 2J2UA 4MDSA 3A8BA 1O3OA 4FU9A 2ZGBH 3MNBA 4DW2U 1F0RA 1FIWA 5JBAS 1MZAA 1N1LA 1K1PA 3K65B 1UTNA 2AH4X 4XFQA 4JK6A 4XE4A 1ZGIA 1JBUH 2GMTB 4ZXYH 3HATH 5JDUB 2BB4A 2XBVA 5CHAC 3A7XA 1THSH 4Y0ZE 2ASUB 1SPJA 1PPEE 4AB8A 3GCTF 1HLTH 1C9TA 1UTKA 2CXVA 3TU7H 4J1YA 4I8JA 4H42U 5EPYA 3SU5A 1QB1A 1FONA 1LKBA 4FUDA 1XVOA 1V2TT 4FUIA 3E3TA 1M9UA 1HJAB 5T6DA 3F9FA 1DWEH 3I29A 1HUTH 1O2XA 5FBIA 3S9AA 1B0EA 1AFQB 1PQ7A 2Z94A 4CRBA 1GI3A 3ZV8A 5E0GA 1HBTH 2ZEBA 3RLYH 2BVRH 1MTSA 2NU1E 1AUTC 1FDPA 1LPZB 1ZMNA 1C5UA 4FUEA 1NRNH 1VITF 1GBEA 3A83A 3S9CA 1LCYA 1O2QA 2EI8A 1CT2E 1DM4B 3M3TA 3SNCA 2FOAA 1W10U 4THNH 5G4BA 3FP6E 4WJG2 1KXBA 1BRCE 5A8YA 2GCTC 3GDUA 1O3MA 2WUCA 2QA9E 1KDQB 1VITH 5DO4H 3F6UH 1SI5H 2D2DA 1S83A 3K2UA 4LZ1H 4FUGA 1GG6B 4A92A 3ZVCA 2OBOA 1BHXF 1VCWA 2B7DH 1KLIH 3UREA 2KAIB 5F8TA 1O34A 1YKTA 1KXEA 1J14A 2ZTXA 1WOFA 1SC8U 2G55A 3PMJA 1C2FA 1X7AC 2VINA 4DIIH 1EATA 2AGEX 2Z3CA 1O3JA 3EA8A 1GCTC 4X0WU 1UO6A 1XMNB 2ZFFH 1ARCA 2ZTZA 3K9XB 4WH8A 1GBKA 1DXWA 1SQOA 1QBVH 1C1MA 1QB9A 1EAIA 3ZZ5A 1JMOH 1XUFA 2AYWA 2ZQ2A 1L4DA 1YPLH 1GGDC 1TPOA 4NA7A 1DFPA 2EI6A 1K21H 1LVOA 2H5DA 3RXAA 1UCYH 2BX3A 3AW0A 1PJPA 3MU5A 2P59A 1BA8B 3PYHA 1KLTA 4AGKA 2CF9H 4I8GA 1UTJA 1BMAA 4ISHH 1MH0A 1AB9C 3BTHE 4YLUA 3VGCB 2ZPQA 1NFYA 5EQSA 3U1JB 2C8ZB 3RU4T 3SHAH 1DWBH 3MNSA 2FS8A 1HJ9A 1F0UA 1CHGA 4WY3A 5F8ZA 1BTYA 3BTDE 2WPJS 2P94A 2VU8E 3F1SB 2ZG0H 1SL3A 2JETB 1ZLRA 1IHSH 3Q3XA 2BQ6B 1MTNC 2STAE 3MOCA 3UFAA 1O3FA 1O2LA 1HAGE 1THRH 4DOQA 3NUMA 1EOJA 1O35A 1ARBA 4AFQA 1FMGA 5LH8A 1G37A 1P3EA 2BDHA 1L1JA 2P3UB 3GY2A 1GJ5H 5JB8S 1S84A 9LPRA 1C5ZB 1TNGA 1T8NA 1W12U 2UWLA 2ZHDA 1O3PB 3SU0A 1PYTD 5GCHF 2ZTYA 1OKXA 4TPYA 4UDWH 2VWNA 4AFUA 4OS7A 3B9FH 3UNSA 1PQAA 3VFEA 1XUHA 3STJA 3ATMA 4IS5A 2GX4A 2VIPA 2SGFE 4JZ1A 1DX5M 2FTLE 3P8NA 4GPGA 1EAWA 3QK1A 8KME2 4GHTA 2XCFA 3LDXH 4JZFH 3RU4E 1YYY1 5L30H 1WTHD 4I8LA 1XXDA 5AHGH 3RU4D 2D26C 3UNQA 3SGBE 3P95A 2Z9JA 4D76A 4HGCA 1V2WT 5T6FA 1DE7H 1A4WH 1D3TB 4FUHA 2FZZA 1SGEE 4WF8A 4XDEA 1KXCA 1BTWA 1W0ZU 4B71A 1T7CA 1LHFH 4DIHH 1MAYA 4ISOA 2FOCA 3P8FA 1AU8A 1H9HE 2O8UA 3A81A 1GI4A 3BTEE 3A7ZA 1QBNA 2FI5E 2FLRH 1GBFA 1A2CH 3HKIB 4A5TS 1A7SA 3T26A 1XUIA 4YM9A 1IQGA 1TLDA 1MCVA 4FU7A 4NZQA 4GUXA 5HM2A 2ZCKP 2Z9KA 1PPHE 1A0JA 3SUEA 3K6YA 1BJUA 3LJJA 2FYRA 2ULLA 1HIAB 1RJXB 1GHYH 4A6LA 1C1WH 4JK5A 2ODQA 5DP3A 1YGCH 2YNBA 4R0IA 1MU8B 5LGOA 1UVSH 4NIWA 1IQMA 2C8WB 1J15A 1TMUH 1QGFA 1N6YA 5LPEA 3S7HB 2OC0A 2AGGX 1SGIB 3OY6U 1TIOA 3A7TA 3CS0A 2A0QB 1P2MA 1UVPA 4X2WA 3QGNB 4F49A 3SV7A 1HPGA 2XBWA 1E0FD 3Q3KA 1CO7E 3LT3A 1V3XA 2PR3A 2ZKSA 1BBRH 3A8DA 5EXLA 2VVCA 4B2AA 2A7CA 2STBE 4B2CA 5LPFA 3ZZAA 3VXEH 1C5QA 2B5TB 4K1EA 1YCPM 2C8YB 4X2VA 3SOSA 2P8OC 3F9GA 1MQ6A 5DGJA 4GAWA 5FPSA 2UWOA 4WH6A 7KMEH 1O5FH 3A7VA 1JXPA 3A7YA 3HPTB 1Y3WA 4UFEH 3LOXA 1HRTH 3P92A 5SGAE 5BPEA 1IQHA 1ELDE 4NG9H 4NIXA 2CMYA 2OUAA 4MLFB 1Y3UA 1O37A 2TIOA 4UONA 2FIRH 2BY6X 1ZR0A 4BANB 1Z7KA 2IPHA 1EUFA 1ELVA 1H9LB 1LDTT 3V12A 5EW2H 3T27A 2F9BH 3FP8E 3QZQA 2BOKA 5IYTA 1V2NT 2ZDVH 3RDZA 3UR6A 1F5LA 1V2RT 1YPMH 2XXLA 4JYUH 1OWIA 2FX4A 5I46H 1K9OE 1EB2A 4Y6DA 4JYVH 5DP6A 1GI1A 2Z9LA 1GI6A 1DSUA 1GJ6A 1UTQA 2HWLB 1RTKA 1NFWA 1TYNA 1DITH 3OU0A 1E34B 1HAVA 1N8OB 4GCHG 2F9UA 4O03A 2G00A 2Y80A 5EOKA 1ZPCA 1GJDB 1IAUA 1P02A 1TNHA 3MMGA 1UTOA 3P6ZB 3U69H 1ZTLA 5AF9H 3SBKA 1TAWA 2R2MB 3RXGA 3RXDA 3GISB 4FVBA 1EZQA 2C8XB 1NRRH 3AVZA 2CHAC 1BB0B 1RFNA 1HIAA 1VZQH 1TNLA 2OD3B 4KP0A 3SU3A 1QA7A 1Z8JB 3VB5A 5FHTA 3BV9B 1IQFA 1TX6A 7ESTE 1CT4E 2QXHA 1H1BA 4I32A 1GG6C 2Q1JA 3U8RH 3BG8A 2YOLA 5E2OA 3ZVDA 3ZZ8A 1GVZA 2J4IA 3SGAE 1VCPA 2PHBA 3O8CA 2HNTE 3MNCA 3TLOA 1B7XB 1P0SH 1BTHH 1DWCH 1BBRE 2GV7A 3TJUA 3KL6A 3DT0H 4X2YA 4A1VA 1CVWH 1C2JA 4AN7A 1SFQB 2BD9A 2SGAA 2FMJA 3DFLA 4MTBA 5GIBA 3KGPA 3MH6A 5L2YH 4CRGA 1P2OA 5EXMA 3RXCA 1ORFA 3LU9B 3TH2H 2RA0A 2A4QA 1IHTH 5ESTE 1AGJA 5C67A 1CU1A 3RXMA 5A0CA 1C2KA 2A45B 2JKHA 2XW9A 4B2BA 3MH4A 1MUEB 2F9PA 1G32B 4ABGA 1N6XA 3VGCC 1BHXB 1OXGA 4BTTB 2AGIX 1GBCA 1P8VC 5JBCS 1ACBE 1O39A 1Z1JA 1GHZA 1A5GH 3EYDA 1GJ8B
chains in the Genus database with same CATH superfamily
1Z8GA 4CRDA 1PQ8A 3BTWE 1Q31A 2FODA 1D3QB 4LXBH 4NGAH 5EG4A 2SNWA 3UQOA 1O3GA 2W3KA 1OYQA 3KQEA 1ZRBA 3TITA 1S0QA 1OWKA 4BXSA 1TFXA 4ABEA 3SU6A 1P01A 1GCDA 3A87A 1Z8RA 1ESTA 2SGQE 1GBJA 4MNWA 3P8OA 2Q6FA 1C1OA 4E7RG 1HFDA 3NPSA 2BQ7B 1W3CA 2F4LA 2TPIZ 5BRRE 2ZFRH 2Q6DA 3AAVA 3RC5A 4WWYA 5A2MH 3S0NA 3A8AA 1BCUH 1VGCB 1RD3B 2OP9A 1H4WA 2SFAA 3LGVA 5E0HA 2GP9B 1P12E 4RN6A 2JH6D 1W0KD 1ELFA 1PPGE 1TX8A 1O2GH 3PO1C 4KKDA 4DVAU 2G5NA 3EAJA 1GMCF 5E0JA 2J98B 3U9AH 1GMDF 3HK6B 2OLGA 1JRTA 1S85A 3DFJA 2VIVA 1WAYB 1YWUA 2PSXA 1L1NA 1GDQA 1NRPH 2GTBA 4X8UH 5CE1A 1XVMA 4TT3D 1W14U 3IG6B 4INLA 1MKWK 3NRLA 4OGYA 1QFKH 1K1JA 3KQBA 1AO5A 3L3TA 1ZYOA 3H5CB 3SUGA 5A0AE 1TBZH 1ESBA 3RXSA 3U8OH 4JCNA 1WYKA 1SQAA 2ZA5A 1K28D 2GZ7A 3PRDA 1SGPE 3GY4A 1E38B 5GDSH 1MKXH 3RXEA 1O2SA 1QNJA 2WPHS 4CR5A 3QUMP 3SU4A 4ABDA 1L4ZA 4D8NA 1HAHH 3KYFA 3SJ8A 3LH1A 2FOGA 3UTUH 2HOBA 1C4U2 3GICB 1SLUB 4FVDA 2OBQA 2LELA 3LGTA 1F5KU 5L6NH 4ASHA 1P10A 3PWBA 4JZEH 2XYAA 2ODPA 1YLCA 2C93B 1LHEH 3ZVBA 1NU9A 5DK1A 2J9NA 2A5IA 2HNTC 1C5TA 2QY0B 1MTVA 2FLBH 2ZHFH 5KGOA 3SJ9A 1Y5BT 2R2WU 5HM9A 1ZJDA 2Z9GA 5C5NA 1NBME 1UCYE 2VNTA 1NFXA 5HIYA 4E05H 1T31A 1IOEA 1P2IA 2G5VA 3CNRA 1KMHB 4Y71A 3DSPA 3SORA 3WWFA 4H4FA 2W3IA 2PLXA 1KTTB 4QT8C 4ABBA 4TWYA 1ANEA 3RMOH 1SKYE 2Y7XA 1GI8B 2KCAA 1GBMA 1UMAH 4YT6H 1E36B 5CHAB 1GJCB 3HK3B 3B8JA 1AZ8A 1BUIA 3PMHB 1C5RA 3A80A 2BY8X 2GV6A 3SZNA 1F0SA 2ZQ1A 2PKSB 5JBBS 3LONA 1S0RA 1O38A 2V0BA 2H5CA 1SFIA 1TGNA 1WBGB 1O5EH 3ZIAD 4Y10E 3MTYA 3AASA 3Q00A 1C1SA 1DICA 1YPGH 2HLDD 3TNTA 1SQTA 1GDUA 1QL7A 3EE7A 3NXPA 2FOBA 1W13U 4ABHA 2WUBA 5A8XA 4JYTA 1HXEH 1C4Y2 1XM1A 1T8MA 1C1NA 2BDGA 3O8DA 4XBDA 2QV1A 1SG8B 3HKJB 4BTIB 1O2OA 4K1TA 3A88A 2THFB 1JWTA 1NTPA 3GYMA 3ITIA 1O0DH 1RXPA 1WU1A 1KSNA 2AFQB 4K5ZA 3CS7A 4BAQB 4X1NU 5HGGA 1C9PA 1G3DA 3SV2H 5DPAA 2J94A 4NSYA 3LKWA 1GMHF 1V2MT 3ATWA 3RC6A 3E6PH 3ZZ6A 3BEIB 2FI4E 2UWPA 1UVOA 1NT1A 3SI4H 9ESTA 4Y76A 3M3VA 5GCHG 2A7HA 2JH5D 2G52A 1DANH 1QBOA 2WYGA 2VH6A 1GI7B 2BZ6H 4UFGH 1TGTA 2A32A 2TBSA 3ESTA 3GCNA 4NSVA 2EA3A 3D62A 4CH2B 2XTTB 3VB4A 5K7RA 3SHCH 1FX0B 1EJAA 3SU1A 1C5MD 1OP8A 2O9QA 3TJVA 1GVKB 2CK3D 4ZKRU 4NFFA 3MFJA 4JMYA 1THPB 1DDJA 3ZV9A 1EB1H 1E1QD 5HIZA 2QF3A 2TGPZ 2A4RA 1LMWB 2G4TA 5DP7A 1HCGA 1INCA 4U01A 1NU7B 2NU0E 2V3OH 1BZXE 2V6NA 1P2QA 2ZHEH 3UY9A 5FCRA 3T2NA 4B6EA 2TRMA 1EQ9A 2B9LA 2EC9H 4ZMAH 5L2ZH 1F5RA 5FCKA 4GSOA 3TGIE 5T3HA 1ZSLA 3LJOA 1B5GH 2KAIA 1ZGVA 1CHOG 4OS1A 2IJOB 4UD9H 1MTNB 3SNEA 1QURH 2D8WA 4ACAA 4ABJA 4NA9H 3QGJA 2BQWB 2WYJA 4X2XA 2SNVA 3MHWU 1O3HA 2NWNA 2XC4A 4B1TA 2PUQH 5DSFA 5TCAA 4AX9H 4AG2A 4YO9A 3GY5A 2GZ8A 2BLOA 1SGCA 3UPEA 4O3TA 1H8HD 1CGHA 2PGBB 2Z6BD 1V2PT 2J92A 5ESBA 1D9IA 4NA8A 3SI3H 4BAKB 2ESTE 3PWCA 1ZHRA 3LC3A 1MMJN 5C17A 1DXPA 1JRSA 1CHOF 2VIQA 2CGAA 2GD4B 2FS9A 1JIMA 1W0YH 2BLQA 2GCHG 2PUXB 1V2KT 3RXUA 4AFSA 3ZYDA 3SV8A 1VGCC 2H1UA 1AWFH 4OGXA 1ZTJA 2P93A 1FUJA 1L1GA 4RSPA 1TX7A 2BD3A 4YT7H 2R0KA 4UE7H 1XKBC 3SV6A 1HNEE 3A89A 1GI2A 1J17T 4B73A 1O3DA 4BXWA 1EZSC 1OSSA 1ETSH 5H4IB 1WUNH 2ZU2A 5T1VA 1AE8H 1C1RA 3TGJE 2ZU3A 1FN6A 5CMXH 2QGRA 4CHAB 2HNTF 4LOYH 1H8ED 2L6OA 3DSGA 2CF8H 8GCHG 2OTVA 3TK9A 1C5SA 1D6WA 3M5OA 3BTFE 2AEIH 3SW2B 1GHBF 2A31A 1QZ8A 5FPYA 2WPDD 3KQ5A 3BEFB 1XUGA 2OCVB 3D23A 1BJVA 1TNKA 4CBOA 1EZUC 1PPFE 2ZU1A 3RLWH 3TIUA 2WV9A 3W1EA 4HTCH 1GMCG 2ZGXH 1OYTH 4LK4A 3ZZCA 3EA7A 2GDEH 3DA9B 4F55A 3GYLB 1FY1A 3S69A 5LPRA 2VB0A 2AS9A 2A4GA 2W7UA 2FOHA 1KIGH 4ABAA 1QY6A 1HV7A 4F4OC 3NKKA 1OWDA 1AVXA 1SOTA 1UVTH 1ZTKA 2A1DB 4XBBA 1AY6H 1S6HA 2R3YA 1G30B 1HAIH 1MD8A 2WPKS 2ODYB 2QC2A 1QL9A 3TNSA 4IN1A 3UR9A 1SSXA 1ID5H 1MABB 2C4FH 2VGCB 1JIRA 1P57B 1TRYA 1RS0A 1RTLA 3Q76A 4KGAA 1A61H 4FUJA 4IN2A 2YMSC 4D9RA 3TPIZ 5EODA 3UWJH 2BD4A 2J38A 1TRMA 2ZZUH 2QXIA 2A4OA 2ZFQH 4PROA 3ZZ4A 3B23B 1OX1A 2ZIQH 3SV9A 1COWD 1E79D 4DURA 2ZDAH 1P9SA 1W0JD 1MBQA 2Z3EA 2DE9A 1A5IA 3BN9A 2V35A 4CBNA 1LQEA 1ESAA 1O3CA 3E0NB 1AE5A 1C2IA 1DY9A 3M5LA 1YPHC 1UCYK 1NZQH 3O8BA 1O2MA 1Z71A 1WCZA 5C5OA 3BEUA 1ZSKA 1G3CA 2VWMA 1OPHB 4ESTE 4VGCC 1FXYA 3GY7A 1LPGB 2Y6TA 1GBLA 2VIWA 4K3JA 2GT7A 2PKSC 1UK4A 4FUFA 1O5DH 2PW8H 3BF6H 3F2FA 4KTSA 5A09A 1SR5C 3GY6A 2WZQA 1GHAG 4FXGH 2BLWA 2UUFB 1QRXA 3EE0B 4K2YA 1PPBH 5I25A 1VJ9U 2EY4C 5TJXA 4BAOB 1N8OC 2BVSH 4MNXA 1QTFA 3E90B 4YOJA 3G01A 1FN8A 1DPOA 3F2HA 1VR1H 4YOGA 3OSYA 4GHQA 4X8TH 2BD2A 3FAOA 1ELEE 2BZAA 3F9HA 3QO6A 4TY7A 1ZMLA 3FZZA 3OYPA 1EAXA 2QIQA 1SMFE 1C4V2 4YTAA 1TALA 3TH3H 1Z8IB 1F0TA 1A0LA 2C3SA 2W6JD 1W7GH 1E1RD 5ABWA 5GJ4B 2G4UA 3VB6A 5HYOA 1IQLA 1Z6EA 1DLKB 2DUCA 4YOIA 2PGQB 4OS6A 1BQYA 2WV5A 5AFZH 3BTKE 1O2KA 2M2AA 1QB6A 2ZNKH 3LC5A 5CHBA 1C2LA 2ILNA 1UJ1A 3UB0A 1WQSA 1MCTA 5HXFA 4X6PA 1D3DB 2TGDA 3STIA 5GXPA 1YCPK 5FXLA 1AN1E 2QYIA 4Y7BA 3SNBA 1TONA 3BTQE 1O5AB 3AW1A 3K6ZA 3U8TH 1SGFA 6GCHG 2ZC9H 1P03A 1PPCE 1BITA 4NWLA 5PTPA 2JIZD 1Y3XA 1BTPA 2F9OA 1TPAE 4HI3A 1LO6A 1GBAA 3UOUA 2ZWLH 1CBWC 2OQ5A 3D65E 2GDDA 2ZECA 1ZHPA 4I31A 1QL8A 4J2YB 3D49H 3TK5A 1WSSH 2Q6GA 1YBWA 2ZHQH 4X6OA 1GBDA 1G36A 1K1MA 4ZUHA 1H9IE 3T5FH 1YF4A 4MPUA 4X6NA 3BSQA 2O8TA 4P00A 1KXDA 3MWIU 3M7TA 3BIUH 2Y5FA 1FJSA 1QRWA 1DUAA 2V3HH 1O2ZA 4ABIA 1AHTH 1O3NA 3A7WA 1LQDB 5A8ZA 3GY3A 4AC9A 5EW1H 3SN8A 4TWWA 4MG3A 2P95A 1UW7A 4AORA 3P70B 1FPHH 1BDAA 1ETRH 4MPWA 1V2OT 2OXSA 1MD7A 3F0PA 2BD5A 3KN2A 2IJD1 1GHXH 3UOPA 1TWXB 2WPLS 1O5GH 1J16A 6ESTA 3PV4A 4X1QU 2BYAX 3MI4A 2LNCA 2ZDLA 4DJZB 2G81E 1HDTH 2GZ9A 2PFEA 4K1SA 1XKAC 4ISLA 3ZZBA 1DWDH 1AZZA 3PMAB 1FIZA 2KCPA 1D6RA 1MTUA 6GCHF 1C5VA 3GCHC 1XUKA 2W7SA 1Z6JH 3RXQA 1HAOH 3LGUA 1TQ7B 1GL1A 1J9CH 1ANBA 4X8SH 2B0FA 3T29A 3PB1E 2BOHB 1P2JA 2FM2A 3KQCA 1GHBG 5EJZA 4OS5A 1AIXH 3MNXA 4I8KA 1SVPA 4A1TA 3OAAD 1C2GA 4WVPE 1T4UH 3FVFB 3PMBB 4KTCA 3QWCH 1SQRA 2EQNA 1HYLA 4OM9A 1P2NA 5FAHA 2F9NA 2F83A 4MNVA 3CENA 6CHAC 1C1PA 4E06H 5EQQA 2ZPRA 1O2TA 3M3SA 3URDA 4ISIH 3OFND 2VWLA 3RM0H 4NFEA 5J4QA 4CHAC 1ANDA 1O2WA 1O3IA 4UFFH 1AD8H 1KTSB 5FBEA 1Q2WA 1V2UT 4O3UA 4XOJA 2G51A 3BG4B 3NK8A 4AYYB 1UTMA 2KR7A 3F9EA 2H9TH 1VITG 2W6ID 2SGEE 1AUJA 5B6LA 2GCHF 2UUKB 1YC0A 2PWXA 5DP5A 1O2UA 1DS2E 2CV3A 1C2EA 1RIWB 1C5NH 3RXRA 3NZIA 3TVJB 2K1QA 1DLEA 3SJOA 2H9HA 1S82A 4DT4A 3GCTG 3FANA 1GHWH 4BAMB 2RG3A 1D3PB 1IQNA 2A5KA 3UUZA 2ZFPH 3GDVA 4AB9A 2H9EH 5DKMA 2JJ1D 2ZO3H 4CRFA 4FUCA 4GVUA 2FOEA 1HAYB 4B74A 3IITA 3OTPA 1W11U 4BNRA 3RXLA 1EFRD 1OWEA 2VGCC 2R0LA 2XBXA 2F91A 2GT8A 3T25A 4D7GA 3ODDA 4BAHB 1LVMA 2W5EA 2C90B 1YPKH 1NRQH 1PPZA 4K8BA 1ELCA 2I6QA 2BXTH 4YESB 1WTGH 2UUJB 5EGMA 4M7GA 3RUOA 1CA0B 2XRCA 2ZFSA 1FNIA 2B8OH 1GI0A 4DT7B 1IQKA 3I77A 4ZKNU 1FAXA 1TRNA 4X1SU 3SQHE 1H8IH 3LGYA 2FO9A 1AKSA 2BX4A 4U30A 5DJ7A 1O2PA 2GMTC 2VJ1A 2FP7B 4A7IB 2BDBA 1OP2A 2FYQA 2XNIA 3ZVGA 3MH7A 3JZ2B 1E37B 3M5MA 4TPIZ 1HAXB 2V3MA 3HGPA 2BD8A 3WY8A 1P09A 3F3BA 1F2SE 3ELAH 1QCPA 1Y8TA 4OS2A 2ZGHA 1A3EH 4UEHH 1PYTC 4U32A 1EJNA 2J98A 1C2DA 3RXHA 1XX9A 2FDAA 1ELTA 1HJ8A 1T8LA 4IC6A 2O8WA 1YY3A 3TH4H 1F92A 1V2LT 4AGJA 1P11E 3JZ1B 4H6SB 5C1YA 3PTBA 3V7TA 3C27B 1O2NA 1EOLA 4I33A 5FX6A 2RCEA 1SLWB 3PROA 2RDEA 1IQJA 1AFQC 3L6PA 1C5YB 2BDYA 1TOCB 1AFEH 1ABJH 1WQVH 2NU3E 2JH0D 3A82A 1XUJA 4XRNA 2A2XH 2PKAB 3MU8A 3RMNH 2J95A 1YPEH 1GPZA 1TGSZ 1FV9A 3FFGA 2OINA 3L33A 4R8TB 2IOTA 1QQUA 4ABFA 1O2IA 3NCLA 2ZGJA 1BIOA 3A85A 5EU8A 1SBWA 2XBYA 2FX6A 3RXJA 3RC4A 2BDIA 4RKOB 1TBQH 4ZXXH 3E8LA 4K8YA 1TPPA 1LKAA 1PFXC 5AFYH 5EQRA 5EPNA 3W95A 1GDNA 1O5BB 3SNAA 2EI7A 2K0QA 4K69A 3R3GB 3SYJA 1FZZA 5C1UA 2VH0A 2HVXA 4FU8A 5F6MA 3LIWA 1GHVH 1ETTH 4WMFA 1CGJE 2ZHWH 3UAIC 1V2JT 3CP7A 2SGDE 1L2EA 3I78A 3QZRA 1IQIA 1Z1IA 1VJAU 4Q4LA 3UQVA 6LPRA 1TPSA 1YPJH 2HLCA 2ZDNA 3DHKH 3OX7U 4CREA 4K60A 1NPMA 2CN0H 4NIYA 1CSOE 1OWJA 1NY22 1LHGH 1GI5A 1GGDB 4MVNA 1O3EA 2TGTA 3F68H 4INKA 1Y59T 1LVYA 2Z9IA 5HMAA 2R3UA 1B0FA 3M7QA 1V6DA 3PLKA 5DP8A 3RXKA 1GJ4H 4Q7ZA 1P04A 1MKXK 5A0BA 4GCHF 1Q3XA 2KCOA 1KXAA 1FAKH 2ZI2H 1GWAA 3RXTA 3U98H 3UNRA 1P05A 1GVLA 1MBMA 2OC1A 5C20A 1S6FA 3S9BA 3M7UA 3PRBA 2AMDA 1G3EA 3U1IB 4X1PU 2BXUH 2FXRA 1O2RA 4KELA 4AG1A 1BBRK 1O3KA 1FY3A 3A86A 1P3CA 2JDID 2GCTB 1V2VT 5DG6A 2Y81A 1W8BH 4ZHLU 5HKKD 4Y0YE 2AMPA 4SGAE 4A1XA 1EPTC 2ZP0H 3GCOA 1Y3VA 1DT2A 1Y5UT 2XWBI 3H7TA 3R0FA 2BTCE 1CT0E 1SHYA 1AKSB 4WXIA 2KZ4A 4HG6A 4F48B 4D9QA 3VPKA 5EXNA 4X1RU 3SQEE 2BY7X 5B6OA 3RXOA 2I6SA 3GCHB 2VVVA 5J4SA 2FOMB 1WV7H 2W26A 1KXFA 1KDQA 1K1IA 5EJLA 1XXFA 1YM0A 3FN8A 3MU1A 3ZZ7A 1GCTB 2AIQA 1IQEA 1AMHA 1JOUB 1Y5AT 2ZDKA 2AHME 3ZZ9A 2F43B 1UHBB 2BMGB 2JJ2D 1RTFB 1QIXB 3VB7A 3O8RA 1O2YA 3KEEA 4Y79A 1BRBE 4X6MA 3TK6A 2FWWA 4IGDA 3RMLH 4CRCA 1SLXB 5C1XA 1AVGH 1HAVB 5DP9A 1L0ZA 2PTCE 3S7KB 3T62A 4Y8YA 3V0XA 1GMHG 3SJKA 1EAUA 1ZPZA 1K1NA 3EDXB 2GJGA 1RRKA 3H09A 3KF2A 1QHRB 1K2I1 1GJ7B 2O8LA 3ZZDA 1SLVB 1O2VA 1EJMA 4YLQH 3Q3YA 3RP2A 1UTLM 4UFDH 4B6FA 1D4PB 2P16A 4WXVA 3RXPA 2HPQH 1OP0A 1W2KH 4I8HA 3H7OA 5T6GA 3WWBA 4D7FA 2XC0A 5DP4A 2J34A 1C5XB 3PTNA 5C3NA 4CR9A 2HALA 1HJAC 2FOFA 1KLJH 3F0OA 1RGQA 1GL0E 5EIYA 3MO6A 1NN6A 4XSKU 1BTZA 1UTPA 3ATIA 3ZVEA 3M61U 1EKBB 4NZLA 1ABIH 3VB3A 2AIPA 2XCNA 4I7YH 1KY9A 1K0HA 3SU2A 4FUBA 1ELAA 4Z0KA 2F9VA 1C5WB 3A84A 1HAPH 3RM2H 3BIVH 5C94A 1GBBA 2Y7ZA 1EP6A 1G2MA 8ESTE 4XD7D 1FY5A 2Y5HA 4CRAA 2ANKH 1E35B 2HRVA 4Q2KA 4E7NA 1GJ9B 2GGVB 1C5OH 2P3FH 1FQ3A 5E8EH 1CE5A 5KECA 1YP9A 1K1OA 1U6QA 2KCYA 1BMNH 4MPVA 4Y8ZA 7GCHG 7LPRA 1BT7A 2PV9B 2ZFTA 1LPKB 4MPXA 3C1KA 1MQ5A 2RDLA 3AAUA 2H2ZA 3DD2H 2ANWA 3PLPA 4IBLH 1C1VH 1C2HA 1S81A 3N99A 2BDCA 4BTUB 1K22H 3V3MA 4ISNA 6CHAB 5C2ZA 1V2ST 2WPIS 3EGKH 1OS8A 1ZSJA 1TA6A 2BY9X 3TJNA 1CA0C 1TBRH 4Y8XA 5F8XA 3ZVFA 3MU0A 2EEKA 1SGDE 2RA3A 7GCHF 2ZF0H 3A8CA 4DGJA 1PQ5A 4ZHMU 2QF0A 3TJOA 1SGRE 4H6TA 1GBTA 4VGCB 1AQ7A 5AVDA 4ZH8A 1EX3A 1ELBA 1HGTH 1FLEE 2LP6A 3BTTE 1CBWB 2ZDMA 1FPCH 2QXGA 2HGTH 1K1LA 1O2HA 1O3BA 2G8TA 4SGBE 3KNXA 1FY4A 3BTGE 2BM2A 5GWZA 1AB9B 1TA2A 3E91A 5K0HA 3RXFA 2WINI 3PM3A 1SOZA 1NROH 3GY8A 3M5NA 1O32A 1G2LA 1SGNE 4NIVA 1CGIE 4X8VH 3LGWA 1O3LA 5JBTA 2CJIA 3QTOH 2A2QH 2Z7FE 2ZCHP 2ZPSA 1O36A 1LHCH 1GJBB 2PTNA 2ZU5A 1ZRKA 1ZPBA 1MAXA 2HVYB 3SGQE 3RXBA 1H8DH 3SUDA 2WV4A 2Y5GA 1SGQE 3TGKE 1TQ0B 1QA0A 1UHBA 3ENSB 3N7OA 1MTWA 3ZZ3A 4AFZA 5JYIA 1NRSH 1TMBH 2WPMS 3VEQB 1HXFH 2ZCLP 1QJ1B 2Y82A 1FY8E 3PLBA 3EA9A 1CA8B 3EQ0H 5FX5A 4Y7AA 2O8MA 3M36A 1GMDG 1NO9H 4OS4A 1T4VH 4AZ2B 3DUXH 1EASA 1TABE 3ZYEA 4B76A 1ZHMA 3KCGH 2P8OB 4ACBA 2QCYA 5IK2D 4BOHA 3QN7A 4ZAEA 4ASUD 3SNDA 3M35A 5F53A 3NWUA 3AK5A 3HGNA 1ZJKA 2IN2A 4JZIA 1ZZZA 4FETA 1NFUA 3BTME 1CQQA 2BVXH 3E0PB 1AWHB 3IWMA 4ZROA 1DOJA 1NC6A 1OOKB 3FZDA 3MO9A 2VWOA 4AOQA 3E16B 3MU4A 1O5CB 1VKYA 4IMQA 4KTUA 1BRAA 2OQUA 4ZKSU 1QQ4A 1BTXA 1ZOMA 5TCCA 1O30A 4B75A 1BOQA 4NWKA 2HPPH 3ODFA 1EZXC 3OTJE 1C1TA 3OE7D 1LVBA 4IMZA 3ATLA 1GBHA 3QDZB 2VVUA 4YXWD 5IDKA 1P2KA 3OEED 2H6MA 3VG8A 3SZEA 1GBIA 4O97A 1YPHE 2FEQH 2NU4E 3LGIA 2JETC 5GPIB 1O31A 1NESE 2WHXA 1A5HA 2TGAA 3PV2A 1NM6A 2A5AA 1GHAF 3OY5U 2QAAA 1MKWH 2QN5T 3U28C 1AI8H 1C5PA 3ZVAA 3VXFH 2AMQA 2ALPA 4Y11E 1GI9B 3UIRA 5FPTA 1C5LH 2M5TA 1DVAH 1C1QA 1RIWC 1QR3E 2J97A 1T8OA 1YCPH 3MQKC 2BD7A 5JB9S 8GCHF 2XNDD 5KEDA 2OC8A 4HZHA 4JZDH 1MU6B 3KHVA 4Q63A 2L74A 4GLYA 2R9PA 1O33A 1BMFD 3FP7E 1BTUA 1GJAB 3ATKA 3SUFA 3T28A 4IC5A 4Z6AH 2LPRA 1HAZB 1TNJA 1A3BH 1NS3A 3SO3A 1SHHB 4CH8B 3M37A 2UUYA 3LPRA 3P17H 1Y3YA 1DY8A 1P06A 4IW4E 2BHGA 4TY6A 1EP5A 2GKVE 2ZU4A 3GS9A 2BDAA 2NU2E 4ZHAA 1YLDA 1TMTH 1ZMJA 1P9UA 1SGFG 3MO3A 3QLPH 1ELGA 1EXFA 3P8GA 2QXJA 3LH3A 1A46H 1HB0B 4TSFD 1UVUH 2ANMH 2VIOA 4WMEA 1TGBA 2GVFA 1TE0A 1KYNA 2F3CE 3KQDA 1QJ6B 5DN6D 2VBCA 2QF4A 2YNAA 2VIDA 3UWIA 1OWHA 5F03A 4YZUA 1EPTA 1T32A 1AVWA 4Q7YA 1DSTA 2FI3E 1BMMH 3GDSA 3KIDU 4NCYA 3WW7A 8LPRA 3BG4C 1A1RA 1TNIA 1O2JA 2FPZA 4WMDA 1G3BA 4DG4A 2ZGCA 2AERH 1BRUP 2DE8A 3QX5H 4Q80A 1QRZA 4DY7B 2ALVA 3RMMH 5ETXA 1C2MA 4XBCA 4HFPB 1EPTB 1A0HB 1TOMH 3Q77A 2P3TB 4MQAA 3GOVB 3RXVA 4O9VA 1V2QT 2A7JA 1J8AA 2FESH 2PSYA 3MH5A 3MYWA 1LTOA 4INHA 3SJIA 1C1UH 4U2WA 1SB1H 2ANYA 1G9IE 1SGYE 4LZ4B 2BLVA 2OC7A 1SGTA 1QJ7B 4ZKOU 1BMLA 1LHDH 2CHAB 3QTVH 2Z3DA 2SGPE 2BY5X 1MZDA 1TB6H 5E2PA 1S5SA 3PO1B 2XC5A 2XWAA 2FTMA 3URCA 1VCQA 3V13A 1TGCA 1UK3A 3E1XB 1O3AA 3W94A 4DCDA 1DUEA 4TYDA 4MNYA 1F7ZA 2PKAA 1W7XH 4Q7XA 1FI8A 1UK2A 3RXIA 5JPMH 2D1JA 4RKJB 4AYVB 1ANCA 2J2UA 4MDSA 3A8BA 1O3OA 4FU9A 2ZGBH 3MNBA 4DW2U 1F0RA 1FIWA 5JBAS 1MZAA 1N1LA 1K1PA 3K65B 1UTNA 2AH4X 4XFQA 4JK6A 4XE4A 1ZGIA 2IPQX 1JBUH 2GMTB 4ZXYH 2OK5A 3HATH 5JDUB 2BB4A 2XBVA 5CHAC 3A7XA 1THSH 4Y0ZE 2ASUB 1SPJA 5C0UA 1PPEE 4AB8A 3GCTF 1HLTH 1C9TA 1UTKA 2CXVA 3TU7H 2QE7D 4J1YA 4I8JA 4H42U 5EPYA 2KFWA 3SU5A 1QB1A 1FONA 1LKBA 4FUDA 1XVOA 1V2TT 4FUIA 3E3TA 1M9UA 1HJAB 5T6DA 3F9FA 1DWEH 3I29A 1HUTH 1O2XA 3FO8D 5FBIA 3S9AA 1B0EA 1AFQB 1PQ7A 2Z94A 4CRBA 1GI3A 4ZCNA 3ZV8A 5E0GA 1HBTH 1WXRA 2ZEBA 3RLYH 2BVRH 1MTSA 2NU1E 1AUTC 1FDPA 1LPZB 1ZMNA 1C5UA 4FUEA 1NRNH 1VITF 1GBEA 3A83A 3S9CA 1LCYA 1O2QA 2EI8A 1CT2E 1DM4B 3M3TA 3SNCA 2FOAA 1W10U 4THNH 5G4BA 3FP6E 4WJG2 1KXBA 1BRCE 5A8YA 4FOUC 3KYGA 2GCTC 3GDUA 1O3MA 2WUCA 2QA9E 1KDQB 1VITH 5DO4H 3F6UH 1SI5H 2D2DA 1S83A 3K2UA 4LZ1H 4FUGA 1GG6B 4A92A 3ZVCA 2OBOA 1BHXF 1VCWA 2B7DH 1KLIH 3UREA 2KAIB 5F8TA 1O34A 1YKTA 1KXEA 1J14A 2ZTXA 1WOFA 1SC8U 2G55A 3PMJA 1C2FA 1X7AC 2VINA 4DIIH 1EATA 2AGEX 2Z3CA 1O3JA 3EA8A 1GCTC 4X0WU 1UO6A 1XMNB 2ZFFH 1ARCA 2ZTZA 3K9XB 4WH8A 1GBKA 1DXWA 1SQOA 1QBVH 1C1MA 1QB9A 1EAIA 3ZZ5A 1JMOH 1XUFA 2AYWA 2ZQ2A 1L4DA 1YPLH 1GGDC 1TPOA 4NA7A 1DFPA 2EI6A 1K21H 1LVOA 4RI0A 2H5DA 3RXAA 1UCYH 2BX3A 3AW0A 1PJPA 3MU5A 2P59A 1BA8B 3PYHA 1KLTA 4AGKA 2CF9H 4I8GA 1UTJA 1BMAA 4ISHH 1MH0A 1AB9C 3BTHE 4YLUA 3VGCB 2ZPQA 3FOAA 1NFYA 5EQSA 3U1JB 2C8ZB 3RU4T 3SHAH 1DWBH 3MNSA 2FS8A 4RT1A 1HJ9A 5EJ1A 1F0UA 1CHGA 4WY3A 5F8ZA 1BTYA 3BTDE 2WPJS 2P94A 2VU8E 3F1SB 2ZG0H 1SL3A 2JETB 1ZLRA 1IHSH 2KX4A 3Q3XA 2BQ6B 1MTNC 2STAE 3MOCA 3UFAA 1O3FA 1O2LA 1HAGE 1THRH 2YMSD 4DOQA 1NBMD 3NUMA 1EOJA 1O35A 3F2GA 1ARBA 1YLNA 4AFQA 1WDIA 1FMGA 5LH8A 1G37A 1P3EA 2BDHA 1L1JA 2P3UB 3GY2A 1GJ5H 5JB8S 1S84A 9LPRA 1C5ZB 1TNGA 1T8NA 1W12U 2UWLA 2ZHDA 1O3PB 3SU0A 1PYTD 5GCHF 2ZTYA 1OKXA 4TPYA 4UDWH 2VWNA 4AFUA 4OS7A 3B9FH 5CDFE 3UNSA 3PV5A 1PQAA 3VFEA 1XUHA 5GNDA 3STJA 3ATMA 4IS5A 2GX4A 2VIPA 2SGFE 4JZ1A 1DX5M 2FTLE 3P8NA 4GPGA 1EAWA 3QK1A 8KME2 4GHTA 2XCFA 3LDXH 4JZFH 3RU4E 1YYY1 5L30H 1WTHD 4I8LA 1XXDA 5AHGH 3RU4D 2D26C 3UNQA 2K8IA 3SGBE 3P95A 2Z9JA 4D76A 4HGCA 1V2WT 5T6FA 1DE7H 1A4WH 1D3TB 4FUHA 2FZZA 1SGEE 4WF8A 4XDEA 1KXCA 1BTWA 1W0ZU 4B71A 1T7CA 2J5UA 1LHFH 4DIHH 1MAYA 4ISOA 2FOCA 3P8FA 1AU8A 1H9HE 2O8UA 3A81A 1GI4A 2RFKC 3BTEE 3A7ZA 1QBNA 2FI5E 2FLRH 1GBFA 3DCLA 1A2CH 3HKIB 4A5TS 4M9FA 1A7SA 3T26A 5C0TA 1XUIA 4YM9A 1IQGA 1TLDA 1MCVA 4FU7A 4NZQA 4GUXA 5HM2A 2ZCKP 2Z9KA 1PPHE 1A0JA 3SUEA 2PP6A 3K6YA 1BJUA 3LJJA 2FYRA 2ULLA 4RT0A 1HIAB 1RJXB 1GHYH 4A6LA 1C1WH 4JK5A 2ODQA 5DP3A 1YGCH 2YNBA 4R0IA 1MU8B 1S6LA 1UVSH 5LGOA 4NIWA 1IQMA 2C8WB 1J15A 1TMUH 1QGFA 1N6YA 5LPEA 3S7HB 2OC0A 2AGGX 1SGIB 3N7DA 3OY6U 1TIOA 3A7TA 3CS0A 2A0QB 1P2MA 1UVPA 4X2WA 3QGNB 4F49A 3SV7A 1HPGA 2V7QD 2XBWA 1E0FD 3Q3KA 1CO7E 3LT3A 1V3XA 2PR3A 2ZKSA 1BBRH 3A8DA 5EXLA 2VVCA 4B2AA 2A7CA 2STBE 4B2CA 5LPFA 3ZZAA 3VXEH 1C5QA 2B5TB 3DSOA 4K1EA 1YCPM 2C8YB 4X2VA 3SOSA 2P8OC 2YMSB 3F9GA 1MQ6A 5DGJA 4GAWA 5FPSA 2UWOA 4WH6A 2WSSD 7KMEH 1O5FH 3A7VA 1JXPA 3A7YA 3HPTB 1Y3WA 4UFEH 3LOXA 1HRTH 3P92A 5SGAE 4I86A 5BPEA 1IQHA 1ELDE 4NG9H 4NIXA 2CMYA 2OUAA 4MLFB 3OEHD 1Y3UA 1O37A 2TIOA 4UONA 2FIRH 2BY6X 1ZR0A 4BANB 1Z7KA 2IPHA 1EUFA 1ELVA 1H9LB 1LDTT 3V12A 5EW2H 3FKSD 3T27A 2F9BH 3FP8E 3QZQA 2KM0A 2BOKA 5IYTA 1V2NT 2ZDVH 3RDZA 3UR6A 1F5LA 1V2RT 1YPMH 2XXLA 4JYUH 1OWIA 2FX4A 5I46H 1K9OE 1EB2A 4Y6DA 4JYVH 5DP6A 1GI1A 2Z9LA 1GI6A 1DSUA 1GJ6A 1UTQA 2HWLB 1RTKA 1NFWA 1TYNA 1DITH 3OU0A 1E34B 1HAVA 1N8OB 4GCHG 2F9UA 4O03A 2G00A 2Y80A 5EOKA 1ZPCA 1GJDB 1IAUA 1P02A 1TNHA 3MMGA 1UTOA 3P6ZB 3U69H 4Z1MD 1ZTLA 5AF9H 3SBKA 1TAWA 5FL7D 2R2MB 3RXGA 3RXDA 3GISB 4FVBA 1EZQA 2C8XB 1NRRH 3AVZA 2CHAC 1BB0B 1RFNA 1HIAA 1VZQH 1TNLA 2OD3B 4KP0A 3SU3A 1QA7A 1Z8JB 3VB5A 5FHTA 3BV9B 1IQFA 1TX6A 7ESTE 1CT4E 2QXHA 1H1BA 4I32A 1GG6C 2Q1JA 3U8RH 2QF5A 3BG8A 2XOKD 2YOLA 5E2OA 3ZVDA 3ZZ8A 1GVZA 2J4IA 3SGAE 1VCPA 2PHBA 3O8CA 2HNTE 3MNCA 3TLOA 1B7XB 1P0SH 1BTHH 1DWCH 1BBRE 2GV7A 3TJUA 3KL6A 3DT0H 4X2YA 4A1VA 1CVWH 1C2JA 4AN7A 1SFQB 2BD9A 2SGAA 2FMJA 3DFLA 4MTBA 5GIBA 3KGPA 3MH6A 5L2YH 4CRGA 1P2OA 5EXMA 3RXCA 1ORFA 3LU9B 3TH2H 2RA0A 2A4QA 1IHTH 5ESTE 1AGJA 5C67A 1CU1A 3RXMA 5A0CA 1C2KA 2A45B 2JKHA 2XW9A 4B2BA 3MH4A 1MUEB 3N7EA 1OHHD 2F9PA 1G32B 4ABGA 1N6XA 4P02A 3VGCC 1BHXB 1OXGA 4BTTB 2AGIX 1GBCA 1P8VC 5JBCS 1ACBE 1O39A 1Z1JA 1GHZA 1A5GH 3EYDA 1GJ8B
chains in the Genus database with same CATH topology
1Z8GA 4CRDA 1PQ8A 3BTWE 1Q31A 2FODA 1D3QB 4LXBH 4NGAH 5EG4A 2SNWA 3UQOA 1O3GA 2W3KA 1OYQA 3KQEA 1ZRBA 3TITA 1S0QA 1OWKA 4BXSA 1TFXA 4ABEA 3SU6A 1P01A 1GCDA 3A87A 1Z8RA 1ESTA 2SGQE 1GBJA 4MNWA 3P8OA 2Q6FA 1C1OA 4E7RG 1HFDA 3NPSA 2BQ7B 1W3CA 2TPIZ 5BRRE 2ZFRH 2Q6DA 3AAVA 3RC5A 4WWYA 5A2MH 3S0NA 3A8AA 1BCUH 1VGCB 1RD3B 2OP9A 1H4WA 2SFAA 3LGVA 5E0HA 2GP9B 1P12E 4RN6A 2JH6D 1ELFA 1PPGE 1TX8A 1O2GH 3PO1C 4KKDA 4DVAU 2G5NA 3EAJA 1GMCF 5E0JA 3U9AH 1GMDF 3HK6B 2OLGA 1JRTA 1S85A 3DFJA 2VIVA 1WAYB 2PSXA 1L1NA 1GDQA 1NRPH 2GTBA 4X8UH 5CE1A 1XVMA 1W14U 3IG6B 4INLA 1MKWK 4OGYA 1QFKH 1K1JA 3KQBA 1AO5A 3L3TA 1ZYOA 3H5CB 3SUGA 5A0AE 1TBZH 1ESBA 3RXSA 3U8OH 4JCNA 1WYKA 1SQAA 2ZA5A 1K28D 2GZ7A 1SGPE 3GY4A 1E38B 5GDSH 1MKXH 3RXEA 1O2SA 1QNJA 2WPHS 4CR5A 3QUMP 3SU4A 4ABDA 1L4ZA 4D8NA 1HAHH 3SJ8A 3LH1A 2FOGA 3UTUH 2HOBA 1C4U2 3GICB 1SLUB 4FVDA 2OBQA 3LGTA 1F5KU 5L6NH 4ASHA 1P10A 3PWBA 4JZEH 2XYAA 2ODPA 1YLCA 2C93B 1LHEH 3ZVBA 1NU9A 5DK1A 2J9NA 2A5IA 2HNTC 1C5TA 2QY0B 1MTVA 2FLBH 2ZHFH 3SJ9A 1Y5BT 2R2WU 5HM9A 1ZJDA 2Z9GA 5C5NA 1UCYE 2VNTA 1NFXA 4E05H 1T31A 1IOEA 1P2IA 2G5VA 4Y71A 3SORA 4H4FA 2W3IA 2PLXA 1KTTB 4QT8C 4ABBA 4TWYA 1ANEA 3RMOH 2Y7XA 1GI8B 1GBMA 1UMAH 4YT6H 1E36B 5CHAB 1GJCB 3HK3B 3B8JA 1AZ8A 1BUIA 3PMHB 1C5RA 3A80A 2BY8X 2GV6A 3SZNA 1F0SA 2ZQ1A 2PKSB 5JBBS 3LONA 1S0RA 1O38A 2V0BA 2H5CA 1SFIA 1TGNA 1WBGB 1O5EH 4Y10E 3MTYA 3AASA 3Q00A 1C1SA 1DICA 1YPGH 3TNTA 1SQTA 1GDUA 1QL7A 3NXPA 2FOBA 1W13U 4ABHA 2WUBA 5A8XA 4JYTA 1HXEH 1C4Y2 1XM1A 1T8MA 1C1NA 2BDGA 3O8DA 4XBDA 2QV1A 1SG8B 3HKJB 4BTIB 1O2OA 4K1TA 3A88A 2THFB 1JWTA 1NTPA 3GYMA 3ITIA 1O0DH 1RXPA 1WU1A 1KSNA 2AFQB 4K5ZA 3CS7A 4BAQB 4X1NU 5HGGA 1C9PA 1G3DA 3SV2H 5DPAA 2J94A 4NSYA 3LKWA 1GMHF 1V2MT 3ATWA 3RC6A 3E6PH 3ZZ6A 3BEIB 2FI4E 2UWPA 1UVOA 1NT1A 3SI4H 9ESTA 4Y76A 3M3VA 5GCHG 2A7HA 2JH5D 2G52A 1DANH 1QBOA 2WYGA 2VH6A 1GI7B 2BZ6H 4UFGH 1TGTA 2A32A 2TBSA 3ESTA 3GCNA 4NSVA 2EA3A 3D62A 4CH2B 2XTTB 3VB4A 5K7RA 3SHCH 1EJAA 3SU1A 1C5MD 1OP8A 2O9QA 3TJVA 1GVKB 4ZKRU 4NFFA 3MFJA 4JMYA 1THPB 1DDJA 3ZV9A 1EB1H 2QF3A 2TGPZ 2A4RA 1LMWB 2G4TA 5DP7A 1HCGA 1INCA 4U01A 1NU7B 2NU0E 2V3OH 1BZXE 2V6NA 1P2QA 2ZHEH 3UY9A 5FCRA 3T2NA 2TRMA 1EQ9A 2B9LA 2EC9H 4ZMAH 5L2ZH 1F5RA 5FCKA 4GSOA 3TGIE 5T3HA 1ZSLA 3LJOA 1B5GH 2KAIA 1ZGVA 1CHOG 4OS1A 2IJOB 4UD9H 1MTNB 3SNEA 1QURH 2D8WA 4ABJA 4NA9H 3QGJA 2BQWB 2WYJA 4X2XA 2SNVA 3MHWU 1O3HA 2NWNA 2XC4A 4B1TA 2PUQH 5TCAA 4AX9H 4AG2A 4YO9A 3GY5A 2GZ8A 2BLOA 1SGCA 3UPEA 4O3TA 1CGHA 2PGBB 2Z6BD 1V2PT 2J92A 5ESBA 1D9IA 4NA8A 3SI3H 4BAKB 2ESTE 3PWCA 1ZHRA 3LC3A 1MMJN 1DXPA 1JRSA 1CHOF 2VIQA 2CGAA 2GD4B 2FS9A 1JIMA 1W0YH 2BLQA 2GCHG 2PUXB 1V2KT 3RXUA 4AFSA 3ZYDA 3SV8A 1VGCC 2H1UA 1AWFH 4OGXA 1ZTJA 2P93A 1FUJA 1L1GA 4RSPA 1TX7A 2BD3A 4YT7H 2R0KA 4UE7H 1XKBC 3SV6A 1HNEE 3A89A 1GI2A 1J17T 4B73A 1O3DA 4BXWA 1EZSC 1OSSA 1ETSH 5H4IB 1WUNH 2ZU2A 3TGJE 1AE8H 1C1RA 2ZU3A 1FN6A 5CMXH 2QGRA 4CHAB 2HNTF 4LOYH 2CF8H 8GCHG 2OTVA 3TK9A 1C5SA 1D6WA 3M5OA 3BTFE 2AEIH 3SW2B 1GHBF 2A31A 5FPYA 3BEFB 1XUGA 2OCVB 3D23A 1BJVA 1TNKA 4CBOA 1EZUC 1PPFE 2ZU1A 3RLWH 3TIUA 4HTCH 1GMCG 2ZGXH 1OYTH 4LK4A 3ZZCA 3EA7A 2GDEH 3DA9B 3GYLB 1FY1A 3S69A 5LPRA 2VB0A 2AS9A 2A4GA 2W7UA 2FOHA 1KIGH 4ABAA 1QY6A 1HV7A 4F4OC 3NKKA 1OWDA 1AVXA 1SOTA 1UVTH 1ZTKA 2A1DB 4XBBA 1AY6H 1S6HA 2R3YA 1G30B 1HAIH 1MD8A 2WPKS 2ODYB 2QC2A 1QL9A 3TNSA 4IN1A 3UR9A 1SSXA 1ID5H 2C4FH 2VGCB 1JIRA 1P57B 1TRYA 1RS0A 1RTLA 3Q76A 4KGAA 1A61H 4FUJA 4IN2A 4D9RA 3TPIZ 5EODA 3UWJH 2BD4A 2J38A 1TRMA 2ZZUH 2QXIA 2A4OA 2ZFQH 4PROA 3ZZ4A 3B23B 1OX1A 2ZIQH 3SV9A 4DURA 2ZDAH 1P9SA 1MBQA 2Z3EA 2DE9A 1A5IA 3BN9A 2V35A 4CBNA 1LQEA 1ESAA 1O3CA 3E0NB 1AE5A 1C2IA 1DY9A 3M5LA 1YPHC 1UCYK 1NZQH 3O8BA 1O2MA 1Z71A 1WCZA 5C5OA 3BEUA 1ZSKA 1G3CA 2VWMA 1OPHB 4ESTE 4VGCC 1FXYA 3GY7A 1LPGB 2Y6TA 1GBLA 2VIWA 4K3JA 2GT7A 2PKSC 1UK4A 4FUFA 1O5DH 2PW8H 3BF6H 4KTSA 5A09A 1SR5C 3GY6A 1GHAG 4FXGH 2BLWA 2UUFB 1QRXA 3EE0B 4K2YA 1PPBH 5I25A 1VJ9U 5TJXA 4BAOB 1N8OC 2BVSH 4MNXA 1QTFA 3E90B 4YOJA 3G01A 1FN8A 1DPOA 1VR1H 4YOGA 3OSYA 4GHQA 4X8TH 2BD2A 3FAOA 1ELEE 2BZAA 3F9HA 3QO6A 4TY7A 1ZMLA 3FZZA 3OYPA 1EAXA 2QIQA 1SMFE 1C4V2 4YTAA 1TALA 3TH3H 1Z8IB 1F0TA 1A0LA 2C3SA 1W7GH 5ABWA 5GJ4B 2G4UA 3VB6A 5HYOA 1IQLA 1Z6EA 1DLKB 2DUCA 4YOIA 2PGQB 4OS6A 1BQYA 2WV5A 5AFZH 3BTKE 1O2KA 1QB6A 2ZNKH 3LC5A 1C2LA 2ILNA 1UJ1A 1WQSA 1MCTA 5HXFA 4X6PA 1D3DB 2TGDA 3STIA 5GXPA 1YCPK 5FXLA 1AN1E 2QYIA 4Y7BA 3SNBA 1TONA 3BTQE 1O5AB 3AW1A 3K6ZA 3U8TH 1SGFA 6GCHG 2ZC9H 1P03A 1PPCE 1BITA 4NWLA 5PTPA 1Y3XA 1BTPA 2F9OA 1TPAE 4HI3A 1LO6A 1GBAA 3UOUA 2ZWLH 1CBWC 2OQ5A 3D65E 2GDDA 2ZECA 1ZHPA 4I31A 1QL8A 4J2YB 3D49H 3TK5A 1WSSH 2Q6GA 1YBWA 2ZHQH 4X6OA 1GBDA 1G36A 1K1MA 4ZUHA 1H9IE 3T5FH 1YF4A 4MPUA 4X6NA 3BSQA 2O8TA 1KXDA 3MWIU 3M7TA 3BIUH 2Y5FA 1FJSA 1QRWA 1DUAA 2V3HH 1O2ZA 4ABIA 1AHTH 1O3NA 3A7WA 1LQDB 5A8ZA 3GY3A 5EW1H 3SN8A 4TWWA 4MG3A 2P95A 4AORA 3P70B 1FPHH 1BDAA 1ETRH 4MPWA 1V2OT 2OXSA 1MD7A 3KN2A 2BD5A 1GHXH 3UOPA 1TWXB 2WPLS 1O5GH 1J16A 6ESTA 3PV4A 4X1QU 2BYAX 3MI4A 2LNCA 2ZDLA 4DJZB 2G81E 1HDTH 2GZ9A 2PFEA 4K1SA 1XKAC 4ISLA 3ZZBA 1DWDH 1AZZA 3PMAB 1FIZA 1D6RA 1MTUA 6GCHF 1C5VA 3GCHC 1XUKA 2W7SA 1Z6JH 3RXQA 1HAOH 3LGUA 1TQ7B 1GL1A 1J9CH 1ANBA 4X8SH 2B0FA 3T29A 3PB1E 2BOHB 1P2JA 2FM2A 3KQCA 1GHBG 4OS5A 1AIXH 3MNXA 4I8KA 1SVPA 4A1TA 1C2GA 4WVPE 1T4UH 3FVFB 3PMBB 4KTCA 3QWCH 1HYLA 5FAHA 1P2NA 2F9NA 2F83A 4MNVA 3CENA 6CHAC 1C1PA 4E06H 5EQQA 2ZPRA 1O2TA 3M3SA 3URDA 4ISIH 2VWLA 3RM0H 4NFEA 5J4QA 4CHAC 1ANDA 1O2WA 1O3IA 4UFFH 1AD8H 1KTSB 5FBEA 1Q2WA 1V2UT 4O3UA 4XOJA 2G51A 3BG4B 3NK8A 4AYYB 1UTMA 3F9EA 2H9TH 1VITG 2SGEE 1AUJA 2GCHF 2UUKB 1YC0A 2PWXA 5DP5A 1O2UA 1DS2E 2CV3A 1C2EA 1RIWB 1C5NH 3RXRA 3NZIA 3TVJB 2K1QA 1DLEA 3SJOA 2H9HA 1S82A 3GCTG 3FANA 1GHWH 4BAMB 2RG3A 1D3PB 1IQNA 2A5KA 3UUZA 2ZFPH 3GDVA 4AB9A 2H9EH 5DKMA 2ZO3H 4CRFA 4FUCA 4GVUA 2FOEA 1HAYB 4B74A 3IITA 4BNRA 1W11U 3RXLA 1OWEA 2VGCC 2XBXA 2R0LA 2F91A 2GT8A 3T25A 4D7GA 3ODDA 4BAHB 1LVMA 2W5EA 2C90B 1YPKH 1NRQH 1PPZA 4K8BA 1ELCA 2I6QA 2BXTH 4YESB 1WTGH 2UUJB 5EGMA 4M7GA 3RUOA 1CA0B 2XRCA 2ZFSA 1FNIA 2B8OH 1GI0A 4DT7B 1IQKA 3I77A 4ZKNU 1FAXA 1TRNA 4X1SU 3SQHE 1H8IH 3LGYA 2FO9A 1AKSA 2BX4A 4U30A 5DJ7A 1O2PA 2GMTC 2VJ1A 2FP7B 4A7IB 2BDBA 1OP2A 2FYQA 2XNIA 3ZVGA 3MH7A 3JZ2B 1E37B 3M5MA 4TPIZ 1HAXB 3HGPA 2BD8A 3WY8A 1P09A 1F2SE 3ELAH 1QCPA 1Y8TA 4OS2A 2ZGHA 1A3EH 4UEHH 1PYTC 4U32A 1EJNA 1C2DA 3RXHA 1XX9A 2FDAA 1ELTA 1HJ8A 1T8LA 4IC6A 2O8WA 3TH4H 1F92A 1V2LT 4AGJA 1P11E 3JZ1B 4H6SB 5C1YA 3PTBA 3V7TA 3C27B 1O2NA 1EOLA 4I33A 5FX6A 2RCEA 1SLWB 3PROA 1IQJA 1AFQC 3L6PA 1C5YB 2BDYA 1TOCB 1AFEH 1ABJH 1WQVH 2NU3E 2JH0D 3A82A 1XUJA 2A2XH 2PKAB 3MU8A 3RMNH 2J95A 1YPEH 1GPZA 1TGSZ 1FV9A 3FFGA 2OINA 3L33A 4R8TB 2IOTA 1QQUA 4ABFA 1O2IA 3NCLA 2ZGJA 1BIOA 3A85A 5EU8A 1SBWA 2XBYA 2FX6A 3RXJA 3RC4A 2BDIA 4RKOB 1TBQH 4ZXXH 3E8LA 4K8YA 1TPPA 1LKAA 1PFXC 5AFYH 5EQRA 5EPNA 3W95A 1GDNA 1O5BB 3SNAA 2EI7A 4K69A 3R3GB 1FZZA 5C1UA 2VH0A 2HVXA 4FU8A 5F6MA 3LIWA 1GHVH 1ETTH 4WMFA 1CGJE 2ZHWH 1V2JT 3CP7A 2SGDE 1L2EA 3I78A 3QZRA 1IQIA 1Z1IA 1VJAU 3UQVA 6LPRA 1TPSA 1YPJH 2HLCA 2ZDNA 3DHKH 3OX7U 4CREA 4K60A 1NPMA 2CN0H 4NIYA 1CSOE 1OWJA 1NY22 1LHGH 1GI5A 1GGDB 4MVNA 1O3EA 2TGTA 3F68H 4INKA 1Y59T 1LVYA 2Z9IA 5HMAA 2R3UA 1B0FA 3M7QA 1V6DA 3PLKA 5DP8A 3RXKA 1GJ4H 4Q7ZA 1P04A 1MKXK 5A0BA 4GCHF 1Q3XA 1KXAA 1FAKH 2ZI2H 1GWAA 3RXTA 3U98H 3UNRA 1P05A 1GVLA 1MBMA 2OC1A 5C20A 1S6FA 3S9BA 3M7UA 2AMDA 1G3EA 3U1IB 4X1PU 2BXUH 2FXRA 1O2RA 4KELA 4AG1A 1BBRK 1O3KA 1FY3A 3A86A 1P3CA 2GCTB 1V2VT 5DG6A 2Y81A 1W8BH 4ZHLU 4Y0YE 2AMPA 4SGAE 4A1XA 1EPTC 2ZP0H 3GCOA 1Y3VA 1DT2A 1Y5UT 2XWBI 3H7TA 3R0FA 2BTCE 1CT0E 1SHYA 1AKSB 4WXIA 4D9QA 3VPKA 5EXNA 4X1RU 3SQEE 2BY7X 5B6OA 3RXOA 2I6SA 3GCHB 2VVVA 5J4SA 2FOMB 1WV7H 2W26A 1KXFA 1KDQA 1K1IA 1XXFA 1YM0A 3MU1A 3ZZ7A 1GCTB 2AIQA 1IQEA 1AMHA 1JOUB 1Y5AT 2ZDKA 3ZZ9A 1UHBB 2BMGB 1RTFB 1QIXB 3VB7A 3O8RA 1O2YA