4XOJA

Structure of bovine trypsin in complex with analogues of sunflower inhibitor 1 (sfti-1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Investigation of Serine-Proteinase-Catalyzed Peptide Splicing in Analogues of Sunflower Trypsin Inhibitor 1 (SFTI-1).
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xojA02
1KTTB 3UQVA 4X2WA 2R3UA 1C5LH 3RXTA 2BVXH 1FZZA 2FIRH 2Y5FA 3MU0A 4IMZA 2XCFA 2VIVA 5FBEA 1AWFH 2ZFSA 4XE4A 3BN9A 1AD8H 3W94A 1DPOA 1KXAA 4K60A 1L0ZA 1JRSA 2HPPH 3W95A 2B5TB 4NA8A 4YZUA 1C5XB 4CBNA 1E38B 5HXFA 1THPB 2UUJB 1GJBB 3LC5A 2HPQH 4CBOA 4D9RA 2EC9H 2VVCA 1LHEH 3TK6A 5DPAA 1HLTH 5E0GA 3RXSA 2BLVA 3MWIU 1QRXA 4NIVA 5I25A 1C2MA 1Z8IB 5AFYH 4K8BA 1C5TA 1D4PB 2GCHF 1NU9A 3GICB 1C2IA 1GI3A 1O2UA 2A7HA 2GGVB 1QFKH 2EEKA 2GMTB 4JK6A 3MNCA 1SQAA 2VIOA 4IN2A 3SU2A 1HIAB 2P8OB 5GIBA 1QB6A 1JXPA 1SLVB 1UK4A 1ZTKA 3D62A 2XTTB 3GY6A 4ISHH 1OKXA 2FLRH 3BTDE 4XBDA 1GBCA 5CHAB 1NO9H 1ELFA 2VGCC 2ZDLA 1F0SA 2BDGA 1O3DA 1OWKA 3CENA 3I77A 1GHAF 1THSH 1IHTH 1ZJKA 3MTYA 3VEQB 2F9VA 2EA3A 2Z3EA 1O32A 7GCHF 1TPAE 2HVXA 4Q7YA 1E34B 1V2OT 1C1RA 1HPGA 1F5LA 3UIRA 5C5NA 1G36A 1O2GH 1G2LA 3M61U 3BG4C 1LDTT 1LHDH 1QR3E 2CV3A 4ABFA 2PKSB 1EOLA 5HM2A 4X1QU 1P10A 5L2YH 1FAXA 2BVSH 2BDBA 3ATIA 5DP3A 3AAVA 5A0CA 2ZA5A 1WOFA 4IW4E 2J2UA 3HGNA 4DOQA 2GX4A 1SQTA 2OCVB 2NU1E 1TIOA 3ZVDA 3BIUH 4WH8A 1Z1IA 4BANB 4ISNA 1A5HA 4D76A 3NCLA 2H9HA 5GCHF 1D9IA 1SGFG 2A0QB 3RXJA 1BTWA 5JBAS 3BTKE 5F8ZA 3BEIB 3BTFE 3MO3A 1JBUH 1Y5UT 3EQ0H 3P8NA 1AUTC 1V6DA 1O3KA 2HNTE 1GI5A 5C3NA 4IC5A 2VH0A 1PYTC 1XM1A 1GI1A 1GJAB 2H5DA 3T29A 5T6DA 1WBGB 2A31A 2ZDAH 2H2ZA 2V3HH 1F5RA 4ZKOU 1CHOG 2D8WA 2WYGA 1QBNA 2F9OA 1DSUA 1FY3A 2UWOA 2SGEE 4ABHA 4U01A 3ESTA 1ETRH 1HAVB 2BMGB 2STAE 1O33A 3BV9B 2H5CA 1UTLM 1PPBH 5EXMA 2EI6A 4ISLA 3OY5U 1NZQH 1J8AA 3OX7U 1ZRKA 1GBFA 3SHAH 2A4RA 4BTUB 4FUGA 3HATH 1CHGA 3A8BA 1DM4B 2ZQ1A 1C5OH 1UCYK 3B8JA 1L4DA 2SFAA 4CH2B 1OX1A 3UNRA 5JDUB 1SQOA 1GBTA 4A92A 1KXEA 1O2MA 1GJCB 3SW2B 1EZQA 4NA9H 5A09A 4E05H 1KTSB 5SGAE 1TB6H 3P6ZB 2QXIA 1LVYA 2PWXA 1UMAH 4X1NU 2J94A 1P11E 1UHBA 4NGAH 1INCA 2V0BA 3MI4A 2ESTE 2ZTZA 4BAHB 3DT0H 4JCNA 1FMGA 1AIXH 4VGCC 1T8NA 5A8ZA 2GDEH 4TY6A 7LPRA 1PQ8A 1O39A 1S85A 3RXCA 2G55A 3LU9B 4MTBA 1CGHA 3RU4E 1AY6H 2WUCA 3RMNH 5FPTA 1J14A 1O2SA 3RC4A 1TGNA 1C5QA 1AGJA 4TPYA 5E0JA 3RXRA 3SV2H 1MCTA 1ZHRA 2QN5T 3U98H 1FY8E 4IC6A 4IGDA 1D3TB 1HAIH 5A8YA 4NIYA 1QQ4A 1C1OA 1Z1JA 4B73A 5AF9H 1E35B 1S6HA 5F6MA 4XBBA 2GCTC 3U1IB 5GWZA 3A7XA 1WUNH 3P17H 1EOJA 1BA8B 3RXIA 1UTPA 1ORFA 2J9NA 3BTTE 3UNSA 1G37A 3RMOH 1TBQH 3PMAB 3MNBA 4X6MA 1XXFA 4AFZA 1C5SA 3CS0A 2P94A 1EPTA 1CHOF 1GDNA 1LVOA 1JIRA 1YCPM 2XCNA 3F9FA 3A88A 3P95A 2QF0A 2AMPA 3ATLA 1TNJA 1TA2A 3ODFA 2XBWA 1V2WT 2CJIA 4WMDA 1PPCE 4TPIZ 4Y8YA 2AMDA 4Y76A 1DXWA 3B23B 4HTCH 1FN8A 1JMOH 1SI5H 1C9TA 1SGRE 1DWDH 1YF4A 2Q6DA 2VVUA 2HWLB 3PLBA 3LGVA 1G32B 2ZG0H 1GJ4H 3SQHE 1GWAA 2QXHA 3TGJE 1NRRH 6CHAC 3ZZ8A 2VINA 3ZZBA 4YOJA 1BTYA 2FWWA 1TABE 1BHXF 3HKIB 1ZZZA 1J15A 5FPSA 3QDZB 1P9UA 1P04A 1SGEE 1W3CA 2TGPZ 3VFEA 2PHBA 1FLEE 2V3OH 2ZU5A 1O2KA 3VXEH 1F92A 4R0IA 1C9PA 4MPVA 2CF8H 3V0XA 1JRTA 4F49A 1C2EA 5A8XA 2FI5E 2ZI2H 2XC0A 1SPJA 4JZEH 1SFQB 4X1PU 3P8OA 4B76A 4YO9A 3MH4A 4NSYA 1TAWA 2W7UA 1NESE 2O8LA 3M35A 5DGJA 3SGAE 1LO6A 2ZDVH 3OSYA 3Q3KA 1IQFA 1UTKA 3E1XB 3UREA 1SG8B 4AFUA 1T31A 2ODYB 1Q2WA 3SJOA 1OYTH 4Y0YE 2ULLA 1O34A 4GHTA 5G4BA 1O3CA 4CRAA 1GJ5H 3SGQE 3M7QA 4GAWA 2ZDKA 4XDEA 1P02A 3ATWA 1V2UT 1QJ1B 3Q76A 1ZOMA 1BBRE 4MPWA 4X6NA 1ESTA 1P2QA 4ZROA 3QK1A 3GCNA 4ZHMU 1AVGH 4YLUA 3VGCB 3ZZCA 4JYVH 5L2ZH 4RSPA 5E8EH 1C5ZB 2QIQA 1MBMA 2F91A 2OINA 1B0EA 2ZEBA 4XSKU 1EQ9A 1GCTB 3CS7A 5LGOA 1C4U2 2GT7A 2B9LA 3KQDA 5LPRA 1BTUA 2GV6A 1P2JA 4WH6A 3ZVFA 3RXDA 1BTHH 1D3QB 4FUJA 3QGJA 1O3BA 1FQ3A 5EG4A 2AFQB 3KL6A 1V2KT 2GZ7A 3N7OA 3RM0H 2BD2A 4CHAC 1GPZA 5JBBS 1NU7B 2PSXA 4FU8A 1QTFA 1DVAH 3GCHB 1TE0A 1RGQA 4X8SH 4Y11E 4U2WA 4FUDA 4FUHA 3EGKH 3MU5A 4K3JA 1MTUA 2BX4A 1IQEA 4MNXA 2ZCLP 2P3TB 4IBLH 2CN0H 1TYNA 3BTME 1AVXA 3RXBA 1ETSH 1B7XB 1Z7KA 3R0FA 1G2MA 2NU3E 2ZHFH 1BIOA 4YLQH 1J17T 1HB0B 3DHKH 3BTQE 1SGDE 1Y3YA 1O36A 4B2AA 1C2LA 2A7CA 1WSSH 1AU8A 3DA9B 1GDUA 1GGDB 1K22H 1KSNA 3MH6A 1YPJH 4GHQA 5GPIB 6GCHG 5GXPA 1S0RA 1ARBA 5A2MH 1TNHA 1Z71A 3M36A 3NKKA 1ZLRA 3T27A 3OY6U 1NFXA 5DP7A 3UOPA 3ZZ6A 4M7GA 3SU6A 1TMUH 1QL8A 1TQ7B 2GD4B 2AGEX 4ZHLU 2ZFQH 1P2IA 1O2VA 1F7ZA 1KXCA 3SNDA 4ABDA 3A8AA 4E7RG 1S0QA 2OXSA 1NRPH 1FY1A 3KQEA 2A1DB 2Y7XA 2BQ7B 4IMQA 1HNEE 1MU6B 1C1UH 1P8VC 1HXEH 1C1PA 2PUQH 2DUCA 1DLEA 4AN7A 2VWMA 1O30A 5C2ZA 1ANCA 2JH0D 1C1WH 1QURH 3VB6A 1NRSH 2R3YA 3HPTB 4CRDA 2AYWA 5IYTA 1TNIA 2ZPSA 1NS3A 1TLDA 1GCDA 2GMTC 2KAIA 3LC3A 4D7FA 3P8FA 5EQQA 3M3VA 4MNWA 1TONA 1ZYOA 3BEFB 2P8OC 4INLA 4X6OA 4K1EA 5FCKA 1SGYE 1FONA 1TPSA 4WVPE 4BAQB 1C1NA 4KELA 1HRTH 1AQ7A 1GI0A 2JETC 2O8TA 2C8YB 5EGMA 1UTQA 2Z94A 1TOMH 1TRYA 3M5NA 1QHRB 5HM9A 5LPEA 1ZHPA 4NG9H 5CHAC 3SNEA 1SR5C 1CGIE 2FX4A 4AB9A 1BTZA 1O5GH 1TGTA 4KP0A 5LPFA 1SC8U 1FAKH 1LHGH 1CO7E 3FZDA 3Q77A 1MQ6A 1NROH 1XUFA 2ZP0H 4RKOB 4X2VA 3V7TA 4ABAA 1P57B 1SFIA 6GCHF 2IJOB 4DGJA 3IITA 3RP2A 3VB4A 1UCYH 1GMCG 2NU2E 2Q1JA 4DG4A 1SGPE 2SGAA 1NY22 4OS2A 1S81A 1OWHA 7GCHG 5C1UA 1BITA 1DDJA 3GY2A 2PKSC 2EI8A 5PTPA 3SUEA 1C5UA 4I8JA 1PQ5A 2AIPA 1EXFA 2HLCA 1DS2E 4I7YH 2FMJA 1VGCB 2FYRA 2J4IA 1OP0A 5F03A 1GHBG 1MAXA 1CA0B 1DUEA 1C2HA 1RTKA 2OBQA 1T4UH 1EJMA 1O3AA 4NIXA 4UONA 2CHAB 2VIPA 5CMXH 5ESTE 4DW2U 1O3FA 3STJA 2OUAA 1BTPA 2Z9IA 5F8XA 1CT0E 1PPGE 2C3SA 3T5FH 3ZVAA 1SGQE 2BM2A 1PPZA 1FV9A 1XXDA 5GCHG 1L1NA 3GY3A 5JB8S 2SGPE 5GDSH 2H1UA 4OS7A 2SGDE 1YPHC 1C4Y2 2C90B 3RLWH 3A84A 3ATKA 3KF2A 4AB8A 3OYPA 3TGIE 4FVBA 1MBQA 5AVDA 1XVMA 3A8DA 4OS6A 2LNCA 3UOUA 3CP7A 1AZZA 1AVWA 2WINI 2D2DA 1SGFA 2B7DH 3D49H 6LPRA 1TX7A 4MVNA 1NRNH 1GBAA 5K7RA 2P95A 1SHYA 2ALVA 1ELEE 1KY9A 1MTVA 3A89A 3UWJH 1HAPH 2XNIA 1HGTH 2XWAA 3QGNB 4FU7A 3MOCA 1UVSH 3FZZA 1D6RA 1RIWB 1TNGA 3HK6B 2AMQA 4BOHA 1GDQA 3KQBA 1K2I1 2XYAA 1QRWA 4NWLA 1GMCF 2A32A 4LK4A 1W14U 1DANH 3MNSA 3U9AH 4TWWA 3SNCA 3DD2H 4LZ4B 1GHZA 1UVPA 1W0YH 1H4WA 5T3HA 4FUCA 4I31A 1ZMJA 3M5OA 1C1TA 1O2NA 2P16A 2R0KA 2ZF0H 1C5MD 1GHBF 4KTSA 1UTJA 5EXLA 4ABGA 3NWUA 4JZFH 5C1YA 2D1JA 3MU4A 4MLFB 4O03A 1Y3UA 2NU4E 3TIUA 1DITH 3F9HA 3QUMP 1Z6EA 1T8OA 1C4V2 1W7GH 3U8TH 2WPIS 1QIXB 1S84A 2ZHWH 2A4OA 4INHA 2P3FH 1HAGE 2GP9B 3E0NB 1IAUA 1K28D 4AGKA 2TBSA 4KTUA 1O2HA 3E91A 1GI8B 1O31A 1KDQA 2FI3E 3RXAA 1KLIH 1BMLA 1O3MA 2G52A 2PR3A 4H4FA 4Z6AH 3G01A 2TGDA 1ACBE 3RXFA 3KHVA 2AS9A 2F9UA 1GBMA 4QT8C 1P9SA 1OWJA 8KME2 3ZVGA 1EAWA 3U8OH 3OU0A 3TK9A 1BRBE 3M5MA 1GJ9B 1LPZB 4K8YA 1C1VH 2FTLE 2TIOA 2Z9GA 4DVAU 1V2JT 1Y5AT 2F9NA 2OTVA 4JMYA 2YNAA 3SU3A 2TGTA 3RUOA 2FS9A 4J1YA 1EAUA 1O3HA 1ESBA 1VCQA 2H9EH 3EA7A 2A45B 4ABEA 3TJVA 3TITA 2I6QA 1HXFH 2G5VA 1O2YA 5C1XA 2FZZA 2IN2A 3TK5A 4ABJA 4ZAEA 3A7VA 5L30H 4B74A 3SU4A 5DKMA 2QGRA 2VWOA 4KGAA 3LH1A 2G51A 3ZZAA 1TRNA 1XKAC 5EW1H 1IQGA 3GDUA 1AUJA 1BMAA 1UTNA 2OP9A 4BAKB 2BOHB 1Z8RA 2FOBA 4ISOA 1GMHG 3UUZA 3M7UA 1XUJA 1XVOA 2VGCB 4UFFH 2Z9LA 1OWEA 2ALPA 2VB0A 4MPXA 3LDXH 3ZZ5A 7KMEH 4ABIA 2O8WA 3ITIA 1Y3VA 1AFQB 1L4ZA 2VIDA 3SI4H 2SGFE 4Y8XA 1IQMA 3VB5A 5ETXA 2AH4X 3BG4B 3QTOH 1LKAA 1MKXK 4Q7ZA 1AKSB 1Y8TA 2PTCE 1BJVA 2J34A 3TVJB 3BEUA 3ZV9A 2J95A 3D23A 3IWMA 1PPHE 1HBTH 2Y5GA 5JPMH 2FOCA 4Y79A 1DOJA 1QB9A 1U6QA 3FANA 3ZVCA 5DP6A 2AGGX 1IQJA 1OS8A 1AE5A 1RJXB 3MFJA 1L2EA 4HZHA 3T2NA 3RXQA 5JBTA 1O5EH 4ZXXH 1D6WA 1XUKA 2FOEA 1QBVH 1ABJH 3V12A 3GDVA 4NIWA 2BD9A 1O2WA 3MU8A 1K1NA 3LPRA 4CR5A 2Y6TA 1HAXB 5E2PA 2OC0A 2HNTF 3M3SA 3VGCC 2PTNA 2AIQA 4GCHG 1TNLA 2QY0B 2G5NA 4FUBA 1GHXH 1H8IH 1LHCH 4Q2KA 1GCTC 4AX9H 1O37A 1OYQA 3S7HB 4O97A 2Y5HA 2YNBA 5JB9S 6ESTA 1EKBB 4X2YA 1ELDE 3RLYH 1HJ9A 1A3EH 1KLJH 2ODQA 3RXOA 1LVMA 1Y3WA 1NFWA 2VH6A 3LONA 2ODPA 2Z9JA 1AFEH 1SGIB 2WV4A 3A80A 3MU1A 4PROA 3GCHC 3RXMA 5FCRA 2THFB 1GG6B 2ZDNA 2ZPRA 1GMHF 4X2XA 1O3IA 3F1SB 3ZZDA 4YM9A 3E16B 2BVRH 1BRCE 1O2ZA 1CQQA 1G3EA 2OBOA 3ZVBA 3Q3YA 3Q3XA 4DCDA 1C2DA 5IDKA 3SOSA 1AB9B 4I8KA 1GHYH 2O9QA 1YBWA 4UE7H 1RFNA 3PO1B 4ISIH 3RMLH 2G81E 5DP9A 1TGBA 1PQ7A 3E0PB 4AGJA 1GJ6A 4HGCA 1T8LA 4FUIA 4CRGA 1GGDC 1DX5M 1QA7A 2Z3CA 1K1PA 2KAIB 2R0LA 1LMWB 3URCA 1N6YA 3AAUA 2C4FH 5L6NH 1O3PB 2BZAA 4WMFA 1FJSA 2Z7FE 1KXBA 1LQEA 4A6LA 1IQIA 2BLWA 2BDCA 1G3DA 1Q31A 3TJOA 4E06H 1W11U 2Y81A 3A83A 3SI3H 1ZGIA 3FVFB 1A5IA 3MHWU 2DE9A 1NFUA 4Z0KA 2W26A 3O8BA 4B1TA 3VXFH 1WV7H 2HNTC 4H6SB 1NM6A 4X6PA 1TBRH 1YC0A 1C5WB 3M7TA 3VB3A 1H9LB 3F68H 3PWCA 4FUEA 1TMBH 1GL1A 1ZTLA 5J4SA 4ZMAH 1IQHA 4GCHF 4DT7B 2RA3A 2H6MA 4XBCA 3A87A 3UY9A 2LPRA 3BTGE 1EUFA 3KIDU 5DO4H 4ESTE 1F0RA 1RTLA 2HOBA 1SL3A 2BY9X 3EYDA 1B5GH 3Q00A 3UQOA 2ZFPH 3EA9A 1TGCA 4YOGA 1YPEH 1O5AB 1AI8H 2CF9H 1F0TA 4X0WU 2ANMH 3RMMH 1M9UA 4BTIB 4BXWA 3SU1A 1IHSH 2J38A 2P59A 2PKAA 1V2TT 1ELVA 2VU8E 1V2QT 4B2CA 1GMDG 4ZKNU 2FOMB 4JK5A 1P09A 3VPKA 3HGPA 3RXLA 1TQ0B 2VIWA 2BDIA 1AZ8A 3A7WA 2P3UB 1ZMNA 1ARCA 1V2PT 4Q80A 1JWTA 1EB1H 3SORA 1LPKB 1OP2A 1YYY1 2ZIQH 1ZPZA 3OTJE 9ESTA 2BD8A 3GYLB 3P8GA 4DURA 1QJ6B 1SB1H 2Y82A 3NUMA 1HAHH 1L1JA 1QNJA 2WPJS 1OP8A 3ENSB 1EZSC 2C8ZB 2ILNA 4I32A 1NFYA 2VWLA 1D3PB 2Q6GA 3UFAA 1T7CA 1CGJE 2G00A 2ZGHA 1MAYA 1MZDA 3K65B 3EA8A 4K2YA 2QAAA 1TBZH 1SLWB 2Q6FA 1YPMH 2BD7A 1IOEA 1SHHB 1VCPA 1O5BB 1O5DH 4BTTB 1YGCH 3JZ2B 1V2MT 1GL0E 1K1IA 4BAOB 2OQ5A 1OWDA 2UUKB 1VGCC 2UWPA 1C5VA 4BAMB 3E6PH 3S9BA 3KQCA 1CA0C 1W8BH 1BMNH 2ZU3A 1RXPA 1QQUA 1P3EA 3BG8A 4O3TA 2PUXB 2CHAC 4MPUA 3ZV8A 1FIZA 4WMEA 1BQYA 3KCGH 3ZZ7A 2GTBA 1FN6A 3LGWA 3P70B 3NXPA 1GJ8B 2G8TA 5AHGH 1P03A 1HAOH 1WTGH 2HALA 1XUIA 1O3GA 2FOGA 3GY8A 2A4GA 1DY8A 1K21H 3RU4D 1O2XA 2FLBH 3LT3A 2ZTYA 3E8LA 2FYQA 3ATMA 2BYAX 3PLKA 1V2LT 1V3XA 3T62A 1G3CA 5ESBA 1GMDF 5HGGA 3PMHB 3RDZA 1J9CH 2P93A 1Y59T 4WWYA 1BMMH 1VJ9U 2BD4A 1NN6A 2H9TH 5FPYA 1BT7A 3QX5H 2W7SA 4ZKSU 1EJNA 5EU8A 3DUXH 1FI8A 5DJ7A 1SBWA 2SNWA 1TX8A 4X8TH 4MG3A 1UVUH 5HMAA 3L6PA 4U30A 1QL7A 1E36B 2Y7ZA 1IQKA 1PJPA 1KDQB 1XUGA 3NK8A 1CT4E 4ZH8A 1N8OB 4K5ZA 1RIWC 4CHAB 1MKWH 2FEQH 2RDLA 1T32A 1QBOA 1QB1A 2NU0E 3TH2H 1Z6JH 3BSQA 2ZECA 3ZYEA 1C5RA 2BLQA 1E0FD 3RXHA 1TA6A 2ZU1A 3A7YA 1MU8B 1HJ8A 2CGAA 4GSOA 1ZJDA 4ZKRU 2STBE 1YM0A 1P2OA 4FVDA 1GHVH 1LVBA 4UDWH 2ZGCA 1ANDA 2BY7X 5EQSA 3VB7A 5K0HA 4K1SA 2VIQA 1WTHD 2K1QA 3BTEE 1CBWB 1UJ1A 2C93B 5A0AE 1DXPA 3A8CA 4JYUH 2VNTA 1FNIA 2O8UA 4F4OC 1A3BH 1OSSA 2ZKSA 1ZPBA 4X1RU 1CVWH 1S6FA 1TWXB 2ZHQH 2QV1A 4DIHH 1UK3A 3E3TA 2I6SA 3ODDA 1W13U 4TYDA 4AORA 4H6TA 4KKDA 3RXKA 1BUIA 4I8GA 3UR9A 5C67A 3FP8E 1UHBB 3F9GA 3A86A 2OC8A 2A2XH 4AYYB 2RA0A 2HRVA 1MKXH 3I78A 5FX6A 3QWCH 5FX5A 1NT1A 3QO6A 1ANEA 1HJAB 7ESTE 2FXRA 1MZAA 1F0UA 1HAYB 1GBDA 4LOYH 2BD5A 3T26A 4D9QA 1KLTA 1K1MA 4GLYA 3TJUA 1DT2A 1VCWA 3P92A 1T4VH 2GVFA 2Y80A 1O3LA 2ZTXA 3O8DA 1K9OE 1P12E 1RD3B 5BPEA 2ZHDA 3SUFA 3SO3A 1C2JA 1EZXC 1IQNA 3KNXA 1UO6A 1BBRH 4RKJB 1G30B 1P2KA 3BF6H 1TNKA 1BDAA 2BD3A 1V2VT 3SNBA 3UWIA 1QCPA 1FIWA 1V2NT 1VJAU 1A0LA 4D8NA 4DIIH 4FUFA 5B6OA 1VITH 2YOLA 4MQAA 5EXNA 1EPTB 3SN8A 5BRRE 1CSOE 1CT2E 2FO9A 2QC2A 1MTNB 2JETB 1S83A 2QXJA 1MD8A 3SV6A 1AO5A 4XFQA 2BTCE 1OXGA 1O2TA 5TCAA 2Z9KA 3RXVA 2TGAA 1SOZA 4OS1A 3T25A 3LIWA 1W7XH 1GI2A 1UTOA 1GBEA 1DFPA 4ZHAA 1GBIA 5ABWA 1L1GA 3TH4H 1P2MA 3KEEA 5EPYA 2PLXA 1AFQC 4GPGA 4D7GA 1SLUB 1LCYA 3LJOA 5FAHA 2ZCKP 4B2BA 1A4WH 5TJXA 3SV9A 1GI9B 1VZQH 1AWHB 1H8DH 5JBCS 1WCZA 1HCGA 2XRCA 4HFPB 5LH8A 3TPIZ 2FOFA 2PGBB 1A0JA 5FBIA 4X8VH 1MQ5A 4I8LA 3UTUH 1O35A 1S82A 4Y7BA 2ZFRH 4UD9H 3R3GB 3PB1E 4AG2A 1TALA 4THNH 2C8WB 2TRMA 3PWBA 1QGFA 1OWIA 3FAOA 4Y7AA 1XKBC 3GCTG 1GI6A 2ZDMA 3A81A 1ELAA 4MDSA 3V3MA 3S9CA 2ANWA 4GUXA 5F8TA 2ZO3H 5E0HA 2BQ6B 3PTBA 1TX6A 3SJIA 3L33A 4CRFA 4A5TS 1O2PA 4MNYA 5EODA 1MKWK 1X7AC 2ZWLH 3K6YA 3PTNA 4K69A 1H1BA 3SJKA 1O3OA 1O5FH 3SUDA 1A46H 1ELTA 2ZFTA 1IQLA 1BCUH 1JIMA 1ZSJA 3LJJA 2SNVA 2PSYA 3PYHA 3SNAA 4YT7H 1HUTH 3BIVH 5T6FA 3E90B 3TJNA 3RU4T 1QL9A 3SBKA 1MTWA 2PFEA 3TH3H 1GVLA 3I29A 1O3JA 2GDDA 1GI7B 1YLDA 1FPHH 2JH5D 2ZZUH 2R2WU 3LGYA 1C2KA 1P01A 1GG6C 1HV7A 1NPMA 1SGTA 3S9AA 1DWCH 4R8TB 3B9FH 1V2ST 1PPEE 1GBKA 2OLGA 4WF8A 4CR9A 1JOUB 1T8MA 2ZNKH 3K6ZA 2WPLS 1ANBA 4OGYA 5CE1A 1W10U 2WYJA 1AB9C 3AW0A 1DY9A 4NZLA 4Y0ZE 2WV5A 3PO1C 4E7NA 2M5TA 4I33A 1LPGB 1OOKB 1C2FA 2BY5X 3PV4A 3NPSA 5H4IB 1YPLH 2AGIX 2BHGA 1DE7H 1GBJA 2FOAA 2PKAB 1EAIA 1QY6A 4H42U 1BTXA 1ELCA 3MH7A 1PYTD 5DP8A 4FXGH 3HK3B 1W0ZU 3UNQA 1C1SA 5DG6A 1C1MA 2FPZA 2WPMS 4B71A 1RRKA 4B75A 8LPRA 3QZRA 2WUBA 3ZZ9A 3FFGA 4YTAA 5T6GA 1Z8JB 1P0SH 3BTHE 1EJAA 3C1KA 3GCTF 1NC6A 2A4QA 4UFEH 1ZSKA 4A1VA 3U69H 1DWEH 1AMHA 3LGUA 5EOKA 1MMJN 1O2LA 3A82A 1HIAA 2A7JA 3QZQA 2BLOA 3C27B 4IS5A 4TWYA 2ASUB 4XOJA 2BQWB 2DE8A 1BBRK 3GY7A 2VWNA 1DWBH 4UFGH 3S69A 3U8RH 2FOHA 4CREA 3M3TA 2A2QH 3EAJA 5DP4A 2FDAA 1HAZB 1SSXA 4HI3A 2PGQB 1CU1A 1H9HE 5GJ4B 1MD7A 3LGIA 1O0DH 3GISB 1ZMLA 1O2IA 5E2OA 2W5EA 3QTVH 2A5KA 4DY7B 1W12U 1RTFB 1EB2A 2FM2A 4MNVA 4WXVA 5TCCA 2D26C 4UFDH 1O2OA 1FY4A 3RC6A 4O3UA 3SU5A 1O2QA 2BDAA 1P06A 2XBYA 3ZVEA 4CRCA 3MH5A 4Y8ZA 2ANKH 1FDPA 4FU9A 1AHTH 3SUGA 1E37B 1TGSZ 1WQSA 1ZR0A 2BXUH 3TLOA 1EAXA 1BRAA 3PMBB 3M37A 4KTCA 2GV7A 1OPHB 1Z8GA 1UCYE 1F2SE 1KYNA 2ZQ2A 3RXPA 1CA8B 4NSVA 4SGAE 2FESH 2G4UA 2HGTH 2OC1A 4BNRA 1O3NA 1ZGVA 3GY5A 1PPFE 1GBLA 2F9BH 2UUYA 2XBXA 3PROA 5DK1A 1YCPH 4NFEA 2ZHEH 1O38A 3H7TA 4AG1A 1FUJA 2FP7B 1DSTA 2BDYA 4YESB 2ANYA 1PFXC 3DFLA 1DLKB 2QYIA 3GDSA 2G4TA 2IPHA 1GI4A 4VGCB 2GZ8A 4LZ1H 3MO9A 4DJZB 1LTOA 3RXUA 3EE0B 1SGCA 1ABIH 4NWKA 1O2RA 2XW9A 1XX9A 2XC4A 3MO6A 4K1TA 1K1JA 1GJ7B 4A1XA 1HAVA 1SVPA 4GVUA 3UR6A 2ZU2A 1A1RA 1FPCH 4A7IB 2V35A 1ELGA 2AEIH 3D65E 1GVKB 3PM3A 1LQDB 2Z3DA 2A5AA 1GBHA 1ID5H 1QRZA 2GCTB 4IN1A 1G9IE 1WQVH 1YKTA 1F5KU 2J92A 1QJ7B 4ZUHA 4NCYA 3F9EA 2UWLA 2BOKA 1KIGH 5A0BA 3LOXA 5EPNA 2PV9B 3T28A 1YPGH 1H9IE 1O2JA 2F83A 1SGNE 1UVOA 4Y10E 2QCYA 3LGTA 2W3KA 1YLCA 3IG6B 3NZIA 1C5YB 2R2MB 4ZXYH 3LH3A 4NA7A 4X1SU 1AN1E 5C5OA 3TNTA 1P05A 2EI7A 4YOIA 3U1JB 1VITG 3SU0A 3SQEE 4AYVB 3RM2H 2BX3A 3ZZ4A 3V13A 2ZC9H 5FHTA 1YPHE 2AERH 3K2UA 4RN6A 1DUAA 5C20A 3H5CB 3S7KB 3HKJB 2WPKS 1N1LA 1ESAA 4Y71A 3SV7A 6CHAB 3LKWA 1XMNB 1N8OC 2F3CE 1D3DB 1TPOA 1SMFE 3BTWE 1BB0B 1AKSA 4WJG2 2O8MA 2V6NA 4J2YB 1THRH 2SGQE 1GJDB 1A61H 3PLPA 2ZFFH 4O9VA 1A5GH 2GZ9A 1HYLA 4U32A 1Q3XA 8GCHG 1BOQA 2ZCHP 1GVZA 2Z6BD 4OGXA 5EQRA 5HYOA 1C2GA 1KXDA 1MUEB 1Y5BT 2NWNA 4Q7XA 3QN7A 3A7TA 1WU1A 2BDHA 3RC5A 1HFDA 1C5PA 1ETTH 2ZGXH 3M5LA 1RS0A 1CBWC 3FP6E 3A7ZA 3SGBE 2FTMA 4INKA 3TNSA 1K1LA 1FY5A 1YP9A 1EX3A 1FXYA 2QA9E 3SV8A 3AVZA 1K1OA 5FXLA 3S0NA 3GY4A 4CRBA 4JZIA 1MTSA 2TPIZ 3GCOA 1BRUP 1MH0A 1Y3XA 2R9PA 1G3BA 1DICA 3WY8A 1ZRBA 4OS5A 1UVTH 2BXTH 1HDTH 2FI4E 2JKHA 8ESTE 1A7SA 5EW2H 3KN2A 1C5NH 4A1TA 4BXSA 3GOVB 3GYMA 2A5IA 1EATA 1LHFH 1C1QA 1O5CB 1HJAC 1ELBA 2B8OH 3JZ1B 2PW8H 3F6UH 2C8XB 2UUFB 2WPHS 2ZGBH 2JH6D 5JYIA 5DP5A 1ZTJA 1VR1H 1EASA 2BY8X 1VITF 2OQUA 4ASHA 2XC5A 3URDA 1EP5A 4AOQA 2GT8A 2W3IA 1QA0A 1V2RT 3ZYDA 1BJUA 2BB4A 3KGPA 3O8RA 2B0FA 3MNXA 2VVVA 1GHWH 4NFFA 1BHXB 2BY6X 4AFQA 1YCPK 1A2CH 3DFJA 2RG3A 1YPKH 1ZHMA 3TGKE 1EP6A 2OC7A 3SJ9A 1A0HB 3H7OA 4CH8B 1PQAA 2XWBI 4JYTA 2BZ6H 2FX6A 5AFZH 1SLXB 3PMJA 1WYKA 3STIA 1TFXA 2GKVE 1NRQH 2GCHG 1O3EA 3SHCH 4AFSA 3QLPH 3MYWA 1EPTC 4YT6H 2QF3A 1LKBA 1MTNC 3ELAH 1ZSLA 1EZUC 4ABBA 1W2KH 1BZXE 3AASA 1P3CA 2FS8A 8GCHF 1SOTA 3ZZ3A 2FODA 4I8HA 3RXGA 3MMGA 1CE5A 1WAYB 2CXVA 1UK2A 2RCEA 3EDXB 2CMYA 4OS4A 1J16A 3L3TA 5I46H 3SZNA 4JZDH 1KXFA 4Y6DA 2VJ1A 1TOCB 2OD3B 2ZU4A 4JZ1A 4SGBE 1AE8H 1P2NA 3SJ8A 1TPPA 4WXIA 3FP7E 1GHAG 4AZ2B 3RXEA 4TY7A 1S5SA 1UTMA 3A85A 1NTPA 2ZGJA 1XUHA 4X8UH 3K9XB 1GBBA 2QXGA 4WY3A 3UPEA 2F9PA 1ZPCA 9LPRA 1MCVA 3O8CA 5J4QA 1TMTH 3AW1A 4LXBH 2XBVA 1B0FA 1N6XA 4UEHH 2XXLA 2ZPQA 4NZQA 2IOTA 1TRMA 3TU7H
chains in the Genus database with same CATH superfamily
1KTTB 3UQVA 4X2WA 2R3UA 1C5LH 3RXTA 2BVXH 1FZZA 2FIRH 2Y5FA 3MU0A 4IMZA 2XCFA 2VIVA 5FBEA 1AWFH 2ZFSA 2V7QD 4XE4A 3BN9A 1AD8H 3W94A 1DPOA 1KXAA 4K60A 1L0ZA 1JRSA 2HPPH 3W95A 2B5TB 4NA8A 4YZUA 1C5XB 4CBNA 1E38B 5HXFA 1THPB 2QF4A 2UUJB 1GJBB 2WSSD 3LC5A 2HPQH 4CBOA 4D9RA 2EC9H 2VVCA 1LHEH 3TK6A 5DPAA 1HLTH 5E0GA 3RXSA 2BLVA 3MWIU 1QRXA 1WXRA 4NIVA 5I25A 1C2MA 1Z8IB 5AFYH 4K8BA 1C5TA 1D4PB 2GCHF 1NU9A 3GICB 2QF5A 1C2IA 1GI3A 1O2UA 2A7HA 2GGVB 1QFKH 2EEKA 2GMTB 4JK6A 3MNCA 1SQAA 2VIOA 4IN2A 3SU2A 1HIAB 2P8OB 5GIBA 1QB6A 1JXPA 1SLVB 1UK4A 1ZTKA 3D62A 2XTTB 3GY6A 4ISHH 1OKXA 2FLRH 3BTDE 4XBDA 1GBCA 5CHAB 1NO9H 4F48B 1ELFA 2VGCC 2ZDLA 1F0SA 2BDGA 1O3DA 1OWKA 3CENA 3I77A 1GHAF 1THSH 1IHTH 1ZJKA 3MTYA 3VEQB 2F9VA 2EA3A 2Z3EA 1O32A 7GCHF 1TPAE 2HVXA 4Q7YA 1E34B 1V2OT 1C1RA 1HPGA 1F5LA 3UIRA 5C5NA 1G36A 1O2GH 1G2LA 3M61U 3BG4C 1LDTT 1LHDH 1QR3E 2CV3A 4ABFA 2PKSB 1EOLA 5HM2A 4X1QU 1P10A 5L2YH 1FAXA 2BVSH 2BDBA 3ATIA 5DP3A 3AAVA 5A0CA 2ZA5A 1WOFA 4IW4E 2J2UA 3HGNA 4DOQA 2GX4A 1SQTA 2OCVB 2NU1E 1TIOA 3ZVDA 3BIUH 3H09A 4WH8A 1Z1IA 2K8IA 2LELA 4BANB 4ISNA 1A5HA 5DSFA 3NCLA 4ASUD 4D76A 2H9HA 5GCHF 3OTPA 1D9IA 1SGFG 2A0QB 3RXJA 1BTWA 5JBAS 3BTKE 5F8ZA 3BEIB 3BTFE 3MO3A 1JBUH 1Y5UT 3EQ0H 3P8NA 1NBME 1AUTC 1V6DA 1O3KA 2HNTE 1GI5A 5C3NA 4IC5A 2VH0A 1PYTC 1XM1A 1GI1A 1GJAB 2H5DA 3T29A 5T6DA 1WBGB 2A31A 2ZDAH 2H2ZA 2V3HH 1F5RA 4ZKOU 1CHOG 2D8WA 2WYGA 1QBNA 2F9OA 1DSUA 1FY3A 2UWOA 2OK5A 2SGEE 4ABHA 4U01A 3ESTA 1ETRH 1HAVB 2BMGB 2STAE 1O33A 3BV9B 2H5CA 1UTLM 1PPBH 5EXMA 2EI6A 4ISLA 3OY5U 1NZQH 1J8AA 3FO8D 1ZRKA 3OX7U 1GBFA 3SHAH 2A4RA 4BTUB 4FUGA 3HATH 1CHGA 3A8BA 1DM4B 2AHME 1C5OH 1UCYK 2ZQ1A 3B8JA 1L4DA 2SFAA 4CH2B 1OX1A 3UNRA 5JDUB 1SQOA 1GBTA 4A92A 1KXEA 1O2MA 1GJCB 4I86A 1EZQA 4NA9H 3SW2B 5A09A 4E05H 1KTSB 3OAAD 5SGAE 1TB6H 3P6ZB 1VKYA 3OE7D 2QXIA 1LVYA 2PWXA 1UMAH 4X1NU 4ACAA 2J94A 1P11E 1UHBA 4NGAH 1INCA 2V0BA 3MI4A 2ESTE 2ZTZA 4BAHB 3DT0H 4JCNA 1FMGA 1AIXH 4VGCC 1T8NA 5A8ZA 2GDEH 4TY6A 7LPRA 1PQ8A 1O39A 1S85A 3RXCA 2G55A 3LU9B 4MTBA 1CGHA 3RU4E 1AY6H 2WUCA 3RMNH 5FPTA 1J14A 1O2SA 3RC4A 1TGNA 1C5QA 1AGJA 4TPYA 5E0JA 3RXRA 3SV2H 1MCTA 1ZHRA 2QN5T 3U98H 1FY8E 4IC6A 4IGDA 1D3TB 1HAIH 5A8YA 4NIYA 1QQ4A 1C1OA 1Z1JA 4B73A 5AF9H 1E35B 1S6HA 5F6MA 4XBBA 2GCTC 3U1IB 5GWZA 3A7XA 3SZEA 1WUNH 3P17H 1EOJA 1BA8B 3RXIA 1UTPA 1ORFA 2J9NA 3BTTE 3UNSA 1G37A 3RMOH 1TBQH 3PMAB 3MNBA 4X6MA 1XXFA 4AFZA 1C5SA 3CS0A 2P94A 1EPTA 1CHOF 1GDNA 1LVOA 1JIRA 2V3MA 1YCPM 2XCNA 3DSOA 3F9FA 3A88A 3P95A 2QF0A 2AMPA 3ATLA 1TNJA 2KZ4A 1TA2A 3ODFA 2XBWA 1V2WT 2CJIA 4WMDA 1PPCE 4TPIZ 4Y8YA 2AMDA 4Y76A 1DXWA 2WPDD 3B23B 4HTCH 1FN8A 1JMOH 1SI5H 1C9TA 1SGRE 1DWDH 1YF4A 2Q6DA 2VVUA 2HWLB 3PLBA 3LGVA 1G32B 2ZG0H 1GJ4H 3SQHE 1GWAA 2QXHA 3TGJE 2KM0A 1NRRH 6CHAC 3ZZ8A 2VINA 3ZZBA 4YOJA 1BTYA 2FWWA 1TABE 1BHXF 3HKIB 1ZZZA 1J15A 5FPSA 3QDZB 1P9UA 1P04A 1SGEE 1W3CA 2TGPZ 3VFEA 2PHBA 1FLEE 2V3OH 2ZU5A 1O2KA 3VXEH 1F92A 4R0IA 1C9PA 4MPVA 2CF8H 3V0XA 1JRTA 4F49A 1C2EA 5A8XA 2FI5E 2ZI2H 2XC0A 1SPJA 4JZEH 1SFQB 4X1PU 3P8OA 4P00A 4B76A 4YO9A 3MH4A 4NSYA 5T1VA 1TAWA 2W7UA 1NESE 2O8LA 3M35A 5DGJA 3N99A 3SGAE 1LO6A 2ZDVH 3OSYA 3Q3KA 1IQFA 1UTKA 3E1XB 3UREA 1SG8B 3OEHD 1T31A 4AFUA 2ODYB 1Q2WA 3SJOA 2KR7A 1OYTH 4Y0YE 2ULLA 1O34A 4GHTA 5G4BA 1O3CA 4CRAA 1GJ5H 3SGQE 3M7QA 4GAWA 2ZDKA 4Z1MD 4XDEA 1P02A 2YMSD 3ATWA 1V2UT 1QJ1B 3Q76A 1ZOMA 1BBRE 4MPWA 4X6NA 1ESTA 1P2QA 2GJGA 4ZROA 3QK1A 3GCNA 4F55A 4ZHMU 1AVGH 4YLUA 3VGCB 3ZZCA 2IJD1 4JYVH 5L2ZH 4RSPA 5E8EH 1C5ZB 2QIQA 1MBMA 2F91A 2OINA 1B0EA 2ZEBA 4XSKU 1EQ9A 5C17A 1GCTB 3CS7A 5LGOA 1K0HA 1C4U2 2GT7A 2B9LA 3KQDA 5LPRA 1BTUA 2GV6A 1P2JA 4WH6A 3ZVFA 3RXDA 1BTHH 1D3QB 4FUJA 3QGJA 1O3BA 1FQ3A 5EG4A 2AFQB 3KL6A 1V2KT 2GZ7A 3N7OA 3RM0H 2BD2A 4CHAC 1GPZA 5JBBS 1NU7B 2PSXA 4FU8A 1QTFA 1DVAH 3GCHB 1TE0A 1NBMD 2YMSB 1RGQA 3CNRA 4X8SH 4Y11E 4U2WA 2F4LA 4FUDA 4FUHA 3EGKH 3MU5A 4K3JA 1MTUA 2BX4A 1IQEA 4MNXA 2ZCLP 2P3TB 4IBLH 2CN0H 1TYNA 3BTME 1AVXA 3RXBA 1ETSH 1B7XB 1Z7KA 3R0FA 1G2MA 2NU3E 2ZHFH 1BIOA 4YLQH 1J17T 1HB0B 3DHKH 5DN6D 3BTQE 1SGDE 1Y3YA 1O36A 4B2AA 1C2LA 2A7CA 1WSSH 1AU8A 3DA9B 2K0QA 1GDUA 1GGDB 1K22H 1KSNA 3MH6A 1YPJH 4GHQA 5GPIB 6GCHG 5GXPA 1S0RA 1ARBA 5A2MH 1TNHA 1Z71A 3M36A 2JIZD 3NKKA 1ZLRA 3T27A 3DCLA 3OY6U 1NFXA 5DP7A 3UOPA 3ZZ6A 4M7GA 3SU6A 1TMUH 1YLNA 1QL8A 1TQ7B 2GD4B 2AGEX 4ZHLU 2ZFQH 1P2IA 1O2VA 1F7ZA 1KXCA 2M2AA 3SNDA 4ABDA 3A8AA 4E7RG 1S0QA 2OXSA 1NRPH 1FY1A 3KQEA 2A1DB 2Y7XA 2WV9A 2BQ7B 4IMQA 1WDIA 1HNEE 1MU6B 1C1UH 1P8VC 1HXEH 1C1PA 2PUQH 2DUCA 3ZIAD 1DLEA 4AN7A 2VWMA 1O30A 5C2ZA 1ANCA 2JH0D 1C1WH 1QURH 3VB6A 1NRSH 2R3YA 3HPTB 4CRDA 2AYWA 5IYTA 1TNIA 2ZPSA 1NS3A 1TLDA 1GCDA 2GMTC 2KAIA 3LC3A 4D7FA 3P8FA 5EQQA 3M3VA 4MNWA 1E79D 1TONA 1ZYOA 2P8OC 3BEFB 4INLA 4X6OA 4K1EA 5FCKA 1SGYE 1FONA 1TPSA 4WVPE 4BAQB 1C1NA 4KELA 1HRTH 3U28C 1AQ7A 5EJLA 1GI0A 2JETC 2O8TA 2C8YB 5EGMA 1UTQA 2Z94A 1TOMH 1TRYA 3M5NA 1QHRB 5HM9A 5LPEA 1ZHPA 4NG9H 5CHAC 3SNEA 3DSGA 1SR5C 1CGIE 2FX4A 4AB9A 1BTZA 1O5GH 1TGTA 4KP0A 5LPFA 1SC8U 1FAKH 1LHGH 1CO7E 2QE7D 3FZDA 3Q77A 1MQ6A 1NROH 1XUFA 2ZP0H 4RKOB 4X2VA 4AC9A 3V7TA 4ABAA 1P57B 1SFIA 6GCHF 2IJOB 4DGJA 3IITA 3RP2A 3VB4A 1UCYH 1GMCG 2NU2E 2Q1JA 4DG4A 1SGPE 1W0KD 2SGAA 1NY22 4OS2A 3FN8A 1S81A 1OWHA 7GCHG 5C1UA 1BITA 1DDJA 3GY2A 2PKSC 3SYJA 2EI8A 5PTPA 3SUEA 1C5UA 4TT3D 4I8JA 1PQ5A 2AIPA 1EXFA 2HLCA 2HLDD 1DS2E 4I7YH 2FMJA 1VGCB 2FYRA 2J4IA 5EIYA 1OP0A 5F03A 5F53A 1GHBG 1MAXA 2KFWA 1CA0B 1DUEA 1C2HA 1RTKA 2OBQA 1T4UH 1EJMA 1O3AA 4NIXA 4UONA 2CHAB 2VIPA 5CMXH 5ESTE 5EJZA 4DW2U 1O3FA 3STJA 2OUAA 3OFND 1BTPA 2Z9IA 5F8XA 1CT0E 1PPGE 2C3SA 5HIYA 3T5FH 3ZVAA 1SGQE 2BM2A 1PPZA 1FV9A 1XXDA 5GCHG 1L1NA 2W6ID 3GY3A 5JB8S 2SGPE 5GDSH 2H1UA 4OS7A 2SGDE 1YY3A 1YPHC 1C4Y2 2C90B 3RLWH 3A84A 3ATKA 3KF2A 4AB8A 3OYPA 3TGIE 4FVBA 1MBQA 5AVDA 1XVMA 3A8DA 4OS6A 2LNCA 3UOUA 3CP7A 1AZZA 2PP6A 3DSPA 1AVWA 2WINI 2D2DA 3KYGA 1SGFA 2B7DH 3D49H 6LPRA 1TX7A 4MVNA 1NRNH 1GBAA 5K7RA 2P95A 1SHYA 2ALVA 1ELEE 1KY9A 1MTVA 3A89A 3UWJH 1HAPH 2XNIA 2KCYA 1HGTH 2XWAA 3QGNB 2CK3D 3F0OA 4FU7A 3MOCA 1UVSH 3FZZA 1D6RA 1RIWB 1TNGA 3HK6B 2AMQA 4BOHA 1GDQA 3KQBA 1K2I1 2XYAA 1QRWA 4NWLA 1GMCF 2A32A 2KCOA 4LK4A 1W14U 1DANH 3MNSA 3U9AH 4TWWA 3SNCA 3DD2H 4LZ4B 1GHZA 1UVPA 1W0YH 1H4WA 5T3HA 4FUCA 4I31A 1ZMJA 3M5OA 1C1TA 1O2NA 2P16A 2R0KA 2ZF0H 1C5MD 1GHBF 4KTSA 1UTJA 5EXLA 4ABGA 5HKKD 3NWUA 4JZFH 5C1YA 2D1JA 3MU4A 4MLFB 4O03A 1Y3UA 2NU4E 3TIUA 3WWBA 1DITH 3F9HA 3QUMP 1Z6EA 2J5UA 1T8OA 1C4V2 1W7GH 3U8TH 2WPIS 1QIXB 1S84A 2ZHWH 2A4OA 4INHA 2P3FH 1HAGE 2GP9B 3E0NB 1IAUA 1K28D 4AGKA 2TBSA 4KTUA 1O2HA 3E91A 1GI8B 1O31A 1KDQA 2FI3E 3RXAA 1KLIH 1BMLA 1O3MA 2G52A 2PR3A 4H4FA 4Z6AH 3G01A 2TGDA 1ACBE 3RXFA 3KHVA 2AS9A 2F9UA 1GBMA 4QT8C 1P9SA 1OWJA 8KME2 3ZVGA 1EAWA 3U8OH 3OU0A 3TK9A 1BRBE 3M5MA 1GJ9B 1LPZB 4K8YA 1C1VH 2FTLE 2TIOA 2Z9GA 4DVAU 1V2JT 1Y5AT 2F9NA 2OTVA 4JMYA 2YNAA 3SU3A 4M9FA 2TGTA 3RUOA 2FS9A 1H8HD 4J1YA 1EAUA 1O3HA 5EJ1A 1ESBA 5KECA 1VCQA 2H9EH 3EA7A 2A45B 4ABEA 3TJVA 3TITA 2I6QA 4FETA 1HXFH 2G5VA 1O2YA 5C1XA 2FZZA 2IN2A 3TK5A 4ABJA 4ZAEA 3A7VA 5L30H 4B74A 3SU4A 5DKMA 2QGRA 2VWOA 4KGAA 3LH1A 2G51A 3ZZAA 1TRNA 1XKAC 5EW1H 1IQGA 3GDUA 1AUJA 1BMAA 1UTNA 2OP9A 4BAKB 2BOHB 1Z8RA 2FOBA 4ISOA 1GMHG 3UUZA 3M7UA 1XUJA 1XVOA 2VGCB 4UFFH 2Z9LA 1OWEA 2ALPA 2VB0A 2XNDD 4MPXA 3LDXH 3ZZ5A 3UAIC 2J98A 7KMEH 4ABIA 2O8WA 3ITIA 1Y3VA 1AFQB 1L4ZA 2VIDA 3SI4H 2SGFE 4Y8XA 1IQMA 3VB5A 5ETXA 2AH4X 3BG4B 3QTOH 1LKAA 1MKXK 4Q7ZA 1AKSB 1Y8TA 3F2HA 2PTCE 1BJVA 5CDFE 2J34A 3TVJB 3BEUA 3ZV9A 2J95A 3D23A 3IWMA 1PPHE 1KMHB 1HBTH 2Y5GA 5JPMH 2FOCA 4Y79A 1DOJA 1QB9A 1U6QA 3FANA 3ZVCA 5DP6A 2AGGX 1IQJA 1OS8A 1AE5A 1RJXB 3MFJA 1L2EA 4HZHA 3T2NA 3RXQA 5JBTA 1O5EH 4ZXXH 1D6WA 1XUKA 2FOEA 1QBVH 1ABJH 3V12A 3GDVA 1MABB 4NIWA 2BD9A 1O2WA 3MU8A 1K1NA 3LPRA 4CR5A 2Y6TA 1HAXB 5E2PA 2OC0A 2HNTF 3M3SA 3VGCC 2PTNA 2AIQA 4GCHG 1TNLA 2QY0B 2G5NA 4FUBA 1GHXH 1H8IH 1LHCH 4Q2KA 1GCTC 4AX9H 4TSFD 1O37A 1OYQA 3S7HB 4O97A 2Y5HA 2YNBA 5JB9S 6ESTA 1EKBB 4X2YA 1ELDE 3RLYH 1HJ9A 1A3EH 1KLJH 2ODQA 3RXOA 1LVMA 1Y3WA 1NFWA 2VH6A 3LONA 2ODPA 2Z9JA 1AFEH 1SGIB 2WV4A 3A80A 3MU1A 4PROA 3GCHC 3RXMA 5FCRA 2THFB 1GG6B 2YMSC 2ZDNA 2ZPRA 1GMHF 4X2XA 1O3IA 3F1SB 3ZZDA 4YM9A 3E16B 2BVRH 1BRCE 1O2ZA 1CQQA 1G3EA 2OBOA 3ZVBA 3Q3YA 3Q3XA 4DCDA 1C2DA 5IDKA 3SOSA 1AB9B 4I8KA 1GHYH 2O9QA 1YBWA 4UE7H 1RFNA 3PO1B 4ISIH 3RMLH 2G81E 5DP9A 1TGBA 1PQ7A 3E0PB 4AGJA 1GJ6A 4HGCA 1T8LA 4FUIA 4CRGA 1GGDC 1DX5M 1QA7A 2Z3CA 1K1PA 2KAIB 2R0LA 1LMWB 3URCA 1N6YA 3AAUA 2C4FH 5L6NH 1O3PB 2BZAA 4WMFA 1FJSA 2Z7FE 1KXBA 1LQEA 4A6LA 1IQIA 2BLWA 2BDCA 1G3DA 1Q31A 3TJOA 4E06H 1W11U 2Y81A 3A83A 3SI3H 4B6FA 1ZGIA 3FVFB 1A5IA 3MHWU 2DE9A 1NFUA 4Z0KA 2W26A 3O8BA 4B1TA 3VXFH 1WV7H 2HNTC 4H6SB 1NM6A 4X6PA 1TBRH 1YC0A 1C5WB 3M7TA 3VB3A 1H9LB 3F68H 5C0TA 3PWCA 4FUEA 1TMBH 1GL1A 1ZTLA 5J4SA 4ZMAH 1IQHA 4GCHF 4DT7B 2RA3A 2H6MA 4XBCA 3A87A 3UY9A 2LPRA 3BTGE 1EUFA 3KIDU 5DO4H 4ESTE 1F0RA 1RTLA 2HOBA 1SL3A 2BY9X 3EYDA 1B5GH 3Q00A 3UQOA 2ZFPH 3EA9A 1TGCA 4YOGA 1YPEH 1O5AB 1AI8H 2CF9H 1F0TA 4X0WU 2ANMH 3RMMH 1M9UA 4BTIB 4BXWA 3SU1A 1IHSH 2J38A 2P59A 2PKAA 1V2TT 1ELVA 2VU8E 1V2QT 4B2CA 1GMDG 2JDID 4ZKNU 2FOMB 4JK5A 1P09A 3VPKA 3HGPA 3RXLA 1TQ0B 2VIWA 2BDIA 1AZ8A 5HIZA 3A7WA 2P3UB 1ZMNA 1ARCA 3OEED 1V2PT 4Q80A 1JWTA 4RT0A 1EB1H 3SORA 1LPKB 1OP2A 1YYY1 2ZIQH 1ZPZA 3OTJE 9ESTA 2BD8A 3GYLB 3P8GA 4DURA 1QJ6B 1SB1H 2Y82A 3NUMA 1HAHH 1L1JA 1QNJA 2WPJS 1OP8A 3ENSB 1EZSC 2C8ZB 2ILNA 4I32A 1NFYA 2VWLA 1D3PB 2Q6GA 3UFAA 1T7CA 1CGJE 2G00A 2ZGHA 1MAYA 1MZDA 3K65B 3EA8A 4K2YA 2QAAA 1TBZH 1SLWB 2Q6FA 1YPMH 2BD7A 1IOEA 1SHHB 3WW7A 1VCPA 1O5BB 1O5DH 4BTTB 1YGCH 3JZ2B 1V2MT 1GL0E 1K1IA 4BAOB 2OQ5A 1OWDA 2UUKB 1VGCC 2UWPA 1C5VA 4BAMB 3E6PH 3S9BA 3KQCA 1CA0C 1W8BH 1BMNH 2ZU3A 1RXPA 1QQUA 1P3EA 3BG8A 4O3TA 2PUXB 2CHAC 4MPUA 3ZV8A 1FIZA 4WMEA 1BQYA 3KCGH 3ZZ7A 2GTBA 1FN6A 3LGWA 3P70B 1FX0B 3NXPA 1GJ8B 2G8TA 5AHGH 1P03A 1HAOH 1WTGH 2HALA 1XUIA 1O3GA 2FOGA 3GY8A 2A4GA 1DY8A 1K21H 3RU4D 1QZ8A 1O2XA 2FLBH 3LT3A 2ZTYA 3E8LA 2FYQA 3ATMA 2BYAX 4RT1A 3PLKA 1V2LT 1V3XA 3T62A 1G3CA 5ESBA 1GMDF 5HGGA 3PMHB 3RDZA 1J9CH 2P93A 1YWUA 1Y59T 4WWYA 1BMMH 1VJ9U 2BD4A 1NN6A 2H9TH 5FPYA 1BT7A 3QX5H 2W7SA 4ZKSU 1EJNA 5EU8A 3F2FA 3DUXH 1FI8A 5DJ7A 1SBWA 2SNWA 1TX8A 4X8TH 4MG3A 1UVUH 5HMAA 3L6PA 4U30A 4DT4A 1QL7A 1E36B 2Y7ZA 1IQKA 1PJPA 1KDQB 1XUGA 3NK8A 1CT4E 4ZH8A 1N8OB 4K5ZA 1RIWC 4CHAB 1MKWH 2FEQH 2RDLA 1T32A 1QBOA 1QB1A 2NU0E 3TH2H 1Z6JH 3BSQA 2ZECA 3ZYEA 1C5RA 2BLQA 1E0FD 3RXHA 1TA6A 2ZU1A 3A7YA 1MU8B 1HJ8A 2CGAA 4GSOA 1ZJDA 4ZKRU 2STBE 1OHHD 1YM0A 1P2OA 4FVDA 1GHVH 1LVBA 4UDWH 2ZGCA 1ANDA 2BY7X 5EQSA 3VB7A 5K0HA 4K1SA 2VIQA 1WTHD 2K1QA 3BTEE 1CBWB 1UJ1A 2C93B 5A0AE 1DXPA 3A8CA 4JYUH 2VNTA 1FNIA 1SKYE 2O8UA 4F4OC 1A3BH 1OSSA 2ZKSA 1ZPBA 4X1RU 1CVWH 1S6FA 1TWXB 2ZHQH 2QV1A 4DIHH 1UK3A 3E3TA 2I6SA 3ODDA 1W13U 4TYDA 4AORA 4H6TA 4KKDA 3RXKA 1BUIA 4I8GA 3UR9A 5C67A 3FP8E 1UHBB 3F9GA 3A86A 2OC8A 2A2XH 4AYYB 3N7EA 2RA0A 2HRVA 1MKXH 3I78A 5FX6A 3QWCH 5FX5A 1NT1A 3QO6A 1ANEA 1HJAB 7ESTE 2FXRA 2J98B 1MZAA 1F0UA 1HAYB 1GBDA 4LOYH 2BD5A 3T26A 4D9QA 1KLTA 1K1MA 3UB0A 4GLYA 3TJUA 1DT2A 1VCWA 3GS9A 3EE7A 3P92A 1T4VH 4B6EA 2GVFA 2Y80A 1O3LA 4YXWD 2ZTXA 3O8DA 1K9OE 1P12E 1RD3B 5BPEA 2ZHDA 3SUFA 3SO3A 1C2JA 1EZXC 1IQNA 3KNXA 1UO6A 1BBRH 4RKJB 1G30B 1P2KA 3BF6H 1TNKA 3PV5A 1BDAA 2BD3A 1V2VT 3SNBA 3UWIA 2WHXA 1QCPA 1FIWA 1V2NT 1VJAU 1A0LA 4ZCNA 4D8NA 4DIIH 4FUFA 5B6OA 1VITH 2YOLA 4MQAA 5EXNA 1EPTB 3SN8A 5BRRE 1CSOE 1CT2E 2FO9A 2KCAA 2QC2A 1MTNB 2JETB 1S83A 2QXJA 1MD8A 3SV6A 1AO5A 4XFQA 2BTCE 1OXGA 1O2TA 5TCAA 2Z9KA 3RXVA 2TGAA 1SOZA 2XOKD 4OS1A 3T25A 3LIWA 1W7XH 1GI2A 1UTOA 1GBEA 1DFPA 4ZHAA 1GBIA 5ABWA 1COWD 1L1GA 3TH4H 1P2MA 3KEEA 5EPYA 2PLXA 1AFQC 4GPGA 4D7GA 1SLUB 1LCYA 3LJOA 5FAHA 2ZCKP 4B2BA 4OM9A 5KEDA 1A4WH 2J97A 5C94A 5TJXA 3SV9A 1S6LA 1GI9B 1VZQH 1AWHB 1H8DH 5JBCS 1WCZA 1HCGA 2XRCA 4HFPB 5LH8A 3TPIZ 2FOFA 2PGBB 1A0JA 5FBIA 4X8VH 1MQ5A 4I8LA 3UTUH 1O35A 1S82A 1W0JD 4Y7BA 2ZFRH 4UD9H 3R3GB 4Q63A 3PB1E 4AG2A 1TALA 4THNH 2KCPA 2C8WB 2TRMA 3PWBA 1QGFA 1OWIA 3FAOA 4Y7AA 1XKBC 3GCTG 2HVYB 1GI6A 2ZDMA 3A81A 1ELAA 4MDSA 3V3MA 3S9CA 2ANWA 4GUXA 5F8TA 2ZO3H 5E0HA 4P02A 2BQ6B 3PTBA 1TX6A 3SJIA 3L33A 4CRFA 4A5TS 5IK2D 1O2PA 4MNYA 5EODA 1MKWK 1X7AC 2ZWLH 3K6YA 3PTNA 4K69A 1H1BA 3SJKA 1O3OA 1O5FH 3SUDA 1A46H 1ELTA 2ZFTA 4RI0A 1IQLA 1BCUH 1JIMA 1ZSJA 3LJJA 2SNVA 2PSYA 3PYHA 3SNAA 4YT7H 1HUTH 3BIVH 5T6FA 3E90B 3TJNA 5KGOA 3RU4T 1QL9A 3SBKA 1MTWA 2PFEA 3TH3H 1GVLA 3WWFA 1SQRA 1O3JA 3I29A 2GDDA 1GI7B 1YLDA 1FPHH 2JH5D 2ZZUH 2R2WU 3LGYA 1C2KA 1P01A 1GG6C 1HV7A 1NPMA 1SGTA 2KX4A 1DWCH 3S9AA 4R8TB 3B9FH 1V2ST 1PPEE 1GBKA 2OLGA 4WF8A 4CR9A 1JOUB 1T8MA 2ZNKH 3K6ZA 2WPLS 1ANBA 4OGYA 5CE1A 1W10U 2WYJA 1AB9C 3AW0A 1DY9A 4NZLA 3VG8A 4Y0ZE 2WV5A 3PO1C 4E7NA 2M5TA 3AK5A 4I33A 1LPGB 1OOKB 1C2FA 2BY5X 3PV4A 3NPSA 5H4IB 1YPLH 2AGIX 2BHGA 1DE7H 1GBJA 2FOAA 2PKAB 1EAIA 1QY6A 4H42U 1BTXA 1ELCA 3MH7A 4XD7D 1PYTD 2JJ1D 5DP8A 4FXGH 3HK3B 1W0ZU 3UNQA 1C1SA 5DG6A 1C1MA 2FPZA 2WPMS 3PRDA 4B71A 1RRKA 4B75A 8LPRA 3QZRA 2WUBA 3ZZ9A 3FFGA 4YTAA 5T6GA 1Z8JB 1P0SH 3BTHE 1EJAA 3C1KA 1EFRD 3GCTF 1NC6A 2A4QA 4UFEH 1ZSKA 4A1VA 2VBCA 3U69H 1DWEH 1AMHA 3LGUA 5EOKA 1MMJN 1O2LA 3A82A 1HIAA 2A7JA 3QZQA 2BLOA 3C27B 4IS5A 4TWYA 2ASUB 4XOJA 2BQWB 2DE8A 1BBRK 3GY7A 2VWNA 1DWBH 4UFGH 3S69A 3U8RH 3MQKC 2FOHA 4CREA 3M3TA 2A2QH 2LP6A 3EAJA 5DP4A 2FDAA 1HAZB 1SSXA 1E1QD 4HI3A 2PGQB 1CU1A 1H9HE 5GJ4B 1MD7A 3LGIA 1O0DH 3GISB 1ZMLA 1O2IA 2JJ2D 5E2OA 2W5EA 3QTVH 2A5KA 4DY7B 1W12U 1RTFB 1EB2A 2FM2A 4MNVA 4WXVA 5TCCA 5CHBA 4HG6A 2D26C 4UFDH 1O2OA 1FY4A 3RC6A 4O3UA 3SU5A 1O2QA 2BDAA 1P06A 2XBYA 3ZVEA 4CRCA 3MH5A 4Y8ZA 2ANKH 1FDPA 4FU9A 1BMFD 1AHTH 2EQNA 3SUGA 1E37B 1TGSZ 1WQSA 1ZR0A 2BXUH 3TLOA 1EAXA 4Q4LA 1BRAA 3PMBB 3KYFA 3M37A 4KTCA 2GV7A 1OPHB 1Z8GA 1UCYE 1F2SE 1KYNA 2ZQ2A 3RXPA 1CA8B 4NSVA 4SGAE 2FESH 2G4UA 2HGTH 2OC1A 4BNRA 1O3NA 1ZGVA 3GY5A 1PPFE 1GBLA 2F9BH 2UUYA 2XBXA 3PROA 5DK1A 1YCPH 4NFEA 2ZHEH 1O38A 3H7TA 4AG1A 1FUJA 2FP7B 1DSTA 2WZQA 2BDYA 4YESB 2ANYA 1PFXC 3DFLA 1DLKB 2QYIA 3GDSA 2G4TA 2IPHA 1GI4A 4VGCB 2GZ8A 2EY4C 4LZ1H 3MO9A 3FKSD 4DJZB 1LTOA 3RXUA 3EE0B 1SGCA 1ABIH 2L6OA 4NWKA 1O2RA 2XW9A 1XX9A 2XC4A 3MO6A 4K1TA 2RFKC 1K1JA 1GJ7B 4A1XA 1HAVA 1SVPA 4GVUA 3UR6A 2ZU2A 1A1RA 1FPCH 4A7IB 4ACBA 2V35A 1ELGA 2AEIH 3D65E 1GVKB 3PM3A 1LQDB 2Z3DA 2A5AA 1GBHA 1ID5H 1QRZA 2GCTB 4IN1A 1G9IE 1WQVH 1YKTA 1F5KU 2J92A 1QJ7B 4ZUHA 4NCYA 3F9EA 2UWLA 2BOKA 1KIGH 5A0BA 3LOXA 5EPNA 2PV9B 3T28A 1YPGH 1H9IE 1O2JA 5C0UA 2F83A 1SGNE 1UVOA 4Y10E 2QCYA 3LGTA 2W3KA 1YLCA 3IG6B 3NZIA 1C5YB 2R2MB 4ZXYH 3LH3A 4NA7A 2RDEA 1AN1E 4X1SU 5C5OA 3TNTA 1P05A 2EI7A 4YOIA 3U1JB 1VITG 3SU0A 3SQEE 4AYVB 3RM2H 1H8ED 2BX3A 5FL7D 3ZZ4A 3V13A 3KQ5A 2ZC9H 5FHTA 1YPHE 2AERH 3K2UA 2W6JD 4RN6A 1DUAA 5C20A 3H5CB 3S7KB 3W1EA 3HKJB 2WPKS 1N1LA 1ESAA 4Y71A 3SV7A 6CHAB 3LKWA 1XMNB 1N8OC 3F3BA 2F3CE 3F2GA 1D3DB 1TPOA 1SMFE 3BTWE 1BB0B 1AKSA 4WJG2 2O8MA 2V6NA 4J2YB 1THRH 2SGQE 1GJDB 1A61H 3PLPA 2ZFFH 4O9VA 1A5GH 2GZ9A 1HYLA 4U32A 3F0PA 1Q3XA 8GCHG 1BOQA 2ZCHP 1GVZA 2Z6BD 4OGXA 5EQRA 5HYOA 1C2GA 1KXDA 1MUEB 1Y5BT 2NWNA 3PRBA 4Q7XA 3QN7A 3A7TA 1WU1A 2L74A 2BDHA 3RC5A 1HFDA 1C5PA 1ETTH 2ZGXH 3M5LA 1RS0A 1CBWC 2F43B 3FP6E 3A7ZA 3SGBE 2FTMA 4INKA 3TNSA 1K1LA 1FY5A 4XRNA 1YP9A 1EX3A 1FXYA 2QA9E 3SV8A 3AVZA 1K1OA 5FXLA 3S0NA 3GY4A 4CRBA 4JZIA 1MTSA 2TPIZ 3GCOA 1BRUP 5GNDA 1MH0A 1Y3XA 2R9PA 1G3BA 1DICA 3WY8A 1ZRBA 4OS5A 1UVTH 2BXTH 1HDTH 2FI4E 2JKHA 8ESTE 1A7SA 5EW2H 3KN2A 1C5NH 4A1TA 4BXSA 3GOVB 3GYMA 2A5IA 1EATA 1LHFH 1C1QA 1O5CB 1HJAC 5B6LA 1ELBA 2B8OH 3JZ1B 2PW8H 3F6UH 2C8XB 2UUFB 2WPHS 2ZGBH 2JH6D 5JYIA 5DP5A 1ZTJA 1VR1H 1EASA 2BY8X 1VITF 2OQUA 4ASHA 2XC5A 3URDA 1EP5A 4AOQA 2GT8A 2W3IA 1QA0A 1V2RT 3PV2A 3ZYDA 1BJUA 2BB4A 3KGPA 3O8RA 2B0FA 3MNXA 2VVVA 1GHWH 4NFFA 2IPQX 1BHXB 2BY6X 4AFQA 1YCPK 1A2CH 3DFJA 2RG3A 1YPKH 1ZHMA 3TGKE 1EP6A 2OC7A 3SJ9A 1A0HB 3H7OA 4CH8B 1PQAA 2XWBI 4JYTA 2BZ6H 2FX6A 4FOUC 1SLXB 3PMJA 1WYKA 5AFZH 3STIA 1TFXA 2GKVE 1NRQH 2GCHG 1O3EA 3SHCH 4AFSA 3QLPH 3MYWA 1EPTC 4YT6H 3N7DA 2QF3A 1LKBA 1MTNC 3ELAH 1ZSLA 1EZUC 4ABBA 1W2KH 1BZXE 3AASA 1P3CA 2FS8A 8GCHF 1SOTA 3ZZ3A 2FODA 4I8HA 3RXGA 3MMGA 1CE5A 1WAYB 2CXVA 1UK2A 2RCEA 3EDXB 2CMYA 4OS4A 1J16A 3L3TA 5I46H 3SZNA 4JZDH 1KXFA 1UW7A 4Y6DA 2VJ1A 1TOCB 2OD3B 2ZU4A 4JZ1A 4SGBE 1AE8H 3NRLA 1P2NA 3SJ8A 1TPPA 4WXIA 3FP7E 1GHAG 4AZ2B 3RXEA 4TY7A 1S5SA 1UTMA 3A85A 1NTPA 3FOAA 2ZGJA 1XUHA 4X8UH 3K9XB 1GBBA 2QXGA 4WY3A 3UPEA 2F9PA 1ZPCA 9LPRA 1E1RD 1MCVA 3O8CA 5J4QA 1TMTH 3AW1A 4LXBH 2XBVA 1B0FA 1N6XA 4UEHH 2XXLA 2ZPQA 4NZQA 2IOTA 1TRMA 3TU7H
chains in the Genus database with same CATH topology
1KTTB 3UQVA 4X2WA 2R3UA 1C5LH 3RXTA 2BVXH 1FZZA 2FIRH 2Y5FA 3MU0A 4IMZA 2XCFA 2VIVA 5FBEA 1AWFH 2ZFSA 4XE4A 3BN9A 1AD8H 3W94A 1DPOA 1KXAA 4K60A 1L0ZA 1JRSA 2HPPH 3W95A 2B5TB 4NA8A 4YZUA 1C5XB 4CBNA 1E38B 5HXFA 1THPB 2UUJB 1GJBB 3LC5A 2HPQH 4CBOA 4D9RA 2EC9H 2VVCA 1LHEH 3TK6A 5DPAA 1HLTH 5E0GA 3RXSA 2BLVA 3MWIU 1QRXA 4NIVA 5I25A 1C2MA 1Z8IB 5AFYH 4K8BA 1C5TA 1D4PB 2GCHF 1NU9A 3GICB 1C2IA 1GI3A 1O2UA 2A7HA 2GGVB 1QFKH 2EEKA 2GMTB 4JK6A 3MNCA 1SQAA 2VIOA 4IN2A 3SU2A 1HIAB 2P8OB 5GIBA 1QB6A 1JXPA 1SLVB 1UK4A 1ZTKA 3D62A 2XTTB 3GY6A 4ISHH 1OKXA 2FLRH 3BTDE 4XBDA 1GBCA 5CHAB 1NO9H 1ELFA 2VGCC 2ZDLA 1F0SA 2BDGA 1O3DA 1OWKA 3CENA 3I77A 1GHAF 1THSH 1IHTH 1ZJKA 3MTYA 3VEQB 2F9VA 2EA3A 2Z3EA 1O32A 7GCHF 1TPAE 2HVXA 4Q7YA 1E34B 1V2OT 1C1RA 1HPGA 1F5LA 3UIRA 5C5NA 1G36A 1O2GH 1G2LA 3M61U 3BG4C 1LDTT 1LHDH 1QR3E 2CV3A 4ABFA 2PKSB 1EOLA 5HM2A 4X1QU 1P10A 5L2YH 1FAXA 2BVSH 2BDBA 3ATIA 5DP3A 3AAVA 5A0CA 2ZA5A 1WOFA 4IW4E 2J2UA 3HGNA 4DOQA 2GX4A 1SQTA 2OCVB 2NU1E 1TIOA 3ZVDA 3BIUH 4WH8A 1Z1IA 4BANB 4ISNA 1A5HA 4D76A 3NCLA 2H9HA 5GCHF 1D9IA 1SGFG 2A0QB 3RXJA 1BTWA 5JBAS 3BTKE 5F8ZA 3BEIB 3BTFE 3MO3A 1JBUH 1Y5UT 3EQ0H 3P8NA 1AUTC 1V6DA 1O3KA 2HNTE 1GI5A 5C3NA 4IC5A 2VH0A 1PYTC 1XM1A 1GI1A 1GJAB 2H5DA 3T29A 5T6DA 1WBGB 2A31A 2ZDAH 2H2ZA 2V3HH 1F5RA 4ZKOU 1CHOG 2D8WA 2WYGA 1QBNA 2F9OA 1DSUA 1FY3A 2UWOA 2SGEE 4ABHA 4U01A 3ESTA 1ETRH 1HAVB 2BMGB 2STAE 1O33A 3BV9B 2H5CA 1UTLM 1PPBH 5EXMA 2EI6A 4ISLA 3OY5U 1NZQH 1J8AA 3OX7U 1ZRKA 1GBFA 3SHAH 2A4RA 4BTUB 4FUGA 3HATH 1CHGA 3A8BA 1DM4B 2ZQ1A 1C5OH 1UCYK 3B8JA 1L4DA 2SFAA 4CH2B 1OX1A 3UNRA 5JDUB 1SQOA 1GBTA 4A92A 1KXEA 1O2MA 1GJCB 3SW2B 1EZQA 4NA9H 5A09A 4E05H 1KTSB 5SGAE 1TB6H 3P6ZB 2QXIA 1LVYA 2PWXA 1UMAH 4X1NU 2J94A 1P11E 1UHBA 4NGAH 1INCA 2V0BA 3MI4A 2ESTE 2ZTZA 4BAHB 3DT0H 4JCNA 1FMGA 1AIXH 4VGCC 1T8NA 5A8ZA 2GDEH 4TY6A 7LPRA 1PQ8A 1O39A 1S85A 3RXCA 2G55A 3LU9B 4MTBA 1CGHA 3RU4E 1AY6H 2WUCA 3RMNH 5FPTA 1J14A 1O2SA 3RC4A 1TGNA 1C5QA 1AGJA 4TPYA 5E0JA 3RXRA 3SV2H 1MCTA 1ZHRA 2QN5T 3U98H 1FY8E 4IC6A 4IGDA 1D3TB 1HAIH 5A8YA 4NIYA 1QQ4A 1C1OA 1Z1JA 4B73A 5AF9H 1E35B 1S6HA 5F6MA 4XBBA 2GCTC 3U1IB 5GWZA 3A7XA 1WUNH 3P17H 1EOJA 1BA8B 3RXIA 1UTPA 1ORFA 2J9NA 3BTTE 3UNSA 1G37A 3RMOH 1TBQH 3PMAB 3MNBA 4X6MA 1XXFA 4AFZA 1C5SA 3CS0A 2P94A 1EPTA 1CHOF 1GDNA 1LVOA 1JIRA 1YCPM 2XCNA 3F9FA 3A88A 3P95A 2QF0A 2AMPA 3ATLA 1TNJA 1TA2A 3ODFA 2XBWA 1V2WT 2CJIA 4WMDA 1PPCE 4TPIZ 4Y8YA 2AMDA 4Y76A 1DXWA 3B23B 4HTCH 1FN8A 1JMOH 1SI5H 1C9TA 1SGRE 1DWDH 1YF4A 2Q6DA 2VVUA 2HWLB 3PLBA 3LGVA 1G32B 2ZG0H 1GJ4H 3SQHE 1GWAA 2QXHA 3TGJE 1NRRH 6CHAC 3ZZ8A 2VINA 3ZZBA 4YOJA 1BTYA 2FWWA 1TABE 1BHXF 3HKIB 1ZZZA 1J15A 5FPSA 3QDZB 1P9UA 1P04A 1SGEE 1W3CA 2TGPZ 3VFEA 2PHBA 1FLEE 2V3OH 2ZU5A 1O2KA 3VXEH 1F92A 4R0IA 1C9PA 4MPVA 2CF8H 3V0XA 1JRTA 4F49A 1C2EA 5A8XA 2FI5E 2ZI2H 2XC0A 1SPJA 4JZEH 1SFQB 4X1PU 3P8OA 4B76A 4YO9A 3MH4A 4NSYA 1TAWA 2W7UA 1NESE 2O8LA 3M35A 5DGJA 3SGAE 1LO6A 2ZDVH 3OSYA 3Q3KA 1IQFA 1UTKA 3E1XB 3UREA 1SG8B 4AFUA 1T31A 2ODYB 1Q2WA 3SJOA 1OYTH 4Y0YE 2ULLA 1O34A 4GHTA 5G4BA 1O3CA 4CRAA 1GJ5H 3SGQE 3M7QA 4GAWA 2ZDKA 4XDEA 1P02A 3ATWA 1V2UT 1QJ1B 3Q76A 1ZOMA 1BBRE 4MPWA 4X6NA 1ESTA 1P2QA 4ZROA 3QK1A 3GCNA 4ZHMU 1AVGH 4YLUA 3VGCB 3ZZCA 4JYVH 5L2ZH 4RSPA 5E8EH 1C5ZB 2QIQA 1MBMA 2F91A 2OINA 1B0EA 2ZEBA 4XSKU 1EQ9A 1GCTB 3CS7A 5LGOA 1C4U2 2GT7A 2B9LA 3KQDA 5LPRA 1BTUA 2GV6A 1P2JA 4WH6A 3ZVFA 3RXDA 1BTHH 1D3QB 4FUJA 3QGJA 1O3BA 1FQ3A 5EG4A 2AFQB 3KL6A 1V2KT 2GZ7A 3N7OA 3RM0H 2BD2A 4CHAC 1GPZA 5JBBS 1NU7B 2PSXA 4FU8A 1QTFA 1DVAH 3GCHB 1TE0A 1RGQA 4X8SH 4Y11E 4U2WA 4FUDA 4FUHA 3EGKH 3MU5A 4K3JA 1MTUA 2BX4A 1IQEA 4MNXA 2ZCLP 2P3TB 4IBLH 2CN0H 1TYNA 3BTME 1AVXA 3RXBA 1ETSH 1B7XB 1Z7KA 3R0FA 1G2MA 2NU3E 2ZHFH 1BIOA 4YLQH 1J17T 1HB0B 3DHKH 3BTQE 1SGDE 1Y3YA 1O36A 4B2AA 1C2LA 2A7CA 1WSSH 1AU8A 3DA9B 1GDUA 1GGDB 1K22H 1KSNA 3MH6A 1YPJH 4GHQA 5GPIB 6GCHG 5GXPA 1S0RA 1ARBA 5A2MH 1TNHA 1Z71A 3M36A 3NKKA 1ZLRA 3T27A 3OY6U 1NFXA 5DP7A 3UOPA 3ZZ6A 4M7GA 3SU6A 1TMUH 1QL8A 1TQ7B 2GD4B 2AGEX 4ZHLU 2ZFQH 1P2IA 1O2VA 1F7ZA 1KXCA 3SNDA 4ABDA 3A8AA 4E7RG 1S0QA 2OXSA 1NRPH 1FY1A 3KQEA 2A1DB 2Y7XA 2BQ7B 4IMQA 1HNEE 1MU6B 1C1UH 1P8VC 1HXEH 1C1PA 2PUQH 2DUCA 1DLEA 4AN7A 2VWMA 1O30A 5C2ZA 1ANCA 2JH0D 1C1WH 1QURH 3VB6A 1NRSH 2R3YA 3HPTB 4CRDA 2AYWA 5IYTA 1TNIA 2ZPSA 1NS3A 1TLDA 1GCDA 2GMTC 2KAIA 3LC3A 4D7FA 3P8FA 5EQQA 3M3VA 4MNWA 1TONA 1ZYOA 3BEFB 2P8OC 4INLA 4X6OA 4K1EA 5FCKA 1SGYE 1FONA 1TPSA 4WVPE 4BAQB 1C1NA 4KELA 1HRTH 1AQ7A 1GI0A 2JETC 2O8TA 2C8YB 5EGMA 1UTQA 2Z94A 1TOMH 1TRYA 3M5NA 1QHRB 5HM9A 5LPEA 1ZHPA 4NG9H 5CHAC 3SNEA 1SR5C 1CGIE 2FX4A 4AB9A 1BTZA 1O5GH 1TGTA 4KP0A 5LPFA 1SC8U 1FAKH 1LHGH 1CO7E 3FZDA 3Q77A 1MQ6A 1NROH 1XUFA 2ZP0H 4RKOB 4X2VA 3V7TA 4ABAA 1P57B 1SFIA 6GCHF 2IJOB 4DGJA 3IITA 3RP2A 3VB4A 1UCYH 1GMCG 2NU2E 2Q1JA 4DG4A 1SGPE 2SGAA 1NY22 4OS2A 1S81A 1OWHA 7GCHG 5C1UA 1BITA 1DDJA 3GY2A 2PKSC 2EI8A 5PTPA 3SUEA 1C5UA 4I8JA 1PQ5A 2AIPA 1EXFA 2HLCA 1DS2E 4I7YH 2FMJA 1VGCB 2FYRA 2J4IA 1OP0A 5F03A 1GHBG 1MAXA 1CA0B 1DUEA 1C2HA 1RTKA 2OBQA 1T4UH 1EJMA 1O3AA 4NIXA 4UONA 2CHAB 2VIPA 5CMXH 5ESTE 4DW2U 1O3FA 3STJA 2OUAA 1BTPA 2Z9IA 5F8XA 1CT0E 1PPGE 2C3SA 3T5FH 3ZVAA 1SGQE 2BM2A 1PPZA 1FV9A 1XXDA 5GCHG 1L1NA 3GY3A 5JB8S 2SGPE 5GDSH 2H1UA 4OS7A 2SGDE 1YPHC 1C4Y2 2C90B 3RLWH 3A84A 3ATKA 3KF2A 4AB8A 3OYPA 3TGIE 4FVBA 1MBQA 5AVDA 1XVMA 3A8DA 4OS6A 2LNCA 3UOUA 3CP7A 1AZZA 1AVWA 2WINI 2D2DA 1SGFA 2B7DH 3D49H 6LPRA 1TX7A 4MVNA 1NRNH 1GBAA 5K7RA 2P95A 1SHYA 2ALVA 1ELEE 1KY9A 1MTVA 3A89A 3UWJH 1HAPH 2XNIA 1HGTH 2XWAA 3QGNB 4FU7A 3MOCA 1UVSH 3FZZA 1D6RA 1RIWB 1TNGA 3HK6B 2AMQA 4BOHA 1GDQA 3KQBA 1K2I1 2XYAA 1QRWA 4NWLA 1GMCF 2A32A 4LK4A 1W14U 1DANH 3MNSA 3U9AH 4TWWA 3SNCA 3DD2H 4LZ4B 1GHZA 1UVPA 1W0YH 1H4WA 5T3HA 4FUCA 4I31A 1ZMJA 3M5OA 1C1TA 1O2NA 2P16A 2R0KA 2ZF0H 1C5MD 1GHBF 4KTSA 1UTJA 5EXLA 4ABGA 3NWUA 4JZFH 5C1YA 2D1JA 3MU4A 4MLFB 4O03A 1Y3UA 2NU4E 3TIUA 1DITH 3F9HA 3QUMP 1Z6EA 1T8OA 1C4V2 1W7GH 3U8TH 2WPIS 1QIXB 1S84A 2ZHWH 2A4OA 4INHA 2P3FH 1HAGE 2GP9B 3E0NB 1IAUA 1K28D 4AGKA 2TBSA 4KTUA 1O2HA 3E91A 1GI8B 1O31A 1KDQA 2FI3E 3RXAA 1KLIH 1BMLA 1O3MA 2G52A 2PR3A 4H4FA 4Z6AH 3G01A 2TGDA 1ACBE 3RXFA 3KHVA 2AS9A 2F9UA 1GBMA 4QT8C 1P9SA 1OWJA 8KME2 3ZVGA 1EAWA 3U8OH 3OU0A 3TK9A 1BRBE 3M5MA 1GJ9B 1LPZB 4K8YA 1C1VH 2FTLE 2TIOA 2Z9GA 4DVAU 1V2JT 1Y5AT 2F9NA 2OTVA 4JMYA 2YNAA 3SU3A 2TGTA 3RUOA 2FS9A 4J1YA 1EAUA 1O3HA 1ESBA 1VCQA 2H9EH 3EA7A 2A45B 4ABEA 3TJVA 3TITA 2I6QA 1HXFH 2G5VA 1O2YA 5C1XA 2FZZA 2IN2A 3TK5A 4ABJA 4ZAEA 3A7VA 5L30H 4B74A 3SU4A 5DKMA 2QGRA 2VWOA 4KGAA 3LH1A 2G51A 3ZZAA 1TRNA 1XKAC 5EW1H 1IQGA 3GDUA 1AUJA 1BMAA 1UTNA 2OP9A 4BAKB 2BOHB 1Z8RA 2FOBA 4ISOA 1GMHG 3UUZA 3M7UA 1XUJA 1XVOA 2VGCB 4UFFH 2Z9LA 1OWEA 2ALPA 2VB0A 4MPXA 3LDXH 3ZZ5A 7KMEH 4ABIA 2O8WA 3ITIA 1Y3VA 1AFQB 1L4ZA 2VIDA 3SI4H 2SGFE 4Y8XA 1IQMA 3VB5A 5ETXA 2AH4X 3BG4B 3QTOH 1LKAA 1MKXK 4Q7ZA 1AKSB 1Y8TA 2PTCE 1BJVA 2J34A 3TVJB 3BEUA 3ZV9A 2J95A 3D23A 3IWMA 1PPHE 1HBTH 2Y5GA 5JPMH 2FOCA 4Y79A 1DOJA 1QB9A 1U6QA 3FANA 3ZVCA 5DP6A 2AGGX 1IQJA 1OS8A 1AE5A 1RJXB 3MFJA 1L2EA 4HZHA 3T2NA 3RXQA 5JBTA 1O5EH 4ZXXH 1D6WA 1XUKA 2FOEA 1QBVH 1ABJH 3V12A 3GDVA 4NIWA 2BD9A 1O2WA 3MU8A 1K1NA 3LPRA 4CR5A 2Y6TA 1HAXB 5E2PA 2OC0A 2HNTF 3M3SA 3VGCC 2PTNA 2AIQA 4GCHG 1TNLA 2QY0B 2G5NA 4FUBA 1GHXH 1H8IH 1LHCH 4Q2KA 1GCTC 4AX9H 1O37A 1OYQA 3S7HB 4O97A 2Y5HA 2YNBA 5JB9S 6ESTA 1EKBB 4X2YA 1ELDE 3RLYH 1HJ9A 1A3EH 1KLJH 2ODQA 3RXOA 1LVMA 1Y3WA 1NFWA 2VH6A 3LONA 2ODPA 2Z9JA 1AFEH 1SGIB 2WV4A 3A80A 3MU1A 4PROA 3GCHC 3RXMA 5FCRA 2THFB 1GG6B 2ZDNA 2ZPRA 1GMHF 4X2XA 1O3IA 3F1SB 3ZZDA 4YM9A 3E16B 2BVRH 1BRCE 1O2ZA 1CQQA 1G3EA 2OBOA 3ZVBA 3Q3YA 3Q3XA 4DCDA 1C2DA 5IDKA 3SOSA 1AB9B 4I8KA 1GHYH 2O9QA 1YBWA 4UE7H 1RFNA 3PO1B 4ISIH 3RMLH 2G81E 5DP9A 1TGBA 1PQ7A 3E0PB 4AGJA 1GJ6A 4HGCA 1T8LA 4FUIA 4CRGA 1GGDC 1DX5M 1QA7A 2Z3CA 1K1PA 2KAIB 2R0LA 1LMWB 3URCA 1N6YA