1MTWA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
molecule tags Serine protease
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA02
1DWDH 4INLA 2Y5FA 5JBCS 2GDDA 1C9PA 3TJVA 3A80A 1EAIA 3F1SB 1UCYK 1VITH 5F8XA 1Z8JB 1GHAF 2QXJA 1NM6A 1O3NA 2H9EH 1GWAA 3M5NA 5EQRA 1C5RA 1H8IH 2WPKS 3KQDA 3W94A 1O39A 1UCYH 3UREA 2P3TB 1WTHD 5EPNA 3RDZA 1CU1A 3SJ8A 3M5MA 1O3GA 4NIVA 4X2VA 1UVPA 2BY7X 2YNAA 1MMJN 5EGMA 2JH0D 3RXMA 3VGCB 1O0DH 2HNTC 3LGVA 3RXJA 1F2SE 2VVVA 1S6FA 2A4QA 4JK6A 1C2IA 1P2QA 1IQFA 1J14A 2BTCE 2CHAC 2GP9B 2K1QA 3UR6A 3GICB 1TGCA 2FI5E 4AYYB 1QB6A 1YKTA 4D8NA 4NGAH 3TLOA 3ZZ8A 4ISOA 4O3UA 2R2WU 2F9OA 2ALPA 3AAVA 3E3TA 5GDSH 2FO9A 5EPYA 2FYRA 4IMZA 1A5GH 3N7OA 1TWXB 1C1VH 2AH4X 3GY5A 1DWEH 1GHXH 1AKSA 2PTNA 4ZKOU 1HAXB 2C90B 3SU4A 5HM9A 2FM2A 1TGSZ 4I32A 5L2YH 1TNJA 2FOHA 1C5SA 4JK5A 1UK4A 1TX6A 1UTOA 4GAWA 3S7KB 4ISHH 1MBMA 4AB8A 3PYHA 1AY6H 1V2RT 2GCTC 1DE7H 3FAOA 1OX1A 1HLTH 2WV5A 1LKAA 1N1LA 3SUDA 4ABFA 2O8MA 3TVJB 1P09A 3EQ0H 5EW2H 3UFAA 4MNXA 1MKXK 1TOMH 1FPHH 1C4V2 1T8LA 1S84A 2ZG0H 5JBBS 1GMHF 1LVMA 3ZV9A 4ABEA 3HATH 4CR9A 2H2ZA 1TGTA 1VITG 1GMCF 4X6MA 2O8UA 5GCHF 1MKXH 1WSSH 4UFFH 3K65B 1NTPA 4X0WU 3IWMA 1GMDG 3O8DA 3Q3YA 2W7SA 3S9BA 1TFXA 4TY7A 1ZGVA 3TK6A 2HLCA 1G36A 2OC0A 4TY6A 1KXCA 1GHYH 1IHTH 1O2ZA 3A8CA 4K3JA 2R9PA 5AHGH 1BTPA 1AWHB 1O37A 3EGKH 2ANWA 3S9CA 3DUXH 1FONA 1DXWA 2FOGA 1P04A 1KXDA 4IBLH 1HV7A 4MPWA 2VIDA 3QGJA 1KXAA 1EAUA 1ESBA 3SJ9A 1XKBC 3ITIA 1AFEH 1NS3A 1WCZA 1AUTC 2FP7B 4YT7H 1MAXA 2R3UA 1RIWC 1GBKA 4HTCH 2FMJA 1L1GA 3C1KA 1T4VH 2WUBA 1O2NA 1Z8GA 1A1RA 1LCYA 1OOKB 2OINA 4VGCC 2ODYB 2ZGXH 2GCTB 2BD5A 3D62A 5AFZH 1KTTB 1V2OT 3KQCA 3URCA 1K1LA 2ZFFH 2QY0B 3NCLA 3JZ1B 4ZXYH 4JCNA 4WMEA 1FQ3A 1F5KU 5FBIA 4WH8A 3A83A 2ODQA 2ZPQA 1EB2A 1F0SA 1O2LA 1YPKH 3ATWA 3GY4A 4UE7H 2PKAB 2ZO3H 5J4QA 4BTTB 1VCQA 2J4IA 1K2I1 2AGIX 1WV7H 1FXYA 1FI8A 1SB1H 1BQYA 3SI4H 4NCYA 2W5EA 3RXOA 4D9QA 1PPCE 1VJAU 3BV9B 2ZCLP 2GKVE 1Y59T 3GCHC 1TPSA 2GGVB 5K0HA 1EP5A 4AFQA 2PGBB 3SV9A 1P2NA 3SU5A 1ELCA 1J9CH 4Q7XA 3E90B 5L30H 3RXVA 5H4IB 2V35A 1XUGA 3M37A 3S9AA 1Y5UT 1O2HA 3E6PH 2D1JA 1LVOA 1ORFA 4ZKRU 1GHWH 1O2MA 2BHGA 2D2DA 2Z94A 3BIVH 4Y8YA 1SI5H 1LHEH 1OPHB 2BVRH 1BMAA 5LPRA 4RKOB 2CMYA 1Y3XA 3GY8A 2A4OA 1CHOF 2TGAA 1XVMA 2D8WA 4FUJA 1ELAA 3SV7A 2Z7FE 3H5CB 5CHAB 1AWFH 1F0UA 1OS8A 3D65E 3IITA 1EJAA 1C5UA 1HYLA 4X8UH 1SHHB 4MNVA 1W3CA 2GZ9A 4X6PA 1C5MD 2XC4A 2FIRH 2PWXA 2H6MA 1ZOMA 4AZ2B 1SOTA 2A2XH 1QL8A 8ESTE 3P8OA 1PPZA 2F3CE 1Y3UA 1BRBE 1G3EA 5LPEA 2UUKB 2J38A 4XFQA 3LIWA 5K7RA 3RXHA 2G00A 1O5DH 1UCYE 2PKAA 4H42U 1D3DB 1G3DA 2QYIA 5EG4A 5J4SA 1GI6A 2W7UA 1HIAB 1A5IA 1ZPZA 4K1EA 4Y8ZA 3UQVA 2ZQ2A 3JZ2B 5A8ZA 1NC6A 3ZZ6A 1A0LA 1TRNA 2G51A 5E8EH 2R0LA 1XUFA 1UTPA 3TK5A 1PYTC 4ABDA 1NFWA 1RTLA 3KEEA 1NO9H 3VXEH 5FXLA 2HWLB 1QB1A 2AS9A 2UUFB 1O3MA 2P8OC 3LT3A 1IQHA 3OU0A 1P03A 4KGAA 1GJ5H 1FDPA 2BD7A 3U1JB 2BVXH 1K9OE 1ABJH 3F9FA 1SHYA 3UR9A 3PLBA 2PFEA 2PUXB 1EAXA 1NRQH 4LZ4B 4R0IA 1CA0C 1P3CA 7LPRA 2QF3A 2A5KA 3G01A 2RG3A 1K21H 1FZZA 1QRZA 4OGYA 3BG8A 1AIXH 2QXIA 2ODPA 1L1NA 1TB6H 1GVKB 1V2MT 2GCHF 1RJXB 1NESE 1GVLA 4GHTA 2G8TA 3PWBA 5DP4A 2WV4A 3ATKA 1LPKB 2J95A 1H9HE 4BOHA 2GTBA 1HAZB 1BRUP 1PQ8A 2Y5GA 4FUFA 1G2MA 1KDQB 2ANKH 1B0EA 4NWLA 3D49H 2P16A 2OQ5A 4ZXXH 1JOUB 2Z9IA 5GJ4B 2NU1E 1TNHA 3BTWE 3RMMH 1LHCH 2ZFPH 3ZZBA 2OC1A 2OLGA 1Z8RA 1T31A 2FZZA 4FUDA 5GWZA 4CHAC 2VB0A 1PPFE 4GCHF 2BDAA 1GJAB 1QL7A 5A8YA 2BY9X 4JZDH 3V3MA 1HIAA 3BTME 2A7HA 1LQDB 2DE8A 1FY1A 2BDYA 1AVXA 3SUGA 1BA8B 1CGJE 3E1XB 4WH6A 3Q00A 3LPRA 4XBCA 2PV9B 1FY4A 3RXTA 2IJOB 2YOLA 1GBDA 4U32A 5FPYA 1SQAA 2P95A 1GCTC 1OXGA 1ID5H 4YZUA 4SGAE 3GCOA 4YOJA 1CGHA 2XWBI 4Y6DA 2ESTE 4MPXA 1O31A 2AGEX 3O8RA 1C2GA 1CT0E 4NA7A 1EJNA 1GBAA 3STJA 2CV3A 3ZVCA 2JETB 1DY8A 3HK6B 3ZZAA 1IHSH 3ZVEA 1NU9A 2Z9LA 3DFJA 1LTOA 3SORA 2ZTZA 3F9HA 2G52A 2ZFQH 4JZIA 1ZHRA 4A5TS 1P06A 3A7WA 4IN1A 2BDIA 1PPEE 3LONA 2BMGB 2H9TH 2ZHFH 1T32A 2Y6TA 1V2KT 4X1RU 2Q6FA 1O3HA 1BTWA 2Y7ZA 2TGPZ 5L2ZH 4INKA 3RXIA 1EB1H 3KL6A 1GBLA 4LXBH 3M5LA 3RC6A 2SGAA 2R2MB 1NFYA 4CHAB 1VR1H 2BD9A 2VJ1A 1ZYOA 2AFQB 1KDQA 5C5NA 1SQTA 3GY7A 2A1DB 3SU2A 5JB9S 3A7ZA 1MTNC 1YCPM 3RXLA 3TGKE 3V7TA 4H4FA 2XBYA 5C1UA 1RFNA 1EUFA 4R8TB 3T2NA 3UIRA 1GL1A 4NFEA 4FUBA 3A84A 1P2MA 4GVUA 4A6LA 1YPEH 1L2EA 3P95A 4ZHLU 1ZHMA 1HAYB 4LOYH 4YOIA 4AX9H 2XC0A 3L6PA 5LPFA 2FX6A 3RLYH 1BJVA 4HFPB 1A3EH 1PPBH 1HJAB 4F4OC 1IAUA 1RS0A 4DG4A 3F9GA 1ETSH 4YM9A 2QC2A 2SGPE 5E0JA 1FJSA 1DPOA 1C5PA 1ZGIA 5T6GA 4FVBA 2XWAA 3PLKA 5EODA 1AI8H 4IC5A 1DLKB 4XBBA 3BTEE 1LVBA 1DY9A 4FUEA 1C1RA 1ELEE 1ZJKA 1GPZA 3BTQE 2ZCHP 3V12A 2UWOA 2EEKA 1H8DH 1W13U 1DICA 1P01A 1K1OA 3EDXB 1TQ7B 2NWNA 2VNTA 3HKIB 1C9TA 2GV7A 1AFQC 3SN8A 1FAKH 4I7YH 3QLPH 1GI2A 3RUOA 1UTKA 1V2ST 1QQ4A 2QXHA 5DP3A 3TU7H 3GDUA 4SGBE 1BJUA 1B7XB 2Z3EA 1P10A 1CHGA 1OWHA 1F5RA 2QXGA 3LC3A 4BAQB 3DD2H 1V2WT 4JYVH 1XUKA 1BTZA 3VGCC 3HGNA 3F9EA 2ZZUH 3HGPA 4Y71A 1FY8E 3SJOA 1OYQA 3GY6A 2B0FA 1LPZB 1BT7A 1SGRE 1PPGE 1PQ7A 1GI1A 2G5VA 2IOTA 1JXPA 1GMHG 1VJ9U 3BN9A 4DT7B 3SU0A 2XRCA 1TONA 4BANB 2I6SA 4E7NA 1GMCG 1H1BA 1SLVB 5GCHG 1TNIA 3ZZDA 3SNEA 3QWCH 1C5ZB 2FOCA 2V0BA 2YNBA 1LPGB 4AN7A 1E37B 1LVYA 1MKWK 1FPCH 1OWEA 4B73A 2A7JA 3P92A 4WJG2 4NSVA 1TGBA 4B71A 5SGAE 5DKMA 3LGTA 1MKWH 2PSYA 5DJ7A 1EOJA 1AFQB 5ABWA 1AMHA 4CRAA 3LGIA 1G9IE 1WOFA 3ZZ7A 1O5EH 5GXPA 2C93B 1L4ZA 1G32B 1VCPA 1E34B 2GDEH 3T29A 1HDTH 1T8OA 3A87A 1ANBA 1DOJA 3QZQA 1XUHA 3ESTA 1S81A 1SGDE 4X6NA 1DLEA 5DP5A 1TX8A 2BLWA 5F8ZA 1O2RA 2FWWA 1DS2E 4YLQH 3SJKA 2BX4A 5A09A 3BTDE 2GZ8A 2HPPH 3GCTF 4X8SH 1RGQA 4M7GA 4MNWA 1YGCH 2VU8E 3MU8A 2Z9KA 1E0FD 5EQSA 3P8NA 4JZEH 2A45B 4BTIB 5DP7A 2ANMH 2STAE 4UD9H 3RXEA 2G4UA 1ZRKA 4ABIA 1BOQA 1SGEE 2Y80A 4CRCA 1TMTH 1IQNA 1YC0A 2ZU1A 3PO1B 4O97A 2CXVA 2OTVA 3PB1E 4OS7A 2BB4A 2EI8A 2FPZA 4MDSA 3ZZ5A 2SGQE 1GJBB 1QL9A 3SBKA 3SUEA 1Z6JH 4GLYA 1NFXA 3UNQA 1HNEE 1AO5A 1WBGB 2OXSA 1YBWA 2JKHA 2OQUA 4WVPE 1DSTA 3MH5A 1QBNA 4ESTE 1EJMA 5CE1A 4GUXA 3ODDA 2HALA 1ARBA 2AMPA 1EZUC 2Y82A 3TPIZ 4Q7ZA 1GHVH 4DY7B 2O8LA 3U8TH 4IC6A 1ZR0A 2F83A 1TE0A 4Y7BA 2BY5X 3MFJA 4DOQA 1OSSA 1D6WA 2B5TB 2OCVB 1V6DA 4NSYA 2A0QB 4K8YA 2PUQH 1EATA 4THNH 1CHOG 1ZRBA 3MOCA 4D9RA 2BOKA 4MNYA 5EW1H 2ZDMA 3EAJA 4NZLA 4CR5A 1GBMA 1O3JA 1UTLM 1ZTKA 3PV4A 3EA9A 1JIMA 3SV2H 1RRKA 2LPRA 5A8XA 4FUIA 1DX5M 1AVGH 2ZHEH 3SQHE 2AYWA 5FX5A 2V3OH 3B8JA 2PGQB 2NU3E 8LPRA 2P3UB 1T8MA 2Z3DA 1HBTH 1THRH 2ZC9H 1A0JA 2NU0E 4Y0YE 1MZDA 1Y3YA 1V2PT 1W0ZU 2VVUA 1BBRK 4UONA 6CHAB 3Q77A 3VEQB 1V2LT 2B9LA 1AVWA 1J15A 2BM2A 5EU8A 4UFGH 3SNBA 3RP2A 1AZ8A 1BBRH 4K5ZA 1ZTJA 2R3YA 1DVAH 3BEIB 1F0TA 4JZFH 1O3IA 3K6ZA 5CHAC 2PR3A 1P02A 1BRAA 1K1JA 1TAWA 3VB7A 2OC7A 3RXAA 2A32A 2TPIZ 1UTQA 2GT7A 3FP7E 3KQBA 2XCNA 1W2KH 1X7AC 1Y3WA 1O2YA 3AAUA 3SJIA 3V13A 2ZTYA 3GY2A 5FHTA 1ELVA 2BOHB 1SR5C 1ETRH 3LH1A 1KIGH 1NROH 1D6RA 3NKKA 3H7OA 3ZV8A 1C2DA 1SSXA 4CBOA 2HPQH 1J8AA 5TCCA 2F9NA 4MG3A 2KAIB 3BTGE 1OWJA 1OP0A 5F6MA 1ZZZA 1O2WA 3PLPA 3Q76A 1V2TT 2CGAA 1BUIA 3NUMA 1O3OA 3F6UH 2ZIQH 5ESBA 3TJOA 3MU1A 3SZNA 7ESTE 1KLJH 1ZSLA 3PMBB 3S0NA 1NPMA 3O8BA 2SNVA 1F7ZA 1LHGH 1RXPA 4O03A 4BAHB 5FPTA 1AE8H 3ATLA 3A8AA 4KTCA 4ASHA 2GZ7A 1MD7A 2IPHA 3SNDA 1P8VC 5TCAA 1DM4B 3A88A 3LDXH 3GYMA 3HK3B 2O9QA 1AUJA 1VITF 3P8FA 2FX4A 1ZPCA 5IDKA 1MD8A 4JYUH 4BAMB 1TBQH 1TA2A 1SLWB 3E0PB 1FNIA 1C1UH 2ASUB 1TALA 2ANYA 1TA6A 3L33A 3RC5A 3SQEE 1GVZA 1DXPA 1GI9B 3TNTA 1PFXC 1W12U 1MCTA 3SGBE 1EP6A 1V2VT 4LK4A 1GI5A 3OY6U 3U98H 2J92A 1ZJDA 2EA3A 2G55A 3SO3A 3UUZA 5HXFA 1TMUH 2ZGHA 4MPUA 1M9UA 1YPHE 3OX7U 2B7DH 3LKWA 4A1XA 1NY22 1A3BH 3BTKE 3RU4D 1CBWB 2XBWA 1IQEA 3K6YA 2TGTA 1C1WH 1O3CA 3OYPA 3U69H 1UMAH 4AGKA 3E0NB 1QJ7B 2C8ZB 1GDQA 2G4TA 2UWLA 1FY3A 1O33A 2VIWA 3BG4B 4X8VH 1VGCB 4FXGH 2TRMA 5EOKA 3BTHE 2KAIA 1YLDA 2DE9A 2ZTXA 3NXPA 5E2PA 4ABJA 1NRNH 2BLQA 4XDEA 1Z71A 1K1PA 2WINI 3OTJE 2VIQA 4F49A 1O34A 2OD3B 5AVDA 2QN5T 1FN8A 1BB0B 3KGPA 3RMNH 4Q7YA 3FZDA 1CGIE 1QA7A 1XKAC 1S5SA 5B6OA 2H1UA 5BRRE 5AFYH 3P8GA 4ABHA 4UFEH 2ZPSA 1AZZA 3M7TA 3B9FH 4GSOA 4J2YB 1ELTA 2O8WA 4DGJA 2HRVA 3SU6A 4CH8B 2HOBA 3Q3XA 3KNXA 1YPLH 2JETC 1H9LB 5E0HA 3RMOH 1A5HA 1TQ0B 1WUNH 5T6DA 3NZIA 1YPGH 1C1QA 4MLFB 4Q80A 1GHZA 5GPIB 1VCWA 1A61H 4Y76A 1P2KA 2BQ7B 1SPJA 2PTCE 2VIOA 3RXCA 1S0QA 4OS5A 4J1YA 1BMNH 1SLXB 4E06H 1OWIA 2XCFA 4Z0KA 3ELAH 1Y5BT 4ZKSU 4AG2A 2C8WB 3TGIE 2ZDNA 2WPLS 4DURA 8GCHF 1CA8B 1ZTLA 1H9IE 1WAYB 1SGFA 2C8YB 1ACBE 1D4PB 1GL0E 1W0YH 1YM0A 3SU1A 1BHXB 4B74A 1G37A 1QBOA 2Y81A 3M36A 1OKXA 1W8BH 3RC4A 2ZU5A 2P59A 1JRSA 3UWJH 1DANH 1GI3A 1WTGH 1Z7KA 3BTFE 1YYY1 2ZU2A 5JBTA 5DPAA 3KQEA 5C5OA 4BXWA 3RXBA 1AQ7A 1YF4A 1WQSA 5F03A 1ZHPA 5JBAS 3QK1A 1TNGA 2EI6A 3SV8A 5C67A 4X6OA 2A4GA 2Z9GA 1T7CA 1O2KA 1HGTH 2EC9H 1C5WB 4B2CA 1SGNE 1FIWA 4CREA 1BBRE 1HAVB 1HJAC 1NRPH 4MVNA 1D3QB 1H4WA 5T6FA 3ZZ4A 6GCHF 4AFZA 4CRDA 2Z9JA 3MHWU 1GCDA 4ZROA 4NG9H 4Y10E 3VPKA 1O2UA 3GYLB 1EPTC 2DUCA 2Z3CA 3LJOA 1DDJA 1TGNA 3GOVB 1C2KA 3CP7A 2R0KA 1O2GH 1IOEA 3EE0B 4OS1A 3KIDU 3MWIU 5E2OA 2C4FH 1XXFA 5LGOA 3EA8A 3ZZCA 4OGXA 1ANDA 3ZYEA 1JIRA 2BZAA 1ZMJA 4WXIA 1EZQA 1N6XA 4BAKB 3SW2B 4QT8C 1E35B 1GJ4H 5A0AE 1O2QA 1HAPH 1QRWA 2Y7XA 2BD4A 2VINA 2FS9A 1WU1A 2C8XB 3GDSA 5EXNA 2A4RA 1BMMH 2ZNKH 2PSXA 3NK8A 2BXTH 2UUJB 3S7HB 3MTYA 1MTVA 1OWDA 3VB3A 3BTTE 2ZFTA 1QFKH 3VFEA 1TPOA 4O9VA 1C5YB 2SNWA 1V3XA 1F92A 1YLCA 1MQ6A 4RN6A 1GHAG 4A92A 4X2XA 1DSUA 5C1YA 1XM1A 1JWTA 1O5AB 4XOJA 1C2HA 1L0ZA 1O2VA 2Y5HA 3ZZ9A 1EPTB 1HJ8A 1PYTD 1DWCH 1XUJA 1MZAA 2ZF0H 1C2EA 1JBUH 1QJ6B 1AGJA 1GBTA 1SFIA 3SU3A 1LKBA 1GJCB 2F91A 3HPTB 3KCGH 3AW0A 7KMEH 4DCDA 3A7YA 5A2MH 1DFPA 3R3GB 1IQKA 1FN6A 3GCTG 1HAVA 4FU9A 1Q3XA 4YESB 1O36A 3UNSA 1N8OB 3FP8E 2ZGJA 1K1IA 4AOQA 1O38A 2QF0A 2TGDA 1HFDA 4FUGA 1QNJA 5G4BA 4TPIZ 2FYQA 4CH2B 1QURH 2ZPRA 1GG6B 1CQQA 1TABE 1C2MA 1KLIH 3LGWA 1FLEE 1O3LA 1P0SH 3SUFA 1GJ9B 3TH2H 3A8BA 1EZXC 3T25A 3LJJA 2ZU3A 2ZDLA 4AGJA 1ANCA 1KYNA 3RXDA 2PLXA 1YPJH 3RM0H 3I29A 3TK9A 1DT2A 2F9PA 2M5TA 3T27A 2FTLE 1XX9A 1SL3A 3ATIA 2A2QH 1QBVH 1S85A 2F9BH 3URDA 2VIPA 1O3KA 5DK1A 1W14U 2ZKSA 1V2JT 1CE5A 1QTFA 4XSKU 4ZMAH 2AIQA 2JH5D 3F68H 4WMDA 4ZHAA 3TITA 1O5CB 1P9SA 1GJ8B 1FAXA 1V2UT 2QIQA 1GJ6A 3PMJA 3FZZA 1Z1IA 3SNAA 1SC8U 3ZVDA 1WQVH 3PO1C 3VXFH 2HNTE 3P17H 3H7TA 4K60A 3ZVBA 4YTAA 1GDNA 3SNCA 2P94A 1SMFE 2W26A 3RXUA 4WWYA 1EQ9A 2ULLA 4Y7AA 2NU2E 1EPTA 2GV6A 1C1TA 2ZDVH 4FUCA 3ZYDA 3ATMA 2AERH 2CN0H 4NA8A 4Y11E 1O5GH 2UUYA 1NT1A 4NZQA 2D26C 2LNCA 3OSYA 2J94A 3R0FA 4IN2A 3RU4E 1UTJA 1GI7B 2ZDAH 1GBCA 3SHCH 1MBQA 2BDHA 2ILNA 1YP9A 3MYWA 2J34A 2AGGX 1CT4E 4KKDA 2O8TA 2ZECA 1GI8B 1EKBB 1UVOA 5EXMA 2RA3A 1Y5AT 2FS8A 2P3FH 4H6TA 2Q6GA 1C5XB 2FLBH 3I78A 1O3DA 5A0CA 3FVFB 1A2CH 1NRSH 4X1QU 1MQ5A 3MH6A 3QUMP 6CHAC 1TLDA 2BQWB 2PKSB 2FTMA 2BYAX 4X1NU 3MU5A 1QCPA 1IQJA 2AMDA 3TH4H 4MTBA 3ENSB 3MMGA 3M61U 2BX3A 1S6HA 1SQOA 3K2UA 3T5FH 4RKJB 1TOCB 3WY8A 5C3NA 2FEQH 1QQUA 5EXLA 4YT6H 1Q31A 5ESTE 2WYGA 4MQAA 2BDBA 3FFGA 3RXGA 2XTTB 3PROA 7GCHF 4TWWA 1GJ7B 2SGEE 3KN2A 4ISLA 2VWMA 2ZA5A 1ZLRA 2ALVA 4A7IB 1G30B 4E7RG 1UK2A 1LQEA 1L1JA 3A81A 3VB4A 4OS6A 3RXQA 2J2UA 4HI3A 1FV9A 1C5QA 4K2YA 3PTNA 2GX4A 1W10U 1MTUA 2RDLA 4AFUA 3QGNB 1P12E 2CF9H 4X1PU 4D7FA 1W7XH 3I77A 1OWKA 1C5TA 3M3TA 1GHBF 1PPHE 4PROA 2CHAB 2IN2A 3V0XA 1DUAA 9ESTA 2VGCC 3EA7A 3PMAB 1L4DA 1CSOE 1O2XA 4KTUA 2ZP0H 3UY9A 4B1TA 4B76A 1NU7B 1V2NT 1EZSC 2GVFA 1ABIH 4UFDH 1XXDA 2BDGA 1QHRB 1KXEA 3SI3H 5JYIA 3O8CA 4WMFA 4O3TA 4AORA 3A7XA 3TGJE 2FLRH 3RXRA 3T28A 1CT2E 5LH8A 1O3EA 3A85A 5AF9H 2VVCA 2Z6BD 3LGUA 2QA9E 1UTMA 1YCPK 1KY9A 5E0GA 2H9HA 1C5VA 1C2JA 2F9VA 3B23B 1HXEH 2XNIA 2XBVA 3M5OA 2BDCA 1YCPH 3A7VA 5C2ZA 3MU0A 2WPJS 1G2LA 2J9NA 3RU4T 2BZ6H 3ODFA 2BVSH 2FI3E 1P2IA 2ZHDA 3MI4A 3D23A 1J17T 1AU8A 1O3AA 3VB6A 1CO7E 3PM3A 2VWNA 5C20A 2FOMB 1MTWA 4A1TA 3EYDA 1A7SA 3PWCA 1K22H 3TJNA 1QGFA 1HAGE 3M3VA 4X2WA 5DP8A 1CBWC 3GY3A 1TRMA 5T3HA 1O5FH 3U8OH 2F9UA 2VGCB 2GCHG 1T4UH 3LGYA 3E91A 4AFSA 1Y8TA 4FVDA 4I8GA 1P05A 2STBE 1P57B 1TBRH 1TYNA 3STIA 1IQGA 1BHXF 1P2JA 1V2QT 1WYKA 3BG4C 1VGCC 1ANEA 2V6NA 2NU4E 3W95A 3MH4A 3UTUH 2XYAA 4KTSA 4GHQA 3T62A 4BNRA 2BD3A 2FOEA 3P6ZB 1DUEA 2ZHWH 1O2PA 4RSPA 1O2TA 1RIWB 2WPMS 3PTBA 1SFQB 2G81E 5TJXA 4Q2KA 3MO6A 2H5CA 4ISNA 2FODA 2QAAA 5IYTA 4VGCB 2V3HH 1EAWA 1UHBB 1GMDF 3MO9A 5I25A 1ZMNA 1MUEB 8GCHG 1SG8B 1GGDC 1K28D 1INCA 1ELGA 4Z6AH 3CS0A 3FANA 1BRCE 4GCHG 1HJ9A 1SGQE 3M7UA 2RCEA 3SOSA 1W11U 1BCUH 3UOUA 3DA9B 1C4Y2 4DJZB 3SV6A 4DVAU 4CRBA 1PQ5A 1HCGA 1TNLA 1OP8A 3TIUA 4OS2A 2P93A 3U1IB 2FOBA 3CENA 1DITH 2OBOA 3RXPA 2FESH 5ETXA 1O2JA 3QTOH 3LOXA 1D3PB 1TNKA 2GMTC 4H6SB 1HPGA 2AEIH 2A31A 1KTSB 3GCHB 3ZVFA 1FIZA 1JRTA 3K9XB 4TPYA 5GIBA 3OY5U 3AW1A 4B75A 6GCHG 1BITA 3BEUA 5FBEA 3RXFA 2PW8H 3CS7A 4YLUA 1THSH 4DW2U 4I8LA 3UOPA 2OC8A 4UDWH 2VH0A 1UVSH 3UNRA 1LO6A 2Q1JA 1D9IA 4KELA 1MU6B 4X2YA 3QO6A 5DGJA 1UJ1A 3KHVA 1GDUA 1J16A 1Y3VA 1NRRH 2BY8X 2ZGCA 3SHAH 4NFFA 1TRYA 1B5GH 1D3TB 2QGRA 2TIOA 1HAIH 1QJ1B 1PJPA 2WUCA 1O3PB 2SFAA 4ABBA 1IQIA 1HB0B 3GISB 1GBIA 1O35A 4XE4A 2XXLA 4Y0ZE 5JB8S 2VWLA 1RTKA 1GGDB 3E8LA 4HZHA 1TIOA 3LC5A 2SGDE 3TNSA 4U30A 2AIPA 3A7TA 4I8HA 4YO9A 4ZUHA 4K69A 4A1VA 1YPHC 5HYOA 1VZQH 4HGCA 3AASA 3UWIA 4I8JA 2QCYA 4JMYA 2BLOA 2W3KA 3T26A 1XUIA 1MH0A 2BXUH 1UHBA 2OBQA 2ZI2H 4Y8XA 3MU4A 4FU8A 5F8TA 3TJUA 4DIIH 3QTVH 2GMTB 3A82A 1SLUB 2GD4B 1UVUH 4D76A 2BQ6B 3UQOA 1ETTH 1A0HB 5HMAA 4CRGA 3M7QA 1KXFA 3DT0H 1Z8IB 2AMQA 1KXBA 1SBWA 1BTUA 4NA9H 2FXRA 1TPAE 4XBDA 1GBFA 1QA0A 1O2SA 1AD8H 1TX7A 2I6QA 1C1SA 2ZDKA 2ZWLH 2B8OH 2WYJA 4ZKNU 1P9UA 1HAOH 1PQAA 5JPMH 3LU9B 4YOGA 3BEFB 3MNSA 1HUTH 1O5BB 2ZEBA 1O32A 3BF6H 4INHA 5DP9A 3M35A 4I31A 4D7GA 4K1TA 3U9AH 3IG6B 1C5OH 2P8OB 3ZVGA 1O2IA 3MNCA 5HGGA 2PHBA 2BD8A 1MTSA 1GBJA 1CA0B 4NIWA 1RD3B 1NZQH 4X8TH 1C2FA 3QZRA 4WY3A 1C4U2 2VIVA 4NWKA 3M3SA 5DP6A 2JH6D 1O30A 1JMOH 1QRXA 4AG1A 2A7CA 1RTFB 5DO4H 3A86A 1SOZA 3GDVA 5L6NH 3RMLH 4B2BA 2W3IA 5JDUB 1G3CA 1UK3A 1GBBA 2BD2A 5FCRA 2FDAA 1UTNA 2SGFE 2ZGBH 2BY6X 1C1OA 2ZQ1A 1FMGA 1OYTH 2GT8A 1N8OC 5BPEA 2A5AA 1ZSKA 4JZ1A 4U2WA 1QY6A 1YPMH 3GCNA 4NIYA 5EQQA 1OP2A 5FPSA 1ESTA 3KF2A 1TMBH 4ZHMU 3VB5A 1Z1JA 4WF8A 1GG6C 1C1MA 1LMWB 2ZFSA 4JYTA 1GI0A 4TYDA 3MNXA 1A4WH 1T8NA 4I33A 1ELBA 1S0RA 3NPSA 4ABAA 4WXVA 4U01A 2HGTH 2ZCKP 3ZVAA 1GI4A 1C1NA 2G5NA 3BIUH 3RLWH 1BTHH 1W7GH 3QDZB 4BTUB 3UPEA 5I46H 1UO6A 1Q2WA 2A5IA 1ESAA 1SGIB 2BLVA 5C1XA 5HM2A 4FUHA 2VH6A 3MO3A 5DG6A 5FX6A 4OS4A 1THPB 4TWYA 1HXFH 3QX5H 6ESTA 1GCTB 1ZSJA 1QR3E 3TH3H 2OP9A 3A8DA 2OUAA 1ARCA 1LDTT 1SVPA 1XVOA 2XC5A 2TBSA 2CF8H 1UVTH 5PTPA 1C2LA 1G3BA 1IQLA 2ZHQH 1FUJA 4GPGA 3SGQE 1FY5A 4UEHH 1MCVA 3LH3A 1MAYA 4I8KA 1P11E 4CBNA 3ZZ3A 5FAHA 1BZXE 3P70B 1O2OA 4X1SU 1KSNA 3HKJB 4B2AA 5A0BA 1CVWH 1E36B 4Y79A 4E05H 1QIXB 1NN6A 1BTYA 2H5DA 4K1SA 1A46H 1SGCA 4IMQA 1AB9C 3NWUA 1U6QA 4ABGA 1MU8B 1C5LH 1AN1E 1S83A 1BDAA 1O3FA 4K8BA 3RXKA 1NFUA 3RXSA 1N6YA 4BAOB 1AE5A 2RA0A 1HAHH 1IQMA 1O3BA 3QN7A 1ZMLA 3MNBA 1LHDH 1MTNB 1TPPA 5CMXH 4ISIH 1KLTA 3DHKH 3FP6E 4AYVB 1F0RA 2HNTF 4IW4E 1EX3A 2WPIS 4FU7A 4IS5A 1B0FA 3L3TA 4ZH8A 1SGYE 2ZFRH 9LPRA 1C1PA 1TBZH 4KP0A 1DWBH 3SGAE 4AB9A 2Q6DA 2CJIA 2FI4E 3MH7A 1LHFH 4ZAEA 4DIHH 3A89A 3PMHB 1K1MA 2FOAA 2XW9A 3DFLA 7GCHG 2FOFA 1E38B 1Z6EA 1AKSB 1P2OA 4CRFA 4LZ1H 1SGTA 1BMLA 1F5LA 1QB9A 2C3SA 3U8RH 3C27B 1AHTH 6LPRA 3BSQA 3S69A 1SGFG 2QV1A 1ELFA 1XMNB 1EOLA 8KME2 2PKSC 1ELDE 4IGDA 2EI7A 2WPHS 2VWOA 2XBXA 1EASA 2HVXA 1BIOA 1K1NA 3AVZA 1BTXA 2UWPA 1AB9B 4NIXA 1SGPE 1S82A 1GHBG 1C5NH 1GBEA 1P3EA 1GBHA 4MPVA 1EXFA 2ZU4A 3Q3KA 4BXSA 1HRTH 1GJDB 3RM2H 1ZPBA 5FCKA 3E16B 2THFB
chains in the Genus database with same CATH superfamily
1DWDH 4INLA 2Y5FA 5JBCS 2GDDA 1C9PA 3TJVA 3A80A 1EAIA 3F1SB 1UCYK 1VITH 5F8XA 1Z8JB 1GHAF 2QXJA 1NM6A 1O3NA 2H9EH 1GWAA 3M5NA 5EQRA 1C5RA 1H8IH 2WPKS 3KQDA 3W94A 1O39A 1UCYH 3UREA 2P3TB 1WTHD 5EPNA 3RDZA 1CU1A 3SJ8A 3M5MA 1O3GA 4NIVA 4X2VA 1UVPA 2BY7X 2YNAA 1MMJN 5EGMA 2JH0D 3RXMA 3VGCB 1O0DH 2HNTC 3LGVA 3RXJA 1F2SE 2VVVA 1S6FA 2A4QA 4JK6A 1C2IA 1P2QA 1IQFA 1J14A 2BTCE 2CHAC 2GP9B 2K1QA 3UR6A 3GICB 1TGCA 2FI5E 4AYYB 1QB6A 1YKTA 4D8NA 4NGAH 3TLOA 3ZZ8A 4ISOA 4O3UA 2R2WU 2F9OA 2ALPA 3AAVA 3E3TA 5GDSH 2FO9A 5EPYA 2FYRA 4IMZA 2EY4C 1A5GH 5KEDA 3N7OA 1TWXB 1C1VH 2AH4X 3GY5A 1DWEH 1GHXH 1AKSA 2PTNA 4ZKOU 1HAXB 3EE7A 2C90B 3SU4A 5HM9A 2FM2A 1TGSZ 4I32A 5L2YH 1TNJA 2FOHA 1C5SA 4JK5A 1UK4A 1TX6A 1UTOA 4GAWA 3S7KB 4ISHH 1MBMA 4AB8A 3PYHA 1AY6H 1MABB 1V2RT 2GCTC 1DE7H 3FAOA 1OX1A 1HLTH 2WV5A 1LKAA 1N1LA 3SUDA 4ABFA 2O8MA 3TVJB 1P09A 3EQ0H 5EW2H 3UFAA 4MNXA 1MKXK 1TOMH 1FPHH 1C4V2 1T8LA 1S84A 2ZG0H 5JBBS 1GMHF 1LVMA 1YLNA 1E79D 3ZV9A 4ABEA 3HATH 4CR9A 2H2ZA 1TGTA 1VITG 1GMCF 4X6MA 2O8UA 5GCHF 1MKXH 1WSSH 4UFFH 3K65B 1NTPA 4X0WU 3IWMA 1GMDG 3O8DA 3Q3YA 2W7SA 3S9BA 1TFXA 4TY7A 1ZGVA 3TK6A 2HLCA 1G36A 2OC0A 4TY6A 1KXCA 1GHYH 1IHTH 1O2ZA 3A8CA 4K3JA 2R9PA 5AHGH 1BTPA 1AWHB 1O37A 3EGKH 2ANWA 4XD7D 3S9CA 3DUXH 1FONA 1DXWA 2FOGA 1P04A 1KXDA 4IBLH 1HV7A 4MPWA 2VIDA 3QGJA 1KXAA 1EAUA 3F0OA 1ESBA 3SJ9A 1XKBC 3ITIA 1AFEH 1NS3A 1WCZA 1AUTC 2FP7B 4YT7H 1MAXA 2R3UA 1RIWC 1GBKA 4HTCH 2FMJA 1L1GA 3C1KA 1T4VH 2WUBA 1O2NA 1Z8GA 1COWD 1A1RA 1LCYA 1OOKB 2OINA 4VGCC 2ODYB 3UB0A 2ZGXH 2GCTB 2BD5A 3D62A 5AFZH 1KTTB 1V2OT 3KQCA 3URCA 1K1LA 2ZFFH 2QY0B 3NCLA 3JZ1B 3DSOA 4ZXYH 4JCNA 4WMEA 1FQ3A 1F5KU 5FBIA 4WH8A 3A83A 2ODQA 2ZPQA 1EB2A 1F0SA 1O2LA 1YPKH 3ATWA 3GY4A 4UE7H 2PKAB 2ZO3H 5J4QA 4BTTB 1VCQA 2J4IA 3CNRA 1K2I1 2AGIX 1WV7H 1FXYA 1FI8A 1SB1H 1BQYA 3SI4H 4NCYA 2W5EA 3RXOA 4D9QA 1PPCE 1VJAU 3BV9B 2ZCLP 2GKVE 1Y59T 2JJ2D 3GCHC 1TPSA 2GGVB 5K0HA 1EP5A 4AFQA 2PGBB 3SV9A 1P2NA 3SU5A 1ELCA 1J9CH 4Q7XA 3E90B 5L30H 3RXVA 5H4IB 2V35A 1XUGA 3M37A 3S9AA 1Y5UT 1O2HA 3E6PH 2D1JA 1LVOA 1ORFA 2KM0A 1GHWH 4ZKRU 1O2MA 2BHGA 2D2DA 2Z94A 3BIVH 4Y8YA 1SI5H 1LHEH 1OPHB 2BVRH 1BMAA 5LPRA 4RKOB 2CMYA 1Y3XA 3GY8A 2A4OA 3N7EA 1CHOF 2TGAA 1XVMA 2D8WA 4M9FA 4FUJA 1ELAA 3SV7A 2Z7FE 3H5CB 5CHAB 1AWFH 1F0UA 1OS8A 3D65E 3IITA 1EJAA 1C5UA 1HYLA 4X8UH 1SHHB 4MNVA 1W3CA 2GZ9A 4X6PA 1C5MD 2XC4A 2FIRH 2PWXA 2H6MA 1ZOMA 4AZ2B 1SOTA 2A2XH 1QL8A 8ESTE 2JDID 3P8OA 1PPZA 2F3CE 1Y3UA 1BRBE 1G3EA 5LPEA 2UUKB 2J38A 5T1VA 4XFQA 3LIWA 3ZIAD 5K7RA 3RXHA 2G00A 1O5DH 1UCYE 2PKAA 4H42U 1D3DB 1G3DA 2QYIA 5EG4A 4TT3D 5J4SA 1GI6A 2W7UA 1HIAB 1A5IA 1ZPZA 4K1EA 4Y8ZA 3UQVA 2ZQ2A 3JZ2B 5A8ZA 1NC6A 3ZZ6A 5C94A 3F3BA 1A0LA 1TRNA 2G51A 5E8EH 2R0LA 1XUFA 1UTPA 3TK5A 1PYTC 4ABDA 1NFWA 1RTLA 3KEEA 1NO9H 3VXEH 5FXLA 2HWLB 1QB1A 2AS9A 2UUFB 4AC9A 1O3MA 2P8OC 3LT3A 1IQHA 3OU0A 1P03A 4KGAA 1GJ5H 1FDPA 2BD7A 3F2FA 2BVXH 1K9OE 1ABJH 2IPQX 1SHYA 3F9FA 3U1JB 3UR9A 3PLBA 2PFEA 2PUXB 1EAXA 1NRQH 4LZ4B 4R0IA 1CA0C 4YXWD 1P3CA 7LPRA 2QF3A 2A5KA 3G01A 2RG3A 1K21H 1FZZA 1QRZA 4OGYA 3BG8A 1AIXH 2QXIA 2ODPA 4Q4LA 1L1NA 1TB6H 1GVKB 1V2MT 2GCHF 1RJXB 1NESE 1GVLA 1KMHB 4GHTA 2G8TA 3PWBA 5DP4A 2WV4A 3ATKA 1LPKB 2J95A 1H9HE 4BOHA 2GTBA 1HAZB 1BRUP 1PQ8A 2Y5GA 4FUFA 1G2MA 1KDQB 2ANKH 1B0EA 4NWLA 3D49H 2P16A 2OQ5A 4ZXXH 1JOUB 2Z9IA 5GJ4B 2NU1E 1TNHA 3BTWE 3RMMH 1LHCH 2ZFPH 3ZZBA 2OC1A 2OLGA 2QF5A 1Z8RA 2F43B 1T31A 2FZZA 4FUDA 5GWZA 4CHAC 2VB0A 2W6ID 1PPFE 4GCHF 1SQRA 2BDAA 1GJAB 1QL7A 5A8YA 2BY9X 4JZDH 3W1EA 3V3MA 1HIAA 3BTME 5HIYA 2A7HA 1LQDB 2DE8A 1FY1A 2BDYA 1AVXA 5HIZA 2GJGA 3SUGA 1BA8B 1CGJE 3E1XB 4WH6A 3Q00A 3LPRA 4XBCA 2PV9B 1FY4A 3RXTA 2IJOB 2YOLA 1GBDA 4U32A 5FPYA 1SQAA 2P95A 1GCTC 1OXGA 1ID5H 4YZUA 4SGAE 3GCOA 4YOJA 1CGHA 2XWBI 4Y6DA 2ESTE 4MPXA 1O31A 2AGEX 3O8RA 1C2GA 1CT0E 4NA7A 1EJNA 1GBAA 3STJA 2CV3A 3ZVCA 2JETB 1DY8A 3HK6B 3ZZAA 1IHSH 3ZVEA 1NU9A 2Z9LA 3DFJA 1LTOA 3SORA 2ZTZA 3F9HA 2G52A 2ZFQH 4JZIA 1ZHRA 4A5TS 1P06A 3A7WA 4IN1A 2BDIA 1PPEE 3LONA 2BMGB 2H9TH 2ZHFH 1T32A 2Y6TA 1V2KT 4X1RU 2Q6FA 1O3HA 1BTWA 2Y7ZA 2TGPZ 5L2ZH 4INKA 4ACAA 3RXIA 1EB1H 3KL6A 1GBLA 4LXBH 3M5LA 3RC6A 2SGAA 2R2MB 1NFYA 4CHAB 1VR1H 2BD9A 2VJ1A 1ZYOA 2AFQB 1KDQA 2WZQA 5C5NA 1SQTA 3GY7A 2A1DB 3SU2A 5JB9S 3A7ZA 2WHXA 1MTNC 1YCPM 3RXLA 3TGKE 5CHBA 3V7TA 4H4FA 2XBYA 5C1UA 1RFNA 1EUFA 4R8TB 3T2NA 3UIRA 1GL1A 4NFEA 4FUBA 3A84A 1P2MA 2WPDD 4GVUA 4A6LA 1YPEH 1L2EA 3P95A 4ZHLU 1ZHMA 1HAYB 2VBCA 4LOYH 4YOIA 4RT0A 4AX9H 2XC0A 3L6PA 5LPFA 2FX6A 2QF4A 3RLYH 1EFRD 1BJVA 4HFPB 1A3EH 1PPBH 1HJAB 4F4OC 1IAUA 1RS0A 4DG4A 3F9GA 1ETSH 4YM9A 2QC2A 2SGPE 5E0JA 1FJSA 1DPOA 1C5PA 1ZGIA 5T6GA 4FVBA 2XWAA 3PLKA 5EODA 1AI8H 4IC5A 1DLKB 4XBBA 3BTEE 1LVBA 1DY9A 4FUEA 1C1RA 1ELEE 1ZJKA 1GPZA 3BTQE 2ZCHP 3V12A 2UWOA 2EEKA 1H8DH 1W13U 1DICA 1P01A 1K1OA 3EDXB 1TQ7B 2NWNA 2VNTA 3HKIB 1C9TA 2GV7A 1AFQC 3OAAD 3FOAA 1FAKH 3SN8A 4I7YH 3QLPH 1GI2A 3RUOA 1UTKA 1V2ST 1QQ4A 2QXHA 5DP3A 3TU7H 3GDUA 4SGBE 1BJUA 1B7XB 2Z3EA 1P10A 1CHGA 1OWHA 1F5RA 3FN8A 2QXGA 3LC3A 4BAQB 3DD2H 1V2WT 4JYVH 1W0JD 1XUKA 1BTZA 3VGCC 3HGNA 3F9EA 2ZZUH 3HGPA 4Y71A 2V3MA 3DSPA 1FY8E 2XOKD 3SJOA 3KYFA 1OYQA 3GY6A 2B0FA 1LPZB 2WSSD 1SGRE 1BT7A 1PPGE 1PQ7A 1GI1A 2G5VA 2IOTA 1JXPA 1GMHG 1VJ9U 3BN9A 4DT7B 3H09A 2XRCA 3SU0A 1TONA 4BANB 2I6SA 4E7NA 1GMCG 1H1BA 1SLVB 5GCHG 1TNIA 3ZZDA 3SNEA 3QWCH 1C5ZB 2FOCA 2V0BA 2YNBA 1LPGB 4AN7A 1K0HA 1E37B 1LVYA 1MKWK 1FPCH 1OWEA 4B73A 2A7JA 3P92A 4WJG2 4NSVA 1TGBA 4B71A 5SGAE 5DKMA 3LGTA 1MKWH 2PSYA 5DJ7A 1EOJA 1AFQB 5ABWA 1AMHA 4CRAA 2J5UA 3LGIA 1G9IE 1WOFA 3ZZ7A 1O5EH 5GXPA 2C93B 1L4ZA 1G32B 1VCPA 1YWUA 1E34B 5FL7D 2GDEH 3T29A 1HDTH 1T8OA 3A87A 1ANBA 1DOJA 3QZQA 1XUHA 3ESTA 1S81A 1SGDE 4X6NA 1DLEA 5DP5A 1TX8A 4I86A 2BLWA 5F8ZA 1O2RA 2FWWA 1DS2E 4YLQH 3SJKA 2BX4A 5A09A 3BTDE 2GZ8A 2HPPH 3GCTF 4X8SH 1RGQA 4M7GA 4MNWA 5CDFE 1YGCH 2VU8E 3MU8A 2Z9KA 1E0FD 5EQSA 3P8NA 4JZEH 2A45B 4BTIB 5DP7A 2ANMH 2STAE 4UD9H 3RXEA 2G4UA 1ZRKA 4ABIA 1BOQA 1SGEE 2Y80A 4CRCA 1TMTH 1IQNA 1YC0A 2ZU1A 3PO1B 4O97A 2CXVA 2OTVA 3PB1E 4OS7A 1WDIA 2BB4A 2EI8A 2LP6A 2FPZA 4MDSA 3ZZ5A 2SGQE 1GJBB 5DSFA 1QL9A 2J97A 3SBKA 3SUEA 1Z6JH 4GLYA 1NFXA 3UNQA 1HNEE 1AO5A 1WBGB 2KCPA 2OXSA 1YBWA 2JKHA 2OQUA 4WVPE 1DSTA 3MH5A 1QBNA 4ESTE 1EJMA 5CE1A 4GUXA 3ODDA 2HALA 1ARBA 2AMPA 1EZUC 2Y82A 3TPIZ 4Q7ZA 1GHVH 4DY7B 2O8LA 3U8TH 4IC6A 3U28C 1W0KD 1ZR0A 2F83A 1TE0A 4Y7BA 2BY5X 3MFJA 4DOQA 1OSSA 1D6WA 2B5TB 2OCVB 1V6DA 4NSYA 2A0QB 4K8YA 2PUQH 2F4LA 1EATA 4THNH 1CHOG 1ZRBA 3MOCA 4D9RA 2BOKA 4MNYA 5EW1H 2ZDMA 3EAJA 4NZLA 4CR5A 1GBMA 2KFWA 1O3JA 1UTLM 1ZTKA 3PV4A 3EA9A 1JIMA 3SV2H 1RRKA 2LPRA 5A8XA 4FUIA 1DX5M 1AVGH 2ZHEH 3SQHE 2AYWA 5FX5A 2V3OH 3B8JA 2PGQB 2NU3E 8LPRA 1YY3A 2P3UB 1T8MA 2Z3DA 1HBTH 1THRH 2ZC9H 1A0JA 2NU0E 4Y0YE 1MZDA 1Y3YA 1V2PT 1W0ZU 2VVUA 1BBRK 4UONA 6CHAB 1S6LA 3Q77A 3VEQB 1V2LT 2B9LA 1AVWA 1J15A 2BM2A 5EU8A 2YMSD 4UFGH 3SNBA 3RP2A 1AZ8A 1BBRH 4K5ZA 1ZTJA 2R3YA 1DVAH 3BEIB 1F0TA 4JZFH 1O3IA 3K6ZA 5CHAC 2PR3A 1P02A 1BRAA 1K1JA 1TAWA 3VB7A 2OC7A 3RXAA 2A32A 2TPIZ 1UTQA 2GT7A 3FP7E 3KQBA 2XCNA 1W2KH 1X7AC 1Y3WA 1O2YA 3AAUA 3SJIA 3V13A 2ZTYA 3GY2A 5FHTA 1ELVA 2BOHB 1SR5C 1ETRH 3LH1A 1KIGH 1NROH 2IJD1 1D6RA 4FOUC 3NKKA 4ZCNA 3H7OA 3ZV8A 1C2DA 1SSXA 2RDEA 4CBOA 2HPQH 1J8AA 5TCCA 2F9NA 4MG3A 2KAIB 2J98B 3BTGE 1OWJA 1OP0A 5F6MA 1ZZZA 1O2WA 3PLPA 3Q76A 1V2TT 2CGAA 1BUIA 3NUMA 1O3OA 3F6UH 2ZIQH 5ESBA 3TJOA 3MU1A 4B6EA 3SZNA 7ESTE 1KLJH 1ZSLA 3PMBB 3S0NA 1NPMA 3O8BA 2SNVA 1F7ZA 1LHGH 1RXPA 4O03A 4BAHB 5FPTA 1AE8H 3ATLA 3A8AA 5GNDA 4KTCA 4ASHA 2GZ7A 1MD7A 2IPHA 3SNDA 1P8VC 5TCAA 1DM4B 3A88A 3LDXH 3GYMA 3HK3B 2O9QA 1AUJA 1E1QD 1VITF 3P8FA 2FX4A 1ZPCA 5IDKA 1MD8A 4JYUH 4BAMB 1TBQH 1TA2A 1SLWB 3E0PB 1FNIA 1C1UH 2ASUB 1TALA 2ANYA 1TA6A 3L33A 3RC5A 3SQEE 1GVZA 2RFKC 1DXPA 1GI9B 3TNTA 1PFXC 1W12U 1MCTA 3SGBE 2QE7D 1EP6A 1V2VT 4LK4A 1GI5A 3OY6U 3U98H 2J92A 1ZJDA 2EA3A 2G55A 3SO3A 3UUZA 5HXFA 1TMUH 2ZGHA 4MPUA 1M9UA 2KR7A 1YPHE 3OX7U 3SYJA 2B7DH 3LKWA 4A1XA 1NY22 1A3BH 3BTKE 3RU4D 1CBWB 2XBWA 1IQEA 3K6YA 2TGTA 1C1WH 1O3CA 3OYPA 3U69H 1UMAH 4AGKA 3E0NB 1QJ7B 2C8ZB 3OTPA 1GDQA 2G4TA 2UWLA 1FY3A 1O33A 2VIWA 3BG4B 4X8VH 1VGCB 4FXGH 2TRMA 5EOKA 3BTHE 2KAIA 2J98A 1YLDA 2DE9A 2ZTXA 3NXPA 5E2PA 4ABJA 1NRNH 2BLQA 4XDEA 1Z71A 1K1PA 2WINI 3OTJE 2VIQA 4F49A 1O34A 2OD3B 3MQKC 5AVDA 2QN5T 1FN8A 1BB0B 3KGPA 3RMNH 4Q7YA 3FZDA 1CGIE 1QA7A 1XKAC 1S5SA 5B6OA 2H1UA 5BRRE 5AFYH 3P8GA 4ABHA 4UFEH 2ZPSA 1AZZA 3M7TA 3B9FH 4GSOA 4J2YB 1ELTA 2O8WA 4DGJA 2HRVA 3SU6A 4CH8B 2HOBA 3Q3XA 3KNXA 1YPLH 2JETC 1H9LB 5E0HA 3RMOH 1A5HA 1TQ0B 1WUNH 5T6DA 3NZIA 1YPGH 1C1QA 4MLFB 4Q80A 1GHZA 5GPIB 1VCWA 1A61H 4Y76A 2AHME 5F53A 1P2KA 2BQ7B 1SPJA 2PTCE 2VIOA 3RXCA 1S0QA 4OS5A 4J1YA 1BMNH 3F0PA 1SLXB 4E06H 1OWIA 2XCFA 4Z0KA 3ELAH 1Y5BT 4ZKSU 4AG2A 2C8WB 3TGIE 2ZDNA 2WPLS 4DURA 8GCHF 1CA8B 1ZTLA 5EJ1A 1H9IE 1WAYB 5IK2D 1SGFA 2C8YB 1ACBE 1D4PB 1GL0E 1W0YH 1YM0A 4P02A 3SU1A 1BHXB 4B74A 1G37A 1QBOA 2Y81A 3M36A 1OKXA 1W8BH 3RC4A 2ZU5A 2P59A 1JRSA 3UWJH 1DANH 1GI3A 1WTGH 1Z7KA 3BTFE 1YYY1 2ZU2A 5JBTA 5DPAA 3KQEA 5C5OA 4BXWA 3RXBA 1AQ7A 1YF4A 1WQSA 5F03A 1ZHPA 5JBAS 3QK1A 1TNGA 1BMFD 2EI6A 3SV8A 5C67A 4X6OA 2A4GA 2Z9GA 1T7CA 1O2KA 4F55A 1HGTH 2EC9H 1C5WB 4B2CA 1SGNE 1FIWA 4CREA 1BBRE 1HAVB 1HJAC 1NRPH 4MVNA 1D3QB 3NRLA 1H4WA 5T6FA 3ZZ4A 6GCHF 4AFZA 4CRDA 2Z9JA 3MHWU 1GCDA 4ZROA 4NG9H 4Y10E 3VPKA 1O2UA 3GYLB 1EPTC 2DUCA 2Z3CA 3LJOA 1DDJA 1TGNA 3GOVB 1C2KA 3CP7A 2R0KA 1O2GH 1FX0B 3F2HA 1IOEA 3EE0B 4OS1A 3KIDU 4ASUD 3WWBA 3MWIU 4Q63A 5E2OA 2C4FH 3AK5A 1XXFA 5LGOA 3EA8A 3ZZCA 4OGXA 1ANDA 3ZYEA 1JIRA 2BZAA 1ZMJA 4WXIA 3PRBA 1EZQA 1N6XA 4BAKB 3SW2B 4QT8C 1E35B 1GJ4H 5A0AE 1O2QA 1HAPH 1QRWA 2Y7XA 2BD4A 2VINA 2FS9A 1WU1A 2C8XB 3GDSA 5EXNA 2A4RA 1BMMH 2ZNKH 2PSXA 3NK8A 2BXTH 2UUJB 3S7HB 3MTYA 1MTVA 1OWDA 3VB3A 3BTTE 2ZFTA 1QFKH 3VFEA 1TPOA 4O9VA 2L6OA 1C5YB 2SNWA 1V3XA 1F92A 1YLCA 1MQ6A 4RN6A 1GHAG 4A92A 4X2XA 4OM9A 5KGOA 1DSUA 5C1YA 1XM1A 1JWTA 1O5AB 3VG8A 4XOJA 1C2HA 1L0ZA 1O2VA 2Y5HA 3OE7D 3ZZ9A 1EPTB 1HJ8A 1PYTD 1DWCH 1XUJA 1MZAA 2ZF0H 1C2EA 1JBUH 1QJ6B 1AGJA 1GBTA 1SFIA 3SU3A 1LKBA 1GJCB 2F91A 3HPTB 3KCGH 3AW0A 7KMEH 4DCDA 3A7YA 5A2MH 1DFPA 3R3GB 1IQKA 1FN6A 3GCTG 3SZEA 1HAVA 1QZ8A 4FU9A 1Q3XA 4YESB 1O36A 3UNSA 1N8OB 4F48B 3FP8E 2ZGJA 1K1IA 5C0TA 4AOQA 1O38A 2QF0A 2TGDA 1HFDA 4FUGA 1QNJA 5G4BA 4TPIZ 2FYQA 4CH2B 1QURH 2ZPRA 1H8HD 1GG6B 1CQQA 1TABE 1C2MA 1KLIH 3LGWA 1FLEE 1O3LA 1P0SH 2KZ4A 1GJ9B 3SUFA 3TH2H 3A8BA 1EZXC 3T25A 4Z1MD 3LJJA 2ZU3A 2ZDLA 4AGJA 1ANCA 1KYNA 3RXDA 2PLXA 1YPJH 3RM0H 3I29A 3TK9A 1DT2A 2F9PA 2M5TA 3T27A 2FTLE 1XX9A 1SL3A 3ATIA 2A2QH 1QBVH 1S85A 2F9BH 3URDA 2VIPA 1O3KA 5DK1A 1W14U 2ZKSA 2YMSC 1V2JT 1CE5A 1QTFA 4XSKU 4ZMAH 2AIQA 5DN6D 2JH5D 3F68H 4WMDA 4ZHAA 3TITA 1O5CB 1P9SA 1GJ8B 1FAXA 1V2UT 2QIQA 1GJ6A 3PMJA 3GS9A 3FZZA 1Z1IA 3SNAA 1WXRA 1SC8U 3ZVDA 1WQVH 3PO1C 3VXFH 2HNTE 3P17H 3H7TA 4K60A 3ZVBA 4YTAA 1GDNA 3SNCA 2P94A 1SMFE 2W26A 3RXUA 4WWYA 1EQ9A 2ULLA 4Y7AA 2NU2E 1EPTA 2GV6A 1C1TA 2ZDVH 4FUCA 3ZYDA 3ATMA 5EJZA 4RT1A 2AERH 2CN0H 4NA8A 4Y11E 5B6LA 1O5GH 2UUYA 1NT1A 4NZQA 2L74A 2D26C 2LNCA 3OSYA 3FKSD 2J94A 3R0FA 4IN2A 3RU4E 3OEED 1UTJA 1GI7B 2ZDAH 1GBCA 3SHCH 1MBQA 2BDHA 5KECA 2ILNA 1YP9A 2YMSB 3MYWA 2J34A 2AGGX 2JJ1D 1CT4E 4KKDA 2O8TA 2ZECA 1GI8B 1EKBB 1UVOA 5EXMA 2RA3A 1NBMD 1Y5AT 2FS8A 2P3FH 4H6TA 2Q6GA 1C5XB 2FLBH 3I78A 1O3DA 5A0CA 3FVFB 1A2CH 1NRSH 4X1QU 1MQ5A 3MH6A 3QUMP 6CHAC 1TLDA 2BQWB 2PKSB 3KYGA 2FTMA 2K8IA 2BYAX 4X1NU 3MU5A 1QCPA 1IQJA 2AMDA 3TH4H 4MTBA 3ENSB 3MMGA 3M61U 2BX3A 1S6HA 1SQOA 2KCAA 3K2UA 3T5FH 4RKJB 1TOCB 3WY8A 5C3NA 2FEQH 5EJLA 1QQUA 5EXLA 4YT6H 1Q31A 5ESTE 2WYGA 4MQAA 2BDBA 3FFGA 3RXGA 2XTTB 3PROA 7GCHF 4TWWA 1GJ7B 2SGEE 3KN2A 4ISLA 2VWMA 2ZA5A 1ZLRA 2ALVA 4A7IB 1G30B 4E7RG 1UK2A 4ACBA 1LQEA 1L1JA 3A81A 3VB4A 4OS6A 2KCYA 3RXQA 2J2UA 4HI3A 1FV9A 1C5QA 4K2YA 3PTNA 2GX4A 2KX4A 1W10U 1MTUA 2RDLA 4AFUA 3QGNB 1P12E 2CF9H 4X1PU 4D7FA 1W7XH 3I77A 1OWKA 1C5TA 3M3TA 1GHBF 1PPHE 4PROA 2CHAB 2IN2A 3V0XA 1DUAA 9ESTA 2VGCC 3EA7A 3PMAB 1L4DA 1CSOE 1O2XA 4KTUA 2ZP0H 3UY9A 4B1TA 4B76A 1NU7B 1V2NT 1EZSC 2GVFA 1ABIH 4UFDH 1XXDA 2BDGA 1QHRB 1KXEA 3SI3H 5JYIA 3O8CA 4WMFA 2CK3D 4O3TA 4AORA 3A7XA 3TGJE 2FLRH 3RXRA 3T28A 1CT2E 5LH8A 1O3EA 3A85A 5AF9H 2VVCA 2Z6BD 3LGUA 2QA9E 1UTMA 3UAIC 1YCPK 1KY9A 5E0GA 2H9HA 1C5VA 1C2JA 2F9VA 3B23B 1HXEH 2XNIA 2XBVA 3M5OA 2BDCA 1YCPH 3A7VA 5C2ZA 3MU0A 2PP6A 2WPJS 1G2LA 2J9NA 3RU4T 2BZ6H 3ODFA 2BVSH 2FI3E 1P2IA 2ZHDA 3MI4A 3D23A 1J17T 1AU8A 1O3AA 3VB6A 2M2AA 1CO7E 3PM3A 2LELA 2VWNA 5C20A 2FOMB 1MTWA 4A1TA 3EYDA 1A7SA 3PWCA 1K22H 3TJNA 1QGFA 1HAGE 3M3VA 4X2WA 5DP8A 1CBWC 3GY3A 1TRMA 5T3HA 1O5FH 3U8OH 2F9UA 4B6FA 2VGCB 2GCHG 1T4UH 3LGYA 3E91A 4AFSA 1Y8TA 4FVDA 4I8GA 1P05A 2STBE 1P57B 1TBRH 1TYNA 3STIA 1IQGA 1BHXF 1P2JA 1H8ED 1V2QT 1WYKA 3BG4C 1VGCC 1ANEA 2V6NA 2NU4E 3W95A 3MH4A 3UTUH 2XYAA 4KTSA 3DSGA 4GHQA 3T62A 4BNRA 2BD3A 2FOEA 3P6ZB 1DUEA 2ZHWH 1O2PA 4RSPA 1O2TA 1RIWB 3N99A 2WPMS 3PTBA 1SFQB 2G81E 5TJXA 4Q2KA 3MO6A 2H5CA 4ISNA 2FODA 2QAAA 5IYTA 4VGCB 2V3HH 1EAWA 1UHBB 1GMDF 3MO9A 5I25A 1ZMNA 1MUEB 8GCHG 1SG8B 1GGDC 1K28D 2WV9A 1INCA 1ELGA 4Z6AH 3CS0A 3FANA 1BRCE 4GCHG 1HJ9A 1SGQE 4RI0A 3M7UA 2RCEA 3SOSA 1W11U 1BCUH 3UOUA 3DA9B 1C4Y2 4DJZB 3SV6A 4DVAU 4CRBA 1PQ5A 1HCGA 1TNLA 1OP8A 3TIUA 4OS2A 2P93A 3U1IB 2FOBA 3CENA 1DITH 2OBOA 3RXPA 2FESH 5ETXA 1O2JA 3QTOH 3LOXA 1D3PB 1TNKA 2GMTC 4H6SB 1HPGA 5C0UA 2AEIH 2A31A 1KTSB 3GCHB 3ZVFA 2JIZD 1FIZA 1JRTA 3K9XB 4TPYA 5GIBA 3OY5U 3AW1A 4B75A 6GCHG 1BITA 3BEUA 5FBEA 3RXFA 2PW8H 3CS7A 4YLUA 1THSH 4DW2U 4I8LA 3UOPA 2OC8A 4UDWH 2VH0A 1UVSH 3UNRA 1LO6A 2Q1JA 1D9IA 4KELA 1MU6B 4X2YA 3QO6A 5DGJA 1UJ1A 3KHVA 1GDUA 1J16A 1Y3VA 4P00A 1NRRH 2BY8X 2ZGCA 3SHAH 4NFFA 1TRYA 1B5GH 1D3TB 2QGRA 2TIOA 4TSFD 1HAIH 3PV2A 1QJ1B 1PJPA 2WUCA 1O3PB 2SFAA 4ABBA 1IQIA 1HB0B 3GISB 1GBIA 1O35A 3PV5A 4XE4A 2XXLA 4Y0ZE 5JB8S 2VWLA 1RTKA 1GGDB 3E8LA 4HZHA 1TIOA 3LC5A 2SGDE 3TNSA 4U30A 2AIPA 3A7TA 4I8HA 4YO9A 4ZUHA 4K69A 4A1VA 1YPHC 5HYOA 1VZQH 4HGCA 3AASA 3UWIA 4I8JA 2QCYA 4JMYA 2BLOA 2W3KA 3T26A 1XUIA 1MH0A 2BXUH 1UHBA 2OBQA 2ZI2H 4Y8XA 3MU4A 4FU8A 5F8TA 3TJUA 4DIIH 3QTVH 2GMTB 3A82A 1SLUB 2GD4B 1UVUH 4D76A 2BQ6B 3UQOA 1ETTH 1A0HB 5HMAA 3F2GA 4CRGA 3M7QA 1KXFA 3DT0H 1Z8IB 2AMQA 1KXBA 1SBWA 1BTUA 4NA9H 2FXRA 1TPAE 4XBDA 1GBFA 1QA0A 3WW7A 1O2SA 1AD8H 1TX7A 2I6QA 1C1SA 2ZDKA 2ZWLH 2B8OH 2WYJA 4ZKNU 3PRDA 1P9UA 1HAOH 1PQAA 5JPMH 3LU9B 4YOGA 3BEFB 3MNSA 1HUTH 1O5BB 2ZEBA 1O32A 3BF6H 4INHA 5DP9A 3M35A 4I31A 1NBME 4D7GA 4K1TA 3U9AH 4XRNA 3IG6B 1C5OH 2P8OB 3ZVGA 1O2IA 3MNCA 5HGGA 2PHBA 2BD8A 1MTSA 1GBJA 1CA0B 4NIWA 1RD3B 1NZQH 4X8TH 1C2FA 3QZRA 4WY3A 1C4U2 2VIVA 4NWKA 3M3SA 5DP6A 2JH6D 1O30A 2XNDD 1JMOH 1QRXA 4AG1A 2A7CA 1RTFB 5DO4H 3A86A 1SOZA 3GDVA 5L6NH 3RMLH 4B2BA 2W3IA 5JDUB 1G3CA 1UK3A 1GBBA 2BD2A 5FCRA 2FDAA 1UTNA 2SGFE 2ZGBH 2BY6X 1C1OA 2ZQ1A 1FMGA 1OYTH 2GT8A 5C17A 3FO8D 1N8OC 5BPEA 2A5AA 1ZSKA 4JZ1A 4U2WA 1QY6A 1YPMH 3GCNA 4NIYA 5EQQA 4DT4A 2V7QD 1OP2A 5FPSA 1ESTA 3KF2A 1TMBH 1E1RD 4ZHMU 3VB5A 1Z1JA 4WF8A 1GG6C 1OHHD 3DCLA 1C1MA 1LMWB 2ZFSA 4JYTA 2OK5A 1GI0A 4TYDA 3MNXA 1A4WH 1T8NA 4I33A 1ELBA 1S0RA 3NPSA 4ABAA 4WXVA 4U01A 2HGTH 2ZCKP 3ZVAA 1GI4A 1C1NA 2G5NA 3BIUH 3RLWH 1BTHH 1W7GH 3QDZB 2HLDD 4BTUB 3UPEA 5I46H 1UO6A 1Q2WA 2A5IA 1ESAA 1SGIB 2BLVA 5C1XA 5HM2A 4FUHA 2VH6A 3MO3A 1VKYA 5DG6A 5FX6A 3N7DA 4OS4A 1THPB 4TWYA 1HXFH 3QX5H 6ESTA 1GCTB 1ZSJA 1QR3E 3TH3H 2OP9A 3A8DA 2OUAA 1ARCA 1LDTT 1SVPA 3KQ5A 1XVOA 2XC5A 2TBSA 2CF8H 1UVTH 5PTPA 1C2LA 1G3BA 1IQLA 2ZHQH 1FUJA 4GPGA 3SGQE 1FY5A 4UEHH 1MCVA 3LH3A 1MAYA 4I8KA 1P11E 4CBNA 3ZZ3A 5FAHA 1BZXE 3P70B 1O2OA 4X1SU 1KSNA 3HKJB 4B2AA 5A0BA 1CVWH 1E36B 4Y79A 4E05H 1QIXB 1NN6A 1BTYA 2H5DA 4K1SA 1A46H 1SKYE 3OFND 1SGCA 4FETA 1AB9C 2K0QA 4IMQA 3NWUA 1U6QA 4ABGA 1MU8B 1C5LH 1AN1E 4HG6A 1S83A 1BDAA 1O3FA 2HVYB 4K8BA 3RXKA 1NFUA 3RXSA 1N6YA 4BAOB 1AE5A 2RA0A 1HAHH 1IQMA 1O3BA 3QN7A 1ZMLA 3MNBA 2EQNA 1LHDH 1MTNB 1TPPA 5CMXH 4ISIH 1KLTA 3DHKH 3FP6E 4AYVB 1F0RA 2HNTF 4IW4E 1EX3A 2WPIS 4FU7A 4IS5A 1B0FA 3L3TA 4ZH8A 1SGYE 2ZFRH 9LPRA 1C1PA 1TBZH 4KP0A 1DWBH 3SGAE 4AB9A 2Q6DA 2CJIA 2FI4E 3MH7A 5EIYA 1LHFH 4ZAEA 4DIHH 3A89A 3PMHB 1K1MA 2FOAA 2XW9A 3DFLA 7GCHG 2FOFA 1E38B 1Z6EA 1AKSB 1P2OA 4CRFA 4LZ1H 1SGTA 1BMLA 1F5LA 1QB9A 2C3SA 3U8RH 3C27B 1AHTH 6LPRA 3BSQA 3S69A 1SGFG 2QV1A 1ELFA 1XMNB 1EOLA 8KME2 2PKSC 1ELDE 2KCOA 4IGDA 2EI7A 2WPHS 2W6JD 2VWOA 2XBXA 1EASA 2HVXA 1BIOA 1K1NA 3AVZA 1BTXA 2UWPA 1AB9B 4NIXA 1SGPE 1S82A 1GHBG 1C5NH 1GBEA 1P3EA 1GBHA 3OEHD 1EXFA 2ZU4A 3Q3KA 4MPVA 1HRTH 3WWFA 1GJDB 4BXSA 3RM2H 1ZPBA 5FCKA 3E16B 5HKKD 1UW7A 2THFB
chains in the Genus database with same CATH topology
1DWDH 4INLA 2Y5FA 5JBCS 2GDDA 1C9PA 3TJVA 3A80A 1EAIA 3F1SB 1UCYK 1VITH 5F8XA 1Z8JB 1GHAF 2QXJA 1NM6A 1O3NA 2H9EH 1GWAA 3M5NA 5EQRA 1C5RA 1H8IH 2WPKS 3KQDA 3W94A 1O39A 1UCYH 3UREA 2P3TB 1WTHD 5EPNA 3RDZA 1CU1A 3SJ8A 3M5MA 1O3GA 4NIVA 4X2VA 1UVPA 2BY7X 2YNAA 1MMJN 5EGMA 2JH0D 3RXMA 3VGCB 1O0DH 2HNTC 3LGVA 3RXJA 1F2SE 2VVVA 1S6FA 2A4QA 4JK6A 1C2IA 1P2QA 1IQFA 1J14A 2BTCE 2CHAC 2GP9B 2K1QA 3UR6A 3GICB 1TGCA 2FI5E 4AYYB 1QB6A 1YKTA 4D8NA 4NGAH 3TLOA 3ZZ8A 4ISOA 4O3UA 2R2WU 2F9OA 2ALPA 3AAVA 3E3TA 5GDSH 2FO9A 5EPYA 2FYRA 4IMZA 1A5GH 3N7OA 1TWXB 1C1VH 2AH4X 3GY5A 1DWEH 1GHXH 1AKSA 2PTNA 4ZKOU 1HAXB 2C90B 3SU4A 5HM9A 2FM2A 1TGSZ 4I32A 5L2YH 1TNJA 2FOHA 1C5SA 4JK5A 1UK4A 1TX6A 1UTOA 4GAWA 3S7KB 4ISHH 1MBMA 4AB8A 3PYHA 1AY6H 1V2RT 2GCTC 1DE7H 3FAOA 1OX1A 1HLTH 2WV5A 1LKAA 1N1LA 3SUDA 4ABFA 2O8MA 3TVJB 1P09A 3EQ0H 5EW2H 3UFAA 4MNXA 1MKXK 1TOMH 1FPHH 1C4V2 1T8LA 1S84A 2ZG0H 5JBBS 1GMHF 1LVMA 3ZV9A 4ABEA 3HATH 4CR9A 2H2ZA 1TGTA 1VITG 1GMCF 4X6MA 2O8UA 5GCHF 1MKXH 1WSSH 4UFFH 3K65B 1NTPA 4X0WU 3IWMA 1GMDG 3O8DA 3Q3YA 2W7SA 3S9BA 1TFXA 4TY7A 1ZGVA 3TK6A 2HLCA 1G36A 2OC0A 4TY6A 1KXCA 1GHYH 1IHTH 1O2ZA 3A8CA 4K3JA 2R9PA 5AHGH 1BTPA 1AWHB 1O37A 3EGKH 2ANWA 3S9CA 3DUXH 1FONA 1DXWA 2FOGA 1P04A 1KXDA 4IBLH 1HV7A 4MPWA 2VIDA 3QGJA 1KXAA 1EAUA 1ESBA 3SJ9A 1XKBC 3ITIA 1AFEH 1NS3A 1WCZA 1AUTC 2FP7B 4YT7H 1MAXA 2R3UA 1RIWC 1GBKA 4HTCH 2FMJA 1L1GA 3C1KA 1T4VH 2WUBA 1O2NA 1Z8GA 1A1RA 1LCYA 1OOKB 2OINA 4VGCC 2ODYB 2ZGXH 2GCTB 2BD5A 3D62A 5AFZH 1KTTB 1V2OT 3KQCA 3URCA 1K1LA 2ZFFH 2QY0B 3NCLA 3JZ1B 4ZXYH 4JCNA 4WMEA 1FQ3A 1F5KU 5FBIA 4WH8A 3A83A 2ODQA 2ZPQA 1EB2A 1F0SA 1O2LA 1YPKH 3ATWA 3GY4A 4UE7H 2PKAB 2ZO3H 5J4QA 4BTTB 1VCQA 2J4IA 1K2I1 2AGIX 1WV7H 1FXYA 1FI8A 1SB1H 1BQYA 3SI4H 4NCYA 2W5EA 3RXOA 4D9QA 1PPCE 1VJAU 3BV9B 2ZCLP 2GKVE 1Y59T 3GCHC 1TPSA 2GGVB 5K0HA 1EP5A 4AFQA 2PGBB 3SV9A 1P2NA 3SU5A 1ELCA 1J9CH 4Q7XA 3E90B 5L30H 3RXVA 5H4IB 2V35A 1XUGA 3M37A 3S9AA 1Y5UT 1O2HA 3E6PH 2D1JA 1LVOA 1ORFA 4ZKRU 1GHWH 1O2MA 2BHGA 2D2DA 2Z94A 3BIVH 4Y8YA 1SI5H 1LHEH 1OPHB 2BVRH 1BMAA 5LPRA 4RKOB 2CMYA 1Y3XA 3GY8A 2A4OA 1CHOF 2TGAA 1XVMA 2D8WA 4FUJA 1ELAA 3SV7A 2Z7FE 3H5CB 5CHAB 1AWFH 1F0UA 1OS8A 3D65E 3IITA 1EJAA 1C5UA 1HYLA 4X8UH 1SHHB 4MNVA 1W3CA 2GZ9A 4X6PA 1C5MD 2XC4A 2FIRH 2PWXA 2H6MA 1ZOMA 4AZ2B 1SOTA 2A2XH 1QL8A 8ESTE 3P8OA 1PPZA 2F3CE 1Y3UA 1BRBE 1G3EA 5LPEA 2UUKB 2J38A 4XFQA 3LIWA 5K7RA 3RXHA 2G00A 1O5DH 1UCYE 2PKAA 4H42U 1D3DB 1G3DA 2QYIA 5EG4A 5J4SA 1GI6A 2W7UA 1HIAB 1A5IA 1ZPZA 4K1EA 4Y8ZA 3UQVA 2ZQ2A 3JZ2B 5A8ZA 1NC6A 3ZZ6A 1A0LA 1TRNA 2G51A 5E8EH 2R0LA 1XUFA 1UTPA 3TK5A 1PYTC 4ABDA 1NFWA 1RTLA 3KEEA 1NO9H 3VXEH 5FXLA 2HWLB 1QB1A 2AS9A 2UUFB 1O3MA 2P8OC 3LT3A 1IQHA 3OU0A 1P03A 4KGAA 1GJ5H 1FDPA 2BD7A 3U1JB 2BVXH 1K9OE 1ABJH 3F9FA 1SHYA 3UR9A 3PLBA 2PFEA 2PUXB 1EAXA 1NRQH 4LZ4B 4R0IA 1CA0C 1P3CA 7LPRA 2QF3A 2A5KA 3G01A 2RG3A 1K21H 1FZZA 1QRZA 4OGYA 3BG8A 1AIXH 2QXIA 2ODPA 1L1NA 1TB6H 1GVKB 1V2MT 2GCHF 1RJXB 1NESE 1GVLA 4GHTA 2G8TA 3PWBA 5DP4A 2WV4A 3ATKA 1LPKB 2J95A 1H9HE 4BOHA 2GTBA 1HAZB 1BRUP 1PQ8A 2Y5GA 4FUFA 1G2MA 1KDQB 2ANKH 1B0EA 4NWLA 3D49H 2P16A 2OQ5A 4ZXXH 1JOUB 2Z9IA 5GJ4B 2NU1E 1TNHA 3BTWE 3RMMH 1LHCH 2ZFPH 3ZZBA 2OC1A 2OLGA 1Z8RA 1T31A 2FZZA 4FUDA 5GWZA 4CHAC 2VB0A 1PPFE 4GCHF 2BDAA 1GJAB 1QL7A 5A8YA 2BY9X 4JZDH 3V3MA 1HIAA 3BTME 2A7HA 1LQDB 2DE8A 1FY1A 2BDYA 1AVXA 3SUGA 1BA8B 1CGJE 3E1XB 4WH6A 3Q00A 3LPRA 4XBCA 2PV9B 1FY4A 3RXTA 2IJOB 2YOLA 1GBDA 4U32A 5FPYA 1SQAA 2P95A 1GCTC 1OXGA 1ID5H 4YZUA 4SGAE 3GCOA 4YOJA 1CGHA 2XWBI 4Y6DA 2ESTE 4MPXA 1O31A 2AGEX 3O8RA 1C2GA 1CT0E 4NA7A 1EJNA 1GBAA 3STJA 2CV3A 3ZVCA 2JETB 1DY8A 3HK6B 3ZZAA 1IHSH 3ZVEA 1NU9A 2Z9LA 3DFJA 1LTOA 3SORA 2ZTZA 3F9HA 2G52A 2ZFQH 4JZIA 1ZHRA 4A5TS 1P06A 3A7WA 4IN1A 2BDIA 1PPEE 3LONA 2BMGB 2H9TH 2ZHFH 1T32A 2Y6TA 1V2KT 4X1RU 2Q6FA 1O3HA 1BTWA 2Y7ZA 2TGPZ 5L2ZH 4INKA 3RXIA 1EB1H 3KL6A 1GBLA 4LXBH 3M5LA 3RC6A 2SGAA 2R2MB 1NFYA 4CHAB 1VR1H 2BD9A 2VJ1A 1ZYOA 2AFQB 1KDQA 5C5NA 1SQTA 3GY7A 2A1DB 3SU2A 5JB9S 3A7ZA 1MTNC 1YCPM 3RXLA 3TGKE 3V7TA 4H4FA 2XBYA 5C1UA 1RFNA 1EUFA 4R8TB 3T2NA 3UIRA 1GL1A 4NFEA 4FUBA 3A84A 1P2MA 4GVUA 4A6LA 1YPEH 1L2EA 3P95A 4ZHLU 1ZHMA 1HAYB 4LOYH 4YOIA 4AX9H 2XC0A 3L6PA 5LPFA 2FX6A 3RLYH 1BJVA 4HFPB 1A3EH 1PPBH 1HJAB 4F4OC 1IAUA 1RS0A 4DG4A 3F9GA 1ETSH 4YM9A 2QC2A 2SGPE 5E0JA 1FJSA 1DPOA 1C5PA 1ZGIA 5T6GA 4FVBA 2XWAA 3PLKA 5EODA 1AI8H 4IC5A 1DLKB 4XBBA 3BTEE 1LVBA 1DY9A 4FUEA 1C1RA 1ELEE 1ZJKA 1GPZA 3BTQE 2ZCHP 3V12A 2UWOA 2EEKA 1H8DH 1W13U 1DICA 1P01A 1K1OA 3EDXB 1TQ7B 2NWNA 2VNTA 3HKIB 1C9TA 2GV7A 1AFQC 3SN8A 1FAKH 4I7YH 3QLPH 1GI2A 3RUOA 1UTKA 1V2ST 1QQ4A 2QXHA 5DP3A 3TU7H 3GDUA 4SGBE 1BJUA 1B7XB 2Z3EA 1P10A 1CHGA 1OWHA 1F5RA 2QXGA 3LC3A 4BAQB 3DD2H 1V2WT 4JYVH 1XUKA 1BTZA 3VGCC 3HGNA 3F9EA 2ZZUH 3HGPA 4Y71A 1FY8E 3SJOA 1OYQA 3GY6A 2B0FA 1LPZB 1BT7A 1SGRE 1PPGE 1PQ7A 1GI1A 2G5VA 2IOTA 1JXPA 1GMHG 1VJ9U 3BN9A 4DT7B 3SU0A 2XRCA 1TONA 4BANB 2I6SA 4E7NA 1GMCG 1H1BA 1SLVB 5GCHG 1TNIA 3ZZDA 3SNEA 3QWCH 1C5ZB 2FOCA 2V0BA 2YNBA 1LPGB 4AN7A 1E37B 1LVYA 1MKWK 1FPCH 1OWEA 4B73A 2A7JA 3P92A 4WJG2 4NSVA 1TGBA 4B71A 5SGAE 5DKMA 3LGTA 1MKWH 2PSYA 5DJ7A 1EOJA 1AFQB 5ABWA 1AMHA 4CRAA 3LGIA 1G9IE 1WOFA 3ZZ7A 1O5EH 5GXPA 2C93B 1L4ZA 1G32B 1VCPA 1E34B 2GDEH 3T29A 1HDTH 1T8OA 3A87A 1ANBA 1DOJA 3QZQA 1XUHA 3ESTA 1S81A 1SGDE 4X6NA 1DLEA 5DP5A 1TX8A 2BLWA 5F8ZA 1O2RA 2FWWA 1DS2E 4YLQH 3SJKA 2BX4A 5A09A 3BTDE 2GZ8A 2HPPH 3GCTF 4X8SH 1RGQA 4M7GA 4MNWA 1YGCH 2VU8E 3MU8A 2Z9KA 1E0FD 5EQSA 3P8NA 4JZEH 2A45B 4BTIB 5DP7A 2ANMH 2STAE 4UD9H 3RXEA 2G4UA 1ZRKA 4ABIA 1BOQA 1SGEE 2Y80A 4CRCA 1TMTH 1IQNA 1YC0A 2ZU1A 3PO1B 4O97A 2CXVA 2OTVA 3PB1E 4OS7A 2BB4A 2EI8A 2FPZA 4MDSA 3ZZ5A 2SGQE 1GJBB 1QL9A 3SBKA 3SUEA 1Z6JH 4GLYA 1NFXA 3UNQA 1HNEE 1AO5A 1WBGB 2OXSA 1YBWA 2JKHA 2OQUA 4WVPE 1DSTA 3MH5A 1QBNA 4ESTE 1EJMA 5CE1A 4GUXA 3ODDA 2HALA 1ARBA 2AMPA 1EZUC 2Y82A 3TPIZ 4Q7ZA 1GHVH 4DY7B 2O8LA 3U8TH 4IC6A 1ZR0A 2F83A 1TE0A 4Y7BA 2BY5X 3MFJA 4DOQA 1OSSA 1D6WA 2B5TB 2OCVB 1V6DA 4NSYA 2A0QB 4K8YA 2PUQH 1EATA 4THNH 1CHOG 1ZRBA 3MOCA 4D9RA 2BOKA 4MNYA 5EW1H 2ZDMA 3EAJA 4NZLA 4CR5A 1GBMA 1O3JA 1UTLM 1ZTKA 3PV4A 3EA9A 1JIMA 3SV2H 1RRKA 2LPRA 5A8XA 4FUIA 1DX5M 1AVGH 2ZHEH 3SQHE 2AYWA 5FX5A 2V3OH 3B8JA 2PGQB 2NU3E 8LPRA 2P3UB 1T8MA 2Z3DA 1HBTH 1THRH 2ZC9H 1A0JA 2NU0E 4Y0YE 1MZDA 1Y3YA 1V2PT 1W0ZU 2VVUA 1BBRK 4UONA 6CHAB 3Q77A 3VEQB 1V2LT 2B9LA 1AVWA 1J15A 2BM2A 5EU8A 4UFGH 3SNBA 3RP2A 1AZ8A 1BBRH 4K5ZA 1ZTJA 2R3YA 1DVAH 3BEIB 1F0TA 4JZFH 1O3IA 3K6ZA 5CHAC 2PR3A 1P02A 1BRAA 1K1JA 1TAWA 3VB7A 2OC7A 3RXAA 2A32A 2TPIZ 1UTQA 2GT7A 3FP7E 3KQBA 2XCNA 1W2KH 1X7AC 1Y3WA 1O2YA 3AAUA 3SJIA 3V13A 2ZTYA 3GY2A 5FHTA 1ELVA 2BOHB 1SR5C 1ETRH 3LH1A 1KIGH 1NROH 1D6RA 3NKKA 3H7OA 3ZV8A 1C2DA 1SSXA 4CBOA 2HPQH 1J8AA 5TCCA 2F9NA 4MG3A 2KAIB 3BTGE 1OWJA 1OP0A 5F6MA 1ZZZA 1O2WA 3PLPA 3Q76A 1V2TT 2CGAA 1BUIA 3NUMA 1O3OA 3F6UH 2ZIQH 5ESBA 3TJOA 3MU1A 3SZNA 7ESTE 1KLJH 1ZSLA 3PMBB 3S0NA 1NPMA 3O8BA 2SNVA 1F7ZA 1LHGH 1RXPA 4O03A 4BAHB 5FPTA 1AE8H 3ATLA 3A8AA 4KTCA 4ASHA 2GZ7A 1MD7A 2IPHA 3SNDA 1P8VC 5TCAA 1DM4B 3A88A 3LDXH 3GYMA 3HK3B 2O9QA 1AUJA 1VITF 3P8FA 2FX4A 1ZPCA 5IDKA 1MD8A 4JYUH 4BAMB 1TBQH 1TA2A 1SLWB 3E0PB 1FNIA 1C1UH 2ASUB 1TALA 2ANYA 1TA6A 3L33A 3RC5A 3SQEE 1GVZA 1DXPA 1GI9B 3TNTA 1PFXC 1W12U 1MCTA 3SGBE 1EP6A 1V2VT 4LK4A 1GI5A 3OY6U 3U98H 2J92A 1ZJDA 2EA3A 2G55A 3SO3A 3UUZA 5HXFA 1TMUH 2ZGHA 4MPUA 1M9UA 1YPHE 3OX7U 2B7DH 3LKWA 4A1XA 1NY22 1A3BH 3BTKE 3RU4D 1CBWB 2XBWA 1IQEA 3K6YA 2TGTA 1C1WH 1O3CA 3OYPA 3U69H 1UMAH 4AGKA 3E0NB 1QJ7B 2C8ZB 1GDQA 2G4TA 2UWLA 1FY3A 1O33A 2VIWA 3BG4B 4X8VH 1VGCB 4FXGH 2TRMA 5EOKA 3BTHE 2KAIA 1YLDA 2DE9A 2ZTXA 3NXPA 5E2PA 4ABJA 1NRNH 2BLQA 4XDEA 1Z71A 1K1PA 2WINI 3OTJE 2VIQA 4F49A 1O34A 2OD3B 5AVDA 2QN5T 1FN8A 1BB0B 3KGPA 3RMNH 4Q7YA 3FZDA 1CGIE 1QA7A 1XKAC 1S5SA 5B6OA 2H1UA 5BRRE 5AFYH 3P8GA 4ABHA 4UFEH 2ZPSA 1AZZA 3M7TA 3B9FH