1MTWA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA02
4FVBA 2TGDA 1C5QA 2BY5X 2P3UB 1MQ6A 1OX1A 3KQEA 5C5OA 1P9UA 3QGJA 1AGJA 3A7TA 2BVRH 2BDYA 2O8LA 1HJAC 2G4UA 3SNEA 1QL8A 1NN6A 1UK2A 1CGHA 2XCNA 4H6TA 3UIRA 1C1SA 1XUIA 4K5ZA 4MG3A 3A86A 2PKSC 5FXLA 4ABHA 5F6MA 5CE1A 2SGPE 2QIQA 1YPHC 1QBNA 4ISHH 2H5DA 4OS4A 2BDCA 1OOKB 1C4Y2 1SVPA 3RMMH 3Q3XA 2HOBA 1BB0B 1DE7H 1JWTA 1RGQA 4DT7B 1T32A 4X8VH 1WTHD 2WPHS 2W7SA 5CHAC 3UY9A 1N1LA 3K2UA 3RXGA 1Z8IB 1ETSH 3AW0A 3BEUA 1W14U 5A2MH 3V13A 2JH6D 1G32B 5EXMA 2H9TH 2PTCE 3ZZDA 4B2AA 4MNVA 3A85A 1ID5H 2ULLA 3P17H 3L3TA 5AFYH 5FX5A 2TPIZ 4E06H 4AGJA 1NRRH 2GV7A 3T29A 1HNEE 4B74A 4ZKOU 2AEIH 1HAVB 3F9GA 3LT3A 3MYWA 1MZAA 4D9QA 2BDAA 1MBMA 3MHWU 1HAVA 3RU4E 2Z9IA 2FI3E 4X0WU 3BEFB 3ZZ8A 2FYRA 4ABIA 1RIWB 1VITH 4FUCA 2HNTF 1ABJH 7GCHF 1EATA 1GHXH 1GVLA 2WV5A 3LOXA 3UUZA 1FY1A 2W26A 4KGAA 1ANBA 3UOUA 2FXRA 2OCVB 2HVXA 3SJ8A 2O8TA 1JIMA 1TBZH 1BDAA 1N6YA 2F9BH 1GBHA 4RN6A 1L1JA 3PLPA 3W94A 1ELFA 1Z6EA 2NU4E 2ZCLP 1P12E 4I31A 1O3DA 2J95A 3GY5A 1V2MT 2PKSB 2G52A 2V0BA 3NK8A 1TRYA 3MU5A 2ALVA 1ZOMA 2IPHA 5DK1A 2EA3A 1THSH 4DIIH 1ETRH 3TK6A 1XUHA 1FY4A 4KTCA 2XCFA 5DG6A 3Q00A 3TK5A 1JOUB 1EB2A 1GJ4H 1SLVB 1VJAU 2OBOA 5LGOA 1E37B 2P95A 4WVPE 3TH3H 4BAQB 3PLBA 1C5UA 5JBBS 1Z71A 3URCA 2J4IA 2BOKA 2HGTH 3QTVH 4CRBA 1U6QA 5CHAB 1BTYA 1BIOA 2PV9B 3SHCH 3URDA 3ZZBA 1BZXE 5JYIA 3ZVDA 1XVOA 2F9VA 3P8OA 2A7CA 3GCTF 2EI8A 1PQ7A 1YYY1 1O5AB 2BLVA 1ZJDA 3M5OA 1V2ST 1DM4B 3KIDU 2ZFSA 3LPRA 1EAXA 2OXSA 1YPHE 2IJOB 1AVWA 3TGJE 3SOSA 2Y6TA 4R0IA 1WTGH 1V2OT 2BM2A 2WUCA 2VWNA 1SI5H 2BXUH 1B5GH 2ZGCA 1OXGA 1PPZA 3T25A 4YM9A 1P8VC 1TRMA 5T6GA 1F5LA 3SU3A 4H6SB 1F0UA 3MH5A 3SZNA 1P2MA 2NWNA 1QB1A 4WMEA 3SUEA 5AFZH 2BD8A 2QC2A 1FUJA 2C3SA 3RXJA 3OSYA 1C4U2 2SGEE 1TGNA 5I46H 1T31A 4A1TA 2ILNA 1A2CH 2FOEA 5BPEA 4YLUA 1H8IH 1BMMH 1BRCE 1C9TA 2ZA5A 1BBRK 1P3CA 2VIVA 3A7ZA 1LVOA 3RU4D 4KTUA 3EYDA 1TA2A 2H9HA 4ABGA 1Z6JH 2XBWA 4SGBE 3RXRA 4IC5A 2PSXA 1Q31A 3P95A 3A7VA 3SNDA 2JH5D 1HAYB 3SN8A 1F92A 4A7IB 2EI7A 1O3OA 1KXCA 1SLUB 1O3EA 3RC4A 4MNWA 2GT8A 3ENSB 2BX4A 1O33A 1GG6C 3KHVA 1Z1JA 2ASUB 1K1MA 4ABFA 4INLA 3SUGA 3EGKH 1HAGE 1C2HA 1ARBA 2TIOA 1WQSA 3RXTA 5A8XA 1TGSZ 1HAXB 3BTKE 1F5KU 1TYNA 1NPMA 2GX4A 1KIGH 2ZI2H 3QLPH 2A2QH 2C93B 3RC5A 2BB4A 1HJ8A 1AZZA 2EI6A 2ZTXA 3PMHB 1GDUA 1GHYH 1C5LH 4AGKA 5BRRE 3BTTE 3KQDA 1PJPA 1QRWA 2OC1A 4AFUA 4YZUA 1GCDA 4ABDA 1Q2WA 3OTJE 5DP9A 1DICA 1EP6A 1HAPH 5DP6A 1C1RA 2BY8X 1SG8B 1MKXK 2G81E 1SGDE 2AMPA 1C2KA 3P6ZB 3GICB 1SQAA 2VIDA 1XUFA 2LNCA 4IW4E 4Y6DA 1H8DH 1GJBB 5G4BA 1D6RA 1EPTB 1RXPA 3BTEE 3QDZB 3FFGA 4SGAE 1LPKB 1P9SA 2ZU5A 1EPTA 1GCTC 5C5NA 1PPCE 1BMLA 3KNXA 2UUKB 1DWDH 4O03A 4WY3A 5EPNA 3F68H 1QL7A 1LHEH 3SV8A 3T27A 2W7UA 1YKTA 3SNBA 5C2ZA 2D8WA 5JBAS 4THNH 1AU8A 1YPKH 3UFAA 2Z7FE 1O5DH 2AGGX 4BANB 4IBLH 2A4GA 3L6PA 4UDWH 1O2JA 4XE4A 3P92A 1S0RA 1O5EH 2FIRH 1QJ6B 2FTMA 6ESTA 1L1GA 2DUCA 2OQ5A 3SBKA 2RA0A 7LPRA 1BHXB 3MU0A 1UVOA 1GG6B 4B73A 2BOHB 1SGQE 2Z9LA 2G00A 4JZFH 1MCTA 1QHRB 2A5IA 3BG8A 4X8SH 3F9EA 4JZEH 3ZZ5A 2PFEA 3SU4A 1A5HA 1SC8U 5HGGA 1XXDA 1H9IE 1KDQB 2ZPQA 3T26A 2OBQA 3SQEE 3ZV9A 4AFZA 4GCHF 3RMOH 1KDQA 2OC0A 3RXVA 5ESTE 4YO9A 1DLKB 5FBIA 5HXFA 1JRSA 2XBXA 2D26C 1P2IA 4X1PU 1JIRA 1UTJA 4D7GA 1O2KA 2SNVA 1HPGA 3B23B 2HWLB 3PTBA 2C4FH 1GMHG 1P02A 1D3QB 4FU9A 4Y8ZA 1O3IA 3UR9A 1C5NH 1C2JA 1O3GA 3C1KA 4AYVB 1FLEE 1LTOA 3HATH 2ODQA 4MTBA 2ESTE 4U30A 1VITF 2Y7ZA 3VB4A 1BT7A 1GCTB 2FOGA 3KCGH 2QF0A 1V2NT 4NA8A 2ZWLH 5DJ7A 1O3HA 1ANEA 3MTYA 4D76A 1X7AC 3S0NA 1UCYK 3SNCA 4AFSA 1TPAE 2QY0B 3TLOA 5HYOA 2IN2A 1C9PA 1K1IA 2A4QA 1LKAA 1EAUA 2CV3A 4XSKU 1WAYB 1L1NA 1VCWA 4AYYB 1YPGH 5L6NH 1G3BA 1D6WA 2ZDAH 1ARCA 3EDXB 1O2PA 1N6XA 2UWPA 2W3IA 2SGDE 1CSOE 2GCHG 2BDIA 3ZZCA 1DPOA 1MTUA 2YNAA 1YP9A 3DFJA 4ZHMU 2J2UA 4O97A 1UK3A 3PROA 2ZC9H 5HM2A 1DWCH 2HALA 2HPQH 1AVXA 3STIA 4CBOA 3DHKH 1P10A 2CJIA 4NFEA 3NPSA 2OUAA 4XFQA 1QCPA 3DUXH 4I8JA 1TNJA 3HKJB 3U98H 1SPJA 5JBTA 1FMGA 3Q76A 4WF8A 5EOKA 1GBBA 3GY7A 5F8ZA 2GV6A 2AS9A 1GI7B 2PWXA 3MH7A 3E0PB 5EODA 3ZVCA 5DP3A 3V7TA 3PMJA 1AFEH 4HTCH 1QQ4A 2VVUA 3SGQE 2F83A 3KL6A 1RTFB 3RXKA 1WOFA 4B71A 2BVSH 1O2GH 4DY7B 1SGRE 3SNAA 4UONA 2D2DA 2PKAA 3KQCA 1GHBG 5AVDA 1SQTA 4JMYA 1DSUA 2GZ7A 2OC7A 1F7ZA 1GBLA 2ZCKP 1BMNH 1SFQB 1C1NA 2W3KA 1IQGA 1HGTH 1YGCH 1UJ1A 1NFUA 2H5CA 1BCUH 3DA9B 1C5XB 1VGCC 3LJJA 3O8RA 1C2MA 1DS2E 1NZQH 3FVFB 2Z3EA 1V2RT 4NGAH 4IN1A 3TNSA 1C2EA 1C1QA 3RXDA 4DOQA 1SGNE 3UR6A 2AERH 2ODYB 3Q3YA 3STJA 1ELCA 3GCHB 3BTME 2Z94A 1EUFA 3ZZAA 5JB8S 1ESAA 1KXFA 1ANCA 5A0CA 1S6HA 7ESTE 2ZKSA 4INKA 1SGFG 4KP0A 5LH8A 4ZKSU 2BD5A 1MKWK 1FIZA 4U32A 5B6OA 2BZAA 1Y5BT 1GJAB 5JB9S 3FAOA 1OP2A 3GCOA 1EZUC 2ZFTA 1O2SA 3FZZA 4WMDA 1GMDG 1NRPH 1GJDB 1O3PB 5GIBA 2CMYA 1KLJH 1XKBC 5T3HA 4DJZB 2UWOA 1V2TT 4BAMB 1W7XH 1WUNH 2GDDA 1GVZA 1QFKH 3MOCA 6LPRA 2R3YA 1HDTH 1ZMNA 5C1UA 3D65E 5PTPA 4CHAB 1NRNH 3T2NA 1TNGA 2O8MA 2VWOA 2UUFB 2Z6BD 1B0FA 1ZR0A 1VCQA 1G37A 4ZKNU 1ZGVA 4NZQA 3A89A 2FOMB 1GBCA 3K6YA 5L30H 1C2IA 4FUDA 2B0FA 2R9PA 2VH6A 4TWYA 1F0SA 5EPYA 4HFPB 3DFLA 8KME2 8GCHG 1TOMH 3OY5U 3FANA 4K8YA 1C1WH 3IWMA 1A0JA 3UQOA 1IQEA 4AOQA 2QV1A 1ANDA 2FX4A 1H9LB 3JZ2B 1CHOG 2JETC 1N8OB 3QGNB 2TBSA 1WBGB 1YLDA 4HI3A 1LHDH 1KSNA 3LDXH 1GPZA 3MU4A 1Y5UT 3U8OH 1OP0A 3VB3A 3TNTA 1FIWA 1K28D 1C1VH 1SGFA 1THPB 5IDKA 2XC0A 1T8NA 1OKXA 2FP7B 1IHSH 2F9PA 2D1JA 3LKWA 1TB6H 3TJVA 1HV7A 4I8GA 1AD8H 3SW2B 4Y76A 1UMAH 1KYNA 3MU8A 2FPZA 1TX6A 1IQHA 1CU1A 4XOJA 1M9UA 1GMHF 3MO9A 1C2FA 2OLGA 2QXIA 1TWXB 2ZG0H 1EJNA 1O2UA 1V2WT 1GL1A 1EAIA 3SJ9A 2ZQ2A 1P3EA 3LC5A 2ZPRA 4JK6A 3BTWE 4DIHH 1BTXA 2F9NA 3QZRA 4B1TA 4BXWA 1EXFA 1VZQH 2Z3CA 1Y59T 1GI4A 1UTLM 3MNCA 1BRAA 1FY5A 3LJOA 3U9AH 2Y5FA 2FI5E 3RXOA 2FOBA 1THRH 1ZSLA 3R0FA 1TNKA 2WPLS 1O2ZA 4LXBH 2ZHEH 4XBCA 1GBTA 1B0EA 4AB8A 1GI1A 4UFFH 1C1PA 4Q2KA 5C1XA 1YCPK 3HPTB 1ZZZA 2XXLA 1V2QT 4NSYA 1XUGA 2G4TA 3I78A 2P93A 3TU7H 1ZPBA 5T6DA 1O34A 4ISNA 3LGUA 1C5MD 1NT1A 3F1SB 1C1OA 1J16A 2JETB 1O2HA 5FCRA 2AH4X 1AFQB 3A7WA 4BAKB 1KXEA 2Q6DA 4A92A 1GI2A 3Q3KA 1FZZA 1TMTH 3A84A 2ZGJA 3GY3A 3ZVBA 1GVKB 2Y80A 1SGYE 2BVXH 2BY6X 1FXYA 2WPIS 1BUIA 2ZU1A 5E2PA 4B75A 2VIPA 1GBEA 1FN8A 5DP5A 3SI3H 3VB7A 1IHTH 1OPHB 4ISLA 1GBFA 1BJVA 3UWJH 1LPGB 3RXHA 1TGBA 1C4V2 3BV9B 3BTGE 3KN2A 3CS0A 3GCNA 3O8BA 4WWYA 2ANMH 1GHBF 2OTVA 3ZV8A 2UUJB 1PPGE 5IYTA 1T8OA 1W0YH 2PTNA 2GGVB 1C2DA 3LGYA 3ZZ9A 4CBNA 3SORA 3SQHE 6GCHF 1ZYOA 2ZFRH 1FJSA 3UWIA 1BBRE 1P0SH 4E7NA 4K1SA 1O2TA 5DO4H 3RXAA 4UFEH 2GZ9A 1EZSC 1GJ5H 2HLCA 1XX9A 3BSQA 4K69A 1P11E 1SGCA 1P2NA 1MMJN 5FPTA 1XMNB 1O32A 1SLXB 1ZSKA 4MPUA 4YT7H 4NFFA 3LGVA 1QIXB 3O8CA 1OWDA 1BTZA 1CA8B 3TJNA 2JH0D 3E6PH 3GYMA 4ABBA 1AKSB 1D3PB 1P05A 2O8UA 5ABWA 2DE8A 1GGDC 4WXIA 1S85A 1AKSA 1IQNA 3A8DA 4O3UA 5C1YA 3TJOA 3CENA 1GHAF 2ANKH 4JZDH 3M7UA 3MFJA 4M7GA 3PTNA 4JZ1A 3T62A 1WU1A 1O2RA 1DX5M 2P8OC 1FY3A 2B7DH 1HCGA 1EPTC 4OS5A 1K9OE 2Z9KA 4D8NA 1O2WA 2WV4A 2GD4B 1UTKA 2J38A 3NCLA 2B8OH 3K9XB 1BQYA 1BITA 1ZPZA 1FY8E 4JCNA 3ZVAA 2H9EH 3SU0A 2I6QA 3ZYEA 2Z9JA 1YF4A 4YT6H 5GXPA 1Y3VA 3BF6H 2BHGA 1WV7H 1SLWB 2GTBA 1F0TA 2A4OA 1C5TA 2BLWA 1O3NA 4X2XA 3RXCA 1ELTA 3UNRA 1GBIA 2ANYA 4CREA 2ZHFH 1T8MA 2Z3DA 4JYUH 4NIXA 3SV2H 3GY4A 5DGJA 1OYTH 3DT0H 4I33A 3TJUA 1UO6A 2ZHQH 1E36B 1C2GA 1V2LT 1GWAA 1AWHB 1HLTH 4JYTA 1OWEA 2OP9A 4OGXA 2AIQA 2GKVE 9ESTA 5EXLA 2DE9A 2J94A 2XYAA 3E16B 4H4FA 3ATIA 2FOAA 3EA9A 1GGDB 1GJ7B 1ZRKA 1UK4A 4CRCA 3A8AA 5C3NA 2VH0A 3LIWA 3ATMA 3QX5H 5FPYA 1GMCG 2AGIX 4ZKRU 2CF8H 2VVVA 3M35A 3V3MA 1AI8H 1IAUA 4ZHLU 1ELEE 2K1QA 2SGAA 2P8OB 1GJ9B 1KTSB 3QWCH 1A1RA 1ZTLA 2XTTB 1GI5A 2FMJA 9LPRA 4ZHAA 5T6FA 2ZFFH 1VR1H 4HZHA 4R8TB 1S6FA 2VIWA 2BZ6H 4X8TH 2AMDA 3BTDE 4OS1A 3BTFE 3OU0A 1BTUA 3FP8E 4ZH8A 3RDZA 3V0XA 2R2WU 3SHAH 2C8WB 1QBVH 2A5AA 1W11U 4BAOB 1L0ZA 1NU9A 1K21H 1F5RA 4CH2B 5EQQA 4IS5A 1FV9A 3E0NB 3A8CA 5E0GA 4WXVA 3E90B 2FODA 1UCYE 2ZFQH 4IMZA 1FONA 3M5LA 2G8TA 1LVYA 3RM0H 5L2YH 2XWBI 4TY6A 1NM6A 4X1NU 1DSTA 5EG4A 2AFQB 1UVPA 2EEKA 4NIVA 2Y5HA 5F8XA 3P70B 3UQVA 1PQ8A 2V3HH 3FP7E 1YPJH 1H9HE 2A45B 5K7RA 1A61H 4BOHA 1TAWA 2FZZA 1G36A 1O2YA 3TIUA 5GCHG 1ZMLA 1TNLA 3MI4A 4X6NA 2FWWA 4DCDA 3MH4A 1RS0A 2B5TB 1DLEA 1PPEE 1S5SA 1MUEB 1O38A 3H7TA 1ZPCA 1LO6A 1LHGH 4K60A 3SUDA 2FS8A 1MD7A 2VJ1A 1D4PB 3K6ZA 3S9CA 2VVCA 3PWCA 1E35B 3ZZ4A 1QQUA 1W0ZU 2FLBH 3NWUA 2ZTZA 5E0JA 3SUFA 1O30A 3MNBA 2BD2A 2GZ8A 2ZNKH 1OWJA 2J92A 1DXPA 1VJ9U 3LH3A 1EJMA 2ZPSA 3EA7A 3TH2H 1OYQA 1HUTH 1NFYA 3SJOA 2M5TA 3B9FH 1QA7A 4FU8A 1W2KH 1K2I1 3QUMP 4GHTA 1Y3WA 1W13U 1UVUH 1V2JT 2RCEA 1PFXC 1O2QA 1DWEH 3BTHE 1C2LA 2WYJA 4TPYA 2SFAA 3KQBA 3SI4H 3P8FA 3I29A 3OY6U 4AB9A 1PYTD 3ELAH 4UE7H 5J4SA 3S7KB 1DITH 1SMFE 3GCHC 2GDEH 1O39A 5A09A 5CMXH 2ZFPH 3VGCC 2R3UA 1IQMA 3M7QA 1GHVH 5J4QA 1NROH 2F3CE 1WQVH 5A0AE 1CGJE 1GDNA 1ZRBA 2V3OH 7KMEH 2FLRH 2GCTC 3A88A 3FZDA 1DUEA 5E2OA 2H1UA 1EJAA 3RC6A 1SHHB 2FYQA 4GSOA 2BMGB 4MLFB 3U69H 1SGPE 3GDUA 1O2IA 1XVMA 1QRXA 1BA8B 3UNSA 1EAWA 3SV6A 2XBYA 4ASHA 3PYHA 1S82A 1Y3UA 1J8AA 1SGIB 2FI4E 1OWIA 3LGIA 4Z6AH 5C67A 1ETTH 1TPOA 1DWBH 3H5CB 2PKAB 4CHAC 3UOPA 7GCHG 1A7SA 1AWFH 3H7OA 3P8GA 4U2WA 4CRGA 1GI6A 4X6OA 4Q7ZA 2AMQA 1AB9B 1BJUA 3MNXA 1CBWC 1NTPA 3E91A 3RMLH 1P2KA 1Y8TA 2VWMA 2IOTA 3D49H 2ANWA 1AHTH 4WMFA 3VFEA 4GLYA 1O2LA 4B2BA 2R0LA 3EQ0H 1N8OC 1J9CH 1AQ7A 2ZECA 3D62A 4NCYA 2R2MB 4NWLA 1INCA 2ZCHP 1O31A 1O2XA 2OD3B 1L4ZA 3D23A 1D3DB 1A4WH 1L4DA 1H1BA 1TONA 1BHXF 4GVUA 1MH0A 1IQIA 1NS3A 2ZGHA 1A3BH 1IOEA 2F9UA 2WYGA 3VGCB 3GCTG 2TGTA 1CO7E 1ABIH 4K1TA 1HIAB 3TGIE 4ABAA 1RFNA 1Z7KA 2NU0E 1GMCF 1HIAA 1UVTH 4WJG2 2Q6FA 4XBDA 2GCTB 3QO6A 4E05H 2ZTYA 1DT2A 1SL3A 2G5NA 2BXTH 2LPRA 3G01A 2FS9A 4LOYH 2TRMA 4K3JA 1ORFA 3M36A 1DUAA 2TGPZ 4OS6A 4YOGA 2PLXA 2UWLA 1GJ8B 1ELGA 3F9FA 1V3XA 1C5RA 4FUHA 1C1UH 5TCAA 1FDPA 4AG1A 1AO5A 1DANH 4DVAU 2WPMS 1LPZB 4A1VA 1CBWB 1LQEA 5FAHA 3QN7A 1QJ7B 1ZHMA 2JKHA 1C5OH 3UPEA 1BBRH 1DOJA 1AE5A 3HGNA 2BD7A 1O5CB 3M3SA 1YC0A 2HPPH 1J14A 2HNTE 1ESTA 3SU2A 1TX8A 3AW1A 3VPKA 3A8BA 1C5YB 3LGTA 3QK1A 3BTQE 4CH8B 1AFQC 4AG2A 3RXEA 2CXVA 3IITA 2PUQH 1NRSH 2XNIA 3LONA 2OQUA 1WYKA 2PR3A 1QTFA 1AVGH 2ZDVH 3BG4C 1MTWA 2J9NA 3MU1A 3GISB 4FXGH 2F9OA 3SJIA 1MTVA 2ALPA 1QR3E 2ZU2A 2A4RA 4Y7BA 1W3CA 5GDSH 2ZDNA 3M3VA 1SBWA 1A5IA 4D9RA 1NFXA 1GHZA 1EQ9A 1ZHPA 3GY8A 1RD3B 2P16A 3O8DA 2XWAA 1K1LA 4K1EA 4GPGA 2BLQA 3KEEA 5HM9A 2P59A 3RXIA 1Z8JB 8LPRA 3TVJB 4AZ2B 4X8UH 1YM0A 4B2CA 1MKXH 2GMTC 4F49A 4ABEA 2XRCA 4UD9H 2PGQB 1T4UH 4F4OC 5EW2H 2HRVA 5EW1H 2BTCE 1MU8B 2XC5A 1MD8A 4ISIH 5JBCS 3AVZA 1GI9B 5GJ4B 1A0LA 3ZZ7A 1W10U 1ELBA 3SU1A 4CR9A 4CR5A 1O35A 1PPBH 1O0DH 1O5FH 4LZ4B 5F03A 1QB9A 3LC3A 3RLYH 5AF9H 2W5EA 1MAYA 2GCHF 4X2WA 2B9LA 2PGBB 1QJ1B 2A32A 3MMGA 2CN0H 4JK5A 1G3EA 1HAOH 3QZQA 1CE5A 2BQWB 3LGWA 1JXPA 4WH8A 1RTLA 1SOTA 2ZU3A 2QAAA 4YTAA 1ZTKA 3PO1C 1K1NA 3ZVEA 3M61U 1O3JA 5FX6A 4B76A 3BG4B 1P2QA 3B8JA 1SSXA 4PROA 1AE8H 1NFWA 1W7GH 1K1OA 1XM1A 3SU5A 3A81A 4E7RG 1TBQH 3EAJA 1O3FA 1UTQA 1D9IA 3SO3A 3S7HB 3GY2A 3RXFA 1G3CA 1FQ3A 5GWZA 1RJXB 2C8YB 2QCYA 4GCHG 5DP7A 5FPSA 1D3TB 5ESBA 3GYLB 2QN5T 2PUXB 1HJAB 3I77A 4NIWA 4U01A 2GMTB 3U8RH 1MZDA 1GBJA 4I8HA 4AN7A 1PYTC 3AAUA 3IG6B 6CHAC 1AY6H 3VXFH 4FUEA 1EP5A 1EX3A 1LHCH 1W8BH 2GVFA 2OINA 3BIUH 1P2JA 4BTTB 1SR5C 3RXMA 1P06A 2ZDLA 3KGPA 4FU7A 5EGMA 2FO9A 2P3TB 1TQ0B 1W12U 3HK6B 5EQSA 3E3TA 1AMHA 1UCYH 1VITG 3SGBE 3OX7U 2ZDMA 4GAWA 2CGAA 3VXEH 1AZ8A 1FAXA 1A46H 3A7XA 3BEIB 1QA0A 4OS2A 2Z9GA 1HXEH 3VB6A 5DKMA 3SGAE 1O5GH 4NA9H 2V35A 2FM2A 4CRFA 4YOJA 1QNJA 3RLWH 1LHFH 1EZXC 2G5VA 3PO1B 1DFPA 1O3AA 5E0HA 2SGFE 1CA0C 3E1XB 2G55A 1GMDF 1O37A 2ODPA 1HYLA 1HAIH 1EKBB 1UTMA 2PSYA 4J1YA 1MU6B 3S9BA 1Q3XA 5TCCA 1C5ZB 3RUOA 2WINI 3ATWA 4NIYA 1O3LA 1LKBA 2Q6GA 1EOLA 1TALA 1A3EH 4Q80A 1GBDA 3QTOH 1G2LA 1K1PA 1Y3YA 1UVSH 3ATKA 2PHBA 3JZ1B 2BDHA 2RA3A 1C5PA 1PPFE 3Q77A 5DP4A 3EA8A 1G30B 8GCHF 5LPRA 2TGAA 3EE0B 1H4WA 4A5TS 6CHAB 1TPSA 2VIQA 1KXDA 1UTOA 1CHOF 5GPIB 1EB1H 3AASA 3VEQB 1Y5AT 4I32A 2C8ZB 5FHTA 2QXHA 1V2VT 2XBVA 1OP8A 3RXLA 1PPHE 2XW9A 3A83A 3R3GB 4VGCC 1Z8RA 1SGTA 3BIVH 3RMNH 4DURA 3RXBA 1V2KT 4MNXA 2BQ6B 5FBEA 1L2EA 2STAE 4RKJB 4BTUB 4YOIA 3TH4H 2A2XH 1HJ9A 1P2OA 4X2VA 1P57B 3MNSA 2A5KA 2SNWA 1SHYA 2C8XB 1ZSJA 4NZLA 1OWKA 2BY7X 1CT2E 2NU2E 4X2YA 1ESBA 4MVNA 1V2UT 1SGEE 2QYIA 1GI3A 1XUKA 3HGPA 1ELDE 2QXGA 1CA0B 1AUJA 4Z0KA 1HAZB 4LZ1H 2ZF0H 1XKAC 3MWIU 4A1XA 1BTWA 1S83A 2VWLA 3KF2A 1E38B 2H6MA 1V2PT 1GJCB 1MKWH 3CP7A 1TE0A 4ISOA 1CGIE 4NG9H 1P03A 4FUFA 2VGCC 3LH1A 1E34B 1TQ7B 1CT0E 4OS7A 4CRAA 3MO3A 3PLKA 4I7YH 2YNBA 1PQAA 4Y71A 3W95A 3S69A 4YESB 2BLOA 5JDUB 5C20A 3GOVB 2O9QA 3T28A 4TYDA 1LCYA 1OWHA 2VIOA 5EQRA 4AX9H 2Y7XA 4AORA 3ZVGA 1TOCB 1T4VH 3DD2H 1YPLH 4ZUHA 4ESTE 2CF9H 4IGDA 5LPFA 3LU9B 4X1SU 5LPEA 1G3DA 1JRTA 1VCPA 5EU8A 4UFDH 1BTPA 2THFB 1SB1H 2CHAC 2BDGA 1KXAA 2V6NA 3AAVA 1C5WB 1LVBA 1DDJA 2RDLA 2FX6A 1TIOA 1O2NA 3RXQA 2BD3A 2VINA 1UTPA 4VGCB 1GI8B 1TNHA 1GJ6A 4TWWA 4NSVA 1WSSH 4LK4A 1EASA 4MPWA 1TGTA 3ZYDA 1FPHH 1BOQA 3RM2H 2BQ7B 3TK9A 1HFDA 4Y8YA 3GDSA 3RXSA 2F91A 4Q7XA 2BD9A 4MNYA 1TABE 3SU6A 2QXJA 4MPVA 4IMQA 2G51A 1HAHH 2A31A 4UEHH 1AIXH 1O3BA 3ZZ3A 1BMAA 1ZHRA 3ATLA 3CS7A 3E8LA 4OGYA 3HK3B 3UREA 2ZP0H 5TJXA 1OS8A 5FCKA 1O2OA 4KELA 4BAHB 4ZROA 3RXPA 2BY9X 2O8WA 4QT8C 1B7XB 1DVAH 1ZGIA 4KKDA 3NKKA 4XBBA 1NESE 5EXNA 1AB9C 1ELVA 1P01A 2VGCB 1S84A 3SV9A 1ZMJA 3TGKE 2ZU4A 1TGCA 2A1DB 1MQ5A 2FOCA 1O5BB 4CRDA 4IC6A 2FOHA 5L2ZH 3PWBA 1P09A 1S0QA 1LQDB 2PW8H 2ZGBH 1G9IE 3M37A 1XXFA 2VNTA 4BNRA 3GDVA 1LDTT 1TX7A 4XDEA 4I8LA 1CQQA 1YPMH 4JZIA 3L33A 1YBWA 3NUMA 1MTSA 1MBQA 4Q7YA 2J34A 4UFGH 3ESTA 3MH6A 1LMWB 2ZDKA 2ZQ1A 4FUIA 1FAKH 3SV7A 4MDSA 1GL0E 1OSSA 2CHAB 1MCVA 1YCPH 2ZZUH 5H4IB 4K8BA 4MPXA 3HKIB 1G2MA 2UUYA 3SJKA 1J15A 3NZIA 2ZIQH 3U8TH 3PV4A 1HBTH 1GBAA 3PM3A 3UTUH 3U1IB 1CHGA 1QGFA 1E0FD 2SGQE 2VU8E 1K22H 3A82A 1NRQH 4A6LA 1QB6A 2HNTC 3MO6A 2AIPA 2FTLE 1IQKA 2A7JA 4Y0YE 1RRKA 2A0QB 2P3FH 2RG3A 4Y79A 1T7CA 1NY22 2GT7A 3F6UH 4I8KA 3T5FH 1C1MA 3OYPA 4KTSA 4O3TA 1C5VA 4BTIB 2ZHWH 1UTNA 4K2YA 1YPEH 3A7YA 1BTHH 1JMOH 1K1JA 3K65B 1GI0A 2FESH 1ELAA 4H42U 1SQOA 3ODFA 1TA6A 1C1TA 1QL9A 4DGJA 3NXPA 4RKOB 4ABJA 4YLQH 1EZQA 2BYAX 1ACBE 1MTNC 2Y5GA 1IQFA 1IQLA 1QRZA 1DY8A 2BD4A 2NU1E 4ZAEA 4DW2U 2GP9B 1TMBH 2QF3A 4TPIZ 4Y8XA 4ZMAH 2Y82A 1KTTB 2FDAA 5AHGH 3PB1E 4X1QU 3RU4T 1J17T 1NO9H 3M5NA 1YCPM 5DPAA 2WUBA 1GBKA 3F9HA 4NWKA 4FUGA 5F8TA 2AGEX 1FNIA 2A7HA 1NC6A 4D7FA 1P04A 3BN9A 6GCHG 2WPKS 1TLDA 2NU3E 4WH6A 2ZO3H 4Y10E 1KLTA 1NU7B 3RXUA 4GUXA 1C5SA 1QBOA 2Q1JA 3TITA 1HXFH 5K0HA 3PMBB 3C27B 3ZZ6A 2VB0A 1TPPA 1XUJA 2I6SA 3UNQA 3WY8A 1TBRH 1JBUH 1ZTJA 3GY6A 1TNIA 3FP6E 3U1JB 1A5GH 4Y7AA 1ZLRA 4BXSA 1MAXA 1GBMA 5E8EH 4X6MA 2H2ZA 5SGAE 5JPMH 5A0BA 1F0RA 1PQ5A 2BDBA 3RP2A 3TPIZ 1Y3XA 1O3CA 2WPJS 1BRBE 4TY7A 4ZXXH 2EC9H 1FPCH 1FI8A 1CT4E 1QY6A 2STBE 1UHBB 2ZEBA 2FEQH 4X6PA 3ODDA 1AUTC 2XC4A 2QGRA 4DG4A 1KY9A 1TFXA 1UHBA 2ZHDA 1QURH 4IN2A 1KXBA 2QA9E 1O2VA 1HB0B 1DY9A 1GHAG 2P94A 3ITIA 4GHQA 1Z1IA 2FOFA 1TMUH 5I25A 3A80A 5DP8A 4JYVH 3PMAB 1GHWH 1F2SE 2ZGXH 2KAIB 1FN6A 1O3KA 2AYWA 4HGCA 1MTNB 1LVMA 3M5MA 2Y81A 2KAIA 1O36A 1ZJKA 3M3TA 5A8ZA 5A8YA 1A0HB 1SFIA 3ZVFA 1YLCA 3M7TA 4O9VA 4NA7A 4Y0ZE 4FUBA 1TRNA 1SOZA 5ETXA 1CVWH 4J2YB 3S9AA 1HRTH 1AN1E 5GCHF 2YOLA 3VB5A 1GDQA 1KLIH 1T8LA 1WCZA 1O3MA 3N7OA 1VGCB 4Y11E 3A87A 8ESTE 1IQJA 1Z8GA 4MQAA 3V12A 4AFQA 5HMAA 2C90B 1EOJA 2R0KA 3P8NA 1O2MA 1S81A 1V6DA 4X1RU 4FVDA 4ZXYH 2OC8A 1RIWC 1DXWA 4RSPA 1BRUP 4INHA 1RTKA 2BX3A 4FUJA
chains in the Genus database with same CATH superfamily
4FVBA 2TGDA 1C5QA 2BY5X 2P3UB 1MQ6A 1OX1A 3KQEA 5C5OA 1P9UA 3QGJA 1AGJA 3A7TA 2BVRH 2BDYA 2O8LA 1HJAC 2G4UA 3SNEA 3UAIC 1QL8A 1NN6A 1UK2A 1CGHA 2XCNA 4H6TA 3UIRA 1C1SA 1XUIA 4K5ZA 4MG3A 3A86A 2PKSC 5FXLA 2WPDD 4ABHA 5CE1A 5F6MA 2SGPE 2QIQA 1YPHC 1QBNA 2K0QA 4ISHH 2H5DA 2QF4A 4OS4A 5C17A 2BDCA 1OOKB 1C4Y2 1SVPA 3RMMH 3Q3XA 2HOBA 2PP6A 3FKSD 1BB0B 1DE7H 1JWTA 1RGQA 4DT7B 1T32A 4X8VH 5KEDA 1WTHD 2WPHS 2W7SA 5CHAC 3UY9A 1N1LA 3K2UA 3RXGA 1Z8IB 1ETSH 3AW0A 3BEUA 1W14U 5A2MH 3FN8A 3V13A 2JH6D 1G32B 5EXMA 2H9TH 2PTCE 3ZZDA 4B2AA 4AC9A 4MNVA 3A85A 1ID5H 2ULLA 3P17H 3L3TA 5AFYH 5FX5A 2TPIZ 4E06H 4AGJA 1NRRH 2GV7A 3T29A 1HNEE 4B74A 4ZKOU 2AEIH 1HAVB 1VKYA 3F9GA 3LT3A 3MYWA 1MZAA 4D9QA 2BDAA 1MBMA 3MHWU 1HAVA 3RU4E 2Z9IA 2FI3E 4X0WU 3BEFB 3ZZ8A 2FYRA 4ABIA 1RIWB 1VITH 4FUCA 2HNTF 1ABJH 7GCHF 1EATA 1GHXH 1GVLA 2WV5A 3LOXA 3UUZA 1FY1A 2W26A 4KGAA 1ANBA 3UOUA 2FXRA 2OCVB 2HVXA 3SJ8A 2O8TA 1JIMA 1TBZH 1BDAA 1N6YA 2F9BH 1GBHA 4RN6A 1L1JA 3PLPA 3W94A 1ELFA 1Z6EA 2NU4E 2ZCLP 1P12E 4I31A 1O3DA 2J95A 3GY5A 2L6OA 1V2MT 2PKSB 2G52A 2V0BA 3NK8A 1TRYA 3MU5A 2ALVA 1ZOMA 2IPHA 5DK1A 2EA3A 2KCPA 1THSH 3SZEA 1ETRH 4DIIH 3TK6A 1XUHA 3DSGA 1FY4A 4KTCA 2XCFA 5DG6A 3Q00A 3TK5A 1JOUB 1EB2A 1GJ4H 1SLVB 1VJAU 2OBOA 5LGOA 1E37B 2P95A 4WVPE 3TH3H 4BAQB 3PLBA 1C5UA 5JBBS 1Z71A 3URCA 2J4IA 2BOKA 2HGTH 3QTVH 4CRBA 1U6QA 4ASUD 2QF5A 5CHAB 1BTYA 1BIOA 2PV9B 3SHCH 3URDA 3ZZBA 1BZXE 5JYIA 3ZVDA 1XVOA 2F9VA 3N7EA 3P8OA 2A7CA 1H8HD 3GCTF 2HVYB 4FETA 2EI8A 2EQNA 1PQ7A 3MQKC 1YYY1 1O5AB 2BLVA 1ZJDA 3M5OA 1V2ST 1DM4B 3KIDU 2ZFSA 3LPRA 1EAXA 2OXSA 1YPHE 2IJOB 1AVWA 3TGJE 3SOSA 2Y6TA 4R0IA 1WTGH 1V2OT 2BM2A 2WUCA 2VWNA 1SI5H 2BXUH 1B5GH 2ZGCA 4I86A 2W6JD 1OXGA 1PPZA 3T25A 4YM9A 1P8VC 1TRMA 5T6GA 1F5LA 2KX4A 1E1QD 3SU3A 4H6SB 1F0UA 3MH5A 3SZNA 1P2MA 2NWNA 1QB1A 2RDEA 4WMEA 5AFZH 3SUEA 2BD8A 2QC2A 1FUJA 2C3SA 4ACBA 3RXJA 3OSYA 1C4U2 2SGEE 1TGNA 5I46H 1T31A 4A1TA 2ILNA 1A2CH 2FOEA 5BPEA 4YLUA 1H8IH 1BMMH 1BRCE 1W0JD 1C9TA 2ZA5A 1BBRK 1P3CA 1QZ8A 2VIVA 3A7ZA 1LVOA 3RU4D 4KTUA 3EYDA 1TA2A 2H9HA 4ABGA 1Z6JH 2XBWA 4SGBE 3RXRA 4IC5A 2PSXA 1Q31A 3ZIAD 3PV5A 3P95A 3A7VA 3SNDA 2JH5D 1HAYB 3SN8A 1F92A 4A7IB 2EI7A 1O3OA 1KXCA 1S6LA 1SLUB 1O3EA 3RC4A 4MNWA 2GT8A 3ENSB 2BX4A 1O33A 1GG6C 3KHVA 1Z1JA 4FOUC 2ASUB 1K1MA 4ABFA 2F43B 4INLA 3SUGA 3EGKH 1HAGE 1C2HA 3F0PA 1ARBA 2TIOA 1WQSA 3RXTA 5A8XA 1TGSZ 1HAXB 3BTKE 1F5KU 1TYNA 1NPMA 2GX4A 1KIGH 2ZI2H 3QLPH 2A2QH 2C93B 3RC5A 2BB4A 1HJ8A 1AZZA 2EI6A 2ZTXA 3PMHB 1GDUA 5KGOA 1GHYH 1C5LH 4AGKA 5BRRE 3BTTE 3KQDA 1PJPA 1QRWA 2OC1A 3WWBA 4AFUA 4YZUA 1GCDA 4ABDA 1Q2WA 3OTJE 5DP9A 1DICA 1EP6A 1HAPH 5DP6A 1C1RA 2BY8X 1SG8B 1MKXK 2G81E 1SGDE 2AMPA 1C2KA 3P6ZB 3GICB 1SQAA 2VIDA 1XUFA 2LNCA 4IW4E 4Y6DA 1H8DH 1GJBB 5G4BA 1D6RA 1EPTB 1RXPA 3BTEE 3QDZB 3FFGA 4SGAE 1LPKB 1P9SA 2ZU5A 1EPTA 1GCTC 5C5NA 1PPCE 1BMLA 3KNXA 2UUKB 1DWDH 4O03A 4WY3A 5EPNA 3F68H 1QL7A 1LHEH 3SV8A 3T27A 2W7UA 1YKTA 3SNBA 5C2ZA 2D8WA 5JBAS 4THNH 1AU8A 4B6EA 1YPKH 3UFAA 4M9FA 2Z7FE 1O5DH 2AGGX 4BANB 1NBME 4IBLH 2A4GA 3L6PA 4UDWH 1O2JA 4XE4A 3P92A 1S0RA 1O5EH 2FIRH 1QJ6B 2FTMA 6ESTA 1L1GA 2DUCA 2OQ5A 3SBKA 2RA0A 7LPRA 1BHXB 3MU0A 1UVOA 1GG6B 1YY3A 4B73A 2BOHB 1SGQE 2Z9LA 2G00A 4JZFH 1MCTA 4XD7D 1QHRB 2A5IA 3BG8A 4X8SH 3F9EA 4JZEH 3ZZ5A 2PFEA 3SU4A 1A5HA 1SC8U 5HGGA 1XXDA 1H9IE 1KDQB 2ZPQA 3T26A 2OBQA 3SQEE 3ZV9A 4AFZA 4GCHF 3RMOH 1KDQA 2OC0A 3RXVA 5ESTE 4YO9A 1DLKB 5FBIA 5HXFA 1JRSA 2XBXA 2D26C 1P2IA 4X1PU 1JIRA 1UTJA 4D7GA 1O2KA 2SNVA 1HPGA 3B23B 2HWLB 3U28C 3PTBA 2C4FH 1GMHG 1P02A 1D3QB 4FU9A 4Y8ZA 1O3IA 3UR9A 1C5NH 1C2JA 1O3GA 3C1KA 4AYVB 1FLEE 1LTOA 3HATH 2ODQA 4MTBA 2ESTE 4U30A 1VITF 2Y7ZA 3VB4A 1BT7A 1GCTB 2FOGA 3KCGH 2QF0A 1V2NT 4NA8A 2ZWLH 5DJ7A 1O3HA 1ANEA 3MTYA 4D76A 1X7AC 3S0NA 1UCYK 3SNCA 4AFSA 4B6FA 1TPAE 2QY0B 3TLOA 5HYOA 2IN2A 1C9PA 1K1IA 2A4QA 1LKAA 1EAUA 2CV3A 4XSKU 1WAYB 1L1NA 3H09A 1VCWA 4AYYB 1YPGH 5L6NH 1G3BA 1D6WA 2ZDAH 1ARCA 3EDXB 1O2PA 1N6XA 2UWPA 2W3IA 2SGDE 1CSOE 2GCHG 2BDIA 3ZZCA 1DPOA 1MTUA 2YNAA 1YP9A 3DFJA 4ZHMU 2J2UA 5B6LA 4O97A 1UK3A 3PROA 2ZC9H 5HM2A 1DWCH 2HALA 2HPQH 1AVXA 3STIA 4CBOA 3DHKH 1P10A 2CJIA 4NFEA 3NPSA 2OUAA 4XFQA 1QCPA 1BMFD 3DUXH 4I8JA 1TNJA 3HKJB 3U98H 1SPJA 5JBTA 1FMGA 3Q76A 4WF8A 5EOKA 1GBBA 3GY7A 5F8ZA 2GV6A 2AS9A 2JJ2D 1GI7B 2JJ1D 2PWXA 3MH7A 3E0PB 5EODA 3ZVCA 5DP3A 1NBMD 3V7TA 3PMJA 1AFEH 4HTCH 1QQ4A 2VVUA 3SGQE 2F83A 3KL6A 1RTFB 3RXKA 1WOFA 4B71A 2BVSH 1O2GH 4DY7B 1SGRE 3SNAA 4UONA 2D2DA 2PKAA 3KQCA 1GHBG 5AVDA 1E79D 1SQTA 4JMYA 1DSUA 2F4LA 2GZ7A 2OC7A 1F7ZA 1GBLA 2ZCKP 1BMNH 1SFQB 1C1NA 2W3KA 1IQGA 1HGTH 1YGCH 1UJ1A 1NFUA 2H5CA 1BCUH 3DA9B 1C5XB 1VGCC 3LJJA 3O8RA 1C2MA 1DS2E 1NZQH 3FVFB 2W6ID 2Z3EA 1V2RT 3F3BA 4NGAH 2XNDD 4IN1A 3TNSA 1C2EA 1C1QA 2AHME 3RXDA 4DOQA 1SGNE 3UR6A 2AERH 2ODYB 3Q3YA 3STJA 1ELCA 3GCHB 1OHHD 3BTME 2Z94A 1EUFA 3ZZAA 5JB8S 1ESAA 1KXFA 5HIZA 1ANCA 5A0CA 1S6HA 7ESTE 2ZKSA 4INKA 1SGFG 4KP0A 5LH8A 4RI0A 4ZKSU 2BD5A 1MKWK 1FIZA 4U32A 5B6OA 2BZAA 1COWD 1Y5BT 1GJAB 5JB9S 3FAOA 1OP2A 3GCOA 1EZUC 2ZFTA 1O2SA 3FZZA 4WMDA 1GMDG 1NRPH 1GJDB 1O3PB 5GIBA 2CMYA 1KLJH 1XKBC 5T3HA 4DJZB 2UWOA 1V2TT 4BAMB 1W7XH 1WUNH 2V3MA 2GDDA 1GVZA 1QFKH 3MOCA 6LPRA 2R3YA 1HDTH 1ZMNA 2KCOA 5C1UA 3D65E 5PTPA 4CHAB 2J98A 1SQRA 1NRNH 3T2NA 1TNGA 2O8MA 2VWOA 2UUFB 2Z6BD 1B0FA 1ZR0A 1VCQA 1G37A 4ZKNU 1ZGVA 4NZQA 3A89A 2FOMB 1GBCA 3K6YA 5L30H 1C2IA 4FUDA 2B0FA 2R9PA 2VH6A 4TWYA 4ZCNA 1F0SA 5EPYA 4HFPB 3DFLA 8KME2 4DT4A 8GCHG 1TOMH 3OY5U 3FANA 4K8YA 1C1WH 3IWMA 1A0JA 3UQOA 1IQEA 4AOQA 2QV1A 1ANDA 2FX4A 1H9LB 3JZ2B 1CHOG 4Q4LA 5EJZA 2JETC 1N8OB 3QGNB 2TBSA 1WBGB 1YLDA 4HI3A 1LHDH 1KSNA 3LDXH 1GPZA 3MU4A 1Y5UT 3U8OH 1OP0A 3VB3A 3TNTA 1FIWA 1K28D 1C1VH 1SGFA 1THPB 5IDKA 2XC0A 1T8NA 1OKXA 2FP7B 1IHSH 2F9PA 2D1JA 3LKWA 1TB6H 3TJVA 1HV7A 4I8GA 1AD8H 3SW2B 4Y76A 1UMAH 2VBCA 1KYNA 3MU8A 2FPZA 1TX6A 1IQHA 1CU1A 4XOJA 1M9UA 1GMHF 3MO9A 1C2FA 2OLGA 2QXIA 1TWXB 2ZG0H 1EJNA 1O2UA 1V2WT 1GL1A 1EAIA 3SJ9A 2ZQ2A 1P3EA 3LC5A 2ZPRA 4JK6A 2L74A 3BTWE 2KFWA 4DIHH 1BTXA 3N99A 2F9NA 3QZRA 4B1TA 4BXWA 1EXFA 1VZQH 2Z3CA 1Y59T 1GI4A 1UTLM 3MNCA 1BRAA 1FY5A 3LJOA 3U9AH 2Y5FA 2FI5E 3RXOA 2FOBA 1THRH 1ZSLA 3R0FA 1TNKA 2WPLS 1O2ZA 4LXBH 2ZHEH 4XBCA 1GBTA 1B0EA 4AB8A 1GI1A 4UFFH 1C1PA 4Q2KA 5C1XA 1YCPK 3HPTB 1ZZZA 2XXLA 1V2QT 4NSYA 1XUGA 2G4TA 3I78A 4TSFD 2P93A 3TU7H 1ZPBA 5T6DA 1O34A 4ISNA 3LGUA 1C5MD 1NT1A 3F1SB 1C1OA 1J16A 2JETB 1O2HA 5FCRA 2AH4X 1AFQB 3A7WA 4BAKB 1KXEA 2Q6DA 5CHBA 4A92A 1GI2A 3Q3KA 1FZZA 1TMTH 3A84A 2ZGJA 3GY3A 3ZVBA 1GVKB 1E1RD 1SGYE 2Y80A 2BVXH 2BY6X 1FXYA 2WPIS 2WSSD 1BUIA 2ZU1A 5E2PA 4B75A 2VIPA 1GBEA 1FN8A 5DP5A 3SI3H 3VB7A 1IHTH 1OPHB 4ISLA 1GBFA 1BJVA 3UWJH 1LPGB 3RXHA 1TGBA 1C4V2 3BV9B 3BTGE 3KN2A 3CS0A 3GCNA 3O8BA 4WWYA 2ANMH 1GHBF 2OTVA 3ZV8A 2UUJB 1PPGE 5IYTA 1T8OA 1W0YH 2PTNA 2GGVB 1C2DA 3LGYA 3ZZ9A 4CBNA 3SORA 3SQHE 6GCHF 1ZYOA 2ZFRH 1FJSA 3UWIA 1BBRE 1P0SH 4E7NA 4K1SA 1O2TA 5DO4H 3RXAA 4UFEH 2GZ9A 1EZSC 3W1EA 1GJ5H 2HLCA 1XX9A 3BSQA 4K69A 1P11E 1SGCA 1P2NA 1MMJN 5FPTA 1XMNB 1O32A 1SLXB 1ZSKA 4MPUA 4YT7H 4NFFA 3LGVA 1QIXB 3O8CA 1OWDA 1BTZA 1CA8B 3TJNA 2JH0D 3E6PH 3GYMA 4ABBA 1AKSB 1D3PB 1P05A 2O8UA 5ABWA 2DE8A 2GJGA 3VG8A 1GGDC 4WXIA 1S85A 1AKSA 3PV2A 1IQNA 3A8DA 4O3UA 5C1YA 3TJOA 3CENA 1GHAF 2ANKH 4JZDH 3M7UA 3MFJA 4M7GA 3PTNA 4JZ1A 3T62A 1W0KD 1WU1A 1O2RA 1DX5M 2P8OC 1FY3A 2B7DH 1HCGA 1EPTC 4OS5A 3NRLA 1K9OE 2Z9KA 4D8NA 1O2WA 2WV4A 2GD4B 1UTKA 2J38A 3NCLA 3PRDA 2B8OH 3K9XB 1BQYA 1BITA 1ZPZA 1FY8E 4JCNA 3ZVAA 2H9EH 3SU0A 2I6QA 3ZYEA 2Z9JA 1YF4A 4YT6H 5GXPA 1Y3VA 3BF6H 2BHGA 1WV7H 1SLWB 2GTBA 1F0TA 2A4OA 1C5TA 3FO8D 2BLWA 1O3NA 4X2XA 3RXCA 1ELTA 1EFRD 3UNRA 1GBIA 2ANYA 4CREA 2ZHFH 1T8MA 2Z3DA 4JYUH 4NIXA 3SV2H 3GY4A 5DGJA 1OYTH 3DT0H 4I33A 3TJUA 1UO6A 2ZHQH 1E36B 1C2GA 1V2LT 1GWAA 1AWHB 1HLTH 4JYTA 1OWEA 2OP9A 4OGXA 2AIQA 2GKVE 9ESTA 5EXLA 4TT3D 2DE9A 2J94A 2XYAA 3E16B 4H4FA 3ATIA 2FOAA 3EA9A 5EJ1A 1GGDB 1GJ7B 1ZRKA 1UK4A 4CRCA 3A8AA 5C3NA 2VH0A 3LIWA 3ATMA 3QX5H 5FPYA 1GMCG 2AGIX 4YXWD 4ZKRU 2CF8H 2VVVA 3M35A 3V3MA 4RT0A 1AI8H 1IAUA 4ZHLU 1ELEE 2K1QA 2SGAA 2P8OB 1GJ9B 1KTSB 3QWCH 1A1RA 1ZTLA 2XTTB 1GI5A 2FMJA 9LPRA 4ZHAA 3SYJA 5T6FA 2ZFFH 1VR1H 4HZHA 4Z1MD 4R8TB 1S6FA 2VIWA 2BZ6H 4X8TH 2AMDA 3BTDE 4OS1A 3BTFE 3OU0A 1BTUA 3FP8E 4ZH8A 3RDZA 3V0XA 2R2WU 3SHAH 2C8WB 1QBVH 2A5AA 1W11U 4BAOB 1L0ZA 1NU9A 1K21H 1F5RA 4CH2B 5EQQA 4IS5A 1FV9A 3E0NB 2WV9A 3A8CA 5E0GA 4WXVA 3E90B 2FODA 1UCYE 2ZFQH 4IMZA 1FONA 3M5LA 2G8TA 1LVYA 3RM0H 5L2YH 2XWBI 4TY6A 3N7DA 1NM6A 4X1NU 1DSTA 5EG4A 2AFQB 1UVPA 2EEKA 4NIVA 2Y5HA 5F8XA 3P70B 3UQVA 1PQ8A 2V3HH 3FP7E 1YPJH 1H9HE 2A45B 5K7RA 1A61H 4BOHA 1TAWA 2FZZA 1G36A 1O2YA 3TIUA 5GCHG 1ZMLA 1YWUA 1TNLA 3MI4A 4X6NA 2FWWA 3WWFA 4DCDA 3MH4A 1RS0A 2B5TB 1DLEA 1PPEE 1S5SA 1MUEB 1O38A 3H7TA 1ZPCA 2KCYA 1LO6A 1LHGH 4K60A 3SUDA 2FS8A 1MD7A 2VJ1A 5C0UA 1D4PB 3K6ZA 3S9CA 2VVCA 3PWCA 1E35B 3ZZ4A 1QQUA 1W0ZU 2FLBH 3NWUA 2ZTZA 5E0JA 3SUFA 5CDFE 1O30A 3MNBA 2BD2A 2GZ8A 2ZNKH 1OWJA 2J92A 4F55A 1DXPA 1VJ9U 3LH3A 1EJMA 2ZPSA 3EA7A 3TH2H 1OYQA 1HUTH 1NFYA 3SJOA 2M5TA 3B9FH 1QA7A 4FU8A 2WZQA 1W2KH 1K2I1 3QUMP 4GHTA 1Y3WA 1W13U 1UVUH 1V2JT 2RCEA 1PFXC 1O2QA 1DWEH 3BTHE 1C2LA 2WYJA 4TPYA 2SFAA 3KQBA 3KQ5A 3SI4H 3P8FA 3I29A 3OY6U 4AB9A 1PYTD 3EE7A 3ELAH 4UE7H 5J4SA 3S7KB 1DITH 1SMFE 3GCHC 2GDEH 1O39A 5A09A 5CMXH 4RT1A 2ZFPH 3VGCC 2R3UA 1IQMA 3M7QA 1GHVH 5J4QA 5HKKD 1NROH 2F3CE 1WQVH 5A0AE 1CGJE 1GDNA 1ZRBA 2V3OH 7KMEH 2FLRH 2GCTC 3A88A 3FZDA 1DUEA 5E2OA 4ACAA 2H1UA 1EJAA 3RC6A 1SHHB 2FYQA 4GSOA 2BMGB 4MLFB 3U69H 1SGPE 3GDUA 1O2IA 1XVMA 1QRXA 1BA8B 3UNSA 1EAWA 3SV6A 2XBYA 4ASHA 2KZ4A 3PYHA 1S82A 1Y3UA 3OE7D 1J8AA 1SGIB 2FI4E 1OWIA 3LGIA 4Z6AH 5C67A 1ETTH 1TPOA 1DWBH 3H5CB 2PKAB 4CHAC 3UOPA 7GCHG 1A7SA 1AWFH 3H7OA 3P8GA 4U2WA 4CRGA 1GI6A 4X6OA 4Q7ZA 2AMQA 1AB9B 1BJUA 3MNXA 1CBWC 1NTPA 3E91A 3RMLH 1P2KA 1Y8TA 2VWMA 2IOTA 3D49H 2ANWA 1AHTH 4WMFA 3VFEA 5C0TA 4GLYA 1O2LA 4B2BA 2R0LA 3EQ0H 1N8OC 1J9CH 1AQ7A 2ZECA 3D62A 4NCYA 2R2MB 4NWLA 1INCA 2ZCHP 1O31A 1O2XA 2OD3B 1L4ZA 3D23A 5C94A 1D3DB 1A4WH 1L4DA 1H1BA 1TONA 1BHXF 4GVUA 1MH0A 1IQIA 1NS3A 2ZGHA 1A3BH 1IOEA 2F9UA 2WYGA 3VGCB 3GCTG 2TGTA 1CO7E 1ABIH 4K1TA 1HIAB 3TGIE 4ABAA 1RFNA 2V7QD 1Z7KA 2NU0E 1GMCF 1HIAA 1UVTH 4WJG2 2Q6FA 4XBDA 2GCTB 3QO6A 4E05H 2ZTYA 1DT2A 1SL3A 2G5NA 2BXTH 2LPRA 3G01A 2FS9A 2M2AA 4LOYH 2TRMA 3GS9A 4K3JA 1ORFA 3M36A 1DUAA 2TGPZ 2J98B 4OS6A 4YOGA 2PLXA 2UWLA 1GJ8B 1ELGA 3F9FA 1V3XA 1C5RA 4FUHA 1C1UH 5TCAA 1FDPA 4AG1A 1AO5A 1DANH 4DVAU 3CNRA 2WPMS 1LPZB 4A1VA 1CBWB 1LQEA 5FAHA 3QN7A 5DSFA 1QJ7B 1ZHMA 2JKHA 1C5OH 3UPEA 1BBRH 1DOJA 1AE5A 3OEED 3HGNA 2BD7A 1O5CB 3M3SA 1YC0A 2HPPH 1J14A 2HNTE 1ESTA 3SU2A 1TX8A 3AW1A 3VPKA 3A8BA 1C5YB 3LGTA 3QK1A 3BTQE 4CH8B 1AFQC 4AG2A 3RXEA 2CXVA 3IITA 2PUQH 1NRSH 2XNIA 3F0OA 3LONA 2OQUA 1WYKA 2PR3A 1QTFA 1AVGH 2ZDVH 3BG4C 1MTWA 2J9NA 3MU1A 3GISB 4FXGH 2F9OA 3SJIA 1MTVA 2ALPA 1QR3E 2ZU2A 2A4RA 4Y7BA 1W3CA 5GDSH 2ZDNA 3M3VA 1SBWA 1A5IA 4D9RA 1NFXA 1GHZA 1EQ9A 1ZHPA 3GY8A 1RD3B 2QE7D 2P16A 3O8DA 2XWAA 1K1LA 4K1EA 4GPGA 2KR7A 2BLQA 3KEEA 5HM9A 2LELA 2P59A 3RXIA 1Z8JB 8LPRA 3TVJB 4AZ2B 2YMSD 4X8UH 1YM0A 4B2CA 2JDID 1MKXH 2GMTC 4F49A 4ABEA 2XRCA 4UD9H 2PGQB 1T4UH 4F4OC 5EW2H 2HRVA 5EW1H 2BTCE 3AK5A 1MU8B 2XC5A 1MD8A 4ISIH 5JBCS 3AVZA 1GI9B 5GJ4B 1A0LA 3ZZ7A 1W10U 1ELBA 3SU1A 4CR9A 4CR5A 1O35A 1PPBH 1O0DH 1O5FH 4LZ4B 5F03A 1QB9A 3LC3A 3RLYH 5AF9H 2W5EA 1MAYA 2GCHF 4X2WA 4Q63A 2B9LA 2PGBB 1QJ1B 2A32A 3MMGA 2CN0H 4JK5A 1G3EA 1HAOH 3QZQA 1CE5A 2BQWB 3LGWA 1JXPA 4WH8A 1RTLA 1SOTA 2ZU3A 2QAAA 4YTAA 1ZTKA 3PO1C 1K1NA 3ZVEA 3M61U 1O3JA 5FX6A 4B76A 3BG4B 1P2QA 3B8JA 1SSXA 4PROA 1AE8H 1NFWA 1W7GH 1K1OA 1XM1A 3SU5A 3A81A 4E7RG 1TBQH 3EAJA 1O3FA 1UTQA 1D9IA 3SO3A 3DCLA 3S7HB 3GY2A 2K8IA 4HG6A 3RXFA 1G3CA 1FQ3A 5GWZA 1RJXB 2C8YB 2QCYA 3F2HA 4GCHG 5DP7A 5FPSA 1D3TB 5ESBA 3GYLB 2QN5T 1WXRA 2PUXB 1HJAB 3I77A 4NIWA 4U01A 2GMTB 3U8RH 1MZDA 1GBJA 1UW7A 4I8HA 4AN7A 1PYTC 3AAUA 3IG6B 6CHAC 1AY6H 3VXFH 4FUEA 1EP5A 1EX3A 1LHCH 1W8BH 2KM0A 2GVFA 2OINA 3BIUH 1P2JA 4BTTB 1SR5C 3RXMA 1P06A 2ZDLA 3KGPA 1YLNA 4FU7A 5EGMA 2FO9A 2IPQX 1TQ0B 2P3TB 1W12U 3HK6B 5EQSA 3E3TA 1AMHA 1UCYH 1VITG 2WHXA 3SGBE 3OX7U 2ZDMA 3PRBA 4GAWA 2CGAA 3VXEH 1AZ8A 1FAXA 1A46H 3A7XA 3BEIB 1QA0A 4OS2A 2Z9GA 1HXEH 3VB6A 5DKMA 3SGAE 1O5GH 4NA9H 2V35A 2FM2A 4CRFA 4YOJA 1QNJA 3RLWH 1LHFH 3F2FA 2EY4C 1EZXC 2G5VA 3PO1B 3OFND 1DFPA 1O3AA 5E0HA 2SGFE 1CA0C 3E1XB 2G55A 1GMDF 1O37A 2ODPA 1HYLA 1HAIH 1EKBB 1UTMA 2PSYA 4J1YA 1MU6B 3S9BA 1Q3XA 5TCCA 1C5ZB 3RUOA 1KMHB 2WINI 3ATWA 4NIYA 1O3LA 3F2GA 1LKBA 2Q6GA 1EOLA 1TALA 1A3EH 4Q80A 1GBDA 3QTOH 1G2LA 1K1PA 5IK2D 1MABB 1Y3YA 1UVSH 3ATKA 2PHBA 3JZ1B 2BDHA 2RA3A 1C5PA 1PPFE 3Q77A 5DP4A 3EA8A 1G30B 8GCHF 5LPRA 2TGAA 3EE0B 1H4WA 4A5TS 6CHAB 1TPSA 2VIQA 1KXDA 1UTOA 1CHOF 5GPIB 1EB1H 3AASA 3VEQB 1Y5AT 4I32A 2C8ZB 5FHTA 2QXHA 1V2VT 2XBVA 1OP8A 3RXLA 1PPHE 2XW9A 3A83A 3R3GB 4VGCC 1Z8RA 1SGTA 3BIVH 3RMNH 4DURA 3RXBA 1V2KT 4MNXA 2BQ6B 5FBEA 1L2EA 5HIYA 2STAE 4RKJB 4BTUB 4YOIA 3TH4H 2A2XH 1HJ9A 1P2OA 4X2VA 1P57B 3MNSA 2A5KA 2SNWA 1SHYA 2C8XB 1ZSJA 4NZLA 1OWKA 2BY7X 1CT2E 2NU2E 4X2YA 1ESBA 4MVNA 1V2UT 1SGEE 2QYIA 4F48B 1GI3A 1XUKA 3HGPA 1ELDE 2QXGA 5FL7D 1CA0B 1AUJA 4Z0KA 1HAZB 4LZ1H 2ZF0H 1XKAC 3MWIU 4A1XA 1BTWA 1S83A 2VWLA 3KF2A 1H8ED 1E38B 2H6MA 1V2PT 1GJCB 1MKWH 3CP7A 1TE0A 4ISOA 1CGIE 4NG9H 1P03A 4FUFA 2VGCC 3LH1A 1E34B 1TQ7B 1CT0E 4OS7A 4CRAA 3MO3A 5EJLA 3PLKA 4I7YH 2YNBA 1PQAA 4Y71A 3W95A 3S69A 4YESB 2BLOA 5JDUB 5C20A 3GOVB 2O9QA 3T28A 4TYDA 1LCYA 1OWHA 2VIOA 5EQRA 3UB0A 4AX9H 2Y7XA 4AORA 3ZVGA 1TOCB 1T4VH 3DD2H 1YPLH 4ZUHA 4ESTE 2CF9H 4IGDA 5LPFA 3LU9B 4X1SU 5LPEA 1G3DA 1JRTA 1VCPA 5EU8A 4UFDH 1BTPA 2THFB 1SB1H 2CHAC 2BDGA 1KXAA 2V6NA 3AAVA 1C5WB 1LVBA 1DDJA 2RDLA 2FX6A 1TIOA 1O2NA 3RXQA 2BD3A 2VINA 3OEHD 1UTPA 4VGCB 1GI8B 1TNHA 1GJ6A 4TWWA 2LP6A 1WSSH 4LK4A 1EASA 4MPWA 4NSVA 1TGTA 3ZYDA 1FPHH 1BOQA 3RM2H 2BQ7B 3TK9A 1HFDA 4Y8YA 3GDSA 3RXSA 2F91A 4Q7XA 3DSPA 2BD9A 2YMSC 4MNYA 1TABE 3SU6A 2QXJA 4MPVA 3OAAD 4IMQA 5F53A 2G51A 1HAHH 2A31A 4UEHH 1AIXH 1O3BA 3ZZ3A 1BMAA 1ZHRA 3ATLA 3CS7A 3E8LA 4OGYA 3HK3B 5GNDA 2ZP0H 5TJXA 3UREA 1OS8A 5FCKA 1O2OA 4KELA 4BAHB 4ZROA 3RXPA 2BY9X 2O8WA 4QT8C 1B7XB 1DVAH 1ZGIA 4KKDA 3NKKA 4XBBA 1NESE 5EXNA 1AB9C 1ELVA 1P01A 2VGCB 1S84A 3SV9A 3FOAA 1ZMJA 3TGKE 2ZU4A 1TGCA 2A1DB 1MQ5A 2FOCA 1O5BB 4CRDA 4IC6A 2FOHA 5L2ZH 3PWBA 1P09A 1S0QA 1LQDB 2PW8H 2ZGBH 1G9IE 3M37A 1XXFA 2VNTA 4BNRA 3GDVA 1LDTT 1TX7A 4XDEA 2CK3D 4I8LA 1CQQA 1YPMH 4JZIA 3L33A 1YBWA 3NUMA 1MTSA 1MBQA 4Q7YA 2J34A 4UFGH 3ESTA 3MH6A 1LMWB 2ZDKA 2ZQ1A 4FUIA 1FAKH 3SV7A 4MDSA 2RFKC 1GL0E 1OSSA 2CHAB 1MCVA 4OM9A 1YCPH 2ZZUH 5H4IB 4K8BA 4MPXA 3HKIB 1G2MA 5KECA 2UUYA 3SJKA 1J15A 3NZIA 2ZIQH 3U8TH 3PV4A 1HBTH 1GBAA 3PM3A 3UTUH 3U1IB 1CHGA 1QGFA 1E0FD 5DN6D 2SGQE 2VU8E 4P02A 1K22H 3A82A 1NRQH 4A6LA 1QB6A 2HNTC 3WW7A 3MO6A 2AIPA 2FTLE 1IQKA 1K0HA 2A7JA 2KCAA 4Y0YE 1RRKA 2A0QB 2P3FH 2YMSB 2IJD1 2RG3A 4Y79A 1FX0B 1T7CA 1NY22 2GT7A 3F6UH 2JIZD 4I8KA 3T5FH 1C1MA 3OYPA 4KTSA 4O3TA 1C5VA 3KYFA 4BTIB 2ZHWH 1UTNA 4K2YA 1YPEH 3A7YA 1BTHH 1JMOH 1K1JA 3K65B 1GI0A 2FESH 1ELAA 4H42U 1SQOA 3ODFA 1TA6A 1C1TA 1QL9A 4DGJA 3NXPA 4RKOB 2J5UA 4ABJA 4YLQH 1EZQA 2BYAX 1ACBE 1MTNC 2Y5GA 1IQFA 1IQLA 1QRZA 1DY8A 2BD4A 2NU1E 4ZAEA 4DW2U 2GP9B 1TMBH 2QF3A 4TPIZ 4Y8XA 4ZMAH 2Y82A 1KTTB 2FDAA 5AHGH 3PB1E 4X1QU 3RU4T 1J17T 1NO9H 3M5NA 1YCPM 5DPAA 2WUBA 1GBKA 3F9HA 4NWKA 4FUGA 5F8TA 2AGEX 1FNIA 2A7HA 1NC6A 4D7FA 1P04A 3BN9A 3KYGA 6GCHG 1SKYE 2WPKS 1TLDA 2NU3E 4WH6A 2ZO3H 4Y10E 1KLTA 1NU7B 3RXUA 4GUXA 1C5SA 1QBOA 2Q1JA 3TITA 1HXFH 5T1VA 1WDIA 5K0HA 3PMBB 3C27B 3ZZ6A 2VB0A 1TPPA 1XUJA 2I6SA 3UNQA 3WY8A 1TBRH 1JBUH 1ZTJA 3GY6A 1TNIA 3FP6E 3U1JB 1A5GH 4Y7AA 1ZLRA 4BXSA 1MAXA 1GBMA 5E8EH 2XOKD 4X6MA 2H2ZA 2HLDD 4XRNA 5SGAE 5JPMH 5A0BA 1F0RA 1PQ5A 2BDBA 3RP2A 3TPIZ 1Y3XA 1O3CA 2WPJS 1BRBE 4TY7A 4ZXXH 2EC9H 1FPCH 1FI8A 1CT4E 1QY6A 2STBE 1UHBB 2ZEBA 2OK5A 2FEQH 4X6PA 3ODDA 1AUTC 2XC4A 2QGRA 4DG4A 1KY9A 1TFXA 1UHBA 2ZHDA 1QURH 4IN2A 4P00A 1KXBA 2QA9E 1O2VA 1HB0B 1DY9A 1GHAG 2P94A 3ITIA 4GHQA 1Z1IA 2FOFA 1TMUH 5I25A 3A80A 5DP8A 4JYVH 3PMAB 1GHWH 1F2SE 2ZGXH 2KAIB 1FN6A 1O3KA 2AYWA 5EIYA 2J97A 4HGCA 1MTNB 1LVMA 3M5MA 2Y81A 2KAIA 1O36A 1ZJKA 3M3TA 5A8ZA 5A8YA 1A0HB 1SFIA 3ZVFA 1YLCA 3M7TA 4O9VA 4NA7A 4Y0ZE 4FUBA 1TRNA 1SOZA 5ETXA 3DSOA 1CVWH 4J2YB 3OTPA 3S9AA 1HRTH 1AN1E 5GCHF 2YOLA 3VB5A 1GDQA 1KLIH 1T8LA 1WCZA 1O3MA 3N7OA 1VGCB 4Y11E 3A87A 8ESTE 1IQJA 1Z8GA 4MQAA 3V12A 4AFQA 5HMAA 2C90B 1EOJA 2R0KA 3P8NA 1O2MA 1S81A 1V6DA 4X1RU 4FVDA 4ZXYH 2OC8A 1RIWC 1DXWA 4RSPA 1BRUP 4INHA 1RTKA 2BX3A 4FUJA
chains in the Genus database with same CATH topology
4FVBA 2TGDA 1C5QA 2BY5X 2P3UB 1MQ6A 1OX1A 3KQEA 5C5OA 1P9UA 3QGJA 1AGJA 3A7TA 2BVRH 2BDYA 2O8LA 1HJAC 2G4UA 3SNEA 1QL8A 1NN6A 1UK2A 1CGHA 2XCNA 4H6TA 3UIRA 1C1SA 1XUIA 4K5ZA 4MG3A 3A86A 2PKSC 5FXLA 4ABHA 5F6MA 5CE1A 2SGPE 2QIQA 1YPHC 1QBNA 4ISHH 2H5DA 4OS4A 2BDCA 1OOKB 1C4Y2 1SVPA 3RMMH 3Q3XA 2HOBA 1BB0B 1DE7H 1JWTA 1RGQA 4DT7B 1T32A 4X8VH 1WTHD 2WPHS 2W7SA 5CHAC 3UY9A 1N1LA 3K2UA 3RXGA 1Z8IB 1ETSH 3AW0A 3BEUA 1W14U 5A2MH 3V13A 2JH6D 1G32B 5EXMA 2H9TH 2PTCE 3ZZDA 4B2AA 4MNVA 3A85A 1ID5H 2ULLA 3P17H 3L3TA 5AFYH 5FX5A 2TPIZ 4E06H 4AGJA 1NRRH 2GV7A 3T29A 1HNEE 4B74A 4ZKOU 2AEIH 1HAVB 3F9GA 3LT3A 3MYWA 1MZAA 4D9QA 2BDAA 1MBMA 3MHWU 1HAVA 3RU4E 2Z9IA 2FI3E 4X0WU 3BEFB 3ZZ8A 2FYRA 4ABIA 1RIWB 1VITH 4FUCA 2HNTF 1ABJH 7GCHF 1EATA 1GHXH 1GVLA 2WV5A 3LOXA 3UUZA 1FY1A 2W26A 4KGAA 1ANBA 3UOUA 2FXRA 2OCVB 2HVXA 3SJ8A 2O8TA 1JIMA 1TBZH 1BDAA 1N6YA 2F9BH 1GBHA 4RN6A 1L1JA 3PLPA 3W94A 1ELFA 1Z6EA 2NU4E 2ZCLP 1P12E 4I31A 1O3DA 2J95A 3GY5A 1V2MT 2PKSB 2G52A 2V0BA 3NK8A 1TRYA 3MU5A 2ALVA 1ZOMA 2IPHA 5DK1A 2EA3A 1THSH 4DIIH 1ETRH 3TK6A 1XUHA 1FY4A 4KTCA 2XCFA 5DG6A 3Q00A 3TK5A 1JOUB 1EB2A 1GJ4H 1SLVB 1VJAU 2OBOA 5LGOA 1E37B 2P95A 4WVPE 3TH3H 4BAQB 3PLBA 1C5UA 5JBBS 1Z71A 3URCA 2J4IA 2BOKA 2HGTH 3QTVH 4CRBA 1U6QA 5CHAB 1BTYA 1BIOA 2PV9B 3SHCH 3URDA 3ZZBA 1BZXE 5JYIA 3ZVDA 1XVOA 2F9VA 3P8OA 2A7CA 3GCTF 2EI8A 1PQ7A 1YYY1 1O5AB 2BLVA 1ZJDA 3M5OA 1V2ST 1DM4B 3KIDU 2ZFSA 3LPRA 1EAXA 2OXSA 1YPHE 2IJOB 1AVWA 3TGJE 3SOSA 2Y6TA 4R0IA 1WTGH 1V2OT 2BM2A 2WUCA 2VWNA 1SI5H 2BXUH 1B5GH 2ZGCA 1OXGA 1PPZA 3T25A 4YM9A 1P8VC 1TRMA 5T6GA 1F5LA 3SU3A 4H6SB 1F0UA 3MH5A 3SZNA 1P2MA 2NWNA 1QB1A 4WMEA 3SUEA 5AFZH 2BD8A 2QC2A 1FUJA 2C3SA 3RXJA 3OSYA 1C4U2 2SGEE 1TGNA 5I46H 1T31A 4A1TA 2ILNA 1A2CH 2FOEA 5BPEA 4YLUA 1H8IH 1BMMH 1BRCE 1C9TA 2ZA5A 1BBRK 1P3CA 2VIVA 3A7ZA 1LVOA 3RU4D 4KTUA 3EYDA 1TA2A 2H9HA 4ABGA 1Z6JH 2XBWA 4SGBE 3RXRA 4IC5A 2PSXA 1Q31A 3P95A 3A7VA 3SNDA 2JH5D 1HAYB 3SN8A 1F92A 4A7IB 2EI7A 1O3OA 1KXCA 1SLUB 1O3EA 3RC4A 4MNWA 2GT8A 3ENSB 2BX4A 1O33A 1GG6C 3KHVA 1Z1JA 2ASUB 1K1MA 4ABFA 4INLA 3SUGA 3EGKH 1HAGE 1C2HA 1ARBA 2TIOA 1WQSA 3RXTA 5A8XA 1TGSZ 1HAXB 3BTKE 1F5KU 1TYNA 1NPMA 2GX4A 1KIGH 2ZI2H 3QLPH 2A2QH 2C93B 3RC5A 2BB4A 1HJ8A 1AZZA 2EI6A 2ZTXA 3PMHB 1GDUA 1GHYH 1C5LH 4AGKA 5BRRE 3BTTE 3KQDA 1PJPA 1QRWA 2OC1A 4AFUA 4YZUA 1GCDA 4ABDA 1Q2WA 3OTJE 5DP9A 1DICA 1EP6A 1HAPH 5DP6A 1C1RA 2BY8X 1SG8B 1MKXK 2G81E 1SGDE 2AMPA 1C2KA 3P6ZB 3GICB 1SQAA 2VIDA 1XUFA 2LNCA 4IW4E 4Y6DA 1H8DH 1GJBB 5G4BA 1D6RA 1EPTB 1RXPA 3BTEE 3QDZB 3FFGA 4SGAE 1LPKB 1P9SA 2ZU5A 1EPTA 1GCTC 5C5NA 1PPCE 1BMLA 3KNXA 2UUKB 1DWDH 4O03A 4WY3A 5EPNA 3F68H 1QL7A 1LHEH 3SV8A 3T27A 2W7UA 1YKTA 3SNBA 5C2ZA 2D8WA 5JBAS 4THNH 1AU8A 1YPKH 3UFAA 2Z7FE 1O5DH 2AGGX 4BANB 4IBLH 2A4GA 3L6PA 4UDWH 1O2JA 4XE4A 3P92A 1S0RA 1O5EH 2FIRH 1QJ6B 2FTMA 6ESTA 1L1GA 2DUCA 2OQ5A 3SBKA 2RA0A 7LPRA 1BHXB 3MU0A 1UVOA 1GG6B 4B73A 2BOHB 1SGQE 2Z9LA 2G00A 4JZFH 1MCTA 1QHRB 2A5IA 3BG8A 4X8SH 3F9EA 4JZEH 3ZZ5A 2PFEA 3SU4A 1A5HA 1SC8U 5HGGA 1XXDA 1H9IE 1KDQB 2ZPQA 3T26A 2OBQA 3SQEE 3ZV9A 4AFZA 4GCHF 3RMOH 1KDQA 2OC0A 3RXVA 5ESTE 4YO9A 1DLKB 5FBIA 5HXFA 1JRSA 2XBXA 2D26C 1P2IA 4X1PU 1JIRA 1UTJA 4D7GA 1O2KA 2SNVA 1HPGA 3B23B 2HWLB 3PTBA 2C4FH 1GMHG 1P02A 1D3QB 4FU9A 4Y8ZA 1O3IA 3UR9A 1C5NH 1C2JA 1O3GA 3C1KA 4AYVB 1FLEE 1LTOA 3HATH 2ODQA 4MTBA 2ESTE 4U30A 1VITF 2Y7ZA 3VB4A 1BT7A 1GCTB 2FOGA 3KCGH 2QF0A 1V2NT 4NA8A 2ZWLH 5DJ7A 1O3HA 1ANEA 3MTYA 4D76A 1X7AC 3S0NA 1UCYK 3SNCA 4AFSA 1TPAE 2QY0B 3TLOA 5HYOA 2IN2A 1C9PA 1K1IA 2A4QA 1LKAA 1EAUA 2CV3A 4XSKU 1WAYB 1L1NA 1VCWA 4AYYB 1YPGH 5L6NH 1G3BA 1D6WA 2ZDAH 1ARCA 3EDXB 1O2PA 1N6XA 2UWPA 2W3IA 2SGDE 1CSOE 2GCHG 2BDIA 3ZZCA 1DPOA 1MTUA 2YNAA 1YP9A 3DFJA 4ZHMU 2J2UA 4O97A 1UK3A 3PROA 2ZC9H 5HM2A 1DWCH 2HALA 2HPQH 1AVXA 3STIA 4CBOA 3DHKH 1P10A 2CJIA 4NFEA 3NPSA 2OUAA 4XFQA 1QCPA 3DUXH 4I8JA 1TNJA 3HKJB 3U98H 1SPJA 5JBTA 1FMGA 3Q76A 4WF8A 5EOKA 1GBBA 3GY7A 5F8ZA 2GV6A 2AS9A 1GI7B 2PWXA 3MH7A 3E0PB 5EODA 3ZVCA 5DP3A 3V7TA 3PMJA 1AFEH 4HTCH 1QQ4A 2VVUA 3SGQE 2F83A 3KL6A 1RTFB 3RXKA 1WOFA 4B71A 2BVSH 1O2GH 4DY7B 1SGRE 3SNAA 4UONA 2D2DA 2PKAA 3KQCA 1GHBG 5AVDA 1SQTA 4JMYA 1DSUA 2GZ7A 2OC7A 1F7ZA 1GBLA 2ZCKP 1BMNH 1SFQB 1C1NA 2W3KA 1IQGA 1HGTH 1YGCH 1UJ1A 1NFUA 2H5CA 1BCUH 3DA9B 1C5XB 1VGCC 3LJJA 3O8RA 1C2MA 1DS2E 1NZQH 3FVFB 2Z3EA 1V2RT 4NGAH 4IN1A 3TNSA 1C2EA 1C1QA 3RXDA 4DOQA 1SGNE 3UR6A 2AERH 2ODYB 3Q3YA 3STJA 1ELCA 3GCHB 3BTME 2Z94A 1EUFA 3ZZAA 5JB8S 1ESAA 1KXFA 1ANCA 5A0CA 1S6HA 7ESTE 2ZKSA 4INKA 1SGFG 4KP0A 5LH8A 4ZKSU 2BD5A 1MKWK 1FIZA 4U32A 5B6OA 2BZAA 1Y5BT 1GJAB 5JB9S 3FAOA 1OP2A 3GCOA 1EZUC 2ZFTA 1O2SA 3FZZA 4WMDA 1GMDG 1NRPH 1GJDB 1O3PB 5GIBA 2CMYA 1KLJH 1XKBC 5T3HA 4DJZB 2UWOA 1V2TT 4BAMB 1W7XH 1WUNH 2GDDA 1GVZA 1QFKH 3MOCA 6LPRA 2R3YA 1HDTH 1ZMNA 5C1UA 3D65E 5PTPA 4CHAB 1NRNH 3T2NA 1TNGA 2O8MA 2VWOA 2UUFB 2Z6BD 1B0FA 1ZR0A 1VCQA 1G37A 4ZKNU 1ZGVA 4NZQA 3A89A 2FOMB 1GBCA 3K6YA 5L30H 1C2IA 4FUDA 2B0FA 2R9PA 2VH6A 4TWYA 1F0SA 5EPYA 4HFPB 3DFLA 8KME2 8GCHG 1TOMH 3OY5U 3FANA 4K8YA 1C1WH 3IWMA 1A0JA 3UQOA 1IQEA 4AOQA 2QV1A 1ANDA 2FX4A 1H9LB 3JZ2B 1CHOG 2JETC 1N8OB 3QGNB 2TBSA 1WBGB 1YLDA 4HI3A 1LHDH 1KSNA 3LDXH 1GPZA 3MU4A 1Y5UT 3U8OH 1OP0A 3VB3A 3TNTA 1FIWA 1K28D 1C1VH 1SGFA 1THPB 5IDKA 2XC0A 1T8NA 1OKXA 2FP7B 1IHSH 2F9PA 2D1JA 3LKWA 1TB6H 3TJVA 1HV7A 4I8GA 1AD8H 3SW2B 4Y76A 1UMAH 1KYNA 3MU8A 2FPZA 1TX6A 1IQHA 1CU1A 4XOJA 1M9UA 1GMHF 3MO9A 1C2FA 2OLGA 2QXIA 1TWXB 2ZG0H 1EJNA 1O2UA 1V2WT 1GL1A 1EAIA 3SJ9A 2ZQ2A 1P3EA 3LC5A 2ZPRA 4JK6A 3BTWE 4DIHH 1BTXA 2F9NA 3QZRA 4B1TA 4BXWA 1EXFA 1VZQH 2Z3CA 1Y59T 1GI4A 1UTLM 3MNCA 1BRAA 1FY5A 3LJOA 3U9AH 2Y5FA 2FI5E 3RXOA 2FOBA 1THRH 1ZSLA 3R0FA 1TNKA 2WPLS 1O2ZA 4LXBH 2ZHEH 4XBCA 1GBTA 1B0EA 4AB8A 1GI1A 4UFFH 1C1PA 4Q2KA 5C1XA 1YCPK 3HPTB 1ZZZA 2XXLA 1V2QT 4NSYA 1XUGA 2G4TA 3I78A 2P93A 3TU7H 1ZPBA 5T6DA 1O34A 4ISNA 3LGUA 1C5MD 1NT1A 3F1SB 1C1OA 1J16A 2JETB 1O2HA 5FCRA 2AH4X 1AFQB 3A7WA 4BAKB 1KXEA 2Q6DA 4A92A 1GI2A 3Q3KA 1FZZA 1TMTH 3A84A 2ZGJA 3GY3A 3ZVBA 1GVKB 2Y80A 1SGYE 2BVXH 2BY6X 1FXYA 2WPIS 1BUIA 2ZU1A 5E2PA 4B75A 2VIPA 1GBEA 1FN8A 5DP5A 3SI3H 3VB7A 1IHTH 1OPHB 4ISLA 1GBFA 1BJVA 3UWJH 1LPGB 3RXHA 1TGBA 1C4V2 3BV9B 3BTGE 3KN2A 3CS0A 3GCNA 3O8BA 4WWYA 2ANMH 1GHBF 2OTVA 3ZV8A 2UUJB 1PPGE 5IYTA 1T8OA 1W0YH 2PTNA 2GGVB 1C2DA 3LGYA 3ZZ9A 4CBNA 3SORA 3SQHE 6GCHF 1ZYOA 2ZFRH 1FJSA 3UWIA 1BBRE 1P0SH 4E7NA 4K1SA 1O2TA 5DO4H 3RXAA 4UFEH 2GZ9A 1EZSC 1GJ5H 2HLCA 1XX9A 3BSQA 4K69A 1P11E 1SGCA 1P2NA 1MMJN 5FPTA 1XMNB 1O32A 1SLXB 1ZSKA 4MPUA 4YT7H 4NFFA 3LGVA 1QIXB 3O8CA 1OWDA 1BTZA 1CA8B 3TJNA 2JH0D 3E6PH 3GYMA 4ABBA 1AKSB 1D3PB 1P05A 2O8UA 5ABWA 2DE8A 1GGDC 4WXIA 1S85A 1AKSA 1IQNA 3A8DA 4O3UA 5C1YA 3TJOA 3CENA 1GHAF 2ANKH 4JZDH 3M7UA 3MFJA 4M7GA 3PTNA 4JZ1A 3T62A 1WU1A 1O2RA 1DX5M 2P8OC 1FY3A 2B7DH 1HCGA 1EPTC 4OS5A 1K9OE 2Z9KA 4D8NA 1O2WA 2WV4A 2GD4B 1UTKA 2J38A 3NCLA 2B8OH 3K9XB 1BQYA 1BITA 1ZPZA 1FY8E 4JCNA 3ZVAA 2H9EH 3SU0A 2I6QA 3ZYEA 2Z9JA 1YF4A 4YT6H 5GXPA 1Y3VA 3BF6H 2BHGA 1WV7H 1SLWB 2GTBA 1F0TA 2A4OA 1C5TA 2BLWA 1O3NA 4X2XA 3RXCA 1ELTA 3UNRA 1GBIA 2ANYA 4CREA 2ZHFH 1T8MA 2Z3DA 4JYUH 4NIXA 3SV2H 3GY4A 5DGJA 1OYTH 3DT0H 4I33A 3TJUA 1UO6A 2ZHQH 1E36B 1C2GA 1V2LT 1GWAA 1AWHB 1HLTH 4JYTA 1OWEA 2OP9A 4OGXA 2AIQA 2GKVE 9ESTA 5EXLA 2DE9A 2J94A 2XYAA 3E16B 4H4FA 3ATIA 2FOAA 3EA9A 1GGDB 1GJ7B 1ZRKA 1UK4A 4CRCA 3A8AA 5C3NA 2VH0A 3LIWA 3ATMA 3QX5H 5FPYA 1GMCG 2AGIX 4ZKRU 2CF8H 2VVVA 3M35A 3V3MA 1AI8H 1IAUA 4ZHLU 1ELEE 2K1QA 2SGAA 2P8OB 1GJ9B 1KTSB 3QWCH 1A1RA 1ZTLA 2XTTB 1GI5A 2FMJA 9LPRA 4ZHAA 5T6FA 2ZFFH 1VR1H 4HZHA 4R8TB 1S6FA 2VIWA 2BZ6H 4X8TH 2AMDA 3BTDE 4OS1A 3BTFE 3OU0A 1BTUA 3FP8E 4ZH8A 3RDZA 3V0XA 2R2WU 3SHAH 2C8WB 1QBVH 2A5AA 1W11U 4BAOB 1L0ZA 1NU9A 1K21H 1F5RA 4CH2B 5EQQA 4IS5A 1FV9A 3E0NB 3A8CA 5E0GA 4WXVA 3E90B 2FODA 1UCYE 2ZFQH 4IMZA 1FONA 3M5LA 2G8TA 1LVYA 3RM0H 5L2YH 2XWBI 4TY6A