1MTWA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
molecule tags Serine protease
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtwA02
6CHAB 2VIOA 2FMJA 2FX6A 3QLPH 3HK3B 1ELGA 2FDAA 1W0YH 3WY8A 2P94A 2VIDA 4H42U 6LPRA 2A31A 2GTBA 1O2UA 2BD9A 4INKA 1GCDA 3SJOA 1J17T 1HAGE 4Y0ZE 1K1LA 3A81A 1DE7H 4KTUA 5EXNA 5K7RA 1RJXB 1XVMA 1ZGIA 2J94A 4I33A 1P2NA 3HK6B 4Q7YA 3KN2A 1WU1A 2BLVA 2A4RA 2FEQH 3N7OA 1FUJA 1SL3A 1XUFA 1GI9B 5FXLA 3L6PA 1LTOA 1PPCE 4I8KA 1KTSB 1GHAF 3M5NA 3A8BA 3RXGA 4MNWA 1DWEH 2XC0A 4XBBA 1BMNH 1GBLA 4AFUA 1P3CA 1BRBE 4KTSA 4X2WA 2BD7A 1FY3A 2FI3E 2BZ6H 1GDNA 1BQYA 1HAXB 1WQSA 4D7FA 1GHVH 1FMGA 1JRSA 3GY4A 4MNXA 1G3CA 1K1IA 5F03A 4X1RU 5DP5A 1AFEH 1Z6JH 4D7GA 4F49A 4X1PU 3B8JA 1KYNA 2ZGHA 4IGDA 3BG8A 1OSSA 3A82A 8LPRA 1SFIA 2C8YB 2ZFFH 4YOIA 2W3KA 2FZZA 5F8TA 1EPTC 1CE5A 1FY4A 1S81A 1O30A 1TQ7B 3LGUA 3LT3A 3SHAH 5LPFA 4KKDA 1AWFH 4NIWA 1PQ5A 3VB5A 1FY1A 3M61U 3ZZ5A 1TAWA 1O34A 1UK3A 2VINA 3MFJA 1UVUH 1QJ1B 3RMLH 3BTTE 4CBOA 1Y5AT 1L0ZA 1YPGH 1HJAB 2J2UA 7GCHF 3GOVB 3T2NA 1RRKA 1LHCH 1JMOH 1YCPH 4MVNA 2FLRH 3S9CA 1WQVH 2P3TB 5TJXA 3S7KB 3ZVGA 1C2HA 4ZMAH 1PFXC 4Q7XA 3MNCA 4O97A 5HGGA 1GBHA 3H5CB 1C5QA 1TX8A 2P59A 3DFLA 2C90B 1GHZA 1TWXB 5EW2H 3MO9A 4K60A 1XUJA 4AGKA 1J16A 1EZUC 3CS7A 2JH6D 3VB3A 2XC5A 4NA7A 2O8WA 4X6MA 2HOBA 4B71A 1BRAA 1OWKA 1TBZH 5ETXA 3URDA 3ZV8A 4GVUA 2P8OB 2ZGBH 3RXQA 1D9IA 3W94A 3ZVBA 1AWHB 3RXOA 3GY7A 4GHQA 4FUJA 4AORA 5GWZA 1ZTLA 2VWOA 2V35A 1SLWB 1Y3YA 1C1VH 2C8WB 3E3TA 3UTUH 4DW2U 4FU8A 1O3HA 4O3UA 1IQLA 3A8CA 1TA2A 1C5WB 2PUXB 4ISHH 1MD8A 2BX4A 2XBWA 1O2SA 1VITG 2A5IA 1TPPA 5E2OA 3PMJA 3GDUA 3QO6A 4X8TH 3OY5U 1GI3A 1T4UH 1W11U 3VB6A 1UTPA 1BIOA 3MYWA 2H2ZA 5DG6A 5IDKA 3TGJE 1F7ZA 1OWEA 5FBIA 3ZZ8A 1J15A 1YPEH 1WAYB 2HNTF 2J95A 4NWLA 5E0HA 1JBUH 1NRQH 4OS7A 3BG4C 1NFUA 2D1JA 2ZHEH 1JRTA 4B74A 3BSQA 3HGNA 4B75A 1O5GH 1VGCC 3P8NA 3LGYA 1GI4A 3R0FA 3P95A 4NWKA 1FDPA 3RXBA 5E0JA 1UTKA 1OP0A 1Y5BT 2HVXA 2ZPQA 4GSOA 1AE5A 1BBRH 1GVLA 5DJ7A 2VU8E 5CE1A 1TX6A 2M5TA 1NU7B 3BTFE 3ZZ4A 1ZLRA 1SQAA 2IOTA 5DO4H 1H4WA 3ATWA 3BTWE 4X1QU 4K1SA 2SNVA 3FP8E 2BLWA 5JBBS 3VFEA 1S6HA 1Z7KA 2Q6GA 1T31A 1Y59T 1EZXC 3ZZCA 1GHBG 1RTKA 1C2LA 3EDXB 4E06H 2IPHA 4Y7BA 3E0PB 4K1EA 2GMTC 3JZ2B 1UCYK 1C5SA 2JH0D 4J1YA 1O2ZA 3SJ9A 2H5DA 3PWCA 2ZC9H 2VVVA 4FVBA 4MNVA 2G00A 2AERH 1WUNH 2ZEBA 1DPOA 1UK2A 3EQ0H 3E0NB 2HWLB 2BMGB 1C5RA 2PW8H 3EA7A 3EE0B 1DXWA 4JK5A 1YKTA 2WPMS 1D3DB 4NA9H 4FUEA 2QAAA 1NU9A 2W26A 2ZWLH 5BRRE 2ZDLA 1GMHG 2WINI 4DCDA 1O37A 4I31A 4NIXA 4K8YA 2ZFQH 3UNSA 1BDAA 4YLQH 1KXCA 1BOQA 2G8TA 4K5ZA 3CP7A 2G55A 1LDTT 3RXDA 1ID5H 1O2XA 4CRGA 1EAWA 1Z8RA 2C93B 1SGCA 1UVSH 3STJA 4BOHA 5HYOA 5EG4A 1GJ9B 2J38A 2QF3A 1HIAA 3LIWA 1UHBA 1D6WA 1WBGB 1O2TA 2Y82A 4VGCB 1OWHA 1Y3WA 1O5CB 5EQQA 1F2SE 3M7TA 1LMWB 2ZPSA 3NK8A 3MU5A 1D3QB 2Q6FA 1T8MA 1GWAA 2IJOB 3MU0A 1KSNA 1C5MD 1MBMA 3UQVA 3BTQE 3PB1E 1O3JA 3SGAE 1GL0E 1L2EA 1ELFA 1BRUP 1D4PB 1O2KA 2UWOA 2A45B 2PTCE 3SV7A 4WH6A 2TPIZ 4GAWA 2IN2A 5EXMA 1EASA 4ABIA 1KXAA 1MBQA 2VIVA 1TB6H 4X8VH 1PJPA 1O3OA 2OQ5A 1MU8B 1G3EA 4MQAA 2NU3E 4D9QA 1CA0C 3ZZAA 3KEEA 1QNJA 2VWNA 4ZHAA 2BDYA 1O3PB 3ZVCA 3AVZA 1D6RA 1QA0A 1UMAH 3FZZA 2H9TH 4H6SB 2C8ZB 3K6YA 3GCHB 3VXEH 1NFXA 4ABJA 3TVJB 1BZXE 1EXFA 4ZH8A 1QJ7B 1C2GA 3FP6E 2YNAA 2Z3DA 3PROA 2BLQA 1T7CA 1WOFA 2XCFA 2ZG0H 3V13A 1SI5H 3RMMH 2F9NA 1TONA 3A8DA 2CF8H 2WYJA 4OGXA 1YPKH 3A7TA 3MNBA 2BXTH 2CHAB 1MZDA 3KCGH 4WMEA 2C3SA 1EQ9A 4ISIH 1MUEB 1GBAA 2ZZUH 5EW1H 3SV2H 5F8XA 1V2RT 3ZV9A 1P9UA 8ESTE 2B5TB 4CRAA 1F5LA 2ZGXH 2BDBA 4GUXA 1MTWA 5HMAA 3V3MA 2AMPA 3SV9A 1P2MA 5EXLA 2V3OH 3E6PH 3TLOA 1V2PT 1Z6EA 5CHAB 1P09A 2PR3A 1K2I1 1NRNH 1KY9A 2FLBH 2OD3B 4X1NU 1FV9A 3D49H 4AG1A 2FOMB 2XW9A 2GX4A 1DUAA 3F9HA 3SNCA 2ZCLP 3RDZA 1GJ8B 3ZVFA 1NPMA 4AOQA 1A5HA 1MH0A 1BTHH 3PLPA 3A7ZA 4GPGA 3RXKA 1GG6C 3M5OA 4Y79A 4IN2A 3D23A 4XSKU 1O2RA 1EJNA 3O8DA 5JB9S 2BX3A 4CBNA 1GI0A 2VWMA 4BXWA 4OS1A 3RM2H 3U8RH 1A0HB 3BEUA 2Z9JA 1ZSKA 4ZHMU 1A0JA 1QFKH 4FVDA 2P3UB 1NRRH 1FNIA 3OX7U 3KGPA 1T8OA 1JIRA 1O2YA 5L2YH 2GV7A 2Y7XA 1V2NT 3HATH 1LQEA 4CRFA 1EP5A 2CV3A 2FTLE 2DE8A 1BITA 1MD7A 2YOLA 1A5GH 2A5AA 1E38B 1LKAA 1P2OA 1O5EH 1DDJA 4IW4E 4F4OC 3QGNB 1GBCA 1YM0A 3PMBB 5GIBA 3RLYH 3RXUA 1ZZZA 5DP9A 1P2JA 2Z6BD 3T5FH 4ZXYH 1ACBE 2I6QA 2R2MB 1ZMLA 2XCNA 3ATIA 3RMOH 3SJIA 2ZGCA 1SBWA 4B2CA 2HPPH 1O3IA 3RXMA 1ZTKA 1P9SA 2TIOA 3LONA 4WMDA 1HAYB 3MU1A 2ZHQH 2ZFSA 3LGIA 1TOCB 3QWCH 2VGCC 3V7TA 2F83A 2Y7ZA 1MU6B 2DE9A 3PYHA 2H5CA 3BF6H 1HGTH 4ZUHA 1FQ3A 4U2WA 4DOQA 3SV8A 2ZP0H 1WYKA 3B9FH 1GPZA 1UTNA 5L30H 1B0FA 1XVOA 1A3EH 3BTME 3LJJA 3OY6U 2A5KA 5K0HA 3HGPA 2H1UA 1SPJA 1BTWA 4B76A 2FOEA 5LH8A 4XFQA 2VIWA 1GJ5H 3UIRA 1QBVH 1ELVA 4Y0YE 2F91A 2J4IA 1CHOF 1N6XA 2BVXH 2ZDVH 4JMYA 1EAUA 5HM2A 2AYWA 4DT7B 3UNRA 1PPZA 3SUFA 3ZZ9A 2ODPA 2UUKB 1XKAC 1MQ6A 1O3CA 4YTAA 1ZMNA 2SGFE 3A88A 2C4FH 3ZZ3A 3NWUA 3K6ZA 1S85A 2H6MA 1XXFA 2F9OA 1HAZB 1WV7H 5C67A 3KQEA 1MKWK 2ZNKH 2P95A 3T28A 3BV9B 3G01A 4UFDH 3LGTA 2CJIA 3Q3YA 2PHBA 1HLTH 1K1NA 1JWTA 1NT1A 1HCGA 2UWPA 2ANMH 1S84A 1G32B 1L1GA 2ZFPH 4NZLA 3GCNA 1G2MA 3M3TA 1BHXF 5FPTA 1XUIA 2ZKSA 4GLYA 1O2VA 5C5OA 3F1SB 1QIXB 3TITA 1UCYE 2QYIA 1IQKA 5JBTA 3P8OA 4AZ2B 2ESTE 1C4V2 1UTMA 3MH7A 1O32A 1NY22 1QL9A 3RXFA 1Z8IB 2FM2A 1WCZA 2Q6DA 1H8IH 1IQJA 1GDQA 1ZSJA 3QUMP 1V2ST 2ZTYA 1O2MA 4INHA 1GL1A 4WJG2 3RC5A 2BQWB 3OSYA 3P17H 5IYTA 2AGGX 4MNYA 2A4QA 4KTCA 1FPHH 1P02A 1RTLA 4CRDA 1SGTA 2GGVB 4ZKRU 1SGYE 1SMFE 3SU0A 2PKSB 3TNSA 2GVFA 4TPYA 2Z9IA 3P92A 5DP6A 4OS5A 4KP0A 4NFFA 1ETRH 3ZYEA 5GCHG 1A61H 3D65E 1O3KA 1C2MA 1HAPH 1A2CH 1QURH 2I6SA 1PPEE 1PQAA 2QXGA 4A1XA 4UFEH 3UNQA 3EYDA 2ZPRA 1DY9A 1N6YA 1O31A 1Y3VA 4Z0KA 2ZDAH 5T6FA 1CGHA 1S83A 6CHAC 1ARBA 5EODA 1GBDA 2BXUH 1T8LA 3MH4A 4HTCH 4LK4A 1ZJKA 4Y7AA 2FS9A 3PO1B 3RMNH 1UTLM 2WV4A 1LPZB 1QQ4A 3OU0A 1EZQA 3RXLA 1QRXA 4RKJB 1P03A 3AAVA 2XTTB 2VIPA 1C5XB 2ZQ1A 4LXBH 2BD8A 2V6NA 5FHTA 3UQOA 1G37A 1C2DA 2ILNA 2CXVA 4K3JA 3ZVEA 1TRMA 4K8BA 4CR5A 1TGNA 3FVFB 5HXFA 3OTJE 2FS8A 3QX5H 2STAE 3F6UH 4Q7ZA 1LHGH 1FIWA 2FOAA 2Z94A 3OYPA 3GISB 3UR6A 4BXSA 2EC9H 1SGDE 2WUCA 3A80A 3GY3A 4UFGH 3RP2A 1BBRK 5TCCA 2W3IA 3Q3KA 2TGTA 1AD8H 5EQSA 4I7YH 4ZKOU 1EAXA 4ISLA 5AVDA 2D8WA 3SU1A 4FU7A 1GI1A 4B73A 1GJBB 2QIQA 1SG8B 5AFZH 5C1XA 1MKXH 1FXYA 2BY6X 2ULLA 4AFZA 4MPWA 2OTVA 1C5LH 1K28D 3GY5A 4CR9A 1L1JA 1GBTA 2FI5E 2G81E 4IC6A 4MG3A 4Q80A 1SVPA 1GVZA 3RXSA 2Z9KA 1BMAA 1GMDF 1DS2E 1TNKA 1IQMA 2BVSH 3SNEA 2RDLA 3MH5A 1E0FD 5LGOA 1IQIA 3IWMA 1PPHE 2GCTB 1QRZA 3BEFB 3TJVA 1V2KT 1HJAC 1Z71A 1YYY1 3TJUA 1C1UH 3A86A 4X1SU 4OGYA 4DJZB 3ENSB 1IQGA 1ARCA 2BY7X 1Y3UA 2ZGJA 4IN1A 4XDEA 1ELBA 1IQEA 2ZFRH 5G4BA 3MWIU 2FWWA 1DWCH 3F68H 2ANWA 4YESB 1CBWB 4JYUH 1CO7E 4O03A 1EP6A 2OLGA 1V2WT 1PQ7A 1U6QA 3SU2A 4FUFA 1XUKA 2HPQH 1A0LA 2Q1JA 3DUXH 1NTPA 2ALPA 2TRMA 1TQ0B 1C1MA 1O3GA 1P2QA 2P8OC 2VIQA 1UJ1A 1V2OT 2F9PA 2RA0A 1UVOA 3JZ1B 1AQ7A 8GCHF 1AHTH 4H6TA 1ABJH 3TJNA 4AYVB 4JYTA 1HAVB 4AFSA 3RXEA 1AFQB 2ZFTA 2VVUA 1GGDC 1O3BA 3LC3A 1XMNB 2BD5A 4HZHA 5FPYA 1G2LA 3HKJB 5C20A 2Z3EA 2A7JA 2ODQA 4X2XA 5DKMA 1EUFA 1H8DH 1DLEA 2QY0B 2B7DH 3M5MA 1YP9A 1YGCH 2WPJS 5EGMA 4ABEA 1YPMH 2O8LA 1KXEA 2GD4B 2ZA5A 3FAOA 1QBOA 2PKAA 4KGAA 4IBLH 4MTBA 1L1NA 4AB8A 1E36B 1KLTA 2EA3A 2Z3CA 1W2KH 3SUDA 1A5IA 1GI5A 4AFQA 2EI6A 2NU4E 1GBEA 1J9CH 2SGQE 4YLUA 2GMTB 2PSXA 2UUYA 3AW0A 2FYRA 2O8UA 1LVBA 2ANKH 5DK1A 2BD2A 4CHAB 1YF4A 4JZ1A 2BTCE 4ISNA 1EOJA 1K1JA 2PWXA 2BVRH 2KAIA 4MPXA 3RXCA 1TIOA 1SOZA 3DT0H 4A92A 4Y76A 1ZHPA 4FU9A 1TLDA 2NWNA 1LHFH 5JPMH 2G5NA 4GHTA 1S0RA 2GDEH 4MDSA 1G30B 1DITH 1H1BA 3MOCA 1C1QA 1VZQH 3VB7A 4BANB 4TWYA 3KIDU 3TNTA 2EEKA 1GHAG 3KQDA 1DM4B 3QDZB 2A4GA 4WY3A 3SUGA 1W8BH 2BYAX 4B2AA 3F9GA 1MCTA 1ZMJA 3UWJH 1DWDH 1P06A 1OXGA 1KXDA 5FX5A 5E8EH 2J9NA 3P8GA 2RA3A 1EB1H 4LOYH 3RUOA 1TFXA 2NU1E 4BAOB 3EA9A 1SLVB 3VGCC 1O38A 1HRTH 1P12E 3MU8A 3T27A 4I32A 3SGBE 2AGEX 1DFPA 2CGAA 1GJDB 1FZZA 1QB6A 2ZO3H 1O5AB 2ZQ2A 3PMHB 2ZHWH 1SGPE 3QTOH 4NCYA 1O2LA 1C5OH 3CS0A 7GCHG 3PWBA 4BTUB 1C1PA 1BUIA 2RCEA 2JETB 1O5BB 5L6NH 4UDWH 1Q3XA 3O8RA 1DX5M 1P3EA 1VCPA 1K22H 1G3DA 3L3TA 2G4TA 1MTNC 2BQ6B 4M7GA 4ASHA 2ZI2H 1KLIH 3Q77A 1LPGB 2LPRA 3GCTF 3AAUA 1V2TT 2OC0A 4CRBA 1IAUA 1BTZA 1AMHA 1OKXA 5A8XA 2GCHF 1TMTH 1SFQB 4IC5A 1ETTH 2A4OA 1C1NA 1SB1H 1RGQA 1OPHB 1ZJDA 4ABFA 1VCQA 1GHYH 3Q00A 3M37A 1EZSC 1XM1A 2ZU5A 4THNH 1XUGA 2BY9X 4WF8A 1IQNA 2Y5GA 3MTYA 1ZRBA 2G51A 2QA9E 3QN7A 4AG2A 2SGDE 1ZPZA 4YM9A 2K1QA 3HPTB 1C9TA 1PYTD 3GYLB 5AF9H 1W7XH 4INLA 2LNCA 4Y11E 3GCHC 1ETSH 3LPRA 2OINA 1LHDH 4OS2A 5AFYH 1P2IA 4BNRA 1EB2A 1UCYH 3M36A 4X2VA 5TCAA 3BTEE 1HAOH 1ELCA 1AKSB 4XE4A 1QY6A 2ZTXA 2FPZA 3SU3A 3RXHA 1MMJN 1VJ9U 1HPGA 2OC7A 1BT7A 1SOTA 1FN8A 4I8JA 4UD9H 2D26C 5BPEA 2BM2A 1FONA 1O2QA 4DY7B 2B0FA 2CHAC 1F0SA 3A87A 2UUJB 3A7XA 3U1IB 1QJ6B 3KL6A 5T3HA 3K9XB 2QCYA 3R3GB 1LO6A 2ASUB 4LZ1H 3PTNA 1MTVA 2AEIH 1B0EA 2O9QA 2GT7A 6GCHG 1A3BH 4RKOB 1N8OB 4Y71A 3SQEE 1DSTA 1NO9H 1O3DA 1FLEE 3MNXA 4Y6DA 2PGBB 2C8XB 2FTMA 4YOJA 3S9BA 1GMCG 3UUZA 4A6LA 5CHAC 3A85A 4X6PA 7LPRA 1CVWH 1AVWA 1EAIA 4AB9A 1YC0A 1HAIH 4NGAH 4IMZA 3ATMA 4D9RA 1GJ6A 4JK6A 1BCUH 1C5PA 2R3UA 1KLJH 1BTPA 3TGIE 1INCA 3SU6A 5FBEA 4Y10E 4X6OA 4A7IB 2ALVA 2NU2E 1W13U 5A2MH 2GZ8A 3QZRA 2FOCA 4OS6A 1ESTA 3MNSA 1HAHH 4WMFA 3VPKA 5T6DA 1C2FA 1GJ4H 1AI8H 4X8SH 3C27B 1J8AA 1TPOA 1E37B 1AY6H 1GCTB 4I8LA 1O3EA 2V0BA 2BDAA 2FOBA 1H9LB 2VH0A 1BHXB 1FJSA 1PPFE 2ZU4A 3RXAA 2TGDA 1FI8A 2BOKA 4JCNA 1AB9C 3KF2A 1A4WH 3SHCH 3QZQA 3MH6A 1YLCA 2VJ1A 1CSOE 1T32A 1P8VC 1AZ8A 1ELTA 2OXSA 1SSXA 5PTPA 2SNWA 2J92A 3SQHE 1G36A 3VXFH 1Z1JA 3BN9A 5JDUB 3TU7H 1HBTH 3T25A 1CT2E 1JOUB 1L4ZA 4D76A 1HJ9A 1CU1A 2O8MA 2ZDKA 3SOSA 1KDQB 1XXDA 2XC4A 5GDSH 4A5TS 2OC8A 1BTXA 1P01A 1XX9A 4WWYA 4Y8XA 1P04A 1DVAH 1QRWA 1SHYA 1TGTA 2G5VA 1Q31A 1QA7A 4AN7A 5C3NA 1UK4A 1NRSH 4XOJA 1CHGA 1FY5A 2PUQH 3BEIB 1UTOA 1VITF 1GBFA 3M3VA 1SQOA 1HIAB 1TBRH 5LPEA 1Q2WA 3RXRA 3SZNA 5FX6A 8KME2 2TGAA 4XBDA 1O5DH 4ABBA 3URCA 2JKHA 1KXFA 4FUBA 3E16B 2ZECA 2GDDA 4ISOA 2BHGA 4YZUA 2FX4A 3STIA 3BTKE 2G4UA 1NESE 1G3BA 3UOUA 1RIWB 5J4SA 1O2NA 1OWJA 5SGAE 1DICA 2FOGA 2A0QB 2BDIA 4JYVH 3DFJA 2ZHFH 1O3NA 1CT4E 1YCPK 3ZVDA 3TIUA 3B23B 1C1OA 1S0QA 1C5NH 1DOJA 2EI7A 3ATKA 1F92A 1Y5UT 4I8HA 4ZROA 5JBCS 2FESH 3TGKE 2BLOA 1E35B 3PV4A 5FCRA 3NPSA 1SGIB 3M5LA 3DHKH 5FPSA 1NC6A 2W5EA 2QV1A 1V6DA 1V2QT 2OUAA 3DA9B 3Q3XA 4DG4A 4NZQA 2BDCA 4MLFB 3V0XA 3VEQB 2P93A 1NROH 4BAHB 1UVPA 2PSYA 1O33A 1S82A 1BTYA 2XBXA 5T6GA 3ELAH 1C2IA 1ZRKA 1C1TA 1TNLA 1TRNA 1F5KU 2PFEA 4UONA 5GPIB 2HGTH 2ZTZA 5A09A 2F3CE 2XXLA 1GHBF 4E7RG 1QBNA 2B8OH 1P10A 2W7UA 2QN5T 1EJAA 2XRCA 1UTQA 4NIVA 4FUCA 1ABIH 2FYQA 3BTGE 1ELEE 2SGPE 2QF0A 5A0AE 1GI7B 5JB8S 1A1RA 3EAJA 1TNJA 1V2VT 2PKSC 1AGJA 4IMQA 1AU8A 2A7HA 3LH3A 1GBIA 3NCLA 5A0CA 1O2PA 2P3FH 4TWWA 1GMHF 1TMBH 1TALA 2AIQA 4U30A 3U1JB 4SGBE 2WPHS 4NA8A 1EPTB 3E91A 1BTUA 3ODDA 2AIPA 1H9IE 5JYIA 3SJKA 1K21H 1W12U 2BZAA 4GCHG 1ESAA 1YPJH 2GZ7A 3QK1A 1YCPM 1C2JA 3PO1C 3RU4D 1CQQA 1GBBA 4CH8B 3MI4A 4K2YA 1EKBB 3W95A 4FUHA 3LU9B 5DP4A 2F9BH 4MPVA 1IHTH 4BTTB 1MKWH 4H4FA 3TPIZ 1GBJA 1PQ8A 3M35A 4I8GA 2A2XH 1L4DA 1PPBH 1QB1A 5JBAS 4E7NA 1AZZA 2GT8A 1ZOMA 2VB0A 2BD3A 1NM6A 4D8NA 5ESBA 2OP9A 3D62A 1K1PA 4R8TB 1VJAU 1GBKA 1TGSZ 4ABHA 1C5TA 1SGNE 3TK9A 1SLUB 3E1XB 3BTDE 3S0NA 3F9EA 1O36A 4HFPB 1QTFA 1QGFA 3FANA 3SN8A 4IS5A 1S5SA 5A0BA 2RG3A 1GJ7B 1SHHB 1DXPA 3SU4A 1ZPCA 1DLKB 5ABWA 5ESTE 3LOXA 5H4IB 3U69H 4Y8ZA 1TBQH 1C5UA 1FPCH 4TYDA 1M9UA 4DGJA 2WUBA 1GDUA 1ZTJA 1IHSH 4KELA 1UO6A 2HNTC 1CHOG 2J34A 4R0IA 5L2ZH 2BD4A 1NS3A 3SBKA 2V3HH 2TBSA 1K1OA 1THRH 1RS0A 1LPKB 1TE0A 1MAXA 3MO3A 1P11E 2CN0H 2ZIQH 3PMAB 3TK5A 3LGWA 1AKSA 1JIMA 1Y8TA 5B6OA 1NFYA 1C1RA 2GCTC 2Y80A 3QTVH 3BG4B 1LQDB 3FZDA 1UTJA 2ZCKP 3A84A 4WXVA 1JXPA 1YPLH 3EGKH 3ITIA 2R0LA 2R3YA 2QC2A 1TGBA 2H9HA 2BB4A 4DIHH 1HUTH 1GGDB 2OC1A 1VGCB 1ZYOA 3AW1A 4YT7H 4ABGA 1OOKB 3RXVA 2UUFB 2EI8A 3M7UA 1DUEA 2BOHB 2WPKS 1CBWC 3SNDA 3ZVAA 1SLXB 1ZHMA 1RFNA 1F5RA 1DT2A 3GDVA 4FUIA 5I25A 1C4U2 1O3MA 1HFDA 1OWIA 1O3AA 2PV9B 4ZKNU 3SU5A 2ZDMA 2WPIS 3PLBA 3UFAA 1YLDA 2Z9LA 1TOMH 3SJ8A 1ANCA 1CGIE 4U01A 1ESBA 1EATA 1WSSH 2Z7FE 1AO5A 6GCHF 3SORA 1TGCA 1FN6A 1TNHA 1ZR0A 2XYAA 2AFQB 1BJVA 2HALA 1CGJE 1GI8B 1UVTH 1C4Y2 2PGQB 2R9PA 3FFGA 1AFQC 2FI4E 4HI3A 1GBMA 1GMCF 1Y3XA 2VNTA 1BMMH 1F0RA 3IITA 2GP9B 3LDXH 6ESTA 2GV6A 4Y8YA 3GY8A 1O0DH 1RXPA 2BDHA 1SR5C 1K9OE 1QHRB 2FXRA 1D3TB 4J2YB 3ZZ7A 1C1SA 1MTSA 3O8BA 1SGEE 4BAMB 2THFB 3T62A 1ZHRA 4K69A 2O8TA 3SUEA 2BY5X 1O5FH 4JZIA 1P05A 2ZCHP 1HYLA 5HM9A 1VCWA 1V2MT 3ODFA 1LVOA 4Z6AH 2XBYA 4CHAC 1GI2A 3U8OH 2XNIA 1C2EA 1TNIA 2PLXA 4B2BA 1SQTA 1KXBA 5I46H 1Z8GA 1P0SH 2YNBA 1HB0B 3RXJA 5AHGH 1V2LT 3VGCB 1OP8A 5A8YA 1KDQA 3MMGA 1O2OA 3F9FA 2F9UA 3NKKA 2ODYB 2R0KA 2SFAA 1YBWA 4O9VA 2VWLA 3FP7E 3ZYDA 3A7YA 5EU8A 1SGFG 2Y6TA 3SNAA 3U9AH 2R2WU 4U32A 1AIXH 1C9PA 1N1LA 1TPSA 3L33A 3GDSA 2XWAA 3E8LA 2HNTE 3A8AA 4UFFH 4A1VA 4DVAU 2FODA 1V2JT 5DP8A 1P57B 3HKIB 1TA6A 3SW2B 3SV6A 1O2JA 4B1TA 2PTNA 1XUHA 2WV5A 1CA0B 4K1TA 3U8TH 1THSH 1W7GH 4WVPE 1YPHC 5J4QA 1C5YB 2NU0E 3K2UA 1MTNB 1A46H 1W10U 1HJ8A 1EX3A 1KTTB 1O2WA 4FUGA 4VGCC 1S6FA 1OP2A 5GXPA 3GYMA 2GZ9A 1W3CA 3EA8A 1W14U 2FP7B 2QGRA 1BJUA 3LGVA 2XWBI 3BTHE 1QCPA 1AUTC 1GMDG 1SC8U 1IQFA 1LCYA 1LHEH 2AH4X 1O3LA 2JH5D 5C1YA 4X8UH 5C2ZA 3A7WA 2QXHA 3M7QA 2HRVA 1ANBA 3A89A 2BQ7B 1FAXA 1HXFH 1FY8E 4WXIA 3TJOA 3RLWH 3LC5A 2FO9A 3UPEA 3TH3H 1SGFA 4ABAA 1EOLA 1V2UT 2JETC 3GY2A 2WPLS 3IG6B 4JZDH 4E05H 4A1TA 5A8ZA 3K65B 3RM0H 4TY7A 1CT0E 1AVGH 3MO6A 1HDTH 3NZIA 2CMYA 1TPAE 1SGQE 2G52A 2AS9A 2WYGA 1THPB 1OWDA 1BRCE 4PROA 3RU4T 4YOGA 1LVMA 4JZFH 5EPYA 3BIUH 4TY6A 1AN1E 3LH1A 2ZU2A 1SGRE 2VVCA 1BA8B 3ATLA 3PTBA 3RC6A 3RU4E 3RXIA 1HNEE 3S9AA 5EOKA 3H7TA 1NRPH 2Y81A 3NUMA 2A1DB 5F6MA 2ANYA 4ZHLU 2FIRH 1QR3E 4UE7H 5GCHF 3RC4A 3M3SA 3SI4H 1WTHD 1ANEA 3Q76A 1GG6B 1TABE 2FOFA 4UEHH 2A32A 3H7OA 2Y5HA 3KHVA 2FOHA 8GCHG 4NIYA 1O3FA 1BBRE 4NSYA 1GI6A 1ELAA 4X2YA 1IQHA 5E2PA 3I78A 1F0UA 1VR1H 1A7SA 1EPTA 3GY6A 2GKVE 5DP7A 3TK6A 4ZAEA 2HLCA 5DP3A 1F0TA 1BMLA 2B9LA 1TNGA 2OBOA 1QL8A 2D2DA 3O8CA 1EJMA 4O3TA 3T26A 1DWBH 3I77A 2AMDA 2ZDNA 1C2KA 4ABDA 4HGCA 9LPRA 3DD2H 3VB4A 1TMUH 3U98H 1LKBA 3SO3A 1HV7A 5GJ4B 4FUDA 3E90B 1B5GH 3GCOA 5DGJA 4BAQB 1QB9A 1RTFB 1W0ZU 1XKBC 4BAKB 3SNBA 2TGPZ 1N8OC 1DANH 1NFWA 4GCHF 3A7VA 5DPAA 2VGCB 3UOPA 1OYQA 1OYTH 2PKAB 1OX1A 4RSPA 4YT6H 4SGAE 2ZHDA 1O35A 3S7HB 2OBQA 3ZZBA 1AUJA 1GJAB 1VITH 1LVYA 4X6NA 1AB9B 2STBE 1YPHE 1C5ZB 4OS4A 4DURA 9ESTA 1V3XA 4X0WU 4WH8A 4XBCA 1C5VA 2Z9GA 1TYNA 1GHXH 3TH2H 4AX9H 1B7XB 2ZF0H 1CA8B 3AASA 3MHWU 2CF9H 1C1WH 4JZEH 1DSUA 1IOEA 1O2IA 3T29A 3UY9A 2KAIB 1D3PB 2BDGA 1KIGH 1O2GH 3SI3H 1MCVA 1GJCB 1ELDE 3PLKA 1T4VH 2UWLA 1WTGH 2BY8X 3KNXA 1Z1IA 1NN6A 5C5NA 4NSVA 1ORFA 3KQBA 4NG9H 1GVKB 4CH2B 4RN6A 1AVXA 5E0GA 1GCTC 3BIVH 3A83A 1RD3B 4Q2KA 1OS8A 1P2KA 3C1KA 2OCVB 1PYTC 3TH4H 3RXTA 4ZKSU 4BTIB 2QXJA 1E34B 3PM3A 5EQRA 4FXGH 2A2QH 4ZXXH 1MTUA 1MAYA 2AGIX 5EPNA 3ZZDA 5C1UA 1HAVA 1ZSLA 1GHWH 2OQUA 2SGEE 3UWIA 3UR9A 2DUCA 3I29A 1UHBB 3ZZ6A 1K1MA 1J14A 3MU4A 3P8FA 3LJOA 3NXPA 3RXPA 3CENA 1Z8JB 1MQ5A 1ZGVA 3KQCA 4MPUA 2H9EH 2F9VA 2P16A 5LPRA 2W7SA 4CRCA 4DIIH 1T8NA 1O39A 1TRYA 2A7CA 4YO9A 1MKXK 1FIZA 1ZPBA 5F8ZA 1X7AC 1BB0B 1H9HE 3GCTG 4ESTE 1MZAA 3V12A 4QT8C 1AE8H 7KMEH 2AMQA 4AGJA 1HXEH 1DY8A 2ZU1A 3P6ZB 3S69A 2XBVA 4LZ4B 1TX7A 2GCHG 1ANDA 4AYYB 1NZQH 2ZU3A 2QXIA 1PPGE 4NFEA 1QQUA 3LKWA 3QGJA 1FAKH 1QL7A 2SGAA 4CREA 4TPIZ 1RIWC 1O2HA 3UREA 5FCKA 3ESTA 7ESTE 3GICB 3P70B 2VH6A 5CMXH 1G9IE 2Y5FA 5FAHA 3SGQE
chains in the Genus database with same CATH superfamily
6CHAB 2VIOA 2FMJA 2FX6A 3QLPH 3HK3B 1ELGA 2FDAA 1W0YH 3WY8A 1E1RD 2P94A 2VIDA 4H42U 6LPRA 2A31A 2GTBA 1O2UA 2BD9A 4INKA 1GCDA 3SJOA 1J17T 1HAGE 2GJGA 4Y0ZE 1K1LA 3A81A 1DE7H 4KTUA 5EXNA 5K7RA 1RJXB 1XVMA 1ZGIA 2J94A 5EIYA 4I33A 1P2NA 3HK6B 4Q7YA 3KN2A 1WU1A 2BLVA 2A4RA 2FEQH 1VKYA 3N7OA 1FUJA 1SL3A 1XUFA 1GI9B 5FXLA 3L6PA 4P02A 1LTOA 1PPCE 4I8KA 1KTSB 1GHAF 3DSPA 3M5NA 3A8BA 3RXGA 4MNWA 1DWEH 2XC0A 4XBBA 1BMNH 1GBLA 4AFUA 1P3CA 1BRBE 4KTSA 4X2WA 2BD7A 1FY3A 2FI3E 2BZ6H 1GDNA 1E79D 1BQYA 1HAXB 1WQSA 4D7FA 1GHVH 1FMGA 1JRSA 3GY4A 4MNXA 1G3CA 1K1IA 5F03A 4X1RU 4DT4A 5DP5A 1AFEH 1Z6JH 4D7GA 4F49A 4X1PU 3B8JA 1KYNA 2ZGHA 4IGDA 3BG8A 1OSSA 3A82A 8LPRA 1SFIA 3VG8A 2C8YB 2ZFFH 4YOIA 2W3KA 2OK5A 5C94A 2FZZA 5F8TA 1EPTC 1CE5A 1FY4A 1S81A 1O30A 1TQ7B 3LGUA 3LT3A 3SHAH 5LPFA 1BMFD 4KKDA 1AWFH 4NIWA 4AC9A 1PQ5A 3VB5A 1FY1A 3M61U 3ZZ5A 1TAWA 1O34A 1UK3A 2VINA 3MFJA 1UVUH 1QJ1B 3RMLH 3BTTE 4CBOA 1Y5AT 1L0ZA 1YPGH 1HJAB 2J2UA 7GCHF 3GOVB 3T2NA 2RFKC 1RRKA 1LHCH 3F0PA 1JMOH 1YCPH 4MVNA 2FLRH 3S9CA 1WQVH 2P3TB 5TJXA 3S7KB 3ZVGA 3UAIC 1C2HA 4ZMAH 1PFXC 4Q7XA 3MNCA 4O97A 5HGGA 1GBHA 3H5CB 1C5QA 1TX8A 2P59A 3DFLA 2C90B 1GHZA 1TWXB 5EW2H 3MO9A 4K60A 1XUJA 4AGKA 1J16A 1EZUC 3CS7A 2JH6D 3VB3A 2XC5A 4NA7A 2O8WA 4X6MA 2HOBA 4B71A 1BRAA 4FOUC 1OWKA 1TBZH 5ETXA 3URDA 3ZV8A 4GVUA 2P8OB 2ZGBH 3RXQA 1D9IA 3W94A 3ZVBA 1AWHB 3RXOA 3GY7A 4GHQA 1NBME 4FUJA 4AORA 5GWZA 1ZTLA 2VWOA 2V35A 1SLWB 1Y3YA 1C1VH 2C8WB 3E3TA 3OFND 3UTUH 4DW2U 4FU8A 1O3HA 4O3UA 1IQLA 4RT0A 3A8CA 1TA2A 1C5WB 2PUXB 4ISHH 3EE7A 1MD8A 2BX4A 2XBWA 1O2SA 1VITG 2A5IA 1TPPA 5E2OA 1WDIA 3PMJA 3GDUA 3QO6A 4X8TH 1K0HA 3OY5U 1GI3A 1T4UH 1W11U 3VB6A 1UTPA 1BIOA 3MYWA 2H2ZA 5DG6A 5IDKA 3TGJE 1F7ZA 1OWEA 5FBIA 1W0JD 1J15A 3ZZ8A 1YPEH 1WAYB 2RDEA 2HNTF 2J95A 4NWLA 5E0HA 1JBUH 1NRQH 4OS7A 3BG4C 1NFUA 2D1JA 2ZHEH 1JRTA 4B74A 3BSQA 3HGNA 4B75A 1O5GH 1VGCC 3P8NA 3LGYA 1GI4A 3R0FA 3P95A 4NWKA 1FDPA 3RXBA 5E0JA 1UTKA 1OP0A 1Y5BT 2HVXA 2ZPQA 4GSOA 1AE5A 1BBRH 1GVLA 5DJ7A 2VU8E 5CE1A 1TX6A 2M5TA 1NU7B 3BTFE 3MQKC 3ZZ4A 1ZLRA 1SQAA 2IOTA 5DO4H 1H4WA 3ATWA 3OE7D 3BTWE 4X1QU 5HIZA 4K1SA 2SNVA 3FP8E 2BLWA 5JBBS 3VFEA 1S6HA 1Z7KA 2Q6GA 1T31A 1Y59T 1EZXC 2YMSB 3ZZCA 1GHBG 1RTKA 1C2LA 3EDXB 4E06H 2IPHA 4Y7BA 3E0PB 4K1EA 2GMTC 3JZ2B 1UCYK 1C5SA 2JH0D 4J1YA 1O2ZA 3SJ9A 2H5DA 3F2GA 3PWCA 2ZC9H 2VVVA 4FVBA 4MNVA 2G00A 1SQRA 2AERH 1WUNH 2ZEBA 1DPOA 1UK2A 3EQ0H 2KFWA 3E0NB 2HWLB 1FX0B 2BMGB 1C5RA 2PW8H 3EA7A 3EE0B 5EJ1A 1DXWA 4JK5A 1YKTA 2WPMS 1D3DB 4NA9H 4FUEA 2QAAA 1NU9A 2W26A 2ZWLH 5BRRE 2ZDLA 1GMHG 2WINI 4DCDA 1O37A 4I31A 4ZCNA 4NIXA 4K8YA 2ZFQH 3UNSA 1BDAA 2L6OA 4YLQH 1KXCA 1BOQA 3FOAA 2G8TA 4K5ZA 3CP7A 2G55A 1LDTT 3RXDA 1ID5H 1O2XA 4CRGA 1EAWA 1Z8RA 2C93B 1SGCA 1UVSH 3STJA 4BOHA 2KCYA 5HYOA 5EG4A 1GJ9B 2J38A 2QF3A 1HIAA 3LIWA 1UHBA 1D6WA 1WBGB 1O2TA 2Y82A 4VGCB 1OWHA 1Y3WA 1O5CB 3N99A 5EQQA 1F2SE 3M7TA 2JJ1D 1LMWB 2ZPSA 3NK8A 3MU5A 1D3QB 2Q6FA 1T8MA 1GWAA 2IJOB 3MU0A 1KSNA 2EQNA 1C5MD 1MBMA 3UQVA 3BTQE 3PB1E 1O3JA 3F2HA 3SGAE 1GL0E 1L2EA 1ELFA 1BRUP 1D4PB 1O2KA 2UWOA 2A45B 2PTCE 3SV7A 4WH6A 2TPIZ 4GAWA 2IN2A 5EXMA 1EASA 4ABIA 1KXAA 4M9FA 1MBQA 2VIVA 1TB6H 4X8VH 1PJPA 1O3OA 2OQ5A 1MU8B 1G3EA 4MQAA 2NU3E 4D9QA 1CA0C 3ZZAA 3KEEA 1QNJA 2VWNA 4ZHAA 2BDYA 1O3PB 3ZVCA 3AVZA 2WPDD 1D6RA 1QA0A 1UMAH 3FZZA 2H9TH 4H6SB 2C8ZB 3K6YA 3GCHB 3VXEH 1NFXA 4ABJA 3TVJB 1BZXE 1EXFA 4ZH8A 1QJ7B 1C2GA 3FP6E 2YNAA 2Z3DA 3PROA 2BLQA 1T7CA 1WOFA 2XCFA 2ZG0H 3V13A 1SI5H 3RMMH 2F9NA 1TONA 3A8DA 2CF8H 2WYJA 4OGXA 2WZQA 1YPKH 3A7TA 3MNBA 2BXTH 2CHAB 1MZDA 3KCGH 4WMEA 2C3SA 3OTPA 1EQ9A 4ISIH 1MUEB 1GBAA 2ZZUH 5EW1H 3SV2H 5F8XA 1V2RT 3ZV9A 1P9UA 8ESTE 2B5TB 4CRAA 1F5LA 2ZGXH 2BDBA 4GUXA 1MTWA 5HMAA 3V3MA 2AMPA 3SV9A 1P2MA 5EXLA 2V3OH 3E6PH 3TLOA 1V2PT 1Z6EA 5CHAB 1P09A 2PR3A 1K2I1 1NRNH 1KY9A 2FLBH 3KYFA 2OD3B 4X1NU 1FV9A 3D49H 4AG1A 2FOMB 2XW9A 2GX4A 1DUAA 3F9HA 3SNCA 2ZCLP 3RDZA 1GJ8B 3ZVFA 1NPMA 4AOQA 1A5HA 1MH0A 1BTHH 3PLPA 3A7ZA 4GPGA 3RXKA 1GG6C 3M5OA 4Y79A 4IN2A 3D23A 4XSKU 1O2RA 1EJNA 3O8DA 5JB9S 2BX3A 4CBNA 1GI0A 2VWMA 4BXWA 4OS1A 3RM2H 3DSGA 3U8RH 1A0HB 3BEUA 2Z9JA 1ZSKA 4ZHMU 1A0JA 1QFKH 4FVDA 2P3UB 1NRRH 1FNIA 3AK5A 3OX7U 3KGPA 1T8OA 1JIRA 1O2YA 5L2YH 2GV7A 2Y7XA 1V2NT 3HATH 1LQEA 4CRFA 1EP5A 2AHME 2WSSD 2CV3A 2FTLE 2DE8A 1BITA 1MD7A 2YOLA 3GS9A 1A5GH 2A5AA 1E38B 1LKAA 2KR7A 1P2OA 1O5EH 1DDJA 4IW4E 4F4OC 3QGNB 1GBCA 1YM0A 3PMBB 2IPQX 5GIBA 3RLYH 3RXUA 1ZZZA 5DP9A 1P2JA 2Z6BD 3T5FH 4ZXYH 2JJ2D 1ACBE 2I6QA 2R2MB 1ZMLA 2XCNA 3ATIA 3RMOH 3SJIA 2ZGCA 1SBWA 4B2CA 2HPPH 1O3IA 3RXMA 1ZTKA 1P9SA 2TIOA 3LONA 4WMDA 1HAYB 3MU1A 2ZHQH 2ZFSA 3LGIA 1TOCB 3QWCH 2VGCC 3V7TA 2F83A 2Y7ZA 1MU6B 2DE9A 3PYHA 2H5CA 3BF6H 1HGTH 4ZUHA 1FQ3A 4U2WA 4DOQA 3SV8A 2ZP0H 1WYKA 3B9FH 1GPZA 1UTNA 5L30H 1B0FA 3PRDA 1XVOA 1A3EH 3BTME 3LJJA 3OY6U 2A5KA 5K0HA 3HGPA 2H1UA 2QF5A 1SPJA 1BTWA 4B76A 2FOEA 5LH8A 4XFQA 2VIWA 1GJ5H 3UIRA 1QBVH 1ELVA 4Y0YE 2F91A 2J4IA 1CHOF 1N6XA 2BVXH 2ZDVH 4JMYA 1EAUA 5HM2A 3PRBA 2AYWA 4DT7B 3UNRA 1PPZA 3SUFA 3ZZ9A 2ODPA 2UUKB 1XKAC 1MQ6A 1O3CA 4YTAA 1ZMNA 2SGFE 3A88A 2C4FH 3ZZ3A 3NWUA 3K6ZA 1S85A 2H6MA 1XXFA 2F9OA 1HAZB 1WV7H 5C67A 3KQEA 1MKWK 2ZNKH 2P95A 3FO8D 3T28A 5F53A 3BV9B 3G01A 4UFDH 3LGTA 2CJIA 3Q3YA 2PHBA 1HLTH 1K1NA 1JWTA 1NT1A 1HCGA 2UWPA 3N7EA 3F3BA 2ANMH 1S84A 1G32B 1L1GA 2K0QA 2ZFPH 4NZLA 3GCNA 1G2MA 3M3TA 1BHXF 5FPTA 1XUIA 2ZKSA 4GLYA 1O2VA 5C5OA 3F1SB 1QIXB 3TITA 1UCYE 2QYIA 1IQKA 5JBTA 3P8OA 4AZ2B 2ESTE 1C4V2 1UTMA 3MH7A 1O32A 1NY22 1QL9A 3RXFA 1Z8IB 2FM2A 1WCZA 2Q6DA 1H8IH 1IQJA 1GDQA 1ZSJA 3QUMP 1V2ST 2ZTYA 1O2MA 4INHA 1GL1A 4WJG2 3RC5A 2BQWB 3OSYA 3P17H 5IYTA 2AGGX 4MNYA 2A4QA 4KTCA 1FPHH 1P02A 1RTLA 4CRDA 1SGTA 2GGVB 4ZKRU 1SGYE 1SMFE 3SU0A 2PKSB 3TNSA 2GVFA 4TPYA 2Z9IA 3P92A 5DP6A 4OS5A 4KP0A 4NFFA 1ETRH 3ZYEA 5GCHG 1A61H 3D65E 1O3KA 1C2MA 1HAPH 1A2CH 1QURH 2I6SA 1PPEE 2JIZD 1PQAA 2QXGA 4A1XA 4UFEH 3UNQA 3EYDA 2ZPRA 1DY9A 1N6YA 1O31A 1Y3VA 4Z0KA 2ZDAH 5T6FA 1CGHA 1S83A 6CHAC 1ARBA 5EODA 1GBDA 2BXUH 1T8LA 3MH4A 4HTCH 4LK4A 1ZJKA 4Y7AA 2FS9A 3PO1B 3RMNH 1UTLM 2WV4A 1LPZB 1QQ4A 3OU0A 1EZQA 3RXLA 1QRXA 4RKJB 1P03A 3AAVA 2XTTB 2VIPA 1C5XB 2ZQ1A 4LXBH 2BD8A 2V6NA 5FHTA 3U28C 3UQOA 1G37A 1C2DA 2ILNA 2CXVA 4K3JA 3ZVEA 1TRMA 4K8BA 4CR5A 1TGNA 3FVFB 5HXFA 3OTJE 2FS8A 3QX5H 2STAE 3F6UH 4Q7ZA 2KX4A 1LHGH 1FIWA 2FOAA 2Z94A 3OYPA 3GISB 3UR6A 4BXSA 2EC9H 1SGDE 2WUCA 3A80A 3GY3A 4UFGH 3RP2A 1BBRK 5TCCA 2W3IA 3Q3KA 2TGTA 1AD8H 5EQSA 4I7YH 4ZKOU 2KZ4A 1EAXA 4ISLA 5AVDA 2D8WA 3SU1A 4FU7A 1GI1A 4B73A 1GJBB 2QIQA 1SG8B 4Q4LA 5AFZH 5C1XA 1MKXH 1FXYA 2BY6X 2ULLA 4AFZA 4MPWA 2OTVA 1C5LH 1K28D 2HLDD 3GY5A 4CR9A 1L1JA 1GBTA 2FI5E 2G81E 4IC6A 4MG3A 4Q80A 1SVPA 1GVZA 3RXSA 2Z9KA 1BMAA 1GMDF 1DS2E 1TNKA 1IQMA 2BVSH 3SNEA 2RDLA 2YMSD 3MH5A 1E0FD 5LGOA 1IQIA 3IWMA 1PPHE 2GCTB 1QRZA 3BEFB 3TJVA 1V2KT 1HJAC 1Z71A 1YYY1 3TJUA 1C1UH 3A86A 4X1SU 4OGYA 4DJZB 3ENSB 1IQGA 1ARCA 2BY7X 1Y3UA 2ZGJA 4IN1A 4XDEA 1ELBA 1IQEA 2ZFRH 5G4BA 4OM9A 3MWIU 2FWWA 1DWCH 3F68H 2ANWA 4YESB 1CBWB 4JYUH 1CO7E 4O03A 1EP6A 2OLGA 1V2WT 1PQ7A 1U6QA 3SU2A 4FUFA 1XUKA 2HPQH 1A0LA 2Q1JA 3DUXH 1NTPA 2ALPA 2TRMA 1TQ0B 1C1MA 1O3GA 1P2QA 2P8OC 2VIQA 1UJ1A 1V2OT 2F9PA 2RA0A 1UVOA 3JZ1B 1AQ7A 8GCHF 1AHTH 4H6TA 1ABJH 3TJNA 4AYVB 4JYTA 1HAVB 4AFSA 3RXEA 1AFQB 2ZFTA 2VVUA 1GGDC 1O3BA 2PP6A 3LC3A 1XMNB 2BD5A 4HZHA 5FPYA 1G2LA 3HKJB 5C20A 2Z3EA 2A7JA 2ODQA 4X2XA 5DKMA 1EUFA 1H8DH 1DLEA 2QY0B 2B7DH 3M5MA 1YP9A 1YGCH 2WPJS 5EGMA 4ABEA 1YPMH 2O8LA 1KXEA 2GD4B 2ZA5A 3FAOA 1QBOA 2PKAA 4KGAA 4IBLH 4MTBA 1L1NA 4AB8A 1E36B 5DN6D 1KLTA 2M2AA 3FKSD 2EA3A 2Z3CA 1W2KH 3SUDA 1A5IA 1GI5A 4AFQA 2EI6A 2NU4E 1GBEA 1J9CH 2SGQE 4YLUA 2GMTB 2PSXA 2UUYA 3AW0A 2FYRA 2O8UA 1LVBA 2ANKH 5DK1A 2BD2A 4CHAB 1YF4A 4JZ1A 2BTCE 4ISNA 2CK3D 5GNDA 1EOJA 1K1JA 2PWXA 2BVRH 5B6LA 2KAIA 4MPXA 3RXCA 1TIOA 1SOZA 3DT0H 4A92A 4Y76A 1ZHPA 4FU9A 1TLDA 2NWNA 1LHFH 5JPMH 2G5NA 4GHTA 1S0RA 2GDEH 4MDSA 1G30B 3N7DA 1DITH 1H1BA 3MOCA 1C1QA 1VZQH 1OHHD 2YMSC 3VB7A 4BANB 4TWYA 3KIDU 3TNTA 2EEKA 1GHAG 3KQDA 1DM4B 3QDZB 2A4GA 4WY3A 3SUGA 1W8BH 2BYAX 4B2AA 3F9GA 1MCTA 1ZMJA 3UWJH 1DWDH 1P06A 1OXGA 1COWD 1KXDA 5FX5A 5E8EH 2J9NA 3P8GA 2RA3A 1EB1H 4LOYH 3RUOA 3DCLA 1TFXA 4TSFD 2NU1E 4BAOB 3EA9A 1SLVB 3FN8A 3VGCC 1O38A 1HRTH 1P12E 3MU8A 3T27A 4I32A 5CHBA 3SGBE 2KM0A 2AGEX 1DFPA 2KCPA 2XNDD 2CGAA 1GJDB 1FZZA 1QB6A 1QZ8A 1O5AB 2ZO3H 2ZQ2A 3PMHB 2ZHWH 1SGPE 3QTOH 4NCYA 1O2LA 1C5OH 3CS0A 7GCHG 3PWBA 4BTUB 1C1PA 1BUIA 2RCEA 2JETB 1O5BB 5L6NH 4UDWH 1Q3XA 3O8RA 1DX5M 1P3EA 1VCPA 1K22H 1G3DA 3L3TA 2G4TA 1MTNC 2BQ6B 4M7GA 4ASHA 2ZI2H 1KLIH 3Q77A 1LPGB 2LPRA 2WHXA 3GCTF 3AAUA 1V2TT 2OC0A 4CRBA 1IAUA 1BTZA 1AMHA 2V7QD 1OKXA 5A8XA 2GCHF 1TMTH 1SFQB 4IC5A 1ETTH 2A4OA 1C1NA 1SB1H 1RGQA 1OPHB 1ZJDA 4ABFA 1VCQA 1GHYH 3Q00A 3M37A 1EZSC 1XM1A 2ZU5A 4THNH 1XUGA 2BY9X 4WF8A 1IQNA 2Y5GA 3MTYA 1MABB 1ZRBA 2G51A 2QA9E 3QN7A 4AG2A 2SGDE 1ZPZA 4YM9A 4Z1MD 2K1QA 3HPTB 1C9TA 1PYTD 3GYLB 5AF9H 1W7XH 4INLA 2LNCA 4Y11E 3GCHC 2J98B 1ETSH 3LPRA 2OINA 1LHDH 4OS2A 5AFYH 1P2IA 3W1EA 4BNRA 1EB2A 1UCYH 3M36A 4X2VA 5TCAA 3BTEE 1HAOH 1ELCA 1AKSB 4XE4A 1QY6A 2ZTXA 2FPZA 3SU3A 3RXHA 1MMJN 1VJ9U 1HPGA 2OC7A 1BT7A 1SOTA 1FN8A 4I8JA 4UD9H 2D26C 5BPEA 2BM2A 1FONA 1O2QA 4DY7B 2B0FA 2CHAC 1F0SA 3A87A 2UUJB 3A7XA 3U1IB 1QJ6B 3KL6A 5T3HA 3K9XB 2QCYA 3R3GB 4I86A 1LO6A 2ASUB 4LZ1H 3PTNA 1MTVA 2AEIH 1B0EA 2O9QA 2GT7A 6GCHG 1A3BH 4RKOB 4TT3D 1N8OB 4Y71A 3SQEE 1DSTA 1NO9H 1O3DA 1FLEE 3MNXA 4Y6DA 2PGBB 2C8XB 2FTMA 4YOJA 3S9BA 1GMCG 3UUZA 4A6LA 5CHAC 3A85A 4X6PA 7LPRA 1CVWH 1AVWA 1EAIA 4AB9A 1YC0A 2K8IA 1HAIH 4NGAH 4IMZA 3ATMA 4D9RA 1GJ6A 4JK6A 1BCUH 1YY3A 1C5PA 2R3UA 1YLNA 1KLJH 2JDID 1BTPA 3TGIE 1INCA 3SU6A 5FBEA 4Y10E 3SYJA 4X6OA 4A7IB 2ALVA 2NU2E 1W13U 5A2MH 2GZ8A 3QZRA 3H09A 2FOCA 4OS6A 1ESTA 3MNSA 1HAHH 4WMFA 3VPKA 5T6DA 1C2FA 5T1VA 1GJ4H 3OAAD 1AI8H 1H8ED 4X8SH 3C27B 1J8AA 1TPOA 1E37B 1AY6H 1GCTB 4I8LA 1O3EA 2V0BA 2BDAA 2FOBA 1H9LB 2VH0A 1BHXB 1FJSA 1PPFE 2ZU4A 3RXAA 2TGDA 1FI8A 2BOKA 4JCNA 1AB9C 3KF2A 1A4WH 3SHCH 3QZQA 3MH6A 1YLCA 2VJ1A 1CSOE 1T32A 1P8VC 1AZ8A 1ELTA 2OXSA 1SSXA 5PTPA 2SNWA 2J92A 3SQHE 1G36A 3VXFH 1Z1JA 3BN9A 5JDUB 3TU7H 1HBTH 1WXRA 3T25A 1CT2E 1JOUB 1L4ZA 3SZEA 4D76A 1HJ9A 1CU1A 2O8MA 2ZDKA 3SOSA 1KDQB 1XXDA 2XC4A 5KEDA 5GDSH 4A5TS 4B6EA 2OC8A 1BTXA 1P01A 1XX9A 4WWYA 4Y8XA 1P04A 1DVAH 1QRWA 1SHYA 1TGTA 2G5VA 1Q31A 1QA7A 4AN7A 5C3NA 1UK4A 1NRSH 4XOJA 2HVYB 1CHGA 1FY5A 2PUQH 3BEIB 1UTOA 1VITF 1GBFA 3M3VA 1SQOA 1HIAB 1TBRH 5LPEA 1Q2WA 3RXRA 3SZNA 5FX6A 8KME2 2TGAA 4XBDA 1O5DH 4ABBA 3URCA 2JKHA 1KXFA 4FUBA 3E16B 5HKKD 2ZECA 2GDDA 4ISOA 2BHGA 4YZUA 2FX4A 3STIA 3BTKE 2G4UA 1NESE 1G3BA 3UOUA 1RIWB 5J4SA 1O2NA 1OWJA 5SGAE 1DICA 2FOGA 2A0QB 2BDIA 4JYVH 3DFJA 2ZHFH 1O3NA 1CT4E 1YCPK 3ZVDA 3TIUA 3B23B 1C1OA 1S0QA 1C5NH 1DOJA 2EI7A 3ATKA 1F92A 1Y5UT 3UB0A 4I8HA 4ZROA 5JBCS 2FESH 3TGKE 2BLOA 1E35B 3PV4A 5FCRA 3NPSA 1SGIB 3M5LA 3DHKH 5FPSA 1NC6A 2W5EA 2QV1A 1V6DA 1V2QT 2OUAA 5IK2D 3DA9B 3Q3XA 4DG4A 4NZQA 2BDCA 3NRLA 4MLFB 3V0XA 3VEQB 2P93A 1NROH 4BAHB 1UVPA 2PSYA 1O33A 1S82A 1BTYA 2XBXA 5T6GA 3WW7A 3ELAH 1ZRKA 1C2IA 1C1TA 1TNLA 1TRNA 1F5KU 2PFEA 4UONA 5GPIB 2HGTH 2ZTZA 5A09A 2F3CE 2XXLA 1GHBF 4E7RG 1QBNA 2B8OH 1P10A 2W7UA 2QN5T 1EJAA 2XRCA 1UTQA 3OEHD 4NIVA 4FUCA 1ABIH 2FYQA 3BTGE 1ELEE 2SGPE 4B6FA 5C0TA 2IJD1 2QF0A 1GI7B 5A0AE 5JB8S 1A1RA 3EAJA 1TNJA 1V2VT 2PKSC 1AGJA 4IMQA 1AU8A 2A7HA 3LH3A 1GBIA 3NCLA 5A0CA 1O2PA 2P3FH 4TWWA 1GMHF 1TMBH 1TALA 2AIQA 4U30A 3U1JB 3OEED 4SGBE 2WPHS 4NA8A 1EPTB 3E91A 1BTUA 3ODDA 2AIPA 1H9IE 1W0KD 5JYIA 2QE7D 3SJKA 1K21H 1W12U 2BZAA 4GCHG 1ESAA 1YPJH 2GZ7A 3QK1A 1YCPM 1C2JA 3PO1C 3RU4D 1CQQA 1GBBA 3KYGA 4CH8B 3MI4A 4K2YA 1EKBB 3W95A 4FUHA 3LU9B 5DP4A 2F9BH 4MPVA 1IHTH 4BTTB 1MKWH 4H4FA 3TPIZ 1GBJA 1PQ8A 3M35A 4I8GA 2A2XH 1L4DA 1PPBH 1QB1A 5JBAS 4E7NA 1AZZA 2GT8A 1ZOMA 2VB0A 2BD3A 1NM6A 4D8NA 5ESBA 2OP9A 3D62A 1K1PA 4R8TB 1VJAU 1GBKA 1TGSZ 4ABHA 1C5TA 1SGNE 3TK9A 1SLUB 3E1XB 3BTDE 3S0NA 3F9EA 1O36A 4HFPB 1QTFA 1QGFA 3FANA 3SN8A 4IS5A 1S5SA 5A0BA 2RG3A 1GJ7B 1SHHB 1DXPA 3SU4A 1ZPCA 1DLKB 5ABWA 5ESTE 4ACBA 3LOXA 5H4IB 3U69H 4Y8ZA 1TBQH 1C5UA 1FPCH 4TYDA 1M9UA 4DGJA 2WUBA 1GDUA 1ZTJA 1IHSH 2J98A 4KELA 1UO6A 2HNTC 1CHOG 2J34A 4R0IA 5L2ZH 2BD4A 1NS3A 3SBKA 2V3HH 2TBSA 1K1OA 1THRH 4FETA 1RS0A 1LPKB 1TE0A 1MAXA 3MO3A 1P11E 2CN0H 2LP6A 2ZIQH 3PMAB 3TK5A 3LGWA 1AKSA 1JIMA 1Y8TA 2J97A 5B6OA 1NFYA 1C1RA 2GCTC 2Y80A 3QTVH 3BG4B 1LQDB 3FZDA 1UTJA 2ZCKP 3A84A 4WXVA 1JXPA 1YPLH 3EGKH 3ITIA 2R0LA 2R3YA 2QC2A 1TGBA 2H9HA 2BB4A 4DIHH 1HUTH 1GGDB 2OC1A 1VGCB 1ZYOA 3AW1A 4YT7H 4ABGA 1OOKB 3RXVA 2UUFB 2EI8A 3M7UA 1DUEA 5C0UA 2BOHB 3DSOA 2WPKS 1CBWC 3SNDA 5EJLA 3ZVAA 1SLXB 1ZHMA 1RFNA 1F5RA 1DT2A 3GDVA 4FUIA 5I25A 1C4U2 1O3MA 1HFDA 1OWIA 1O3AA 2PV9B 4ZKNU 3SU5A 2ZDMA 2WPIS 3PLBA 3UFAA 1YLDA 2Z9LA 1TOMH 3SJ8A 1ANCA 1CGIE 4U01A 1ESBA 1EATA 1WSSH 2Z7FE 1AO5A 6GCHF 3SORA 1TGCA 1FN6A 1TNHA 1ZR0A 2XYAA 2AFQB 1BJVA 2HALA 1CGJE 1GI8B 1UVTH 1C4Y2 2PGQB 2R9PA 3FFGA 1AFQC 2FI4E 4HI3A 1GBMA 1GMCF 1Y3XA 2VNTA 1BMMH 1F0RA 3IITA 2GP9B 3LDXH 6ESTA 2GV6A 4Y8YA 3GY8A 1O0DH 2F4LA 1RXPA 2BDHA 1SR5C 1K9OE 1QHRB 2FXRA 2W6JD 1D3TB 4J2YB 3ZZ7A 1C1SA 1MTSA 3O8BA 2KCAA 1SGEE 4BAMB 2THFB 3T62A 1ZHRA 4K69A 2O8TA 3SUEA 2BY5X 1O5FH 4JZIA 1P05A 2ZCHP 1HYLA 5HM9A 1VCWA 1V2MT 3ODFA 1LVOA 4Z6AH 2XBYA 3PV5A 4CHAC 4ACAA 1GI2A 3U8OH 2XNIA 1C2EA 1TNIA 2PLXA 4B2BA 1SQTA 1KXBA 5I46H 1Z8GA 1P0SH 2YNBA 1HB0B 3RXJA 5AHGH 1V2LT 3VGCB 1OP8A 4ASUD 5A8YA 1KDQA 3MMGA 1O2OA 3F9FA 2F9UA 3NKKA 2ODYB 2R0KA 2SFAA 1YBWA 4O9VA 2VWLA 3FP7E 3ZYDA 3A7YA 5EU8A 1SGFG 2Y6TA 3SNAA 3U9AH 2R2WU 4U32A 4P00A 1AIXH 1C9PA 1N1LA 1TPSA 2F43B 3L33A 3GDSA 2XWAA 3E8LA 2HNTE 3A8AA 4UFFH 4A1VA 4DVAU 2FODA 1V2JT 5DP8A 1P57B 3HKIB 1TA6A 3SW2B 3SV6A 1O2JA 4B1TA 2PTNA 1XUHA 2WV5A 1CA0B 2VBCA 4K1TA 2LELA 1THSH 3U8TH 1W7GH 4WVPE 1YPHC 5J4QA 1C5YB 2NU0E 3K2UA 1MTNB 1A46H 1W10U 1HJ8A 1EX3A 4F48B 1KTTB 1O2WA 4FUGA 4VGCC 1S6FA 1OP2A 5GXPA 3GYMA 2GZ9A 1W3CA 3EA8A 1W14U 2FP7B 2QGRA 1BJUA 3LGVA 2XWBI 3BTHE 1QCPA 1AUTC 1GMDG 1SC8U 1IQFA 1LCYA 1LHEH 2AH4X 1O3LA 2JH5D 3KQ5A 5C1YA 4X8UH 5C2ZA 3A7WA 4XD7D 2QXHA 3M7QA 2HRVA 1ANBA 3A89A 4F55A 2BQ7B 1FAXA 5FL7D 1HXFH 1FY8E 4WXIA 3TJOA 3RLWH 3LC5A 2FO9A 3UPEA 3TH3H 1SGFA 4ABAA 2W6ID 1EOLA 1V2UT 2JETC 3GY2A 2WPLS 3IG6B 4JZDH 5KGOA 4A1TA 4E05H 5A8ZA 3K65B 3RM0H 4RI0A 4TY7A 1CT0E 1AVGH 3MO6A 1HDTH 3NZIA 2CMYA 1E1QD 1TPAE 1SGQE 2G52A 2AS9A 2WYGA 1THPB 1OWDA 1BRCE 4PROA 3RU4T 4YOGA 1LVMA 3ZIAD 4JZFH 5EPYA 3BIUH 5DSFA 4TY6A 1AN1E 3LH1A 2ZU2A 1SGRE 2VVCA 1BA8B 3ATLA 3PTBA 3RC6A 3RU4E 3RXIA 1HNEE 3S9AA 5EOKA 3H7TA 1NRPH 2Y81A 3NUMA 2A1DB 5F6MA 1H8HD 2ANYA 5C17A 4ZHLU 2FIRH 1QR3E 4UE7H 5GCHF 3RC4A 3M3SA 3SI4H 1WTHD 1ANEA 3Q76A 1GG6B 1TABE 2FOFA 4UEHH 2A32A 3H7OA 2Y5HA 3KHVA 2FOHA 8GCHG 4NIYA 1EFRD 1O3FA 1BBRE 4NSYA 1GI6A 1ELAA 4X2YA 1IQHA 5E2PA 3I78A 1F0UA 1VR1H 4RT1A 1A7SA 1EPTA 3GY6A 2GKVE 5DP7A 3TK6A 4ZAEA 2HLCA 5DP3A 1F0TA 1BMLA 2B9LA 1TNGA 2OBOA 1QL8A 2D2DA 3O8CA 1EJMA 4O3TA 3T26A 1DWBH 3I77A 2AMDA 2ZDNA 1C2KA 4ABDA 4HGCA 1NBMD 9LPRA 3DD2H 3VB4A 1TMUH 3U98H 1YWUA 1LKBA 3SO3A 1HV7A 5GJ4B 4FUDA 3E90B 4XRNA 1B5GH 3GCOA 5DGJA 4BAQB 1QB9A 1RTFB 1W0ZU 1XKBC 4BAKB 3SNBA 2TGPZ 1N8OC 1DANH 1NFWA 4GCHF 3A7VA 5KECA 5DPAA 2VGCB 3UOPA 1OYQA 1OYTH 2PKAB 1KMHB 1OX1A 4RSPA 4YT6H 4SGAE 2ZHDA 1O35A 3S7HB 2OBQA 3ZZBA 1AUJA 1GJAB 1VITH 4HG6A 1LVYA 4X6NA 1AB9B 2STBE 1YPHE 1C5ZB 2KCOA 4OS4A 4DURA 9ESTA 1V3XA 4X0WU 4WH8A 4XBCA 1C5VA 2Z9GA 1TYNA 1GHXH 3TH2H 4AX9H 1B7XB 2ZF0H 1CA8B 3AASA 3MHWU 2CF9H 1C1WH 4JZEH 1DSUA 1IOEA 1O2IA 3T29A 3UY9A 2KAIB 5HIYA 1D3PB 2BDGA 1KIGH 1O2GH 3SI3H 1MCVA 1UW7A 1GJCB 1ELDE 3PLKA 1T4VH 2UWLA 1WTGH 2BY8X 3KNXA 1Z1IA 1NN6A 5C5NA 4YXWD 4NSVA 5CDFE 1ORFA 3KQBA 4NG9H 1GVKB 4CH2B 2EY4C 4RN6A 1AVXA 5E0GA 1GCTC 3BIVH 3A83A 1RD3B 4Q2KA 1OS8A 1P2KA 3C1KA 2OCVB 3WWBA 1PYTC 3TH4H 3RXTA 4ZKSU 4BTIB 2QXJA 1E34B 3PM3A 5EQRA 4FXGH 2A2QH 4ZXXH 1MTUA 3F2FA 5EJZA 1MAYA 2AGIX 5EPNA 3ZZDA 3CNRA 5C1UA 1HAVA 1ZSLA 1GHWH 2L74A 2OQUA 2SGEE 3UWIA 3UR9A 2DUCA 2QF4A 3I29A 1UHBB 3ZZ6A 1K1MA 1J14A 4Q63A 3MU4A 3P8FA 3LJOA 3NXPA 3RXPA 3CENA 1Z8JB 1MQ5A 1ZGVA 3KQCA 4MPUA 2H9EH 2F9VA 2P16A 5LPRA 2W7SA 4CRCA 4DIIH 1T8NA 3WWFA 1O39A 1TRYA 2A7CA 4YO9A 2XOKD 1SKYE 1MKXK 1FIZA 1ZPBA 5F8ZA 1X7AC 1BB0B 1H9HE 3GCTG 2J5UA 4ESTE 1MZAA 3V12A 4QT8C 1AE8H 7KMEH 2AMQA 4AGJA 1HXEH 1DY8A 2ZU1A 3P6ZB 3S69A 2XBVA 4LZ4B 1TX7A 2GCHG 1ANDA 2V3MA 4AYYB 1NZQH 2ZU3A 2QXIA 1PPGE 4NFEA 1QQUA 3LKWA 3QGJA 1FAKH 3F0OA 1QL7A 2SGAA 3PV2A 4CREA 4TPIZ 1RIWC 1O2HA 3UREA 5FCKA 3ESTA 7ESTE 3GICB 3P70B 2VH6A 1S6LA 5CMXH 2WV9A 1G9IE 2Y5FA 5FAHA 3SGQE
chains in the Genus database with same CATH topology
6CHAB 2VIOA 2FMJA 2FX6A 3QLPH 3HK3B 1ELGA 2FDAA 1W0YH 3WY8A 2P94A 2VIDA 4H42U 6LPRA 2A31A 2GTBA 1O2UA 2BD9A 4INKA 1GCDA 3SJOA 1J17T 1HAGE 4Y0ZE 1K1LA 3A81A 1DE7H 4KTUA 5EXNA 5K7RA 1RJXB 1XVMA 1ZGIA 2J94A 4I33A 1P2NA 3HK6B 4Q7YA 3KN2A 1WU1A 2BLVA 2A4RA 2FEQH 3N7OA 1FUJA 1SL3A 1XUFA 1GI9B 5FXLA 3L6PA 1LTOA 1PPCE 4I8KA 1KTSB 1GHAF 3M5NA 3A8BA 3RXGA 4MNWA 1DWEH 2XC0A 4XBBA 1BMNH 1GBLA 4AFUA 1P3CA 1BRBE 4KTSA 4X2WA 2BD7A 1FY3A 2FI3E 2BZ6H 1GDNA 1BQYA 1HAXB 1WQSA 4D7FA 1GHVH 1FMGA 1JRSA 3GY4A 4MNXA 1G3CA 1K1IA 5F03A 4X1RU 5DP5A 1AFEH 1Z6JH 4D7GA 4F49A 4X1PU 3B8JA 1KYNA 2ZGHA 4IGDA 3BG8A 1OSSA 3A82A 8LPRA 1SFIA 2C8YB 2ZFFH 4YOIA 2W3KA 2FZZA 5F8TA 1EPTC 1CE5A 1FY4A 1S81A 1O30A 1TQ7B 3LGUA 3LT3A 3SHAH 5LPFA 4KKDA 1AWFH 4NIWA 1PQ5A 3VB5A 1FY1A 3M61U 3ZZ5A 1TAWA 1O34A 1UK3A 2VINA 3MFJA 1UVUH 1QJ1B 3RMLH 3BTTE 4CBOA 1Y5AT 1L0ZA 1YPGH 1HJAB 2J2UA 7GCHF 3GOVB 3T2NA 1RRKA 1LHCH 1JMOH 1YCPH 4MVNA 2FLRH 3S9CA 1WQVH 2P3TB 5TJXA 3S7KB 3ZVGA 1C2HA 4ZMAH 1PFXC 4Q7XA 3MNCA 4O97A 5HGGA 1GBHA 3H5CB 1C5QA 1TX8A 2P59A 3DFLA 2C90B 1GHZA 1TWXB 5EW2H 3MO9A 4K60A 1XUJA 4AGKA 1J16A 1EZUC 3CS7A 2JH6D 3VB3A 2XC5A 4NA7A 2O8WA 4X6MA 2HOBA 4B71A 1BRAA 1OWKA 1TBZH 5ETXA 3URDA 3ZV8A 4GVUA 2P8OB 2ZGBH 3RXQA 1D9IA 3W94A 3ZVBA 1AWHB 3RXOA 3GY7A 4GHQA 4FUJA 4AORA 5GWZA 1ZTLA 2VWOA 2V35A 1SLWB 1Y3YA 1C1VH 2C8WB 3E3TA 3UTUH 4DW2U 4FU8A 1O3HA 4O3UA 1IQLA 3A8CA 1TA2A 1C5WB 2PUXB 4ISHH 1MD8A 2BX4A 2XBWA 1O2SA 1VITG 2A5IA 1TPPA 5E2OA 3PMJA 3GDUA 3QO6A 4X8TH 3OY5U 1GI3A 1T4UH 1W11U 3VB6A 1UTPA 1BIOA 3MYWA 2H2ZA 5DG6A 5IDKA 3TGJE 1F7ZA 1OWEA 5FBIA 3ZZ8A 1J15A 1YPEH 1WAYB 2HNTF 2J95A 4NWLA 5E0HA 1JBUH 1NRQH 4OS7A 3BG4C 1NFUA 2D1JA 2ZHEH 1JRTA 4B74A 3BSQA 3HGNA 4B75A 1O5GH 1VGCC 3P8NA 3LGYA 1GI4A 3R0FA 3P95A 4NWKA 1FDPA 3RXBA 5E0JA 1UTKA 1OP0A 1Y5BT 2HVXA 2ZPQA 4GSOA 1AE5A 1BBRH 1GVLA 5DJ7A 2VU8E 5CE1A 1TX6A 2M5TA 1NU7B 3BTFE 3ZZ4A 1ZLRA 1SQAA 2IOTA 5DO4H 1H4WA 3ATWA 3BTWE 4X1QU 4K1SA 2SNVA 3FP8E 2BLWA 5JBBS 3VFEA 1S6HA 1Z7KA 2Q6GA 1T31A 1Y59T 1EZXC 3ZZCA 1GHBG 1RTKA 1C2LA 3EDXB 4E06H 2IPHA 4Y7BA 3E0PB 4K1EA 2GMTC 3JZ2B 1UCYK 1C5SA 2JH0D 4J1YA 1O2ZA 3SJ9A 2H5DA 3PWCA 2ZC9H 2VVVA 4FVBA 4MNVA 2G00A 2AERH 1WUNH 2ZEBA 1DPOA 1UK2A 3EQ0H 3E0NB 2HWLB 2BMGB 1C5RA 2PW8H 3EA7A 3EE0B 1DXWA 4JK5A 1YKTA 2WPMS 1D3DB 4NA9H 4FUEA 2QAAA 1NU9A 2W26A 2ZWLH 5BRRE 2ZDLA 1GMHG 2WINI 4DCDA 1O37A 4I31A 4NIXA 4K8YA 2ZFQH 3UNSA 1BDAA 4YLQH 1KXCA 1BOQA 2G8TA 4K5ZA 3CP7A 2G55A 1LDTT 3RXDA 1ID5H 1O2XA 4CRGA 1EAWA 1Z8RA 2C93B 1SGCA 1UVSH 3STJA 4BOHA 5HYOA 5EG4A 1GJ9B 2J38A 2QF3A 1HIAA 3LIWA 1UHBA 1D6WA 1WBGB 1O2TA 2Y82A 4VGCB 1OWHA 1Y3WA 1O5CB 5EQQA 1F2SE 3M7TA 1LMWB 2ZPSA 3NK8A 3MU5A 1D3QB 2Q6FA 1T8MA 1GWAA 2IJOB 3MU0A 1KSNA 1C5MD 1MBMA 3UQVA 3BTQE 3PB1E 1O3JA 3SGAE 1GL0E 1L2EA 1ELFA 1BRUP 1D4PB 1O2KA 2UWOA 2A45B 2PTCE 3SV7A 4WH6A 2TPIZ 4GAWA 2IN2A 5EXMA 1EASA 4ABIA 1KXAA 1MBQA 2VIVA 1TB6H 4X8VH 1PJPA 1O3OA 2OQ5A 1MU8B 1G3EA 4MQAA 2NU3E 4D9QA 1CA0C 3ZZAA 3KEEA 1QNJA 2VWNA 4ZHAA 2BDYA 1O3PB 3ZVCA 3AVZA 1D6RA 1QA0A 1UMAH 3FZZA 2H9TH 4H6SB 2C8ZB 3K6YA 3GCHB 3VXEH 1NFXA 4ABJA 3TVJB 1BZXE 1EXFA 4ZH8A 1QJ7B 1C2GA 3FP6E 2YNAA 2Z3DA 3PROA 2BLQA 1T7CA 1WOFA 2XCFA 2ZG0H 3V13A 1SI5H 3RMMH 2F9NA 1TONA 3A8DA 2CF8H 2WYJA 4OGXA 1YPKH 3A7TA 3MNBA 2BXTH 2CHAB 1MZDA 3KCGH 4WMEA 2C3SA 1EQ9A 4ISIH 1MUEB 1GBAA 2ZZUH 5EW1H 3SV2H 5F8XA 1V2RT 3ZV9A 1P9UA 8ESTE 2B5TB 4CRAA 1F5LA 2ZGXH 2BDBA 4GUXA 1MTWA 5HMAA 3V3MA 2AMPA 3SV9A 1P2MA 5EXLA 2V3OH 3E6PH 3TLOA 1V2PT 1Z6EA 5CHAB 1P09A 2PR3A 1K2I1 1NRNH 1KY9A 2FLBH 2OD3B 4X1NU 1FV9A 3D49H 4AG1A 2FOMB 2XW9A 2GX4A 1DUAA 3F9HA 3SNCA 2ZCLP 3RDZA 1GJ8B 3ZVFA 1NPMA 4AOQA 1A5HA 1MH0A 1BTHH 3PLPA 3A7ZA 4GPGA 3RXKA 1GG6C 3M5OA 4Y79A 4IN2A 3D23A 4XSKU 1O2RA 1EJNA 3O8DA 5JB9S 2BX3A 4CBNA 1GI0A 2VWMA 4BXWA 4OS1A 3RM2H 3U8RH 1A0HB 3BEUA 2Z9JA 1ZSKA 4ZHMU 1A0JA 1QFKH 4FVDA 2P3UB 1NRRH 1FNIA 3OX7U 3KGPA 1T8OA 1JIRA 1O2YA 5L2YH 2GV7A 2Y7XA 1V2NT 3HATH 1LQEA 4CRFA 1EP5A 2CV3A 2FTLE 2DE8A 1BITA 1MD7A 2YOLA 1A5GH 2A5AA 1E38B 1LKAA 1P2OA 1O5EH 1DDJA 4IW4E 4F4OC 3QGNB 1GBCA 1YM0A 3PMBB 5GIBA 3RLYH 3RXUA 1ZZZA 5DP9A 1P2JA 2Z6BD 3T5FH 4ZXYH 1ACBE 2I6QA 2R2MB 1ZMLA 2XCNA 3ATIA 3RMOH 3SJIA 2ZGCA 1SBWA 4B2CA 2HPPH 1O3IA 3RXMA 1ZTKA 1P9SA 2TIOA 3LONA 4WMDA 1HAYB 3MU1A 2ZHQH 2ZFSA 3LGIA 1TOCB 3QWCH 2VGCC 3V7TA 2F83A 2Y7ZA 1MU6B 2DE9A 3PYHA 2H5CA 3BF6H 1HGTH 4ZUHA 1FQ3A 4U2WA 4DOQA 3SV8A 2ZP0H 1WYKA 3B9FH 1GPZA 1UTNA 5L30H 1B0FA 1XVOA 1A3EH 3BTME 3LJJA 3OY6U 2A5KA 5K0HA 3HGPA 2H1UA 1SPJA 1BTWA 4B76A 2FOEA 5LH8A 4XFQA 2VIWA 1GJ5H 3UIRA 1QBVH 1ELVA 4Y0YE 2F91A 2J4IA 1CHOF 1N6XA 2BVXH 2ZDVH 4JMYA 1EAUA 5HM2A 2AYWA 4DT7B 3UNRA 1PPZA 3SUFA 3ZZ9A 2ODPA 2UUKB 1XKAC 1MQ6A 1O3CA 4YTAA 1ZMNA 2SGFE 3A88A 2C4FH 3ZZ3A 3NWUA 3K6ZA 1S85A 2H6MA 1XXFA 2F9OA 1HAZB 1WV7H 5C67A 3KQEA 1MKWK 2ZNKH 2P95A 3T28A 3BV9B 3G01A 4UFDH 3LGTA 2CJIA 3Q3YA 2PHBA 1HLTH 1K1NA 1JWTA 1NT1A 1HCGA 2UWPA 2ANMH 1S84A 1G32B 1L1GA 2ZFPH 4NZLA 3GCNA 1G2MA 3M3TA 1BHXF 5FPTA 1XUIA 2ZKSA 4GLYA 1O2VA 5C5OA 3F1SB 1QIXB 3TITA 1UCYE 2QYIA 1IQKA 5JBTA 3P8OA 4AZ2B 2ESTE 1C4V2 1UTMA 3MH7A 1O32A 1NY22 1QL9A 3RXFA 1Z8IB 2FM2A 1WCZA 2Q6DA 1H8IH 1IQJA 1GDQA 1ZSJA 3QUMP 1V2ST 2ZTYA 1O2MA 4INHA 1GL1A 4WJG2 3RC5A 2BQWB 3OSYA 3P17H 5IYTA 2AGGX 4MNYA 2A4QA 4KTCA 1FPHH 1P02A 1RTLA 4CRDA 1SGTA 2GGVB 4ZKRU 1SGYE 1SMFE 3SU0A 2PKSB 3TNSA 2GVFA 4TPYA 2Z9IA 3P92A 5DP6A 4OS5A 4KP0A 4NFFA 1ETRH 3ZYEA 5GCHG 1A61H 3D65E 1O3KA 1C2MA 1HAPH 1A2CH 1QURH 2I6SA 1PPEE 1PQAA 2QXGA 4A1XA 4UFEH 3UNQA 3EYDA 2ZPRA 1DY9A 1N6YA 1O31A 1Y3VA 4Z0KA 2ZDAH 5T6FA 1CGHA 1S83A 6CHAC 1ARBA 5EODA 1GBDA 2BXUH 1T8LA 3MH4A 4HTCH 4LK4A 1ZJKA 4Y7AA 2FS9A 3PO1B 3RMNH 1UTLM 2WV4A 1LPZB 1QQ4A 3OU0A 1EZQA 3RXLA 1QRXA 4RKJB 1P03A 3AAVA 2XTTB 2VIPA 1C5XB 2ZQ1A 4LXBH 2BD8A 2V6NA 5FHTA 3UQOA 1G37A 1C2DA 2ILNA 2CXVA 4K3JA 3ZVEA 1TRMA 4K8BA 4CR5A 1TGNA 3FVFB 5HXFA 3OTJE 2FS8A 3QX5H 2STAE 3F6UH 4Q7ZA 1LHGH 1FIWA 2FOAA 2Z94A 3OYPA 3GISB 3UR6A 4BXSA 2EC9H 1SGDE 2WUCA 3A80A 3GY3A 4UFGH 3RP2A 1BBRK 5TCCA 2W3IA 3Q3KA 2TGTA 1AD8H 5EQSA 4I7YH 4ZKOU 1EAXA 4ISLA 5AVDA 2D8WA 3SU1A 4FU7A 1GI1A 4B73A 1GJBB 2QIQA 1SG8B 5AFZH 5C1XA 1MKXH 1FXYA 2BY6X 2ULLA 4AFZA 4MPWA 2OTVA 1C5LH 1K28D 3GY5A 4CR9A 1L1JA 1GBTA 2FI5E 2G81E 4IC6A 4MG3A 4Q80A 1SVPA 1GVZA 3RXSA 2Z9KA 1BMAA 1GMDF 1DS2E 1TNKA 1IQMA 2BVSH 3SNEA 2RDLA 3MH5A 1E0FD 5LGOA 1IQIA 3IWMA 1PPHE 2GCTB 1QRZA 3BEFB 3TJVA 1V2KT 1HJAC 1Z71A 1YYY1 3TJUA 1C1UH 3A86A 4X1SU 4OGYA 4DJZB 3ENSB 1IQGA 1ARCA 2BY7X 1Y3UA 2ZGJA 4IN1A 4XDEA 1ELBA 1IQEA 2ZFRH 5G4BA 3MWIU 2FWWA 1DWCH 3F68H 2ANWA 4YESB 1CBWB 4JYUH 1CO7E 4O03A 1EP6A 2OLGA 1V2WT 1PQ7A 1U6QA 3SU2A 4FUFA 1XUKA 2HPQH 1A0LA 2Q1JA 3DUXH 1NTPA 2ALPA 2TRMA 1TQ0B 1C1MA 1O3GA 1P2QA 2P8OC 2VIQA 1UJ1A 1V2OT 2F9PA 2RA0A 1UVOA 3JZ1B 1AQ7A 8GCHF 1AHTH 4H6TA 1ABJH 3TJNA 4AYVB 4JYTA 1HAVB 4AFSA 3RXEA 1AFQB 2ZFTA 2VVUA 1GGDC 1O3BA 3LC3A 1XMNB 2BD5A 4HZHA 5FPYA 1G2LA 3HKJB 5C20A 2Z3EA 2A7JA 2ODQA 4X2XA 5DKMA 1EUFA 1H8DH 1DLEA 2QY0B 2B7DH 3M5MA 1YP9A 1YGCH 2WPJS 5EGMA 4ABEA 1YPMH 2O8LA 1KXEA 2GD4B 2ZA5A 3FAOA 1QBOA 2PKAA 4KGAA 4IBLH 4MTBA 1L1NA 4AB8A 1E36B 1KLTA 2EA3A 2Z3CA 1W2KH 3SUDA 1A5IA 1GI5A 4AFQA 2EI6A 2NU4E 1GBEA 1J9CH 2SGQE 4YLUA 2GMTB 2PSXA 2UUYA 3AW0A 2FYRA 2O8UA 1LVBA 2ANKH 5DK1A 2BD2A 4CHAB 1YF4A 4JZ1A 2BTCE 4ISNA 1EOJA 1K1JA 2PWXA 2BVRH 2KAIA 4MPXA 3RXCA 1TIOA 1SOZA 3DT0H 4A92A 4Y76A 1ZHPA 4FU9A 1TLDA 2NWNA 1LHFH 5JPMH 2G5NA 4GHTA 1S0RA 2GDEH 4MDSA 1G30B 1DITH 1H1BA 3MOCA 1C1QA 1VZQH 3VB7A 4BANB 4TWYA 3KIDU 3TNTA 2EEKA 1GHAG 3KQDA 1DM4B 3QDZB 2A4GA 4WY3A 3SUGA 1W8BH 2BYAX 4B2AA 3F9GA 1MCTA 1ZMJA 3UWJH 1DWDH 1P06A 1OXGA 1KXDA 5FX5A 5E8EH 2J9NA 3P8GA 2RA3A 1EB1H 4LOYH 3RUOA 1TFXA 2NU1E 4BAOB 3EA9A 1SLVB 3VGCC 1O38A 1HRTH 1P12E 3MU8A 3T27A 4I32A 3SGBE 2AGEX 1DFPA 2CGAA 1GJDB 1FZZA 1QB6A 2ZO3H 1O5AB 2ZQ2A 3PMHB 2ZHWH 1SGPE 3QTOH 4NCYA 1O2LA 1C5OH 3CS0A 7GCHG 3PWBA 4BTUB 1C1PA 1BUIA 2RCEA 2JETB