3BTWE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btwE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btwE02
1C4Y2 5T3HA 2ZTZA 5JYIA 2CN0H 1P9SA 1QGFA 3TK5A 1K22H 2HNTE 1LHDH 1P11E 1C1TA 4E05H 1ETRH 2XC4A 4X2WA 2ZFQH 4JK5A 4MQAA 4Y0ZE 1FY1A 1CGJE 2ZCKP 5BRRE 1EB1H 2HPPH 2JETB 1RD3B 4Y10E 4NIXA 1BTUA 2A2QH 2GMTB 1ZRBA 4AORA 1SB1H 1HJAB 2Z7FE 1GMHF 2V3OH 2ANWA 3BN9A 1E34B 1DT2A 3DHKH 4A5TS 1XUIA 2PKAA 4ISLA 2PTNA 1DITH 3MOCA 1MU8B 5A0AE 2HNTF 4OS7A 3ENSB 4J1YA 2J95A 5A2MH 1CGIE 1XUHA 4UONA 2BD2A 5JB9S 1WQSA 3RU4E 4CH8B 3LKWA 1MKXK 1IQEA 2RA0A 1CGHA 3GCHB 1YPKH 4ISNA 3F6UH 3AAUA 3PROA 2ZU4A 1V2UT 1ELAA 1A3EH 4WMDA 3MHWU 4YTAA 1NFYA 3EDXB 2ZQ2A 1C2DA 2VIWA 2GZ8A 2FLBH 2G52A 1BT7A 4A7IB 1FY4A 1PFXC 1C5OH 1AU8A 2H9TH 2NU0E 5EXLA 3OSYA 1O2ZA 3OTJE 1TPAE 3AASA 1AO5A 1K2I1 1TNLA 3O8CA 1TBRH 3SUGA 1O3CA 4AN7A 2FTLE 4DW2U 4JYTA 1DE7H 5GXPA 1HAVB 1BTWA 1WTHD 4GAWA 1GMHG 5FAHA 3M35A 1Z8JB 2HNTC 1C2JA 3UWIA 3GY3A 5DG6A 1TRNA 4OS5A 1Z8GA 2Z3CA 1QL9A 4NA8A 3URCA 5C5NA 2ZFPH 2KAIA 2NU1E 3RM0H 3VGCB 2BTCE 1TIOA 2YNAA 4YOIA 3M5OA 3C27B 1MTWA 2VIVA 4NCYA 4XE4A 4X6NA 3QO6A 2PGQB 1T31A 1AZ8A 4E06H 3F1SB 1XM1A 3LH3A 3RU4T 1G3DA 1C5MD 1M9UA 1GBDA 1N6XA 2J4IA 2O9QA 1ZSJA 2ZO3H 1PPBH 1EJAA 1QRWA 3GCNA 1O2VA 1Q31A 4AFZA 4ISHH 4WH6A 1MUEB 4A1VA 5F8ZA 3STIA 2ZDNA 1TPPA 2B8OH 4FUDA 4JYVH 1SG8B 3GCTF 4ZXXH 1L4DA 1A5HA 3BG4C 4KTCA 2Y5FA 4U2WA 3RU4D 4YLUA 2VVUA 1V2KT 1B0EA 4X8SH 1ELGA 1RTFB 4BNRA 3SGAE 4BAQB 2R3UA 3ZV9A 1C2FA 3LGUA 8KME2 5C5OA 2OC7A 2C8XB 5GJ4B 3SV7A 1O5BB 4NA7A 1AGJA 1K9OE 3GY2A 1MZAA 5DP4A 3SHCH 2VWNA 3HK3B 1GG6B 3M37A 1GCTC 1E0FD 4O03A 1V2RT 1GI1A 1CBWC 1TE0A 3P6ZB 4GSOA 3U98H 1Z1JA 1TALA 3KL6A 3QTVH 3M5NA 2VVVA 1ZPZA 1O3EA 4VGCC 6LPRA 2BZAA 1O3BA 3DA9B 1OWDA 1KXDA 1RTLA 1S5SA 3RXRA 3TIUA 1AHTH 4UFDH 4FVDA 4GCHF 2FTMA 1P2IA 1GMCG 1LVBA 3SJKA 3ZZ3A 1XKBC 4TYDA 1UVOA 2Y7ZA 1BOQA 4Q7ZA 5JBBS 1P2MA 1TGTA 2F3CE 2LNCA 3TNTA 2DE9A 4KP0A 1HPGA 4B2CA 2ZECA 1GI2A 3F68H 1K28D 3KGPA 3SQHE 1OS8A 2CMYA 1LCYA 1V6DA 2GMTC 1F5KU 1HJAC 1AMHA 3V0XA 4ABDA 3RXTA 1YCPM 3RP2A 2DE8A 4FXGH 3Q76A 4I31A 1OOKB 4XBBA 1TQ7B 2ODPA 2J2UA 1PPHE 4ZKOU 1O2NA 5GCHG 5LPEA 2BZ6H 2Y6TA 1TWXB 1YYY1 3SU5A 1O2KA 1P01A 1W7GH 4FUEA 2SFAA 3NZIA 2Z94A 3FVFB 1O2YA 5ESBA 3VB5A 2BXTH 2XRCA 2BDIA 1OWIA 3QUMP 2A4RA 1DOJA 2P8OB 4D8NA 9ESTA 2FPZA 4K69A 1ZSKA 3A7WA 3A8DA 3GDVA 1ACBE 1G2MA 3MNCA 1PPZA 2GT7A 4K1EA 1IQJA 1V2MT 4YO9A 3OY5U 5A0CA 3B9FH 4X0WU 1ANEA 1O5AB 5EXMA 3V12A 1EP6A 2ZDKA 3QZQA 3MI4A 1P2JA 2Z3DA 4MPVA 3TH3H 1GI4A 1JRTA 2OD3B 3NWUA 3DD2H 1ELCA 4X8VH 4D7GA 3B23B 1GBIA 4Q7YA 1G32B 1O2JA 5DGJA 1O39A 2FM2A 3KEEA 1V2WT 2ANMH 1B7XB 2H9EH 3QDZB 4IN1A 4M7GA 3FP8E 1WBGB 1MTVA 1YP9A 2XBWA 4LXBH 1H9IE 1Z71A 4THNH 3UY9A 2PKSB 2QYIA 1B5GH 4WWYA 1QFKH 2BM2A 1QTFA 4NFEA 2FWWA 1O34A 5EGMA 3RXFA 4MTBA 4AX9H 3ATLA 2FS9A 1S0QA 2WINI 3TK9A 1O3LA 1UMAH 1TX7A 3BV9B 4I7YH 3KCGH 2B9LA 5C20A 1TPOA 2G5NA 2JKHA 2VH0A 1GJ4H 1BMNH 1C1VH 4GLYA 2G81E 3H7TA 2FOMB 3A87A 1XKAC 3ZVAA 1MU6B 4DGJA 5DP5A 5F8TA 4ZROA 4B75A 2BY5X 1GHVH 1ZMLA 3EGKH 4DIHH 1GDUA 1Y5AT 2ALPA 2PW8H 3SU2A 4CHAB 3SN8A 2SGEE 3PLBA 3FAOA 1KXCA 2J92A 1BJUA 1ESAA 2WPMS 1QL7A 8GCHF 1EJMA 2G8TA 4MPUA 3ZZ5A 1EOJA 1SGNE 1O3OA 1A5GH 3FANA 3BTFE 4HGCA 1IQGA 1LKAA 2ANYA 4BTTB 2LPRA 4CR5A 5J4QA 2H9HA 1EAUA 1FV9A 1QJ1B 2F9UA 3E91A 1TNIA 2TGAA 3G01A 1L1NA 2O8WA 2FLRH 2GCTB 1GL0E 2OLGA 2UUJB 4U32A 2ODQA 1C9PA 4NA9H 5E2OA 2C8ZB 1C1OA 4X6MA 1ELBA 1A5IA 1QY6A 1GHBF 1IQKA 1G3CA 2GGVB 3ZZ9A 2QCYA 1AFQB 4RKOB 1O3FA 3SI4H 1DXPA 1HB0B 1HV7A 3M7UA 4ZKSU 2ZFTA 3P8NA 1AVGH 1O2GH 3HK6B 3A84A 4CBOA 1C5SA 1P2QA 1C5PA 4H6SB 4O97A 3ZZ7A 4OS1A 2F91A 1PQAA 2F9OA 1P2KA 1NC6A 1S85A 4WMEA 5A0BA 1YLCA 1BITA 1F0RA 2R2MB 3TJNA 4XBDA 1LKBA 1DFPA 1ANCA 5FCKA 3BTME 1JOUB 2SNVA 1KY9A 2PLXA 2C3SA 4UE7H 1OKXA 3LDXH 1A3BH 5C1XA 3A8AA 1AI8H 3VB4A 1ZOMA 1ANBA 3K65B 1SGRE 2YNBA 1FAKH 4ISIH 3LJJA 2O8LA 2XXLA 1P04A 5ESTE 1SGCA 4ZH8A 1HXEH 3MU4A 3MNXA 1DS2E 1GHBG 2BDAA 2P8OC 1GBAA 2NU4E 3SV2H 3HATH 4I8LA 1NRQH 1E36B 5EOKA 2GCHF 1QCPA 2VGCB 1L1GA 1EX3A 2H2ZA 2BD8A 2PHBA 4ISOA 4MNXA 3PLPA 2XYAA 4SGBE 3OU0A 3PYHA 1DUAA 1GI9B 1UJ1A 5A8YA 4CRDA 2GD4B 2XC0A 1P12E 3QTOH 3UWJH 3VFEA 3SU6A 1LMWB 5JDUB 3BTGE 3ZZ8A 3U8TH 2C93B 1O5DH 1DY8A 4H4FA 4INLA 4I8KA 4TWWA 3RC6A 3T28A 3ZVBA 3P8FA 1P2NA 2BQWB 1HRTH 1BTZA 3T27A 3ZVCA 4MVNA 1SI5H 1Y59T 4Z0KA 4NWKA 2G00A 2ZG0H 3LGTA 1C1PA 5EW1H 2ZU3A 5TCAA 1TA2A 1OX1A 4LZ4B 2WUCA 5L30H 1BRUP 5AVDA 2CXVA 3TU7H 4FU8A 1TBQH 3GY4A 2P59A 2PKSC 2BHGA 1CU1A 1FI8A 1O2PA 1LDTT 3S9BA 5JBTA 8LPRA 4Q2KA 4ABFA 1OYQA 1SPJA 2PKAB 2K1QA 4NFFA 1IQIA 1EPTA 2WPJS 2AIPA 1YBWA 4IC6A 2FOBA 1FN6A 1OP2A 1GMDG 4NIVA 2V35A 3LU9B 2R3YA 3U1JB 1XVMA 1O32A 1HLTH 3BIUH 1Y3UA 1TNKA 1P9UA 1BTPA 1V2ST 4FUBA 1EATA 1KTSB 1WTGH 2ZWLH 1HJ8A 4LK4A 1T8MA 1K1IA 4RSPA 4CHAC 4K8BA 2HALA 4NIWA 1C2IA 1GI7B 1TRMA 4DVAU 1ZYOA 3PWCA 4AZ2B 4ZHAA 1TQ0B 2JH0D 2FXRA 1J17T 1NPMA 2A7CA 1L2EA 1VITG 1F5LA 1LQDB 1EZSC 1O37A 2CHAC 2AS9A 2Y80A 3PMBB 1GBKA 5E0JA 4ABHA 4Y8XA 1BIOA 1HAPH 3ELAH 1YCPK 1Q3XA 3RXQA 4Y8YA 4BAKB 3BTDE 1A61H 1GHYH 3TK6A 3RXBA 2V3HH 4JZEH 1BBRE 3SOSA 5JPMH 1X7AC 1P0SH 1MD8A 3MYWA 3UR6A 2D1JA 2R9PA 1W10U 3PMHB 4CRAA 1TMTH 3CS7A 3ATIA 1AB9C 1JBUH 4JMYA 1AFQC 3GOVB 1ZGIA 3FZZA 1L1JA 1DM4B 2VB0A 3QX5H 1MD7A 3BG8A 1NRSH 1SGTA 2UUYA 3VPKA 3L33A 1H8DH 4KTSA 1OWKA 1V2LT 1Y3VA 2ZFSA 1MTNB 3SZNA 3RXEA 3TPIZ 3NXPA 2EC9H 1W14U 3EAJA 1IQFA 1N8OB 3SNBA 1DLKB 1DSUA 4ESTE 1S6FA 1IQHA 2EI7A 2VIQA 1B0FA 1NY22 4WMFA 5CE1A 2AMQA 3LC3A 1GBJA 3FZDA 4GHTA 1Y8TA 3LJOA 2V6NA 3MO3A 4FU7A 1Y3YA 1C5RA 1OWHA 5J4SA 3E16B 4KELA 1QL8A 3GY8A 1MCTA 1C5NH 5HXFA 1QNJA 4ZMAH 5E0GA 3T26A 2PR3A 1GBCA 1Z6EA 4MNYA 3V3MA 5G4BA 4DURA 4K1TA 2RCEA 3KQCA 1O3NA 1V2NT 1SHYA 1BDAA 1VJ9U 1VCPA 4BTIB 1DWEH 1ID5H 2OC8A 1V2QT 5GIBA 2CF8H 2HWLB 4ZUHA 3T62A 4CBNA 4MG3A 5A8XA 3I78A 1BTYA 3PV4A 1HFDA 4B1TA 1TB6H 1T8NA 1HAIH 1TX6A 5FPYA 6GCHG 3F9HA 4FUHA 2ZHEH 3RDZA 3ZZBA 4H42U 1P10A 2XWAA 3MH5A 1NROH 1GBEA 2VH6A 1BBRK 2QXIA 3SNEA 3ESTA 1GI3A 1ELDE 3URDA 5F03A 1G37A 1XUJA 2ODYB 2WPLS 4INKA 2GP9B 1BTHH 5EQQA 1FIWA 1GI0A 1P05A 1W0ZU 2ZHQH 4WVPE 4B71A 1P3EA 1HCGA 2VIOA 4UDWH 5EQSA 2BVSH 3MU5A 2H5DA 2P16A 1HAGE 2ZFFH 1BMLA 1F92A 3L6PA 3RC5A 2ZIQH 1BTXA 2Y5GA 2XBXA 3ATMA 3ATKA 3SNDA 3EA7A 3NCLA 1LPKB 1ETSH 1GHAG 2PUXB 2VU8E 1S84A 2ZPRA 1T4VH 1TABE 5ETXA 3SJ9A 4NSYA 1H9HE 3LPRA 2ZGBH 2QXGA 4XDEA 3GDSA 4WJG2 3KF2A 1CT0E 2CJIA 1GMCF 1H9LB 2HVXA 2PTCE 3VXEH 3SHAH 2H5CA 3QK1A 1G36A 1SGQE 3CENA 4JK6A 3EYDA 2WV4A 2W3KA 2QF0A 1O5EH 1O2HA 2A0QB 4K3JA 2BXUH 2FIRH 4DCDA 1HIAA 1XXFA 1GJCB 1MBQA 1MZDA 3MH6A 1V2PT 1AKSA 3QLPH 3M3VA 3R0FA 1GBFA 5GWZA 3ZVEA 3RMLH 2OBOA 2P3UB 3P70B 4FUGA 4LZ1H 1P09A 1O5FH 1LHEH 3KIDU 1UTLM 4Y11E 5GCHF 4YT7H 1ZLRA 1GL1A 7ESTE 2FODA 2SGDE 4FUJA 3VB3A 4YM9A 5FX5A 4Q7XA 1K1MA 3U1IB 1SGFA 2B7DH 1MMJN 2EI8A 3EE0B 3RXPA 2F83A 1P06A 1C2LA 1FMGA 2HRVA 2BDBA 3KQEA 3T2NA 4AGKA 2ALVA 1MKWK 5LPFA 5IYTA 5JBCS 1BRBE 4B74A 1Z1IA 1MTNC 1FXYA 1VZQH 1FQ3A 3ZYEA 1QB1A 2BB4A 1ZTKA 5L2ZH 1GJ9B 3BEFB 1LTOA 1O2IA 1AQ7A 2B0FA 2BY6X 2ZPQA 4MDSA 1DUEA 1N8OC 1BZXE 4Y79A 1FY5A 1P2OA 1GBLA 2AGGX 1FLEE 2P94A 2JETC 2ZEBA 1TMUH 1IQLA 3RXLA 1JXPA 2XNIA 5HMAA 1D9IA 1ELEE 1P57B 2GKVE 3LIWA 5FHTA 2FI4E 1VGCB 4FVBA 1W11U 3GCOA 4IGDA 5E8EH 5DP9A 5DPAA 2FOEA 1UVPA 3A7YA 3HKIB 3RXUA 1DWDH 1CT2E 1LPZB 2ILNA 4ZHLU 4O3UA 1YGCH 2ZU1A 3LGIA 1QA0A 3SQEE 1AWFH 2EA3A 1XUFA 4GUXA 5JB8S 1FUJA 1KIGH 3LOXA 2QV1A 3VEQB 3GCHC 2JH5D 3GY7A 3SW2B 2NU3E 2NU2E 1C2EA 3ITIA 3PMJA 4AOQA 4IMZA 1BCUH 1ESTA 3PB1E 2DUCA 4XFQA 3TJVA 2WPIS 3SJIA 1ABIH 1TGNA 1DANH 1NO9H 2ZCHP 4Y7BA 1GI5A 1SLUB 1BHXB 1EAIA 2IPHA 4D9RA 2OQ5A 2A5KA 2AEIH 1ZSLA 4UFFH 1QR3E 1CA8B 1GVKB 4X1SU 1F0TA 3QGJA 2FDAA 1C5VA 1BB0B 1O2LA 2ZDLA 2AYWA 1KLJH 1O0DH 4BOHA 1L4ZA 1GDQA 1FZZA 1T8LA 2CF9H 2BY7X 4K5ZA 3V7TA 1GDNA 3SV6A 1F0SA 1S81A 3AVZA 3S7KB 1SQTA 1NFUA 2AGEX 3ZZ4A 2ESTE 1T4UH 5EPYA 3O8DA 3SU4A 3VGCC 2H1UA 3BIVH 1WUNH 1HAXB 3SNCA 2A7HA 2SGPE 1RJXB 3TJOA 2XCFA 1OSSA 1A0JA 4KKDA 3RXIA 2O8MA 2OBQA 1HDTH 1Y5BT 3F9EA 3K9XB 1O5CB 3HKJB 2BMGB 3ZV8A 5BPEA 5EG4A 1K1PA 1AE8H 3ZZ6A 1YPGH 4AB8A 2F9PA 3C1KA 4O3TA 3RM2H 1D6WA 1H4WA 2BOHB 3BSQA 3NKKA 3PLKA 3WY8A 4AFUA 4CRFA 3M5LA 3PTNA 5L2YH 3Q00A 5JBAS 2FESH 1KSNA 5DJ7A 4MNVA 3BTTE 4YLQH 3CS0A 4YOGA 2Z9JA 2PFEA 4RKJB 3SUDA 2R0LA 1W13U 2AERH 1Z6JH 5FXLA 1DVAH 1O31A 5HM2A 2ZP0H 3AAVA 3P95A 2WPKS 4INHA 4YESB 2VVCA 3BF6H 1UTOA 4K2YA 4FUCA 3T5FH 4CRGA 1AE5A 1GG6C 2BD9A 2G5VA 1QA7A 1JWTA 1ORFA 1SGDE 3UOUA 1DDJA 3M5MA 2BDGA 1E37B 2PV9B 1SGYE 1SQOA 2SGQE 1G9IE 1GJ8B 1EPTB 5E0HA 1C2KA 2GV7A 3QWCH 2F9VA 2BYAX 1O3JA 2W5EA 1EAWA 1CT4E 1QIXB 5FBEA 1MBMA 2GX4A 5LPRA 1QJ6B 1O2UA 2YOLA 2ZPSA 4NSVA 2A4GA 1BHXF 5EPNA 1SBWA 2FOAA 1D3QB 1W2KH 1T32A 1NRPH 3S9CA 3GDUA 1QB9A 3GY6A 1T7CA 3KQBA 1TOMH 1ZHMA 4JZDH 1INCA 1DSTA 1AD8H 1CHOG 4I33A 4PROA 4AG1A 2W7SA 1IHSH 1ZHPA 2VJ1A 1TNGA 3QGNB 2BY8X 3MO9A 3ZZAA 1Y5UT 1QURH 5C67A 1D3TB 4BAOB 4GVUA 2XW9A 4DT7B 1UVUH 2W7UA 3A7ZA 4HZHA 1JIRA 1FNIA 2ZHDA 3DUXH 3UQVA 2IJOB 2ZU2A 1HNEE 4JZ1A 4JZIA 1GJ6A 1C1QA 2PWXA 3RMMH 3FP6E 1GHWH 2BVRH 3PMAB 1O3HA 3SU0A 4YOJA 1AN1E 1GMDF 4Y7AA 1IQNA 1U6QA 3MWIU 1Z7KA 2A31A 1CSOE 1K21H 4TWYA 1NESE 1TYNA 1EZUC 3IG6B 2BLQA 5T6FA 1C2MA 1T8OA 1GBBA 1TA6A 2FYRA 3E8LA 1DICA 3UPEA 2A5IA 1C4V2 2QN5T 3U8OH 1KXFA 1PPGE 1NM6A 2HGTH 3BTWE 3BTHE 3OY6U 1TX8A 1GBHA 2J38A 1FDPA 2Y81A 2VIPA 4X1NU 1V2OT 3RMNH 2O8TA 1CVWH 1RS0A 1SL3A 2GV6A 1VITF 1YPEH 2ZNKH 3ZYDA 1LPGB 1YPJH 2ZHFH 4TY7A 1GBMA 3FFGA 2ZDMA 3ZVFA 1LHCH 2OTVA 1ZZZA 5IDKA 5T6GA 1V2JT 2WV5A 1BRCE 3E0NB 3UR9A 1D6RA 3DFLA 4MPWA 1YCPH 1C5UA 1O3PB 1VJAU 1UCYE 4FU9A 1SVPA 3NK8A 2XCNA 1SGEE 1GVLA 4AYVB 1SR5C 1NFXA 1AIXH 1EAXA 1UVTH 3RXHA 3PTBA 1AUJA 1UK3A 4JYUH 2AIQA 2FMJA 2XTTB 7GCHG 1V2VT 3RXAA 1ZMNA 2OUAA 1TRYA 1O33A 5C1UA 5AFZH 4CR9A 5K0HA 1J14A 1MAXA 1PPFE 4BXSA 4AB9A 1TBZH 2BDCA 4JZFH 3D49H 4DY7B 3SO3A 2GDDA 3S9AA 4BANB 1HAYB 2C4FH 3ZZDA 1GVZA 1DY9A 3A7VA 2FS8A 1N1LA 1SQAA 2F9BH 4ABGA 4NZLA 2GT8A 1SLXB 5C2ZA 1RIWB 1QBVH 1G2LA 4I32A 1PPEE 1S83A 3RXMA 1BA8B 1ZPCA 4OGYA 4A92A 3ZVGA 1UTQA 3SV8A 4ABBA 5F8XA 1UVSH 1W0YH 3UREA 5H4IB 3SI3H 2GCTC 1EOLA 1O2OA 1NTPA 2Q6DA 2KAIB 1QBOA 5I46H 3LGYA 4X8TH 3RUOA 1EPTC 4CREA 1MKXH 2ZGCA 1D3PB 2BDHA 1C5WB 3GISB 2VIDA 3R3GB 1QB6A 1RFNA 1A46H 2O8UA 5EU8A 3H5CB 2FP7B 5SGAE 3KN2A 2ZQ1A 4K8YA 1Q2WA 1YLDA 2A7JA 1MTSA 2ASUB 2JH6D 4QT8C 3F9GA 5B6OA 3VB6A 5K7RA 3CP7A 3RXKA 1CBWB 6GCHF 3AW1A 1FPCH 5TCCA 2Y5HA 1KDQA 5PTPA 3PO1B 1ELFA 1CE5A 1PYTD 4BAHB 3LGWA 4UFEH 3A89A 1PPCE 4CRBA 2THFB 3S7HB 1SFIA 1UCYK 2UUFB 1C4U2 4UD9H 4A6LA 5HM9A 1K1LA 3RXDA 3UNSA 3D65E 3LC5A 1BBRH 2XWBI 4AG2A 2RG3A 9LPRA 1HAZB 1HIAB 4HI3A 2Y82A 4IBLH 4TY6A 6ESTA 3T29A 1AKSB 3STJA 4X1PU 3TH4H 2TGTA 5F6MA 2Z9GA 2G51A 1GJAB 1GHXH 2ZGXH 3IWMA 3TVJB 1O38A 2ZFRH 1UTJA 3GY5A 4ZKNU 3OYPA 4Y0YE 1SOZA 2VGCC 2TGPZ 4WF8A 5LH8A 1H1BA 1OP0A 1UHBA 1GHAF 2FI5E 4X2YA 1GJBB 1EXFA 1J16A 1XUKA 3MU0A 3SUFA 1JRSA 4BXWA 1F2SE 4B76A 1FPHH 4Z6AH 1HUTH 4MNWA 3RXSA 3K2UA 1ARBA 1G3BA 5EQRA 3VXFH 1F7ZA 3ZVDA 3MFJA 1J15A 2BD7A 2PGBB 2P93A 2WYJA 1Z8IB 4UEHH 1GJDB 1NFWA 2QXJA 3MH7A 4Q80A 2ZTYA 1LO6A 1E35B 1NRRH 2HPQH 2QGRA 3LONA 1P03A 2GVFA 1AFEH 3NUMA 1NZQH 3PWBA 3P92A 3LGVA 4X2VA 1BMMH 2SNWA 4WXVA 1O5GH 4R0IA 5HYOA 3JZ2B 1A1RA 2Z9KA 4OS2A 1LHFH 3MH4A 1CA0B 2ZF0H 1XMNB 1GJ5H 1EQ9A 2TRMA 2TPIZ 3EA9A 1ETTH 5FCRA 3TGKE 2EI6A 1QJ7B 1UTNA 3A80A 3KHVA 3A7TA 2BLVA 2QF3A 4F4OC 1V3XA 5L6NH 5DP3A 4ABIA 2AMDA 2B5TB 4D76A 1VCWA 2ZZUH 1MQ5A 1HYLA 1KXAA 3N7OA 1SSXA 1YPMH 4NIYA 4X2XA 1ZJKA 1NRNH 1MAYA 2RA3A 1FIZA 4I8GA 1NU9A 1C5LH 1MKWH 3TLOA 3NPSA 1BQYA 1SHHB 4U01A 3BTKE 1TGBA 1KLIH 2A4OA 2QXHA 2ZDAH 2AH4X 4HTCH 4CH2B 2R2WU 3HPTB 3I77A 1AY6H 4K60A 1RIWC 4FUIA 1O3AA 3VB7A 1NS3A 3LH1A 2W3IA 3I29A 4WXIA 1FY8E 5I25A 2G4UA 3TGIE 2BD3A 1DX5M 1O2QA 4NG9H 6CHAB 3E90B 3K6ZA 2ANKH 3RXGA 2Z9IA 1GI6A 1TMBH 2OQUA 3E3TA 2XBYA 4FUFA 3SJOA 4XBCA 4BAMB 2Z3EA 2A4QA 3HGNA 1S0RA 1YF4A 2ZGJA 5ABWA 2OXSA 1WU1A 2Z9LA 4OS6A 1ZR0A 1WV7H 3AW0A 4WH8A 4F49A 3D23A 2OINA 1K1JA 3O8RA 4RN6A 5EXNA 3TJUA 1CHGA 1LVMA 2QIQA 5LGOA 3T25A 4DOQA 4B2BA 1CQQA 1A4WH 1J9CH 3A86A 3W94A 1V2TT 2BQ6B 2FOCA 5GDSH 2Q1JA 4TPIZ 1AUTC 3PO1C 5AHGH 2P3TB 1OYTH 1RTKA 1KXBA 2FZZA 3RXOA 1NU7B 1FJSA 1YKTA 2Q6GA 1PQ8A 1J8AA 2XC5A 1XUGA 3GCTG 3MNBA 4AYYB 1ZJDA 2XBVA 3LT3A 1C2GA 1WYKA 2GZ9A 2PSYA 1OXGA 3MO6A 1O2MA 4BTUB 1YPHE 5CMXH 1UTMA 4D9QA 1MH0A 4NGAH 1TLDA 1HAVA 4OGXA 2TBSA 5A09A 4Y6DA 1W7XH 3BEUA 3EA8A 2STBE 1AZZA 4ABJA 1EZQA 2NWNA 2A45B 1SMFE 8ESTE 3UFAA 5E2PA 5T6DA 1GGDB 5AF9H 1KXEA 1UK2A 1SGFG 4TPYA 3TGJE 3JZ1B 2SGFE 1O3IA 4U30A 4Y8ZA 4AGJA 2ZTXA 3RLYH 2UWOA 2I6SA 3SV9A 4X1RU 3A85A 1HXFH 1ZPBA 1P8VC 1XXDA 2SGAA 5A8ZA 2BD4A 2C90B 3ZZCA 1FY3A 4YZUA 3TITA 3SJ8A 1C1SA 2BDYA 1ZMJA 5CHAB 3UIRA 1WCZA 3A8BA 1EP5A 2C8WB 1BUIA 3Q3XA 1RGQA 1DWCH 2J34A 1A2CH 1O36A 1PQ7A 4GCHG 1G3EA 3U8RH 1F0UA 1SFQB 2FX6A 2I6QA 1UTPA 1WQVH 4K1SA 1TPSA 3RLWH 3ODFA 1CA0C 1ZGVA 2QC2A 3HGPA 2EEKA 4NZQA 5EW2H 2FYQA 1MQ6A 2BD5A 4DIIH 2TGDA 3PM3A 2FOHA 3U69H 1ELVA 1XVOA 1O3GA 3F9FA 1GPZA 2Z6BD 2VWMA 1GWAA 1YPHC 2STAE 1GJ7B 4E7NA 4KTUA 3MNSA 4ZHMU 1C5QA 3GYLB 3SBKA 1ABJH 1LQEA 1ARCA 5DO4H 2D2DA 1O30A 1OWEA 2OC1A 1K1NA 2VNTA 1BRAA 4LOYH 4XOJA 5FPSA 5FBIA 2BX4A 4B2AA 2ZKSA 3M7QA 2AMPA 4ZKRU 2QAAA 4IW4E 7KMEH 1LVYA 1QRZA 1D4PB 1O3KA 2ULLA 1W8BH 1ANDA 1KLTA 1RXPA 2G4TA 2HOBA 3GICB 1CHOF 1QRXA 3Q3KA 2F9NA 3UUZA 2H6MA 1E38B 3U9AH 1FONA 2AFQB 1ZTLA 4OS4A 4CRCA 3MU1A 1DWBH 2ZI2H 6CHAC 3UTUH 2W26A 3UNQA 1CO7E 1H8IH 5GPIB 1O3MA 1A0HB 3GYMA 3SU1A 4ASHA 5FPTA 1EZXC 1SGPE 3O8BA 5EODA 1IOEA 3UOPA 2QY0B 3M61U 3KQDA 1UTKA 3P8GA 1Y3WA 1IHTH 1HAOH 2BLOA 2CHAB 3DFJA 1C1RA 1TONA 1VR1H 1LHGH 1EKBB 2HLCA 1XX9A 4GPGA 2OC0A 1WSSH 2IN2A 4D7FA 3M36A 5AFYH 2BQ7B 3BTQE 2OP9A 3A81A 1P02A 1P3CA 1HGTH 1A7SA 1NT1A 4I8JA 1EJNA 4AFSA 2WPHS 4H6TA 3M3SA 1AB9B 3TH2H 1TNHA 3MMGA 4A1TA 3SGQE 1ZHRA 1F5RA 2FO9A 1QBNA 1VGCC 1ZRKA 2FEQH 4NWLA 2CGAA 1OWJA 1C5YB 3D62A 1DLEA 1GBTA 1W3CA 1FAXA 4UFGH 2R0KA 1A0LA 2VWOA 4XSKU 1C5XB 2BX3A 4ABEA 1DXWA 1THRH 3E6PH 2A32A 8GCHG 4Y71A 1BMAA 1ZTJA 2RDLA 2D26C 3M3TA 1ESBA 5DK1A 1THSH 1VCQA 2GZ7A 3P8OA 4X1QU 3P17H 3FP7E 2G55A 1TOCB 2GTBA 4J2YB 2FOFA 3RXCA 1GGDC 2BLWA 1SOTA 4JCNA 1PJPA 1N6YA 1QQUA 1EB2A 4YT6H 2WUBA 1AVXA 4GHQA 4IN2A 2PUQH 3Q77A 2ZA5A 1GCDA 1WAYB 3SU3A 1C2HA 3A7XA 1HJ9A 7GCHF 2FI3E 4IC5A 2PSXA 4R8TB 5CHAC 3RXJA 1DPOA 3QN7A 3BTEE 5DKMA 5DP7A 1JMOH 2ZC9H 1S82A 1O2TA 1THPB 1UO6A 4IS5A 3W95A 1LVOA 1C1MA 1KDQB 1FN8A 2UUKB 5C1YA 2P95A 1Z8RA 1GHZA 1MCVA 3A82A 4ZAEA 1L0ZA 1TNJA 1YC0A 2UWLA 2V0BA 3SUEA 1TGSZ 1BJVA 1AVWA 3B8JA 3UNRA 3IITA 1MTUA 1C1UH 2A2XH 1C1NA 1W12U 5HGGA 2A5AA 2ZDVH 1OPHB 3TNSA 3E0PB 1VITH 2M5TA 1RRKA 2P3FH 3RC4A 3S0NA 3SORA 4IMQA 1YM0A 1SGIB 3A8CA 1C9TA 1K1OA 2ZCLP 1Y3XA 5FX6A 4DJZB 4AFQA 3ATWA 2VWLA 2CV3A 2D8WA 1UK4A 1UHBB 3A83A 3A88A 1HAHH 5DP6A 1GI8B 1PQ5A 2ZGHA 4A1XA 1EUFA 2FOGA 3L3TA 2UWPA 2GCHG 1AWHB 4E7RG 1TGCA 3KNXA 3RXVA 1SC8U 2J9NA 5C3NA 3QZRA 1C5ZB 3MTYA 2AGIX 3BEIB 1QQ4A 4X6OA 1C1WH 2BY9X 1OP8A 3SNAA 2Q6FA 4DG4A 2VINA 1O3DA 1QHRB 3EQ0H 4SGAE 3DT0H 3M7TA 4MPXA 4X6PA 4Y76A 3ODDA 1UCYH 4O9VA 3BG4B 1IAUA 2IOTA 3RMOH 3UQOA 2Y7XA 1O2WA 3K6YA 1D3DB 2BOKA 3OX7U 1KTTB 2OCVB 1TFXA 1O2XA 3V13A 2TIOA 2BVXH 1KYNA 1TAWA 4KGAA 2A1DB 4ZXYH 4ABAA 1SLWB 2QA9E 4I8HA 4WY3A 3S69A 2GDEH 1IQMA 1NN6A 3MU8A 1EASA 2FX4A 3E1XB 4MLFB 3SGBE 5DP8A 2C8YB 1HBTH 1ELTA 2J94A 1C5TA 1PYTC 1G30B 1GCTB 1O2SA 5TJXA 4X8UH 4HFPB 1JIMA 2ZU5A 4B73A 2WYGA 1O35A 1SLVB 1YPLH 7LPRA 3H7OA 3Q3YA 1WOFA 2ZHWH 1O2RA 1S6HA 4VGCB
chains in the Genus database with same CATH superfamily
1C4Y2 5T3HA 2ZTZA 5JYIA 2CN0H 1P9SA 1QGFA 3TK5A 1K22H 2HNTE 1LHDH 1P11E 1C1TA 4E05H 1ETRH 2XC4A 2KCOA 4X2WA 2ZFQH 3FOAA 4JK5A 4MQAA 4Y0ZE 3KYFA 5FL7D 1FY1A 1CGJE 2ZCKP 5BRRE 1EB1H 2HPPH 2JETB 1RD3B 4Y10E 4NIXA 1BTUA 2A2QH 2GMTB 1ZRBA 4AORA 1SB1H 1HJAB 2Z7FE 1WXRA 1GMHF 2V3OH 2ANWA 3BN9A 1E34B 1DT2A 3DHKH 4A5TS 1XUIA 2PKAA 4XD7D 4ISLA 2PTNA 1DITH 3MOCA 1MU8B 5A0AE 2HNTF 4OS7A 3ENSB 4J1YA 2J95A 5A2MH 1CGIE 1XUHA 4UONA 2BD2A 5JB9S 1WQSA 4Q4LA 3RU4E 4CH8B 3LKWA 1MKXK 1IQEA 2RA0A 1CGHA 3GCHB 1YPKH 4ISNA 1YWUA 3F6UH 3AAUA 3KQ5A 3PROA 2ZU4A 1V2UT 1ELAA 1A3EH 4WMDA 3MHWU 4YTAA 3DSGA 1NFYA 3EDXB 2ZQ2A 1C2DA 2VIWA 2GZ8A 2FLBH 2JJ2D 2G52A 1BT7A 4A7IB 1FY4A 1PFXC 1C5OH 1AU8A 2H9TH 2NU0E 5EXLA 3OSYA 1O2ZA 3OTJE 1TPAE 3AASA 1AO5A 1K2I1 5EJLA 1TNLA 3O8CA 1TBRH 3SUGA 1O3CA 4AN7A 2FTLE 4DW2U 4JYTA 1DE7H 5GXPA 1HAVB 1BTWA 1WTHD 4GAWA 1GMHG 5FAHA 3M35A 1Z8JB 2HNTC 1C2JA 3UWIA 3GY3A 5DG6A 1TRNA 4OS5A 1Z8GA 2CK3D 1QL9A 2Z3CA 4NA8A 3URCA 2ZFPH 5C5NA 2KAIA 2NU1E 3RM0H 3VGCB 2BTCE 1TIOA 2YNAA 4YOIA 3M5OA 3C27B 1MTWA 2VIVA 4NCYA 4XE4A 4X6NA 3QO6A 2PGQB 1T31A 1AZ8A 4E06H 3F1SB 1XM1A 3LH3A 3RU4T 1G3DA 1C5MD 1M9UA 1GBDA 1N6XA 2J4IA 2O9QA 1ZSJA 2ZO3H 1PPBH 1EJAA 1QRWA 3GCNA 3VG8A 1O2VA 1Q31A 2LELA 4ISHH 4WH6A 4AFZA 1MUEB 4A1VA 5F8ZA 3STIA 2ZDNA 1TPPA 2B8OH 4FUDA 4JYVH 2KX4A 1SG8B 3GCTF 4ZXXH 1L4DA 1A5HA 3BG4C 4KTCA 2Y5FA 4U2WA 2KCYA 3RU4D 4YLUA 2VVUA 1V2KT 1B0EA 4X8SH 1ELGA 1RTFB 4BNRA 3SGAE 4BAQB 2R3UA 3ZV9A 1C2FA 3LGUA 8KME2 5C5OA 2OC7A 2C8XB 5GJ4B 3SV7A 1O5BB 4NA7A 3OE7D 3W1EA 1AGJA 1K9OE 3GY2A 1MZAA 5DP4A 3SHCH 2VWNA 3HK3B 1GG6B 3M37A 1GCTC 1E0FD 4O03A 1V2RT 1GI1A 1CBWC 1TE0A 3P6ZB 4B6EA 4GSOA 3U98H 1Z1JA 1TALA 3KL6A 3QTVH 3M5NA 2VVVA 1ZPZA 1O3EA 4VGCC 6LPRA 2BZAA 1O3BA 3DA9B 2V3MA 1OWDA 1KXDA 1RTLA 4RT1A 1S5SA 3RXRA 3TIUA 1AHTH 4UFDH 4FVDA 4GCHF 2FTMA 1P2IA 1GMCG 1LVBA 1W0KD 3SJKA 3ZZ3A 1XKBC 4TYDA 1UVOA 2Y7ZA 1BOQA 4Q7ZA 5JBBS 1P2MA 1TGTA 2F3CE 2LNCA 2K8IA 1QZ8A 3TNTA 2DE9A 4KP0A 1HPGA 4B2CA 4F48B 2ZECA 1GI2A 3F68H 1K28D 3KGPA 3SQHE 1OS8A 2CMYA 1LCYA 1H8ED 1V6DA 3FKSD 2GMTC 1F5KU 1HJAC 1AMHA 3V0XA 4ABDA 3RXTA 1YCPM 3RP2A 2DE8A 4FXGH 3Q76A 4I31A 1OOKB 4XBBA 1TQ7B 2ODPA 2J2UA 1PPHE 4ZKOU 1O2NA 5GCHG 5LPEA 2BZ6H 3PRBA 2Y6TA 1TWXB 1YYY1 3SU5A 1O2KA 1P01A 1W7GH 4FUEA 2SFAA 3NZIA 2Z94A 3FVFB 1O2YA 5ESBA 3VB5A 2BXTH 2XRCA 2BDIA 1OWIA 3QUMP 2A4RA 1DOJA 2P8OB 4D8NA 9ESTA 2FPZA 4K69A 1ZSKA 3A7WA 2J98A 3A8DA 3GDVA 1ACBE 1G2MA 3MNCA 1PPZA 1E1RD 2GT7A 4K1EA 1IQJA 1V2MT 4YO9A 3OY5U 5A0CA 3B9FH 4X0WU 1ANEA 1O5AB 5EXMA 3V12A 1EP6A 2ZDKA 3QZQA 1BMFD 1MABB 3MI4A 1P2JA 2Z3DA 4MPVA 3TH3H 1GI4A 1JRTA 2OD3B 3NWUA 3DD2H 1ELCA 4X8VH 4D7GA 3B23B 3DCLA 3WW7A 2QE7D 1GBIA 4Q7YA 1G32B 1O2JA 5DGJA 1O39A 2FM2A 3KEEA 1V2WT 2ANMH 4I86A 1B7XB 2H9EH 3QDZB 4IN1A 4M7GA 3FP8E 1NBME 1WBGB 1MTVA 2K0QA 1YP9A 2QF4A 2XBWA 4LXBH 1H9IE 1Z71A 4THNH 3UY9A 2PKSB 2QYIA 1B5GH 4WWYA 1QFKH 2BM2A 1QTFA 4NFEA 2FWWA 1O34A 5EGMA 3RXFA 4MTBA 4AX9H 3ATLA 2FS9A 1S0QA 2HVYB 2WINI 3TK9A 1O3LA 1UMAH 1TX7A 3BV9B 4I7YH 2JJ1D 3KCGH 2B9LA 3GS9A 5T1VA 1TPOA 2G5NA 2JKHA 2VH0A 5C20A 1GJ4H 1BMNH 1C1VH 4GLYA 2G81E 3SZEA 3H7TA 2FOMB 3A87A 1XKAC 3ZVAA 1MU6B 4DGJA 5DP5A 5B6LA 5F8TA 4ZROA 4B75A 2BY5X 2EQNA 1GHVH 1ZMLA 3EGKH 3F2GA 4DIHH 1GDUA 1Y5AT 2ALPA 5EJZA 2PW8H 3SU2A 4CHAB 3MQKC 3SN8A 2SGEE 3PLBA 3FAOA 1KXCA 2J92A 1BJUA 1ESAA 2WPMS 5IK2D 1QL7A 8GCHF 1EJMA 2G8TA 4MPUA 3ZZ5A 1EOJA 1SGNE 1O3OA 1A5GH 3FANA 3OEED 3BTFE 4HGCA 1IQGA 1LKAA 2ANYA 4BTTB 2LPRA 4RT0A 4CR5A 5J4QA 2H9HA 4P00A 2F4LA 1EAUA 1FV9A 1QJ1B 2F9UA 3E91A 5HKKD 1TNIA 2TGAA 3G01A 1L1NA 2O8WA 2FLRH 2GCTB 1GL0E 2OLGA 3FN8A 2UUJB 4U32A 2ODQA 1C9PA 4NA9H 5E2OA 2C8ZB 3OAAD 1C1OA 4X6MA 1ELBA 1A5IA 1QY6A 1GHBF 1IQKA 1G3CA 2GGVB 3ZZ9A 2QCYA 1AFQB 4ASUD 4RKOB 1O3FA 3SI4H 1DXPA 1HB0B 1HV7A 3M7UA 4ZKSU 1SKYE 2ZFTA 3P8NA 1AVGH 1O2GH 3HK6B 3A84A 4CBOA 1C5SA 1P2QA 3DSPA 1C5PA 4H6SB 4O97A 2PP6A 3ZZ7A 4OS1A 2F91A 1PQAA 2F9OA 1P2KA 1NC6A 1S85A 4Q63A 4WMEA 5A0BA 1YLCA 1BITA 1F0RA 2KCAA 2R2MB 3TJNA 4XBDA 1LKBA 1DFPA 1ANCA 5FCKA 3BTME 1JOUB 2SNVA 1KY9A 2PLXA 2C3SA 4UE7H 1OKXA 3LDXH 3PV2A 1A3BH 5C1XA 3A8AA 1AI8H 3VB4A 1ZOMA 1ANBA 3K65B 1SGRE 2YNBA 1FAKH 4ISIH 3LJJA 2O8LA 2XXLA 1P04A 5ESTE 1SGCA 4ZH8A 1HXEH 4XRNA 3MU4A 3MNXA 1DS2E 1GHBG 2BDAA 2P8OC 1GBAA 2NU4E 3SV2H 3PV5A 3HATH 4I8LA 1NRQH 1E36B 5EOKA 2GCHF 1QCPA 2VGCB 4TT3D 1L1GA 1EX3A 2H2ZA 2BD8A 2PHBA 4ISOA 4MNXA 3PLPA 2XYAA 4SGBE 3OU0A 3PYHA 1DUAA 1GI9B 1UJ1A 5A8YA 4CRDA 2GD4B 2XC0A 1P12E 3QTOH 3UWJH 3VFEA 3SU6A 1LMWB 1YY3A 5JDUB 3BTGE 3ZZ8A 3U8TH 2C93B 1O5DH 1DY8A 4H4FA 4INLA 4I8KA 4TWWA 3RC6A 3T28A 3ZVBA 3P8FA 1P2NA 2BQWB 1HRTH 1BTZA 3T27A 3ZVCA 4MVNA 1SI5H 1Y59T 4Z0KA 4NWKA 2G00A 2ZG0H 3LGTA 1C1PA 4FETA 5EW1H 2ZU3A 5TCAA 1TA2A 1OX1A 4LZ4B 2WUCA 5L30H 1BRUP 5AVDA 2CXVA 3TU7H 4FU8A 1TBQH 3GY4A 2P59A 1VKYA 2PKSC 2BHGA 1CU1A 1FI8A 1O2PA 1LDTT 3S9BA 5JBTA 8LPRA 4Q2KA 4ABFA 1OYQA 1SPJA 2PKAB 2K1QA 4NFFA 1IQIA 1EPTA 2WPJS 2AIPA 1YBWA 4IC6A 2FOBA 1FN6A 1OP2A 1GMDG 4NIVA 2V35A 3LU9B 2R3YA 3U1JB 3OFND 1XVMA 1O32A 1HLTH 3BIUH 1Y3UA 1TNKA 1P9UA 1BTPA 1V2ST 4FUBA 1EATA 1KTSB 1WTGH 2RDEA 2ZWLH 1HJ8A 2M2AA 4LK4A 1T8MA 1K1IA 4RSPA 4CHAC 4K8BA 2HALA 4NIWA 1C2IA 1GI7B 1TRMA 4DVAU 1ZYOA 3PWCA 4AZ2B 4ZHAA 1TQ0B 2JH0D 2FXRA 1J17T 1NPMA 2A7CA 1L2EA 1VITG 1F5LA 3EE7A 1LQDB 1EZSC 1O37A 2CHAC 2AS9A 2Y80A 3PMBB 1GBKA 5E0JA 2L6OA 4ABHA 4Y8XA 1BIOA 1HAPH 3ELAH 1YCPK 1Q3XA 3RXQA 4Y8YA 4BAKB 3BTDE 1A61H 1GHYH 3TK6A 3RXBA 2V3HH 4JZEH 1BBRE 3SOSA 5JPMH 1X7AC 1P0SH 1MD8A 3MYWA 3UR6A 3AK5A 2D1JA 3F2FA 2R9PA 1W10U 3PMHB 4CRAA 3NRLA 1TMTH 3CS7A 3ATIA 1AB9C 1JBUH 4JMYA 1AFQC 3GOVB 1ZGIA 3FZZA 1L1JA 1DM4B 2VB0A 3QX5H 1MD7A 2OK5A 3BG8A 1NRSH 1SGTA 2UUYA 1WDIA 2EY4C 3VPKA 3L33A 1H8DH 4KTSA 1OWKA 1V2LT 1Y3VA 2ZFSA 1MTNB 3SZNA 2IJD1 3RXEA 3TPIZ 3NXPA 2EC9H 1W14U 3EAJA 1IQFA 1N8OB 3SNBA 1DLKB 1DSUA 4ESTE 1S6FA 5HIZA 1IQHA 2EI7A 2VIQA 1B0FA 1NY22 4WMFA 5CE1A 2AMQA 3LC3A 1GBJA 3FZDA 4GHTA 1Y8TA 3LJOA 3UB0A 2V6NA 3MO3A 4FU7A 1Y3YA 1C5RA 1OWHA 5J4SA 3E16B 4KELA 1QL8A 3GY8A 1MCTA 1C5NH 5HXFA 1QNJA 4ZMAH 5E0GA 3T26A 2PR3A 1GBCA 1Z6EA 4MNYA 3V3MA 5G4BA 4DURA 4K1TA 1EFRD 2RCEA 3KQCA 1O3NA 1V2NT 1SHYA 1BDAA 1VJ9U 1VCPA 4BTIB 1DWEH 1ID5H 2OC8A 1V2QT 5GIBA 4F55A 2CF8H 2HWLB 4ZUHA 3T62A 4CBNA 4MG3A 5A8XA 3I78A 4TSFD 1BTYA 3PV4A 1HFDA 4B1TA 1TB6H 1T8NA 1HAIH 1TX6A 5FPYA 6GCHG 1YLNA 3F9HA 4FUHA 2ZHEH 3RDZA 3ZZBA 4H42U 1P10A 2XWAA 3MH5A 1NROH 1GBEA 2VH6A 1BBRK 2QXIA 3SNEA 3ESTA 1GI3A 1ELDE 3URDA 5F03A 1G37A 1XUJA 2ODYB 2WPLS 4INKA 2GP9B 1BTHH 5EQQA 1FIWA 1GI0A 1P05A 1W0ZU 2ZHQH 4WVPE 4B71A 1P3EA 1HCGA 2VIOA 2KR7A 4UDWH 5EQSA 2BVSH 3MU5A 2H5DA 2P16A 1HAGE 2ZFFH 1BMLA 1F92A 3L6PA 3RC5A 2ZIQH 4ACBA 1BTXA 2Y5GA 2XBXA 3ATMA 3ATKA 3SNDA 3EA7A 3NCLA 1LPKB 1W0JD 1ETSH 1GHAG 2PUXB 2VU8E 1S84A 2ZPRA 1T4VH 2KCPA 1TABE 5ETXA 3SJ9A 4NSYA 1H9HE 3LPRA 2ZGBH 2QXGA 4XDEA 2J98B 3GDSA 4WJG2 5KECA 3KF2A 1CT0E 2CJIA 1GMCF 1H9LB 2HVXA 2PTCE 3VXEH 3SHAH 2H5CA 3QK1A 1G36A 1SGQE 2AHME 3CENA 4JK6A 3EYDA 2WV4A 2W3KA 2QF0A 1O5EH 1O2HA 2A0QB 4K3JA 2BXUH 2FIRH 4DCDA 1HIAA 1XXFA 1GJCB 1MBQA 1MZDA 3MH6A 1V2PT 1AKSA 3QLPH 3M3VA 3R0FA 1GBFA 5GWZA 3ZVEA 3RMLH 2OBOA 2P3UB 3P70B 4FUGA 4LZ1H 1P09A 1O5FH 1LHEH 3KIDU 1UTLM 4Y11E 5GCHF 4YT7H 1ZLRA 1GL1A 7ESTE 2FODA 2SGDE 4FUJA 3VB3A 4YM9A 5FX5A 4Q7XA 1K1MA 3U1IB 1SGFA 2B7DH 1MMJN 2EI8A 3EE0B 3RXPA 2F83A 1P06A 1C2LA 1FMGA 2HRVA 2BDBA 3KQEA 3T2NA 4AGKA 2ALVA 1MKWK 5LPFA 5IYTA 5JBCS 1BRBE 4B74A 1Z1IA 1MTNC 1FXYA 1VZQH 1FQ3A 3ZYEA 1QB1A 2BB4A 1ZTKA 5L2ZH 1GJ9B 3BEFB 1LTOA 1O2IA 1AQ7A 2B0FA 2BY6X 2ZPQA 4MDSA 1DUEA 1N8OC 1BZXE 4Y79A 1FY5A 1P2OA 1GBLA 2AGGX 1FLEE 2P94A 2JETC 2ZEBA 1TMUH 1IQLA 3RXLA 1JXPA 2XNIA 5HMAA 1D9IA 1ELEE 1P57B 2GKVE 3LIWA 5FHTA 2FI4E 1VGCB 4FVBA 1W11U 3GCOA 4IGDA 5E8EH 5DP9A 5DPAA 2FOEA 1UVPA 3A7YA 3HKIB 3RXUA 1DWDH 1CT2E 5F53A 1LPZB 2ILNA 4ZHLU 4O3UA 1YGCH 2ZU1A 3LGIA 1QA0A 3SQEE 1AWFH 2EA3A 1XUFA 4GUXA 5JB8S 1FUJA 1KIGH 3LOXA 2QV1A 3VEQB 3GCHC 2JH5D 3GY7A 3SW2B 2NU3E 2NU2E 1C2EA 3ITIA 3PMJA 4AOQA 4IMZA 1BCUH 5CDFE 1ESTA 3PB1E 2DUCA 4XFQA 3TJVA 2WPIS 3SJIA 1ABIH 1TGNA 1DANH 1NO9H 2ZCHP 4Y7BA 1GI5A 1SLUB 1BHXB 1EAIA 2IPHA 4D9RA 2YMSB 2A5KA 2OQ5A 2AEIH 1ZSLA 4UFFH 1QR3E 1CA8B 1GVKB 4X1SU 1F0TA 3QGJA 2FDAA 3WWBA 1C5VA 1BB0B 1O2LA 2ZDLA 2AYWA 1KLJH 1O0DH 4BOHA 1L4ZA 1GDQA 1FZZA 4HG6A 1T8LA 2CF9H 2BY7X 4K5ZA 3V7TA 1GDNA 3SV6A 1F0SA 1S81A 3AVZA 3S7KB 1SQTA 1NFUA 2AGEX 3ZZ4A 2ESTE 1T4UH 5EPYA 3O8DA 3SU4A 3VGCC 2H1UA 3BIVH 1WUNH 1HAXB 3SNCA 2A7HA 2SGPE 1RJXB 3TJOA 2XCFA 1OSSA 1A0JA 4KKDA 3RXIA 2O8MA 2OBQA 1HDTH 1Y5BT 3F9EA 3K9XB 1O5CB 3HKJB 2BMGB 3ZV8A 5BPEA 5EG4A 1K1PA 1AE8H 3ZZ6A 1YPGH 4AB8A 2F9PA 3C1KA 4O3TA 3RM2H 1D6WA 1H4WA 2BOHB 3BSQA 3NKKA 3PLKA 3WY8A 4AFUA 4CRFA 3M5LA 3PTNA 5L2YH 3Q00A 5JBAS 2FESH 1KSNA 5DJ7A 4MNVA 3BTTE 4YLQH 3CS0A 4YOGA 2Z9JA 4YXWD 2PFEA 4RKJB 3SUDA 2R0LA 1E1QD 1W13U 2AERH 1Z6JH 5FXLA 1DVAH 1O31A 5HM2A 2ZP0H 3AAVA 3P95A 4Z1MD 2WPKS 4INHA 5DN6D 4YESB 2VVCA 3BF6H 1UTOA 4K2YA 4FUCA 3T5FH 4CRGA 1AE5A 1GG6C 2BD9A 2F43B 2G5VA 1QA7A 1JWTA 1ORFA 1SGDE 3UOUA 1DDJA 3M5MA 2BDGA 1E37B 2PV9B 1SGYE 1SQOA 2SGQE 1G9IE 1GJ8B 1EPTB 5E0HA 1C2KA 2GV7A 3QWCH 2F9VA 1KMHB 2BYAX 1O3JA 2W5EA 1EAWA 1CT4E 1QIXB 5FBEA 1MBMA 2GX4A 5LPRA 1QJ6B 1O2UA 2YOLA 2ZPSA 4NSVA 2A4GA 1BHXF 2W6JD 5EPNA 1SBWA 2FOAA 1D3QB 1W2KH 1T32A 1NRPH 3S9CA 2J5UA 3GDUA 1QB9A 5EJ1A 3GY6A 1T7CA 3KQBA 1TOMH 1OHHD 1ZHMA 4JZDH 1INCA 1DSTA 1AD8H 1CHOG 4I33A 4PROA 4AG1A 5C17A 2W7SA 2XOKD 1IHSH 1ZHPA 2VJ1A 1TNGA 3QGNB 2BY8X 3MO9A 3ZZAA 1Y5UT 1QURH 5C67A 1D3TB 3F0PA 4ACAA 4BAOB 4GVUA 2XW9A 4DT7B 1UVUH 2W7UA 3OEHD 3A7ZA 4HZHA 1JIRA 1FNIA 2ZHDA 3DUXH 3UQVA 2IJOB 2ZU2A 1HNEE 4JZ1A 3F0OA 4JZIA 1GJ6A 1C1QA 2PWXA 3RMMH 3FP6E 2JIZD 2V7QD 1GHWH 2BVRH 3PMAB 1O3HA 3SU0A 4YOJA 1AN1E 1GMDF 4RI0A 4Y7AA 1IQNA 1U6QA 3MWIU 1Z7KA 2A31A 1CSOE 1K21H 4TWYA 1NESE 1TYNA 1EZUC 3IG6B 2BLQA 5T6FA 1C2MA 1T8OA 1GBBA 1TA6A 2YMSC 2FYRA 3E8LA 1DICA 3UPEA 2A5IA 1C4V2 2QN5T 3U8OH 1KXFA 2IPQX 4AC9A 3N7DA 1PPGE 2YMSD 1NM6A 2HGTH 3BTWE 3BTHE 3OY6U 1TX8A 1GBHA 2J38A 1FDPA 2Y81A 2VIPA 4X1NU 1V2OT 3RMNH 2O8TA 1CVWH 1RS0A 1SL3A 2GV6A 1VITF 1YPEH 2ZNKH 3ZYDA 1LPGB 1YPJH 2ZHFH 4TY7A 1GBMA 3FFGA 2ZDMA 3ZVFA 1LHCH 3N99A 2OTVA 2HLDD 1ZZZA 5IDKA 5T6GA 1V2JT 2WV5A 1BRCE 3E0NB 3UR9A 1D6RA 3DFLA 4MPWA 1YCPH 1C5UA 1O3PB 1VJAU 1UCYE 2KFWA 2L74A 1SVPA 3NK8A 4FU9A 2XCNA 1SGEE 4DT4A 1GVLA 4AYVB 1SR5C 1NFXA 1AIXH 1EAXA 1UVTH 3RXHA 3PTBA 1AUJA 1UK3A 4JYUH 2AIQA 2FMJA 2XTTB 7GCHG 1V2VT 3FO8D 3RXAA 1ZMNA 2OUAA 1TRYA 2XNDD 1O33A 5C1UA 5AFZH 4CR9A 5K0HA 1J14A 1MAXA 1PPFE 4BXSA 4AB9A 1TBZH 2BDCA 4JZFH 3D49H 4DY7B 3SO3A 2GDDA 3S9AA 4BANB 1HAYB 2C4FH 3ZZDA 1GVZA 1DY9A 1E79D 3A7VA 2FS8A 1N1LA 1SQAA 2F9BH 4ABGA 3KYGA 4NZLA 2GT8A 1SLXB 5C2ZA 1RIWB 1QBVH 1G2LA 4I32A 1PPEE 1S83A 3RXMA 1BA8B 1ZPCA 4OGYA 4A92A 3ZVGA 1UTQA 3SV8A 4ABBA 5F8XA 1UVSH 1W0YH 3UREA 5H4IB 3SI3H 2GCTC 1EOLA 1O2OA 1NTPA 2Q6DA 2KAIB 1QBOA 5I46H 3LGYA 4X8TH 3RUOA 3WWFA 1EPTC 4CREA 1MKXH 2ZGCA 1D3PB 2BDHA 1C5WB 3GISB 2VIDA 3R3GB 1QB6A 3OTPA 1RFNA 1A46H 2O8UA 5CHBA 5EU8A 3H5CB 2FP7B 5SGAE 3KN2A 2ZQ1A 4K8YA 1Q2WA 1YLDA 2A7JA 1MTSA 2ASUB 2JH6D 4QT8C 3F9GA 5B6OA 3VB6A 5K7RA 3CP7A 3RXKA 1CBWB 6GCHF 3AW1A 1FPCH 2GJGA 2Y5HA 5TCCA 1KDQA 5PTPA 3PO1B 1ELFA 1CE5A 1PYTD 4BAHB 3F2HA 3LGWA 4UFEH 3A89A 1PPCE 4CRBA 2THFB 3S7HB 1SFIA 1UCYK 2UUFB 1C4U2 4UD9H 4A6LA 5HM9A 1UW7A 1K1LA 3RXDA 3UNSA 3D65E 3LC5A 1BBRH 2XWBI 4AG2A 2RG3A 9LPRA 1HAZB 1HIAB 4HI3A 2Y82A 4IBLH 4TY6A 6ESTA 3T29A 1AKSB 3STJA 4X1PU 3TH4H 2TGTA 5F6MA 2Z9GA 2G51A 1GJAB 1GHXH 2ZGXH 3IWMA 3TVJB 1O38A 2ZFRH 1UTJA 3GY5A 4ZKNU 3OYPA 4Y0YE 1SOZA 2VGCC 2TGPZ 4WF8A 5LH8A 1H1BA 1OP0A 1UHBA 1GHAF 2FI5E 4X2YA 1GJBB 1EXFA 1J16A 1XUKA 3MU0A 3SUFA 1JRSA 4BXWA 1F2SE 4B76A 1FPHH 4Z6AH 1HUTH 4MNWA 3RXSA 3K2UA 1ARBA 1G3BA 5EQRA 3VXFH 1F7ZA 3ZVDA 3MFJA 1J15A 2BD7A 5C94A 2PGBB 2KM0A 2P93A 2WYJA 1Z8IB 4UEHH 1GJDB 1NFWA 2QXJA 3MH7A 4Q80A 2ZTYA 1LO6A 1E35B 1NRRH 2HPQH 2QGRA 3LONA 1P03A 2GVFA 1AFEH 3NUMA 1NZQH 3PWBA 3P92A 3LGVA 4X2VA 1BMMH 2SNWA 4WXVA 1O5GH 4R0IA 5HYOA 3JZ2B 1A1RA 2Z9KA 4OS2A 1LHFH 3MH4A 1CA0B 2ZF0H 1XMNB 4P02A 1GJ5H 1EQ9A 2TRMA 2TPIZ 3EA9A 1ETTH 5FCRA 3TGKE 2EI6A 1QJ7B 1UTNA 3A80A 3KHVA 3A7TA 2BLVA 2QF3A 5HIYA 4F4OC 1V3XA 5L6NH 5DP3A 4ABIA 2AMDA 2B5TB 4D76A 1VCWA 2ZZUH 1MQ5A 1HYLA 1KXAA 3N7OA 1SSXA 1YPMH 4NIYA 4X2XA 1ZJKA 1NRNH 1MAYA 2RA3A 1FIZA 4I8GA 1NU9A 1C5LH 1MKWH 3TLOA 3NPSA 1BQYA 1SHHB 4U01A 3BTKE 1TGBA 1KLIH 2A4OA 2QXHA 2ZDAH 2AH4X 4HTCH 4CH2B 2R2WU 3HPTB 3I77A 1AY6H 2J97A 4K60A 1RIWC 4FUIA 1O3AA 3VB7A 1NS3A 3LH1A 2W3IA 3I29A 4WXIA 1FY8E 5I25A 2G4UA 3TGIE 2BD3A 1DX5M 1O2QA 4NG9H 6CHAB 3E90B 3K6ZA 2ANKH 3RXGA 2Z9IA 1GI6A 1TMBH 2OQUA 3E3TA 2XBYA 1COWD 4FUFA 4XBCA 3SJOA 4BAMB 2Z3EA 2A4QA 3HGNA 1S0RA 1YF4A 2ZGJA 5ABWA 2OXSA 1WU1A 2Z9LA 4OS6A 1ZR0A 5EIYA 1WV7H 3AW0A 4WH8A 4F49A 3D23A 2OINA 1K1JA 3O8RA 4RN6A 5C0UA 5EXNA 3TJUA 1CHGA 1LVMA 2QIQA 5LGOA 3T25A 4DOQA 4B2BA 1CQQA 1A4WH 1J9CH 2WSSD 3A86A 2WHXA 3W94A 1V2TT 5GNDA 2BQ6B 2FOCA 5GDSH 2Q1JA 4TPIZ 1AUTC 3PO1C 5AHGH 2P3TB 1OYTH 1RTKA 1KXBA 2FZZA 2W6ID 3U28C 3RXOA 1NU7B 1FJSA 1YKTA 2Q6GA 1PQ8A 1J8AA 2XC5A 1XUGA 3GCTG 3MNBA 4AYYB 1ZJDA 2XBVA 3LT3A 1C2GA 1WYKA 2GZ9A 2PSYA 1OXGA 3MO6A 1O2MA 4BTUB 1FX0B 1YPHE 2VBCA 1UTMA 5CMXH 4D9QA 1MH0A 4NGAH 1TLDA 1HAVA 4OGXA 2TBSA 5A09A 4Y6DA 1W7XH 3BEUA 3EA8A 2STBE 1AZZA 4ABJA 2RFKC 1EZQA 2NWNA 2QF5A 2A45B 1SMFE 8ESTE 3UFAA 5E2PA 5T6DA 1GGDB 2KZ4A 5DSFA 5AF9H 1KXEA 1UK2A 1SGFG 4TPYA 3TGJE 3JZ1B 2SGFE 1O3IA 4U30A 4Y8ZA 4AGJA 2ZTXA 3RLYH 2UWOA 2I6SA 3SV9A 4X1RU 3A85A 1HXFH 1ZPBA 1P8VC 1XXDA 2SGAA 5A8ZA 2BD4A 2C90B 3ZZCA 1FY3A 4YZUA 3TITA 3SJ8A 1C1SA 2BDYA 1ZMJA 5CHAB 3UIRA 1WCZA 3A8BA 1EP5A 2C8WB 1BUIA 3Q3XA 1RGQA 1DWCH 2J34A 1A2CH 1O36A 1PQ7A 4GCHG 5KEDA 1G3EA 3U8RH 1F0UA 1SFQB 2FX6A 2I6QA 1UTPA 1WQVH 4K1SA 1TPSA 3RLWH 3ODFA 1CA0C 1ZGVA 2QC2A 3HGPA 2EEKA 4NZQA 4M9FA 5EW2H 2FYQA 1MQ6A 2BD5A 5KGOA 2TGDA 4DIIH 3PM3A 2FOHA 3U69H 2JDID 1ELVA 1XVOA 1O3GA 3F9FA 1GPZA 2Z6BD 2VWMA 1GWAA 1YPHC 2STAE 1GJ7B 4E7NA 4KTUA 3MNSA 4ZHMU 1C5QA 3GYLB 3SBKA 1ABJH 1LQEA 1ARCA 2WPDD 5DO4H 2D2DA 1O30A 1OWEA 2OC1A 1K1NA 2VNTA 2WV9A 1BRAA 4LOYH 4XOJA 5FPSA 5FBIA 2BX4A 4B2AA 2ZKSA 3M7QA 2AMPA 3N7EA 4ZKRU 3ZIAD 2QAAA 4IW4E 7KMEH 1LVYA 1QRZA 1D4PB 1O3KA 2LP6A 2ULLA 1W8BH 4FOUC 1ANDA 1KLTA 1RXPA 2G4TA 4OM9A 2HOBA 3GICB 1CHOF 1QRXA 1SQRA 3Q3KA 2F9NA 3H09A 2H6MA 3UUZA 1E38B 3U9AH 1FONA 2AFQB 1ZTLA 4OS4A 4CRCA 3MU1A 1DWBH 2ZI2H 6CHAC 1H8HD 3UTUH 2W26A 3UNQA 1CO7E 1H8IH 5GPIB 1O3MA 1A0HB 3GYMA 3SU1A 4ASHA 5FPTA 1EZXC 1SGPE 3O8BA 5EODA 1IOEA 3UOPA 2QY0B 3M61U 3KQDA 1UTKA 3P8GA 1Y3WA 1IHTH 1HAOH 2BLOA 2CHAB 3DFJA 1C1RA 1TONA 1VR1H 1LHGH 1EKBB 2HLCA 1XX9A 4GPGA 2OC0A 1WSSH 2IN2A 4D7FA 3M36A 5AFYH 2BQ7B 3BTQE 2OP9A 3A81A 1P02A 1P3CA 1HGTH 1A7SA 1NT1A 4I8JA 1EJNA 4AFSA 2WPHS 1K0HA 4H6TA 3M3SA 1AB9B 3TH2H 1TNHA 3MMGA 4A1TA 3SGQE 1ZHRA 1F5RA 2FO9A 1QBNA 1NBMD 1VGCC 1ZRKA 2FEQH 4NWLA 2CGAA 1OWJA 1C5YB 3D62A 1DLEA 1GBTA 1W3CA 4ZCNA 1FAXA 4UFGH 2R0KA 1A0LA 2VWOA 4XSKU 1C5XB 2BX3A 4ABEA 1DXWA 1THRH 3E6PH 2A32A 8GCHG 4Y71A 1BMAA 1ZTJA 2RDLA 5C0TA 2D26C 3M3TA 1ESBA 5DK1A 1THSH 1VCQA 2GZ7A 3P8OA 4X1QU 3P17H 3FP7E 2G55A 1TOCB 2GTBA 4J2YB 2FOFA 3RXCA 1GGDC 2BLWA 1SOTA 4JCNA 1PJPA 1N6YA 1QQUA 1EB2A 4YT6H 2WUBA 1AVXA 4GHQA 4IN2A 2PUQH 3Q77A 2ZA5A 1GCDA 1WAYB 3SU3A 1C2HA 3A7XA 1HJ9A 7GCHF 2FI3E 4IC5A 2PSXA 4R8TB 5CHAC 3RXJA 1DPOA 3QN7A 3BTEE 5DKMA 5DP7A 1JMOH 2ZC9H 1S82A 1O2TA 1THPB 1UO6A 4IS5A 3W95A 1LVOA 1C1MA 1KDQB 1FN8A 2UUKB 5C1YA 2P95A 1Z8RA 1GHZA 1MCVA 3A82A 4ZAEA 1L0ZA 1TNJA 1S6LA 1YC0A 2UWLA 2V0BA 3SUEA 1TGSZ 1BJVA 1AVWA 3B8JA 3UNRA 3IITA 1MTUA 1C1UH 2A2XH 3F3BA 1C1NA 1W12U 5HGGA 2A5AA 2ZDVH 1OPHB 3TNSA 3E0PB 1VITH 2M5TA 1RRKA 2P3FH 3RC4A 2WZQA 3S0NA 3SORA 4IMQA 1YM0A 1SGIB 3A8CA 1C9TA 1K1OA 2ZCLP 1Y3XA 5FX6A 4DJZB 4AFQA 3ATWA 2VWLA 2CV3A 2D8WA 1UK4A 1UHBB 3A83A 3A88A 1HAHH 5DP6A 1GI8B 1PQ5A 2ZGHA 4A1XA 1EUFA 2FOGA 3L3TA 2UWPA 2GCHG 1AWHB 4E7RG 1TGCA 3KNXA 3RXVA 1SC8U 2J9NA 5C3NA 3QZRA 1C5ZB 3MTYA 2AGIX 3BEIB 1QQ4A 4X6OA 1C1WH 2BY9X 1OP8A 3UAIC 3SNAA 4B6FA 2Q6FA 4DG4A 2VINA 1O3DA 1QHRB 3EQ0H 4SGAE 3DT0H 3M7TA 4MPXA 4X6PA 4Y76A 3ODDA 1UCYH 4O9VA 3BG4B 1IAUA 2IOTA 3RMOH 3DSOA 3UQOA 3CNRA 2Y7XA 1O2WA 3K6YA 1D3DB 2BOKA 3OX7U 1KTTB 2OCVB 1TFXA 1O2XA 3V13A 2TIOA 2BVXH 1KYNA 1TAWA 4KGAA 3SYJA 2A1DB 4ZXYH 4ABAA 1SLWB 2QA9E 4I8HA 4WY3A 3S69A 2GDEH 1IQMA 1NN6A 3MU8A 1EASA 2FX4A 3E1XB 4MLFB 3PRDA 3SGBE 5DP8A 2C8YB 1HBTH 1ELTA 2J94A 1C5TA 1PYTC 1G30B 1GCTB 1O2SA 5TJXA 4X8UH 4HFPB 1JIMA 2ZU5A 4B73A 2WYGA 1O35A 1SLVB 1YPLH 7LPRA 3H7OA 3Q3YA 1WOFA 2ZHWH 1O2RA 1S6HA 4VGCB
chains in the Genus database with same CATH topology
1C4Y2 5T3HA 2ZTZA 5JYIA 2CN0H 1P9SA 1QGFA 3TK5A 1K22H 2HNTE 1LHDH 1P11E 1C1TA 4E05H 1ETRH 2XC4A 4X2WA 2ZFQH 4JK5A 4MQAA 4Y0ZE 1FY1A 1CGJE 2ZCKP 5BRRE 1EB1H 2HPPH 2JETB 1RD3B 4Y10E 4NIXA 1BTUA 2A2QH 2GMTB 1ZRBA 4AORA 1SB1H 1HJAB 2Z7FE 1GMHF 2V3OH 2ANWA 3BN9A 1E34B 1DT2A 3DHKH 4A5TS 1XUIA 2PKAA 4ISLA 2PTNA 1DITH 3MOCA 1MU8B 5A0AE 2HNTF 4OS7A 3ENSB 4J1YA 2J95A 5A2MH 1CGIE 1XUHA 4UONA 2BD2A 5JB9S 1WQSA 3RU4E 4CH8B 3LKWA 1MKXK 1IQEA 2RA0A 1CGHA 3GCHB 1YPKH 4ISNA 3F6UH 3AAUA 3PROA 2ZU4A 1V2UT 1ELAA 1A3EH 4WMDA 3MHWU 4YTAA 1NFYA 3EDXB 2ZQ2A 1C2DA 2VIWA 2GZ8A 2FLBH 2G52A 1BT7A 4A7IB 1FY4A 1PFXC 1C5OH 1AU8A 2H9TH 2NU0E 5EXLA 3OSYA 1O2ZA 3OTJE 1TPAE 3AASA 1AO5A 1K2I1 1TNLA 3O8CA 1TBRH 3SUGA 1O3CA 4AN7A 2FTLE 4DW2U 4JYTA 1DE7H 5GXPA 1HAVB 1BTWA 1WTHD 4GAWA 1GMHG 5FAHA 3M35A 1Z8JB 2HNTC 1C2JA 3UWIA 3GY3A 5DG6A 1TRNA 4OS5A 1Z8GA 2Z3CA 1QL9A 4NA8A 3URCA 5C5NA 2ZFPH 2KAIA 2NU1E 3RM0H 3VGCB 2BTCE 1TIOA 2YNAA 4YOIA 3M5OA 3C27B 1MTWA 2VIVA 4NCYA 4XE4A 4X6NA 3QO6A 2PGQB 1T31A 1AZ8A 4E06H 3F1SB 1XM1A 3LH3A 3RU4T 1G3DA 1C5MD 1M9UA 1GBDA 1N6XA 2J4IA 2O9QA 1ZSJA 2ZO3H 1PPBH 1EJAA 1QRWA 3GCNA 1O2VA 1Q31A 4AFZA 4ISHH 4WH6A 1MUEB 4A1VA 5F8ZA 3STIA 2ZDNA 1TPPA 2B8OH 4FUDA 4JYVH 1SG8B 3GCTF 4ZXXH 1L4DA 1A5HA 3BG4C 4KTCA 2Y5FA 4U2WA 3RU4D 4YLUA 2VVUA 1V2KT 1B0EA 4X8SH 1ELGA 1RTFB 4BNRA 3SGAE 4BAQB 2R3UA 3ZV9A 1C2FA 3LGUA 8KME2 5C5OA 2OC7A 2C8XB 5GJ4B 3SV7A 1O5BB 4NA7A 1AGJA 1K9OE 3GY2A 1MZAA 5DP4A 3SHCH 2VWNA 3HK3B 1GG6B 3M37A 1GCTC 1E0FD 4O03A 1V2RT 1GI1A 1CBWC 1TE0A 3P6ZB 4GSOA 3U98H 1Z1JA 1TALA 3KL6A 3QTVH 3M5NA 2VVVA 1ZPZA 1O3EA 4VGCC 6LPRA 2BZAA 1O3BA 3DA9B 1OWDA 1KXDA 1RTLA 1S5SA 3RXRA 3TIUA 1AHTH 4UFDH 4FVDA 4GCHF 2FTMA 1P2IA 1GMCG 1LVBA 3SJKA 3ZZ3A 1XKBC 4TYDA 1UVOA 2Y7ZA 1BOQA 4Q7ZA 5JBBS 1P2MA 1TGTA 2F3CE 2LNCA 3TNTA 2DE9A 4KP0A 1HPGA 4B2CA 2ZECA 1GI2A 3F68H 1K28D 3KGPA 3SQHE 1OS8A 2CMYA 1LCYA 1V6DA 2GMTC 1F5KU 1HJAC 1AMHA 3V0XA 4ABDA 3RXTA 1YCPM 3RP2A 2DE8A 4FXGH 3Q76A 4I31A 1OOKB 4XBBA 1TQ7B 2ODPA 2J2UA 1PPHE 4ZKOU 1O2NA 5GCHG 5LPEA 2BZ6H 2Y6TA 1TWXB 1YYY1 3SU5A 1O2KA 1P01A 1W7GH 4FUEA 2SFAA 3NZIA 2Z94A 3FVFB 1O2YA 5ESBA 3VB5A 2BXTH 2XRCA 2BDIA 1OWIA 3QUMP 2A4RA 1DOJA 2P8OB 4D8NA 9ESTA 2FPZA 4K69A 1ZSKA 3A7WA 3A8DA 3GDVA 1ACBE 1G2MA 3MNCA 1PPZA 2GT7A 4K1EA 1IQJA 1V2MT 4YO9A 3OY5U 5A0CA 3B9FH 4X0WU 1ANEA 1O5AB 5EXMA 3V12A 1EP6A 2ZDKA 3QZQA 3MI4A 1P2JA 2Z3DA 4MPVA 3TH3H 1GI4A 1JRTA 2OD3B 3NWUA 3DD2H 1ELCA 4X8VH 4D7GA 3B23B 1GBIA 4Q7YA 1G32B 1O2JA 5DGJA 1O39A 2FM2A 3KEEA 1V2WT 2ANMH 1B7XB 2H9EH 3QDZB 4IN1A 4M7GA 3FP8E 1WBGB 1MTVA 1YP9A 2XBWA 4LXBH 1H9IE 1Z71A 4THNH 3UY9A 2PKSB 2QYIA 1B5GH 4WWYA 1QFKH 2BM2A 1QTFA 4NFEA 2FWWA 1O34A 5EGMA 3RXFA 4MTBA 4AX9H 3ATLA 2FS9A 1S0QA 2WINI 3TK9A 1O3LA 1UMAH 1TX7A 3BV9B 4I7YH 3KCGH 2B9LA 5C20A 1TPOA 2G5NA 2JKHA 2VH0A 1GJ4H 1BMNH 1C1VH 4GLYA 2G81E 3H7TA 2FOMB 3A87A 1XKAC 3ZVAA 1MU6B 4DGJA 5DP5A 5F8TA 4ZROA 4B75A 2BY5X 1GHVH 1ZMLA 3EGKH 4DIHH 1GDUA 1Y5AT 2ALPA 2PW8H 3SU2A 4CHAB 3SN8A 2SGEE 3PLBA 3FAOA 1KXCA 2J92A 1BJUA 1ESAA 2WPMS 1QL7A 8GCHF 1EJMA 2G8TA 4MPUA 3ZZ5A 1EOJA 1SGNE 1O3OA 1A5GH 3FANA 3BTFE 4HGCA 1IQGA 1LKAA 2ANYA 4BTTB 2LPRA 4CR5A 5J4QA 2H9HA 1EAUA 1FV9A 1QJ1B 2F9UA 3E91A 1TNIA 2TGAA 3G01A 1L1NA 2O8WA 2FLRH 2GCTB 1GL0E 2OLGA 2UUJB 4U32A 2ODQA 1C9PA 4NA9H 5E2OA 2C8ZB 1C1OA 4X6MA 1ELBA 1A5IA 1QY6A 1GHBF 1IQKA 1G3CA 2GGVB 3ZZ9A 2QCYA 1AFQB 4RKOB 1O3FA 3SI4H 1DXPA 1HB0B 1HV7A 3M7UA 4ZKSU 2ZFTA 3P8NA 1AVGH 1O2GH 3HK6B 3A84A 4CBOA 1C5SA 1P2QA 1C5PA 4H6SB 4O97A 3ZZ7A 4OS1A 2F91A 1PQAA 2F9OA 1P2KA 1NC6A 1S85A 4WMEA 5A0BA 1YLCA 1BITA 1F0RA 2R2MB 3TJNA 4XBDA 1LKBA 1DFPA 1ANCA 5FCKA 3BTME 1JOUB 2SNVA 1KY9A 2PLXA 2C3SA 4UE7H 1OKXA 3LDXH 1A3BH 5C1XA 3A8AA 1AI8H 3VB4A 1ZOMA 1ANBA 3K65B 1SGRE 2YNBA 1FAKH 4ISIH 3LJJA 2O8LA 2XXLA 1P04A 5ESTE 1SGCA 4ZH8A 1HXEH 3MU4A 3MNXA 1DS2E 1GHBG 2BDAA 2P8OC 1GBAA 2NU4E 3SV2H 3HATH 4I8LA 1NRQH 1E36B 5EOKA 2GCHF 1QCPA 2VGCB 1L1GA 1EX3A 2H2ZA 2BD8A 2PHBA 4ISOA 4MNXA 3PLPA 2XYAA 4SGBE 3OU0A 3PYHA 1DUAA 1GI9B 1UJ1A 5A8YA 4CRDA 2GD4B 2XC0A 1P12E 3QTOH 3UWJH 3VFEA 3SU6A 1LMWB 5JDUB 3BTGE 3ZZ8A 3U8TH 2C93B 1O5DH 1DY8A 4H4FA 4INLA 4I8KA 4TWWA 3RC6A 3T28A 3ZVBA 3P8FA 1P2NA 2BQWB 1HRTH 1BTZA 3T27A 3ZVCA 4MVNA 1SI5H 1Y59T 4Z0KA 4NWKA 2G00A 2ZG0H 3LGTA 1C1PA 5EW1H 2ZU3A 5TCAA 1TA2A 1OX1A 4LZ4B 2WUCA 5L30H 1BRUP 5AVDA 2CXVA 3TU7H 4FU8A 1TBQH 3GY4A 2P59A 2PKSC 2BHGA 1CU1A 1FI8A 1O2PA 1LDTT 3S9BA 5JBTA 8LPRA 4Q2KA 4ABFA 1OYQA 1SPJA 2PKAB 2K1QA 4NFFA 1IQIA 1EPTA 2WPJS 2AIPA 1YBWA 4IC6A 2FOBA 1FN6A 1OP2A 1GMDG 4NIVA 2V35A 3LU9B 2R3YA 3U1JB 1XVMA 1O32A 1HLTH 3BIUH 1Y3UA 1TNKA 1P9UA 1BTPA 1V2ST 4FUBA 1EATA 1KTSB 1WTGH 2ZWLH 1HJ8A 4LK4A 1T8MA 1K1IA 4RSPA 4CHAC 4K8BA 2HALA 4NIWA 1C2IA 1GI7B 1TRMA 4DVAU 1ZYOA 3PWCA 4AZ2B 4ZHAA 1TQ0B 2JH0D 2FXRA 1J17T 1NPMA 2A7CA 1L2EA 1VITG 1F5LA 1LQDB 1EZSC 1O37A 2CHAC 2AS9A 2Y80A 3PMBB 1GBKA 5E0JA 4ABHA 4Y8XA 1BIOA 1HAPH 3ELAH 1YCPK 1Q3XA 3RXQA 4Y8YA 4BAKB 3BTDE 1A61H 1GHYH 3TK6A 3RXBA 2V3HH 4JZEH 1BBRE 3SOSA 5JPMH 1X7AC 1P0SH 1MD8A 3MYWA 3UR6A 2D1JA 2R9PA 1W10U 3PMHB 4CRAA 1TMTH 3CS7A 3ATIA 1AB9C 1JBUH 4JMYA 1AFQC 3GOVB 1ZGIA 3FZZA 1L1JA 1DM4B 2VB0A 3QX5H 1MD7A 3BG8A 1NRSH 1SGTA 2UUYA 3VPKA 3L33A 1H8DH 4KTSA 1OWKA 1V2LT 1Y3VA 2ZFSA 1MTNB 3SZNA 3RXEA 3TPIZ 3NXPA 2EC9H 1W14U 3EAJA 1IQFA 1N8OB 3SNBA 1DLKB 1DSUA 4ESTE 1S6FA 1IQHA 2EI7A 2VIQA 1B0FA 1NY22 4WMFA 5CE1A 2AMQA 3LC3A 1GBJA 3FZDA 4GHTA 1Y8TA 3LJOA 2V6NA 3MO3A 4FU7A 1Y3YA 1C5RA 1OWHA 5J4SA 3E16B 4KELA 1QL8A 3GY8A 1MCTA 1C5NH 5HXFA 1QNJA 4ZMAH 5E0GA 3T26A 2PR3A 1GBCA 1Z6EA 4MNYA 3V3MA 5G4BA 4DURA 4K1TA 2RCEA 3KQCA 1O3NA 1V2NT 1SHYA 1BDAA 1VJ9U 1VCPA 4BTIB 1DWEH 1ID5H 2OC8A 1V2QT 5GIBA 2CF8H 2HWLB 4ZUHA 3T62A 4CBNA 4MG3A 5A8XA 3I78A 1BTYA 3PV4A 1HFDA 4B1TA 1TB6H 1T8NA 1HAIH 1TX6A 5FPYA 6GCHG 3F9HA 4FUHA 2ZHEH 3RDZA 3ZZBA 4H42U 1P10A 2XWAA 3MH5A 1NROH 1GBEA 2VH6A 1BBRK 2QXIA 3SNEA 3ESTA 1GI3A 1ELDE 3URDA 5F03A 1G37A 1XUJA 2ODYB 2WPLS 4INKA 2GP9B 1BTHH 5EQQA 1FIWA 1GI0A 1P05A 1W0ZU 2ZHQH 4WVPE 4B71A 1P3EA 1HCGA 2VIOA 4UDWH 5EQSA 2BVSH 3MU5A 2H5DA 2P16A 1HAGE 2ZFFH 1BMLA 1F92A 3L6PA 3RC5A 2ZIQH 1BTXA 2Y5GA 2XBXA 3ATMA 3ATKA 3SNDA 3EA7A 3NCLA 1LPKB 1ETSH 1GHAG 2PUXB 2VU8E 1S84A 2ZPRA 1T4VH 1TABE 5ETXA 3SJ9A 4NSYA 1H9HE 3LPRA 2ZGBH 2QXGA 4XDEA 3GDSA 4WJG2 3KF2A 1CT0E 2CJIA 1GMCF 1H9LB 2HVXA 2PTCE 3VXEH 3SHAH 2H5CA 3QK1A 1G36A 1SGQE 3CENA 4JK6A 3EYDA 2WV4A 2W3KA 2QF0A 1O5EH 1O2HA 2A0QB 4K3JA 2BXUH 2FIRH 4DCDA 1HIAA 1XXFA 1GJCB 1MBQA 1MZDA 3MH6A 1V2PT 1AKSA 3QLPH 3M3VA 3R0FA 1GBFA 5GWZA 3ZVEA 3RMLH 2OBOA 2P3UB 3P70B 4FUGA 4LZ1H 1P09A 1O5FH 1LHEH 3KIDU 1UTLM 4Y11E 5GCHF 4YT7H 1ZLRA 1GL1A 7ESTE 2FODA 2SGDE 4FUJA 3VB3A 4YM9A 5FX5A 4Q7XA 1K1MA 3U1IB 1SGFA 2B7DH 1MMJN 2EI8A 3EE0B 3RXPA 2F83A 1P06A 1C2LA 1FMGA 2HRVA 2BDBA 3KQEA 3T2NA 4AGKA 2ALVA 1MKWK 5LPFA 5IYTA 5JBCS 1BRBE 4B74A 1Z1IA 1MTNC 1FXYA 1VZQH 1FQ3A 3ZYEA 1QB1A 2BB4A 1ZTKA 5L2ZH 1GJ9B 3BEFB 1LTOA 1O2IA 1AQ7A 2B0FA 2BY6X 2ZPQA 4MDSA 1DUEA 1N8OC 1BZXE 4Y79A 1FY5A 1P2OA 1GBLA 2AGGX 1FLEE 2P94A 2JETC 2ZEBA 1TMUH 1IQLA 3RXLA 1JXPA 2XNIA 5HMAA 1D9IA 1ELEE 1P57B 2GKVE 3LIWA 5FHTA 2FI4E 1VGCB 4FVBA 1W11U 3GCOA 4IGDA 5E8EH 5DP9A 5DPAA 2FOEA 1UVPA 3A7YA 3HKIB 3RXUA 1DWDH 1CT2E 1LPZB 2ILNA 4ZHLU 4O3UA 1YGCH 2ZU1A 3LGIA 1QA0A 3SQEE 1AWFH 2EA3A 1XUFA 4GUXA 5JB8S 1FUJA 1KIGH 3LOXA 2QV1A 3VEQB 3GCHC 2JH5D 3GY7A 3SW2B 2NU3E 2NU2E 1C2EA 3ITIA 3PMJA 4AOQA 4IMZA 1BCUH 1ESTA 3PB1E 2DUCA 4XFQA 3TJVA 2WPIS 3SJIA 1ABIH 1TGNA 1DANH 1NO9H 2ZCHP 4Y7BA 1GI5A 1SLUB 1BHXB 1EAIA 2IPHA 4D9RA 2OQ5A 2A5KA 2AEIH 1ZSLA 4UFFH 1QR3E 1CA8B 1GVKB 4X1SU 1F0TA 3QGJA 2FDAA 1C5VA 1BB0B 1O2LA 2ZDLA 2AYWA 1KLJH 1O0DH 4BOHA 1L4ZA 1GDQA 1FZZA 1T8LA 2CF9H 2BY7X 4K5ZA 3V7TA 1GDNA 3SV6A 1F0SA 1S81A 3AVZA 3S7KB 1SQTA 1NFUA 2AGEX 3ZZ4A 2ESTE 1T4UH 5EPYA 3O8DA 3SU4A 3VGCC 2H1UA 3BIVH 1WUNH 1HAXB 3SNCA 2A7HA 2SGPE 1RJXB 3TJOA 2XCFA 1OSSA