1QQUA

Crystal structure of porcine beta trypsin with bound acetate ion
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA TRYPSIN
publication title Crystal structure at 1.63 A resolution of the native form of porcine beta-trypsin: revealing an acetate ion binding site and functional water network.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qquA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qquA02
1Y3WA 4B75A 1EAWA 1N8OC 3M7UA 3W94A 2F9BH 5DP7A 1C5OH 3UTUH 1ANCA 1U6QA 1W0ZU 3DFLA 2A7HA 1VZQH 1UK2A 2K1QA 5AVDA 2ZNKH 2SGDE 2G5NA 2NU2E 1GMHG 2NU0E 2OC1A 1Z1IA 2BTCE 1WOFA 4ABIA 3GY5A 1HAVB 6CHAB 1O2VA 4M7GA 3LGYA 1YLCA 3MNCA 3SO3A 1AFQC 3IG6B 2KAIA 1EX3A 1Z1JA 5T6GA 1ZYOA 3SQEE 3DHKH 4ABBA 3TJUA 2P95A 2XBYA 1GBMA 1CT4E 4U32A 1TNLA 2NWNA 3RXOA 1L2EA 4K60A 2OC8A 1BTXA 1BRUP 1P57B 1TNKA 1L1GA 1PQAA 1GBDA 3D49H 4D7FA 5IYTA 1IQNA 2C8WB 1TGCA 2FLRH 1W12U 1UTOA 4WJG2 1TB6H 3TK6A 1P2KA 1UMAH 2THFB 3BG4B 1T7CA 2QIQA 4F4OC 3E91A 2A4GA 1SVPA 2VIVA 1AMHA 1TQ7B 8KME2 1ZJKA 3M3TA 1C5NH 1GJ8B 3TIUA 4FVBA 4BOHA 1SOTA 4E06H 1HAIH 3STJA 1V2PT 1AZZA 1D6WA 1XKAC 3A8DA 4JZIA 3Q3KA 1C4V2 1C5LH 2EC9H 5F8TA 4QT8C 2O8TA 1IQLA 4X6MA 4D76A 1V2LT 3SJ9A 3S7KB 1E34B 1TNGA 2AGEX 1NESE 3DT0H 4ABEA 3BEIB 4WWYA 2Z6BD 1JIRA 2SGEE 3KQDA 3TITA 1GHBF 1GJ5H 3GCOA 3SGAE 1Y5BT 1XX9A 4K8BA 1T32A 3HATH 5T6DA 5A8XA 1BTZA 3MWIU 5FCRA 1FIZA 3U8OH 5DO4H 2VGCC 1C5XB 3A7XA 1BT7A 5EXMA 3ZVFA 1ELVA 3RC6A 2ZGHA 2PTNA 4CREA 2ZU4A 2JETC 3VFEA 3PLBA 2ZQ1A 1EB1H 1TPOA 2CF8H 3RXTA 2VJ1A 3SORA 1GHZA 4GCHF 2ZDVH 2QXJA 1C1VH 3VB6A 2AMDA 1IAUA 2HALA 2G55A 1RRKA 2CN0H 1ZJDA 3T2NA 3BTME 5EQRA 3TGJE 4RKJB 1Q2WA 3PMHB 1AB9C 2R2MB 1IQFA 4A5TS 4FUEA 2C93B 2PWXA 2XTTB 4AG2A 1P11E 3L33A 1OP2A 4U01A 1TA6A 1MAXA 3SUFA 3JZ2B 4JK5A 1SLWB 2PR3A 4DY7B 1M9UA 1FLEE 3KGPA 3SV7A 4BAQB 1GGDC 1W0YH 2JKHA 3TH2H 1ZTLA 3FAOA 4ZHAA 1BDAA 1LDTT 2DE9A 1YCPM 2ESTE 2BDHA 1GBBA 1HAHH 1VJAU 5FBEA 1O2JA 1O3OA 1QRZA 1WAYB 3ZYEA 2ZFSA 4CRFA 4ABDA 1GMCG 2J92A 3U98H 2FEQH 1UTMA 2FX4A 2ANKH 2SGPE 3RMLH 1QTFA 1QA7A 1SFQB 1GHVH 1CU1A 2FOMB 4DURA 3K6YA 4CH2B 1V2WT 2A0QB 5EGMA 1G3CA 4D9RA 4I8KA 1EJMA 4I8GA 1OWJA 5L2ZH 3Q3YA 1NN6A 1T8LA 4ZHMU 1AE8H 1TX7A 2OBOA 4X8TH 3UWIA 2QN5T 1UTPA 2Y6TA 4CRBA 1MCVA 4K3JA 1D3QB 3TJOA 1TNIA 1P2NA 4H6SB 1NRNH 2SGAA 1JIMA 1O3KA 1XVOA 2D1JA 1UVOA 1YLDA 3VEQB 3R0FA 4B2AA 3SUGA 1UCYH 1SGNE 1A5GH 1G3BA 1TOCB 4THNH 1MUEB 2ZGJA 4DIHH 3URCA 1XUIA 2V6NA 5FX6A 5FPTA 4Y0YE 4YTAA 3OY5U 4R0IA 3MNXA 1C1MA 4TPIZ 3SGBE 1GI5A 1DSUA 4AN7A 3V3MA 4BTTB 3V0XA 3RXQA 4OS1A 4ABAA 5F03A 1TIOA 1EZQA 3BSQA 5G4BA 4MG3A 4ZKSU 3A8BA 3UQVA 3HKJB 3MU0A 2GCHF 4FVDA 2BQ7B 1G3DA 3S9BA 3D62A 4MTBA 1GJ6A 2Q1JA 3AW0A 2C8XB 2FPZA 4YLQH 1CA8B 4TWWA 1JXPA 4X1QU 2Y82A 2Q6FA 2BVRH 1TRMA 1ESBA 1SGFG 2AFQB 5F8XA 1CA0B 2FX6A 2HVXA 2ZTXA 4U30A 1LKBA 4E05H 1ZZZA 8LPRA 3GICB 3PB1E 3A85A 1WCZA 4MQAA 2BY6X 2OC7A 3RXSA 1GBCA 2B9LA 1SQOA 4FUIA 5FCKA 2O8UA 4MPXA 2O8MA 1VGCB 1LPZB 5C1UA 2GV6A 4NSVA 4SGAE 4X1SU 5DP8A 2A45B 1MTSA 2PKAB 1GG6C 4ESTE 1O3PB 1EPTA 2Q6GA 2CHAC 2J4IA 2UUFB 2AS9A 3L3TA 3M3SA 1JMOH 1Q31A 3M5NA 1ZOMA 1FY1A 4AFQA 1O3JA 1HAXB 4NIXA 2BY5X 1INCA 1QR3E 2GV7A 3T62A 1C1PA 2OQUA 1NM6A 2YNBA 4IW4E 3ELAH 1P2IA 3GCTF 3RXGA 2Z3CA 1UTQA 2VWLA 1C5ZB 4INLA 4UEHH 3VXEH 2P3UB 1ANEA 2F9UA 1C2FA 2ZPSA 4MNVA 1RGQA 1B0FA 5LPRA 1MTNB 2BD4A 1GJDB 1UTKA 1WYKA 1HBTH 3W95A 3STIA 1F0SA 5FXLA 1ABIH 1TMUH 1O2GH 1TFXA 1SGQE 1DWBH 1THSH 1BJVA 2PW8H 5HM2A 3KQCA 1P09A 4NFEA 2GCTB 3BTKE 5BPEA 5K0HA 5T6FA 5C20A 2P8OB 2A5KA 2R2WU 4CHAB 1TE0A 3QGNB 1X7AC 5CHAC 1UO6A 3E0PB 1SFIA 2A4OA 2GZ9A 2GT8A 2VH6A 4YO9A 1A3BH 6ESTA 1NFUA 5J4QA 2R3YA 2VWMA 1C2IA 1KDQA 3A7VA 1T8OA 2F9VA 5DKMA 7GCHF 2HPPH 2H9TH 2KAIB 1JBUH 1DLKB 1IOEA 2EA3A 1V3XA 2TGDA 2VIPA 3BTQE 1FV9A 4OS4A 2UWPA 3P8FA 3MH4A 2V0BA 5L30H 3MHWU 1H4WA 1PQ8A 1YPMH 1KYNA 3PLKA 3VXFH 4DJZB 1DT2A 2OINA 1FZZA 2P3TB 4YOIA 5F6MA 3HK3B 1TAWA 1FXYA 3D65E 1GHBG 2AH4X 4NIYA 1XUFA 2FIRH 2RG3A 1PPBH 1V2KT 1WV7H 3EYDA 4XBCA 1TPPA 1ZHPA 1BMAA 2Z94A 1W7XH 1YCPK 3ATMA 3ZZCA 3LONA 3LGUA 3MH7A 1J14A 2AMQA 2LNCA 3A81A 4X0WU 1O37A 5PTPA 4MVNA 2ODQA 2ZHFH 1GVZA 5AF9H 4GCHG 1HAYB 1C2DA 3VB3A 1OWDA 2IOTA 2WPMS 4WMDA 3RXJA 1C5YB 3ATIA 1O2RA 3I78A 4YT6H 1QNJA 1ID5H 1SBWA 2Z9KA 3F68H 3LPRA 3S9AA 2SGFE 1YPJH 1BTUA 1UJ1A 7KMEH 2BX4A 4OS6A 2C3SA 1C9TA 1RIWB 2WYGA 5E2PA 2FESH 1BCUH 1XXFA 2YNAA 5JDUB 3E3TA 4D7GA 1DWDH 1PPZA 1GWAA 3UNQA 1Z8GA 3H7OA 2ANMH 2SNVA 3RXMA 2ZHQH 1XMNB 2AERH 3SJ8A 1HJAB 1KLIH 3QWCH 4Y8XA 3U9AH 1C1TA 4FU7A 3FANA 5F8ZA 1DUEA 3KHVA 2ZFRH 3U1IB 3AVZA 2STBE 1VCPA 1QBVH 1TPAE 2ZEBA 4HZHA 3SU5A 1O38A 1D3DB 3BTTE 3EQ0H 1NRPH 2FOCA 9ESTA 4A1XA 1HUTH 2IPHA 1TRYA 2BOKA 5EQSA 1ABJH 2GX4A 2ZCKP 3RXCA 2XC0A 1HAOH 3RMOH 4HTCH 2Z9IA 2PKSC 1YKTA 3KIDU 1SHYA 2BVSH 3SHAH 3LH1A 1B5GH 2FTLE 3FFGA 1Y8TA 3SUDA 3SNCA 3MU5A 1P12E 1Y3UA 3URDA 2I6QA 4GLYA 1NRRH 2GMTB 3QTOH 4Y6DA 3SU4A 1NFYA 3FP7E 2FYRA 4OS2A 1OP0A 1O34A 1QB6A 2P94A 3KEEA 3LC3A 4FU8A 1GBIA 1AN1E 3GDUA 1LHCH 2BLVA 3MH5A 1KSNA 1PPCE 1KTSB 1G2MA 3ZYDA 4X1PU 2ZTZA 1SI5H 2FM2A 1E36B 4YOGA 1YM0A 2V3HH 1GI6A 1EASA 1BMMH 4A6LA 1S5SA 1DWEH 2GCHG 1IQHA 1OWEA 2BYAX 3S9CA 1OSSA 1AKSA 2BD9A 6CHAC 1GCTB 3UWJH 2J34A 5C67A 1S6HA 5DJ7A 3I29A 2JH0D 1TPSA 4MLFB 4GVUA 3CP7A 3NWUA 3LC5A 1WU1A 2FOEA 2XYAA 2WPKS 4FUBA 1LPGB 5K7RA 1SLUB 4AG1A 2QA9E 4RSPA 2ZHDA 1EZSC 1TNHA 2ZIQH 1BBRH 4FUJA 4NA8A 3OY6U 1QQ4A 1OYQA 5E0HA 4BXSA 5DP3A 5FPSA 2JH6D 3MU4A 1KXEA 3M5MA 3M3VA 3S7HB 2VNTA 4B2CA 5LGOA 5E0JA 1RTFB 4A7IB 3BG4C 1W10U 1SQTA 1N6YA 2ZFPH 3A86A 5JBTA 1Q3XA 1LVYA 3MYWA 1WTHD 2QC2A 1L0ZA 1A61H 3BTDE 1IQGA 3G01A 3ZZ3A 1UVTH 1Y3YA 3NXPA 1O5GH 5ABWA 1YPHE 1SLXB 5C5NA 2F9NA 1MQ5A 4X2WA 2ZCHP 3S69A 1HDTH 2EI8A 1MTUA 2A1DB 3M37A 1BA8B 1WQSA 2F91A 3BTFE 3C1KA 1T8MA 2R0LA 1TBQH 3OTJE 1GL0E 1PQ5A 1C5PA 1LVOA 1EPTB 3EGKH 1S85A 1DFPA 1V6DA 1RTKA 3SU3A 1S83A 5C3NA 1T4UH 1KLJH 2GDDA 1C5TA 4H42U 1BRCE 1CHGA 1HJ9A 2FOGA 3M5OA 2XCNA 1K28D 2RA0A 2BD8A 1O2TA 1ELBA 2C4FH 4K2YA 4BXWA 1ZMNA 2ZFFH 2F3CE 1O2NA 5JB8S 1C2LA 1C5RA 2FI5E 1ZHRA 2GP9B 1OXGA 3TVJB 1F92A 7GCHG 1Z71A 2FLBH 3KQBA 5GIBA 2FZZA 1FY8E 1SSXA 3A8AA 5C1XA 1MTVA 1SGDE 2BQ6B 1PJPA 1CHOF 4K69A 4UFGH 1J8AA 6LPRA 1MKWK 1E0FD 1C5UA 1JRTA 4WY3A 3ZZ4A 3BEFB 4YESB 5A0BA 2DE8A 3GYMA 1DX5M 1GJ9B 1HJ8A 3MOCA 1V2OT 3WY8A 1QL9A 3NPSA 2WV5A 1QB9A 3BIVH 2ZPQA 1KDQB 1ZGIA 2QXGA 2VVVA 4O3TA 1OWHA 4WXVA 4ABJA 1J9CH 4ABFA 3UNSA 2ZGXH 1FY4A 4UE7H 1ELEE 2FOBA 3BG8A 4KTCA 2O9QA 4NIWA 1QJ6B 4Y8ZA 3SNEA 1GDUA 2B5TB 1CT2E 3ATLA 4UFEH 3UR9A 3SU6A 4CRGA 1HNEE 2AMPA 3RMNH 3RXRA 1C5WB 2ZU1A 2OCVB 3GDVA 3PLPA 1HYLA 3BN9A 3BTEE 2TPIZ 1CBWB 1N8OB 1YPGH 4A1TA 4AB9A 1MZDA 4I33A 4ABGA 1P2OA 3PV4A 3LIWA 3LGTA 1TGTA 1ELAA 3GYLB 4ISIH 1K1IA 2R3UA 3SV9A 2ANYA 4LK4A 1SGRE 4BAKB 2W7UA 3N7OA 3HGNA 1MTWA 1V2NT 2V35A 3EE0B 2YOLA 4OGYA 2HPQH 2VIQA 2VIDA 4NWKA 2ZI2H 4B73A 2PHBA 1Y5UT 4PROA 8GCHG 1FONA 3UIRA 1EP5A 1Z6EA 4UFFH 4UDWH 3ZVBA 1MH0A 3ESTA 1LPKB 3FP6E 3LT3A 4NCYA 4A92A 2BX3A 2DUCA 1ELCA 1C4Y2 3ZV9A 1TRNA 4TY7A 3ZVCA 1H8IH 1W11U 1IHTH 4XFQA 3TNSA 4NZLA 1CA0C 1VITH 1QB1A 1LHEH 4B71A 1TMTH 3GY3A 3Q77A 1W3CA 3PMJA 2CGAA 1Z6JH 4X6NA 3D23A 1LTOA 1K1PA 2G5VA 1VGCC 3UQOA 1P02A 2W3IA 4JZFH 1GI3A 4AFZA 4LXBH 2QAAA 1WSSH 4FUHA 5DG6A 2ZU3A 3V12A 1O2SA 1TALA 2ZGBH 4IC6A 1DE7H 4KTSA 2VB0A 1EAUA 1HV7A 5LPEA 4TPYA 3NKKA 1ZPZA 1L1NA 1P2JA 2B7DH 1F0TA 1GI7B 2BD3A 1TGNA 1VITF 1QRWA 1A7SA 4TY6A 1GCDA 5HGGA 3SW2B 4Y10E 1S82A 4ZH8A 4UD9H 1MD8A 2P16A 1UHBA 3NK8A 3U8RH 2Z7FE 3GCHB 4FU9A 2BDAA 1K22H 4IN1A 1MTNC 4NGAH 1TX8A 1O5BB 1P03A 1JOUB 2XRCA 2BQWB 3ZZ9A 5HXFA 1NY22 1ARBA 3E1XB 1V2MT 5A8ZA 5IDKA 3SV2H 5E8EH 3SU1A 1V2QT 4HI3A 3RP2A 1WQVH 5EW1H 1FI8A 1AO5A 1DLEA 2GCTC 5DP5A 3OYPA 1MU8B 1O39A 1LO6A 2P8OC 4CHAC 1FAXA 4E7RG 1IQIA 1XM1A 1CGJE 4YOJA 1AKSB 3A88A 1P9SA 4NA9H 5EU8A 2OQ5A 3Q00A 2ZP0H 1Z8RA 1O0DH 2BM2A 3P70B 1OX1A 3B9FH 2I6SA 5GDSH 1QQUA 5EPYA 4AX9H 2G52A 4ISNA 4ISLA 4XBBA 1O33A 2QYIA 2Y7ZA 2A5IA 1B7XB 3UFAA 1NU9A 1Y5AT 1YPKH 2F83A 2J9NA 4J1YA 4MNXA 1YGCH 2VH0A 5JB9S 5SGAE 3PWCA 2GKVE 4ZROA 2H2ZA 5DP4A 1E35B 3ZZ7A 1VCQA 1OWIA 2ZECA 1MBQA 1RXPA 2AGGX 4ZUHA 1GVLA 1ZR0A 4AB8A 1WUNH 5JBCS 2GGVB 4I8HA 4DVAU 5GCHF 3ZZAA 1BTPA 2TGPZ 2B8OH 1DICA 1O3GA 4WH8A 1F5RA 1GHAF 3RLWH 3T29A 1SQAA 5DGJA 2VVUA 1Z7KA 1F7ZA 1V2TT 1BMNH 2GDEH 2WPHS 2Y7XA 1F5LA 1AGJA 1C1OA 1EOJA 3K6ZA 1EXFA 4NSYA 1O2KA 2HNTF 1SOZA 3HGPA 5GXPA 1ELDE 1ELFA 1RS0A 2OLGA 2FYQA 2STAE 1O31A 4GSOA 3O8DA 1IQJA 2QF3A 2A2XH 1SL3A 3RM2H 2M5TA 1NS3A 5GPIB 9LPRA 3SHCH 4BTUB 2FS9A 1GBFA 1QJ1B 5HYOA 3ZVEA 3VB4A 2CF9H 1PPEE 3P95A 3TPIZ 4X2XA 2UWLA 4VGCB 3P8OA 2NU3E 2BZAA 1CHOG 3U1JB 4CR9A 1RIWC 4LOYH 2WUBA 2F9OA 5CMXH 1ZSJA 1SR5C 2NU1E 4K1TA 2H5DA 3JZ1B 4X1RU 3T26A 1UVPA 1KLTA 2SNWA 2Z3DA 3NUMA 4AYVB 1MMJN 2BZ6H 1BQYA 1C2GA 1W13U 4H6TA 3SV8A 2ODPA 1BZXE 2BLOA 4JK6A 2A7CA 4X1NU 1HJAC 4BANB 4LZ1H 1SPJA 2C8ZB 4CRCA 3UOPA 3TNTA 1GPZA 2G81E 1LCYA 1GHXH 4B76A 2ZFTA 1GBKA 4JZEH 1DY9A 2BB4A 1UTNA 1NT1A 1PYTC 4Q2KA 5I46H 1TNJA 1FY5A 2XCFA 1BOQA 4JYUH 2Z9GA 2ZHEH 4E7NA 1GI0A 5DK1A 4GUXA 1OWKA 3OSYA 1YC0A 3SJKA 1QJ7B 1N1LA 5AHGH 1QCPA 1O2QA 1O2PA 1P05A 1W7GH 4AFUA 5B6OA 3F9EA 1EB2A 2J2UA 2OD3B 1CGHA 2GMTC 3RU4E 3EA8A 1SB1H 4KKDA 3VGCB 2AYWA 1O35A 3FP8E 3LOXA 1D4PB 2BY7X 2OXSA 2Y5HA 3PYHA 3EAJA 1NRQH 1A46H 3VPKA 4Y76A 4KGAA 5BRRE 1LVBA 4MPWA 4NIVA 5ESTE 3T5FH 2FOFA 2O8WA 1O2OA 2IN2A 1O2MA 2PTCE 4I32A 4KTUA 4A1VA 2OP9A 4NWLA 2QY0B 3BTWE 2J95A 1C5QA 2OUAA 3K9XB 3KN2A 3BEUA 4AFSA 2VIWA 1IHSH 1GCTC 1BRBE 2WV4A 2ZC9H 4IMZA 3IWMA 1GVKB 1ZHMA 3SQHE 5J4SA 1MZAA 2AIQA 4KELA 4OGXA 1K1OA 1NROH 4ZHLU 8GCHF 3NZIA 3R3GB 1UVUH 1TYNA 2W3KA 1T4VH 3A7ZA 2WPJS 4ASHA 1XUHA 2R0KA 1A0JA 2G51A 2D2DA 5CE1A 4Q7XA 3SN8A 1BB0B 1L4ZA 3UPEA 3KQEA 1TMBH 4Z6AH 5FX5A 2FDAA 5ETXA 3TH3H 1C2KA 4GAWA 1GJAB 2ZA5A 7ESTE 4XBDA 2PGQB 3BF6H 1O3EA 4BAOB 4WXIA 3RLYH 1P10A 3SV6A 1D3TB 1O5AB 3QUMP 5LH8A 1A0HB 2J94A 1JRSA 1VITG 3RXKA 1TA2A 2Z9JA 2ZCLP 4CH8B 2H9HA 6GCHF 1MD7A 1XUKA 4ABHA 1A1RA 2Y5GA 3QTVH 4X2YA 3Q76A 4D9QA 2BLWA 1LKAA 1QBNA 3MFJA 3QLPH 3M61U 1ETSH 2ZFQH 1Y3VA 1YPEH 4YLUA 2A31A 1EPTC 1TLDA 1BJUA 3GY4A 2ZWLH 1NTPA 4D8NA 1E37B 3OU0A 4MPVA 1C1UH 1YP9A 2PSXA 3PTNA 1A2CH 4TWYA 1KY9A 3PMAB 1LHFH 3SI4H 1WBGB 2ASUB 3GISB 2OTVA 1P0SH 4BAMB 2GD4B 3UUZA 2BOHB 5HM9A 4FUCA 5FBIA 3K65B 2EI6A 1SHHB 1TBZH 1DVAH 1UHBB 4XSKU 1NFXA 1HLTH 4DOQA 2ZQ2A 4BTIB 1K21H 5TCAA 1AVWA 3ATKA 3TGIE 3Q3XA 1TWXB 2QXIA 2NU4E 1O2UA 5EW2H 3SU2A 2XNIA 1S81A 1H9LB 1LVMA 4I7YH 1BITA 1FNIA 3T25A 2FWWA 4MDSA 2TRMA 1VCWA 5JPMH 1QY6A 4Y11E 1AIXH 2A32A 1O30A 2G4UA 3LGWA 3PO1B 3A84A 3MU1A 1ZRKA 1QL8A 5GCHG 2SGQE 1L4DA 2Z9LA 1H1BA 4WVPE 2ZDNA 1GHAG 1OP8A 1VR1H 3UNRA 4JYVH 2UUKB 4B2BA 1F5KU 2HWLB 2HNTC 1NO9H 3RU4D 1GI1A 4HGCA 3PTBA 5EODA 2P59A 1BBRE 1QA0A 1BTWA 1XKBC 1P3EA 2EI7A 3SZNA 4NZQA 3ZZ8A 1CBWC 1C4U2 1AD8H 4I31A 2HRVA 1CQQA 1BIOA 1A5IA 1YYY1 1SGFA 3P6ZB 5I25A 3IITA 3I77A 1C1QA 2CXVA 1DS2E 3SJOA 2XBXA 1CGIE 1TOMH 2HOBA 1O2IA 2C90B 1C9PA 4NA7A 1PPGE 3CS0A 1B0EA 1GL1A 1P04A 3LH3A 3PWBA 2XC5A 3QZQA 4K5ZA 4WH6A 1LQDB 3O8CA 2VWOA 1GI8B 2WINI 4IMQA 3O8RA 3GY6A 1CO7E 2ZTYA 2UUYA 5FAHA 3MU8A 2ALPA 2JH5D 1CE5A 3MNBA 2Y80A 4JYTA 2H9EH 1GBAA 1EP6A 2G4TA 1MU6B 2PUXB 4X8UH 3MMGA 3F9HA 5A0CA 2ZZUH 1L1JA 1D3PB 2PUQH 2BDGA 2OBQA 3A87A 3A7TA 2A7JA 3AASA 2BDBA 1O5FH 1UK4A 3ENSB 1P2QA 2QF0A 4O03A 2XW9A 2FP7B 3EA9A 3VB5A 2UUJB 2W5EA 1QGFA 4ZXXH 4R8TB 3ZZBA 1ELGA 5EPNA 3ODDA 1QBOA 1SLVB 1W8BH 1SGEE 4ZKNU 1DUAA 1J17T 1MKXK 5T3HA 5L6NH 1KXCA 3P17H 1HXEH 1C2HA 4YT7H 1AI8H 4HFPB 5JBAS 3ODFA 4JCNA 3RU4T 1GDQA 4ZXYH 4KP0A 4I8LA 3MNSA 1C1WH 1TGSZ 3F9FA 1V2VT 1NU7B 1C5MD 2GZ7A 4XDEA 1BTYA 3F1SB 3LDXH 4DW2U 1C2EA 1AFQB 3TLOA 1V2ST 2ILNA 3GDSA 1G32B 2BHGA 1QFKH 3ZZDA 3B23B 4TYDA 1HAPH 3GCHC 1C5VA 2BD7A 1SGCA 1P8VC 1HGTH 3GY2A 2AGIX 1QRXA 1HIAA 2PSYA 4O97A 1GHYH 3RM0H 2ZG0H 1FPCH 7LPRA 5JBBS 1DDJA 3RDZA 5H4IB 2R9PA 3P92A 1BBRK 4Y0ZE 1HRTH 2WYJA 3FZZA 1H8DH 4MPUA 1G36A 3PROA 3V13A 1S84A 2XBWA 4OS7A 1O2ZA 1G37A 1ZRBA 1ANBA 1D9IA 1RTLA 1FQ3A 5FPYA 1TX6A 3RXUA 3LGVA 3M36A 1KXAA 2AEIH 4DGJA 1TABE 2UWOA 1EZXC 3LJJA 1ANDA 1KXDA 2FXRA 2SFAA 3RC4A 1DM4B 3MTYA 3SNAA 4GPGA 1OS8A 1DXWA 2J38A 2ZDAH 1DOJA 3GCNA 5EG4A 3UREA 1YCPH 4Y7AA 1GBLA 1Y59T 1O3HA 1A3EH 1BMLA 3QO6A 1UTJA 2BMGB 2RA3A 4JZDH 4WMEA 6GCHG 3UOUA 1GJ7B 1FN8A 1QL7A 1O2YA 2VGCB 2OC0A 1MBMA 1P9UA 4RKOB 2FOHA 1T31A 5JYIA 3BTGE 4AORA 1FAKH 1TQ0B 1GHWH 2JETB 1C1SA 1DY8A 2XBVA 4DIIH 3A8CA 1W2KH 2BVXH 2FI3E 2ULLA 4FUFA 3L6PA 1GI4A 1Z8JB 4K1EA 3PM3A 2PLXA 2BXUH 3EDXB 3T27A 3TU7H 5EQQA 3A7WA 2H5CA 1AB9B 1C5SA 4DG4A 3AAVA 4X8SH 1ACBE 1ORFA 1AQ7A 4MNWA 2BY9X 2BDCA 3H5CB 5EXLA 5A8YA 1UVSH 4VGCC 1AUJA 4Q7ZA 2B0FA 1GGDB 1AWFH 1WTGH 5C5OA 2PV9B 2H1UA 1GJBB 2Y81A 2GT7A 2BDYA 2TGTA 2Q6DA 3A80A 1UCYE 3HPTB 4X6OA 1SC8U 3DA9B 3E90B 1O5EH 1PQ7A 5EXNA 2C8YB 4MNYA 1KXFA 4BAHB 4I8JA 1GMDF 1KTTB 1EAXA 1YPHC 2A5AA 1IQKA 1AE5A 2RCEA 4UONA 3F9GA 4B74A 1GJ4H 1THRH 3RXBA 2XXLA 1O3BA 3S0NA 3SOSA 4AYYB 1GBTA 4DCDA 3RXDA 1ELTA 2QCYA 1ZPCA 2ZHWH 2VWNA 1ZGVA 2GVFA 1CSOE 4OS5A 2XC4A 2BLQA 4X8VH 3MI4A 1MAYA 1NFWA 4IS5A 1BRAA 1FJSA 1ZSLA 1O2WA 5AFYH 3A82A 3ZZ6A 3GOVB 1EJNA 1SGYE 1HAVA 1PYTD 1K2I1 3QGJA 1N6XA 1SGIB 3BV9B 4CRDA 5L2YH 1CT0E 1AVXA 1ZMJA 3LJOA 3UY9A 3ZVGA 4Q7YA 4XOJA 1A5HA 1GBEA 1HXFH 2FS8A 2VVCA 3MO3A 1H9HE 3VGCC 2BXTH 3KNXA 2CJIA 4LZ4B 1FY3A 5AFZH 2AIPA 1FUJA 2HNTE 3GY7A 3M7TA 3QDZB 3K2UA 4BNRA 1FN6A 3LGIA 4JMYA 5A0AE 4AOQA 3DD2H 1O5DH 2TGAA 2PFEA 4YM9A 1GMHF 3SNDA 1O3CA 5E2OA 1KIGH 1EAIA 1G3EA 3BIUH 1ZLRA 1O2LA 1BHXB 3F6UH 3TJVA 1F0RA 1SG8B 2CMYA 2LPRA 3O8BA 3M35A 1O2XA 1O32A 3ITIA 1EKBB 1TBRH 5C2ZA 1EJAA 1ZTJA 3A83A 4Y79A 3HK6B 2BDIA 1O3IA 3GY8A 1YPLH 1DITH 3RXVA 1DWCH 4IGDA 1DANH 1GI9B 3U8TH 2HGTH 2TBSA 3HKIB 4K8YA 4ISHH 4GHQA 4ZKOU 1XVMA 2IJOB 2O8LA 5E0GA 2ZDKA 1GG6B 1OOKB 1TGBA 4JZ1A 1VJ9U 2CHAB 2WPIS 4ISOA 1NC6A 1PPHE 1Y3XA 1P06A 1O3AA 1K1JA 5ESBA 4NFFA 2VU8E 2W26A 3A7YA 4RN6A 1FPHH 5TJXA 1BUIA 2XWBI 1Z8IB 1UCYK 2P3FH 3M5LA 3NCLA 4DT7B 4WMFA 1S6FA 2WPLS 1FDPA 1AZ8A 1K9OE 3LKWA 5LPFA 1RD3B 1QURH 1IQMA 1RFNA 2VINA 2ZF0H 3V7TA 3CENA 1O2HA 4IBLH 4Q80A 3ZZ5A 3RXEA 5GWZA 4XE4A 1XUGA 2ZDLA 2FI4E 1GJCB 3OX7U 1HCGA 1KXBA 2A4RA 1THPB 1NPMA 2H6MA 3A89A 1O3NA 1RJXB 3TJNA 1K1NA 3M7QA 3DUXH 4NG9H 4O9VA 3QX5H 4GHTA 5CHAB 4IC5A 1HAGE 3C27B 3QK1A 4ZKRU 3H7TA 2QXHA 4K1SA 2WUCA 3MO9A 1P2MA 2FMJA 1OPHB 4X2VA 4UFDH 8ESTE 5DP6A 3ZVAA 5TCCA 3AW1A 1DSTA 4H4FA 4IN2A 1GBJA 4CBNA 1MKWH 2FOAA 1EOLA 4ZMAH 3RMMH 2FO9A 3ZV8A 1D6RA 1ZTKA 1AVGH 3RXFA 1QHRB 1HB0B 1C1RA 4F49A 1ZMLA 1O3MA 1HIAB 1ARCA 2BY8X 1F0UA 3E16B 4INHA 1YF4A 1AWHB 3FZDA 1OKXA 1PFXC 1SGPE 5A2MH 1DPOA 3SU0A 4YZUA 3KCGH 1O3DA 4Y8YA 3E8LA 3SNBA 5A09A 1ZPBA 1P01A 2ANWA 1YBWA 1HPGA 2GZ8A 1GMCF 1SMFE 3PO1C 3TGKE 3KF2A 1AU8A 3TK5A 1O5CB 4Y7BA 3UR6A 1IQEA 1ESAA 1G9IE 1MCTA 1GDNA 3AAUA 1MKXH 1S0QA 1A0LA 2ZU2A 2GTBA 4SGBE 4FUGA 5HMAA 1LHGH 3RXPA 1S0RA 1K1MA 4AGJA 1NZQH 3B8JA 4B1TA 1XXDA 2TIOA 3ATWA 3U69H 2QGRA 3P8NA 1A4WH 3SBKA 3SGQE 4AZ2B 1PPFE 1HAZB 3TH4H 1ETTH 3RXHA 1ESTA 1V2RT 4Y71A 2F9PA 1J16A 1OYTH 2EEKA 2Y5FA 3RXLA 2PGBB 3SI3H 1TONA 3KL6A 4U2WA 2A4QA 2D26C 1UK3A 1O36A 2ALVA 3E6PH 1AUTC 3LU9B 1P3CA 1C2MA 2V3OH 1J15A 3VB7A 1ZSKA 1SGTA 2ZPRA 1AHTH 2XWAA 1V2UT 1BTHH 2FODA 3FVFB 2D8WA 1K1LA 2ZU5A 4FXGH 2ZKSA 4AGKA 5FHTA 4CRAA 3SUEA 1XUJA 2VIOA 2P93A 4FUDA 1EZUC 2G8TA 1QIXB 3QZRA 4X6PA 3RUOA 4INKA 1LHDH 5DPAA 1E38B 1GMDG 2A2QH 1O3LA 4CR5A 3RXAA 3RXIA 3MH6A 1HFDA 3EA7A 2PKAA 3ZVDA 2W7SA 2RDLA 4J2YB 1O3FA 5GJ4B 1BHXF 4Z0KA 1C1NA 1NRSH 1MQ6A 1LQEA 1T8NA 4O3UA 2G00A 2ODYB 1EATA 1ETRH 3TK9A 1G30B 1F2SE 2PKSB 5C1YA 3DFJA 2HLCA 2CV3A 1V2JT 2ZGCA 1LMWB 1AFEH 1DXPA 3PMBB 4WF8A 3E0NB 1JWTA 1FMGA 2ZDMA 1GBHA 1AY6H 2BD5A 3RC5A 5DP9A 1FIWA 1CVWH 3P8GA 5EOKA 3QN7A 1W14U 3GCTG 3BTHE 1GI2A 3MO6A 3CS7A 1H9IE 4ZAEA 1EQ9A 1EUFA 1UTLM 3T28A 2ZO3H 3SJIA 1C2JA 4CBOA 2Z3EA 1G2LA 2BD2A 2QV1A 2FTMA
chains in the Genus database with same CATH superfamily
1Y3WA 4B75A 1EAWA 1N8OC 3M7UA 3W94A 2F9BH 5DP7A 1C5OH 3UTUH 1ANCA 1U6QA 1W0ZU 3DFLA 2A7HA 1VZQH 1UK2A 2K1QA 5AVDA 2ZNKH 2SGDE 2G5NA 2NU2E 1GMHG 2NU0E 2OC1A 1Z1IA 2BTCE 1WOFA 4ABIA 3GY5A 1HAVB 6CHAB 1O2VA 4M7GA 3LGYA 1YLCA 3MNCA 3SO3A 1AFQC 3IG6B 2KAIA 1EX3A 1Z1JA 5T6GA 1ZYOA 5HIZA 3SQEE 3DHKH 4ABBA 3TJUA 2P95A 3FKSD 2XBYA 1GBMA 1CT4E 4U32A 1TNLA 2NWNA 3RXOA 1L2EA 4K60A 2OC8A 1BTXA 1BRUP 3CNRA 1P57B 1TNKA 1L1GA 1PQAA 3KQ5A 1GBDA 3D49H 4D7FA 5IYTA 1IQNA 2C8WB 1TGCA 2FLRH 1W12U 1UTOA 4WJG2 1TB6H 3TK6A 2JDID 1P2KA 1UMAH 2THFB 3BG4B 1T7CA 2QIQA 4F4OC 3E91A 2A4GA 1SVPA 2VIVA 1AMHA 1TQ7B 8KME2 1ZJKA 3M3TA 1C5NH 1GJ8B 3TIUA 4FVBA 4BOHA 1SOTA 4E06H 1HAIH 3STJA 1V2PT 1AZZA 1D6WA 1XKAC 3A8DA 4JZIA 3Q3KA 1C4V2 1C5LH 2EC9H 5F8TA 4QT8C 2O8TA 1IQLA 4X6MA 4D76A 1V2LT 3SJ9A 3S7KB 1E34B 1TNGA 2AGEX 1NESE 3DT0H 4ABEA 3BEIB 4WWYA 1EFRD 2Z6BD 1JIRA 2SGEE 3KQDA 3TITA 1GHBF 1GJ5H 3GCOA 3SGAE 1Y5BT 1XX9A 3OEHD 4K8BA 1T32A 3HATH 5T6DA 5A8XA 1BTZA 3MWIU 5FCRA 1FIZA 3U8OH 5DO4H 2VGCC 1C5XB 3A7XA 1BT7A 5EXMA 2KFWA 1ELVA 3ZVFA 2KX4A 3RC6A 2ZGHA 2PTNA 4CREA 2ZU4A 2JETC 3VFEA 3PLBA 2ZQ1A 1EB1H 1TPOA 2CF8H 3RXTA 2VJ1A 3SORA 1GHZA 4GCHF 2ZDVH 2QXJA 1C1VH 3VB6A 2YMSC 2AMDA 2RFKC 1IAUA 5CDFE 2HALA 2G55A 1RRKA 2CN0H 1ZJDA 3T2NA 3BTME 5EQRA 3TGJE 4RKJB 1Q2WA 3PMHB 1AB9C 2R2MB 1IQFA 2F4LA 4A5TS 4FUEA 2C93B 2PWXA 2XTTB 4AG2A 1P11E 3L33A 1OP2A 4U01A 1TA6A 1MAXA 3SUFA 1MABB 3JZ2B 4JK5A 1SLWB 2PR3A 4DY7B 1M9UA 1FLEE 3KGPA 3SV7A 4BAQB 1GGDC 1W0YH 2JKHA 3TH2H 1ZTLA 3FAOA 4ZHAA 1BDAA 1LDTT 2DE9A 2ESTE 1NBME 1YCPM 2BDHA 1GBBA 1HAHH 1VJAU 3KYFA 5FBEA 1O2JA 1O3OA 1QRZA 1WAYB 3ZYEA 2ZFSA 4CRFA 4ABDA 1GMCG 2J92A 3U98H 2FEQH 1UTMA 2FX4A 2ANKH 2SGPE 3RMLH 5KEDA 1QTFA 1QA7A 1SFQB 1GHVH 1CU1A 2FOMB 4DURA 3K6YA 4CH2B 1V2WT 2A0QB 5EGMA 1G3CA 4D9RA 4I8KA 1EJMA 4I8GA 1OWJA 5L2ZH 3Q3YA 2KCYA 1NN6A 1T8LA 4ZHMU 1AE8H 1TX7A 2OBOA 4ASUD 4X8TH 3UWIA 2QN5T 1UTPA 2Y6TA 4CRBA 1MCVA 4K3JA 1BMFD 3DSGA 1D3QB 3TJOA 1TNIA 1P2NA 4H6SB 1NRNH 2SGAA 1JIMA 1O3KA 1XVOA 2D1JA 1UVOA 1YLDA 3VEQB 3R0FA 4B2AA 3SUGA 1UCYH 1SGNE 1A5GH 1G3BA 1TOCB 4THNH 1MUEB 2ZGJA 4DIHH 3URCA 1XUIA 2V6NA 5FX6A 5FPTA 4Y0YE 4YTAA 3OY5U 4R0IA 3MNXA 1C1MA 4TPIZ 3SGBE 1GI5A 1DSUA 4AN7A 3V3MA 4BTTB 3V0XA 3RXQA 4OS1A 4ABAA 2GJGA 5F03A 1TIOA 1EZQA 3BSQA 2KM0A 5G4BA 4MG3A 4ZKSU 3A8BA 3UQVA 3HKJB 3MU0A 2GCHF 4FVDA 2BQ7B 1G3DA 3S9BA 3D62A 4MTBA 1GJ6A 2Q1JA 3AW0A 2C8XB 2FPZA 4YLQH 1CA8B 4TWWA 1JXPA 4X1QU 2Y82A 1YLNA 2XOKD 2Q6FA 2BVRH 1TRMA 1ESBA 1SGFG 2AFQB 5F8XA 1CA0B 2FX6A 2HVXA 2ZTXA 4U30A 1LKBA 4E05H 1ZZZA 8LPRA 3GICB 3PB1E 3A85A 1WCZA 4MQAA 2AHME 2M2AA 2BY6X 2OC7A 3RXSA 1GBCA 2B9LA 1SQOA 4FUIA 5FCKA 3N99A 2O8UA 4MPXA 2O8MA 1VGCB 1LPZB 5C1UA 2GV6A 4NSVA 4SGAE 4X1SU 5DP8A 2J98A 2A45B 1MTSA 2PKAB 1GG6C 4ESTE 1O3PB 1EPTA 2Q6GA 2CHAC 2J4IA 2UUFB 2AS9A 3L3TA 3M3SA 1JMOH 1Q31A 3M5NA 1ZOMA 1FY1A 4AFQA 1O3JA 1HAXB 4NIXA 2BY5X 1INCA 1QR3E 2GV7A 3T62A 1C1PA 2OQUA 1NM6A 2YNBA 4IW4E 3UB0A 3ELAH 1P2IA 3GCTF 3RXGA 2Z3CA 1UTQA 2VWLA 1C5ZB 4INLA 4UEHH 2KCAA 3VXEH 2P3UB 1ANEA 2F9UA 1C2FA 2ZPSA 4MNVA 1RGQA 1B0FA 5LPRA 1MTNB 2BD4A 1GJDB 1UTKA 1WYKA 3H09A 1HBTH 3W95A 3STIA 1F0SA 5FXLA 1ABIH 1TMUH 1O2GH 5KGOA 1TFXA 1SGQE 1DWBH 1THSH 1BJVA 2PW8H 5HM2A 3KQCA 1P09A 4NFEA 2GCTB 3BTKE 5BPEA 5K0HA 5T6FA 5C20A 2P8OB 2A5KA 3DSOA 2R2WU 4CHAB 1TE0A 3QGNB 1X7AC 5CHAC 1UO6A 3E0PB 1SFIA 2A4OA 2GZ9A 2GT8A 2VH6A 4YO9A 1A3BH 6ESTA 1NFUA 5J4QA 2R3YA 2VWMA 1C2IA 1KDQA 3A7VA 1T8OA 2F9VA 5DKMA 4FOUC 7GCHF 2HPPH 1NBMD 2H9TH 2KAIB 1JBUH 1DLKB 2EA3A 1IOEA 1V3XA 2TGDA 2VIPA 3BTQE 1FV9A 4OS4A 2UWPA 3P8FA 3MH4A 2V0BA 5L30H 3MHWU 1H4WA 1PQ8A 1YPMH 1KYNA 3PLKA 3VXFH 4DJZB 1DT2A 2OINA 1FZZA 2P3TB 4RT1A 2PP6A 4YOIA 5F6MA 3HK3B 1TAWA 1FXYA 3D65E 1GHBG 2AH4X 4NIYA 1XUFA 2FIRH 2RG3A 1PPBH 1V2KT 1WV7H 3EYDA 4XBCA 1TPPA 1ZHPA 1BMAA 3F0PA 2Z94A 5KECA 1W7XH 1YCPK 3ATMA 3ZZCA 3LONA 3LGUA 3MH7A 1J14A 2AMQA 2LNCA 3A81A 4X0WU 1O37A 5PTPA 4MVNA 2ODQA 2ZHFH 1GVZA 5AF9H 4GCHG 1HAYB 1C2DA 3VB3A 1OWDA 2IOTA 2WPMS 4WMDA 3RXJA 1C5YB 3ATIA 1O2RA 3I78A 4YT6H 1QNJA 1ID5H 1SBWA 2Z9KA 3F68H 3LPRA 3S9AA 2SGFE 1YPJH 2EY4C 1BTUA 1UJ1A 7KMEH 2BX4A 4OS6A 2C3SA 1C9TA 1RIWB 2WYGA 5E2PA 2FESH 1BCUH 1XXFA 2YNAA 5JDUB 3E3TA 4D7GA 3N7DA 1DWDH 1PPZA 1GWAA 3UNQA 1Z8GA 4XD7D 3H7OA 2ANMH 2SNVA 3RXMA 2ZHQH 1XMNB 2AERH 3SJ8A 1HJAB 1KLIH 3QWCH 4Y8XA 3U9AH 1C1TA 4FU7A 3FANA 5F8ZA 1DUEA 3KHVA 2ZFRH 3GS9A 3U1IB 3AVZA 1OHHD 2STBE 1VCPA 1QBVH 1TPAE 2ZEBA 4HZHA 3SU5A 2QF4A 1O38A 1D3DB 3BTTE 3EQ0H 1NRPH 2FOCA 9ESTA 4A1XA 1HUTH 2IPHA 1TRYA 2BOKA 5EQSA 1ABJH 2GX4A 2ZCKP 3RXCA 2XC0A 1HAOH 3RMOH 4Q63A 4HTCH 2Z9IA 2PKSC 1YKTA 3F2HA 3KIDU 1SHYA 2BVSH 3SHAH 3LH1A 1B5GH 2FTLE 3FFGA 1Y8TA 3SUDA 3SNCA 3MU5A 1P12E 1Y3UA 3URDA 2I6QA 4GLYA 1NRRH 2GMTB 3QTOH 4Y6DA 3SU4A 1NFYA 3FP7E 2FYRA 4OS2A 1OP0A 1O34A 1QB6A 2P94A 3KEEA 3LC3A 4FU8A 1GBIA 1AN1E 3GDUA 1YWUA 1LHCH 2BLVA 3MH5A 1KSNA 1PPCE 1KTSB 1G2MA 3ZYDA 4X1PU 2ZTZA 1SI5H 2FM2A 1E36B 4YOGA 1YM0A 2V3HH 1GI6A 1EASA 1BMMH 4A6LA 1S5SA 5HKKD 5C0TA 1DWEH 2GCHG 1IQHA 1OWEA 2BYAX 3S9CA 1OSSA 1AKSA 2BD9A 6CHAC 1GCTB 3UWJH 2J34A 5C67A 1S6HA 5DJ7A 3I29A 2JH0D 1TPSA 4MLFB 4GVUA 3CP7A 3NWUA 3LC5A 3U28C 1WU1A 2FOEA 2XYAA 2WPKS 4FUBA 1LPGB 5K7RA 1SLUB 4AG1A 2QA9E 4ACAA 4RSPA 2ZHDA 1EZSC 1TNHA 2ZIQH 1BBRH 4FUJA 4NA8A 3OY6U 4M9FA 1QQ4A 1OYQA 5E0HA 4BXSA 5DP3A 5FPSA 2JH6D 3MU4A 1KXEA 3M5MA 3M3VA 3S7HB 2VNTA 4B6EA 5CHBA 4B2CA 5LGOA 5E0JA 1RTFB 4A7IB 1K0HA 3BG4C 1W10U 1SQTA 1N6YA 2ZFPH 3A86A 5JBTA 1Q3XA 1LVYA 3MYWA 1S6LA 1WTHD 2QC2A 1L0ZA 1A61H 3BTDE 1IQGA 3G01A 3ZZ3A 1UVTH 1Y3YA 3NXPA 1O5GH 5ABWA 1YPHE 1SLXB 5C5NA 2F9NA 1MQ5A 4X2WA 2ZCHP 3S69A 1HDTH 2EI8A 1MTUA 2A1DB 3M37A 1BA8B 1FX0B 4OM9A 1WQSA 2F91A 2WHXA 3BTFE 3C1KA 1T8MA 2R0LA 1TBQH 1SKYE 3OTJE 1GL0E 1PQ5A 2J98B 1C5PA 1LVOA 1EPTB 3EGKH 1S85A 1DFPA 3DSPA 1V6DA 1RTKA 3SU3A 1S83A 5C3NA 1T4UH 1KLJH 2GDDA 1C5TA 4H42U 1BRCE 1CHGA 1HJ9A 2FOGA 3M5OA 2XCNA 1K28D 2RA0A 2BD8A 3OAAD 1O2TA 1ELBA 2C4FH 4K2YA 4BXWA 1ZMNA 2ZFFH 2F3CE 1O2NA 5JB8S 1C2LA 1C5RA 2FI5E 1ZHRA 2RDEA 2GP9B 1OXGA 3TVJB 1F92A 7GCHG 1Z71A 2FLBH 3KQBA 5GIBA 2FZZA 1FY8E 1SSXA 3A8AA 5C1XA 1MTVA 1SGDE 2BQ6B 1PJPA 1CHOF 4K69A 4UFGH 1J8AA 6LPRA 1MKWK 1UW7A 5F53A 5C94A 1E0FD 2J5UA 1C5UA 1JRTA 4WY3A 3ZZ4A 3BEFB 4YESB 5A0BA 2DE8A 2QF5A 3GYMA 1W0JD 1DX5M 1GJ9B 1E1RD 1HJ8A 3MOCA 1V2OT 3WY8A 1QL9A 3NPSA 2WV5A 1QB9A 2KZ4A 3SYJA 3BIVH 2ZPQA 1KDQB 1ZGIA 2QXGA 2VVVA 4O3TA 1OWHA 4WXVA 4XRNA 4ABJA 1J9CH 4ABFA 3UNSA 2ZGXH 1FY4A 4UE7H 1ELEE 2FOBA 3BG8A 4KTCA 2O9QA 4NIWA 1QJ6B 2J97A 4Y8ZA 3SNEA 1GDUA 2B5TB 1W0KD 1CT2E 3ATLA 4UFEH 3UR9A 3SU6A 4CRGA 1HNEE 2AMPA 3RMNH 3RXRA 1C5WB 2ZU1A 2OCVB 3GDVA 3PLPA 1HYLA 3BN9A 3BTEE 2TPIZ 1CBWB 1N8OB 1YPGH 4A1TA 4AB9A 1MZDA 4I33A 4ABGA 1P2OA 3PV4A 3LIWA 3LGTA 1TGTA 1ELAA 3GYLB 4ISIH 1K1IA 2R3UA 3SV9A 2ANYA 4LK4A 1SGRE 4BAKB 2W7UA 3N7OA 3HGNA 1MTWA 1V2NT 2V35A 3EE0B 2YOLA 4OGYA 2HPQH 2JJ2D 2VIQA 2VIDA 4NWKA 2ZI2H 4B73A 2PHBA 1Y5UT 4PROA 8GCHG 1FONA 3UIRA 1EP5A 1Z6EA 4UFFH 4UDWH 3ZVBA 1MH0A 3ESTA 1LPKB 3FP6E 3LT3A 4NCYA 4A92A 2BX3A 2DUCA 1ELCA 1C4Y2 3OFND 3ZV9A 1TRNA 4TY7A 3ZVCA 1H8IH 1W11U 1IHTH 4XFQA 3TNSA 4NZLA 1CA0C 1VITH 1QB1A 1LHEH 3NRLA 4B71A 1TMTH 3GY3A 3Q77A 1W3CA 3PMJA 2CGAA 1Z6JH 4X6NA 3D23A 1LTOA 1K1PA 3WWFA 2G5VA 1VGCC 3UQOA 1P02A 2W3IA 4JZFH 1GI3A 4AFZA 4LXBH 2QAAA 1WSSH 4FUHA 5DG6A 3UAIC 2ZU3A 3V12A 1O2SA 1TALA 2ZGBH 4IC6A 1DE7H 4KTSA 2VB0A 1EAUA 1HV7A 5LPEA 4TPYA 3NKKA 1ZPZA 1L1NA 2WV9A 1P2JA 2B7DH 1F0TA 1GI7B 2BD3A 3W1EA 1TGNA 1VITF 1QRWA 1E79D 1A7SA 4TY6A 1GCDA 5HGGA 3SW2B 4Y10E 1S82A 4ZH8A 4UD9H 1MD8A 2P16A 1UHBA 3NK8A 3U8RH 2Z7FE 3GCHB 4FU9A 2BDAA 1K22H 4IN1A 1MTNC 4NGAH 1TX8A 1O5BB 1P03A 1JOUB 1WDIA 2BQWB 2XRCA 3ZZ9A 5HXFA 1NY22 1ARBA 3E1XB 1V2MT 5A8ZA 5IDKA 3SV2H 5E8EH 3SU1A 1V2QT 5DSFA 4DT4A 4HI3A 3RP2A 1WQVH 5EW1H 1FI8A 1AO5A 1DLEA 2GCTC 5DP5A 3OYPA 1MU8B 1O39A 1LO6A 2P8OC 5B6LA 4CHAC 1FAXA 4E7RG 1IQIA 1XM1A 1CGJE 4YOJA 1AKSB 3A88A 1P9SA 4NA9H 5EU8A 2OQ5A 3Q00A 2ZP0H 1Z8RA 1O0DH 2BM2A 3P70B 5DN6D 1OX1A 3B9FH 2I6SA 3EE7A 1QQUA 5GDSH 5EPYA 4AX9H 2G52A 4ISNA 4ISLA 4XBBA 1O33A 2QYIA 2Y7ZA 2A5IA 1B7XB 3UFAA 1NU9A 1Y5AT 1YPKH 2F83A 2J9NA 4J1YA 4MNXA 1YGCH 2VH0A 5JB9S 5SGAE 3PWCA 2GKVE 4ZROA 2H2ZA 2L74A 5DP4A 1E35B 3ZZ7A 1VCQA 1OWIA 2ZECA 1MBQA 1RXPA 2AGGX 4ZUHA 1GVLA 1ZR0A 4AB8A 1WUNH 5JBCS 2GGVB 4I8HA 4DVAU 5GCHF 3ZZAA 1BTPA 2TGPZ 2B8OH 1DICA 1O3GA 4WH8A 1F5RA 1GHAF 3RLWH 3T29A 1SQAA 5DGJA 2VVUA 1Z7KA 1F7ZA 1V2TT 1BMNH 2GDEH 2WPHS 2Y7XA 1F5LA 5T1VA 1AGJA 1C1OA 1EOJA 3K6ZA 4TSFD 1EXFA 4P00A 4NSYA 1O2KA 2HNTF 1SOZA 3HGPA 5GXPA 1ELDE 1ELFA 1RS0A 2OLGA 2FYQA 2STAE 1O31A 4GSOA 3O8DA 1IQJA 2QF3A 2A2XH 1SL3A 3RM2H 2M5TA 1NS3A 5GPIB 9LPRA 3SHCH 4BTUB 2FS9A 1GBFA 1QJ1B 5HYOA 3ZVEA 3VB4A 2CF9H 1PPEE 3P95A 3TPIZ 4X2XA 2UWLA 4VGCB 3P8OA 2NU3E 2BZAA 1CHOG 3U1JB 4CR9A 1RIWC 4LOYH 2KR7A 2WUBA 2F9OA 5CMXH 1ZSJA 1SR5C 2NU1E 4K1TA 2H5DA 3JZ1B 4X1RU 3T26A 1UVPA 1KLTA 5C0UA 2SNWA 2Z3DA 3NUMA 4AYVB 1MMJN 2BZ6H 1BQYA 1C2GA 1W13U 4H6TA 3F3BA 3SV8A 2ODPA 1BZXE 2BLOA 4JK6A 2A7CA 4X1NU 1HJAC 4BANB 4LZ1H 1SPJA 2C8ZB 4CRCA 3UOPA 1H8ED 3TNTA 1GPZA 2G81E 1LCYA 4ZCNA 1GHXH 4B76A 2ZFTA 1GBKA 4JZEH 1DY9A 2BB4A 1UTNA 1NT1A 1PYTC 4Q2KA 5I46H 1TNJA 1FY5A 2XCFA 2IPQX 2KCPA 1BOQA 4JYUH 2Z9GA 2ZHEH 4E7NA 1GI0A 5DK1A 4GUXA 1OWKA 2W6ID 3OSYA 1YC0A 3SJKA 1QJ7B 1N1LA 5AHGH 1QCPA 1O2QA 1O2PA 1P05A 4TT3D 1W7GH 4AFUA 5B6OA 3F9EA 1EB2A 2J2UA 2OD3B 1CGHA 2GMTC 3RU4E 3EA8A 1SB1H 4KKDA 3VGCB 2AYWA 1O35A 3FP8E 3LOXA 1D4PB 2BY7X 2OXSA 2Y5HA 3PYHA 3EAJA 1NRQH 1A46H 3VPKA 4Y76A 4KGAA 5BRRE 1LVBA 4MPWA 4NIVA 5ESTE 3T5FH 2FOFA 2O8WA 1O2OA 2IN2A 1O2MA 2PTCE 4I32A 4KTUA 4A1VA 2OP9A 4NWLA 2EQNA 2QY0B 3BTWE 2J95A 1C5QA 2OUAA 3K9XB 3KN2A 3BEUA 4AFSA 2VIWA 1IHSH 1GCTC 1BRBE 2WV4A 2ZC9H 4IMZA 3IWMA 3DCLA 1GVKB 1ZHMA 3SQHE 5J4SA 1MZAA 2AIQA 4KELA 4OGXA 1K1OA 1NROH 4ZHLU 8GCHF 3NZIA 3R3GB 1UVUH 1TYNA 2W3KA 1T4VH 2LELA 3A7ZA 2WPJS 4ASHA 1XUHA 2R0KA 1A0JA 2G51A 2D2DA 5CE1A 4Q7XA 3SN8A 1BB0B 1L4ZA 3OEED 3UPEA 3KQEA 1TMBH 4Z6AH 5FX5A 2FDAA 3F2FA 5ETXA 3TH3H 1C2KA 3MQKC 4GAWA 1GJAB 2ZA5A 7ESTE 4XBDA 2PGQB 3BF6H 1O3EA 4BAOB 4WXIA 3RLYH 1P10A 3SV6A 1D3TB 1O5AB 3QUMP 5LH8A 1A0HB 2J94A 1JRSA 1VITG 3RXKA 1TA2A 2Z9JA 2ZCLP 4CH8B 2H9HA 6GCHF 1MD7A 1XUKA 4ABHA 1A1RA 2Y5GA 3QTVH 4X2YA 3Q76A 4D9QA 2BLWA 1LKAA 1QBNA 3MFJA 3QLPH 3M61U 1ETSH 2ZFQH 1Y3VA 1YPEH 4YLUA 2A31A 1EPTC 1TLDA 1BJUA 3GY4A 2ZWLH 1NTPA 4D8NA 1E37B 3OU0A 4MPVA 1C1UH 1YP9A 2PSXA 3PTNA 1A2CH 4TWYA 1KY9A 3PMAB 1LHFH 3SI4H 1WBGB 2ASUB 3GISB 2OTVA 1P0SH 4BAMB 2GD4B 3UUZA 2BOHB 5HM9A 4FUCA 5FBIA 3K65B 2EI6A 1SHHB 2L6OA 1TBZH 1DVAH 1UHBB 4XSKU 5C17A 1NFXA 1HLTH 2V3MA 4DOQA 2ZQ2A 4BTIB 1K21H 5EJZA 5TCAA 2XNDD 1AVWA 3ATKA 3TGIE 3Q3XA 1TWXB 2QXIA 2NU4E 1O2UA 5EW2H 3SU2A 2XNIA 4ACBA 1S81A 2LP6A 1H9LB 1LVMA 4I7YH 1BITA 1FNIA 2K8IA 3T25A 2FWWA 4MDSA 2TRMA 1VCWA 5JPMH 1QY6A 4Y11E 1AIXH 2A32A 4F55A 1O30A 2G4UA 3LGWA 3PO1B 3A84A 3MU1A 1ZRKA 1QL8A 5GCHG 2SGQE 1L4DA 2Z9LA 1H1BA 4WVPE 2ZDNA 1GHAG 1OP8A 1VR1H 3FO8D 3UNRA 4JYVH 2UUKB 4B2BA 1F5KU 2HWLB 2HNTC 1NO9H 3RU4D 1GI1A 4HGCA 3PTBA 5EODA 2P59A 1BBRE 1QA0A 1BTWA 1XKBC 1P3EA 2EI7A 3SZNA 4NZQA 3ZZ8A 1CBWC 2JJ1D 1C4U2 1AD8H 4I31A 2HRVA 1CQQA 1BIOA 1A5IA 1YYY1 1SGFA 3P6ZB 5I25A 5IK2D 3IITA 3I77A 1C1QA 2CXVA 1DS2E 3SJOA 2XBXA 1CGIE 1TOMH 2HOBA 1O2IA 2C90B 1C9PA 4NA7A 1PPGE 3CS0A 1B0EA 1GL1A 1P04A 3LH3A 2YMSD 3PWBA 2XC5A 3QZQA 4K5ZA 4WH6A 1LQDB 3O8CA 2VWOA 1GI8B 2WINI 4IMQA 3O8RA 3GY6A 1CO7E 2ZTYA 2UUYA 5FAHA 3MU8A 2ALPA 2JH5D 1CE5A 3MNBA 2Y80A 4JYTA 2H9EH 1GBAA 1EP6A 2G4TA 1MU6B 2PUXB 4X8UH 3MMGA 3F9HA 5A0CA 2ZZUH 1L1JA 1D3PB 2PUQH 2BDGA 2OBQA 3A87A 3A7TA 2A7JA 3AASA 2BDBA 1O5FH 1UK4A 3ENSB 1P2QA 2QF0A 4O03A 2XW9A 2FP7B 3EA9A 2K0QA 3VB5A 2UUJB 2W5EA 1QGFA 4ZXXH 4R8TB 3ZZBA 1ELGA 5EPNA 3ODDA 1QBOA 1SLVB 1W8BH 1SGEE 4ZKNU 1DUAA 1J17T 1MKXK 5T3HA 5L6NH 1KXCA 3P17H 1HXEH 1C2HA 4P02A 2IJD1 4YT7H 1AI8H 4HFPB 5JBAS 3ODFA 4JCNA 2QE7D 3RU4T 1GDQA 4ZXYH 4KP0A 4I8LA 3MNSA 1C1WH 1TGSZ 3F9FA 1V2VT 1NU7B 1C5MD 2GZ7A 4XDEA 2HVYB 1BTYA 3F1SB 3LDXH 4DW2U 1C2EA 1AFQB 3TLOA 1V2ST 2ILNA 3GDSA 2HLDD 1G32B 2BHGA 1QFKH 3WW7A 3ZZDA 3B23B 4TYDA 1HAPH 3GCHC 1C5VA 2BD7A 1SGCA 1P8VC 1HGTH 3GY2A 2OK5A 2AGIX 1QRXA 1HIAA 2PSYA 4O97A 1GHYH 3RM0H 2ZG0H 1FPCH 7LPRA 5JBBS 1DDJA 3RDZA 5H4IB 2R9PA 3P92A 1BBRK 4Y0ZE 1HRTH 2WYJA 3FZZA 1H8DH 4MPUA 1G36A 3PROA 3V13A 1S84A 2XBWA 4OS7A 1O2ZA 1G37A 1ZRBA 1ANBA 3ZIAD 1D9IA 1RTLA 2KCOA 5HIYA 1FQ3A 5FPYA 1TX6A 3RXUA 3LGVA 3M36A 1KXAA 2AEIH 4DGJA 1TABE 2UWOA 1EZXC 3LJJA 1ANDA 1KXDA 2FXRA 2SFAA 3RC4A 1DM4B 2WPDD 3MTYA 3SNAA 4GPGA 1OS8A 5GNDA 1DXWA 2J38A 2ZDAH 1DOJA 3GCNA 3PRBA 5EG4A 3UREA 1YCPH 4Y7AA 4F48B 1GBLA 1Y59T 1O3HA 1A3EH 1BMLA 3QO6A 1UTJA 2BMGB 2RA3A 4JZDH 4WMEA 6GCHG 3UOUA 1GJ7B 1FN8A 1QL7A 1O2YA 2VGCB 2OC0A 1MBMA 1P9UA 4RKOB 2FOHA 1T31A 5JYIA 3BTGE 4AORA 3PV2A 1FAKH 1TQ0B 1GHWH 2JETB 1C1SA 1DY8A 2XBVA 4DIIH 3A8CA 1W2KH 2BVXH 2FI3E 2ULLA 4FUFA 2YMSB 3L6PA 1GI4A 1Z8JB 4K1EA 3PM3A 2PLXA 2BXUH 3EDXB 3T27A 3TU7H 5EQQA 1H8HD 3A7WA 2JIZD 2H5CA 1AB9B 1C5SA 3F0OA 4DG4A 4FETA 3AAVA 4X8SH 1ACBE 1ORFA 1AQ7A 4MNWA 2BY9X 2BDCA 3H5CB 5EXLA 5A8YA 1UVSH 4VGCC 1AUJA 4Q7ZA 2B0FA 1GGDB 1AWFH 1WTGH 5C5OA 2PV9B 3AK5A 2H1UA 1GJBB 2Y81A 2GT7A 2BDYA 2TGTA 2Q6DA 3A80A 1UCYE 3HPTB 4X6OA 1SC8U 3DA9B 3E90B 5FL7D 1O5EH 1PQ7A 5EXNA 2C8YB 4MNYA 1KXFA 2VBCA 4BAHB 3PRDA 1QZ8A 4I8JA 1GMDF 1KTTB 1EAXA 1YPHC 2A5AA 1IQKA 1AE5A 2RCEA 4UONA 3F9GA 4B74A 1GJ4H 1THRH 3RXBA 2XXLA 1O3BA 3S0NA 1YY3A 3SOSA 1GBTA 4AYYB 4DCDA 3RXDA 1ELTA 2QCYA 1ZPCA 2ZHWH 2VWNA 1ZGVA 2GVFA 1CSOE 4OS5A 2XC4A 2BLQA 3OTPA 4X8VH 3MI4A 1MAYA 1NFWA 4IS5A 1BRAA 1FJSA 3VG8A 1ZSLA 1O2WA 5AFYH 3A82A 3ZZ6A 3GOVB 4AC9A 1EJNA 1SGYE 1HAVA 1PYTD 1K2I1 3QGJA 1N6XA 1SGIB 3BV9B 4CRDA 5L2YH 1CT0E 4RT0A 1AVXA 1KMHB 1ZMJA 3LJOA 3UY9A 3ZVGA 4Q7YA 4XOJA 1A5HA 1GBEA 1HXFH 2FS8A 2VVCA 3MO3A 1H9HE 3VGCC 2BXTH 3KNXA 2CJIA 4LZ4B 1FY3A 5AFZH 2AIPA 1FUJA 2HNTE 3GY7A 3M7TA 3QDZB 3K2UA 4BNRA 1FN6A 3LGIA 4JMYA 5A0AE 4AOQA 3DD2H 4YXWD 1O5DH 2TGAA 2PFEA 4YM9A 1GMHF 3SNDA 1O3CA 5E2OA 1KIGH 1EAIA 1G3EA 3BIUH 1ZLRA 1O2LA 1WXRA 1BHXB 3F6UH 3TJVA 1F0RA 1SG8B 2CMYA 2LPRA 3O8BA 3M35A 4RI0A 1O2XA 1O32A 3ITIA 1EKBB 1TBRH 5C2ZA 1EJAA 1ZTJA 3A83A 4Y79A 3HK6B 4Q4LA 2BDIA 1O3IA 3GY8A 4HG6A 1YPLH 1DITH 3RXVA 1DWCH 4IGDA 1DANH 1GI9B 3U8TH 2HGTH 2TBSA 3HKIB 4K8YA 4ISHH 4GHQA 4ZKOU 4Z1MD 1XVMA 2IJOB 2O8LA 5E0GA 2ZDKA 1GG6B 1OOKB 1TGBA 4JZ1A 1VJ9U 2CHAB 2WPIS 4ISOA 1NC6A 1PPHE 1Y3XA 1P06A 1O3AA 1K1JA 5ESBA 4NFFA 2VU8E 2W26A 3A7YA 4RN6A 1FPHH 5TJXA 1BUIA 2XWBI 1Z8IB 1UCYK 2P3FH 3M5LA 3NCLA 4DT7B 4WMFA 1S6FA 2WPLS 1FDPA 1AZ8A 5EJ1A 1K9OE 3LKWA 5LPFA 1RD3B 1QURH 1IQMA 1RFNA 2VINA 2ZF0H 3V7TA 3CENA 1O2HA 4IBLH 4Q80A 3ZZ5A 3RXEA 5GWZA 4XE4A 1XUGA 2ZDLA 3WWBA 2FI4E 1GJCB 3OX7U 1HCGA 1KXBA 2A4RA 1THPB 1NPMA 2CK3D 2H6MA 3A89A 1O3NA 1RJXB 2V7QD 1K1NA 3TJNA 3M7QA 3DUXH 4NG9H 4O9VA 3QX5H 4GHTA 5CHAB 4IC5A 1HAGE 3C27B 1COWD 3QK1A 4ZKRU 4I86A 3FOAA 3H7TA 2QXHA 4K1SA 2WUCA 3MO9A 1P2MA 2WSSD 2FMJA 1OPHB 4X2VA 4UFDH 8ESTE 3KYGA 5DP6A 3ZVAA 5TCCA 3AW1A 1DSTA 2W6JD 4B6FA 4H4FA 4IN2A 1GBJA 4CBNA 1MKWH 2FOAA 1EOLA 4ZMAH 3RMMH 2FO9A 3ZV8A 1D6RA 1ZTKA 1AVGH 3RXFA 1QHRB 1HB0B 1C1RA 4F49A 1ZMLA 1O3MA 1HIAB 3SZEA 1ARCA 5EJLA 2BY8X 3OE7D 1F0UA 3E16B 4INHA 1YF4A 1AWHB 3FZDA 1OKXA 1PFXC 1SGPE 5A2MH 1DPOA 1E1QD 3SU0A 4YZUA 3KCGH 1O3DA 4Y8YA 3E8LA 3SNBA 5A09A 1ZPBA 1P01A 2ANWA 1YBWA 1HPGA 2GZ8A 1GMCF 1SMFE 3PO1C 3TGKE 3KF2A 1AU8A 3TK5A 5EIYA 1O5CB 4Y7BA 3UR6A 1IQEA 1ESAA 1G9IE 1MCTA 1GDNA 3AAUA 1MKXH 1S0QA 1A0LA 2ZU2A 2GTBA 4SGBE 4FUGA 5HMAA 1LHGH 3RXPA 1S0RA 1K1MA 4AGJA 1NZQH 3B8JA 3F2GA 4B1TA 1XXDA 2TIOA 3ATWA 3U69H 2QGRA 3P8NA 1A4WH 3SBKA 3SGQE 4AZ2B 1PPFE 1HAZB 3TH4H 1ETTH 1VKYA 3RXHA 1ESTA 1V2RT 4Y71A 2F9PA 1J16A 1OYTH 2EEKA 2Y5FA 3RXLA 2PGBB 3SI3H 1TONA 3KL6A 4U2WA 2A4QA 2D26C 1UK3A 3PV5A 1O36A 2ALVA 3E6PH 1AUTC 3LU9B 1P3CA 1C2MA 2V3OH 1J15A 3VB7A 1ZSKA 1SGTA 3N7EA 2ZPRA 1AHTH 2XWAA 1V2UT 1BTHH 2FODA 3FVFB 2D8WA 1K1LA 2ZU5A 4FXGH 2ZKSA 4AGKA 5FHTA 4CRAA 3SUEA 1XUJA 2VIOA 2P93A 4FUDA 1EZUC 3FN8A 2G8TA 1QIXB 3QZRA 4X6PA 3RUOA 4INKA 1LHDH 1SQRA 5DPAA 1E38B 1GMDG 2A2QH 1O3LA 4CR5A 3RXAA 3RXIA 3MH6A 1HFDA 3EA7A 2F43B 2PKAA 3ZVDA 2W7SA 2RDLA 4J2YB 1O3FA 5GJ4B 1BHXF 4Z0KA 1C1NA 1NRSH 1MQ6A 1LQEA 1T8NA 4O3UA 2G00A 2ODYB 2WZQA 1EATA 1ETRH 3TK9A 1G30B 1F2SE 2PKSB 5C1YA 3DFJA 2HLCA 2CV3A 1V2JT 2ZGCA 1LMWB 1AFEH 1DXPA 3PMBB 4WF8A 3E0NB 1JWTA 1FMGA 2ZDMA 1GBHA 1AY6H 2BD5A 3RC5A 5DP9A 1FIWA 1CVWH 3P8GA 5EOKA 3QN7A 1W14U 3GCTG 3BTHE 1GI2A 3MO6A 3CS7A 1H9IE 4ZAEA 1EQ9A 1EUFA 1UTLM 3T28A 2ZO3H 3SJIA 1C2JA 4CBOA 2Z3EA 1G2LA 2BD2A 2QV1A 2FTMA
chains in the Genus database with same CATH topology
1Y3WA 4B75A 1EAWA 1N8OC 3M7UA 3W94A 2F9BH 5DP7A 1C5OH 3UTUH 1ANCA 1U6QA 1W0ZU 3DFLA 2A7HA 1VZQH 1UK2A 2K1QA 5AVDA 2ZNKH 2SGDE 2G5NA 2NU2E 1GMHG 2NU0E 2OC1A 1Z1IA 2BTCE 1WOFA 4ABIA 3GY5A 1HAVB 6CHAB 1O2VA 4M7GA 3LGYA 1YLCA 3MNCA 3SO3A 1AFQC 3IG6B 2KAIA 1EX3A 1Z1JA 5T6GA 1ZYOA 3SQEE 3DHKH 4ABBA 3TJUA 2P95A 2XBYA 1GBMA 1CT4E 4U32A 1TNLA 2NWNA 3RXOA 1L2EA 4K60A 2OC8A 1BTXA 1BRUP 1P57B 1TNKA 1L1GA 1PQAA 1GBDA 3D49H 4D7FA 5IYTA 1IQNA 2C8WB 1TGCA 2FLRH 1W12U 1UTOA 4WJG2 1TB6H 3TK6A 1P2KA 1UMAH 2THFB 3BG4B 1T7CA 2QIQA 4F4OC 3E91A 2A4GA 1SVPA 2VIVA 1AMHA 1TQ7B 8KME2 1ZJKA 3M3TA 1C5NH 1GJ8B 3TIUA 4FVBA 4BOHA 1SOTA 4E06H 1HAIH 3STJA 1V2PT 1AZZA 1D6WA 1XKAC 3A8DA 4JZIA 3Q3KA 1C4V2 1C5LH 2EC9H 5F8TA 4QT8C 2O8TA 1IQLA 4X6MA 4D76A 1V2LT 3SJ9A 3S7KB 1E34B 1TNGA 2AGEX 1NESE 3DT0H 4ABEA 3BEIB 4WWYA 2Z6BD 1JIRA 2SGEE 3KQDA 3TITA 1GHBF 1GJ5H 3GCOA 3SGAE 1Y5BT 1XX9A 4K8BA 1T32A 3HATH 5T6DA 5A8XA 1BTZA 3MWIU 5FCRA 1FIZA 3U8OH 5DO4H 2VGCC 1C5XB 3A7XA 1BT7A 5EXMA 3ZVFA 1ELVA 3RC6A 2ZGHA 2PTNA 4CREA 2ZU4A 2JETC 3VFEA 3PLBA 2ZQ1A 1EB1H 1TPOA 2CF8H 3RXTA 2VJ1A 3SORA 1GHZA 4GCHF 2ZDVH 2QXJA 1C1VH 3VB6A 2AMDA 1IAUA 2HALA 2G55A 1RRKA 2CN0H 1ZJDA 3T2NA 3BTME 5EQRA 3TGJE 4RKJB 1Q2WA 3PMHB 1AB9C 2R2MB 1IQFA 4A5TS 4FUEA 2C93B 2PWXA 2XTTB 4AG2A 1P11E 3L33A 1OP2A 4U01A 1TA6A 1MAXA 3SUFA 3JZ2B 4JK5A 1SLWB 2PR3A 4DY7B 1M9UA 1FLEE 3KGPA 3SV7A 4BAQB 1GGDC 1W0YH 2JKHA 3TH2H 1ZTLA 3FAOA 4ZHAA 1BDAA 1LDTT 2DE9A 1YCPM 2ESTE 2BDHA 1GBBA 1HAHH 1VJAU 5FBEA 1O2JA 1O3OA 1QRZA 1WAYB 3ZYEA 2ZFSA 4CRFA 4ABDA 1GMCG 2J92A 3U98H 2FEQH 1UTMA 2FX4A 2ANKH 2SGPE 3RMLH 1QTFA 1QA7A 1SFQB 1GHVH 1CU1A 2FOMB 4DURA 3K6YA 4CH2B 1V2WT 2A0QB 5EGMA 1G3CA 4D9RA 4I8KA 1EJMA 4I8GA 1OWJA 5L2ZH 3Q3YA 1NN6A 1T8LA 4ZHMU 1AE8H 1TX7A 2OBOA 4X8TH 3UWIA 2QN5T 1UTPA 2Y6TA 4CRBA 1MCVA 4K3JA 1D3QB 3TJOA 1TNIA 1P2NA 4H6SB 1NRNH 2SGAA 1JIMA 1O3KA 1XVOA 2D1JA 1UVOA 1YLDA 3VEQB 3R0FA 4B2AA 3SUGA 1UCYH 1SGNE 1A5GH 1G3BA 1TOCB 4THNH 1MUEB 2ZGJA 4DIHH 3URCA 1XUIA 2V6NA 5FX6A 5FPTA 4Y0YE 4YTAA 3OY5U 4R0IA 3MNXA 1C1MA 4TPIZ 3SGBE 1GI5A 1DSUA 4AN7A 3V3MA 4BTTB 3V0XA 3RXQA 4OS1A 4ABAA 5F03A 1TIOA 1EZQA 3BSQA 5G4BA 4MG3A 4ZKSU 3A8BA 3UQVA 3HKJB 3MU0A 2GCHF 4FVDA 2BQ7B 1G3DA 3S9BA 3D62A 4MTBA 1GJ6A 2Q1JA 3AW0A 2C8XB 2FPZA 4YLQH 1CA8B 4TWWA 1JXPA 4X1QU 2Y82A 2Q6FA 2BVRH 1TRMA 1ESBA 1SGFG 2AFQB 5F8XA 1CA0B 2FX6A 2HVXA 2ZTXA 4U30A 1LKBA 4E05H 1ZZZA 8LPRA 3GICB 3PB1E 3A85A 1WCZA 4MQAA 2BY6X 2OC7A 3RXSA 1GBCA 2B9LA 1SQOA 4FUIA 5FCKA 2O8UA 4MPXA 2O8MA 1VGCB 1LPZB 5C1UA 2GV6A 4NSVA 4SGAE 4X1SU 5DP8A 2A45B 1MTSA 2PKAB 1GG6C 4ESTE 1O3PB 1EPTA 2Q6GA 2CHAC 2J4IA 2UUFB 2AS9A 3L3TA 3M3SA 1JMOH 1Q31A 3M5NA 1ZOMA 1FY1A 4AFQA 1O3JA 1HAXB 4NIXA 2BY5X 1INCA 1QR3E 2GV7A 3T62A 1C1PA 2OQUA 1NM6A 2YNBA 4IW4E 3ELAH 1P2IA 3GCTF 3RXGA 2Z3CA 1UTQA 2VWLA 1C5ZB 4INLA 4UEHH 3VXEH 2P3UB 1ANEA 2F9UA 1C2FA 2ZPSA 4MNVA 1RGQA 1B0FA 5LPRA 1MTNB 2BD4A 1GJDB 1UTKA 1WYKA 1HBTH 3W95A 3STIA 1F0SA 5FXLA 1ABIH 1TMUH 1O2GH 1TFXA 1SGQE 1DWBH 1THSH 1BJVA 2PW8H 5HM2A 3KQCA 1P09A 4NFEA 2GCTB 3BTKE 5BPEA 5K0HA 5T6FA 5C20A 2P8OB 2A5KA 2R2WU 4CHAB 1TE0A 3QGNB 1X7AC 5CHAC 1UO6A 3E0PB 1SFIA 2A4OA 2GZ9A 2GT8A 2VH6A 4YO9A 1A3BH 6ESTA 1NFUA 5J4QA 2R3YA 2VWMA 1C2IA 1KDQA 3A7VA 1T8OA 2F9VA 5DKMA 7GCHF 2HPPH 2H9TH 2KAIB 1JBUH 1DLKB 1IOEA 2EA3A 1V3XA 2TGDA 2VIPA 3BTQE 1FV9A 4OS4A 2UWPA 3P8FA 3MH4A 2V0BA 5L30H 3MHWU 1H4WA 1PQ8A 1YPMH 1KYNA 3PLKA 3VXFH 4DJZB 1DT2A 2OINA 1FZZA 2P3TB 4YOIA 5F6MA 3HK3B 1TAWA 1FXYA 3D65E 1GHBG 2AH4X 4NIYA 1XUFA 2FIRH 2RG3A 1PPBH 1V2KT 1WV7H 3EYDA 4XBCA 1TPPA 1ZHPA 1BMAA 2Z94A 1W7XH 1YCPK 3ATMA 3ZZCA 3LONA 3LGUA 3MH7A 1J14A 2AMQA 2LNCA 3A81A 4X0WU 1O37A 5PTPA 4MVNA 2ODQA 2ZHFH 1GVZA 5AF9H 4GCHG 1HAYB 1C2DA 3VB3A 1OWDA 2IOTA 2WPMS 4WMDA 3RXJA 1C5YB 3ATIA 1O2RA 3I78A 4YT6H 1QNJA 1ID5H 1SBWA 2Z9KA 3F68H 3LPRA 3S9AA 2SGFE 1YPJH 1BTUA 1UJ1A 7KMEH 2BX4A 4OS6A 2C3SA 1C9TA 1RIWB 2WYGA 5E2PA 2FESH 1BCUH 1XXFA 2YNAA 5JDUB 3E3TA 4D7GA 1DWDH 1PPZA 1GWAA 3UNQA 1Z8GA 3H7OA 2ANMH 2SNVA 3RXMA 2ZHQH 1XMNB 2AERH 3SJ8A 1HJAB 1KLIH 3QWCH 4Y8XA 3U9AH 1C1TA 4FU7A 3FANA 5F8ZA 1DUEA 3KHVA 2ZFRH 3U1IB 3AVZA 2STBE 1VCPA 1QBVH 1TPAE 2ZEBA 4HZHA 3SU5A 1O38A 1D3DB 3BTTE 3EQ0H 1NRPH 2FOCA 9ESTA 4A1XA 1HUTH 2IPHA 1TRYA 2BOKA 5EQSA 1ABJH 2GX4A 2ZCKP 3RXCA 2XC0A 1HAOH 3RMOH 4HTCH 2Z9IA 2PKSC 1YKTA 3KIDU 1SHYA 2BVSH 3SHAH 3LH1A 1B5GH 2FTLE 3FFGA 1Y8TA 3SUDA 3SNCA 3MU5A 1P12E 1Y3UA 3URDA 2I6QA 4GLYA 1NRRH 2GMTB 3QTOH 4Y6DA 3SU4A 1NFYA 3FP7E 2FYRA 4OS2A 1OP0A 1O34A 1QB6A 2P94A 3KEEA 3LC3A 4FU8A 1GBIA 1AN1E 3GDUA 1LHCH 2BLVA 3MH5A 1KSNA 1PPCE 1KTSB 1G2MA 3ZYDA 4X1PU 2ZTZA 1SI5H 2FM2A 1E36B 4YOGA 1YM0A 2V3HH 1GI6A 1EASA 1BMMH 4A6LA 1S5SA 1DWEH 2GCHG 1IQHA 1OWEA 2BYAX 3S9CA 1OSSA 1AKSA 2BD9A 6CHAC 1GCTB 3UWJH 2J34A 5C67A 1S6HA 5DJ7A 3I29A 2JH0D 1TPSA 4MLFB 4GVUA 3CP7A 3NWUA 3LC5A 1WU1A 2FOEA 2XYAA 2WPKS 4FUBA 1LPGB 5K7RA 1SLUB 4AG1A 2QA9E 4RSPA 2ZHDA 1EZSC 1TNHA 2ZIQH 1BBRH 4FUJA 4NA8A 3OY6U 1QQ4A 1OYQA 5E0HA 4BXSA 5DP3A 5FPSA 2JH6D 3MU4A 1KXEA 3M5MA 3M3VA 3S7HB 2VNTA 4B2CA 5LGOA 5E0JA 1RTFB 4A7IB 3BG4C 1W10U 1SQTA 1N6YA 2ZFPH 3A86A 5JBTA 1Q3XA 1LVYA 3MYWA 1WTHD 2QC2A 1L0ZA 1A61H 3BTDE 1IQGA 3G01A 3ZZ3A 1UVTH 1Y3YA 3NXPA 1O5GH 5ABWA 1YPHE 1SLXB 5C5NA 2F9NA 1MQ5A 4X2WA 2ZCHP 3S69A 1HDTH 2EI8A 1MTUA 2A1DB 3M37A 1BA8B 1WQSA 2F91A 3BTFE 3C1KA 1T8MA 2R0LA 1TBQH 3OTJE 1GL0E 1PQ5A 1C5PA 1LVOA 1EPTB 3EGKH 1S85A 1DFPA 1V6DA 1RTKA 3SU3A 1S83A 5C3NA 1T4UH 1KLJH 2GDDA 1C5TA 4H42U 1BRCE 1CHGA 1HJ9A 2FOGA 3M5OA 2XCNA 1K28D 2RA0A 2BD8A 1O2TA 1ELBA 2C4FH 4K2YA 4BXWA 1ZMNA 2ZFFH 2F3CE 1O2NA 5JB8S 1C2LA 1C5RA 2FI5E 1ZHRA 2GP9B 1OXGA 3TVJB 1F92A 7GCHG 1Z71A 2FLBH 3KQBA 5GIBA 2FZZA 1FY8E 1SSXA 3A8AA 5C1XA 1MTVA 1SGDE 2BQ6B 1PJPA 1CHOF 4K69A 4UFGH 1J8AA 6LPRA 1MKWK 1E0FD 1C5UA 1JRTA 4WY3A 3ZZ4A 3BEFB 4YESB 5A0BA 2DE8A 3GYMA 1DX5M 1GJ9B 1HJ8A 3MOCA 1V2OT 3WY8A 1QL9A 3NPSA 2WV5A 1QB9A 3BIVH 2ZPQA 1KDQB 1ZGIA 2QXGA 2VVVA 4O3TA 1OWHA 4WXVA 4ABJA 1J9CH 4ABFA 3UNSA 2ZGXH 1FY4A 4UE7H 1ELEE 2FOBA 3BG8A 4KTCA 2O9QA 4NIWA 1QJ6B 4Y8ZA 3SNEA 1GDUA 2B5TB 1CT2E 3ATLA 4UFEH 3UR9A 3SU6A 4CRGA 1HNEE 2AMPA 3RMNH 3RXRA 1C5WB 2ZU1A 2OCVB 3GDVA 3PLPA 1HYLA 3BN9A 3BTEE 2TPIZ 1CBWB 1N8OB 1YPGH 4A1TA 4AB9A 1MZDA 4I33A 4ABGA 1P2OA 3PV4A 3LIWA 3LGTA 1TGTA 1ELAA 3GYLB 4ISIH 1K1IA 2R3UA 3SV9A 2ANYA 4LK4A 1SGRE 4BAKB 2W7UA 3N7OA 3HGNA 1MTWA 1V2NT 2V35A 3EE0B 2YOLA 4OGYA 2HPQH 2VIQA 2VIDA 4NWKA 2ZI2H 4B73A 2PHBA 1Y5UT 4PROA 8GCHG 1FONA 3UIRA 1EP5A 1Z6EA 4UFFH 4UDWH 3ZVBA 1MH0A 3ESTA 1LPKB 3FP6E 3LT3A 4NCYA 4A92A 2BX3A 2DUCA 1ELCA 1C4Y2 3ZV9A 1TRNA 4TY7A 3ZVCA 1H8IH 1W11U 1IHTH 4XFQA 3TNSA 4NZLA 1CA0C 1VITH 1QB1A 1LHEH 4B71A 1TMTH 3GY3A 3Q77A 1W3CA 3PMJA 2CGAA 1Z6JH 4X6NA 3D23A 1LTOA 1K1PA 2G5VA 1VGCC 3UQOA 1P02A 2W3IA 4JZFH 1GI3A 4AFZA 4LXBH 2QAAA 1WSSH 4FUHA 5DG6A 2ZU3A 3V12A 1O2SA 1TALA 2ZGBH 4IC6A 1DE7H 4KTSA 2VB0A 1EAUA 1HV7A 5LPEA 4TPYA 3NKKA 1ZPZA 1L1NA 1P2JA 2B7DH 1F0TA 1GI7B 2BD3A 1TGNA 1VITF 1QRWA 1A7SA 4TY6A 1GCDA 5HGGA 3SW2B 4Y10E 1S82A 4ZH8A 4UD9H 1MD8A 2P16A 1UHBA 3NK8A 3U8RH 2Z7FE 3GCHB 4FU9A 2BDAA 1K22H 4IN1A 1MTNC 4NGAH 1TX8A 1O5BB 1P03A 1JOUB 2XRCA 2BQWB 3ZZ9A 5HXFA 1NY22 1ARBA 3E1XB 1V2MT 5A8ZA 5IDKA 3SV2H 5E8EH 3SU1A 1V2QT 4HI3A 3RP2A 1WQVH 5EW1H 1FI8A 1AO5A 1DLEA 2GCTC 5DP5A 3OYPA 1MU8B 1O39A 1LO6A 2P8OC 4CHAC 1FAXA 4E7RG 1IQIA 1XM1A 1CGJE 4YOJA 1AKSB 3A88A 1P9SA 4NA9H 5EU8A 2OQ5A 3Q00A 2ZP0H 1Z8RA 1O0DH 2BM2A 3P70B 1OX1A 3B9FH 2I6SA 5GDSH 1QQUA 5EPYA 4AX9H 2G52A 4ISNA 4ISLA 4XBBA 1O33A 2QYIA 2Y7ZA 2A5IA 1B7XB 3UFAA 1NU9A 1Y5AT 1YPKH 2F83A 2J9NA 4J1YA 4MNXA 1YGCH 2VH0A 5JB9S 5SGAE 3PWCA 2GKVE 4ZROA 2H2ZA 5DP4A 1E35B 3ZZ7A 1VCQA 1OWIA 2ZECA 1MBQA 1RXPA 2AGGX 4ZUHA 1GVLA 1ZR0A 4AB8A 1WUNH 5JBCS 2GGVB 4I8HA 4DVAU 5GCHF 3ZZAA 1BTPA 2TGPZ 2B8OH 1DICA 1O3GA 4WH8A 1F5RA 1GHAF 3RLWH 3T29A 1SQAA 5DGJA 2VVUA 1Z7KA 1F7ZA 1V2TT 1BMNH 2GDEH 2WPHS 2Y7XA 1F5LA 1AGJA 1C1OA