1QQUA

Crystal structure of porcine beta trypsin with bound acetate ion
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA TRYPSIN
publication title Crystal structure at 1.63 A resolution of the native form of porcine beta-trypsin: revealing an acetate ion binding site and functional water network.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qquA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qquA02
1TONA 2GT7A 1U6QA 3IWMA 1TBZH 1F0RA 1Y8TA 3LU9B 1KDQB 1EAXA 2VIPA 2BHGA 1T4VH 3ZVBA 4NIYA 3OU0A 3SV6A 1AVXA 1GBDA 1BJVA 1A2CH 1UK4A 4ABDA 1MKWK 1EKBB 2P16A 1GCTC 3A7ZA 2P3TB 2PR3A 3M37A 2GVFA 4LOYH 5EQQA 4MNVA 2GDEH 1H9LB 1V2KT 1XUJA 1OPHB 4B76A 2XW9A 1SGYE 2HVXA 1UTMA 1AGJA 1A1RA 2V0BA 2GZ9A 1P0SH 1CGIE 3UR6A 4ZH8A 1CT0E 1WBGB 1NFYA 1O38A 3SW2B 1CA0C 1C2FA 2F9VA 2QC2A 4ABGA 5C67A 1GMCF 4WMEA 2Q6DA 5JDUB 1CO7E 4GCHG 1PPFE 1O35A 2EI6A 2BLQA 2Z9JA 2G52A 2CN0H 2P93A 5ESBA 3M3VA 2QCYA 1DWEH 2QGRA 1V2UT 2Z3EA 2ZQ2A 1MTNC 4H42U 3SJOA 8KME2 1W7GH 1YPHC 2IOTA 4NIWA 1O2ZA 1GVZA 1C5UA 1BMLA 1LVBA 3D49H 1GL1A 3U9AH 1BHXF 4U30A 1BTWA 4YESB 5DGJA 2BX3A 2C4FH 1OWJA 1P2QA 2WUBA 1CBWC 2VIDA 2UUKB 4X8UH 1O2UA 2G5VA 2PTCE 1TIOA 2A2QH 4BANB 4X1NU 2CF9H 2BLOA 1GJDB 1IAUA 3LH1A 3PM3A 1TA6A 2XTTB 1EB2A 4Q2KA 3TGKE 1BRBE 1BBRE 3A7YA 1ARCA 1SSXA 1Z71A 3UWIA 2F9OA 1VR1H 3N7OA 1GI1A 1TYNA 2Y5GA 1AIXH 2TRMA 2Z7FE 1O5BB 2BDIA 3L33A 4R0IA 5T6DA 1UCYH 2F91A 3ZZ6A 3HK6B 3BTEE 1G30B 3ELAH 4F4OC 1SLXB 1YBWA 2UWLA 3Q76A 4FU8A 3QN7A 1XKAC 1D3DB 4X6MA 2D2DA 1LPKB 1GBJA 1BMNH 3T27A 2AFQB 1O0DH 1EJAA 1QA7A 1YM0A 3MU8A 1GJ4H 1QL9A 5HMAA 3RM0H 3SJKA 2XNIA 1QJ1B 2BYAX 4NWLA 1FPCH 1RTKA 4IGDA 1OYQA 2R0LA 1UTQA 3ZVGA 1T32A 1W14U 1C9TA 3UREA 1ZRKA 1AY6H 2BD9A 1VGCB 1IQEA 5HM9A 4JK5A 1MU8B 1LKAA 5BRRE 4UEHH 1MD7A 4UDWH 1XX9A 3I77A 3SI3H 1FY5A 1H8DH 1S6HA 1V2JT 2F9BH 2H5CA 4IC6A 1YCPM 1GL0E 5JBCS 2FX6A 4I7YH 1GI4A 1DLEA 1VITG 2FO9A 1N6YA 4JYUH 1KIGH 1UK3A 4X1QU 4H6SB 3VGCC 1GJ7B 4X6NA 3A7WA 1NRPH 2GP9B 2LPRA 2TGTA 5E2PA 4K8YA 1GI0A 1C1PA 1WOFA 8ESTE 1K22H 5EGMA 3LOXA 3VXEH 2BLVA 1O3LA 1M9UA 2PFEA 8GCHF 1KTSB 4JCNA 1C2EA 1OWIA 3Q3KA 1HJ8A 5DP9A 1BRAA 2C8YB 3S0NA 2FOCA 4NWKA 2ODYB 3SU4A 2B0FA 3L6PA 2RCEA 1O3BA 1Y3UA 2ALPA 4ISOA 2W7UA 2OTVA 3FZDA 1T8MA 2GT8A 1BRCE 1P02A 3EGKH 2A2XH 2ZFSA 1UTKA 5BPEA 1UVSH 1EUFA 2ZPSA 1C2LA 4LZ4B 1K1PA 1QY6A 4MPUA 5FBIA 2EEKA 1LQEA 2RA3A 1S84A 1EAWA 4OS1A 1Z1IA 2QXIA 3SV8A 1HIAB 1NM6A 3VPKA 1P2IA 5A8YA 1IHSH 2BQWB 1GHAG 3SUGA 3M3TA 4KP0A 1NT1A 2ZEBA 3F9GA 1Y59T 2HALA 2QXGA 3V0XA 1MKWH 1XM1A 1PPZA 3RXUA 3STIA 3P70B 3EQ0H 2ZP0H 3BTFE 2PSYA 4Y8XA 5LGOA 1T4UH 3BTWE 1G9IE 3URCA 3KF2A 3KQDA 3QZRA 3PB1E 1HAPH 1ELVA 2FLRH 1SGTA 2BD3A 1MMJN 1V2PT 2OQUA 5IDKA 2BMGB 2ZFPH 1SMFE 3S9AA 2ZGHA 1EPTB 1ARBA 4UFEH 7ESTE 1HAZB 3TJVA 1CGHA 2FS9A 2XRCA 3DFJA 4YOGA 2FXRA 2ZHEH 2WYGA 1O2JA 5FCKA 4ABFA 2F83A 4IN2A 1BMMH 2ODPA 4DIHH 2SNWA 1PFXC 3T5FH 2ANKH 4AGKA 1IQIA 4AG1A 3ZZ4A 4MNXA 2PGQB 3RXAA 1T7CA 3LDXH 1GI3A 1HAIH 3RXJA 2H6MA 2KAIA 4I32A 1T8NA 4X1PU 2WYJA 1GGDC 2B8OH 5C1YA 1Q3XA 1BHXB 5JBAS 1P2OA 2FOBA 1F0SA 3ZZ7A 4DY7B 1MD8A 1GBEA 3JZ2B 5C1UA 1EX3A 1VCWA 1O3EA 3PMJA 1SOZA 2AGEX 3A86A 3Q3XA 1Q2WA 1MCTA 3T28A 5L2YH 4GPGA 3RU4T 2HOBA 1GHBG 3GCTG 4ASHA 1NRRH 2A7JA 1XXFA 5FAHA 2AMQA 1FAXA 4B2AA 4X2WA 1SG8B 4KELA 3SOSA 1EZXC 2AS9A 1J8AA 1L1NA 1K1JA 3VB5A 4NFFA 2GDDA 1EATA 1SL3A 3EA9A 3MU0A 2W26A 3MH5A 3VB3A 4NCYA 1QJ7B 1Z6EA 1BTUA 6LPRA 4JZ1A 4PROA 1YC0A 1C5RA 1G37A 5E0GA 3W94A 4O97A 3HGNA 4GLYA 1GI5A 2ZTYA 1A3EH 2HNTC 1NFUA 1OXGA 3RXGA 1C1RA 2OC1A 1DT2A 4AFZA 3BTKE 1G32B 3OY5U 5A8ZA 1IQLA 3UNSA 4OS4A 5EPNA 1HPGA 4IC5A 2CJIA 1FIWA 1MAYA 2G5NA 9ESTA 4ZHAA 1YPEH 3SHAH 1DITH 1JXPA 1SFQB 4MDSA 4IN1A 2FS8A 1H9IE 1DSTA 1ZSKA 5EQSA 1TRMA 4H6TA 3TNSA 1QRXA 1C1NA 3ZVDA 1K1LA 1SB1H 1L2EA 2BZAA 2HPPH 2OP9A 2PGBB 1QURH 4AX9H 3RU4E 1Z7KA 4NA7A 3MO9A 1KSNA 2EI8A 4GAWA 1O39A 7LPRA 3SGQE 1W3CA 4UFDH 1V3XA 1V2VT 3SUFA 4YLUA 2CF8H 1LDTT 1O3OA 2GMTC 4FUBA 4B2BA 4ZKSU 1LHEH 4A1XA 4A1TA 3FVFB 3MH6A 4DW2U 1ETTH 1AE5A 1UK2A 3BG4B 1EZUC 2XBWA 2BVSH 3C1KA 1GI6A 4WF8A 1ELTA 2Z6BD 1BOQA 1FV9A 2XBVA 3TNTA 1O3MA 4CBNA 4BXWA 1KDQA 5CHAC 5FBEA 1O2PA 2OD3B 1A4WH 4IW4E 1PYTD 1RIWB 3HKJB 4DVAU 1O32A 1Z8JB 2B5TB 3PO1B 1SGNE 2UUFB 3RMMH 1TPSA 2O8MA 1GWAA 1C4U2 4D8NA 2G4UA 1A0LA 2R3UA 2ZDLA 1C5YB 4CRFA 1KYNA 5DKMA 2H2ZA 1CE5A 3ZZ5A 3NUMA 1QIXB 4Z0KA 5DP4A 1SOTA 4B2CA 1F0TA 3SUDA 1GVLA 1AFQB 3RXVA 3QGNB 5DP8A 1K28D 3UWJH 2BX4A 1V2NT 3GOVB 4KTCA 4ZKRU 2ZG0H 4RKOB 3HPTB 1ZSLA 4XBDA 3SJ8A 1GJBB 5AFZH 4BTTB 1TMBH 1AU8A 1CHOF 3BN9A 4X8TH 1J17T 2ULLA 3A8AA 3SHCH 4LXBH 3A81A 4CRAA 2Y81A 5FX5A 4AN7A 2LNCA 1C1OA 2FOHA 1DOJA 2FOFA 1L4DA 4F49A 1W7XH 2BOHB 3M7QA 1DXPA 1LCYA 1SLVB 2Q1JA 3GY3A 2FP7B 3LONA 3BF6H 2ZHQH 3M61U 1NROH 2BY5X 3GYLB 2SNVA 4M7GA 1K9OE 1C5MD 1HAVB 4WMDA 2Z94A 2A4OA 2BD5A 1W11U 4X2VA 1LHCH 3LGVA 1OWHA 1NN6A 1WCZA 1C9PA 5EXNA 2UUYA 3LC3A 6GCHF 2ZWLH 2QV1A 3H7OA 2BXTH 2PKAB 2BQ6B 3PTBA 4TWYA 4TWWA 2QIQA 3CS7A 4XBBA 1NRQH 2ANYA 1DVAH 2P3UB 3OSYA 4X6OA 3ATMA 7GCHG 1QA0A 4I8LA 1C1UH 4GSOA 2A4GA 3TK9A 4CR9A 3SO3A 1C5TA 3UFAA 3BTTE 1S85A 4K1SA 3DT0H 4WJG2 1FZZA 3SU0A 2O8UA 1ZZZA 1PYTC 3EE0B 3LT3A 3SU5A 3O8CA 1VCPA 5EW1H 4BTUB 2VIWA 4BAHB 1UO6A 2ZKSA 4O9VA 2BDGA 2OC7A 3NK8A 3A87A 2PV9B 3SGBE 3E0NB 1V2LT 1AWHB 2PKSB 3BTQE 1P12E 1NY22 3RP2A 1GMDG 1TNLA 2G55A 1C2GA 2GKVE 2VH6A 2O8WA 2YNBA 3BIVH 4YO9A 1E38B 2QXJA 5FX6A 3IG6B 2OCVB 2AYWA 3Q77A 3BSQA 1FY1A 2YNAA 1ZMJA 3ZYDA 1UTPA 5EODA 2ZC9H 1ELBA 3QUMP 3NPSA 1O2NA 1VCQA 1JIMA 4IMZA 2VH0A 1D3TB 5TJXA 1F5KU 4AYVB 1GBMA 3PMHB 1X7AC 3FP7E 5GXPA 3RXRA 1YCPK 2FLBH 2VNTA 2A7CA 1K21H 4KKDA 1HJAC 1Q31A 1V2WT 3ITIA 2FOMB 5F03A 1HXFH 1GG6C 2A1DB 2TGDA 5EU8A 1P8VC 1LHDH 1TMTH 1GPZA 2CV3A 4TYDA 1DFPA 1QGFA 4FUFA 2VWLA 4HTCH 1KXAA 1OOKB 1ZRBA 3O8BA 1SLWB 2BTCE 1QB1A 4O3UA 4ABHA 1A0JA 4I8JA 1WAYB 1XVMA 3S69A 1HIAA 3LC5A 3U8RH 3ZZ3A 1S5SA 2GCHF 5HYOA 1MKXK 1A61H 4ISIH 3T25A 2W7SA 1GDQA 1VJ9U 3PMBB 5DPAA 1XUIA 4MQAA 1N8OB 3F6UH 5GWZA 3F9HA 5H4IB 1Y3WA 3SQEE 4BAMB 2A5AA 2VIVA 3A88A 5FPYA 2WPJS 3P8OA 1AB9B 2BZ6H 2XC5A 4VGCB 4XFQA 4YT6H 3MNXA 2NWNA 5AFYH 4A92A 5GCHF 2DE8A 1CT2E 2OUAA 3S9CA 1IQJA 4NG9H 2ZDKA 5T3HA 4JZEH 1V2RT 2BDCA 2EI7A 1FN8A 4Y8YA 1GMHF 1ZR0A 2BY7X 1NRNH 4YTAA 1IOEA 1BIOA 4JYVH 2XC4A 4D9QA 4FUJA 2O8TA 4KTSA 3GCNA 1ZSJA 2FOAA 2WV5A 1EPTA 2GV6A 4AFUA 3MYWA 1BT7A 1V6DA 1ZTKA 3STJA 2PSXA 1HBTH 1C1VH 2GCTC 1S0QA 1LPZB 2OBOA 2BB4A 4MTBA 4FXGH 1DXWA 1RTFB 1P09A 2FI5E 4A1VA 1AUJA 4AFSA 1OP8A 1G36A 2P8OB 1BJUA 2H1UA 1D3PB 2JH5D 3Q3YA 1WSSH 4ZAEA 1ELFA 2Q6GA 1ACBE 2XYAA 1HLTH 4OS6A 4R8TB 3TLOA 3W95A 2ZFTA 1XUKA 3K6YA 1J15A 3KGPA 1INCA 1OP0A 1NZQH 5C2ZA 2SGDE 2SGFE 3DA9B 1AKSB 4H4FA 2WPLS 3ZVFA 1F7ZA 1THPB 1JWTA 1TRYA 3T26A 4RSPA 3M7TA 1LHFH 1O5CB 1V2QT 1ZPZA 1E0FD 4YLQH 1SFIA 4INLA 4NA9H 2SFAA 3HKIB 1RFNA 4Q80A 4WWYA 4Y7BA 1XVOA 1MTVA 5A0CA 5C1XA 1MZDA 3U1IB 1EB1H 4U01A 4CREA 4JZIA 1GCDA 5ABWA 1F5RA 1DWBH 4AB8A 5C5OA 4U32A 4OGXA 3P6ZB 5GJ4B 2VWNA 5A0BA 3LIWA 1P2MA 1XUFA 3MWIU 3SJ9A 1GBIA 1TX6A 1QTFA 1C5LH 1ABJH 1C1WH 5GDSH 4X2YA 2P3FH 2BDBA 4ZKOU 4X8VH 5F8TA 3TGJE 1AHTH 5DK1A 2OQ5A 1BTHH 1GJ6A 3KIDU 4Y7AA 2G8TA 2I6SA 2AH4X 3E16B 1V2MT 1VITH 3RUOA 4DGJA 1TPPA 4OGYA 4AB9A 1IQNA 3RC6A 1FXYA 2PW8H 4INHA 1E35B 3EDXB 2XWBI 1HGTH 2F3CE 5HGGA 4AYYB 1EJMA 3UOPA 2A4QA 1RRKA 3KN2A 1DDJA 1GDUA 3RDZA 1XKBC 5FPTA 1GI7B 2ZHFH 1GCTB 1TE0A 2NU3E 8LPRA 5LPRA 1D3QB 2BY6X 1DM4B 4Y76A 2C8XB 3QWCH 2Y5HA 4WH8A 3AW1A 1MU6B 3QLPH 1EAIA 1O3DA 1V2OT 3PLKA 4WH6A 4ZXXH 1LQDB 3LGUA 1YCPH 2AGIX 2QF3A 3SGAE 1TFXA 1CA0B 1QNJA 1UTOA 2J2UA 3A84A 4UFFH 3TH3H 1CA8B 3M5NA 1BMAA 1DWCH 1A7SA 5ETXA 4ZHLU 1QB6A 2UWOA 2D1JA 2V3OH 2W3IA 5TCCA 1NU7B 1HAGE 2BD8A 2ZDNA 1YKTA 4O03A 1B0EA 3SU2A 3IITA 1AD8H 1BQYA 3VXFH 4CRBA 1MTWA 2BD4A 1A5IA 1G2LA 2VGCC 1C5PA 3MNSA 2STBE 1GI8B 1MKXH 1L1GA 4HZHA 2AGGX 3V13A 1O2YA 7GCHF 1O30A 1HCGA 2GZ7A 1CBWB 1G3EA 3L3TA 1FN6A 1PJPA 3RXTA 3GY6A 5FPSA 2VB0A 1GBAA 1O2HA 4X1RU 1O5EH 1O3HA 4D9RA 2XCFA 1O2RA 5L6NH 1GMCG 3JZ1B 3BEUA 4ABIA 1DS2E 3P8NA 1S6FA 2R0KA 3BG8A 3Q00A 1GBTA 1A0HB 2QXHA 2VVUA 1RXPA 3K2UA 2SGQE 3RXOA 1SVPA 1BBRK 1TA2A 3QX5H 1FI8A 4JK6A 1H8IH 3PWCA 5TCAA 2ILNA 1DPOA 5F8XA 2D8WA 5FCRA 1FUJA 2ZFRH 3MHWU 3SU6A 3TK5A 5GPIB 1SGQE 1SHHB 4ZKNU 3UY9A 1GHWH 2FESH 5LPFA 3SQHE 1ELEE 3U69H 2VWMA 3QK1A 1O2WA 4FUEA 2HNTF 3TJUA 3GDSA 1O2GH 1EAUA 2JETC 3SNEA 4INKA 2VIOA 3G01A 1NO9H 1DE7H 3BIUH 3ZZCA 1HAVA 1CU1A 3T62A 1SQAA 1H9HE 2O8LA 1W2KH 3GCHB 3FANA 5E8EH 3KQEA 4ABEA 2F9PA 4Y0YE 2ZGJA 5T6GA 1Z6JH 1QJ6B 3SORA 2PKAA 2FI4E 2CGAA 4MNWA 6CHAC 4QT8C 1O36A 1ORFA 1ELGA 3FFGA 3MMGA 1RTLA 2C93B 3BV9B 1C5QA 3TJOA 2Z9LA 4IMQA 1TNGA 1KXCA 2OLGA 1P3EA 3MNCA 4BNRA 4GCHF 1TPAE 2FWWA 2FEQH 3NXPA 3VGCB 5HXFA 4JZDH 1MTSA 4K2YA 3BTGE 3CENA 1IQFA 5J4QA 1IQGA 2CXVA 3TK6A 5DG6A 2NU2E 4WY3A 1FJSA 3DHKH 2ODQA 1LVOA 3VEQB 2ZCLP 4I31A 1Y3YA 1PQ8A 1WTHD 2HWLB 2A32A 5LPEA 2BVRH 1C5NH 2UWPA 1XXDA 2GD4B 2K1QA 1GJCB 2OC8A 1ZOMA 1J16A 1KY9A 1O2XA 1QQUA 1WV7H 3ENSB 5EQRA 2J95A 2JH0D 1QCPA 1GI2A 1ZGVA 2BY9X 2TIOA 1P3CA 2ZO3H 3URDA 1A5GH 1CT4E 1NU9A 1O33A 4TPYA 1A3BH 1LO6A 3RU4D 6ESTA 3AAUA 3UPEA 1TX7A 2EC9H 2GTBA 1TRNA 4UONA 1L1JA 2XBXA 2QN5T 3H7TA 3P95A 3RXSA 1RD3B 1VJAU 3CP7A 2J34A 3PYHA 3RXCA 2FMJA 1JBUH 5F8ZA 5EXLA 5A09A 3D62A 4ZHMU 1MBQA 1WQVH 1ZTJA 1C2KA 1GJ5H 3KL6A 8GCHG 2RDLA 1HAOH 1Z1JA 1TB6H 1GHYH 4B73A 3BTHE 4BAOB 4Y0ZE 3ZVEA 2ZCHP 3RLWH 1YPMH 1QHRB 1GJ8B 4HI3A 1JRSA 1TGSZ 3BTDE 1QQ4A 1FAKH 1TNJA 2FPZA 2OC0A 2QY0B 4ZXYH 2BDAA 1QFKH 1MZAA 4K1EA 1YPHE 3ESTA 1B0FA 1OS8A 1WTGH 3RLYH 4CRCA 1GBBA 2WPHS 2V3HH 3SV7A 1FONA 4GHTA 3LGYA 3TGIE 2XXLA 1HB0B 1EJNA 1XMNB 3BEFB 1ZHPA 1ANCA 1ZMLA 1C5OH 2HPQH 1QL8A 1UTJA 1EZQA 2C90B 2ZU1A 4YOIA 4BTIB 2Y6TA 1VITF 2ANMH 1C2DA 1J14A 3QO6A 1GDNA 3TIUA 3QTVH 2VVCA 3UR9A 4Q7XA 5EOKA 2ZCKP 2ZU4A 4DJZB 2RA0A 2ZZUH 3ZVCA 1KLTA 1HJ9A 2BOKA 1UHBB 4BOHA 4FUDA 1O2OA 3SU1A 3SNCA 4AORA 3ATWA 1O2SA 1AZZA 2GX4A 1GGDB 1TNKA 3GICB 3ZZ8A 4CH2B 4K60A 3SNAA 4B75A 1VGCC 2G4TA 1MH0A 2DE9A 4CHAB 1AO5A 4K69A 2Y5FA 2TPIZ 1Y5AT 2AERH 1S83A 3KHVA 1C5VA 3BEIB 2WPMS 1FDPA 1G3DA 4WXIA 2H5DA 1Z8RA 1ABIH 5L30H 1SGIB 1UTNA 1BBRH 1O2LA 3H5CB 3MU4A 1UVTH 4CR5A 4YM9A 1SLUB 2WPIS 2FX4A 2IJOB 2BVXH 1PPHE 1YPKH 2FIRH 1TWXB 2C8WB 1BTPA 1RJXB 4AG2A 1PQAA 1WUNH 1LHGH 3SUEA 1DY8A 1PPBH 3A7XA 1QR3E 4AFQA 1AKSA 3RC5A 1O37A 1HAHH 1P2NA 1TGTA 3M5OA 1GHAF 1GBCA 5A8XA 4CBOA 3E8LA 1GHVH 2DUCA 1Z8GA 1PPCE 2ZNKH 3NWUA 3FP6E 1T8OA 3UUZA 3VB4A 5JB8S 3GYMA 1CVWH 1BA8B 3RXMA 1C2JA 3LGIA 1OKXA 3F1SB 4CRGA 2SGPE 1TALA 1TOCB 4YT7H 5FHTA 1ELCA 3KQBA 3ZV9A 2FYRA 4A6LA 1CSOE 4BAQB 2R3YA 1P57B 3BTME 3NCLA 1MQ6A 4FUHA 4MPXA 2VIQA 1UTLM 1O2VA 1AQ7A 1EZSC 1YPGH 1KXEA 3VB7A 1L4ZA 1EOJA 3QZQA 4UE7H 2P95A 1JRTA 1YLCA 4AOQA 1C1TA 5JBBS 3A82A 1SGRE 2W5EA 1VZQH 1DX5M 1WU1A 1B5GH 2ZTXA 5J4SA 2G00A 3SV2H 2ZU3A 3SN8A 7KMEH 1SR5C 3UNRA 1YP9A 2JKHA 3I29A 2A45B 3RXPA 3OY6U 3V3MA 1C1QA 2GMTB 2ZGCA 3KQCA 2WUCA 4HGCA 1Y3XA 2ZIQH 2FYQA 5LH8A 3EYDA 4OS7A 3M5LA 4MLFB 3TU7H 1OYTH 2AIPA 2CHAB 1NFWA 5CHAB 1JIRA 4HFPB 1MBMA 1TLDA 1O3JA 1ZYOA 1SI5H 3TVJB 1EP6A 1O3PB 1NRSH 2CMYA 2ZU5A 4BAKB 5DO4H 1K1OA 1QBOA 3AW0A 1EPTC 1W0YH 1PPEE 3U8TH 3ZYEA 1FNIA 2PUQH 1N1LA 1S0RA 1W13U 2QAAA 1T31A 4NA8A 4UFGH 3SNBA 2ZTZA 1GHBF 4X2XA 3GCTF 2FM2A 1BTZA 2FOGA 1ANDA 1C5SA 4E05H 4SGAE 3GISB 2ZDAH 3RMOH 1DUEA 1P05A 1HYLA 4O3TA 4CH8B 4MVNA 4SGBE 2VU8E 1GJ9B 2J38A 2AMDA 2PLXA 5E0HA 3OTJE 2GZ8A 1OP2A 2XCNA 4MPVA 3UIRA 2QF0A 1B7XB 4I8KA 4MG3A 5AVDA 3A7VA 3I78A 1AZ8A 1QRWA 3PLPA 4DG4A 2XBYA 1PQ5A 1P06A 3MO3A 2J9NA 3MTYA 2VJ1A 1TABE 1AMHA 1E36B 2C8ZB 3SJIA 4CRDA 4JYTA 4Y8ZA 1V2ST 3F9EA 1O3FA 2Z3CA 1IQHA 1ZTLA 2THFB 2R9PA 3MO6A 1O3KA 4XDEA 1TNIA 2WPKS 2H9HA 4X1SU 1AVGH 1A46H 4NIVA 3F9FA 2B7DH 4XE4A 2UUJB 4K8BA 2I6QA 2J92A 4YOJA 3ODFA 1BDAA 3GY2A 3EAJA 3M3SA 1BTXA 2PUXB 1D9IA 3SI4H 3GCHC 4GHQA 1CHOG 3PLBA 3UNQA 3P8FA 4ZUHA 1GJAB 1KXFA 2ZU2A 2F9NA 1GBFA 4ISNA 4Y6DA 1AN1E 2ZDMA 1D6WA 4J2YB 3LJOA 1EXFA 1E37B 3NZIA 1K2I1 1SBWA 1RS0A 1MUEB 1HUTH 4AZ2B 1LMWB 2Z9KA 1S82A 1F92A 1F0UA 1AUTC 5DP6A 1LVMA 2HLCA 1ESBA 1G3CA 2R2WU 1TQ0B 5EPYA 1PPGE 3FP8E 2PWXA 3A85A 1C1SA 1TBRH 2HNTE 4DT7B 3HGPA 4I8HA 5CE1A 2BM2A 1TGCA 1BZXE 6GCHG 4JZFH 3E1XB 3BG4C 2D26C 3D23A 1XUHA 2J94A 1FLEE 1CHGA 3U8OH 3E90B 3P92A 1ESAA 2Y80A 5EXMA 3PV4A 3EA8A 3PROA 4WMFA 2Z9GA 1DUAA 1GI9B 1HAXB 1RIWC 2ZI2H 2AEIH 1TBQH 2Y7XA 4D76A 3AVZA 3P17H 5ESTE 4B71A 3PO1C 3TH4H 4GVUA 3T29A 3SV9A 3O8DA 3RXDA 1DWDH 4JMYA 4FU7A 5A0AE 1DLKB 1P10A 4NSVA 1DSUA 1K1MA 1O2IA 2FTMA 2STAE 4ABAA 3P8GA 1GHZA 3ATIA 3VB6A 2PHBA 1TMUH 3NKKA 1E34B 3HATH 4NZLA 5K0HA 3QTOH 1SPJA 1P2JA 2YOLA 1HJAB 1O5AB 3PWBA 3HK3B 5A2MH 1JOUB 1EQ9A 1QBVH 3RXIA 1O5FH 3E0PB 1ETSH 1HRTH 3WY8A 2VVVA 2A0QB 2P94A 1GG6B 4NGAH 1FIZA 1UCYE 3GY8A 3SNDA 2ZGBH 2Y82A 1AFQC 2XC0A 4Y11E 1TNHA 1QRZA 2ESTE 3GDUA 1HFDA 1EOLA 3RXBA 1YF4A 1P03A 1MCVA 3ZZAA 1LPGB 1FMGA 1O2QA 4FVDA 4K1TA 1NS3A 4WVPE 5JPMH 1MTNB 1QB9A 4I33A 3UOUA 2ANWA 1CQQA 1TX8A 4XSKU 4I8GA 1O34A 5C3NA 1GVKB 3TJNA 5C20A 2BD2A 4NIXA 1GBHA 3F68H 4XOJA 1DY9A 4AGJA 1SGPE 3UQOA 4NSYA 5K7RA 5AF9H 1SGFA 3MH4A 4OS2A 3VFEA 2ZHDA 4E06H 1Y5BT 3DFLA 3LPRA 1NC6A 4YZUA 1D4PB 1W10U 1THSH 1WYKA 4ISLA 3S7KB 5G4BA 2BDYA 2VWOA 1P9SA 3A8CA 3RMNH 1N6XA 3GY4A 2ZHWH 1GBLA 1YPJH 1ANEA 1F5LA 4THNH 4U2WA 3S7HB 2H9TH 1C5ZB 4MPWA 9LPRA 3MH7A 1NESE 2GCHG 3RC4A 1FY8E 1BCUH 4DOQA 1GMDF 5DP3A 2ZPRA 4CHAC 1C2IA 2GCTB 3MOCA 2ZF0H 1KTTB 1OWKA 3AAVA 1C2HA 4FU9A 2FI3E 4TPIZ 1WQSA 4MNYA 3A89A 1Y5UT 2BXUH 1NFXA 4Y10E 1H1BA 1NTPA 3AASA 5GCHG 4KGAA 3LGTA 1UHBA 2OBQA 2C3SA 1THRH 5DJ7A 4TY7A 1LTOA 3RM2H 1GMHG 1C5WB 4A7IB 1HAYB 3ZZBA 1ESTA 2NU4E 3K65B 3A83A 3KCGH 4FUCA 3R0FA 2PTNA 3MI4A 1O2TA 3PMAB 1AI8H 3TPIZ 2PKSC 1ZPBA 2GV7A 3R3GB 1O2MA 3MU1A 1EASA 2TBSA 1C5XB 1OX1A 3OYPA 2O9QA 1MAXA 5F6MA 2SGAA 1IQKA 3A7TA 5I46H 1C4V2 2G51A 3QDZB 3RXFA 2HRVA 4DURA 1O3NA 4UD9H 4D7GA 1P11E 3GY7A 3MFJA 4RKJB 3T2NA 1SQOA 2A7HA 2Z3DA 3E3TA 4FUGA 1J9CH 3ZV8A 5PTPA 1TPOA 1AWFH 2A5KA 2J4IA 1FY4A 3RXQA 1O2KA 3D65E 3LKWA 3RXEA 1O3IA 3K9XB 5HM2A 1O3GA 5DP7A 1AVWA 1QL7A 1P04A 2ZQ1A 1MQ5A 4ZMAH 2WV4A 1C4Y2 5CMXH 1P9UA 1DICA 1SHYA 1PQ7A 5FXLA 1G3BA 4Z6AH 1LKBA 2GGVB 3OX7U 1HXEH 2NU1E 1SGCA 5I25A 1O31A 1P2KA 1SGDE 2ZPQA 1RGQA 4J1YA 5IYTA 2TGAA 3FZZA 2H9EH 1AFEH 1UVPA 5E0JA 1MTUA 3ZZ9A 1F2SE 5SGAE 1HDTH 2A5IA 1UJ1A 2IPHA 3GY5A 1TQ7B 3RXLA 4LZ1H 3UTUH 2CHAC 3V7TA 4LK4A 1ID5H 1SGEE 4RN6A 1QBNA 1ZGIA 5AHGH 3V12A 2V6NA 1C1MA 1JMOH 4NFEA 1FPHH 1N8OC 5L2ZH 2FDAA 2W3KA 1BUIA 2FODA 3B8JA 3S9BA 1KLIH 2FTLE 3M36A 1AB9C 2FZZA 4VGCC 1K1NA 1OSSA 1ZHRA 2ZFFH 1OWDA 2Q6FA 3MU5A 3K6ZA 2ASUB 4X8SH 3TITA 1S81A 1SQTA 2ZA5A 2V35A 1IHTH 2F9UA 3B23B 4DCDA 1TGBA 2ZFQH 3DUXH 3LH3A 3M5MA 4ZROA 2XWAA 2FOEA 4GUXA 1O5GH 1SGFG 1EP5A 1ZPCA 1V2TT 5JYIA 2BD7A 1UCYK 1W8BH 3CS0A 1SC8U 2KAIB 5GIBA 1L0ZA 4E7RG 5JBTA 1Z8IB 1OWEA 1ELAA 3B9FH 3U98H 3M7UA 1Y3VA 3KNXA 1O3AA 1C2MA 1YPLH 2HGTH 1GHXH 3ZVAA 2OXSA 3RXHA 2AMPA 2AIQA 1GBKA 2SGEE 4FVBA 5T6FA 4Y79A 1AE8H 2QYIA 4DIIH 1UVUH 4NZQA 4BXSA 3SBKA 4FUIA 1ZHMA 3GCOA 3O8RA 2VGCB 2EA3A 1ANBA 2P8OC 3M35A 1T8LA 1G2MA 4K5ZA 1A5HA 2ALVA 1KLJH 1H4WA 4XBCA 3E91A 2ZGXH 4X6PA 2M5TA 1HV7A 4X0WU 2R2MB 1DANH 1ZMNA 3ZZDA 4D7FA 4KTUA 5B6OA 5JB9S 2OINA 3LJJA 3PTNA 1BB0B 1CGJE 3ATLA 1O5DH 2TGPZ 1TOMH 2A4RA 1UMAH 1KXBA 3RMLH 3ATKA 3A80A 4IS5A 1ETRH 3MNBA 1FY3A 1YLDA 2G81E 3QGJA 3FAOA 1LVYA 1TAWA 3U1JB 4B74A 4Y71A 1W0ZU 4OS5A 1XUGA 2IN2A 4WXVA 1BITA 2Z9IA 3A8DA 3ODDA 3UQVA 1ELDE 1ZJKA 1FQ3A 2NU0E 3EA7A 3KEEA 3RXKA 3SZNA 3A8BA 1P01A 1UVOA 2BQ7B 2RG3A 4E7NA 4Q7ZA 1YYY1 2VINA 2JETB 1BRUP 2ZDVH 3GDVA 2ZECA 5EW2H 3LGWA 3E6PH 4IBLH 3TH2H 5E2OA 4A5TS 3DD2H 2B9LA 1TGNA 4B1TA 4TY6A 4ESTE 4K3JA 1BTYA 2WINI 1ZLRA 1NPMA 2P59A 5DP5A 4Q7YA 5C5NA 4ABBA 4ISHH 1HNEE 2BLWA 4ABJA 1KXDA 2QA9E 1O3CA 1YGCH 1D6RA 1K1IA 1IQMA 2BDHA 2BY8X 3C27B 5EG4A 6CHAB 1ZJDA 2Y7ZA 3SU3A 1W12U 2JH6D 2A31A
chains in the Genus database with same CATH superfamily
1TONA 2GT7A 1U6QA 3IWMA 1TBZH 2EQNA 1F0RA 1Y8TA 3LU9B 1KDQB 1EAXA 2VIPA 2BHGA 1T4VH 3ZVBA 4NIYA 3OU0A 3SV6A 1AVXA 1GBDA 1BJVA 1A2CH 1UK4A 4ABDA 1MKWK 1EKBB 2P16A 1GCTC 3A7ZA 2P3TB 2PR3A 2VBCA 3M37A 2GVFA 4LOYH 5EQQA 4MNVA 5C94A 2GDEH 1H9LB 1V2KT 1XUJA 1FX0B 1OPHB 4B76A 2XW9A 1SGYE 2HVXA 1UTMA 1AGJA 1A1RA 2V0BA 2GZ9A 1P0SH 1CGIE 3UR6A 4ZH8A 1CT0E 1WBGB 1NFYA 1O38A 3SW2B 1CA0C 1C2FA 1YWUA 2F9VA 2QC2A 2V3MA 4ABGA 5C67A 1GMCF 4WMEA 2Q6DA 1NBME 5DN6D 5JDUB 1CO7E 4GCHG 1PPFE 1O35A 2EI6A 2BLQA 2Z9JA 2G52A 2CN0H 2P93A 5ESBA 1WDIA 3M3VA 2QCYA 1DWEH 2QGRA 1V2UT 2Z3EA 2ZQ2A 1MTNC 4H42U 3SJOA 8KME2 1W7GH 1YPHC 2IOTA 4NIWA 1O2ZA 1GVZA 1C5UA 1BMLA 1LVBA 3D49H 1GL1A 3U9AH 1BHXF 4U30A 1BTWA 4YESB 5DGJA 4P02A 2BX3A 2C4FH 1OWJA 1P2QA 2WUBA 3EE7A 1CBWC 2VIDA 2UUKB 4X8UH 2KFWA 1O2UA 2G5VA 2PTCE 1TIOA 2A2QH 4BANB 4X1NU 2CF9H 2BLOA 1GJDB 1IAUA 3FO8D 3LH1A 2J98B 3PM3A 5HIYA 1TA6A 2XTTB 1EB2A 4Q2KA 3TGKE 1BRBE 1BBRE 3A7YA 1ARCA 1SSXA 1Z71A 2WHXA 3UWIA 2F9OA 1VR1H 3N7OA 1GI1A 3DSGA 3N7EA 1TYNA 2Y5GA 1AIXH 5EJLA 2TRMA 2Z7FE 1O5BB 2BDIA 3L33A 4R0IA 5T6DA 1UCYH 2JIZD 2F91A 3ZZ6A 3HK6B 3BTEE 1G30B 3ELAH 4F4OC 1SLXB 1YBWA 2UWLA 3Q76A 4FU8A 3QN7A 1XKAC 1D3DB 4X6MA 2D2DA 1LPKB 1GBJA 1BMNH 3T27A 2AFQB 1O0DH 1UW7A 1EJAA 1QA7A 1YM0A 3MU8A 1GJ4H 1QL9A 5HMAA 3KQ5A 3RM0H 3SJKA 2XNIA 1QJ1B 2BYAX 4NWLA 1FPCH 1RTKA 4IGDA 1OYQA 2R0LA 1UTQA 1W0KD 3ZVGA 1T32A 1W14U 1C9TA 3UREA 1ZRKA 1AY6H 2BD9A 1VGCB 1IQEA 5HM9A 4JK5A 1MU8B 1LKAA 5BRRE 4UEHH 1MD7A 2K8IA 4UDWH 1XX9A 4XRNA 3GS9A 3I77A 3SI3H 1FY5A 1H8DH 1S6HA 1V2JT 2F9BH 2H5CA 4IC6A 1YCPM 1GL0E 5JBCS 2FX6A 4I7YH 1GI4A 1DLEA 1VITG 2FO9A 1N6YA 2WZQA 4JYUH 1KIGH 1UK3A 4X1QU 4H6SB 3VGCC 1GJ7B 4X6NA 3A7WA 1NRPH 2GP9B 2LPRA 2TGTA 5E2PA 4K8YA 1GI0A 1C1PA 1WOFA 8ESTE 1K22H 5EGMA 3LOXA 3VXEH 2BLVA 1O3LA 1M9UA 2PFEA 5C0UA 8GCHF 3DSOA 1KTSB 4JCNA 1C2EA 1OWIA 3Q3KA 1HJ8A 5DP9A 1BRAA 3F2GA 2C8YB 1K0HA 3S0NA 2FOCA 4NWKA 2ODYB 3SU4A 2B0FA 3L6PA 2RCEA 1O3BA 1Y3UA 2ALPA 4ISOA 2W7UA 2OTVA 3FZDA 1T8MA 2GT8A 1BRCE 1P02A 3EGKH 4RI0A 2A2XH 2ZFSA 1UTKA 5BPEA 1UVSH 1EUFA 2ZPSA 1C2LA 4LZ4B 1K1PA 1QY6A 4MPUA 5FBIA 2EEKA 1LQEA 2RA3A 1S84A 1EAWA 2YMSB 4OS1A 1Z1IA 2QXIA 3SV8A 1HIAB 1NM6A 3VPKA 1P2IA 5A8YA 1IHSH 2BQWB 1GHAG 3SUGA 3M3TA 4KP0A 1NT1A 2ZEBA 3F9GA 1Y59T 2HALA 1S6LA 2QXGA 3V0XA 1MKWH 1XM1A 1PPZA 3RXUA 3STIA 3P70B 2QF5A 3EQ0H 2ZP0H 3BTFE 2PSYA 4Y8XA 5LGOA 1T4UH 3BTWE 1G9IE 3URCA 3KF2A 3KQDA 3QZRA 3PB1E 1HAPH 1ELVA 2FLRH 1SGTA 2BD3A 1MMJN 1V2PT 2OQUA 5IDKA 2BMGB 2ZFPH 1SMFE 3S9AA 2ZGHA 1EPTB 1ARBA 2RFKC 4UFEH 7ESTE 1HAZB 3TJVA 1CGHA 2FS9A 2XRCA 3DFJA 4YOGA 2FXRA 2ZHEH 2WYGA 1O2JA 5FCKA 4ABFA 2F83A 4IN2A 1BMMH 2ODPA 4DIHH 2SNWA 1PFXC 3T5FH 2ANKH 4AGKA 1IQIA 4AG1A 3ZZ4A 4MNXA 2PGQB 3RXAA 1T7CA 3LDXH 1GI3A 1HAIH 3RXJA 2H6MA 2KAIA 4I32A 1T8NA 4X1PU 2WYJA 1GGDC 2B8OH 3F2HA 5C1YA 1Q3XA 1BHXB 5JBAS 1P2OA 2FOBA 1F0SA 3ZZ7A 4DY7B 1MD8A 1GBEA 3JZ2B 5C1UA 1EX3A 1VCWA 1O3EA 3PMJA 1SOZA 2AGEX 3A86A 3Q3XA 1Q2WA 1MCTA 3T28A 5L2YH 4GPGA 3RU4T 2HOBA 1GHBG 3GCTG 4ASHA 1NRRH 2A7JA 1XXFA 5FAHA 2AMQA 1FAXA 4B2AA 4X2WA 1SG8B 4KELA 3SOSA 1EZXC 2AS9A 1J8AA 1L1NA 1K1JA 3VB5A 4NFFA 2GDDA 1EATA 1SL3A 3EA9A 3MU0A 2W26A 3MH5A 3VB3A 4NCYA 1QJ7B 1Z6EA 1BTUA 6LPRA 4JZ1A 4AC9A 4PROA 1YC0A 1C5RA 1G37A 5E0GA 3W94A 4O97A 3HGNA 7GCHG 4GLYA 1GI5A 2ZTYA 1EFRD 1A3EH 2HNTC 1NFUA 1OXGA 3RXGA 1C1RA 2OC1A 1DT2A 4AFZA 3BTKE 1G32B 3OY5U 5A8ZA 3N99A 1IQLA 3UNSA 4ASUD 4OS4A 5EPNA 5F53A 1HPGA 4IC5A 2CJIA 1FIWA 1MAYA 2G5NA 9ESTA 4ZHAA 1YPEH 3SHAH 1DITH 1JXPA 1SFQB 4MDSA 4IN1A 2FS8A 1H9IE 1DSTA 1ZSKA 5EQSA 1TRMA 4H6TA 3TNSA 1QRXA 1C1NA 3ZVDA 1K1LA 1SB1H 1L2EA 2BZAA 2HPPH 2OP9A 2PGBB 1QURH 4AX9H 3KYFA 3RU4E 1Z7KA 4NA7A 3MO9A 1KSNA 2EI8A 4GAWA 1O39A 5C0TA 3SGQE 7LPRA 1W3CA 4UFDH 2OK5A 1V3XA 1V2VT 3SUFA 4YLUA 2CF8H 1LDTT 1O3OA 2GMTC 4FUBA 4B2BA 4ZKSU 1LHEH 4A1XA 2QF4A 4A1TA 3FVFB 3MH6A 4DW2U 1ETTH 1AE5A 1UK2A 3BG4B 1EZUC 2XBWA 2BVSH 3C1KA 1GI6A 4WF8A 1ELTA 2Z6BD 1BOQA 1FV9A 2XBVA 3TNTA 3F0PA 1O3MA 4CBNA 4BXWA 1KDQA 5CHAC 5FBEA 1O2PA 2OD3B 1A4WH 4IW4E 1PYTD 1RIWB 2IPQX 3HKJB 4DVAU 1O32A 1Z8JB 2B5TB 2KCYA 1SGNE 3PO1B 2UUFB 3RMMH 1TPSA 3WWBA 1KMHB 2O8MA 1GWAA 1C4U2 3U28C 4D8NA 2G4UA 1A0LA 2R3UA 2ZDLA 1C5YB 4CRFA 2F4LA 1KYNA 5DKMA 2H2ZA 1CE5A 3ZZ5A 3NUMA 1QIXB 4Z0KA 5DP4A 5KECA 1SOTA 4B2CA 1F0TA 3SUDA 1GVLA 1AFQB 2WSSD 3RXVA 3QGNB 5DP8A 1E1QD 1K28D 3UWJH 2BX4A 1V2NT 3GOVB 4KTCA 4ZKRU 2V7QD 2ZG0H 4RKOB 3HPTB 1ZSLA 4XBDA 3SJ8A 1GJBB 5AFZH 4BTTB 1TMBH 1AU8A 1CHOF 3FN8A 3BN9A 4X8TH 1J17T 2ULLA 3A8AA 3SHCH 3CNRA 4LXBH 3A81A 4CRAA 2Y81A 5FX5A 4AN7A 2LNCA 1C1OA 2FOHA 1DOJA 2FOFA 1L4DA 4F49A 2J98A 1W7XH 2BOHB 3M7QA 1DXPA 1LCYA 1SLVB 2Q1JA 3GY3A 2FP7B 3LONA 3BF6H 2ZHQH 3M61U 1NROH 2BY5X 3GYLB 2SNVA 4M7GA 1K9OE 2EY4C 1C5MD 1HAVB 1H8HD 4WMDA 2Z94A 2A4OA 2BD5A 1W11U 4X2VA 1LHCH 3LGVA 1OWHA 1NN6A 1WCZA 1C9PA 5EXNA 2UUYA 3LC3A 5EJZA 6GCHF 2ZWLH 2QV1A 3H7OA 2BXTH 2PKAB 2BQ6B 3PTBA 4TWYA 4TWWA 2QIQA 3CS7A 4XBBA 1NRQH 2ANYA 1DVAH 2P3UB 3OSYA 4FETA 3ATMA 4X6OA 1QA0A 4I8LA 1C1UH 4GSOA 2A4GA 3TK9A 4CR9A 3SO3A 1C5TA 3UFAA 3PV2A 3BTTE 1S85A 4K1SA 3DT0H 4WJG2 1FZZA 3SU0A 2O8UA 1ZZZA 1PYTC 3EE0B 3LT3A 3SU5A 1MABB 3O8CA 1VCPA 5EW1H 4BTUB 2VIWA 4BAHB 1UO6A 2ZKSA 4O9VA 2BDGA 2OC7A 3NK8A 3A87A 2PV9B 3SGBE 3E0NB 1V2LT 1AWHB 2PKSB 3BTQE 1P12E 1NY22 3RP2A 5CDFE 1GMDG 1TNLA 2G55A 1C2GA 5HKKD 2GKVE 2VH6A 2O8WA 2YNBA 3BIVH 4YO9A 1E38B 2QXJA 5FX6A 3IG6B 2OCVB 2AYWA 3Q77A 3BSQA 1FY1A 2YNAA 1ZMJA 3ZYDA 1UTPA 5EODA 2ZC9H 1ELBA 3QUMP 3NPSA 1O2NA 1VCQA 1JIMA 4IMZA 2VH0A 1D3TB 5TJXA 1F5KU 4AYVB 1GBMA 3PMHB 1X7AC 3FP7E 5GXPA 3RXRA 1YCPK 2FLBH 2VNTA 2A7CA 1K21H 4KKDA 1HJAC 1Q31A 1V2WT 3ITIA 2FOMB 5F03A 1HXFH 1GG6C 4RT1A 2A1DB 2TGDA 3H09A 5EU8A 1P8VC 1LHDH 1TMTH 1GPZA 2CV3A 4TYDA 1DFPA 1QGFA 4FUFA 2VWLA 1E79D 4HTCH 1KXAA 1OOKB 1ZRBA 3O8BA 1SLWB 2BTCE 1QB1A 4O3UA 4ABHA 1A0JA 4I8JA 1WAYB 1XVMA 3S69A 1HIAA 3LC5A 3U8RH 3ZZ3A 1S5SA 2GCHF 5HYOA 1MKXK 1A61H 4ISIH 3T25A 2LELA 2W7SA 1GDQA 1VJ9U 3PMBB 5DPAA 1XUIA 4MQAA 1N8OB 3F6UH 5GWZA 3F9HA 5H4IB 4XD7D 1Y3WA 1W0JD 3SQEE 4BAMB 2A5AA 2VIVA 3A88A 5FPYA 2WPJS 1OHHD 3P8OA 1AB9B 2BZ6H 2XC5A 4VGCB 4XFQA 4YT6H 3MNXA 2NWNA 5AFYH 4A92A 5GCHF 2DE8A 1CT2E 2OUAA 3S9CA 1IQJA 4NG9H 2ZDKA 5T3HA 4JZEH 2KCPA 1NBMD 1V2RT 2BDCA 2EI7A 2WPDD 1FN8A 4Y8YA 1GMHF 1ZR0A 2BY7X 1NRNH 4TSFD 4YTAA 1IOEA 1BIOA 4JYVH 2XC4A 4D9QA 4FUJA 2O8TA 4KTSA 3GCNA 1ZSJA 2FOAA 2WV5A 1EPTA 2GV6A 4AFUA 1E1RD 3MYWA 1BT7A 1V6DA 1ZTKA 3VG8A 3STJA 2PSXA 1HBTH 1C1VH 2GCTC 1S0QA 1LPZB 2OBOA 2BB4A 4MTBA 4FXGH 1DXWA 1RTFB 1P09A 2FI5E 4A1VA 1AUJA 4AFSA 1OP8A 1G36A 1BJUA 2P8OB 2H1UA 1D3PB 2JH5D 3Q3YA 1WSSH 4ZAEA 1ELFA 2Q6GA 4F48B 1ACBE 2XYAA 1HLTH 4OS6A 4R8TB 3TLOA 3W95A 2ZFTA 1XUKA 3K6YA 3F0OA 1J15A 3KGPA 4M9FA 1INCA 1OP0A 1NZQH 5C2ZA 2SGDE 2SGFE 3DA9B 1AKSB 4H4FA 2WPLS 3ZVFA 1F7ZA 1THPB 1JWTA 1TRYA 3T26A 4RSPA 3M7TA 1LHFH 1O5CB 1V2QT 1ZPZA 1E0FD 3FOAA 1SFIA 4YLQH 2L6OA 4INLA 4NA9H 2SFAA 3HKIB 1RFNA 4Q80A 4WWYA 4Y7BA 1XVOA 1MTVA 5A0CA 5C1XA 1MZDA 3U1IB 1EB1H 4U01A 4CREA 4ACAA 4JZIA 1GCDA 5ABWA 1F5RA 1DWBH 4AB8A 5C5OA 4U32A 4OGXA 4B6EA 3P6ZB 5GJ4B 2VWNA 5A0BA 3LIWA 1P2MA 1XUFA 3MWIU 3SJ9A 1GBIA 1TX6A 1QTFA 1C5LH 1ABJH 1C1WH 5GDSH 4X2YA 2P3FH 2BDBA 4Q4LA 4ZKOU 4X8VH 5F8TA 3TGJE 1AHTH 5DK1A 2OQ5A 1BTHH 1GJ6A 3KIDU 4Y7AA 1BMFD 2G8TA 2I6SA 3UB0A 2AH4X 3E16B 1V2MT 1VITH 3RUOA 4DGJA 1TPPA 4OGYA 4AB9A 1IQNA 3RC6A 1FXYA 2PW8H 4INHA 1E35B 3EDXB 2XWBI 1HGTH 2F3CE 5HGGA 3ZIAD 4AYYB 1EJMA 1SKYE 3UOPA 2A4QA 1RRKA 3KN2A 1DDJA 1GDUA 3RDZA 1XKBC 5FPTA 1GI7B 2ZHFH 1GCTB 1TE0A 2NU3E 8LPRA 5LPRA 1D3QB 2BY6X 4ZCNA 1DM4B 4Y76A 2C8XB 3QWCH 2Y5HA 4WH8A 3AW1A 1MU6B 3QLPH 1EAIA 1O3DA 1V2OT 3PLKA 4WH6A 4ZXXH 1LQDB 3LGUA 1YCPH 2AGIX 2QF3A 4FOUC 3SGAE 1TFXA 1CA0B 1QNJA 1UTOA 2WV9A 2J2UA 3A84A 4UFFH 3TH3H 1CA8B 3M5NA 1BMAA 1DWCH 1A7SA 5ETXA 4ZHLU 1QB6A 2UWOA 2D1JA 2V3OH 2W3IA 5TCCA 1NU7B 1HAGE 2BD8A 2ZDNA 1YKTA 4O03A 1B0EA 3SU2A 3IITA 1AD8H 1BQYA 5KGOA 3VXFH 4CRBA 1MTWA 2BD4A 2J5UA 1A5IA 1G2LA 2VGCC 3MQKC 1C5PA 3MNSA 2STBE 1GI8B 1MKXH 2IJD1 1L1GA 4HZHA 2AGGX 3V13A 1O2YA 7GCHF 1O30A 1HCGA 2GZ7A 1CBWB 1G3EA 3L3TA 1FN6A 1PJPA 3RXTA 3GY6A 5FPSA 2VB0A 1GBAA 1O2HA 4X1RU 1O5EH 1O3HA 4D9RA 2XCFA 1O2RA 5L6NH 1GMCG 3JZ1B 3BEUA 2KM0A 4ABIA 1DS2E 3P8NA 1S6FA 2R0KA 3BG8A 3Q00A 1GBTA 1WXRA 1A0HB 2QXHA 2VVUA 3PV5A 1RXPA 3K2UA 2SGQE 3RXOA 1SVPA 1BBRK 1TA2A 2JJ1D 3QX5H 1FI8A 4JK6A 1H8IH 3PWCA 5TCAA 2ILNA 1DPOA 5F8XA 2D8WA 5FCRA 1FUJA 2ZFRH 3MHWU 3SU6A 3TK5A 5GPIB 1SGQE 1SHHB 4ZKNU 3UY9A 1GHWH 2FESH 5LPFA 3SQHE 1ELEE 3U69H 2VWMA 3QK1A 1O2WA 4FUEA 2HNTF 3TJUA 3GDSA 2KX4A 1O2GH 1EAUA 2JETC 3SNEA 4INKA 2VIOA 3G01A 1NO9H 1DE7H 3BIUH 3ZZCA 1HAVA 1CU1A 3T62A 1SQAA 1H9HE 2W6JD 2O8LA 1W2KH 3GCHB 3FANA 5E8EH 3KQEA 4ABEA 2F9PA 4Y0YE 2ZGJA 5T6GA 1Z6JH 1QJ6B 3SORA 2PKAA 2FI4E 2CGAA 4MNWA 6CHAC 4QT8C 3OE7D 1O36A 1ORFA 1ELGA 3FFGA 3MMGA 1RTLA 2C93B 3BV9B 1C5QA 3TJOA 2Z9LA 4IMQA 1TNGA 1KXCA 2OLGA 1P3EA 3MNCA 4BNRA 4GCHF 1TPAE 2FWWA 2FEQH 3NXPA 3VGCB 5HXFA 4JZDH 1MTSA 4K2YA 3BTGE 3CENA 1IQFA 5J4QA 1IQGA 2CXVA 3TK6A 5DG6A 2NU2E 4WY3A 1FJSA 3DHKH 2ODQA 3OEED 1LVOA 3VEQB 2ZCLP 4I31A 1Y3YA 3OEHD 4F55A 1PQ8A 1WTHD 2HWLB 3OTPA 2A32A 5LPEA 2BVRH 1C5NH 2UWPA 1XXDA 2GD4B 2K0QA 2K1QA 1GJCB 1ZOMA 2OC8A 1J16A 1KY9A 1O2XA 1QQUA 1WV7H 3ENSB 5EQRA 2J95A 2JH0D 1QCPA 1GI2A 1ZGVA 2BY9X 2TIOA 1P3CA 2ZO3H 3URDA 1A5GH 1CT4E 1NU9A 1O33A 4TPYA 1A3BH 1LO6A 3RU4D 6ESTA 3AAUA 3UPEA 1TX7A 2EC9H 2GTBA 1TRNA 4UONA 1L1JA 2XBXA 2QN5T 3H7TA 3P95A 3RXSA 5C17A 1RD3B 1VJAU 3CP7A 2J34A 3PYHA 3RXCA 2FMJA 1JBUH 5F8ZA 5EXLA 5A09A 5DSFA 3D62A 4ZHMU 1MBQA 1WQVH 1ZTJA 1COWD 1C2KA 1GJ5H 3KL6A 8GCHG 2RDLA 1HAOH 1Z1JA 1TB6H 1GHYH 3F3BA 4B73A 3BTHE 4BAOB 4Y0ZE 3ZVEA 2ZCHP 3RLWH 1YPMH 1QHRB 1GJ8B 2YMSD 4HI3A 1JRSA 1TGSZ 3BTDE 1QQ4A 1FAKH 1TNJA 2FPZA 2OC0A 2QY0B 2AHME 4ZXYH 2BDAA 1QFKH 1MZAA 5IK2D 4K1EA 1YPHE 3ESTA 1B0FA 1OS8A 1WTGH 3RLYH 4CRCA 1GBBA 2WPHS 2V3HH 3SV7A 1FONA 4GHTA 3LGYA 3TGIE 2XXLA 1HB0B 1EJNA 1XMNB 3BEFB 1ZHPA 1ANCA 1ZMLA 1C5OH 2HPQH 1QL8A 1UTJA 1EZQA 2C90B 2ZU1A 4YOIA 4BTIB 2Y6TA 1VITF 2ANMH 1C2DA 1J14A 3QO6A 1GDNA 3TIUA 3QTVH 2VVCA 1YLNA 3UR9A 4Q7XA 5EOKA 1SQRA 2ZCKP 2ZU4A 4DJZB 2RA0A 2ZZUH 3ZVCA 1KLTA 1HJ9A 2BOKA 1UHBB 4BOHA 4FUDA 3NRLA 1O2OA 3SU1A 3SNCA 4AORA 3ATWA 1O2SA 1AZZA 2GX4A 1GGDB 1TNKA 3GICB 3ZZ8A 4CH2B 4K60A 3SNAA 4B75A 1VGCC 2G4TA 1MH0A 2DE9A 4CHAB 1AO5A 4K69A 2Y5FA 2TPIZ 1Y5AT 2AERH 1S83A 3KHVA 1C5VA 3BEIB 2WPMS 1FDPA 1G3DA 4WXIA 2H5DA 1Z8RA 1ABIH 5L30H 1SGIB 1UTNA 1BBRH 1O2LA 3H5CB 3MU4A 1UVTH 4CR5A 4YM9A 4HG6A 1SLUB 2WPIS 2FX4A 2IJOB 2BVXH 1PPHE 1YPKH 2FIRH 1TWXB 2C8WB 1BTPA 1RJXB 4AG2A 1PQAA 1WUNH 4OM9A 1LHGH 3SUEA 1DY8A 1PPBH 3A7XA 1QR3E 4AFQA 1AKSA 3RC5A 1O37A 1HAHH 1P2NA 1TGTA 3M5OA 1GHAF 1GBCA 5A8XA 4CBOA 3E8LA 1GHVH 2DUCA 1Z8GA 1PPCE 2ZNKH 3NWUA 3FP6E 1T8OA 3UUZA 3VB4A 5JB8S 3GYMA 1CVWH 1BA8B 3RXMA 1C2JA 3LGIA 1OKXA 3F1SB 4CRGA 2SGPE 1TALA 1TOCB 4YT7H 5FHTA 1ELCA 3KQBA 3ZV9A 2FYRA 4A6LA 1CSOE 4BAQB 2R3YA 1P57B 3BTME 3NCLA 1MQ6A 4FUHA 4MPXA 2VIQA 1UTLM 1O2VA 1AQ7A 1EZSC 1YPGH 1KXEA 3VB7A 1L4ZA 1EOJA 3QZQA 4UE7H 2P95A 1JRTA 1YLCA 4AOQA 1C1TA 2YMSC 5JBBS 3A82A 3SZEA 1SGRE 2W5EA 1VZQH 1DX5M 1WU1A 1B5GH 2ZTXA 5J4SA 2G00A 3SV2H 2ZU3A 3SN8A 7KMEH 1SR5C 3UNRA 2KZ4A 1YP9A 2JKHA 3I29A 1QZ8A 2A45B 3RXPA 3OY6U 3V3MA 1C1QA 2GMTB 2ZGCA 3KQCA 2WUCA 4HGCA 1Y3XA 2ZIQH 2FYQA 5LH8A 3EYDA 4OS7A 3M5LA 4RT0A 3DSPA 5GNDA 4MLFB 3TU7H 1OYTH 2AIPA 2CHAB 1NFWA 5CHAB 1JIRA 4HFPB 1MBMA 1TLDA 1O3JA 1ZYOA 1SI5H 3TVJB 1EP6A 1O3PB 1NRSH 2CMYA 2ZU5A 4BAKB 5DO4H 1K1OA 1QBOA 3AW0A 1EPTC 1W0YH 1PPEE 3U8TH 3ZYEA 1FNIA 1VKYA 2PUQH 1N1LA 1S0RA 1W13U 2QAAA 1T31A 4NA8A 4UFGH 3SNBA 2ZTZA 1GHBF 4X2XA 3GCTF 2FM2A 1BTZA 2FOGA 1ANDA 1C5SA 4E05H 4SGAE 3GISB 2L74A 2ZDAH 3RMOH 1DUEA 1P05A 1HYLA 4O3TA 4CH8B 4MVNA 4SGBE 2VU8E 1GJ9B 2J38A 2AMDA 2PLXA 5E0HA 3OTJE 2GZ8A 1OP2A 2XCNA 4MPVA 3UIRA 2QF0A 1B7XB 4I8KA 4MG3A 5AVDA 3A7VA 3I78A 1AZ8A 2HVYB 1QRWA 3PLPA 3N7DA 4DG4A 2XBYA 1PQ5A 4YXWD 1P06A 3MO3A 2J9NA 3UAIC 3MTYA 2VJ1A 1TABE 1AMHA 2KR7A 1E36B 2C8ZB 3SJIA 4CRDA 2J97A 4JYTA 4Y8ZA 1V2ST 3F9EA 1O3FA 2Z3CA 1IQHA 1ZTLA 2QE7D 2THFB 2R9PA 3MO6A 1O3KA 4XDEA 1TNIA 2WPKS 2H9HA 4X1SU 1AVGH 1A46H 4NIVA 3F9FA 2B7DH 4XE4A 2UUJB 4K8BA 3W1EA 2I6QA 4Q63A 2J92A 4YOJA 3ODFA 1BDAA 3GY2A 3EAJA 3M3SA 1BTXA 2KCOA 2PUXB 1D9IA 3SI4H 3GCHC 4GHQA 1CHOG 3PLBA 3UNQA 3P8FA 4ZUHA 1GJAB 1KXFA 2ZU2A 2F9NA 1GBFA 4ISNA 4Z1MD 4Y6DA 1AN1E 2ZDMA 1D6WA 4J2YB 3LJOA 1EXFA 1E37B 3NZIA 1K2I1 1SBWA 5EIYA 1RS0A 1MUEB 1HUTH 4AZ2B 1LMWB 2Z9KA 1S82A 1F92A 1F0UA 1AUTC 5DP6A 1LVMA 2HLCA 1ESBA 3PRBA 1G3CA 2R2WU 1TQ0B 5EPYA 1PPGE 3FP8E 2XNDD 2PWXA 3A85A 1C1SA 1TBRH 2HNTE 4DT7B 3HGPA 4I8HA 5CE1A 2BM2A 1TGCA 1BZXE 6GCHG 4JZFH 3E1XB 3BG4C 5KEDA 2D26C 3D23A 1XUHA 2J94A 1FLEE 1CHGA 3U8OH 3E90B 3P92A 1ESAA 2Y80A 5EXMA 3PV4A 3EA8A 3DCLA 3PROA 4WMFA 2Z9GA 1DUAA 1GI9B 1HAXB 1RIWC 2ZI2H 2AEIH 1TBQH 2Y7XA 4D76A 3AVZA 3P17H 5ESTE 4P00A 4B71A 3PO1C 3TH4H 4GVUA 3T29A 3SV9A 3O8DA 3RXDA 1DWDH 4JMYA 4FU7A 5A0AE 1DLKB 1P10A 4NSVA 1DSUA 1K1MA 1O2IA 2FTMA 2STAE 4ABAA 3FKSD 3P8GA 1GHZA 3ATIA 3VB6A 2PHBA 1TMUH 3NKKA 1E34B 3HATH 4NZLA 5K0HA 3QTOH 1SPJA 1P2JA 2YOLA 1HJAB 1O5AB 3PWBA 3HK3B 5A2MH 1JOUB 1EQ9A 1QBVH 3RXIA 1O5FH 3E0PB 1ETSH 1HRTH 3WY8A 2VVVA 2A0QB 2P94A 1GG6B 3OFND 4NGAH 1FIZA 1UCYE 3GY8A 3SNDA 2ZGBH 2Y82A 1AFQC 3AK5A 2XC0A 4Y11E 3WW7A 1TNHA 1QRZA 4ACBA 2ESTE 5CHBA 3GDUA 1HFDA 1EOLA 3RXBA 1YF4A 1P03A 1MCVA 3ZZAA 1LPGB 1FMGA 1O2QA 4FVDA 4K1TA 1NS3A 4WVPE 5JPMH 1MTNB 1QB9A 4I33A 3UOUA 2ANWA 2JDID 1CQQA 1TX8A 4XSKU 4I8GA 1O34A 5C3NA 1GVKB 3TJNA 5C20A 2BD2A 4NIXA 1GBHA 3F68H 4XOJA 1DY9A 4AGJA 1SGPE 3UQOA 4NSYA 5K7RA 5AF9H 1SGFA 3MH4A 4OS2A 3VFEA 2ZHDA 4E06H 1Y5BT 3DFLA 3LPRA 1NC6A 4YZUA 1D4PB 1W10U 1THSH 1WYKA 4ISLA 3S7KB 5G4BA 2BDYA 2VWOA 1P9SA 3A8CA 3RMNH 1N6XA 3GY4A 2ZHWH 5HIZA 1GBLA 1YPJH 1ANEA 1F5LA 4THNH 4U2WA 3S7HB 2H9TH 1C5ZB 4MPWA 9LPRA 3MH7A 3WWFA 1NESE 2GCHG 3RC4A 2KCAA 1FY8E 1BCUH 4DOQA 2GJGA 2PP6A 1GMDF 5DP3A 2ZPRA 4CHAC 1C2IA 2GCTB 3MOCA 2ZF0H 1KTTB 1OWKA 3AAVA 1C2HA 4FU9A 2FI3E 4TPIZ 1WQSA 4MNYA 3A89A 1Y5UT 2BXUH 1NFXA 4Y10E 1H1BA 1NTPA 3AASA 5GCHG 4KGAA 3LGTA 1UHBA 2OBQA 2C3SA 1THRH 5DJ7A 4TY7A 1LTOA 3RM2H 1GMHG 1C5WB 4A7IB 1HAYB 3ZZBA 1ESTA 2NU4E 3K65B 3A83A 3KCGH 4FUCA 2CK3D 3R0FA 2PTNA 3MI4A 1O2TA 3PMAB 1AI8H 3TPIZ 2PKSC 1ZPBA 2GV7A 3R3GB 1O2MA 3MU1A 1EASA 2TBSA 1C5XB 1OX1A 2W6ID 3OYPA 2O9QA 1MAXA 5F6MA 2SGAA 1IQKA 3A7TA 4TT3D 5I46H 1C4V2 2G51A 3QDZB 3RXFA 2HRVA 4DURA 1O3NA 4UD9H 4D7GA 1P11E 3GY7A 3MFJA 4RKJB 3T2NA 1SQOA 2A7HA 2Z3DA 3E3TA 4FUGA 1J9CH 3ZV8A 5PTPA 1TPOA 1AWFH 2A5KA 2J4IA 1FY4A 3RXQA 1O2KA 3D65E 3LKWA 3RXEA 1O3IA 3K9XB 5HM2A 1O3GA 5DP7A 1AVWA 1QL7A 1P04A 2ZQ1A 1MQ5A 4ZMAH 2WV4A 1C4Y2 5CMXH 1P9UA 1DICA 1SHYA 1PQ7A 5FXLA 1G3BA 4Z6AH 1LKBA 2GGVB 3OX7U 1HXEH 2NU1E 1SGCA 5I25A 1O31A 1P2KA 1SGDE 2ZPQA 1RGQA 4J1YA 5IYTA 2TGAA 3FZZA 2H9EH 1AFEH 1UVPA 1YY3A 5E0JA 1MTUA 3ZZ9A 1F2SE 5SGAE 1HDTH 2A5IA 1UJ1A 2IPHA 3GY5A 1TQ7B 3RXLA 4LZ1H 3UTUH 2CHAC 3V7TA 4LK4A 1ID5H 1SGEE 4RN6A 1QBNA 1ZGIA 5AHGH 3V12A 2V6NA 1C1MA 1JMOH 4NFEA 1FPHH 1N8OC 5L2ZH 2FDAA 2W3KA 1BUIA 4B6FA 2FODA 3B8JA 3S9BA 1KLIH 2FTLE 3M36A 5EJ1A 1AB9C 2FZZA 4VGCC 1K1NA 1OSSA 1ZHRA 2ZFFH 1OWDA 2Q6FA 3MU5A 3K6ZA 2ASUB 4X8SH 3TITA 1S81A 1SQTA 1H8ED 2ZA5A 2V35A 1IHTH 2F9UA 3B23B 4DCDA 1TGBA 2ZFQH 3DUXH 3LH3A 3M5MA 4ZROA 2XWAA 2FOEA 4GUXA 1O5GH 1SGFG 1EP5A 1ZPCA 1V2TT 5JYIA 2BD7A 1UCYK 1W8BH 3CS0A 1SC8U 2KAIB 5GIBA 1L0ZA 4E7RG 5JBTA 1Z8IB 1OWEA 1ELAA 3B9FH 3U98H 3M7UA 1Y3VA 3KNXA 1O3AA 1C2MA 2LP6A 1YPLH 2HGTH 1GHXH 3ZVAA 2OXSA 3RXHA 2AMPA 2AIQA 1GBKA 2SGEE 4FVBA 5T6FA 4Y79A 1AE8H 2QYIA 4DIIH 1UVUH 4NZQA 4BXSA 3SBKA 4FUIA 1ZHMA 2RDEA 3GCOA 3O8RA 2XOKD 2VGCB 2EA3A 1ANBA 2P8OC 3M35A 1T8LA 1G2MA 4K5ZA 1A5HA 2ALVA 1KLJH 1H4WA 4XBCA 3E91A 2ZGXH 4X6PA 2M5TA 1HV7A 4X0WU 2F43B 2R2MB 1DANH 1ZMNA 3ZZDA 4D7FA 4KTUA 5B6OA 5JB9S 2OINA 3LJJA 3PTNA 1BB0B 1CGJE 3ATLA 1O5DH 2HLDD 2TGPZ 1TOMH 2A4RA 1UMAH 1KXBA 3RMLH 3ATKA 3A80A 4IS5A 1ETRH 3MNBA 1FY3A 1YLDA 2G81E 3QGJA 4DT4A 3FAOA 5T1VA 1LVYA 1TAWA 3U1JB 4B74A 4Y71A 1W0ZU 4OS5A 1XUGA 2IN2A 4WXVA 1BITA 2Z9IA 5B6LA 3A8DA 3ODDA 3UQVA 1ELDE 1ZJKA 1FQ3A 2NU0E 3EA7A 3KEEA 3RXKA 3SZNA 3A8BA 1P01A 1UVOA 2BQ7B 2RG3A 4E7NA 4Q7ZA 1YYY1 2VINA 2JJ2D 2JETB 1BRUP 2ZDVH 3GDVA 2ZECA 5EW2H 3LGWA 3E6PH 5FL7D 3PRDA 4IBLH 3TH2H 5E2OA 4A5TS 3DD2H 3OAAD 3KYGA 2B9LA 1TGNA 4B1TA 4TY6A 4I86A 3F2FA 4ESTE 4K3JA 1BTYA 2WINI 1ZLRA 1NPMA 2P59A 5DP5A 4Q7YA 5C5NA 4ABBA 4ISHH 1HNEE 2BLWA 4ABJA 1KXDA 2QA9E 1O3CA 3SYJA 1YGCH 1D6RA 2M2AA 1K1IA 1IQMA 2BDHA 2BY8X 3C27B 5EG4A 6CHAB 1ZJDA 2Y7ZA 3SU3A 1W12U 2JH6D 2A31A
chains in the Genus database with same CATH topology
1TONA 2GT7A 1U6QA 3IWMA 1TBZH 1F0RA 1Y8TA 3LU9B 1KDQB 1EAXA 2VIPA 2BHGA 1T4VH 3ZVBA 4NIYA 3OU0A 3SV6A 1AVXA 1GBDA 1BJVA 1A2CH 1UK4A 4ABDA 1MKWK 1EKBB 2P16A 1GCTC 3A7ZA 2P3TB 2PR3A 3M37A 2GVFA 4LOYH 5EQQA 4MNVA 2GDEH 1H9LB 1V2KT 1XUJA 1OPHB 4B76A 2XW9A 1SGYE 2HVXA 1UTMA 1AGJA 1A1RA 2V0BA 2GZ9A 1P0SH 1CGIE 3UR6A 4ZH8A 1CT0E 1WBGB 1NFYA 1O38A 3SW2B 1CA0C 1C2FA 2F9VA 2QC2A 4ABGA 5C67A 1GMCF 4WMEA 2Q6DA 5JDUB 1CO7E 4GCHG 1PPFE 1O35A 2EI6A 2BLQA 2Z9JA 2G52A 2CN0H 2P93A 5ESBA 3M3VA 2QCYA 1DWEH 2QGRA 1V2UT 2Z3EA 2ZQ2A 1MTNC 4H42U 3SJOA 8KME2 1W7GH 1YPHC 2IOTA 4NIWA 1O2ZA 1GVZA 1C5UA 1BMLA 1LVBA 3D49H 1GL1A 3U9AH 1BHXF 4U30A 1BTWA 4YESB 5DGJA 2BX3A 2C4FH 1OWJA 1P2QA 2WUBA 1CBWC 2VIDA 2UUKB 4X8UH 1O2UA 2G5VA 2PTCE 1TIOA 2A2QH 4BANB 4X1NU 2CF9H 2BLOA 1GJDB 1IAUA 3LH1A 3PM3A 1TA6A 2XTTB 1EB2A 4Q2KA 3TGKE 1BRBE 1BBRE 3A7YA 1ARCA 1SSXA 1Z71A 3UWIA 2F9OA 1VR1H 3N7OA 1GI1A 1TYNA 2Y5GA 1AIXH 2TRMA 2Z7FE 1O5BB 2BDIA 3L33A 4R0IA 5T6DA 1UCYH 2F91A 3ZZ6A 3HK6B 3BTEE 1G30B 3ELAH 4F4OC 1SLXB 1YBWA 2UWLA 3Q76A 4FU8A 3QN7A 1XKAC 1D3DB 4X6MA 2D2DA 1LPKB 1GBJA 1BMNH 3T27A 2AFQB 1O0DH 1EJAA 1QA7A 1YM0A 3MU8A 1GJ4H 1QL9A 5HMAA 3RM0H 3SJKA 2XNIA 1QJ1B 2BYAX 4NWLA 1FPCH 1RTKA 4IGDA 1OYQA 2R0LA 1UTQA 3ZVGA 1T32A 1W14U 1C9TA 3UREA 1ZRKA 1AY6H 2BD9A 1VGCB 1IQEA 5HM9A 4JK5A 1MU8B 1LKAA 5BRRE 4UEHH 1MD7A 4UDWH 1XX9A 3I77A 3SI3H 1FY5A 1H8DH 1S6HA 1V2JT 2F9BH 2H5CA 4IC6A 1YCPM 1GL0E 5JBCS 2FX6A 4I7YH 1GI4A 1DLEA 1VITG 2FO9A 1N6YA 4JYUH 1KIGH 1UK3A 4X1QU 4H6SB 3VGCC 1GJ7B 4X6NA 3A7WA 1NRPH 2GP9B 2LPRA 2TGTA 5E2PA 4K8YA 1GI0A 1C1PA 1WOFA 8ESTE 1K22H 5EGMA 3LOXA 3VXEH 2BLVA 1O3LA 1M9UA 2PFEA 8GCHF 1KTSB 4JCNA 1C2EA 1OWIA 3Q3KA 1HJ8A 5DP9A 1BRAA 2C8YB 3S0NA 2FOCA 4NWKA 2ODYB 3SU4A 2B0FA 3L6PA 2RCEA 1O3BA 1Y3UA 2ALPA 4ISOA 2W7UA 2OTVA 3FZDA 1T8MA 2GT8A 1BRCE 1P02A 3EGKH 2A2XH 2ZFSA 1UTKA 5BPEA 1UVSH 1EUFA 2ZPSA 1C2LA 4LZ4B 1K1PA 1QY6A 4MPUA 5FBIA 2EEKA 1LQEA 2RA3A 1S84A 1EAWA 4OS1A 1Z1IA 2QXIA 3SV8A 1HIAB 1NM6A 3VPKA 1P2IA 5A8YA 1IHSH 2BQWB 1GHAG 3SUGA 3M3TA 4KP0A 1NT1A 2ZEBA 3F9GA 1Y59T 2HALA 2QXGA 3V0XA 1MKWH 1XM1A 1PPZA 3RXUA 3STIA 3P70B 3EQ0H 2ZP0H 3BTFE 2PSYA 4Y8XA 5LGOA 1T4UH 3BTWE 1G9IE 3URCA 3KF2A 3KQDA 3QZRA 3PB1E 1HAPH 1ELVA 2FLRH 1SGTA 2BD3A 1MMJN 1V2PT 2OQUA 5IDKA 2BMGB 2ZFPH 1SMFE 3S9AA 2ZGHA 1EPTB 1ARBA 4UFEH 7ESTE 1HAZB 3TJVA 1CGHA 2FS9A 2XRCA 3DFJA 4YOGA 2FXRA 2ZHEH 2WYGA 1O2JA 5FCKA 4ABFA 2F83A 4IN2A 1BMMH 2ODPA 4DIHH 2SNWA 1PFXC 3T5FH 2ANKH 4AGKA 1IQIA 4AG1A 3ZZ4A 4MNXA 2PGQB 3RXAA 1T7CA 3LDXH 1GI3A 1HAIH 3RXJA 2H6MA 2KAIA 4I32A 1T8NA 4X1PU 2WYJA 1GGDC 2B8OH 5C1YA 1Q3XA 1BHXB 5JBAS 1P2OA 2FOBA 1F0SA 3ZZ7A 4DY7B 1MD8A 1GBEA 3JZ2B 5C1UA 1EX3A 1VCWA 1O3EA 3PMJA 1SOZA 2AGEX 3A86A 3Q3XA 1Q2WA 1MCTA 3T28A 5L2YH 4GPGA 3RU4T 2HOBA 1GHBG 3GCTG 4ASHA 1NRRH 2A7JA 1XXFA 5FAHA 2AMQA 1FAXA 4B2AA 4X2WA 1SG8B 4KELA 3SOSA 1EZXC 2AS9A 1J8AA 1L1NA 1K1JA 3VB5A 4NFFA 2GDDA 1EATA 1SL3A 3EA9A 3MU0A 2W26A 3MH5A 3VB3A 4NCYA 1QJ7B 1Z6EA 1BTUA 6LPRA 4JZ1A 4PROA 1YC0A 1C5RA 1G37A 5E0GA 3W94A 4O97A 3HGNA 4GLYA 1GI5A 2ZTYA 1A3EH 2HNTC 1NFUA 1OXGA 3RXGA 1C1RA 2OC1A 1DT2A 4AFZA 3BTKE 1G32B 3OY5U 5A8ZA 1IQLA 3UNSA 4OS4A 5EPNA 1HPGA 4IC5A 2CJIA 1FIWA 1MAYA 2G5NA 9ESTA 4ZHAA 1YPEH 3SHAH 1DITH 1JXPA 1SFQB 4MDSA 4IN1A 2FS8A 1H9IE 1DSTA 1ZSKA 5EQSA 1TRMA 4H6TA 3TNSA 1QRXA 1C1NA 3ZVDA 1K1LA 1SB1H 1L2EA 2BZAA 2HPPH 2OP9A 2PGBB 1QURH 4AX9H 3RU4E 1Z7KA 4NA7A 3MO9A 1KSNA 2EI8A 4GAWA 1O39A 7LPRA 3SGQE 1W3CA 4UFDH 1V3XA 1V2VT 3SUFA 4YLUA 2CF8H 1LDTT 1O3OA 2GMTC 4FUBA 4B2BA 4ZKSU 1LHEH 4A1XA 4A1TA 3FVFB 3MH6A 4DW2U 1ETTH 1AE5A 1UK2A 3BG4B 1EZUC 2XBWA 2BVSH 3C1KA 1GI6A 4WF8A 1ELTA 2Z6BD 1BOQA 1FV9A 2XBVA 3TNTA 1O3MA 4CBNA 4BXWA 1KDQA 5CHAC 5FBEA 1O2PA 2OD3B 1A4WH 4IW4E 1PYTD 1RIWB 3HKJB 4DVAU 1O32A 1Z8JB 2B5TB 3PO1B 1SGNE 2UUFB 3RMMH 1TPSA 2O8MA 1GWAA 1C4U2 4D8NA 2G4UA 1A0LA 2R3UA 2ZDLA 1C5YB 4CRFA 1KYNA 5DKMA 2H2ZA 1CE5A 3ZZ5A 3NUMA 1QIXB 4Z0KA 5DP4A 1SOTA 4B2CA 1F0TA 3SUDA 1GVLA 1AFQB 3RXVA 3QGNB 5DP8A 1K28D 3UWJH 2BX4A 1V2NT 3GOVB 4KTCA 4ZKRU 2ZG0H 4RKOB 3HPTB 1ZSLA 4XBDA 3SJ8A 1GJBB 5AFZH 4BTTB 1TMBH 1AU8A 1CHOF 3BN9A 4X8TH 1J17T 2ULLA 3A8AA 3SHCH 4LXBH 3A81A 4CRAA 2Y81A 5FX5A 4AN7A 2LNCA 1C1OA 2FOHA 1DOJA 2FOFA 1L4DA 4F49A 1W7XH 2BOHB 3M7QA 1DXPA 1LCYA 1SLVB 2Q1JA 3GY3A 2FP7B 3LONA 3BF6H 2ZHQH 3M61U 1NROH 2BY5X 3GYLB 2SNVA 4M7GA 1K9OE 1C5MD 1HAVB 4WMDA 2Z94A 2A4OA 2BD5A 1W11U 4X2VA 1LHCH 3LGVA 1OWHA 1NN6A 1WCZA 1C9PA 5EXNA 2UUYA 3LC3A 6GCHF 2ZWLH 2QV1A 3H7OA 2BXTH 2PKAB 2BQ6B 3PTBA 4TWYA 4TWWA 2QIQA 3CS7A 4XBBA 1NRQH 2ANYA 1DVAH 2P3UB 3OSYA 4X6OA 3ATMA 7GCHG 1QA0A 4I8LA 1C1UH 4GSOA 2A4GA 3TK9A 4CR9A 3SO3A 1C5TA 3UFAA 3BTTE 1S85A 4K1SA 3DT0H 4WJG2 1FZZA 3SU0A 2O8UA 1ZZZA 1PYTC 3EE0B 3LT3A 3SU5A 3O8CA 1VCPA 5EW1H 4BTUB 2VIWA 4BAHB 1UO6A 2ZKSA 4O9VA 2BDGA 2OC7A 3NK8A 3A87A 2PV9B 3SGBE 3E0NB 1V2LT 1AWHB 2PKSB 3BTQE 1P12E 1NY22 3RP2A 1GMDG 1TNLA 2G55A 1C2GA 2GKVE 2VH6A 2O8WA 2YNBA 3BIVH 4YO9A 1E38B 2QXJA 5FX6A 3IG6B 2OCVB 2AYWA 3Q77A 3BSQA 1FY1A 2YNAA 1ZMJA 3ZYDA 1UTPA 5EODA 2ZC9H 1ELBA 3QUMP 3NPSA 1O2NA 1VCQA 1JIMA 4IMZA 2VH0A 1D3TB 5TJXA 1F5KU 4AYVB 1GBMA 3PMHB 1X7AC 3FP7E 5GXPA 3RXRA 1YCPK 2FLBH 2VNTA 2A7CA 1K21H 4KKDA 1HJAC 1Q31A 1V2WT 3ITIA 2FOMB 5F03A 1HXFH 1GG6C 2A1DB 2TGDA 5EU8A 1P8VC 1LHDH 1TMTH 1GPZA 2CV3A 4TYDA 1DFPA 1QGFA 4FUFA 2VWLA 4HTCH 1KXAA 1OOKB 1ZRBA 3O8BA 1SLWB 2BTCE 1QB1A 4O3UA 4ABHA 1A0JA 4I8JA 1WAYB 1XVMA 3S69A 1HIAA 3LC5A 3U8RH 3ZZ3A 1S5SA 2GCHF 5HYOA 1MKXK 1A61H 4ISIH 3T25A 2W7SA 1GDQA 1VJ9U 3PMBB 5DPAA 1XUIA 4MQAA 1N8OB 3F6UH 5GWZA 3F9HA 5H4IB 1Y3WA 3SQEE 4BAMB 2A5AA 2VIVA 3A88A 5FPYA 2WPJS 3P8OA 1AB9B 2BZ6H 2XC5A 4VGCB 4XFQA 4YT6H 3MNXA 2NWNA 5AFYH 4A92A 5GCHF 2DE8A 1CT2E 2OUAA 3S9CA 1IQJA 4NG9H 2ZDKA 5T3HA 4JZEH 1V2RT 2BDCA 2EI7A 1FN8A 4Y8YA 1GMHF 1ZR0A 2BY7X 1NRNH 4YTAA 1IOEA 1BIOA 4JYVH 2XC4A 4D9QA 4FUJA 2O8TA 4KTSA 3GCNA 1ZSJA 2FOAA 2WV5A 1EPTA 2GV6A 4AFUA 3MYWA 1BT7A 1V6DA 1ZTKA 3STJA 2PSXA 1HBTH 1C1VH 2GCTC 1S0QA 1LPZB 2OBOA 2BB4A 4MTBA 4FXGH 1DXWA 1RTFB 1P09A 2FI5E 4A1VA 1AUJA 4AFSA 1OP8A 1G36A 2P8OB 1BJUA 2H1UA 1D3PB 2JH5D 3Q3YA 1WSSH 4ZAEA 1ELFA 2Q6GA 1ACBE 2XYAA 1HLTH 4OS6A 4R8TB 3TLOA 3W95A 2ZFTA 1XUKA 3K6YA 1J15A 3KGPA 1INCA 1OP0A 1NZQH 5C2ZA 2SGDE 2SGFE 3DA9B 1AKSB 4H4FA 2WPLS 3ZVFA 1F7ZA 1THPB 1JWTA 1TRYA 3T26A 4RSPA 3M7TA 1LHFH 1O5CB 1V2QT 1ZPZA 1E0FD 4YLQH 1SFIA 4INLA 4NA9H 2SFAA 3HKIB 1RFNA 4Q80A 4WWYA 4Y7BA 1XVOA 1MTVA 5A0CA 5C1XA 1MZDA 3U1IB 1EB1H 4U01A 4CREA 4JZIA 1GCDA 5ABWA 1F5RA 1DWBH 4AB8A 5C5OA 4U32A 4OGXA 3P6ZB 5GJ4B 2VWNA 5A0BA 3LIWA 1P2MA 1XUFA 3MWIU 3SJ9A 1GBIA 1TX6A 1QTFA 1C5LH 1ABJH 1C1WH 5GDSH 4X2YA 2P3FH 2BDBA 4ZKOU 4X8VH 5F8TA 3TGJE 1AHTH 5DK1A 2OQ5A 1BTHH 1GJ6A 3KIDU 4Y7AA 2G8TA 2I6SA 2AH4X 3E16B 1V2MT 1VITH 3RUOA 4DGJA 1TPPA 4OGYA 4AB9A 1IQNA 3RC6A 1FXYA 2PW8H 4INHA 1E35B 3EDXB 2XWBI 1HGTH 2F3CE 5HGGA 4AYYB 1EJMA 3UOPA 2A4QA 1RRKA 3KN2A 1DDJA 1GDUA 3RDZA 1XKBC 5FPTA 1GI7B 2ZHFH 1GCTB 1TE0A 2NU3E 8LPRA 5LPRA 1D3QB 2BY6X 1DM4B 4Y76A 2C8XB 3QWCH 2Y5HA 4WH8A 3AW1A 1MU6B 3QLPH 1EAIA 1O3DA 1V2OT 3PLKA 4WH6A 4ZXXH 1LQDB 3LGUA 1YCPH 2AGIX 2QF3A 3SGAE 1TFXA 1CA0B 1QNJA 1UTOA 2J2UA 3A84A 4UFFH 3TH3H 1CA8B 3M5NA 1BMAA 1DWCH 1A7SA 5ETXA 4ZHLU 1QB6A 2UWOA 2D1JA 2V3OH 2W3IA 5TCCA 1NU7B 1HAGE 2BD8A 2ZDNA 1YKTA 4O03A 1B0EA 3SU2A 3IITA 1AD8H 1BQYA 3VXFH 4CRBA 1MTWA 2BD4A 1A5IA 1G2LA 2VGCC 1C5PA 3MNSA 2STBE 1GI8B 1MKXH 1L1GA 4HZHA 2AGGX 3V13A 1O2YA 7GCHF 1O30A 1HCGA 2GZ7A 1CBWB 1G3EA 3L3TA 1FN6A 1PJPA 3RXTA 3GY6A 5FPSA 2VB0A 1GBAA 1O2HA 4X1RU 1O5EH 1O3HA 4D9RA 2XCFA 1O2RA 5L6NH 1GMCG 3JZ1B 3BEUA 4ABIA 1DS2E 3P8NA 1S6FA 2R0KA 3BG8A 3Q00A 1GBTA 1A0HB 2QXHA 2VVUA 1RXPA 3K2UA 2SGQE 3RXOA 1SVPA 1BBRK 1TA2A 3QX5H 1FI8A 4JK6A 1H8IH 3PWCA 5TCAA 2ILNA 1DPOA 5F8XA 2D8WA 5FCRA 1FUJA 2ZFRH 3MHWU 3SU6A 3TK5A 5GPIB 1SGQE 1SHHB 4ZKNU 3UY9A 1GHWH 2FESH 5LPFA 3SQHE 1ELEE 3U69H 2VWMA 3QK1A 1O2WA 4FUEA 2HNTF