1MZDA

Crystal structure of human pro-granzyme k
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
240
structure length
240
Chain Sequence
MEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDAGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords pro-granzyme K
publication title The 2.2-A Crystal Structure of Human Pro-granzyme K Reveals a Rigid Zymogen with Unusual Features
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzdA01
1GJBB 4HFPB 1WBGB 3U1IB 3NPSA 2ZCKP 4Q7ZA 4DJZB 2VIWA 2YOLA 3RU4E 3BV9B 3T5FH 1L0ZA 3E0PB 1XXFA 2XWAA 4CR5A 1EXFA 5EW1H 4Y10E 1C5TA 1GI3A 3BIUH 3LC3A 3SV2H 1ZHPA 1D3DB 4I8HA 1C1MA 1T31A 2QV1A 3TJVA 1EAXA 1BQYA 3FZZA 1MBQA 1EAWA 1Y8TA 1AY6H 1TYNA 2OUAA 4JZIA 3VXFH 3ZV9A 1KLTA 3G01A 3JZ1B 1AVXA 1O2IA 1NM6A 1FPHH 1V2JT 1LKAA 4H6TA 1C5XB 1ZLRA 2Z9IA 4FVDA 2GT7A 4BAMB 3P92A 1A61H 3PROA 2FP7B 4B76A 2QXJA 1LPKB 3TH4H 1W12U 4B2BA 3QTOH 1DFPA 5GCHG 3ZZDA 7KMEH 5GCHF 1GI8B 2QGRA 4MQAA 3NCLA 1W2KH 1H4WA 1TGSZ 5LPRA 1FZZA 3BTQE 2CV3A 1GMHF 3M61U 2NU1E 3AW1A 6CHAB 1SFQB 4Y79A 3WY8A 3W94A 1O2ZA 4XBBA 3ATKA 3A7WA 3KQCA 1LPZB 1AU8A 2PW8H 2HNTF 3S0NA 2ZU5A 5DP3A 1N8OC 2BQ6B 2YNAA 2BY6X 2A5IA 1NRQH 3GY3A 1GL1A 4CRBA 1SI5H 1HAZB 2PTCE 1GJAB 2FODA 1UTQA 1DXPA 1O5EH 2F83A 2ZTZA 3RMMH 2VB0A 3SU5A 2ZEBA 2ZPRA 3L3TA 1XMNB 1A5GH 2HNTE 4X1NU 3SUGA 1NRSH 4ISOA 1EQ9A 1O2PA 3TJUA 4GVUA 1UTNA 2FOCA 1SGRE 3K2UA 1MQ6A 5ESTE 2FDAA 3RXPA 1MTNC 4Y8ZA 1O3IA 1H9HE 4ABEA 2VWLA 1BTUA 4JZDH 1QBNA 4HGCA 1EB2A 3P8GA 1P01A 4OS4A 4U30A 1BRCE 2ZNKH 2BOHB 1S84A 4ZHMU 1YYY1 5K7RA 5C67A 1AB9C 1CE5A 4OGYA 4Z6AH 4K1TA 4WH6A 5T6GA 5AVDA 1FXYA 4MLFB 2STAE 3LDXH 1GBBA 4MTBA 4K2YA 1IQEA 2XC5A 4B2CA 3MO9A 1C1OA 3TU7H 4A92A 1GDQA 1C2EA 2FLRH 1OWEA 1J14A 1S82A 1TMTH 3B9FH 3F9EA 2R0LA 3M7QA 4I8LA 3RC6A 1SQTA 1K2I1 2ZFTA 1LMWB 1NFWA 1RIWC 4GUXA 2GV7A 4Q2KA 3FZDA 2G5NA 1TFXA 2GDDA 3BG4B 3TNSA 2R3UA 3DHKH 1PYTD 2C93B 5C1XA 2BY8X 1TWXB 5LPEA 2CHAC 3AW0A 2FWWA 4K1EA 3ZVCA 3F9HA 1WSSH 1RXPA 4K8YA 4B74A 3V12A 1S5SA 2B8OH 3BTWE 1P11E 3U8TH 1WAYB 1NN6A 2Y81A 1O30A 2HALA 5LH8A 1O3LA 4I32A 1OYQA 5GXPA 1QB9A 1H8IH 3CS0A 1RGQA 2OBOA 3E0NB 1TONA 2OLGA 3SQHE 2TRMA 3S9BA 5L2ZH 1PPCE 2GZ8A 4KGAA 1GJ5H 3EE0B 3VB3A 3P8OA 3RXVA 3UR6A 5LGOA 2W3IA 5GIBA 2VIQA 4NCYA 4FUGA 2FLBH 1MU8B 3HATH 3KEEA 2BD4A 4B2AA 1O3EA 3RXKA 4CRAA 1LCYA 1AQ7A 2Z6BD 4ZKNU 1LKBA 3BEFB 3PTBA 2H2ZA 4BTUB 4YT7H 1JRSA 1SB1H 4FUHA 1K1PA 1TNJA 2AMDA 1QL9A 5B6OA 2IJOB 2ZU1A 4MPWA 1SGFG 1F0RA 3LGVA 1NROH 1NRNH 3SBKA 3ZYDA 1LHGH 2SGDE 2ZDLA 3GDSA 2UUFB 2CJIA 1ZRKA 3BN9A 1QJ7B 1ZHMA 2A7CA 1VZQH 5JBAS 1NRPH 4NA7A 2QA9E 3EGKH 3GICB 2JH5D 3U98H 1C2JA 2BDIA 2M5TA 3TLOA 1ANBA 2WV4A 1AZ8A 1KSNA 3E8LA 4UFDH 2ZP0H 1DWEH 1VGCC 2OINA 2OBQA 1PQ8A 3PMHB 1CT2E 1EZQA 1MTVA 1OWKA 2CMYA 4ZMAH 1GI0A 2LPRA 1QCPA 1NESE 3RLYH 1GBMA 2Y80A 1EJAA 1GMCF 1P3EA 1PJPA 3OYPA 5E0JA 2G00A 4BAHB 5DPAA 1DS2E 1TNKA 2I6SA 4D76A 3GY6A 4Y8YA 1XXDA 4UE7H 5CHAB 2JKHA 1HAGE 4FU9A 2OC8A 3M3TA 3RXUA 3UOUA 3BSQA 3PV4A 2PKAA 2PKAB 3E16B 2OXSA 3PLKA 3SV8A 5F03A 3DFJA 3ZZ9A 1GBJA 3PB1E 5TCAA 3VFEA 3TPIZ 3SU0A 1ZMNA 1C1TA 1AUJA 3SV7A 2HGTH 5PTPA 2SGQE 2ZCHP 1SGQE 4NIVA 1EB1H 1O2YA 5JB9S 1BUIA 5E2PA 1GBTA 5F6MA 5DP6A 4KELA 2A4OA 1GCTB 5JBBS 3T28A 2ANWA 4K3JA 1TX6A 2FYRA 3SJIA 2VVVA 1QFKH 2P8OC 3ZZ7A 4YLUA 4IBLH 1ZSKA 3UY9A 1PPZA 1ELAA 2GCTC 1V2WT 1BCUH 2QYIA 1GI1A 4DGJA 2O8TA 1P2OA 1PFXC 1NFYA 3K9XB 1O3GA 1G2MA 4X8VH 1O3JA 3V7TA 2PKSB 1O3AA 3GY7A 2J95A 1RJXB 4Q80A 3KGPA 5GWZA 2TGPZ 2A4GA 2IPHA 4MPUA 1SC8U 3KHVA 2VIDA 4JZFH 1YPGH 1JBUH 3GCHC 1UCYH 1AIXH 1ZTLA 4BXSA 3ATWA 1ZZZA 5H4IB 2P3FH 1C5UA 3Q76A 4MNVA 1C2MA 1YPJH 1O2HA 2UUJB 4X6MA 2W3KA 2Q6FA 4ZKSU 1YLCA 1FAKH 1OKXA 4UEHH 4WH8A 3RXLA 1ELBA 2A1DB 3UQVA 4CH8B 2BHGA 1T4VH 1UTOA 1MAXA 3O8RA 2B5TB 2ZFRH 4X6NA 1KIGH 3FFGA 4AFZA 3MI4A 1BRBE 3DFLA 2P95A 1Z71A 3LGWA 3SI4H 3STIA 1NU9A 3GYLB 5A09A 1SSXA 1GDNA 1GHYH 3GY5A 3K6ZA 2H9EH 3MU0A 1YF4A 1BTXA 1G3BA 4I7YH 1VITG 3TGIE 2OC0A 2SFAA 1VITF 1UK4A 4AYVB 4K1SA 2A32A 2G4TA 4XFQA 4YOIA 2F9BH 2ZGJA 3V13A 5EPNA 1O2XA 1TABE 2ZC9H 2A5KA 2OP9A 1TOCB 1DOJA 2FM2A 2PGQB 3PLPA 3PWBA 1ZJDA 1HB0B 2PUQH 1TGNA 4JZEH 2XBWA 2ZGHA 4AN7A 4JZ1A 1LVYA 3FVFB 4CRFA 1DSUA 1Q2WA 3ZVBA 3ATLA 4Y0ZE 2ZPSA 4E7RG 4H42U 1TNLA 1W13U 3RXDA 3RXRA 3SUDA 1SMFE 1CA0B 4RN6A 3PMAB 1YPMH 1QQUA 2CF9H 7GCHF 3RXSA 3MO3A 3D65E 2GTBA 2V35A 2ZGXH 1V2LT 2ZHWH 2RG3A 3RLWH 1AZZA 1BT7A 1L1JA 1UCYK 4ABAA 3P8NA 1O3DA 1C1NA 3AVZA 2KAIA 2Y5FA 5FAHA 4AGKA 1F5KU 1PPBH 1ELEE 1AHTH 1Q31A 3QZRA 2C8ZB 1A0HB 1A4WH 4KTCA 1WUNH 4JCNA 4A6LA 2FI3E 4GSOA 1RS0A 3BTFE 1B0FA 1THRH 2VWMA 3HGPA 1NTPA 1O2SA 2F9OA 2P59A 1ZSLA 2NU0E 3TH2H 4F4OC 2Z9GA 1LO6A 4BOHA 1O3HA 1SGIB 5EGMA 2VVCA 3M36A 3A86A 6CHAC 1GCDA 2OQUA 5HYOA 2XXLA 4KTSA 4KP0A 1TGCA 1FN6A 1MKXH 1J17T 1BDAA 2J4IA 2A2XH 3HKIB 3BTHE 4GCHG 2PV9B 3OTJE 1KLJH 1N6XA 1ZSJA 2AS9A 1YLDA 2C8WB 1G9IE 3R3GB 2ZQ2A 2ZHDA 2Z7FE 2BD2A 1GJ6A 4M7GA 4NIYA 4E06H 1P2NA 1Y59T 1S0RA 3P95A 3UREA 1BMAA 1E37B 4D8NA 3MMGA 1HYLA 1GJ4H 1LVBA 1T8OA 1TX8A 3ZZAA 1AFQB 3S9CA 1GHWH 3JZ2B 2J38A 2VWNA 3B23B 1XUJA 4CH2B 5AF9H 1EJNA 1DY8A 2PGBB 4BNRA 4AG2A 5I25A 1KXAA 1RFNA 3OSYA 3SJKA 4IN1A 4ABBA 1G3CA 1C9PA 2BVXH 2UWPA 5EODA 1A0LA 1MMJN 1PQAA 1A5IA 1Z8JB 2WINI 4NZLA 1TAWA 1LHDH 2GVFA 4LXBH 3AAUA 1JMOH 3ZVEA 2PFEA 1P09A 1X7AC 2AMPA 4I8KA 3Q3YA 1A5HA 1ELFA 3S69A 1XVOA 1GG6B 3ATMA 2O9QA 4X1PU 1OP8A 3PO1B 3I78A 2F9UA 2OC7A 3FAOA 3LGTA 3QGNB 1F2SE 3CP7A 4ZUHA 3TK6A 3TGJE 4TWYA 1O5AB 2HWLB 1NO9H 4TWWA 4X8UH 3SO3A 1WV7H 1QNJA 1YPHC 3KQBA 4DOQA 1MUEB 2J34A 1BRAA 4R0IA 1H1BA 1IQNA 5AHGH 1IHSH 2STBE 3M5NA 2WYJA 3BIVH 1L1GA 3ZVDA 3BG4C 3PYHA 1TLDA 3A80A 1O3MA 4ZAEA 1Z1JA 2VIOA 1K1JA 5TJXA 1C2DA 2AERH 1QL7A 5JPMH 1PQ5A 2PWXA 2XNIA 1MKXK 1BTWA 4ESTE 2QXIA 3T25A 1QRZA 1NRRH 3M37A 3Q77A 5C1UA 1JIRA 1YP9A 2BDHA 5FBIA 4ISNA 1C5SA 5T6FA 1LDTT 5A0BA 1SGPE 5EQSA 1QY6A 1UTLM 2P3UB 4VGCB 7LPRA 1FAXA 1GMHG 5DO4H 3ZV8A 4D7FA 2VGCB 2HLCA 1DWDH 1WQSA 1MCVA 1D6RA 1O31A 3F1SB 2CXVA 1GHZA 3SNAA 1K21H 1HRTH 1XUGA 1ZPBA 3S7KB 4CREA 1MZAA 4NSYA 3A8CA 4O9VA 3RMNH 1F5LA 3A83A 2D26C 2JH0D 3A88A 4X8SH 2EI7A 3BG8A 1P8VC 5IDKA 1C5OH 1SGYE 1SGDE 1ZPCA 5J4SA 4NFFA 4YOJA 1P10A 3QWCH 1GBKA 1HJ9A 1XUHA 2FMJA 4H4FA 1EKBB 4TY7A 3TK5A 1HAYB 3TVJB 2P93A 3K6YA 3U8OH 4AYYB 4BAKB 1ELVA 2Q6GA 1IQMA 3A8AA 1SGFA 1Y3XA 5DG6A 1TBZH 3RXMA 1MU6B 1QL8A 1BBRH 3TGKE 4IC6A 2JH6D 3LKWA 3MNBA 1IAUA 5EW2H 1O35A 2QY0B 1IQGA 4OS1A 3L6PA 8KME2 4CRDA 1ZMJA 4ABGA 3BTME 3HGNA 1CVWH 1E34B 5E2OA 2F91A 5SGAE 3L33A 4ZXYH 4ZHLU 2VIPA 4ISIH 3C27B 3RXEA 1O3KA 1JWTA 1AFEH 4MNWA 3RXBA 2BY7X 3ZZ5A 3MHWU 1UTJA 1V2PT 1P04A 4WMEA 1VCQA 4DG4A 2ZGBH 2TGTA 3HPTB 1IQHA 4ISHH 3A89A 1SQOA 2BY9X 2XRCA 1GHAG 2SGAA 1XKBC 2NU3E 4D9RA 1GHAF 1W11U 1BTZA 1O2WA 1BHXB 2Q1JA 3ZVAA 4AX9H 4O3TA 4WMFA 1XKAC 2QF0A 1O0DH 3SNBA 2BDBA 1L1NA 1K1IA 3GOVB 1SHHB 4X2YA 3M3VA 3UNSA 4K8BA 4TPIZ 4FUIA 2ZG0H 1GCTC 2C3SA 4JK5A 3E90B 1UVSH 2TPIZ 2TGDA 4X2VA 1DANH 1UVOA 4J1YA 1EZXC 1J15A 3QX5H 1JXPA 2HPQH 2A45B 1ZYOA 3HK3B 3F9GA 3LGIA 4WXIA 1C2GA 1SGNE 4I33A 5GDSH 1ZGVA 2G51A 3BF6H 5JBCS 2BXTH 1NFXA 2PKSC 1HFDA 2V0BA 1V2KT 3SV9A 2BX3A 2V6NA 1YCPH 1BB0B 3LPRA 4BANB 4FUCA 2FX4A 2RA3A 3Q3KA 2Y82A 2O8WA 2OD3B 2AYWA 5EXMA 3A7VA 2H5CA 4XSKU 3NKKA 4THNH 1GHVH 3SNEA 1UVPA 1C9TA 1BBRK 1O2OA 1TBQH 1QJ6B 1TPOA 1GI2A 1G3EA 3VXEH 2HRVA 3NXPA 5T6DA 1ETTH 1DE7H 2ZU4A 5HMAA 1ETRH 3ZZ6A 3U69H 1XUFA 2JETB 2XC4A 1PPFE 1AO5A 4SGAE 3TNTA 4NZQA 1ANCA 1QB6A 4MPXA 3RXOA 5F8ZA 1Y3UA 1O2RA 1S83A 1EATA 2J2UA 2GV6A 3MU4A 1UMAH 5FCKA 1AKSA 4ZH8A 2F9PA 1AKSB 3KCGH 2G8TA 1FJSA 2AGEX 1ZJKA 2ODQA 4B71A 2BM2A 2F3CE 1GGDB 3PMBB 1DITH 1RTLA 2Z9KA 4INLA 2PSYA 3OU0A 3GISB 1UVUH 1QGFA 2ALPA 3MNXA 9LPRA 1ETSH 1E35B 1HGTH 3RUOA 1C5QA 1GMCG 2FS8A 4Y6DA 1OSSA 4XBDA 1DICA 1QRXA 1EZUC 1XVMA 1TQ7B 2FOFA 1O2VA 1SLVB 3MNCA 3ODDA 4XOJA 1DY9A 1K1LA 2FTLE 4INHA 3GDUA 4K60A 4RSPA 1BHXF 3SHAH 2ZWLH 3FANA 4DT7B 3A82A 3IWMA 3A7YA 4MG3A 1OYTH 3U1JB 3SU6A 1E38B 1XUIA 8LPRA 1O3OA 3TH3H 2Y6TA 1AB9B 3UPEA 1CA0C 3RM2H 1TMUH 3SU1A 1O39A 1MQ5A 1T8MA 1YCPM 2J94A 5F8TA 5DP8A 1GBCA 1D6WA 1EUFA 1K1OA 1LHEH 4Y7AA 1TA2A 2V3OH 3ZYEA 1Q3XA 5FX5A 3UIRA 2C90B 1YCPK 3LH1A 2VJ1A 3I77A 3M3SA 1HV7A 2ZDKA 2O8UA 1Z8IB 3QUMP 2BB4A 1B5GH 1XX9A 1Z8RA 1CBWB 4IS5A 4WJG2 3VGCB 3S7HB 1GHBG 1AMHA 1BTPA 3LU9B 1GHBF 2LNCA 2ZHFH 1IQFA 3MFJA 2YNBA 3BTKE 1F5RA 1QA0A 2OTVA 1V6DA 1C5RA 1DSTA 5C5NA 2G4UA 2NWNA 3D23A 2CHAB 5CE1A 1GI6A 2QXGA 2SGEE 2ZZUH 1IOEA 1HAVB 2QN5T 3MU1A 1TOMH 2BVSH 2O8MA 1N6YA 5LPFA 5EOKA 1OOKB 4UD9H 1TGTA 2UWOA 2BX4A 1HNEE 2ULLA 1C2IA 3TIUA 4NWLA 1AE8H 2GZ7A 4K5ZA 1VCPA 1KXBA 1EOJA 1GI5A 1SG8B 3SI3H 1ESBA 3SN8A 1A7SA 2BOKA 3BTGE 4UFGH 1ID5H 1EASA 4ZXXH 1QHRB 1S0QA 1D3TB 1FNIA 2HNTC 3P70B 4MPVA 3LGYA 1P2JA 3EDXB 5C20A 5EXNA 3S9AA 3QLPH 1AFQC 1HIAB 2BQ7B 2Y7XA 1BOQA 1YPEH 4TYDA 1MZDA 3SJOA 1P2MA 1C5MD 1P03A 4DVAU 1A2CH 1EP5A 3CS7A 1O3NA 1O5GH 1SPJA 5ABWA 1L4DA 1SGEE 1UTMA 1CGJE 3QN7A 4AZ2B 4CHAB 2VH0A 1G3DA 2BDAA 1BIOA 4NA8A 5DP4A 1AD8H 2XWBI 3K65B 1GBHA 1OXGA 4AB9A 1HXFH 1WTGH 2BLOA 1GG6C 4ZHAA 1W10U 2FOEA 4X1QU 3T26A 2ZIQH 3U9AH 4CRCA 4Y0YE 1MD7A 3OX7U 1VGCB 2EI6A 3PO1C 1H8DH 2BQWB 3F68H 4GAWA 1SGCA 1QRWA 5FPTA 1F92A 1UHBA 2VVUA 4ABHA 1UHBB 3SNCA 2VU8E 3F9FA 3LJOA 7GCHG 3GY4A 1Y3VA 2SNVA 1YC0A 4MNXA 3RXHA 4WMDA 4YTAA 3EA7A 1WOFA 3R0FA 3SORA 1ORFA 1OP2A 3EYDA 3UR9A 5EG4A 4OS2A 5DP5A 2ZDMA 2Z3CA 4LZ4B 1SR5C 2H5DA 1W0ZU 1WCZA 1V2NT 2BD8A 5CMXH 3LGUA 1U6QA 1O2QA 1W7GH 2ALVA 4GHTA 1Y3WA 4X8TH 4HTCH 2H9HA 1QR3E 1P57B 1GBLA 2Z3DA 1ESAA 3SU3A 3BEUA 3GY2A 1GBFA 3SJ9A 2QAAA 3O8CA 1FUJA 1P2KA 4FUDA 1TIOA 1MBMA 4ZROA 1O37A 4VGCC 5DGJA 2EC9H 1AI8H 4Y7BA 1ANDA 4IW4E 1O3FA 2R3YA 1ZOMA 2FOGA 3FP6E 1UVTH 1L4ZA 2RDLA 2A7JA 3MYWA 5C3NA 1MD8A 2D2DA 1KXEA 4BXWA 2Y7ZA 4QT8C 1BA8B 3E6PH 1DX5M 4O3UA 1O5CB 2FESH 4U32A 1AE5A 4DY7B 2FX6A 1VJ9U 3D49H 1HJAB 2BD5A 2FTMA 4CBNA 2FS9A 1O32A 4U2WA 4CR9A 2FXRA 3RU4D 4X1RU 1BTHH 3MTYA 1P12E 2GMTB 3ZVGA 1MAYA 1GDUA 1LVMA 1SHYA 1EAUA 3STJA 1CGHA 2XYAA 3T29A 5HM9A 3MH4A 2BY5X 2BZAA 3RXQA 2RA0A 3RXTA 1FN8A 5FXLA 1RD3B 2AEIH 6GCHG 1MTSA 6GCHF 1UK3A 4INKA 2EEKA 3QO6A 2J92A 1IQLA 1CHOG 2B0FA 2WYGA 1CHOF 2GCHG 2TIOA 1TALA 3SGBE 1W7XH 3A87A 5C5OA 1BTYA 2GCHF 3UFAA 2R2WU 1A46H 2H9TH 4KTUA 2VWOA 4B1TA 4NGAH 3GCNA 1F7ZA 4FUFA 5K0HA 4OGXA 5L2YH 1B0EA 1C1RA 3SV6A 4JK6A 2TBSA 1C2FA 1D9IA 3GCTF 4IC5A 4YZUA 3GYMA 3E3TA 1TRNA 3IITA 1DLKB 1CHGA 1C4U2 1G30B 5AFZH 4AFQA 2C4FH 1YGCH 1F0TA 2ZGCA 1QB1A 4LZ1H 2QC2A 2TGAA 1GVKB 3TJNA 2Z9JA 1ELCA 2C8YB 4YT6H 2UUKB 1GBAA 2QCYA 3QK1A 2DE8A 1BJVA 1LTOA 2AIPA 1V2VT 2CGAA 1Y5BT 3V3MA 4MDSA 1MTWA 3BTEE 1IHTH 1XUKA 1DVAH 1HXEH 1OWDA 3RM0H 3KL6A 3MU5A 3VPKA 4DW2U 1G32B 2A7HA 4YLQH 2Y5HA 3RXCA 1MKWH 3MH7A 1FDPA 1O5BB 4FUJA 4IMQA 5J4QA 1C4V2 1ELGA 4MNYA 1F0UA 2W7SA 7ESTE 4I31A 3DA9B 5DKMA 1TA6A 1H9LB 2R9PA 1CO7E 1GMDG 1E0FD 1GMDF 1SQAA 1UTKA 1OS8A 4BTIB 1SVPA 3RXIA 2G81E 8ESTE 1NZQH 1HLTH 3IG6B 3T2NA 1EPTA 1UCYE 1EPTB 1O3PB 3RXJA 1O33A 2ZU3A 4A7IB 3VEQB 3RP2A 2WUBA 3ESTA 4MVNA 1FY4A 1F0SA 1Y5AT 1IQJA 1O3CA 1FI8A 3SUFA 2VH6A 1TNIA 1SFIA 4Q7YA 4SGBE 1S6FA 1TX7A 1ELTA 1M9UA 2BZ6H 3OY5U 4YESB 3PTNA 4NSVA 1CU1A 5F8XA 3PMJA 4NWKA 2PHBA 3EQ0H 3KQDA 2A0QB 2D8WA 4X2WA 1SGTA 4AFUA 3P8FA 3SOSA 3UNRA 1C2KA 1GBIA 4K69A 2H1UA 5G4BA 2XCFA 4FU8A 2ANMH 3KIDU 1V2RT 3M7UA 2QXHA 4E7NA 1DM4B 1JIMA 1O2MA 2BLVA 2JETC 2R2MB 2XBVA 1CSOE 4I8JA 5FCRA 1ABIH 1IQIA 4X6PA 1T8NA 1XM1A 3ODFA 3DD2H 3BEIB 2BD9A 1QA7A 2GZ9A 1Z1IA 1DWCH 2WPLS 2H6MA 1UO6A 2VIVA 1CQQA 2ZF0H 3T27A 4WVPE 1CT0E 1O34A 1C1QA 1GGDC 1NU7B 5EQQA 4FUEA 5EXLA 1EP6A 1TMBH 1C1VH 4X6OA 1NFUA 4NIXA 9ESTA 3AASA 1O2KA 1HAPH 1MKWK 1DUEA 5FHTA 4FUBA 1ARBA 2UUYA 1SL3A 2GGVB 5L6NH 1OWJA 3LH3A 4YM9A 1WYKA 1O5DH 3UNQA 1Y5UT 2NU4E 1K22H 3A81A 2ZI2H 4DCDA 1GPZA 4YOGA 1S85A 1NC6A 4WWYA 5CHAC 1FMGA 3P17H 3QTVH 4AFSA 5L30H 2Q6DA 5T3HA 1C5PA 2ZHQH 5DJ7A 1YKTA 1THSH 3E1XB 1AWFH 1CA8B 2ODPA 1WQVH 3FP8E 1VR1H 3AAVA 6ESTA 2FIRH 5C1YA 1A1RA 3B8JA 5EQRA 3C1KA 2Z9LA 3PM3A 2NU2E 1HUTH 1RTKA 2BTCE 2Y5GA 3QZQA 1C2HA 3ZZ8A 1O5FH 1IQKA 1TNHA 3Q3XA 2PUXB 1NS3A 3VB5A 2ZA5A 1NT1A 1D3QB 4AOQA 1PQ7A 1ZHRA 3SU2A 1VITH 1CBWC 2XTTB 2F9VA 3UUZA 1P2QA 3VGCC 3I29A 2ZCLP 3TITA 2WUCA 4O03A 4AGJA 2XCNA 3KNXA 1TRMA 5GJ4B 1AWHB 3HKJB 2F9NA 5FX6A 3MWIU 2GX4A 1EJMA 1EZSC 2BLQA 2HVXA 3FP7E 1VJAU 3BTDE 1DWBH 3GDVA 5EU8A 4ABDA 5E8EH 4A1XA 1E36B 2IN2A 2A4QA 2BLWA 1BMLA 2ILNA 1THPB 4XBCA 1P2IA 1C1SA 4IN2A 1K9OE 2AH4X 1SLXB 1TE0A 2QF3A 2ANYA 3QGJA 2WPIS 4Q7XA 1NY22 1ZR0A 1O38A 2HPPH 4R8TB 1HPGA 1SOTA 3NK8A 1FLEE 1N1LA 2AIQA 2GDEH 4DURA 2W5EA 3RU4T 1QQ4A 2OQ5A 2FI5E 1FIWA 3SHCH 1G37A 2XC0A 3A7XA 2SGPE 1P9SA 3DT0H 1KXCA 1T8LA 5HGGA 1EOLA 1LQDB 1AGJA 4FXGH 5DK1A 1LHFH 1GVZA 2AFQB 1A3EH 3H7OA 1Z6JH 1GBDA 1N8OB 3H5CB 4ISLA 3ZZCA 1Z7KA 4TPYA 3RXGA 4ASHA 2ZDNA 1FY1A 1PPHE 1B7XB 3SGQE 1HJ8A 3URCA 2WPKS 2R0KA 4LK4A 4E05H 1GHXH 1GBEA 2VINA 3UQOA 4JYVH 1W3CA 3ZVFA 1HAIH 1J9CH 3VB7A 4Z0KA 4JYUH 3LT3A 3M7TA 2FPZA 2RCEA 1P0SH 4AG1A 3A85A 4F49A 5BRRE 2ZPQA 2FOHA 4WXVA 1SOZA 5A0AE 4CHAC 4NFEA 4A5TS 4ZKRU 2AGGX 1AN1E 4NIWA 1HBTH 4PROA 1ABJH 1FPCH 2ZTXA 3UTUH 2G5VA 3MH5A 1MTNB 1BRUP 4U01A 1TNGA 4A1TA 2A4RA 2BD3A 6LPRA 1FIZA 4NA9H 1J8AA 1H9IE 1O2TA 1GL0E 4Y76A 1ESTA 1FY8E 3A8DA 2FI4E 1Y3YA 5GPIB 3U8RH 3UWJH 3SZNA 3KF2A 1HAOH 3CENA 4FU7A 1KY9A 2K1QA 2VNTA 2ZQ1A 1O36A 1YBWA 1GWAA 4ZKOU 2EI8A 3HK6B 2PSXA 4OS6A 3NUMA 2P3TB 1P06A 5A8YA 1C2LA 1ZMLA 1T4UH 5A8XA 1C5WB 1ACBE 4Y8XA 1DT2A 1JRTA 1SLUB 2ANKH 1C1UH 1DUAA 4ABIA 2ODYB 3RC4A 1TPSA 1MCTA 2PR3A 1ELDE 4JYTA 1ZTJA 1RIWB 1V2UT 3LOXA 1O2JA 1K1MA 1YPHE 1S6HA 3MOCA 1PPGE 1V2ST 2O8LA 1LVOA 5I46H 4OS7A 2ZFPH 3SU4A 3O8DA 3ZZ4A 3ELAH 1KTTB 1HAVA 1OPHB 3KQEA 1HCGA 1FONA 2GKVE 1QIXB 1NPMA 4BAOB 2XW9A 2Z3EA 1QTFA 3M35A 4O97A 1ZGIA 1GJ7B 1QBVH 3MO6A 1CGIE 4IGDA 2J9NA 1FV9A 4YO9A 4KKDA 3URDA 4WF8A 5JDUB 4TY6A 1HJAC 4UFEH 4B73A 1AVWA 4ABFA 4CBOA 4X2XA 1TRYA 2GMTC 1UK2A 2AGIX 1PPEE 5FPSA 3EA8A 4WY3A 3O8BA 1EX3A 3MH6A 1UJ1A 1P05A 2QIQA 3MU8A 5JYIA 1OWIA 3RMOH 4D7GA 2D1JA 1HIAA 1OX1A 2FO9A 2BDGA 2CF8H 2BYAX 1VCWA 1BBRE 4DIIH 1HDTH 5DP7A 4DIHH 4ABJA 1O2NA 1QURH 3A7TA 4IMZA 3PLBA 4UONA 5ESBA 2ZU2A 1UTPA 1S81A 3MNSA 1HAHH 3LONA 3QDZB 1AUTC 4OS5A 4B75A 1GVLA 1MH0A 5BPEA 3M5OA 1DLEA 5AFYH 2I6QA 1L2EA 2P94A 3H7TA 3ITIA 5IYTA 3SUEA 3PWCA 1GI7B 1C5LH 1TPPA 2FOAA 1Z8GA 1V2MT 1KDQA 3UOPA 1KDQB 4HZHA 1C1WH 2BD7A 2HOBA 4D9QA 3F6UH 2WPHS 4X1SU 2FOBA 2ZFFH 2PTNA 1EAIA 1D3PB 1RTFB 2XBYA 1WU1A 8GCHG 1GI4A 1FY3A 1C5YB 4UDWH 1BMNH 1BMMH 1W8BH 2FZZA 8GCHF 1YM0A 1P9UA 1W14U 1YPKH 2BDYA 3SGAE 3DUXH 3W95A 1GJCB 3VB4A 2ASUB 1T7CA 2P16A 2BXUH 2FOMB 2UWLA 3SNDA 4GLYA 5A2MH 1KYNA 3RXAA 1W0YH 1TGBA 3M5LA 1O2LA 2DUCA 2PLXA 1V2TT 5JB8S 1INCA 1C1PA 1DPOA 1KXFA 1QJ1B 5JBTA 4AB8A 3M5MA 5DP9A 1ZTKA 4CRGA 3BTTE 1SBWA 1FQ3A 4Y11E 2ZO3H 1C5ZB 1C4Y2 4XE4A 4H6SB 1D4PB 2AMQA 3D62A 3ZZBA 4GHQA 1KXDA 4X0WU 3SW2B 3A8BA 1BITA 1C5VA 3Q00A 4BTTB 1RRKA 3RMLH 3A84A 3E91A 2EA3A 4UFFH 2DE9A 1P02A 2G55A 1KLIH 5ETXA 3EA9A 1EPTC 2KAIB 2ZECA 1JOUB 3ATIA 3V0XA 3NWUA 2P8OB 2VGCC 1GJ9B 2W26A 1OP0A 2ZDAH 3SQEE 2GCTB 4FVBA 1CT4E 1YPLH 1HAXB 5A0CA 4J2YB 1TPAE 4A1VA 1ZRBA 3P6ZB 5FPYA 3GCOA 2THFB 1GJDB 2FYQA 2B9LA 1G36A 2BDCA 2FEQH 4NG9H 2G52A 1P3CA 1V2QT 1TB6H 1J16A 2GT8A 4RKJB 3GCHB 1QBOA 1K28D 3OY6U 2SNWA 2V3HH 2SGFE 3T62A 1LHCH 4GPGA 5E0GA 1OWHA 3ENSB 4RKOB 5A8ZA 2A31A 1T32A 2Z94A 2ZFQH 2ZDVH 3NZIA 2BMGB 2BVRH 4GCHF 1TBRH 4AORA 2GD4B 2OCVB 3SJ8A 4JMYA 4LOYH 1WTHD 1V3XA 1PYTC 2W7UA 3GY8A 1ANEA 1K1NA 3LIWA 3N7OA 3ZZ3A 5FBEA 3LJJA 1GJ8B 3GCTG 1ARCA 2A2QH 3KN2A 1A0JA 2CN0H 4Y71A 3LC5A 1LPGB 2B7DH 4XDEA 2WV5A 5HXFA 4HI3A 2ZKSA 1V2OT 2OC1A 2ZTYA 1FY5A 1Z6EA 5HM2A 1MTUA 1DDJA 1A3BH 2ZFSA 1O2GH 1O3BA 5EPYA 3RC5A 4I8GA 1DXWA 2A5AA 3A7ZA 2GP9B 1LQEA 1KTSB 5C2ZA 1SLWB 3EAJA 2ESTE 1ZPZA 1GI9B 1O2UA 1G2LA 1TQ0B 2WPMS 3UWIA 3TK9A 2IOTA 2WPJS 1BZXE 2ZHEH 3RDZA 1BJUA 1C5NH 5E0HA 3TJOA 3RXFA 1AVGH 2C8XB 3VB6A 4BAQB 5TCCA 2XBXA
chains in the Genus database with same CATH superfamily
1GJBB 4HFPB 1WBGB 3U1IB 3NPSA 2ZCKP 4Q7ZA 2YMSD 4DJZB 2VIWA 2YOLA 3RU4E 3BV9B 3T5FH 1L0ZA 3E0PB 1XXFA 2XWAA 4CR5A 1EXFA 5EW1H 4Y10E 1C5TA 1GI3A 3BIUH 3LC3A 3SV2H 1ZHPA 1D3DB 4I8HA 1C1MA 1T31A 2QV1A 3TJVA 1EAXA 1BQYA 3FZZA 1MBQA 1EAWA 1Y8TA 2WSSD 1AY6H 1TYNA 5DSFA 2OUAA 4JZIA 3VXFH 3ZV9A 1KLTA 3G01A 3JZ1B 5C0TA 1AVXA 1O2IA 1NM6A 1FPHH 1V2JT 1LKAA 4H6TA 1C5XB 1ZLRA 2Z9IA 4FVDA 2GT7A 4BAMB 3P92A 1A61H 3PROA 2FP7B 4B76A 2QXJA 1LPKB 3TH4H 1W12U 4B2BA 3QTOH 1DFPA 5GCHG 3ZZDA 7KMEH 5GCHF 1GI8B 2WZQA 2QGRA 4MQAA 3NCLA 1W2KH 1H4WA 1TGSZ 5LPRA 1FZZA 3BTQE 2CV3A 1GMHF 3M61U 2NU1E 3AW1A 6CHAB 1SFQB 5EIYA 4Y79A 3WY8A 3W94A 1O2ZA 4XBBA 3ATKA 3A7WA 3KQCA 1LPZB 3PRBA 1AU8A 2PW8H 2HNTF 3S0NA 2ZU5A 5DP3A 1N8OC 2BQ6B 2YNAA 2BY6X 2A5IA 1NRQH 3GY3A 1GL1A 4CRBA 1SI5H 1HAZB 2PTCE 1GJAB 2FODA 1UTQA 1DXPA 1O5EH 2F83A 2ZTZA 3RMMH 2L74A 2VB0A 3SU5A 2ZEBA 2ZPRA 3L3TA 1XMNB 1A5GH 2HNTE 4X1NU 3F2HA 3SUGA 1NRSH 4ISOA 1EQ9A 1O2PA 3TJUA 4GVUA 1UTNA 2FOCA 1SGRE 3K2UA 1MQ6A 5ESTE 2FDAA 3RXPA 1MTNC 4Y8ZA 1O3IA 1H9HE 4ABEA 2VWLA 1BTUA 4JZDH 1QBNA 4HGCA 1EB2A 3P8GA 1P01A 4OS4A 4U30A 1BRCE 2ZNKH 2BOHB 1S84A 4ZHMU 1YYY1 5EJLA 5K7RA 5C67A 1AB9C 1CE5A 4OGYA 4Z6AH 4K1TA 4WH6A 5T6GA 5AVDA 1FXYA 2KZ4A 4MLFB 2STAE 3LDXH 1GBBA 4MTBA 4K2YA 1IQEA 2XC5A 4B2CA 3MO9A 1C1OA 3TU7H 4A92A 1GDQA 1C2EA 2FLRH 3SYJA 1OWEA 1J14A 1S82A 1TMTH 3B9FH 3F9EA 2J5UA 2R0LA 3M7QA 4I8LA 3RC6A 1SQTA 1K2I1 2ZFTA 1LMWB 1NFWA 1RIWC 4GUXA 4FETA 2GV7A 4Q2KA 3FZDA 2G5NA 1TFXA 2XNDD 2GDDA 3BG4B 5GNDA 3TNSA 2R3UA 3DHKH 1PYTD 2C93B 5C1XA 2BY8X 1TWXB 5LPEA 2CHAC 3AW0A 2FWWA 4K1EA 3ZVCA 3F9HA 1WSSH 1RXPA 4K8YA 4B74A 3V12A 1S5SA 2B8OH 3BTWE 1P11E 3U8TH 1WAYB 1NN6A 2Y81A 1O30A 2HALA 5LH8A 1O3LA 4I32A 1OYQA 5GXPA 2W6ID 2JDID 1QB9A 1H8IH 3CS0A 1RGQA 2OBOA 3E0NB 1TONA 2OLGA 3SQHE 2TRMA 3S9BA 5L2ZH 1PPCE 2GZ8A 4KGAA 1GJ5H 3EE0B 3VB3A 3P8OA 3RXVA 3UR6A 5LGOA 2W3IA 5GIBA 2VIQA 4NCYA 4FUGA 2FLBH 1MU8B 3HATH 3KEEA 2BD4A 4B2AA 1O3EA 3RXKA 4CRAA 1LCYA 1AQ7A 2F4LA 2Z6BD 4ZKNU 1LKBA 3BEFB 3PTBA 2H2ZA 4BTUB 4YT7H 1JRSA 1SB1H 4FUHA 1K1PA 1TNJA 2AMDA 1QL9A 5B6OA 2IJOB 2ZU1A 4MPWA 1E79D 3PV2A 3VG8A 1SGFG 1F0RA 3LGVA 1NROH 1NRNH 3SBKA 3ZYDA 3PRDA 1LHGH 2SGDE 2ZDLA 2WPDD 3GDSA 2UUFB 2CJIA 1ZRKA 5DN6D 3BN9A 1QJ7B 1ZHMA 2A7CA 1VZQH 5JBAS 1NRPH 4NA7A 2QA9E 3EGKH 3GICB 2JH5D 3U98H 1C2JA 2BDIA 2M5TA 3TLOA 1ANBA 2WV4A 1AZ8A 1KSNA 3E8LA 4UFDH 2ZP0H 1DWEH 1VGCC 2OINA 2OBQA 1PQ8A 3PMHB 1CT2E 1EZQA 1MTVA 1OWKA 2CMYA 3DCLA 4ZMAH 2HVYB 1GI0A 2LPRA 1QCPA 3N7EA 1NESE 3RLYH 1GBMA 2Y80A 1EJAA 1GMCF 1P3EA 1PJPA 3OYPA 5E0JA 2G00A 4TT3D 4BAHB 5DPAA 1DS2E 1TNKA 2I6SA 4D76A 3GY6A 4Y8YA 1XXDA 4UE7H 5CHAB 2JKHA 3N99A 1HAGE 4FU9A 2OC8A 3M3TA 3RXUA 2GJGA 3BSQA 3UOUA 3PV4A 3WWBA 2PKAA 2PKAB 3E16B 2OXSA 3PLKA 3SV8A 5F03A 3DFJA 3ZZ9A 1GBJA 3PB1E 5TCAA 3VFEA 3TPIZ 3SU0A 1ZMNA 1C1TA 1AUJA 3SV7A 2HGTH 5PTPA 2SGQE 2ZCHP 1SGQE 4NIVA 1EB1H 1O2YA 5JB9S 1BUIA 5E2PA 5EJ1A 1GBTA 5F6MA 5DP6A 4KELA 2A4OA 1GCTB 5JBBS 3T28A 2ANWA 4K3JA 1TX6A 2FYRA 3SJIA 2VVVA 1QFKH 2P8OC 3ZZ7A 4YLUA 4RT0A 4IBLH 1ZSKA 3UY9A 1PPZA 1ELAA 2GCTC 1V2WT 1BCUH 2QYIA 1GI1A 4DGJA 5KEDA 2O8TA 1P2OA 1PFXC 1NFYA 3K9XB 1O3GA 1G2MA 4X8VH 1O3JA 3V7TA 2L6OA 2PKSB 1O3AA 3GY7A 2J95A 1RJXB 4Q80A 3KGPA 5GWZA 2TGPZ 2LELA 2A4GA 2IPHA 4MPUA 1SC8U 3KHVA 2VIDA 4JZFH 1YPGH 1JBUH 3GCHC 1UCYH 1AIXH 1ZTLA 2OK5A 4BXSA 3ATWA 1ZZZA 5H4IB 2P3FH 1C5UA 3Q76A 4MNVA 1C2MA 1YPJH 1O2HA 2UUJB 4X6MA 2W3KA 2Q6FA 4ZKSU 1YLCA 1FAKH 4F48B 1OKXA 4UEHH 4WH8A 3RXLA 1ELBA 2M2AA 2A1DB 3UQVA 4CH8B 2BHGA 1T4VH 1UTOA 1MAXA 3O8RA 2B5TB 2ZFRH 4X6NA 1KIGH 1W0KD 3FFGA 3MI4A 4AFZA 1BRBE 1E1QD 3DFLA 2P95A 1Z71A 3LGWA 3SI4H 3STIA 1NU9A 3GYLB 5A09A 1SSXA 1GDNA 1GHYH 3GY5A 3K6ZA 2H9EH 3MU0A 3UAIC 1YF4A 1BTXA 1G3BA 4I7YH 1VITG 3TGIE 2OC0A 2SFAA 1VITF 1UK4A 4AYVB 4K1SA 2A32A 2G4TA 4XFQA 4YOIA 2F9BH 2ZGJA 3V13A 5EPNA 1O2XA 1TABE 2RDEA 2ZC9H 2A5KA 1TOCB 2OP9A 1DOJA 2FM2A 2PGQB 3PLPA 3PWBA 5CDFE 1ZJDA 1HB0B 2PUQH 1TGNA 4JZEH 4B6FA 2XBWA 2ZGHA 4AN7A 4JZ1A 1LVYA 3FVFB 3PV5A 4CRFA 1DSUA 1Q2WA 3ZVBA 3ATLA 4Y0ZE 2ZPSA 4E7RG 4H42U 4XRNA 1TNLA 1W13U 3RXDA 3RXRA 3SUDA 1SMFE 1CA0B 4RN6A 3PMAB 1YPMH 1QQUA 2CF9H 7GCHF 3RXSA 3MO3A 3D65E 2GTBA 2V35A 2ZGXH 1V2LT 2ZHWH 2RG3A 1NBME 3RLWH 1AZZA 1BT7A 1L1JA 1UCYK 4ABAA 3P8NA 1O3DA 1OHHD 1C1NA 3AVZA 2KAIA 2Y5FA 5FAHA 4AGKA 1F5KU 1PPBH 1ELEE 1AHTH 1Q31A 3QZRA 2C8ZB 1A0HB 1A4WH 4KTCA 1WUNH 4JCNA 4A6LA 2FI3E 4GSOA 1RS0A 3BTFE 1B0FA 2LP6A 1THRH 2VWMA 3HGPA 1NTPA 4ZCNA 1O2SA 2F9OA 2P59A 1ZSLA 2NU0E 3TH2H 4F4OC 2Z9GA 1LO6A 4BOHA 1O3HA 1SGIB 5EGMA 2VVCA 3M36A 3A86A 6CHAC 1GCDA 2OQUA 5HYOA 2XXLA 4KTSA 4KP0A 1TGCA 1FN6A 1MKXH 1J17T 1BDAA 2J4IA 2A2XH 3HKIB 3BTHE 4GCHG 2PV9B 3OTJE 1KLJH 1N6XA 1ZSJA 2AS9A 1YLDA 2C8WB 1G9IE 3R3GB 2ZQ2A 2ZHDA 2Z7FE 2BD2A 1GJ6A 4M7GA 4NIYA 4RI0A 4E06H 1P2NA 1Y59T 1S0RA 3P95A 3UREA 1BMAA 1E37B 3EE7A 3MMGA 1HYLA 4D8NA 1GJ4H 1LVBA 1T8OA 1TX8A 3ZZAA 1AFQB 3S9CA 1GHWH 1BMFD 3JZ2B 2J38A 2VWNA 3B23B 1XUJA 4CH2B 5AF9H 1EJNA 1DY8A 2PGBB 4BNRA 4AG2A 5I25A 1KXAA 1RFNA 3OSYA 3SJKA 3KYGA 4IN1A 4ABBA 1G3CA 1C9PA 2BVXH 2UWPA 5EODA 1A0LA 1MABB 1MMJN 1PQAA 1A5IA 1Z8JB 2WINI 4NZLA 1TAWA 1LHDH 2GVFA 4LXBH 3AAUA 1JMOH 3ZVEA 2PFEA 1P09A 1X7AC 2AMPA 4I8KA 3Q3YA 1A5HA 1ELFA 3S69A 1XVOA 1GG6B 3ATMA 2O9QA 4X1PU 1OP8A 3PO1B 3I78A 2EY4C 2F9UA 2OC7A 3FAOA 3LGTA 3QGNB 1F2SE 3CP7A 4ZUHA 3TK6A 3TGJE 4TWYA 1O5AB 2HWLB 1NO9H 4TWWA 4X8UH 3SO3A 1WV7H 1QNJA 1YPHC 3KQBA 4DOQA 1MUEB 2J34A 1BRAA 4R0IA 1H1BA 1IQNA 5AHGH 1IHSH 2STBE 3M5NA 2WYJA 3BIVH 1L1GA 3ZVDA 3DSOA 3BG4C 3PYHA 1TLDA 3A80A 1O3MA 4ZAEA 1Z1JA 2VIOA 1K1JA 5TJXA 1C2DA 2AERH 1QL7A 5JPMH 1PQ5A 2PWXA 2XNIA 2J97A 1MKXK 1BTWA 4ESTE 2QXIA 3T25A 1QRZA 1NRRH 3M37A 3Q77A 5C1UA 1JIRA 1YP9A 2BDHA 5FBIA 4ISNA 1C5SA 5T6FA 5C94A 1LDTT 5A0BA 1SGPE 5EQSA 1QY6A 2K0QA 1UTLM 2P3UB 4VGCB 3WW7A 7LPRA 1FAXA 1GMHG 4Q4LA 5DO4H 3ZV8A 4D7FA 2VGCB 2HLCA 1DWDH 1WQSA 1MCVA 1D6RA 1O31A 3F1SB 2CXVA 1GHZA 3SNAA 1K21H 3OTPA 1HRTH 1XUGA 1ZPBA 3S7KB 4CREA 1MZAA 4NSYA 3A8CA 4O9VA 3RMNH 1F5LA 3A83A 5EJZA 2D26C 2JH0D 3FKSD 3A88A 4X8SH 2EI7A 3BG8A 1P8VC 1S6LA 5IDKA 1C5OH 1SGYE 1SGDE 1ZPCA 2CK3D 5J4SA 4NFFA 4YOJA 1P10A 3QWCH 1GBKA 1HJ9A 1XUHA 2FMJA 4H4FA 1EKBB 4TY7A 3TK5A 1HAYB 3TVJB 2P93A 3K6YA 3U8OH 4AYYB 4BAKB 1ELVA 2Q6GA 1IQMA 4AC9A 3A8AA 1SGFA 1Y3XA 5DG6A 1TBZH 3RXMA 1MU6B 1QL8A 1BBRH 3TGKE 4IC6A 2JH6D 3LKWA 3FOAA 3MNBA 1IAUA 5EW2H 1O35A 2QY0B 1IQGA 4OS1A 3L6PA 8KME2 4CRDA 1ZMJA 4ABGA 3BTME 3HGNA 1CVWH 1E34B 5E2OA 2F91A 5SGAE 3L33A 4ZXYH 4ZHLU 2KR7A 2VIPA 4ISIH 3C27B 5KGOA 3RXEA 1O3KA 1JWTA 1AFEH 4MNWA 3RXBA 2BY7X 3ZZ5A 3MHWU 1UTJA 3FN8A 1V2PT 1P04A 4WMEA 1VCQA 4DG4A 2ZGBH 2TGTA 3HPTB 1IQHA 4ISHH 5CHBA 3A89A 1SQOA 2BY9X 2XRCA 1GHAG 2SGAA 1XKBC 2NU3E 4D9RA 1GHAF 1W11U 1BTZA 1O2WA 1BHXB 2Q1JA 3ZVAA 4AX9H 4O3TA 4WMFA 1XKAC 2QF0A 4M9FA 1O0DH 3SNBA 2BDBA 1L1NA 1K1IA 3GOVB 1SHHB 4X2YA 3M3VA 3UNSA 4K8BA 4TPIZ 4HG6A 4FUIA 2ZG0H 1GCTC 2C3SA 4JK5A 3E90B 1UVSH 2TPIZ 2TGDA 4X2VA 1DANH 1UVOA 4J1YA 1EZXC 1J15A 3QX5H 1JXPA 2HPQH 2A45B 1ZYOA 3HK3B 3F9GA 3LGIA 4WXIA 1C2GA 1SGNE 4I33A 5GDSH 1ZGVA 2G51A 3BF6H 5JBCS 2BXTH 1NFXA 1HFDA 2PKSC 2V0BA 1V2KT 3SV9A 2BX3A 2V6NA 1YCPH 1BB0B 3LPRA 3WWFA 4BANB 4FUCA 2FX4A 2RA3A 3Q3KA 2Y82A 2O8WA 2OD3B 2AYWA 5EXMA 3A7VA 2H5CA 4XSKU 3NKKA 4THNH 1GHVH 3SNEA 1UVPA 1C9TA 1BBRK 1O2OA 1TBQH 1QJ6B 1TPOA 1GI2A 1G3EA 3VXEH 2HRVA 3NXPA 5T6DA 1ETTH 1DE7H 2ZU4A 5HMAA 1ETRH 3ZZ6A 3U69H 1XUFA 2JETB 2XC4A 3DSGA 1PPFE 1AO5A 4SGAE 3TNTA 4NZQA 1ANCA 1W0JD 1QB6A 4MPXA 3RXOA 5F8ZA 1Y3UA 1O2RA 1S83A 1EATA 2J2UA 2GV6A 3MU4A 1UMAH 5FCKA 1AKSA 4ZH8A 2F9PA 1AKSB 3KCGH 2W6JD 2G8TA 1FJSA 2AGEX 1ZJKA 2QE7D 2ODQA 4B71A 2BM2A 2F3CE 1GGDB 3PMBB 3F0PA 4DT4A 1DITH 1RTLA 2Z9KA 4INLA 2QF5A 2PP6A 2PSYA 3OU0A 3GISB 1UVUH 1QGFA 2ALPA 3MNXA 9LPRA 1ETSH 1E35B 1HGTH 3RUOA 1C5QA 1GMCG 2FS8A 4Y6DA 1OSSA 4XBDA 1DICA 1QRXA 1EZUC 1XVMA 1TQ7B 2FOFA 1O2VA 1SLVB 5F53A 3MNCA 3ODDA 4XOJA 3OE7D 1DY9A 1K1LA 2FTLE 4INHA 3GDUA 4K60A 5FL7D 4RSPA 1BHXF 3SHAH 5IK2D 2ZWLH 1SQRA 5C0UA 3FANA 4DT7B 3A82A 3IWMA 3A7YA 4MG3A 1OYTH 3U1JB 3SU6A 1E38B 1XUIA 2V7QD 1O3OA 3TH3H 8LPRA 2Y6TA 1AB9B 3UPEA 1CA0C 3RM2H 1TMUH 3SU1A 4B6EA 1O39A 1MQ5A 1T8MA 1YCPM 2J94A 2KCOA 5F8TA 5DP8A 1GBCA 1D6WA 1EUFA 1K1OA 1LHEH 4Y7AA 1TA2A 2V3OH 3ZYEA 1Q3XA 5FX5A 3UIRA 2C90B 1YCPK 3LH1A 2VJ1A 3I77A 3M3SA 1HV7A 2ZDKA 3U28C 4ACAA 2O8UA 1Z8IB 3QUMP 2BB4A 1B5GH 1XX9A 1Z8RA 1CBWB 4IS5A 4WJG2 3VGCB 3S7HB 1GHBG 1AMHA 1BTPA 3LU9B 1GHBF 2LNCA 2ZHFH 1IQFA 3MFJA 2YNBA 3BTKE 1F5RA 1QA0A 2OTVA 1V6DA 1C5RA 1DSTA 5C5NA 2G4UA 2J98A 2NWNA 3D23A 2CHAB 4FOUC 5CE1A 2J98B 1GI6A 2QXGA 3MQKC 2SGEE 2ZZUH 1IOEA 1HAVB 2QN5T 3AK5A 3MU1A 1TOMH 2BVSH 2O8MA 1N6YA 5LPFA 5EOKA 1OOKB 4UD9H 1TGTA 2UWOA 2BX4A 2QF4A 1HNEE 2ULLA 1C2IA 3TIUA 4NWLA 1H8ED 1AE8H 2GZ7A 3KYFA 4K5ZA 1VCPA 1KXBA 1EOJA 1GI5A 1SG8B 3SI3H 1ESBA 3SN8A 3KQ5A 1A7SA 2BOKA 3BTGE 4UFGH 1ID5H 1EASA 4ZXXH 1QHRB 1NBMD 1S0QA 1D3TB 1FNIA 2HNTC 3P70B 4MPVA 3LGYA 1P2JA 3EDXB 5C20A 5EXNA 3S9AA 3QLPH 1AFQC 1HIAB 2BQ7B 2Y7XA 1BOQA 1YPEH 4TYDA 1MZDA 3SJOA 1P2MA 1C5MD 1P03A 4DVAU 1A2CH 1EP5A 3CS7A 2XOKD 1O3NA 1O5GH 2JJ1D 1SPJA 5ABWA 1L4DA 1SGEE 1UTMA 1CGJE 3QN7A 4AZ2B 4CHAB 2VH0A 2VBCA 1G3DA 1WXRA 2BDAA 1BIOA 4NA8A 5DP4A 1AD8H 2XWBI 3K65B 1GBHA 1OXGA 4AB9A 1HXFH 1WTGH 2BLOA 1GG6C 4ZHAA 1W10U 2FOEA 4X1QU 3T26A 2ZIQH 3U9AH 4CRCA 4ACBA 4Y0YE 1MD7A 3OX7U 1VGCB 2EI6A 3PO1C 1H8DH 2BQWB 3F68H 4GAWA 1SGCA 1QRWA 5FPTA 1F92A 1UHBA 2VVUA 4ABHA 1UHBB 3SNCA 2VU8E 3F9FA 3LJOA 7GCHG 3GY4A 1Y3VA 2SNVA 1YC0A 4MNXA 3RXHA 4WMDA 4YTAA 3EA7A 1WOFA 3R0FA 3SORA 1ORFA 1OP2A 3EYDA 3UR9A 5EG4A 4OS2A 5DP5A 2ZDMA 2Z3CA 4LZ4B 1SR5C 2H5DA 1W0ZU 1WCZA 1V2NT 2BD8A 5CMXH 3LGUA 1U6QA 4I86A 1O2QA 1W7GH 2ALVA 4GHTA 1Y3WA 4X8TH 4HTCH 2H9HA 2KX4A 1QR3E 1P57B 1GBLA 2Z3DA 1ESAA 3SU3A 3BEUA 3GY2A 1GBFA 3SJ9A 2QAAA 3O8CA 1FUJA 1P2KA 4FUDA 1TIOA 1MBMA 4ZROA 1O37A 2AHME 4VGCC 2KCPA 5DGJA 2EC9H 1AI8H 4Y7BA 1ANDA 4IW4E 1O3FA 2R3YA 1ZOMA 2FOGA 3FP6E 1UVTH 1L4ZA 2RDLA 2A7JA 3MYWA 5C3NA 1MD8A 2D2DA 1KXEA 1FX0B 4BXWA 2Y7ZA 4QT8C 1BA8B 3E6PH 1DX5M 4O3UA 1O5CB 2FESH 4U32A 1AE5A 4DY7B 2FX6A 1VJ9U 3D49H 1HJAB 2BD5A 2FTMA 3F2FA 4CBNA 2FS9A 1O32A 4U2WA 4CR9A 2FXRA 5HIYA 3RU4D 4X1RU 1BTHH 3MTYA 1P12E 2GMTB 3ZVGA 1MAYA 1GDUA 1LVMA 1SHYA 1EAUA 3STJA 1CGHA 2XYAA 3T29A 5HM9A 3MH4A 2BY5X 2BZAA 3RXQA 2RA0A 3RXTA 1FN8A 5FXLA 1RD3B 2YMSB 2AEIH 6GCHG 2WHXA 1MTSA 6GCHF 1UK3A 4INKA 2EEKA 3QO6A 2J92A 1IQLA 1CHOG 2B0FA 2WYGA 3H09A 1CHOF 2GCHG 2TIOA 1TALA 3SGBE 1W7XH 3A87A 5C5OA 1BTYA 2GCHF 3UFAA 2R2WU 1A46H 2H9TH 4KTUA 3SZEA 2VWOA 4B1TA 4NGAH 3GCNA 1F7ZA 4FUFA 5K0HA 4OGXA 5L2YH 1B0EA 1C1RA 3SV6A 4JK6A 4P02A 2TBSA 1C2FA 1D9IA 3GCTF 4IC5A 4YZUA 3GYMA 3E3TA 1TRNA 3IITA 1DLKB 1CHGA 1C4U2 1G30B 5AFZH 4AFQA 2C4FH 1YGCH 1F0TA 2ZGCA 1QB1A 4LZ1H 2QC2A 2TGAA 1GVKB 3TJNA 2Z9JA 1ELCA 2C8YB 4YT6H 2UUKB 1GBAA 2QCYA 3QK1A 2DE8A 1BJVA 1LTOA 2AIPA 1V2VT 2CGAA 1Y5BT 4YXWD 3V3MA 4MDSA 1MTWA 3BTEE 1IHTH 1XUKA 4XD7D 1DVAH 1HXEH 1OWDA 3RM0H 3KL6A 3MU5A 3VPKA 4DW2U 1G32B 2A7HA 4YLQH 2Y5HA 3RXCA 1MKWH 5T1VA 3MH7A 1FDPA 1O5BB 4FUJA 4IMQA 5J4QA 1C4V2 2RFKC 1ELGA 4MNYA 1F0UA 2W7SA 7ESTE 4I31A 3DA9B 5DKMA 1TA6A 1H9LB 2R9PA 1CO7E 1GMDG 2HLDD 1E0FD 1GMDF 1SQAA 1UTKA 1OS8A 4BTIB 1SVPA 3RXIA 2G81E 8ESTE 1NZQH 1HLTH 3IG6B 3W1EA 3T2NA 1EPTA 1UCYE 1EPTB 1O3PB 3RXJA 1O33A 2ZU3A 4A7IB 3VEQB 3RP2A 2WUBA 3ESTA 4MVNA 1FY4A 1F0SA 1Y5AT 1IQJA 4TSFD 1O3CA 1FI8A 3SUFA 2VH6A 1TNIA 1SFIA 4Q7YA 4SGBE 1S6FA 1TX7A 1ELTA 1M9UA 2BZ6H 3OY5U 4YESB 4ASUD 3PTNA 4NSVA 1CU1A 5F8XA 3PMJA 4NWKA 2PHBA 3EQ0H 3KQDA 2A0QB 2D8WA 4X2WA 1SGTA 4AFUA 3P8FA 3SOSA 3UNRA 1C2KA 1GBIA 4K69A 2H1UA 5G4BA 2XCFA 4FU8A 2ANMH 3KIDU 1V2RT 3M7UA 2QXHA 4E7NA 1DM4B 1JIMA 1O2MA 2BLVA 2JETC 2R2MB 2KFWA 2XBVA 3CNRA 1CSOE 4I8JA 5FCRA 4F55A 1ABIH 1IQIA 4X6PA 1T8NA 1XM1A 3ODFA 3DD2H 3BEIB 2BD9A 1QA7A 1YLNA 2GZ9A 1Z1IA 1DWCH 2WPLS 2H6MA 1UO6A 2VIVA 1CQQA 2ZF0H 3T27A 4WVPE 1CT0E 1O34A 1C1QA 1GGDC 1NU7B 5EQQA 4FUEA 5EXLA 1EP6A 1TMBH 1C1VH 4X6OA 1NFUA 4NIXA 9ESTA 3AASA 1O2KA 1HAPH 1MKWK 1DUEA 5FHTA 4Z1MD 4FUBA 1ARBA 2UUYA 1SL3A 2GGVB 5L6NH 1OWJA 3LH3A 4YM9A 1WYKA 1O5DH 3UNQA 1Y5UT 2NU4E 1K22H 3A81A 2ZI2H 4DCDA 1GPZA 4YOGA 3F2GA 1EFRD 1S85A 1NC6A 4WWYA 5CHAC 1FMGA 3P17H 3QTVH 4AFSA 5L30H 2Q6DA 5T3HA 1C5PA 2ZHQH 5DJ7A 1YKTA 1THSH 3E1XB 1AWFH 1CA8B 2ODPA 1WQVH 3FP8E 1VR1H 3AAVA 6ESTA 2FIRH 5C1YA 1A1RA 3B8JA 5EQRA 3C1KA 2Z9LA 3PM3A 2NU2E 1HUTH 1RTKA 2BTCE 3OEHD 2Y5GA 3QZQA 1C2HA 3ZZ8A 1O5FH 1IQKA 1TNHA 3Q3XA 2PUXB 1NS3A 3VB5A 2ZA5A 1NT1A 1D3QB 4AOQA 1PQ7A 1ZHRA 3SU2A 1VITH 1CBWC 2XTTB 2F9VA 3UUZA 1P2QA 3VGCC 3I29A 2ZCLP 3TITA 2WUCA 2IPQX 4O03A 4AGJA 2XCNA 3KNXA 1TRMA 5GJ4B 1AWHB 2KCYA 3HKJB 2F9NA 5FX6A 3MWIU 2GX4A 1EJMA 1EZSC 2BLQA 2HVXA 3FP7E 1VJAU 3BTDE 1DWBH 3GDVA 5EU8A 4ABDA 5E8EH 4A1XA 1E36B 2IN2A 2A4QA 2BLWA 1BMLA 2ILNA 1THPB 4XBCA 1P2IA 1C1SA 4IN2A 1K9OE 2AH4X 1SLXB 1TE0A 2QF3A 3NRLA 2ANYA 3QGJA 3F3BA 2WPIS 4Q7XA 1NY22 1ZR0A 1O38A 2HPPH 4R8TB 1HPGA 1SOTA 3NK8A 1FLEE 1N1LA 3GS9A 2AIQA 2GDEH 4DURA 2W5EA 3RU4T 1QQ4A 2OQ5A 2FI5E 1FIWA 3SHCH 1G37A 2XC0A 3A7XA 2SGPE 1P9SA 3DT0H 1KXCA 1T8LA 5HGGA 1EOLA 1LQDB 1AGJA 4FXGH 5DK1A 1LHFH 1GVZA 2AFQB 1A3EH 3H7OA 1Z6JH 1GBDA 1N8OB 3H5CB 4ISLA 3ZZCA 1Z7KA 4TPYA 3RXGA 4ASHA 2ZDNA 1FY1A 1PPHE 1B7XB 3SGQE 1HJ8A 1YWUA 3URCA 2WPKS 2R0KA 4LK4A 4Q63A 4E05H 1GHXH 1SKYE 1GBEA 2VINA 4P00A 3UQOA 4JYVH 1W3CA 3ZVFA 1HAIH 1J9CH 3VB7A 4Z0KA 4JYUH 3LT3A 3M7TA 2FPZA 2RCEA 1P0SH 4AG1A 3A85A 4F49A 3DSPA 5BRRE 2ZPQA 2FOHA 4WXVA 1SOZA 5A0AE 4CHAC 4NFEA 4A5TS 4ZKRU 2AGGX 1AN1E 4NIWA 1HBTH 4PROA 1ABJH 1FPCH 2ZTXA 3UTUH 2G5VA 3MH5A 1MTNB 1BRUP 4U01A 1TNGA 4A1TA 2A4RA 2BD3A 6LPRA 1FIZA 4NA9H 1J8AA 1H9IE 1O2TA 3OAAD 1GL0E 1QZ8A 4Y76A 1ESTA 1FY8E 3A8DA 2FI4E 1Y3YA 5GPIB 3U8RH 3UWJH 3SZNA 3KF2A 1HAOH 3CENA 4FU7A 2KM0A 1KY9A 2K1QA 2VNTA 2ZQ1A 1O36A 1YBWA 1GWAA 4ZKOU 2EI8A 3HK6B 2PSXA 4OS6A 3NUMA 2P3TB 1P06A 5A8YA 1C2LA 1ZMLA 1T4UH 5A8XA 3FO8D 1C5WB 1ACBE 4Y8XA 1DT2A 1JRTA 1SLUB 2ANKH 1C1UH 1DUAA 5KECA 4ABIA 2ODYB 3RC4A 1TPSA 1MCTA 2PR3A 1ELDE 4JYTA 1ZTJA 1RIWB 1V2UT 3LOXA 1O2JA 1K1MA 1YPHE 1S6HA 3MOCA 1PPGE 1V2ST 2O8LA 1LVOA 5I46H 4OS7A 2ZFPH 3SU4A 3O8DA 3ZZ4A 3ELAH 1K0HA 2K8IA 1KTTB 1HAVA 1OPHB 3KQEA 1HCGA 1FONA 2GKVE 1QIXB 1NPMA 4BAOB 2JIZD 2XW9A 2Z3EA 1QTFA 3M35A 4O97A 1ZGIA 1GJ7B 1QBVH 3MO6A 1CGIE 4IGDA 2J9NA 1FV9A 4YO9A 4KKDA 3URDA 4WF8A 5JDUB 4TY6A 1HJAC 4UFEH 4B73A 1AVWA 4ABFA 4CBOA 4X2XA 1TRYA 2GMTC 1UK2A 2AGIX 1PPEE 1E1RD 5FPSA 3EA8A 4OM9A 4WY3A 3O8BA 1EX3A 3MH6A 2F43B 1UJ1A 1P05A 2YMSC 2QIQA 3MU8A 5JYIA 1OWIA 3RMOH 4D7GA 2D1JA 5B6LA 4RT1A 1HIAA 1WDIA 1OX1A 2FO9A 2BDGA 2CF8H 2BYAX 1VCWA 1BBRE 4DIIH 1HDTH 5DP7A 4DIHH 4ABJA 1O2NA 1QURH 3A7TA 4IMZA 2JJ2D 3PLBA 4UONA 5ESBA 2ZU2A 1UTPA 1S81A 3MNSA 1HAHH 3LONA 3QDZB 1AUTC 4OS5A 4B75A 1GVLA 1MH0A 5BPEA 3M5OA 1DLEA 5AFYH 2I6QA 1L2EA 2P94A 3H7TA 3ITIA 5IYTA 3SUEA 3PWCA 1GI7B 1C5LH 1TPPA 2FOAA 1COWD 1Z8GA 1V2MT 1KDQA 3UOPA 1KDQB 4HZHA 1C1WH 2BD7A 2HOBA 4D9QA 3F6UH 2WPHS 2EQNA 4X1SU 2FOBA 2ZFFH 2PTNA 1EAIA 1D3PB 1RTFB 2XBYA 1WU1A 8GCHG 1GI4A 1FY3A 1C5YB 4UDWH 1BMNH 1BMMH 1W8BH 2FZZA 8GCHF 1YM0A 1P9UA 1W14U 1YPKH 2BDYA 1UW7A 3SGAE 3DUXH 2V3MA 3W95A 1GJCB 3VB4A 2ASUB 1T7CA 2P16A 2BXUH 2FOMB 2UWLA 3SNDA 4GLYA 5A2MH 1KYNA 5HIZA 1W0YH 1TGBA 3RXAA 3M5LA 1O2LA 2DUCA 2PLXA 1V2TT 5HKKD 1INCA 1C1PA 1DPOA 5JB8S 1KXFA 1QJ1B 5JBTA 4AB8A 3M5MA 5DP9A 1ZTKA 2IJD1 4CRGA 3BTTE 1SBWA 1FQ3A 4Y11E 2ZO3H 1C5ZB 1C4Y2 4XE4A 4H6SB 1D4PB 2AMQA 3D62A 3ZZBA 4GHQA 1KXDA 4X0WU 3SW2B 3A8BA 1BITA 1C5VA 3Q00A 4BTTB 1RRKA 3RMLH 3A84A 3E91A 2EA3A 4UFFH 2DE9A 1P02A 5C17A 2G55A 1KLIH 5ETXA 3EA9A 1EPTC 2KAIB 2ZECA 1JOUB 3ATIA 3V0XA 3NWUA 2P8OB 2VGCC 1GJ9B 2W26A 1OP0A 2ZDAH 3SQEE 2GCTB 4FVBA 1CT4E 1YPLH 1HAXB 5A0CA 4J2YB 1TPAE 4A1VA 1ZRBA 3P6ZB 5FPYA 3GCOA 2THFB 1GJDB 2FYQA 2B9LA 1G36A 2BDCA 1VKYA 2FEQH 4NG9H 2G52A 3UB0A 1P3CA 1V2QT 1TB6H 1J16A 2GT8A 4RKJB 3GCHB 1QBOA 1K28D 3OY6U 2SNWA 2V3HH 2SGFE 3T62A 1LHCH 4GPGA 5E0GA 1OWHA 3ENSB 4RKOB 5A8ZA 3F0OA 2A31A 1T32A 2Z94A 2ZFQH 2ZDVH 3NZIA 3N7DA 3ZIAD 2BMGB 2BVRH 4GCHF 1TBRH 4AORA 2GD4B 2OCVB 3SJ8A 4JMYA 4LOYH 1WTHD 1V3XA 1PYTC 2W7UA 3GY8A 1ANEA 1K1NA 3LIWA 3N7OA 3ZZ3A 5FBEA 3LJJA 1GJ8B 3GCTG 1ARCA 2A2QH 3OFND 3KN2A 1A0JA 2CN0H 4Y71A 3LC5A 1LPGB 2B7DH 3OEED 4XDEA 2WV5A 5HXFA 4HI3A 2WV9A 2ZKSA 1V2OT 2OC1A 2ZTYA 1FY5A 1Z6EA 5HM2A 1MTUA 1DDJA 1A3BH 2ZFSA 1O2GH 1O3BA 5EPYA 3RC5A 4I8GA 1DXWA 1YY3A 2A5AA 3A7ZA 2GP9B 1LQEA 1KTSB 5C2ZA 1SLWB 2KCAA 2ESTE 1H8HD 3EAJA 1ZPZA 1GI9B 1O2UA 1G2LA 1TQ0B 2WPMS 3UWIA 3TK9A 2IOTA 2WPJS 1BZXE 2ZHEH 3RDZA 1BJUA 1C5NH 5E0HA 3TJOA 3RXFA 1AVGH 2C8XB 3VB6A 4BAQB 5TCCA 2XBXA 1KMHB
chains in the Genus database with same CATH topology
1GJBB 4HFPB 1WBGB 3U1IB 3NPSA 2ZCKP 4Q7ZA 4DJZB 2VIWA 2YOLA 3RU4E 3BV9B 3T5FH 1L0ZA 3E0PB 1XXFA 2XWAA 4CR5A 1EXFA 5EW1H 4Y10E 1C5TA 1GI3A 3BIUH 3LC3A 3SV2H 1ZHPA 1D3DB 4I8HA 1C1MA 1T31A 2QV1A 3TJVA 1EAXA 1BQYA 3FZZA 1MBQA 1EAWA 1Y8TA 1AY6H 1TYNA 2OUAA 4JZIA 3VXFH 3ZV9A 1KLTA 3G01A 3JZ1B 1AVXA 1O2IA 1NM6A 1FPHH 1V2JT 1LKAA 4H6TA 1C5XB 1ZLRA 2Z9IA 4FVDA 2GT7A 4BAMB 3P92A 1A61H 3PROA 2FP7B 4B76A 2QXJA 1LPKB 3TH4H 1W12U 4B2BA 3QTOH 1DFPA 5GCHG 3ZZDA 7KMEH 5GCHF 1GI8B 2QGRA 4MQAA 3NCLA 1W2KH 1H4WA 1TGSZ 5LPRA 1FZZA 3BTQE 2CV3A 1GMHF 3M61U 2NU1E 3AW1A 6CHAB 1SFQB 4Y79A 3WY8A 3W94A 1O2ZA 4XBBA 3ATKA 3A7WA 3KQCA 1LPZB 1AU8A 2PW8H 2HNTF 3S0NA 2ZU5A 5DP3A 1N8OC 2BQ6B 2YNAA 2BY6X 2A5IA 1NRQH 3GY3A 1GL1A 4CRBA 1SI5H 1HAZB 2PTCE 1GJAB 2FODA 1UTQA 1DXPA 1O5EH 2F83A 2ZTZA 3RMMH 2VB0A 3SU5A 2ZEBA 2ZPRA 3L3TA 1XMNB 1A5GH 2HNTE 4X1NU 3SUGA 1NRSH 4ISOA 1EQ9A 1O2PA 3TJUA 4GVUA 1UTNA 2FOCA 1SGRE 3K2UA 1MQ6A 5ESTE 2FDAA 3RXPA 1MTNC 4Y8ZA 1O3IA 1H9HE 4ABEA 2VWLA 1BTUA 4JZDH 1QBNA 4HGCA 1EB2A 3P8GA 1P01A 4OS4A 4U30A 1BRCE 2ZNKH 2BOHB 1S84A 4ZHMU 1YYY1 5K7RA 5C67A 1AB9C 1CE5A 4OGYA 4Z6AH 4K1TA 4WH6A 5T6GA 5AVDA 1FXYA 4MLFB 2STAE 3LDXH 1GBBA 4MTBA 4K2YA 1IQEA 2XC5A 4B2CA 3MO9A 1C1OA 3TU7H 4A92A 1GDQA 1C2EA 2FLRH 1OWEA 1J14A 1S82A 1TMTH 3B9FH 3F9EA 2R0LA 3M7QA 4I8LA 3RC6A 1SQTA 1K2I1 2ZFTA 1LMWB 1NFWA 1RIWC 4GUXA 2GV7A 4Q2KA 3FZDA 2G5NA 1TFXA 2GDDA 3BG4B 3TNSA 2R3UA 3DHKH 1PYTD 2C93B 5C1XA 2BY8X 1TWXB 5LPEA 2CHAC 3AW0A 2FWWA 4K1EA 3ZVCA 3F9HA 1WSSH 1RXPA 4K8YA 4B74A 3V12A 1S5SA 2B8OH 3BTWE 1P11E 3U8TH 1WAYB 1NN6A 2Y81A 1O30A 2HALA 5LH8A 1O3LA 4I32A 1OYQA 5GXPA 1QB9A 1H8IH 3CS0A 1RGQA 2OBOA 3E0NB 1TONA 2OLGA 3SQHE 2TRMA 3S9BA 5L2ZH 1PPCE 2GZ8A 4KGAA 1GJ5H 3EE0B 3VB3A 3P8OA 3RXVA 3UR6A 5LGOA 2W3IA 5GIBA 2VIQA 4NCYA 4FUGA 2FLBH 1MU8B 3HATH 3KEEA 2BD4A 4B2AA 1O3EA 3RXKA 4CRAA 1LCYA 1AQ7A 2Z6BD 4ZKNU 1LKBA 3BEFB 3PTBA 2H2ZA 4BTUB 4YT7H 1JRSA 1SB1H 4FUHA 1K1PA 1TNJA 2AMDA 1QL9A 5B6OA 2IJOB 2ZU1A 4MPWA 1SGFG 1F0RA 3LGVA 1NROH 1NRNH 3SBKA 3ZYDA 1LHGH 2SGDE 2ZDLA 3GDSA 2UUFB 2CJIA 1ZRKA 3BN9A 1QJ7B 1ZHMA 2A7CA 1VZQH 5JBAS 1NRPH 4NA7A 2QA9E 3EGKH 3GICB 2JH5D 3U98H 1C2JA 2BDIA 2M5TA 3TLOA 1ANBA 2WV4A 1AZ8A 1KSNA 3E8LA 4UFDH 2ZP0H 1DWEH 1VGCC 2OINA 2OBQA 1PQ8A 3PMHB 1CT2E 1EZQA 1MTVA 1OWKA 2CMYA 4ZMAH 1GI0A 2LPRA 1QCPA 1NESE 3RLYH 1GBMA 2Y80A 1EJAA 1GMCF 1P3EA 1PJPA 3OYPA 5E0JA 2G00A 4BAHB 5DPAA 1DS2E 1TNKA 2I6SA 4D76A 3GY6A 4Y8YA 1XXDA 4UE7H 5CHAB 2JKHA 1HAGE 4FU9A 2OC8A 3M3TA 3RXUA 3UOUA 3BSQA 3PV4A 2PKAA 2PKAB 3E16B 2OXSA 3PLKA 3SV8A 5F03A 3DFJA 3ZZ9A 1GBJA 3PB1E 5TCAA 3VFEA 3TPIZ 3SU0A 1ZMNA 1C1TA 1AUJA 3SV7A 2HGTH 5PTPA 2SGQE 2ZCHP 1SGQE 4NIVA 1EB1H 1O2YA 5JB9S 1BUIA 5E2PA 1GBTA 5F6MA 5DP6A 4KELA 2A4OA 1GCTB 5JBBS 3T28A 2ANWA 4K3JA 1TX6A 2FYRA 3SJIA 2VVVA 1QFKH 2P8OC 3ZZ7A 4YLUA 4IBLH 1ZSKA 3UY9A 1PPZA 1ELAA 2GCTC 1V2WT 1BCUH 2QYIA 1GI1A 4DGJA 2O8TA 1P2OA 1PFXC 1NFYA 3K9XB 1O3GA 1G2MA 4X8VH 1O3JA 3V7TA 2PKSB 1O3AA 3GY7A 2J95A 1RJXB 4Q80A 3KGPA 5GWZA 2TGPZ 2A4GA 2IPHA 4MPUA 1SC8U 3KHVA 2VIDA 4JZFH 1YPGH 1JBUH 3GCHC 1UCYH 1AIXH 1ZTLA 4BXSA 3ATWA 1ZZZA 5H4IB 2P3FH 1C5UA 3Q76A 4MNVA 1C2MA 1YPJH 1O2HA 2UUJB 4X6MA 2W3KA 2Q6FA 4ZKSU 1YLCA 1FAKH 1OKXA 4UEHH 4WH8A 3RXLA 1ELBA 2A1DB 3UQVA 4CH8B 2BHGA 1T4VH 1UTOA 1MAXA 3O8RA 2B5TB 2ZFRH 4X6NA 1KIGH 3FFGA 4AFZA 3MI4A 1BRBE 3DFLA 2P95A 1Z71A 3LGWA 3SI4H 3STIA 1NU9A 3GYLB 5A09A 1SSXA 1GDNA 1GHYH 3GY5A 3K6ZA 2H9EH 3MU0A 1YF4A 1BTXA 1G3BA 4I7YH 1VITG 3TGIE 2OC0A 2SFAA 1VITF 1UK4A 4AYVB 4K1SA 2A32A 2G4TA 4XFQA 4YOIA 2F9BH 2ZGJA 3V13A 5EPNA 1O2XA 1TABE 2ZC9H 2A5KA 2OP9A 1TOCB 1DOJA 2FM2A 2PGQB 3PLPA 3PWBA 1ZJDA 1HB0B 2PUQH 1TGNA 4JZEH 2XBWA 2ZGHA 4AN7A 4JZ1A 1LVYA 3FVFB 4CRFA 1DSUA 1Q2WA 3ZVBA 3ATLA 4Y0ZE 2ZPSA 4E7RG 4H42U 1TNLA 1W13U 3RXDA 3RXRA 3SUDA 1SMFE 1CA0B 4RN6A 3PMAB 1YPMH 1QQUA 2CF9H 7GCHF 3RXSA 3MO3A 3D65E 2GTBA 2V35A 2ZGXH 1V2LT 2ZHWH 2RG3A 3RLWH 1AZZA 1BT7A 1L1JA 1UCYK 4ABAA 3P8NA 1O3DA 1C1NA 3AVZA 2KAIA 2Y5FA 5FAHA 4AGKA 1F5KU 1PPBH 1ELEE 1AHTH 1Q31A 3QZRA 2C8ZB 1A0HB 1A4WH 4KTCA 1WUNH 4JCNA 4A6LA 2FI3E 4GSOA 1RS0A 3BTFE 1B0FA 1THRH 2VWMA 3HGPA 1NTPA 1O2SA 2F9OA 2P59A 1ZSLA 2NU0E 3TH2H 4F4OC 2Z9GA 1LO6A 4BOHA 1O3HA 1SGIB 5EGMA 2VVCA 3M36A 3A86A 6CHAC 1GCDA 2OQUA 5HYOA 2XXLA 4KTSA 4KP0A 1TGCA 1FN6A 1MKXH 1J17T 1BDAA 2J4IA 2A2XH 3HKIB 3BTHE 4GCHG 2PV9B 3OTJE 1KLJH 1N6XA 1ZSJA 2AS9A 1YLDA 2C8WB 1G9IE 3R3GB 2ZQ2A 2ZHDA 2Z7FE 2BD2A 1GJ6A 4M7GA 4NIYA 4E06H 1P2NA 1Y59T 1S0RA 3P95A 3UREA 1BMAA 1E37B 4D8NA 3MMGA 1HYLA 1GJ4H 1LVBA 1T8OA 1TX8A 3ZZAA 1AFQB 3S9CA 1GHWH 3JZ2B 2J38A 2VWNA 3B23B 1XUJA 4CH2B 5AF9H 1EJNA 1DY8A 2PGBB 4BNRA 4AG2A 5I25A 1KXAA 1RFNA 3OSYA 3SJKA 4IN1A 4ABBA 1G3CA 1C9PA 2BVXH 2UWPA 5EODA 1A0LA 1MMJN 1PQAA 1A5IA 1Z8JB 2WINI 4NZLA 1TAWA 1LHDH 2GVFA 4LXBH 3AAUA 1JMOH 3ZVEA 2PFEA 1P09A 1X7AC 2AMPA 4I8KA 3Q3YA 1A5HA 1ELFA 3S69A 1XVOA 1GG6B 3ATMA 2O9QA 4X1PU 1OP8A 3PO1B 3I78A 2F9UA 2OC7A 3FAOA 3LGTA 3QGNB 1F2SE 3CP7A 4ZUHA 3TK6A 3TGJE 4TWYA 1O5AB 2HWLB 1NO9H 4TWWA 4X8UH 3SO3A 1WV7H 1QNJA 1YPHC 3KQBA 4DOQA 1MUEB 2J34A 1BRAA 4R0IA 1H1BA 1IQNA 5AHGH 1IHSH 2STBE 3M5NA 2WYJA 3BIVH 1L1GA 3ZVDA 3BG4C 3PYHA 1TLDA 3A80A 1O3MA 4ZAEA 1Z1JA 2VIOA 1K1JA 5TJXA 1C2DA 2AERH 1QL7A 5JPMH 1PQ5A 2PWXA 2XNIA 1MKXK 1BTWA 4ESTE 2QXIA 3T25A 1QRZA 1NRRH 3M37A 3Q77A 5C1UA 1JIRA 1YP9A 2BDHA 5FBIA 4ISNA 1C5SA 5T6FA 1LDTT 5A0BA 1SGPE 5EQSA 1QY6A 1UTLM 2P3UB 4VGCB 7LPRA 1FAXA 1GMHG 5DO4H 3ZV8A 4D7FA 2VGCB 2HLCA 1DWDH 1WQSA 1MCVA 1D6RA 1O31A 3F1SB 2CXVA 1GHZA 3SNAA 1K21H 1HRTH 1XUGA 1ZPBA 3S7KB 4CREA 1MZAA 4NSYA 3A8CA 4O9VA 3RMNH 1F5LA 3A83A 2D26C 2JH0D 3A88A 4X8SH 2EI7A 3BG8A 1P8VC 5IDKA 1C5OH 1SGYE 1SGDE 1ZPCA 5J4SA 4NFFA 4YOJA 1P10A 3QWCH 1GBKA 1HJ9A 1XUHA 2FMJA 4H4FA 1EKBB 4TY7A 3TK5A 1HAYB 3TVJB 2P93A 3K6YA 3U8OH 4AYYB 4BAKB 1ELVA 2Q6GA 1IQMA 3A8AA 1SGFA 1Y3XA 5DG6A 1TBZH 3RXMA 1MU6B 1QL8A 1BBRH 3TGKE 4IC6A 2JH6D 3LKWA 3MNBA 1IAUA 5EW2H 1O35A 2QY0B 1IQGA 4OS1A 3L6PA 8KME2 4CRDA 1ZMJA 4ABGA 3BTME 3HGNA 1CVWH 1E34B 5E2OA 2F91A 5SGAE 3L33A 4ZXYH 4ZHLU 2VIPA 4ISIH 3C27B 3RXEA 1O3KA 1JWTA 1AFEH 4MNWA 3RXBA 2BY7X 3ZZ5A 3MHWU 1UTJA 1V2PT 1P04A 4WMEA 1VCQA 4DG4A 2ZGBH 2TGTA 3HPTB 1IQHA 4ISHH 3A89A 1SQOA 2BY9X 2XRCA 1GHAG 2SGAA 1XKBC 2NU3E 4D9RA 1GHAF 1W11U 1BTZA 1O2WA 1BHXB 2Q1JA 3ZVAA 4AX9H 4O3TA 4WMFA 1XKAC 2QF0A 1O0DH 3SNBA 2BDBA 1L1NA 1K1IA 3GOVB 1SHHB 4X2YA 3M3VA 3UNSA 4K8BA 4TPIZ 4FUIA 2ZG0H 1GCTC 2C3SA 4JK5A 3E90B 1UVSH 2TPIZ 2TGDA 4X2VA 1DANH 1UVOA 4J1YA 1EZXC 1J15A 3QX5H 1JXPA 2HPQH 2A45B 1ZYOA 3HK3B 3F9GA 3LGIA 4WXIA 1C2GA 1SGNE 4I33A 5GDSH 1ZGVA 2G51A 3BF6H 5JBCS 2BXTH 1NFXA 2PKSC 1HFDA 2V0BA 1V2KT 3SV9A 2BX3A 2V6NA 1YCPH 1BB0B 3LPRA 4BANB 4FUCA 2FX4A 2RA3A 3Q3KA 2Y82A 2O8WA 2OD3B 2AYWA 5EXMA 3A7VA 2H5CA 4XSKU 3NKKA 4THNH 1GHVH 3SNEA 1UVPA 1C9TA 1BBRK 1O2OA 1TBQH 1QJ6B 1TPOA 1GI2A 1G3EA 3VXEH 2HRVA 3NXPA 5T6DA 1ETTH 1DE7H 2ZU4A 5HMAA 1ETRH 3ZZ6A 3U69H 1XUFA 2JETB 2XC4A 1PPFE 1AO5A 4SGAE 3TNTA 4NZQA 1ANCA 1QB6A 4MPXA 3RXOA 5F8ZA 1Y3UA 1O2RA 1S83A 1EATA 2J2UA 2GV6A 3MU4A 1UMAH 5FCKA 1AKSA 4ZH8A 2F9PA 1AKSB 3KCGH 2G8TA 1FJSA 2AGEX 1ZJKA 2ODQA 4B71A 2BM2A 2F3CE 1GGDB 3PMBB 1DITH 1RTLA 2Z9KA 4INLA 2PSYA 3OU0A 3GISB 1UVUH 1QGFA 2ALPA 3MNXA 9LPRA 1ETSH 1E35B 1HGTH 3RUOA 1C5QA 1GMCG 2FS8A 4Y6DA 1OSSA 4XBDA 1DICA 1QRXA 1EZUC 1XVMA 1TQ7B 2FOFA 1O2VA 1SLVB 3MNCA 3ODDA 4XOJA 1DY9A 1K1LA 2FTLE 4INHA 3GDUA 4K60A 4RSPA 1BHXF 3SHAH 2ZWLH 3FANA 4DT7B 3A82A 3IWMA 3A7YA 4MG3A 1OYTH 3U1JB 3SU6A 1E38B 1XUIA 8LPRA 1O3OA 3TH3H 2Y6TA 1AB9B 3UPEA 1CA0C 3RM2H 1TMUH 3SU1A 1O39A 1MQ5A 1T8MA 1YCPM 2J94A 5F8TA 5DP8A 1GBCA 1D6WA 1EUFA 1K1OA 1LHEH 4Y7AA 1TA2A 2V3OH 3ZYEA 1Q3XA 5FX5A 3UIRA 2C90B 1YCPK 3LH1A 2VJ1A 3I77A 3M3SA 1HV7A 2ZDKA 2O8UA 1Z8IB 3QUMP 2BB4A 1B5GH 1XX9A 1Z8RA 1CBWB 4IS5A 4WJG2 3VGCB 3S7HB 1GHBG 1AMHA 1BTPA 3LU9B 1GHBF 2LNCA 2ZHFH 1IQFA 3MFJA 2YNBA 3BTKE 1F5RA 1QA0A 2OTVA