5T6FA

1.90 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (orthorhombic p form)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
165
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
total genus 38
structure length 165
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA01
1VCWA 2A45B 5EODA 4B2BA 1E35B 2FS8A 3TNTA 1UHBB 1TBZH 2QN5T 5AHGH 4FUDA 1ABJH 2PTNA 2HLCA 2OINA 4FUIA 1E36B 3SGAE 4ZH8A 3VPKA 3F1SB 2BD7A 3UY9A 1EAIA 2XWBI 2AFQB 1O2JA 1Z71A 4ABHA 2ANKH 2ZFQH 1TWXB 2XCNA 1A61H 4UFFH 1QJ7B 2WYJA 2BHGA 1MZDA 3BTEE 2G5VA 3S7KB 1QL7A 4GCHF 1S84A 3MU0A 4YO9A 4GHQA 2QIQA 1YPJH 5EQSA 1NRNH 1O3HA 1ZZZA 3B23B 4ASHA 1NESE 3RXDA 1V2MT 1ZYOA 2M5TA 2BLQA 1BHXF 1P3CA 1F2SE 5A8YA 2GT7A 4X6MA 1GJBB 3VXFH 2YOLA 1KDQB 3IITA 3M36A 2DUCA 1UTPA 2B8OH 1MU6B 2EEKA 4WVPE 4I8GA 2GCHG 3ATMA 4X6OA 2ZCLP 3V3MA 1C1TA 2Z9IA 2HGTH 2OC1A 2FMJA 7LPRA 1P2JA 1ZTLA 1NPMA 1O38A 5H4IB 1GBCA 4DG4A 1FY4A 1NN6A 1QB9A 4ZROA 5JB9S 4Y11E 3QK1A 3DUXH 4MDSA 3DFLA 2CF8H 1PPEE 4O3UA 1XKAC 5B6OA 3HPTB 3M37A 5C5OA 1MKWH 2EI6A 1EUFA 1HAOH 2BY7X 5DK1A 4ABEA 1UHBA 4U01A 3SJOA 1TONA 3TJNA 2Z94A 1UTLM 1K28D 1O30A 1ZRKA 2VH0A 3VGCC 1HAYB 3U1IB 1TX8A 1YM0A 4CR9A 1N6XA 2J95A 4TWYA 1OWIA 2FEQH 1O3DA 1DOJA 3A7VA 1HJ8A 3CS0A 1E38B 1C5TA 2F9UA 1GBBA 3M3SA 4R0IA 1TX7A 1UTOA 1C1PA 1T32A 1SG8B 3A7TA 4IGDA 5GDSH 1ZSKA 1Z1IA 3CS7A 2O8LA 2FTLE 4U2WA 2RA0A 3RXPA 1SB1H 3GOVB 1Y5AT 1TNLA 1GBLA 2C8ZB 3DHKH 4LXBH 1DFPA 3E6PH 4NIXA 5GIBA 1SQOA 3K6ZA 1LVMA 1YKTA 1T4UH 2P3UB 4ABDA 1F0SA 2R9PA 1BJUA 3A89A 4XSKU 4J1YA 2GTBA 5EOKA 4WMDA 1JRTA 1GJ8B 1V2JT 1H1BA 3PYHA 2ZNKH 1Y3YA 1GVZA 1SGIB 1BTXA 1GWAA 2HNTC 3RXVA 1A1RA 1HAVB 1SLXB 3A84A 1V2QT 2HRVA 7GCHG 3BTHE 1CHOG 3MH4A 2K1QA 4XBCA 3O8RA 2H9EH 3SU0A 5EPNA 1L2EA 1SHHB 4FUEA 3BTKE 1RTLA 1KYNA 1P01A 1ZMLA 3BIVH 2ZTXA 3PMAB 5A0BA 1OXGA 3SN8A 2H5CA 5AFYH 6CHAC 3SU1A 2QXGA 1TALA 2AS9A 1N8OC 2WYGA 1LDTT 5EU8A 2EA3A 1S0QA 3D23A 1SGDE 3VXEH 2Z3CA 1BRBE 1D3DB 3GCNA 1IOEA 1MAYA 4BXWA 1PPCE 5FXLA 4OS5A 2PFEA 1ORFA 2BX3A 1GHZA 2VIPA 1G3BA 3S69A 1T7CA 1K9OE 1HBTH 4NSVA 4FVDA 2C8YB 2FLBH 1YPGH 1SSXA 1BTPA 1EAWA 1RXPA 1IQLA 1TBQH 1TNHA 3A85A 3RC4A 1AU8A 1AWFH 1ETRH 1CA0B 1O2XA 4FU8A 5J4QA 2ALPA 5FBIA 3ATKA 1MH0A 3KNXA 1X7AC 1P2MA 6LPRA 5JB8S 1KIGH 1BTYA 2BD8A 1S6FA 3ZV9A 1ELGA 1P2KA 1HAVA 3KQDA 1GI0A 2GKVE 1P2IA 3ZVFA 3H7TA 1YPEH 2ZKSA 2I6SA 1K22H 3PROA 1CGJE 4Q7YA 5TJXA 3RC5A 4CRAA 2BOHB 1FY3A 1FXYA 4OGYA 3GDSA 5C1UA 1T8LA 1IQJA 1GBKA 3RXFA 1P09A 2H6MA 1LHDH 1ZPCA 1EZXC 1TA6A 1O2TA 2GMTC 4RSPA 1ZLRA 2FYRA 3P8NA 5F03A 3M5MA 1C2IA 2A0QB 3E16B 3MMGA 4B73A 3RXKA 1BTHH 1DSTA 2A5IA 1MTNB 1DE7H 1Y8TA 2BLVA 3NUMA 2BMGB 3ZVDA 1FN6A 1GPZA 2V3OH 3GCOA 3DD2H 7KMEH 1BRCE 2FX4A 2CN0H 4K8YA 1KXAA 2AMQA 1JIMA 1GCTC 2A2QH 2A4GA 1D3TB 2QXHA 1TOMH 1AY6H 2BD4A 2FOHA 3SJ9A 1CGHA 3PB1E 1NC6A 3TJOA 1WAYB 3VB4A 1C4U2 4GPGA 1GVKB 1T8NA 1VR1H 4UEHH 1FAXA 1TGNA 2VIWA 4UFEH 3M35A 3O8DA 5EW2H 2WV5A 4AB8A 4ZHMU 1TE0A 3OY6U 4QT8C 1Y3UA 2Z6BD 1DWEH 1QL9A 2SGQE 1HAZB 1Q2WA 4BAHB 4CREA 2EI7A 5JBBS 4X2XA 1SGYE 2FTMA 1L1GA 3MNXA 2PKSB 4UDWH 1ZR0A 4IMQA 1YP9A 4ABIA 3BIUH 2PUQH 4OGXA 1QJ1B 1TGSZ 3FP8E 1EP5A 3M3TA 3SU2A 4Y0YE 4H42U 1PQ8A 3F9EA 1CBWC 2J92A 2ZHQH 1M9UA 1GBHA 2ZDKA 1LCYA 2ZP0H 1GMCF 4WF8A 1C4V2 1Z1JA 1GHBG 1ELVA 3TH2H 1F0RA 4OS2A 4BTIB 3MO3A 1AMHA 1PQ7A 4WWYA 1EAUA 5EW1H 3HKIB 5FHTA 1OOKB 3UWIA 1HJ9A 4MNWA 2WPKS 3G01A 1L4DA 2QCYA 2CF9H 4ZHAA 4WJG2 3BTDE 2VIVA 2SGEE 3BN9A 4X8TH 3PWBA 2QC2A 3MU5A 3L33A 3Q00A 2BXTH 2GV6A 1PJPA 1THRH 3F9GA 3MNSA 1GHAG 3SNBA 3QLPH 1BRUP 2BDAA 3M3VA 1A0JA 3U8TH 1P04A 2OQ5A 2GDDA 5HGGA 3PTNA 3S9CA 2QF3A 3UIRA 1EZSC 4K69A 3ZZ4A 1LPGB 1C5ZB 1JRSA 1W8BH 1V3XA 3BEIB 1T8OA 2TGPZ 4UE7H 2PHBA 1H4WA 1SQTA 1VITG 2BD9A 1C5YB 1ZMNA 5K7RA 4GLYA 2AMPA 4VGCB 3E3TA 3A7ZA 4RKOB 1A46H 4Y6DA 2GCHF 3FAOA 1O3PB 3RXCA 1GG6B 1ZMJA 2QXJA 3PLKA 2ZQ2A 1GI3A 1GHWH 1OWDA 1P0SH 2FXRA 5CHAC 2BY8X 2AYWA 4I32A 2A32A 1AB9B 3KCGH 1HAXB 2UUJB 3OSYA 4ZMAH 4FU7A 4I8JA 3OY5U 1EASA 1H8IH 3MO6A 2UUKB 3GCHB 3HKJB 3URDA 4DOQA 1JOUB 4I8LA 2ZFPH 1O5BB 2GCTC 2ZCHP 3MFJA 1C4Y2 2ULLA 1CQQA 3CP7A 5LPFA 1F0TA 1V2LT 2DE9A 2R2WU 4IS5A 1UVSH 3E0PB 4BAMB 2ZGCA 1ESTA 2HALA 4J2YB 5C1YA 2ZGBH 1Z8GA 4GHTA 4I8HA 1AFQB 3UNQA 3MU8A 3EE0B 2FI3E 4NFEA 4RKJB 2OC8A 1B0FA 1GCDA 3ZZ6A 1F92A 3UTUH 3STJA 2TGAA 3BTQE 1H9LB 5AFZH 3PTBA 1UCYK 3GDUA 2J9NA 2VWNA 2XCFA 1GBEA 1B0EA 1SGTA 2ZGHA 4UONA 4CBOA 1RGQA 3GCTG 1AVGH 1C1UH 1QURH 1IQGA 1QRXA 2D1JA 1A5HA 1AI8H 4DURA 4FUJA 1QY6A 2ZU5A 4IC5A 2EI8A 2THFB 3EDXB 4Y7AA 1PQAA 1QFKH 3LU9B 3LC5A 3EA7A 4NIYA 1C2LA 4I33A 4AG2A 2C90B 1GJ6A 1IHSH 1V2PT 3T28A 1CT4E 1GI2A 3F68H 4F49A 3S9BA 1A0LA 5JBTA 1F5KU 4AG1A 1C5XB 3ATWA 1AZZA 3FZZA 1O5EH 3ZZCA 4TPIZ 4NZLA 2W7SA 2H5DA 4AX9H 3RDZA 4AN7A 1K2I1 3RP2A 3SJKA 2HPPH 1SLVB 1BTWA 7GCHF 3VB3A 1GBFA 1CHOF 4Y79A 3GISB 4I7YH 1DY9A 1L1NA 1HPGA 1NFYA 4BAQB 1DICA 1FI8A 3F6UH 4JZFH 3FFGA 5DP7A 3R3GB 2NU0E 5E8EH 3SZNA 1ELCA 1J9CH 5HYOA 3GDVA 1ZRBA 1O5AB 2ZU1A 2A4QA 2W7UA 1RJXB 1O5CB 1HIAB 4X6PA 2UWPA 1QCPA 1O2QA 3UPEA 4TY6A 1UVOA 2LPRA 3EGKH 2UWLA 1UJ1A 4ZAEA 5BPEA 1V2WT 2GVFA 4X1QU 1A3EH 1ELBA 1TPAE 3RMLH 1EOJA 5LPRA 3SV9A 4Q7XA 1SL3A 2FOBA 1NO9H 2NU3E 4ZKSU 3H7OA 1J17T 2BTCE 2AGIX 2FESH 1PYTC 1ELDE 1Z6EA 2A7JA 2VB0A 1A0HB 2ZI2H 2ZDLA 1WCZA 3LGTA 2BDBA 1C2MA 2BM2A 3AW1A 5FCRA 5E0HA 2OD3B 2PR3A 3RXUA 1HV7A 2FOMB 3KQEA 1ANBA 1C5SA 3ZZ9A 4ZKRU 4GAWA 3ZZBA 3D65E 2BY5X 1H8DH 3I77A 1S82A 3RLWH 1MTUA 5FX6A 1J8AA 2UWOA 1G37A 1O3KA 2P16A 4Y76A 8ESTE 1GMDG 1Z8IB 1UO6A 3SOSA 4B2CA 1H9HE 5A0AE 1OP8A 4FUCA 4Y10E 1TIOA 1XM1A 1D3PB 1TRYA 1W12U 2VWLA 3GY8A 2J2UA 4Y71A 3OYPA 1C1OA 1NFUA 3RXHA 3N7OA 1EOLA 5TCCA 1GMHG 1UTKA 1XUIA 2ODQA 4TWWA 1RFNA 1W14U 1A2CH 1QQUA 3QO6A 1UCYE 4AYVB 4HI3A 3AW0A 2CMYA 1ZPBA 1GI1A 2J4IA 3VGCB 1HRTH 1NRPH 3BTWE 1DUAA 1P12E 2O8MA 2A5AA 1GDQA 4X1PU 2J34A 3A8BA 5LPEA 3L6PA 2SNVA 4AYYB 4MPWA 1MU8B 1AKSB 1O2UA 3TPIZ 1BMNH 3QZQA 1HIAA 5DG6A 1O2GH 1YF4A 2G5NA 1WQSA 4K60A 4DIIH 1O3JA 2AH4X 2HOBA 2WPMS 3UFAA 1GBMA 3VEQB 1AWHB 1WTHD 1BHXB 2JH0D 1DT2A 1Q3XA 2TRMA 1AZ8A 2PKAB 1FPCH 5C67A 1WUNH 4NFFA 4NGAH 1G3EA 1OPHB 3EAJA 1PYTD 1LQDB 2NU1E 2YNAA 4K1TA 3ZZDA 5A09A 4NG9H 1Z7KA 1J15A 5FX5A 4MNVA 2H2ZA 1LPZB 1NT1A 1SFIA 2A7CA 1XMNB 3W95A 2F9OA 3KIDU 2TIOA 3KEEA 1P06A 1LHEH 1UTMA 4XBDA 1EJAA 2IN2A 3A7WA 3E0NB 1ZJDA 1MZAA 1TABE 1XUJA 2O9QA 4WMFA 3V12A 3A83A 3RXOA 4JZ1A 2XC5A 1C1NA 3A81A 2SGFE 2V0BA 5HXFA 1BB0B 1G2LA 2FX6A 4BTUB 4BTTB 3NK8A 8GCHG 2QXIA 4Q7ZA 1T4VH 4HGCA 1HLTH 1OP2A 5C1XA 1W0ZU 2G00A 5K0HA 1FDPA 3NXPA 4FUHA 1QRWA 3V0XA 2SGPE 4WMEA 1GHBF 3M5NA 2PSYA 4LZ4B 1ID5H 3GYLB 2ILNA 1ANDA 1QNJA 1SLUB 3EA9A 3M7QA 6CHAB 1ZJKA 3PMJA 3ENSB 1DWCH 1N8OB 4K1EA 1K1LA 2Y7XA 2VWOA 3U69H 3ATIA 1W2KH 4LK4A 1K1IA 3P8GA 1K21H 2ZDAH 2BZAA 4MLFB 2XC4A 4AORA 4X1RU 1S6HA 1K1NA 2F91A 2ZZUH 1AKSA 3BTME 1E37B 1V2OT 1DLEA 2Z9GA 1EX3A 1BTZA 3LJOA 3O8BA 3EA8A 3ZVGA 2IJOB 1EXFA 5HM2A 3SUEA 2PKAA 1Y5BT 3QGNB 3SI3H 2EC9H 5A8XA 1MKXK 2V3HH 1O2WA 4AFQA 2CHAC 1TNKA 2FOGA 3KHVA 1SOZA 4NA8A 1S5SA 1TLDA 2J38A 3W94A 3ZZ3A 5E2PA 3QN7A 1O3BA 2Y5FA 1O3AA 1UVTH 2BD2A 3RUOA 1THPB 1VITF 1NRRH 1NROH 3BEFB 1RIWC 2Q6GA 1TGTA 3BTFE 2P59A 3ZV8A 4NA7A 4NIVA 2VIQA 2BDCA 3UR6A 1TQ7B 6GCHG 1OX1A 1DPOA 1S81A 1BUIA 1AE8H 1HNEE 2F9NA 1SBWA 1OWJA 1W13U 2QV1A 5ESBA 1D6RA 1MQ5A 3IWMA 1EPTC 5DP9A 1HXFH 4XE4A 4MG3A 3MTYA 3BSQA 3UQOA 1PPFE 2QGRA 4K5ZA 1Z6JH 2PSXA 3RXRA 3T27A 3KL6A 4TYDA 1G30B 3RXEA 1AIXH 2GMTB 2XBYA 1L0ZA 1THSH 5ETXA 1GJ5H 2PUXB 3T26A 1T8MA 4K8BA 5A0CA 3TJVA 1TA2A 1UK2A 1ANCA 2HVXA 4WH8A 1E34B 4XBBA 3AASA 5DP6A 1O37A 1P57B 1TRMA 3M61U 4IN1A 5EPYA 2Z9KA 3HK3B 4Z6AH 1GCTB 4CHAC 5LH8A 4GVUA 4KKDA 1FIZA 2ZFFH 3GCTF 1SGPE 3GY7A 2Z9LA 3QZRA 5EQRA 3UNRA 4FXGH 1O2VA 1GHVH 2AERH 1FIWA 3BEUA 3T29A 1BJVA 3QUMP 1ELFA 4AFZA 4UD9H 4R8TB 1ZGIA 4FVBA 3EYDA 1V2VT 3QTVH 4JCNA 1C1SA 1C1RA 2BQ7B 4GUXA 1MD8A 1DSUA 5GXPA 1W10U 2XXLA 1EJNA 1EP6A 1EQ9A 2FOAA 1G32B 2STAE 1YPHE 3LONA 1EJMA 3VB7A 1GBIA 2BOKA 4BXSA 1XXFA 1C5QA 1XVOA 1YCPK 1LTOA 2AIQA 2WUCA 1WOFA 1CBWB 1C1VH 3RMOH 1NU9A 1O2PA 2ZO3H 4DIHH 4IBLH 2G52A 1TX6A 3GY3A 2FOEA 4I31A 1ABIH 1C9PA 5GCHG 5FCKA 1KY9A 4TY7A 5L2ZH 1TOCB 5LGOA 1FY1A 1DXWA 2GP9B 1QJ6B 3BF6H 1UVPA 3A7YA 2UUFB 1YC0A 1FV9A 3LOXA 1TNJA 1O0DH 5DP8A 3RC6A 3BTGE 1TFXA 4THNH 1P2QA 1XX9A 1QHRB 1MQ6A 1GI8B 3UR9A 2CGAA 3JZ1B 3RXJA 1SR5C 2WINI 1A3BH 3MH7A 4X0WU 1HAIH 2Y6TA 2ZU3A 3TIUA 2B0FA 5C20A 1AN1E 2IPHA 4JK5A 2IOTA 3A88A 1YPKH 3KF2A 1KLIH 3URCA 2ESTE 3KQBA 4Q80A 2B7DH 1Y3VA 2FLRH 3SU3A 2GX4A 1WTGH 3FVFB 1WQVH 1DM4B 1SGEE 2O8TA 3Q3KA 2ZFSA 2VVVA 2BDGA 2FOCA 1LMWB 1RS0A 1WBGB 1QBOA 2ZQ1A 5EXLA 2RA3A 1G3DA 2PV9B 5EXNA 1QQ4A 2H9HA 4AGJA 1ANEA 3U98H 4DVAU 2P95A 5GWZA 2ZPQA 3MNCA 1GHYH 4ISIH 3SNDA 2GZ8A 1GVLA 3I29A 3BG4C 1HJAC 3STIA 2H9TH 2ZHEH 1HUTH 1PPHE 3RXQA 2FYQA 1LKBA 1O2IA 5EQQA 5CHAB 4CRFA 4O3TA 1ZSLA 3OU0A 3TK5A 4OS1A 2BD5A 1ZPZA 3VB6A 1KXBA 1C2GA 2ZF0H 4B71A 1WU1A 1SMFE 1GMHF 1KXEA 1Y59T 2ODPA 2SNWA 1O3NA 1ZTKA 2GCTB 5EXMA 3ODFA 1BBRK 1TPPA 3ATLA 1Y5UT 3KGPA 4YTAA 3SGQE 1GBJA 1QA7A 1W7XH 3LGIA 3E8LA 3SI4H 4Z0KA 4WH6A 3RU4E 2QF0A 2JETC 2Z9JA 4BAOB 1LPKB 2Y81A 1QA0A 2OUAA 4KP0A 1DDJA 1E0FD 3Q76A 2BY9X 3T62A 2BVSH 2FIRH 4OS7A 3GY6A 1TRNA 3U1JB 2FI5E 3IG6B 1D9IA 4ZKNU 1FONA 1U6QA 4H4FA 2GZ7A 4HZHA 3U8OH 5FBEA 4B1TA 3MH6A 3PWCA 1BTUA 1FMGA 1GBAA 2TPIZ 2FS9A 4XDEA 5JYIA 2ZA5A 1ZHRA 3SNCA 2VGCC 1AVXA 2P8OC 5A2MH 4O9VA 1K1JA 2P3TB 4ISOA 2AGEX 1GBTA 3F9FA 4LOYH 1V2RT 2BYAX 3D62A 3ZVEA 2VVUA 3S7HB 4A5TS 1FUJA 3TK6A 1HGTH 3SO3A 3ZZ8A 1A4WH 1TPOA 3E1XB 1P02A 1NTPA 4KTUA 1OS8A 4YOJA 2NU2E 6ESTA 5J4SA 2OQUA 1IAUA 2AGGX 2ZGXH 3ZVCA 3RMNH 4X1NU 1OWHA 3MI4A 3MU4A 1DUEA 4ZUHA 2VVCA 1GI6A 2ZFRH 1C5VA 3M5LA 4E05H 2ODYB 2GV7A 4NSYA 1OP0A 5IYTA 1GJCB 2FDAA 3OX7U 1MCVA 2KAIA 3JZ2B 3SQHE 3TK9A 1O2ZA 4YM9A 3B8JA 1P9SA 2FO9A 1SGCA 1GI4A 3TLOA 1GI9B 4JZDH 5BRRE 2ZGJA 1GJ9B 1C2FA 3UQVA 1NM6A 1VJAU 3TGJE 3SV7A 2BY6X 1ELAA 4FUGA 1LHCH 3SORA 2BQ6B 2DE8A 1ZHMA 2XYAA 3A7XA 1LVOA 4KTSA 2G55A 2CXVA 4BAKB 2ANYA 3RXGA 1CVWH 1UK4A 5DP5A 4OS6A 3UUZA 2R2MB 4MNXA 2A4RA 1SVPA 1SGRE 2BD3A 4WY3A 2FI4E 1A7SA 1DITH 2ZHWH 4INHA 1C1MA 1C2DA 1P05A 2C4FH 3MU1A 3TU7H 1FY5A 4AZ2B 3KN2A 2FP7B 1AQ7A 2W3IA 4E06H 1IQHA 2BX4A 2XC0A 1RD3B 2BQWB 1YPLH 1YGCH 2FOFA 1O2SA 2Y5HA 6GCHF 4AGKA 1IQFA 1BBRE 1P10A 3PO1C 1BQYA 1GL1A 1UCYH 2ZDMA 4X1SU 3K65B 2QYIA 1YLCA 2PWXA 1O3OA 4YZUA 1BZXE 1C2EA 1EB1H 3A8DA 1O32A 2VU8E 3MNBA 2SGAA 3PMBB 1N6YA 1Y3XA 3NKKA 4YLQH 2P94A 2F9VA 3M5OA 3RXBA 1O3CA 4A1TA 2F9PA 1MTSA 2B9LA 3P8OA 5E2OA 1NFXA 2JH5D 4B2AA 1OWKA 3LGYA 1IHTH 2O8WA 2PW8H 1TQ0B 4WXVA 5F6MA 1NU7B 1XUHA 1P2OA 2Q6DA 4Y8ZA 1NRQH 4A1XA 2OP9A 2RCEA 3RMMH 1OYTH 1GMCG 4ABJA 4WXIA 3MOCA 4D9QA 5C3NA 1BDAA 1INCA 2ZU2A 1HYLA 1ARBA 1MKWK 4A7IB 1O39A 3ZZ7A 1S0RA 3RXSA 1MCTA 1WSSH 2LNCA 4UFDH 3V13A 3SHAH 1V2NT 1EATA 2C8WB 3A80A 3PV4A 3RU4T 3T25A 1LO6A 2VH6A 5F8XA 3SGBE 1UVUH 1NRSH 4YOGA 3DT0H 4H6SB 2H1UA 1BOQA 2GD4B 1FAKH 1P9UA 4I8KA 1V2TT 1KXCA 5FPSA 1SGFA 2F9BH 1OSSA 4B74A 3ZVBA 1PQ5A 1TGBA 4MQAA 1LHGH 4A92A 4Y8XA 3LH1A 1UK3A 3TVJB 1P11E 4XOJA 1GJDB 3ZZAA 3SV8A 2FZZA 2G4UA 9LPRA 4ISLA 2OBQA 1CHGA 4CR5A 1ARCA 1XVMA 1J14A 3SU5A 1ELEE 5GCHF 1O3FA 2BLWA 3GY2A 2YNBA 1C5UA 3PLBA 1CT2E 1YCPM 4E7NA 1BMMH 4JMYA 1G9IE 2OC0A 3MO9A 2CJIA 3P8FA 3LKWA 3DA9B 4U32A 2A1DB 1ZGVA 4DGJA 1KXDA 2ZC9H 1Y3WA 1HDTH 1UTQA 5IDKA 5I25A 4CRBA 2C3SA 2GDEH 2HWLB 2WPHS 4JYTA 1FY8E 1YPHC 1F0UA 5DGJA 3P95A 5DP4A 3LH3A 5CE1A 1DXPA 1W7GH 5EG4A 1O2OA 1UTJA 5TCAA 1Z8RA 1C5OH 5GPIB 1YYY1 1C5NH 4AFSA 2HNTF 3EQ0H 1TB6H 2CHAB 1C5LH 3SUFA 1F5RA 2D8WA 3A8CA 3E90B 4YT7H 2FODA 2ZTZA 1BIOA 3BTTE 3QWCH 2NU4E 2QA9E 2F3CE 2Z7FE 1IQMA 2V6NA 3QTOH 3QDZB 1RIWB 2FM2A 1VGCB 1DWDH 2ZIQH 3E91A 3A86A 1GHXH 1PPGE 2VJ1A 4ISHH 4Y8YA 5AF9H 1OKXA 5JPMH 2G8TA 5FAHA 1BA8B 5DJ7A 3RM0H 1BMLA 4CRCA 3U8RH 5E0JA 1TBRH 4JZIA 3SNEA 1EPTB 1TGCA 5DO4H 1QBVH 4CBNA 1C2HA 1GDNA 3SV2H 1A5IA 1MTWA 2ZTYA 3ZVAA 2PTCE 1GHAF 2D26C 2OC7A 2FWWA 3FP6E 1HAGE 1OWEA 2Q1JA 3LJJA 4ABBA 1DANH 1KDQA 1TAWA 3SU6A 1L1JA 3TJUA 1A5GH 4X2VA 1IQNA 3AVZA 3MH5A 1MUEB 1VCPA 2XWAA 1GI5A 1HCGA 3LIWA 2O8UA 1NZQH 3TGIE 1VGCC 1DY8A 4CHAB 3U9AH 4NZQA 1S85A 2BDYA 3ZZ5A 1SGFG 7ESTE 1XUGA 2VIOA 1JIRA 2VINA 4BNRA 1DS2E 4F4OC 4JYUH 2A2XH 1O2NA 5I46H 5C2ZA 3R0FA 1N1LA 2WPLS 2ASUB 3LPRA 5T6GA 3GY5A 2UUYA 1QL8A 4O97A 4NWKA 3UWJH 2WV4A 3K9XB 1SC8U 3C1KA 4NIWA 3LGWA 1VCQA 1MMJN 1TMBH 1TPSA 5GJ4B 2R0KA 4YLUA 5T3HA 1KSNA 1NFWA 4K1SA 1HB0B 1YBWA 3D49H 1CA8B 3B9FH 1O2RA 1SLWB 4DJZB 1O36A 2CV3A 2ZDNA 1FJSA 1EB2A 1P3EA 2Y80A 5L6NH 4H6TA 2TGDA 2P3FH 1O35A 5EGMA 4JK6A 1JMOH 3SJ8A 1FZZA 5HMAA 3RXIA 1C1QA 5ABWA 1EPTA 3TGKE 1O5DH 1IQKA 1ESBA 2XRCA 4KELA 1MBQA 2J94A 1RTKA 1EAXA 1O3EA 1C1WH 1W11U 3ZYEA 1TMUH 1O2HA 2ANMH 1PPZA 1MKXH 2Y82A 1KLJH 4DW2U 3QGJA 2BDIA 2TBSA 4CRGA 1IQEA 1YLDA 2RG3A 3PLPA 3RXMA 1AHTH 1VJ9U 1RRKA 2FPZA 3A82A 4X8VH 1TNIA 3S0NA 4D9RA 4AOQA 3I78A 4D8NA 1XKBC 3NWUA 1SGNE 2ZFTA 2BXUH 4YESB 4GSOA 1V2UT 3SUGA 1TNGA 2PGQB 2OXSA 1ELTA 4KGAA 4U30A 4ABAA 1QBNA 1ESAA 2Y5GA 3T2NA 3TNSA 1KXFA 4X2WA 4GCHG 1W3CA 1D3QB 1O34A 1O3GA 4NWLA 4X2YA 1O2MA 3FZDA 5JDUB 2WUBA 1JXPA 5L2YH 3V7TA 1SFQB 3P92A 3RLYH 1T31A 4X8SH 1ZSJA 3SQEE 2QAAA 2BZ6H 1FN8A 2BB4A 2OCVB 4B76A 2AMDA 3LDXH 3BG4B 1HJAB 2NWNA 1O3IA 1FPHH 1QIXB 3RU4D 3A87A 1O5FH 3FANA 4MPUA 1CA0C 1TMTH 2C93B 1CSOE 3H5CB 1H9IE 1BCUH 1QTFA 4PROA 1G36A 2ZPSA 3K6YA 4DT7B 1LHFH 3FP7E 4X6NA 3AAVA 4K2YA 1J16A 1BMAA 2VWMA 3S9AA 1MD7A 3QX5H 4B75A 1GGDB 3LGVA 2Z3EA 1EZUC 3RXTA 1LVBA 2ANWA 2A4OA 4SGBE 4IN2A 3P70B 3ELAH 1C5RA 1O33A 1HAHH 1GJAB 1O2YA 3P6ZB 1WYKA 2A5KA 1MAXA 3Q77A 2JETB 2VNTA 2STBE 1WV7H 4DCDA 3WY8A 1FNIA 1GDUA 4A1VA 3M7TA 4INLA 4CRDA 4X8UH 4MVNA 4E7RG 1HAPH 3PMHB 3RXLA 2G81E 4AB9A 1EZQA 1QGFA 4M7GA 2ZECA 1RTFB 2HPQH 1XUKA 1MTNC 2HNTE 5C5NA 5JBAS 1YCPH 3TITA 4FUFA 2ALVA 1KTSB 1VITH 4CH8B 1GMDF 2Y7ZA 1P2NA 2R3UA 2QY0B 2SGDE 2VIDA 1KTTB 3SUDA 3F9HA 4YT6H 2VGCB 4OS4A 2P8OB 1QRZA 2I6QA 1GJ7B 3NCLA 3UOUA 1O2LA 1UTNA 2ZU4A 4DY7B 5T6FA 3O8CA 3PM3A 2JKHA 1GGDC 4ESTE 1GBDA 2W5EA 1ZOMA 3GY4A 3GICB 2KAIB 4JZEH 3TH3H 4LZ1H 4O03A 1DLKB 4IC6A 2BLOA 8KME2 1QB1A 1LKAA 1C2KA 5G4BA 3SHCH 4ZKOU 4MPXA 4INKA 2PKSC 4IMZA 1C5MD 1XUFA 1B7XB 1SGQE 1VZQH 9ESTA 1LVYA 1QR3E 4ISNA 2ZCKP 2XBXA 2ZEBA 4Y0ZE 4CH2B 3A8AA 2BVXH 4D76A 1QB6A 2W26A 1JBUH 1K1OA 3SJIA 5F8ZA 4ABGA 1C5WB 3RXAA 1O2KA 2AIPA 1HFDA 1D6WA 1K1PA 2AEIH 3TH4H 3ODDA 3Q3YA 2ZHDA 1SQAA 5DPAA 3MWIU 1MBMA 2BVRH 1Q31A 5PTPA 1O31A 2R0LA 1SPJA 3LT3A 1O3LA 2GGVB 4YOIA 1AVWA 5A8ZA 1ACBE 4MPVA 3K2UA 5FPTA 1AFEH 4ZXXH 4MNYA 1BRAA 5T6DA 2XTTB 1G3CA 2WPIS 2Q6FA 5SGAE 1KLTA 1SHYA 5HM9A 1SI5H 8GCHF 2GZ9A 4Q2KA 1EKBB 4MTBA 5DP3A 4D7GA 2PLXA 1V2ST 1F5LA 3P17H 3VFEA 2D2DA 1CE5A 1V6DA 3RM2H 1ETTH 1OYQA 1CT0E 4NCYA 2G4TA 1BBRH 3GYMA 1XXDA 1C9TA 3CENA 2F83A 1AUJA 1YPMH 2OLGA 5FPYA 2ZPRA 1B5GH 1AE5A 1LQEA 2SFAA 2PGBB 4ZHLU 3M7UA 3PO1B 4IW4E 1CO7E 2XBWA 1HXEH 1ZHPA 3ESTA 1DX5M 4VGCC 3UOPA 1CGIE 3NPSA 1PPBH 1FQ3A 1NY22 3VB5A 5CMXH 1GG6C 1K1MA 5ESTE 4SGAE 1UMAH 1F7ZA 8LPRA 4KTCA 1AB9C 4ABFA 2A31A 1NS3A 1AUTC 2OTVA 2GT8A 3BG8A 1O3MA 4Y7BA 5DKMA 3UREA 1CU1A 1TYNA 3LGUA 3GCHC 3HGNA 3SNAA 3KQCA 1P8VC 2W3KA 1PFXC 3HATH 1C2JA 3SV6A 4K3JA 4AFUA 2G51A 2JH6D 3SW2B 1IQIA 1AFQC 4FU9A 1BITA 1GI7B 3SU4A 3L3TA 2P93A 3UNSA 1C5PA 2RDLA 3C27B 1BT7A 2WPJS 3MHWU 1MTVA 4ZXYH 3AAUA 3ITIA 3DFJA 2B5TB 1V2KT 1ETSH 2ZDVH 3HK6B 1GJ4H 2OBOA 2BDHA 1W0YH 2TGTA 1AGJA 3HGPA 4BOHA 1DWBH 4TPYA 1FLEE 5E0GA 3T5FH 4UFGH 3LC3A 1P03A 2C8XB 2Z3DA 1O5GH 5F8TA 2XBVA 4JYVH 4FUBA 4A6LA 1SOTA 2V35A 4HFPB 1G2MA 3MYWA 4D7FA 1JWTA 5JBCS 1AD8H 2XNIA 2ZG0H 3NZIA 5AVDA 1Z8JB 3ZYDA 4RN6A 3SBKA 3OTJE 4HTCH 1D4PB 1GL0E 1ZTJA 1DVAH 5L30H 2A7HA 4BANB 2XW9A 1L4ZA 2R3YA 1AO5A 3BV9B 2ZHFH 2ZWLH 4XFQA 4NA9H 1S83A 3Q3XA
chains in the Genus database with same CATH superfamily
1VCWA 2A45B 5EODA 4B2BA 1E35B 2FS8A 3TNTA 1UHBB 1TBZH 2QN5T 5AHGH 4FUDA 1ABJH 2PTNA 2HLCA 2OINA 2WZQA 4FUIA 1E36B 3SGAE 4ZH8A 3VPKA 3F1SB 2BD7A 3UY9A 1EAIA 2XWBI 2AFQB 1O2JA 2WPDD 1Z71A 4ABHA 2ANKH 1BMFD 2ZFQH 1TWXB 2XCNA 1A61H 4UFFH 1QJ7B 1WXRA 2WYJA 2BHGA 1MZDA 3BTEE 5DSFA 2IJD1 2G5VA 3S7KB 2EY4C 1QL7A 4GCHF 1S84A 2V3MA 3MU0A 4YO9A 4GHQA 2QF4A 2QIQA 1YPJH 5EQSA 1NRNH 1O3HA 1ZZZA 3B23B 4ASHA 1NESE 3RXDA 1V2MT 1ZYOA 2M5TA 2BLQA 1BHXF 1P3CA 1F2SE 5A8YA 2GT7A 4X6MA 1GJBB 3VXFH 2YOLA 1KDQB 2IPQX 3IITA 4ZCNA 3M36A 2DUCA 5KECA 1UTPA 5KEDA 2B8OH 1MU6B 2EEKA 4WVPE 4I8GA 2GCHG 3ATMA 4X6OA 2ZCLP 3V3MA 1C1TA 2Z9IA 2HGTH 2OC1A 2FMJA 7LPRA 1P2JA 1ZTLA 1NPMA 1O38A 5H4IB 1GBCA 4DG4A 1FY4A 1NN6A 1QB9A 4ZROA 5JB9S 3EE7A 3GS9A 4Y11E 3QK1A 3DCLA 3DUXH 4MDSA 2JJ1D 3DFLA 2CF8H 1PPEE 4O3UA 1XKAC 5B6OA 3HPTB 3M37A 5C5OA 1MKWH 2EI6A 1EUFA 1HAOH 2BY7X 5DK1A 4ABEA 1UHBA 4U01A 3SJOA 1TONA 3TJNA 2Z94A 2KCOA 1UTLM 1K28D 1O30A 1ZRKA 2VH0A 2JJ2D 3VGCC 1HAYB 3U1IB 1TX8A 1YM0A 5F53A 4CR9A 1N6XA 2J95A 4TWYA 1OWIA 2FEQH 5EJZA 1O3DA 1DOJA 3A7VA 1HJ8A 3CS0A 2L74A 1E38B 1C5TA 3FKSD 2F9UA 1GBBA 3M3SA 2KZ4A 1TX7A 4R0IA 1UTOA 1W0KD 1C1PA 1T32A 2QE7D 1SG8B 3A7TA 4IGDA 5GDSH 1ZSKA 5DN6D 1Z1IA 3CS7A 2O8LA 2FTLE 4U2WA 2RA0A 3RXPA 1SB1H 3GOVB 1Y5AT 1TNLA 1GBLA 2C8ZB 3DHKH 4LXBH 1DFPA 3E6PH 4NIXA 5GIBA 1SQOA 3K6ZA 1LVMA 1YKTA 1T4UH 2P3UB 2M2AA 4ABDA 3H09A 1F0SA 3KQ5A 2R9PA 1BJUA 3A89A 4XSKU 4J1YA 2GTBA 4P00A 1MABB 5EOKA 4WMDA 1JRTA 1GJ8B 1V2JT 1H1BA 4XD7D 3PYHA 2ZNKH 1Y3YA 1GVZA 1SGIB 1BTXA 1GWAA 2HNTC 3RXVA 1A1RA 1HAVB 1SLXB 3A84A 1V2QT 4P02A 2HRVA 7GCHG 3BTHE 1CHOG 3MH4A 2K1QA 4XBCA 3O8RA 2H9EH 3SU0A 5EPNA 1L2EA 1SHHB 5C0TA 2YMSC 4FUEA 3BTKE 1RTLA 1KYNA 1P01A 1ZMLA 3WWBA 3BIVH 4Z1MD 2ZTXA 3PMAB 5A0BA 1OXGA 3SN8A 2H5CA 5AFYH 6CHAC 3SU1A 2QXGA 1TALA 2CK3D 2AS9A 1N8OC 2WYGA 1LDTT 5EU8A 2EA3A 1S0QA 3D23A 1SGDE 3VXEH 2Z3CA 1BRBE 1D3DB 3GCNA 1IOEA 1MAYA 4BXWA 1PPCE 5FXLA 2XOKD 4OS5A 2PFEA 1ORFA 2BX3A 1GHZA 2VIPA 2K8IA 1G3BA 3S69A 1QZ8A 1T7CA 1K9OE 1HBTH 4NSVA 4FVDA 2C8YB 2FLBH 1YPGH 1SSXA 1BTPA 1EAWA 1RXPA 1IQLA 1TBQH 1TNHA 3A85A 3RC4A 1AU8A 1AWFH 1ETRH 1CA0B 1O2XA 4FU8A 5J4QA 2ALPA 5FBIA 3ATKA 1MH0A 3KNXA 1X7AC 1P2MA 6LPRA 5JB8S 1KIGH 1BTYA 2BD8A 1S6FA 4RI0A 3ZV9A 1ELGA 1P2KA 1HAVA 3KQDA 1GI0A 2GKVE 1P2IA 1E79D 3ZVFA 3H7TA 1YPEH 2ZKSA 2I6SA 1K22H 3PROA 1CGJE 4Q7YA 5TJXA 3RC5A 4CRAA 2BOHB 1FY3A 1FXYA 4OGYA 1NBME 3GDSA 5C1UA 1T8LA 2YMSD 1IQJA 1GBKA 3RXFA 1P09A 2H6MA 1LHDH 1ZPCA 1EZXC 1TA6A 1O2TA 2GMTC 4RSPA 1ZLRA 2FYRA 3P8NA 5F03A 3M5MA 1C2IA 2A0QB 3E16B 3MMGA 4B73A 3RXKA 1BTHH 1DSTA 2A5IA 1MTNB 1DE7H 1Y8TA 2BLVA 3DSPA 3NUMA 2BMGB 3ZVDA 1FN6A 4RT0A 1GPZA 2V3OH 3GCOA 3DD2H 7KMEH 1BRCE 2FX4A 2CN0H 4K8YA 1KXAA 2AMQA 1JIMA 1GCTC 2A2QH 2A4GA 1D3TB 2QXHA 5B6LA 1TOMH 1AY6H 2BD4A 2FOHA 3SJ9A 1CGHA 3PB1E 1NC6A 3TJOA 1WAYB 3VB4A 1C4U2 4GPGA 1GVKB 1T8NA 1VR1H 4UEHH 1FAXA 1TGNA 2VIWA 4UFEH 3M35A 3O8DA 5EW2H 2WV5A 4AB8A 4ZHMU 1TE0A 3OY6U 4QT8C 1Y3UA 2Z6BD 1DWEH 1QL9A 2SGQE 1HAZB 1Q2WA 4BAHB 4CREA 2EI7A 5JBBS 4X2XA 1SGYE 2FTMA 5CHBA 1L1GA 3MNXA 2PKSB 4UDWH 1ZR0A 4IMQA 1YP9A 4ABIA 3BIUH 2PUQH 4OGXA 1QJ1B 1TGSZ 3FP8E 1EP5A 3M3TA 3SU2A 4Y0YE 4H42U 4M9FA 1PQ8A 3F9EA 1CBWC 2J92A 2W6ID 2ZHQH 1M9UA 1GBHA 2ZDKA 1LCYA 2ZP0H 1GMCF 3AK5A 4WF8A 1C4V2 1Z1JA 1GHBG 1ELVA 4B6FA 3TH2H 1F0RA 4OS2A 4BTIB 3MO3A 1AMHA 1PQ7A 4WWYA 1EAUA 5EW1H 3HKIB 1SQRA 5FHTA 1OOKB 3UWIA 1HJ9A 4MNWA 2WPKS 3PV2A 3G01A 1L4DA 2QCYA 2CF9H 4ZHAA 4WJG2 5HKKD 3F0PA 3BTDE 2VIVA 2SGEE 3DSOA 3BN9A 4X8TH 5HIYA 3PWBA 2QC2A 3MU5A 3L33A 3Q00A 2BXTH 2GV6A 1PJPA 1THRH 3F9GA 3MNSA 1GHAG 3SNBA 3QLPH 1BRUP 2BDAA 3M3VA 1A0JA 3U8TH 1P04A 2OQ5A 2RDEA 2GDDA 5HGGA 3PTNA 3S9CA 2QF3A 3UIRA 2K0QA 1EZSC 4K69A 3ZZ4A 1LPGB 1C5ZB 1JRSA 1W8BH 1V3XA 1W0JD 3BEIB 1T8OA 2TGPZ 4UE7H 2PHBA 1H4WA 1SQTA 1VITG 2BD9A 1C5YB 1ZMNA 5K7RA 4GLYA 2AMPA 4VGCB 3E3TA 3A7ZA 4RKOB 1A46H 4Y6DA 2GCHF 3FAOA 1O3PB 3RXCA 1GG6B 1ZMJA 2QXJA 3PLKA 2ZQ2A 1GI3A 1GHWH 1OWDA 1P0SH 2FXRA 5CHAC 2BY8X 2AYWA 4I32A 2A32A 1AB9B 3KCGH 1HAXB 2UUJB 3OSYA 4ZMAH 4FU7A 4I8JA 3OY5U 1H8HD 1EASA 1H8IH 3MO6A 2UUKB 3GCHB 3HKJB 3URDA 4DOQA 1JOUB 4I8LA 2ZFPH 1O5BB 2GCTC 2ZCHP 3MFJA 1C4Y2 2ULLA 1CQQA 3CP7A 5LPFA 1F0TA 1V2LT 2DE9A 2R2WU 4IS5A 1UVSH 3E0PB 4BAMB 2ZGCA 1ESTA 2HALA 3PRDA 4J2YB 5C1YA 2ZGBH 1Z8GA 4GHTA 4I8HA 1AFQB 3UNQA 3MU8A 3EE0B 2FI3E 4NFEA 4RKJB 2OC8A 1B0FA 1GCDA 3ZZ6A 1F92A 3UTUH 3STJA 2TGAA 3BTQE 1H9LB 5AFZH 3PTBA 1K0HA 1UCYK 3GDUA 2J9NA 2VWNA 2XCFA 1GBEA 1B0EA 1SGTA 2ZGHA 4UONA 4CBOA 1RGQA 3GCTG 1AVGH 1C1UH 3F3BA 1QURH 1IQGA 1QRXA 2D1JA 1A5HA 1AI8H 4DURA 5C94A 4FUJA 1QY6A 2ZU5A 4IC5A 2EI8A 2THFB 3EDXB 4Y7AA 1PQAA 1QFKH 3LU9B 3LC5A 3EA7A 4NIYA 1C2LA 4HG6A 4I33A 4AG2A 2C90B 1GJ6A 1IHSH 1V2PT 3OEHD 3T28A 4YXWD 1CT4E 1GI2A 3F68H 4F49A 3S9BA 1A0LA 5JBTA 1F5KU 2QF5A 4AG1A 1C5XB 3ATWA 1AZZA 3FZZA 1O5EH 3ZZCA 4TPIZ 4NZLA 3OTPA 2W7SA 2H5DA 4AX9H 3RDZA 4AN7A 1K2I1 3RP2A 3SJKA 2HPPH 1SLVB 1YY3A 1BTWA 7GCHF 3VB3A 1GBFA 1CHOF 4Y79A 3GISB 3N7DA 4I7YH 1DY9A 1L1NA 1HPGA 1NFYA 4BAQB 1DICA 1FI8A 1FX0B 3F6UH 4JZFH 3FFGA 5DP7A 3R3GB 2NU0E 5E8EH 3SZNA 1ELCA 1J9CH 5HYOA 3GDVA 1ZRBA 1O5AB 2ZU1A 2A4QA 2W7UA 1RJXB 1O5CB 1HIAB 4X6PA 3W1EA 2J97A 2UWPA 1QCPA 1O2QA 3UPEA 4TY6A 1UVOA 2LPRA 3EGKH 2UWLA 1UJ1A 4ZAEA 5BPEA 1V2WT 2GVFA 4X1QU 1A3EH 1ELBA 1TPAE 3RMLH 1EOJA 5LPRA 3SV9A 4Q7XA 1SL3A 2FOBA 1NO9H 2NU3E 4ZKSU 3H7OA 1J17T 2BTCE 2AGIX 2FESH 1PYTC 1ELDE 1Z6EA 2A7JA 2VB0A 1A0HB 2ZI2H 2ZDLA 1WCZA 3LGTA 2BDBA 1C2MA 2BM2A 3AW1A 5FCRA 5E0HA 2OD3B 2PR3A 3RXUA 1HV7A 2FOMB 3KQEA 1ANBA 1C5SA 3ZZ9A 4ZKRU 4GAWA 3ZZBA 3D65E 2BY5X 1H8DH 3I77A 1S82A 3RLWH 1MTUA 5FX6A 1J8AA 2UWOA 1G37A 1O3KA 2P16A 4Y76A 8ESTE 5T1VA 1GMDG 1Z8IB 1UO6A 3SOSA 4B2CA 1H9HE 5A0AE 1OP8A 4FUCA 4Y10E 1TIOA 1XM1A 1D3PB 1TRYA 1W12U 2VWLA 3GY8A 2J2UA 4Y71A 3OYPA 1C1OA 1NFUA 3RXHA 3N7OA 1EOLA 5TCCA 5KGOA 1GMHG 1UTKA 1XUIA 2ODQA 4TWWA 1RFNA 1W14U 1A2CH 1QQUA 3QO6A 1UCYE 4AYVB 4HI3A 3AW0A 2CMYA 1ZPBA 1GI1A 2J4IA 3VGCB 1HRTH 1NRPH 3BTWE 1DUAA 1P12E 2O8MA 2A5AA 1GDQA 4X1PU 2J34A 3A8BA 5LPEA 3L6PA 2SNVA 4AYYB 4MPWA 1MU8B 1AKSB 1O2UA 3TPIZ 1BMNH 3QZQA 1HIAA 5DG6A 1O2GH 1YF4A 2G5NA 1WQSA 4K60A 4DIIH 1O3JA 2AH4X 2HOBA 2WPMS 2RFKC 3UFAA 1GBMA 3VEQB 1AWHB 1WTHD 1BHXB 2JH0D 1DT2A 1Q3XA 2TRMA 1AZ8A 2PKAB 1FPCH 5C67A 1WUNH 4NFFA 4NGAH 1G3EA 1OPHB 2GJGA 3EAJA 1PYTD 1LQDB 2NU1E 2YNAA 4K1TA 3ZZDA 5A09A 4NG9H 4B6EA 1Z7KA 1J15A 5FX5A 4MNVA 2H2ZA 1LPZB 1NT1A 1SFIA 2A7CA 1XMNB 3W95A 2F9OA 3KIDU 2TIOA 3KEEA 1P06A 1LHEH 1UTMA 4XBDA 1EJAA 2IN2A 3A7WA 3E0NB 1ZJDA 1MZAA 1TABE 4F55A 1XUJA 2O9QA 4WMFA 3V12A 3A83A 3RXOA 4JZ1A 2XC5A 1C1NA 3A81A 2SGFE 2V0BA 5HXFA 1BB0B 1G2LA 2FX6A 4BTUB 4BTTB 3NK8A 8GCHG 2QXIA 4Q7ZA 1T4VH 4HGCA 1HLTH 1OP2A 5C1XA 1W0ZU 2G00A 2YMSB 5K0HA 1FDPA 3NXPA 4FUHA 1QRWA 3V0XA 2SGPE 2KFWA 4WMEA 1GHBF 3M5NA 2PSYA 4LZ4B 1EFRD 1ID5H 3GYLB 2ILNA 1ANDA 1QNJA 1SLUB 3EA9A 3M7QA 4DT4A 6CHAB 1ZJKA 3PMJA 3ENSB 1DWCH 1N8OB 4K1EA 1K1LA 2Y7XA 2VWOA 3U69H 3ATIA 1W2KH 4LK4A 1K1IA 3P8GA 1K21H 2ZDAH 2BZAA 3N7EA 4MLFB 2XC4A 4AORA 4X1RU 1S6HA 1K1NA 2F91A 2ZZUH 1AKSA 3BTME 1E37B 1V2OT 1DLEA 2Z9GA 3MQKC 1EX3A 1BTZA 3LJOA 3O8BA 3EA8A 3ZVGA 2IJOB 1EXFA 5HM2A 3SUEA 2PKAA 1Y5BT 3QGNB 3SI3H 2EC9H 5A8XA 1MKXK 2V3HH 1O2WA 2JIZD 4AFQA 2PP6A 2CHAC 1NBMD 1TNKA 2FOGA 3UAIC 3KHVA 1SOZA 4NA8A 1S5SA 1TLDA 2J38A 3W94A 3ZZ3A 5E2PA 1E1RD 3QN7A 1O3BA 2Y5FA 1O3AA 1UVTH 2BD2A 3RUOA 1THPB 1VITF 1NRRH 1NROH 3BEFB 1RIWC 2Q6GA 1TGTA 3BTFE 2P59A 3ZV8A 4NA7A 3UB0A 4NIVA 2VIQA 2BDCA 5C17A 3UR6A 1TQ7B 6GCHG 1OX1A 1DPOA 1S81A 1BUIA 1AE8H 1HNEE 2F9NA 1SBWA 1OWJA 1W13U 2QV1A 5ESBA 1D6RA 1MQ5A 3IWMA 1EPTC 5DP9A 1HXFH 4XE4A 4MG3A 3MTYA 3BSQA 3UQOA 1PPFE 2QGRA 4K5ZA 1Z6JH 2PSXA 3RXRA 3T27A 3KL6A 4TYDA 1G30B 3RXEA 1AIXH 2GMTB 2XBYA 1L0ZA 1THSH 5ETXA 1GJ5H 2PUXB 3T26A 1T8MA 4K8BA 5A0CA 3TJVA 1TA2A 1UK2A 1ANCA 2HVXA 4WH8A 1E34B 4XBBA 3AASA 5DP6A 1O37A 1P57B 1TRMA 3M61U 4IN1A 5EPYA 2Z9KA 3FOAA 3HK3B 4Z6AH 2OK5A 1GCTB 4CHAC 5LH8A 4GVUA 4KKDA 1FIZA 2ZFFH 3GCTF 1SGPE 3GY7A 2Z9LA 3QZRA 5EQRA 3UNRA 4FXGH 1O2VA 1GHVH 2AERH 1FIWA 3BEUA 3T29A 1BJVA 2KX4A 3QUMP 1ELFA 3KYFA 4AFZA 4UD9H 4ASUD 4R8TB 1ZGIA 4FVBA 3EYDA 1V2VT 3QTVH 4JCNA 1C1SA 1C1RA 2BQ7B 4GUXA 1MD8A 1DSUA 5GXPA 1W10U 2KM0A 2XXLA 1EJNA 1EP6A 1EQ9A 2FOAA 1G32B 2STAE 1YPHE 3LONA 1EJMA 3VB7A 1GBIA 2BOKA 4BXSA 1XXFA 1C5QA 1XVOA 1YCPK 1LTOA 2AIQA 2WUCA 1WOFA 1CBWB 1C1VH 3RMOH 3WWFA 1NU9A 1O2PA 2ZO3H 4DIHH 5IK2D 4IBLH 2G52A 3KYGA 1TX6A 3GY3A 2FOEA 4I31A 1ABIH 1C9PA 5GCHG 5FCKA 1KY9A 4TY7A 5L2ZH 1TOCB 5LGOA 1FY1A 1DXWA 2GP9B 1QJ6B 3BF6H 1UVPA 3A7YA 2UUFB 1YC0A 1FV9A 3LOXA 1TNJA 1O0DH 5DP8A 3RC6A 3BTGE 1TFXA 4THNH 1P2QA 1XX9A 1QHRB 1MQ6A 1GI8B 3UR9A 2CGAA 3JZ1B 3RXJA 1SR5C 2WINI 1A3BH 3MH7A 4X0WU 2J98A 1HAIH 2Y6TA 2ZU3A 3TIUA 2B0FA 5C20A 1AN1E 2IPHA 4JK5A 2IOTA 3A88A 1YPKH 3KF2A 1KLIH 3URCA 2ESTE 3KQBA 4Q80A 2B7DH 1Y3VA 2FLRH 3SU3A 2GX4A 1WTGH 3FVFB 1WQVH 1DM4B 1SGEE 2O8TA 3Q3KA 2ZFSA 2VVVA 2BDGA 2FOCA 1LMWB 1RS0A 1WBGB 1QBOA 2ZQ1A 5EXLA 2RA3A 1G3DA 2PV9B 5EXNA 1QQ4A 2H9HA 4AGJA 2V7QD 1ANEA 3U98H 4DVAU 2P95A 5GWZA 2ZPQA 3MNCA 1GHYH 4ISIH 3SNDA 2GZ8A 1GVLA 3I29A 3BG4C 1HJAC 3STIA 2H9TH 2ZHEH 1HUTH 1PPHE 3RXQA 2FYQA 1LKBA 1O2IA 5EQQA 1E1QD 5CHAB 4CRFA 4O3TA 1ZSLA 4RT1A 4AC9A 3OU0A 3TK5A 4OS1A 2BD5A 1ZPZA 3VB6A 1KXBA 1C2GA 2ZF0H 4B71A 1WU1A 1SMFE 1GMHF 1KXEA 1Y59T 2ODPA 2SNWA 1O3NA 1ZTKA 2GCTB 5EXMA 3ODFA 3F0OA 1BBRK 1TPPA 3ATLA 1Y5UT 3KGPA 4YTAA 3SGQE 1GBJA 1QA7A 1W7XH 3LGIA 4TSFD 3E8LA 3SI4H 4Z0KA 4WH6A 3RU4E 2QF0A 2JETC 2Z9JA 4BAOB 1LPKB 2Y81A 1QA0A 2KCYA 2OUAA 3CNRA 1DDJA 4KP0A 1E0FD 3FN8A 3Q76A 3OFND 2BY9X 3T62A 2BVSH 4F48B 2FIRH 4OS7A 5C0UA 3GY6A 1TRNA 3U1JB 2FI5E 2AHME 3IG6B 1D9IA 4ZKNU 1FONA 1U6QA 1YWUA 4H4FA 2GZ7A 4HZHA 3U8OH 5FBEA 4B1TA 3MH6A 3PWCA 1BTUA 1FMGA 1GBAA 2TPIZ 2FS9A 4XDEA 5JYIA 2ZA5A 1ZHRA 3SNCA 2VGCC 1AVXA 2P8OC 5A2MH 4O9VA 1K1JA 2P3TB 3ZIAD 4ISOA 2AGEX 1GBTA 3F9FA 4LOYH 1V2RT 2BYAX 3D62A 3ZVEA 2VVUA 3DSGA 3S7HB 4A5TS 1FUJA 3TK6A 1HGTH 3SO3A 3ZZ8A 1A4WH 1TPOA 3E1XB 1P02A 1NTPA 4KTUA 1OS8A 4YOJA 2NU2E 6ESTA 5J4SA 2OQUA 1IAUA 2AGGX 2ZGXH 3ZVCA 3RMNH 4X1NU 1OWHA 3MI4A 3MU4A 1DUEA 4ZUHA 2VVCA 1GI6A 2ZFRH 1C5VA 3M5LA 4E05H 2ODYB 2GV7A 4NSYA 1OP0A 3VG8A 5IYTA 1GJCB 2FDAA 3OX7U 1MCVA 2KAIA 3JZ2B 3SQHE 3TK9A 1O2ZA 4YM9A 3B8JA 1P9SA 2FO9A 1SGCA 1GI4A 3TLOA 1GI9B 4JZDH 5BRRE 2ZGJA 1GJ9B 1C2FA 3UQVA 1NM6A 1VJAU 2VBCA 3TGJE 3SV7A 2BY6X 1ELAA 4FUGA 1LHCH 3SORA 2BQ6B 2DE8A 1ZHMA 2XYAA 3A7XA 1LVOA 4KTSA 2G55A 2CXVA 4BAKB 2ANYA 3RXGA 1CVWH 3FO8D 1UK4A 5DP5A 4OS6A 3UUZA 2R2MB 4MNXA 2A4RA 1SVPA 1SGRE 2BD3A 4WY3A 2FI4E 1A7SA 1DITH 4TT3D 2ZHWH 4INHA 1C1MA 1C2DA 1P05A 2C4FH 3MU1A 3TU7H 3OEED 1FY5A 2WV9A 4AZ2B 3KN2A 1S6LA 2FP7B 1AQ7A 2W3IA 4E06H 1IQHA 2BX4A 2XC0A 2LP6A 1RD3B 2BQWB 1YPLH 1YGCH 3SYJA 2FOFA 1O2SA 2Y5HA 6GCHF 4AGKA 1IQFA 1BBRE 1P10A 3PO1C 1BQYA 1GL1A 1UCYH 5HIZA 2ZDMA 5EJLA 4X1SU 3K65B 2QYIA 3SZEA 1YLCA 2PWXA 1O3OA 4YZUA 1BZXE 1C2EA 1EB1H 3PRBA 3A8DA 1O32A 2VU8E 3MNBA 2SGAA 3PMBB 1N6YA 1Y3XA 3NKKA 4YLQH 2P94A 2F9VA 3M5OA 3RXBA 1O3CA 4A1TA 2F9PA 1MTSA 2B9LA 3P8OA 5E2OA 1NFXA 2JH5D 4B2AA 1OWKA 3LGYA 1IHTH 2O8WA 2PW8H 1TQ0B 4WXVA 1YLNA 5F6MA 1NU7B 1XUHA 1P2OA 2Q6DA 4Y8ZA 1NRQH 4A1XA 2OP9A 2RCEA 3RMMH 1OYTH 1GMCG 4ABJA 4WXIA 3MOCA 4D9QA 5C3NA 1BDAA 1INCA 2ZU2A 1HYLA 1ARBA 1MKWK 4A7IB 1O39A 3NRLA 3ZZ7A 1S0RA 3RXSA 1MCTA 1WSSH 2LNCA 4UFDH 3V13A 3SHAH 1V2NT 1EATA 2C8WB 3A80A 3PV4A 3RU4T 3T25A 1LO6A 2VH6A 1KMHB 5F8XA 3SGBE 1UVUH 1NRSH 4YOGA 3DT0H 4H6SB 2H1UA 1BOQA 2GD4B 1FAKH 1P9UA 4I8KA 1V2TT 1KXCA 5FPSA 1SGFA 2F9BH 1OSSA 4B74A 3ZVBA 1PQ5A 1TGBA 4MQAA 1LHGH 4A92A 4Y8XA 3LH1A 1UK3A 3TVJB 1P11E 4I86A 4XOJA 1GJDB 3ZZAA 5GNDA 4ACBA 3SV8A 2FZZA 2G4UA 9LPRA 4ISLA 1CHGA 1VKYA 2OBQA 1ARCA 1XVMA 1J14A 3SU5A 4CR5A 1ELEE 5GCHF 1O3FA 2BLWA 3GY2A 2L6OA 2YNBA 1C5UA 3PLBA 1CT2E 1YCPM 4E7NA 1BMMH 4JMYA 1G9IE 2OC0A 3MO9A 2CJIA 3P8FA 3LKWA 3DA9B 4U32A 2A1DB 1ZGVA 4DGJA 1KXDA 2ZC9H 1Y3WA 1HDTH 1UTQA 5IDKA 5I25A 4CRBA 2C3SA 2GDEH 2HWLB 2WPHS 4JYTA 1FY8E 1YPHC 1F0UA 5DGJA 3P95A 5DP4A 3LH3A 5CE1A 2HVYB 1DXPA 1W7GH 5EG4A 1O2OA 1UTJA 5TCAA 1Z8RA 1C5OH 3F2FA 5GPIB 1YYY1 1C5NH 4AFSA 2HNTF 3EQ0H 1TB6H 2CHAB 1C5LH 3SUFA 1F5RA 2D8WA 3A8CA 3E90B 4YT7H 2FODA 2ZTZA 1BIOA 3BTTE 3QWCH 2NU4E 2QA9E 2F3CE 2Z7FE 1IQMA 2V6NA 3QTOH 3QDZB 1RIWB 2FM2A 1VGCB 1DWDH 2ZIQH 1UW7A 3E91A 3A86A 1GHXH 1PPGE 2VJ1A 4ISHH 4Y8YA 5AF9H 1OKXA 5JPMH 2G8TA 5FAHA 1BA8B 4FETA 5DJ7A 3RM0H 1BMLA 4CRCA 3U8RH 5E0JA 1TBRH 4JZIA 3SNEA 1EPTB 1TGCA 5DO4H 1QBVH 4CBNA 1C2HA 1GDNA 3SV2H 1A5IA 1MTWA 2ZTYA 3ZVAA 2PTCE 1GHAF 2D26C 2OC7A 2FWWA 3FP6E 1HAGE 1OWEA 2Q1JA 3LJJA 4ABBA 5EIYA 1DANH 1KDQA 1TAWA 3SU6A 1L1JA 3TJUA 1A5GH 4X2VA 1IQNA 3AVZA 3MH5A 1MUEB 1VCPA 2XWAA 1GI5A 1HCGA 3LIWA 2O8UA 1NZQH 3TGIE 1VGCC 1DY8A 4CHAB 3U9AH 4NZQA 1S85A 2BDYA 3ZZ5A 1SGFG 7ESTE 1XUGA 2VIOA 1JIRA 2VINA 3OAAD 4BNRA 1DS2E 4F4OC 4JYUH 2A2XH 1O2NA 5I46H 5C2ZA 3R0FA 1N1LA 2WPLS 2ASUB 3LPRA 5T6GA 2KCPA 3GY5A 2UUYA 1QL8A 4O97A 3OE7D 4NWKA 3UWJH 2WV4A 3K9XB 1SC8U 3C1KA 1OHHD 4NIWA 3LGWA 1VCQA 1MMJN 1TMBH 1TPSA 5GJ4B 2R0KA 4YLUA 5T3HA 1KSNA 1NFWA 1WDIA 4K1SA 1HB0B 1YBWA 3D49H 3WW7A 1CA8B 3B9FH 1O2RA 1SLWB 4DJZB 1O36A 2J5UA 2CV3A 2ZDNA 1FJSA 1EB2A 1P3EA 2Y80A 5L6NH 4H6TA 2TGDA 2J98B 2P3FH 1O35A 5EGMA 4JK6A 1JMOH 3SJ8A 1FZZA 5HMAA 3RXIA 1C1QA 5ABWA 1EPTA 3TGKE 4XRNA 1O5DH 1IQKA 1ESBA 2XRCA 4KELA 1MBQA 2J94A 1RTKA 1EAXA 1O3EA 1C1WH 1W11U 3ZYEA 1TMUH 1O2HA 2ANMH 1PPZA 1MKXH 2Y82A 1KLJH 4DW2U 3QGJA 2BDIA 2TBSA 4CRGA 1IQEA 1YLDA 2RG3A 3PLPA 3RXMA 1AHTH 1VJ9U 1RRKA 2FPZA 3A82A 4X8VH 1TNIA 1H8ED 3S0NA 5FL7D 4D9RA 4AOQA 5CDFE 3I78A 4D8NA 1XKBC 3NWUA 1SGNE 2ZFTA 2BXUH 4YESB 4GSOA 1V2UT 3SUGA 1TNGA 2PGQB 2OXSA 1ELTA 4KGAA 4U30A 3U28C 4ABAA 1QBNA 1ESAA 2Y5GA 3T2NA 3TNSA 1KXFA 4X2WA 4GCHG 1W3CA 1D3QB 1O34A 1O3GA 4NWLA 4X2YA 1O2MA 3FZDA 5JDUB 2WSSD 2WUBA 1JXPA 5L2YH 3V7TA 1SFQB 3P92A 3RLYH 1T31A 4X8SH 1ZSJA 3SQEE 2QAAA 2BZ6H 1FN8A 2BB4A 2OCVB 4B76A 2AMDA 3LDXH 3BG4B 1HJAB 2NWNA 1O3IA 1FPHH 1QIXB 3RU4D 3A87A 1O5FH 3FANA 4MPUA 1CA0C 1TMTH 2C93B 1CSOE 3H5CB 3N99A 1H9IE 1BCUH 1QTFA 4PROA 1G36A 2ZPSA 3K6YA 4DT7B 1LHFH 3FP7E 4X6NA 3AAVA 4K2YA 1J16A 1BMAA 2VWMA 3S9AA 1MD7A 3QX5H 3F2GA 4B75A 1GGDB 3LGVA 2Z3EA 1EZUC 2F43B 3RXTA 1LVBA 2ANWA 2A4OA 4SGBE 4IN2A 4FOUC 3P70B 3ELAH 1C5RA 1O33A 3PV5A 1HAHH 1GJAB 1O2YA 3P6ZB 1WYKA 2A5KA 1MAXA 3Q77A 2JETB 2VNTA 2STBE 1WV7H 4DCDA 3WY8A 1FNIA 1GDUA 4A1VA 4ACAA 3M7TA 2JDID 4INLA 4CRDA 4X8UH 4MVNA 4E7RG 1HAPH 3PMHB 3RXLA 2G81E 3F2HA 4AB9A 1EZQA 1QGFA 4M7GA 2ZECA 1RTFB 2HPQH 1XUKA 1MTNC 2HNTE 5C5NA 5JBAS 1YCPH 3TITA 4FUFA 2ALVA 1KTSB 1VITH 4CH8B 1GMDF 2Y7ZA 1P2NA 2R3UA 2QY0B 2SGDE 2VIDA 1KTTB 3SUDA 3F9HA 4YT6H 2VGCB 4OS4A 2P8OB 1QRZA 2I6QA 1GJ7B 3NCLA 3UOUA 1O2LA 1UTNA 2ZU4A 4DY7B 5T6FA 3O8CA 3PM3A 2JKHA 1GGDC 4ESTE 1GBDA 2W5EA 1ZOMA 3GY4A 3GICB 2KAIB 4JZEH 3TH3H 4LZ1H 4O03A 1DLKB 4IC6A 2BLOA 8KME2 1QB1A 1LKAA 1C2KA 5G4BA 3SHCH 4ZKOU 4MPXA 4INKA 2PKSC 4IMZA 1C5MD 1XUFA 1B7XB 1SGQE 1VZQH 9ESTA 1LVYA 1QR3E 4ISNA 2ZCKP 2XBXA 2ZEBA 4Y0ZE 4CH2B 3A8AA 2BVXH 4D76A 1QB6A 2W26A 1JBUH 1K1OA 3SJIA 5F8ZA 4ABGA 1C5WB 3RXAA 1O2KA 2AIPA 1HFDA 2HLDD 1D6WA 1K1PA 2AEIH 3TH4H 3ODDA 3Q3YA 2ZHDA 1SQAA 5DPAA 3MWIU 1MBMA 2BVRH 1Q31A 5PTPA 1O31A 2R0LA 1SPJA 3LT3A 1O3LA 2GGVB 4YOIA 1AVWA 5A8ZA 1ACBE 4MPVA 3K2UA 5FPTA 1AFEH 4ZXXH 4MNYA 1BRAA 5T6DA 2XTTB 2F4LA 1COWD 1G3CA 2WPIS 2Q6FA 5SGAE 1KLTA 1SHYA 5HM9A 1SI5H 8GCHF 2GZ9A 4Q2KA 1EKBB 4MTBA 5DP3A 4D7GA 2PLXA 1V2ST 1F5LA 3P17H 3VFEA 2D2DA 1CE5A 1V6DA 3RM2H 1ETTH 1OYQA 1CT0E 4NCYA 2G4TA 1BBRH 3GYMA 1XXDA 1C9TA 3CENA 2F83A 4Q63A 1AUJA 1YPMH 2OLGA 5FPYA 2ZPRA 1B5GH 1AE5A 1LQEA 2SFAA 2PGBB 4ZHLU 3M7UA 3PO1B 2KCAA 1CO7E 2XBWA 4IW4E 1HXEH 1ZHPA 3ESTA 1DX5M 4VGCC 3UOPA 2KR7A 1CGIE 3NPSA 1PPBH 1FQ3A 1NY22 3VB5A 5CMXH 1GG6C 1K1MA 5ESTE 4SGAE 1UMAH 1F7ZA 8LPRA 4KTCA 1AB9C 4ABFA 2A31A 1NS3A 1AUTC 2OTVA 2GT8A 3BG8A 1O3MA 4Y7BA 5DKMA 3UREA 1CU1A 1TYNA 3LGUA 3GCHC 3HGNA 3SNAA 3KQCA 5EJ1A 1P8VC 2W3KA 1PFXC 2W6JD 3HATH 1C2JA 3SV6A 4K3JA 4AFUA 2G51A 2JH6D 3SW2B 1IQIA 1AFQC 4FU9A 1BITA 1GI7B 3SU4A 4OM9A 3L3TA 2P93A 3UNSA 1C5PA 2RDLA 3C27B 1BT7A 2WPJS 3MHWU 1MTVA 4ZXYH 3AAUA 3ITIA 3DFJA 2B5TB 1V2KT 1ETSH 2ZDVH 3HK6B 1GJ4H 2OBOA 2BDHA 1W0YH 2TGTA 1AGJA 3HGPA 4BOHA 1DWBH 4TPYA 1FLEE 5E0GA 3T5FH 4UFGH 3LC3A 1P03A 2C8XB 2Z3DA 1O5GH 5F8TA 2XBVA 4JYVH 4FUBA 4A6LA 1SOTA 2V35A 4HFPB 1G2MA 3MYWA 4D7FA 1JWTA 2WHXA 1AD8H 5JBCS 2XNIA 2ZG0H 3NZIA 5AVDA 1Z8JB 3ZYDA 4RN6A 3SBKA 3OTJE 4HTCH 1D4PB 4Q4LA 1GL0E 1ZTJA 2EQNA 2XNDD 1DVAH 5L30H 2A7HA 4BANB 2XW9A 1SKYE 1L4ZA 2R3YA 1AO5A 3BV9B 2LELA 2ZHFH 2ZWLH 4XFQA 4NA9H 1S83A 3Q3XA
chains in the Genus database with same CATH topology
1VCWA 2A45B 5EODA 4B2BA 1E35B 2FS8A 3TNTA 1UHBB 1TBZH 2QN5T 5AHGH 4FUDA 1ABJH 2PTNA 2HLCA 2OINA 4FUIA 1E36B 3SGAE 4ZH8A 3VPKA 3F1SB 2BD7A 3UY9A 1EAIA 2XWBI 2AFQB 1O2JA 1Z71A 4ABHA 2ANKH 2ZFQH 1TWXB 2XCNA 1A61H 4UFFH 1QJ7B 2WYJA 2BHGA 1MZDA 3BTEE 2G5VA 3S7KB 1QL7A 4GCHF 1S84A 3MU0A 4YO9A 4GHQA 2QIQA 1YPJH 5EQSA 1NRNH 1O3HA 1ZZZA 3B23B 4ASHA 1NESE 3RXDA 1V2MT 1ZYOA 2M5TA 2BLQA 1BHXF 1P3CA 1F2SE 5A8YA 2GT7A 4X6MA 1GJBB 3VXFH 2YOLA 1KDQB 3IITA 3M36A 2DUCA 1UTPA 2B8OH 1MU6B 2EEKA 4WVPE 4I8GA 2GCHG 3ATMA 4X6OA 2ZCLP 3V3MA 1C1TA 2Z9IA 2HGTH 2OC1A 2FMJA 7LPRA 1P2JA 1ZTLA 1NPMA 1O38A 5H4IB 1GBCA 4DG4A 1FY4A 1NN6A 1QB9A 4ZROA 5JB9S 4Y11E 3QK1A 3DUXH 4MDSA 3DFLA 2CF8H 1PPEE 4O3UA 1XKAC 5B6OA 3HPTB 3M37A 5C5OA 1MKWH 2EI6A 1EUFA 1HAOH 2BY7X 5DK1A 4ABEA 1UHBA 4U01A 3SJOA 1TONA 3TJNA 2Z94A 1UTLM 1K28D 1O30A 1ZRKA 2VH0A 3VGCC 1HAYB 3U1IB 1TX8A 1YM0A 4CR9A 1N6XA 2J95A 4TWYA 1OWIA 2FEQH 1O3DA 1DOJA 3A7VA 1HJ8A 3CS0A 1E38B 1C5TA 2F9UA 1GBBA 3M3SA 4R0IA 1TX7A 1UTOA 1C1PA 1T32A 1SG8B 3A7TA 4IGDA 5GDSH 1ZSKA 1Z1IA 3CS7A 2O8LA 2FTLE 4U2WA 2RA0A 3RXPA 1SB1H 3GOVB 1Y5AT 1TNLA 1GBLA 2C8ZB 3DHKH 4LXBH 1DFPA 3E6PH 4NIXA 5GIBA 1SQOA 3K6ZA 1LVMA 1YKTA 1T4UH 2P3UB 4ABDA 1F0SA 2R9PA 1BJUA 3A89A 4XSKU 4J1YA 2GTBA 5EOKA 4WMDA 1JRTA 1GJ8B 1V2JT 1H1BA 3PYHA 2ZNKH 1Y3YA 1GVZA 1SGIB 1BTXA 1GWAA 2HNTC 3RXVA 1A1RA 1HAVB 1SLXB 3A84A 1V2QT 2HRVA 7GCHG 3BTHE 1CHOG 3MH4A 2K1QA 4XBCA 3O8RA 2H9EH 3SU0A 5EPNA 1L2EA 1SHHB 4FUEA 3BTKE 1RTLA 1KYNA 1P01A 1ZMLA 3BIVH 2ZTXA 3PMAB 5A0BA 1OXGA 3SN8A 2H5CA 5AFYH 6CHAC 3SU1A 2QXGA 1TALA 2AS9A 1N8OC 2WYGA 1LDTT 5EU8A 2EA3A 1S0QA 3D23A 1SGDE 3VXEH 2Z3CA 1BRBE 1D3DB 3GCNA 1IOEA 1MAYA 4BXWA 1PPCE 5FXLA 4OS5A 2PFEA 1ORFA 2BX3A 1GHZA 2VIPA 1G3BA 3S69A 1T7CA 1K9OE 1HBTH 4NSVA 4FVDA 2C8YB 2FLBH 1YPGH 1SSXA 1BTPA 1EAWA 1RXPA 1IQLA 1TBQH 1TNHA 3A85A 3RC4A 1AU8A 1AWFH 1ETRH 1CA0B 1O2XA 4FU8A 5J4QA 2ALPA 5FBIA 3ATKA 1MH0A 3KNXA 1X7AC 1P2MA 6LPRA 5JB8S 1KIGH 1BTYA 2BD8A 1S6FA 3ZV9A 1ELGA 1P2KA 1HAVA 3KQDA 1GI0A 2GKVE 1P2IA 3ZVFA 3H7TA 1YPEH 2ZKSA 2I6SA 1K22H 3PROA 1CGJE 4Q7YA 5TJXA 3RC5A 4CRAA 2BOHB 1FY3A 1FXYA 4OGYA 3GDSA 5C1UA 1T8LA 1IQJA 1GBKA 3RXFA 1P09A 2H6MA 1LHDH 1ZPCA 1EZXC 1TA6A 1O2TA 2GMTC 4RSPA 1ZLRA 2FYRA 3P8NA 5F03A 3M5MA 1C2IA 2A0QB 3E16B 3MMGA 4B73A 3RXKA 1BTHH 1DSTA 2A5IA 1MTNB 1DE7H 1Y8TA 2BLVA 3NUMA 2BMGB 3ZVDA 1FN6A 1GPZA 2V3OH 3GCOA 3DD2H 7KMEH 1BRCE 2FX4A 2CN0H 4K8YA 1KXAA 2AMQA 1JIMA 1GCTC 2A2QH 2A4GA 1D3TB 2QXHA 1TOMH 1AY6H 2BD4A 2FOHA 3SJ9A 1CGHA 3PB1E 1NC6A 3TJOA 1WAYB 3VB4A 1C4U2 4GPGA 1GVKB 1T8NA 1VR1H 4UEHH 1FAXA 1TGNA 2VIWA 4UFEH 3M35A 3O8DA 5EW2H 2WV5A 4AB8A 4ZHMU 1TE0A 3OY6U 4QT8C 1Y3UA 2Z6BD 1DWEH 1QL9A 2SGQE 1HAZB 1Q2WA 4BAHB 4CREA 2EI7A 5JBBS 4X2XA 1SGYE 2FTMA 1L1GA 3MNXA 2PKSB 4UDWH 1ZR0A 4IMQA 1YP9A 4ABIA 3BIUH 2PUQH 4OGXA 1QJ1B 1TGSZ 3FP8E 1EP5A 3M3TA 3SU2A 4Y0YE 4H42U 1PQ8A 3F9EA 1CBWC 2J92A 2ZHQH 1M9UA 1GBHA 2ZDKA 1LCYA 2ZP0H 1GMCF 4WF8A 1C4V2 1Z1JA 1GHBG 1ELVA 3TH2H 1F0RA 4OS2A 4BTIB 3MO3A 1AMHA 1PQ7A 4WWYA 1EAUA 5EW1H 3HKIB 5FHTA 1OOKB 3UWIA 1HJ9A 4MNWA 2WPKS 3G01A 1L4DA 2QCYA 2CF9H 4ZHAA 4WJG2 3BTDE 2VIVA 2SGEE 3BN9A 4X8TH 3PWBA 2QC2A 3MU5A 3L33A 3Q00A 2BXTH 2GV6A 1PJPA 1THRH 3F9GA 3MNSA 1GHAG 3SNBA 3QLPH 1BRUP 2BDAA 3M3VA 1A0JA 3U8TH 1P04A 2OQ5A 2GDDA 5HGGA 3PTNA 3S9CA 2QF3A 3UIRA 1EZSC 4K69A 3ZZ4A 1LPGB 1C5ZB 1JRSA 1W8BH 1V3XA 3BEIB 1T8OA 2TGPZ 4UE7H 2PHBA 1H4WA 1SQTA 1VITG 2BD9A 1C5YB 1ZMNA 5K7RA 4GLYA 2AMPA 4VGCB 3E3TA 3A7ZA 4RKOB 1A46H 4Y6DA 2GCHF 3FAOA 1O3PB 3RXCA 1GG6B 1ZMJA 2QXJA 3PLKA 2ZQ2A 1GI3A 1GHWH 1OWDA 1P0SH 2FXRA 5CHAC 2BY8X 2AYWA 4I32A 2A32A 1AB9B 3KCGH 1HAXB 2UUJB 3OSYA 4ZMAH 4FU7A 4I8JA 3OY5U 1EASA 1H8IH 3MO6A 2UUKB 3GCHB 3HKJB 3URDA 4DOQA 1JOUB 4I8LA 2ZFPH 1O5BB 2GCTC 2ZCHP 3MFJA 1C4Y2 2ULLA 1CQQA 3CP7A 5LPFA 1F0TA 1V2LT 2DE9A 2R2WU 4IS5A 1UVSH 3E0PB 4BAMB 2ZGCA 1ESTA 2HALA 4J2YB 5C1YA 2ZGBH 1Z8GA 4GHTA 4I8HA 1AFQB 3UNQA 3MU8A 3EE0B 2FI3E 4NFEA 4RKJB 2OC8A 1B0FA 1GCDA 3ZZ6A 1F92A 3UTUH 3STJA 2TGAA 3BTQE 1H9LB 5AFZH 3PTBA 1UCYK 3GDUA 2J9NA 2VWNA 2XCFA 1GBEA 1B0EA 1SGTA 2ZGHA 4UONA 4CBOA 1RGQA 3GCTG 1AVGH 1C1UH 1QURH 1IQGA 1QRXA 2D1JA 1A5HA 1AI8H 4DURA 4FUJA 1QY6A 2ZU5A 4IC5A 2EI8A 2THFB 3EDXB 4Y7AA 1PQAA 1QFKH 3LU9B 3LC5A 3EA7A 4NIYA 1C2LA 4I33A 4AG2A 2C90B 1GJ6A 1IHSH 1V2PT 3T28A 1CT4E 1GI2A 3F68H 4F49A 3S9BA 1A0LA 5JBTA 1F5KU 4AG1A 1C5XB 3ATWA 1AZZA 3FZZA 1O5EH 3ZZCA 4TPIZ 4NZLA 2W7SA 2H5DA 4AX9H 3RDZA 4AN7A 1K2I1 3RP2A 3SJKA 2HPPH 1SLVB 1BTWA 7GCHF 3VB3A 1GBFA 1CHOF 4Y79A 3GISB 4I7YH 1DY9A 1L1NA 1HPGA 1NFYA 4BAQB 1DICA 1FI8A 3F6UH 4JZFH 3FFGA 5DP7A 3R3GB 2NU0E 5E8EH 3SZNA 1ELCA 1J9CH 5HYOA 3GDVA 1ZRBA 1O5AB 2ZU1A 2A4QA 2W7UA 1RJXB 1O5CB 1HIAB 4X6PA 2UWPA 1QCPA 1O2QA 3UPEA 4TY6A 1UVOA 2LPRA 3EGKH 2UWLA 1UJ1A 4ZAEA 5BPEA 1V2WT 2GVFA 4X1QU 1A3EH 1ELBA 1TPAE 3RMLH 1EOJA 5LPRA 3SV9A 4Q7XA 1SL3A 2FOBA 1NO9H 2NU3E 4ZKSU 3H7OA 1J17T 2BTCE 2AGIX 2FESH 1PYTC 1ELDE 1Z6EA 2A7JA 2VB0A 1A0HB 2ZI2H 2ZDLA 1WCZA 3LGTA 2BDBA 1C2MA 2BM2A 3AW1A 5FCRA 5E0HA 2OD3B 2PR3A 3RXUA 1HV7A 2FOMB 3KQEA 1ANBA 1C5SA 3ZZ9A 4ZKRU 4GAWA 3ZZBA 3D65E 2BY5X 1H8DH 3I77A 1S82A 3RLWH 1MTUA 5FX6A 1J8AA 2UWOA 1G37A 1O3KA 2P16A 4Y76A 8ESTE 1GMDG 1Z8IB 1UO6A 3SOSA 4B2CA 1H9HE 5A0AE 1OP8A 4FUCA 4Y10E 1TIOA 1XM1A 1D3PB 1TRYA 1W12U 2VWLA 3GY8A 2J2UA 4Y71A 3OYPA 1C1OA 1NFUA 3RXHA 3N7OA 1EOLA 5TCCA 1GMHG 1UTKA 1XUIA 2ODQA 4TWWA 1RFNA 1W14U 1A2CH 1QQUA 3QO6A 1UCYE 4AYVB 4HI3A 3AW0A 2CMYA 1ZPBA 1GI1A 2J4IA 3VGCB 1HRTH 1NRPH 3BTWE 1DUAA 1P12E 2O8MA 2A5AA 1GDQA 4X1PU 2J34A 3A8BA 5LPEA 3L6PA 2SNVA 4AYYB 4MPWA 1MU8B 1AKSB 1O2UA 3TPIZ 1BMNH 3QZQA 1HIAA 5DG6A 1O2GH 1YF4A 2G5NA 1WQSA 4K60A 4DIIH 1O3JA 2AH4X 2HOBA 2WPMS 3UFAA 1GBMA 3VEQB 1AWHB 1WTHD 1BHXB 2JH0D 1DT2A 1Q3XA 2TRMA 1AZ8A 2PKAB 1FPCH 5C67A 1WUNH 4NFFA 4NGAH 1G3EA 1OPHB 3EAJA 1PYTD 1LQDB 2NU1E 2YNAA 4K1TA 3ZZDA 5A09A 4NG9H 1Z7KA 1J15A 5FX5A 4MNVA 2H2ZA 1LPZB 1NT1A 1SFIA 2A7CA 1XMNB 3W95A 2F9OA 3KIDU 2TIOA 3KEEA 1P06A 1LHEH 1UTMA 4XBDA 1EJAA 2IN2A 3A7WA 3E0NB 1ZJDA 1MZAA 1TABE 1XUJA 2O9QA 4WMFA 3V12A 3A83A 3RXOA 4JZ1A 2XC5A 1C1NA 3A81A 2SGFE 2V0BA 5HXFA 1BB0B 1G2LA 2FX6A 4BTUB 4BTTB 3NK8A 8GCHG 2QXIA 4Q7ZA 1T4VH 4HGCA 1HLTH 1OP2A 5C1XA 1W0ZU 2G00A 5K0HA 1FDPA 3NXPA 4FUHA 1QRWA 3V0XA 2SGPE 4WMEA 1GHBF 3M5NA 2PSYA 4LZ4B 1ID5H 3GYLB 2ILNA 1ANDA 1QNJA 1SLUB 3EA9A 3M7QA 6CHAB 1ZJKA 3PMJA 3ENSB 1DWCH 1N8OB 4K1EA 1K1LA 2Y7XA 2VWOA 3U69H 3ATIA 1W2KH 4LK4A 1K1IA 3P8GA 1K21H 2ZDAH 2BZAA 4MLFB 2XC4A 4AORA 4X1RU 1S6HA 1K1NA 2F91A 2ZZUH 1AKSA 3BTME 1E37B 1V2OT 1DLEA 2Z9GA 1EX3A 1BTZA 3LJOA 3O8BA 3EA8A 3ZVGA 2IJOB 1EXFA 5HM2A 3SUEA 2PKAA 1Y5BT 3QGNB 3SI3H 2EC9H 5A8XA 1MKXK 2V3HH 1O2WA 4AFQA 2CHAC 1TNKA 2FOGA 3KHVA 1SOZA 4NA8A 1S5SA 1TLDA 2J38A 3W94A 3ZZ3A 5E2PA 3QN7A 1O3BA 2Y5FA 1O3AA 1UVTH 2BD2A 3RUOA 1THPB 1VITF 1NRRH 1NROH 3BEFB 1RIWC 2Q6GA 1TGTA 3BTFE 2P59A 3ZV8A 4NA7A 4NIVA 2VIQA 2BDCA 3UR6A 1TQ7B 6GCHG 1OX1A 1DPOA 1S81A 1BUIA 1AE8H 1HNEE 2F9NA 1SBWA 1OWJA 1W13U 2QV1A 5ESBA 1D6RA 1MQ5A 3IWMA 1EPTC 5DP9A 1HXFH 4XE4A 4MG3A 3MTYA 3BSQA 3UQOA 1PPFE 2QGRA 4K5ZA 1Z6JH 2PSXA 3RXRA 3T27A 3KL6A 4TYDA 1G30B 3RXEA 1AIXH 2GMTB 2XBYA 1L0ZA 1THSH 5ETXA 1GJ5H 2PUXB 3T26A 1T8MA 4K8BA 5A0CA 3TJVA 1TA2A 1UK2A 1ANCA 2HVXA 4WH8A 1E34B 4XBBA 3AASA 5DP6A 1O37A 1P57B 1TRMA 3M61U 4IN1A 5EPYA 2Z9KA 3HK3B 4Z6AH 1GCTB 4CHAC 5LH8A 4GVUA 4KKDA 1FIZA 2ZFFH 3GCTF 1SGPE 3GY7A 2Z9LA 3QZRA 5EQRA 3UNRA 4FXGH 1O2VA 1GHVH 2AERH 1FIWA 3BEUA 3T29A 1BJVA 3QUMP 1ELFA 4AFZA 4UD9H 4R8TB 1ZGIA 4FVBA 3EYDA 1V2VT 3QTVH 4JCNA 1C1SA 1C1RA 2BQ7B 4GUXA 1MD8A 1DSUA 5GXPA 1W10U 2XXLA 1EJNA 1EP6A 1EQ9A 2FOAA 1G32B 2STAE 1YPHE 3LONA 1EJMA 3VB7A 1GBIA 2BOKA 4BXSA 1XXFA 1C5QA 1XVOA 1YCPK 1LTOA 2AIQA 2WUCA 1WOFA 1CBWB 1C1VH 3RMOH 1NU9A 1O2PA 2ZO3H 4DIHH 4IBLH 2G52A 1TX6A 3GY3A 2FOEA 4I31A 1ABIH 1C9PA 5GCHG 5FCKA 1KY9A 4TY7A 5L2ZH 1TOCB 5LGOA 1FY1A 1DXWA 2GP9B 1QJ6B 3BF6H 1UVPA