5T6FA

1.90 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (orthorhombic p form)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
165
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Genome polyprotein
total genus 38
structure length 165
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA01
1WTGH 2PKAA 1F5KU 4YM9A 2ANYA 2NU4E 1GMDG 2I6QA 5E0JA 1SL3A 2FTMA 2ZDNA 1OWEA 1SSXA 1T8MA 3ZVAA 4DIHH 4K3JA 1DWCH 1H8IH 1HJAB 1JXPA 3AAVA 4OS2A 4KTSA 1EAIA 2F3CE 2AMQA 2VIVA 2DUCA 3BEUA 1V6DA 1ZOMA 3GDSA 1MCVA 3RXHA 2H9EH 1QBNA 3M5OA 1UVUH 1ZLRA 3ZZ8A 4UFGH 3ZV8A 2XBWA 4THNH 3URCA 2ZPQA 1QGFA 1TA2A 1GCTB 1SLUB 1O3EA 1MD8A 2UUFB 2BDIA 1UTMA 2YNAA 4IBLH 2SGEE 3T25A 3V0XA 1KLJH 4Q2KA 3V3MA 3EQ0H 3BTME 1SGFG 2IOTA 1A5GH 4CRFA 1P2NA 2CMYA 3RDZA 1K1NA 2AGGX 1TONA 1O2JA 1ZMLA 2QXHA 1TIOA 3MMGA 1SHHB 1C1OA 4Z0KA 3FAOA 1PYTC 4ABHA 2CHAB 3SNAA 1K22H 1LHEH 1LVYA 1GJ8B 5EW2H 1FXYA 2BYAX 3ZZDA 1DE7H 1YPJH 1O2KA 2QV1A 2G4UA 1GJ4H 2BY9X 1FQ3A 4KP0A 4MDSA 1O5AB 5F6MA 3MTYA 1ELFA 1DANH 2WPKS 5FPSA 2EI8A 2RDLA 4IW4E 4I32A 4O3TA 3A84A 5C1YA 1VJ9U 3SJOA 1DSTA 2PKSC 1HAVB 1D6WA 1AKSB 2H5DA 3KL6A 1TLDA 4JYUH 5LGOA 3STJA 2CGAA 1KY9A 1ELBA 3ATLA 6CHAC 2A2QH 3RXGA 1N8OC 2HALA 1PQ5A 1GDQA 2QAAA 6LPRA 2VWNA 3RC5A 2TRMA 4AFQA 2WPHS 4KTUA 2NU1E 4FUDA 3DFJA 3E3TA 1RGQA 5AHGH 3Q77A 3F9GA 3A8BA 1BMLA 4A6LA 2R2WU 4NIXA 1TGBA 3SJIA 3LGYA 1GCTC 2ZGXH 1O5GH 3GCNA 1J9CH 4ZH8A 2FOMB 4DGJA 4NG9H 5J4QA 1HAZB 4AFUA 1GGDB 2QXIA 1L4ZA 4ZKRU 4ABAA 2A5IA 3UR6A 1GCDA 2FM2A 3TK6A 3PM3A 1OP0A 1S0RA 1ZZZA 3HK6B 2Z9GA 3QWCH 1LKAA 1AE5A 2XBVA 3PWCA 4R8TB 4JMYA 1IHTH 2A4OA 1Y3UA 5GXPA 2ZEBA 1MU6B 3VB3A 3A81A 1T31A 2XC0A 4Y11E 5DJ7A 2J38A 4CRCA 2GT8A 3Q3KA 1P2OA 2A1DB 2P8OB 3BTKE 4Y10E 5C5OA 1CHOF 3BF6H 3HKIB 1QA0A 3AW1A 3ZVCA 1JRSA 4H42U 2QYIA 3BEIB 1C2LA 4B75A 4YT6H 4ISHH 1TYNA 2FOHA 2Z9KA 3RXUA 2VGCB 8GCHF 1UHBB 2H6MA 3EA8A 1UO6A 2AH4X 2SGAA 2UWOA 4NSYA 5EW1H 3T2NA 1TAWA 1PJPA 1YPKH 1YPGH 3U98H 4B2BA 3K2UA 3BG4B 1AMHA 4BOHA 3RMNH 3BTTE 1S6FA 3SQEE 3UNSA 3M37A 4GCHF 2Z6BD 1PQ7A 1CA0C 1S81A 2PSXA 1TGCA 2GTBA 1LQDB 1EP6A 2Y7XA 2VNTA 1GBIA 3LU9B 4YTAA 3RC4A 2OXSA 1FNIA 1Z6EA 1EPTC 1JIRA 1QB9A 3TGJE 3BTGE 3LONA 5H4IB 4E7NA 2ZFRH 1QFKH 2ZGHA 2ILNA 1QHRB 1UTPA 3U9AH 3ZVDA 4AG1A 2ZCKP 3GCOA 1ZMNA 3K9XB 1HAGE 3M5MA 3F6UH 1QRZA 1A0JA 3RU4D 1EUFA 4K2YA 2J9NA 2WV5A 1TE0A 1P05A 1L1NA 4X6NA 1Y3WA 1BJUA 2ZECA 4WJG2 2CN0H 1Z8RA 2FXRA 1AZ8A 1GMHG 1JIMA 1OWJA 2XNIA 1QJ7B 4FUGA 3TITA 1EQ9A 4X1PU 3BTDE 1GGDC 3JZ1B 2H9HA 3I78A 3M7TA 1ZPBA 1CE5A 2VIOA 1TPPA 3M36A 2BVSH 4JK6A 1IHSH 3U8TH 4LOYH 1UCYE 2QXJA 4KGAA 1L1JA 5LPRA 1TPAE 3A7YA 1OWDA 5L6NH 2R3UA 1BUIA 2GP9B 1Y3YA 5GWZA 1A5IA 3SGQE 3S7KB 2Z9JA 4NFFA 3S0NA 1P2KA 4CH2B 1K9OE 3MH6A 4XBDA 5CMXH 1W7GH 4CH8B 4O97A 1V2JT 2A5KA 2ZHDA 3RXDA 1VITH 5JBAS 6ESTA 3U8OH 1SC8U 3UPEA 3UWJH 4Q7YA 3MI4A 2A5AA 3HPTB 1DUEA 1HDTH 2OCVB 1OYTH 1ARCA 3SHAH 1JWTA 1GHYH 1HYLA 3LH3A 1BBRE 4MQAA 1O3AA 1HLTH 3EYDA 4NFEA 3LGTA 2Z3DA 1YGCH 3BTQE 3RMOH 2D2DA 3OU0A 1O2MA 1UTJA 5JB8S 1GHZA 1UHBA 1J16A 1BRBE 4ABJA 1GBJA 1MAYA 3RXVA 1A46H 1GMCF 5E0GA 2QGRA 1XUGA 2C8ZB 1FONA 3UQVA 5GCHG 2BD9A 1MTVA 5A0BA 3E90B 1V2VT 1TB6H 1SQOA 5B6OA 2BOKA 2ZDKA 1GI2A 3PWBA 1OWIA 1RS0A 3MH7A 4AX9H 4HGCA 1ELEE 1GJ5H 1F0TA 3T62A 3O8DA 4RSPA 3QGJA 2THFB 1H4WA 4K5ZA 1GVZA 2G5VA 4UFFH 3MNSA 1IQNA 3B23B 2GCHF 4B73A 4NGAH 3A7WA 1HV7A 1W7XH 3LJJA 3LOXA 2TPIZ 2PWXA 3ATKA 1SGIB 2FOAA 2EEKA 2F9UA 2ZGJA 1SOTA 5A0CA 2P93A 1HXFH 2R0KA 4X8TH 1GBHA 1GHAF 5IDKA 2J4IA 2RA0A 1JMOH 5EGMA 1V2QT 2XYAA 3MO9A 5TCCA 1ZSJA 3A80A 5I46H 2V6NA 3LGIA 5C20A 2ZU1A 4YOGA 1GI3A 3MO6A 1JRTA 1C5WB 4OS1A 2I6SA 4HZHA 1QB6A 1PPFE 2PV9B 1UK3A 2PHBA 1C2IA 4X8SH 1ELTA 1XUHA 1N1LA 1XMNB 2XCNA 3TJOA 1DX5M 3PMAB 1AWFH 1QTFA 1AKSA 1P02A 1D6RA 2ZFQH 1F0RA 1MQ5A 2BZ6H 2G5NA 1T8OA 5FBEA 1RIWC 3T28A 4WMFA 1ELDE 5JYIA 1C2KA 2CHAC 2V3HH 4IN1A 5DP6A 1TBQH 3SUGA 5L2ZH 4FXGH 1XVOA 6GCHF 1QB1A 5FX6A 1K2I1 3NKKA 3SU5A 4KTCA 1H1BA 1SLWB 3GISB 2ANWA 1AQ7A 2STAE 4YLUA 3L6PA 2BD3A 3M5NA 1YKTA 3NPSA 1P03A 1Q2WA 3GCHB 2Q6DA 1EJNA 5BPEA 1AU8A 1EOJA 4DIIH 1A2CH 1XKAC 2BVRH 4B2AA 7GCHF 3LGUA 3NXPA 2Y6TA 3UFAA 1FN6A 1YP9A 4FUHA 2ZDAH 1Z1JA 3LDXH 1J15A 2OC7A 1RTFB 5HMAA 1QIXB 2SFAA 2SGQE 3SV9A 1LPGB 2O8LA 1SGCA 2WV4A 4JZ1A 1QL9A 3UY9A 4OS4A 5HGGA 3URDA 5F8ZA 2VVVA 5DG6A 1HAHH 2P95A 5JPMH 2QF3A 1PPCE 1TX8A 1AY6H 2PTCE 1DY9A 2JKHA 1GJ7B 1FDPA 1P9UA 4Y7BA 2VWMA 5F8TA 3SOSA 1TBRH 1GI1A 1DOJA 2PW8H 1NTPA 4NA8A 2GMTB 1F5RA 1GBAA 3SU4A 2HRVA 3V13A 1UK2A 5LH8A 1EB2A 3SU0A 1B5GH 2ZGCA 1Y3VA 3QO6A 2BDBA 3KQEA 2YNBA 5E2OA 1LPZB 2R3YA 4Y76A 1X7AC 3TK5A 3EA9A 1GBMA 4LZ1H 1SOZA 3ZZ3A 2AS9A 4X1SU 2IPHA 1OP2A 4D9QA 3QZQA 1CGHA 1ZPCA 5GCHF 3TJVA 1DT2A 1YCPM 2OBQA 3E0PB 3GDUA 3PMBB 5AVDA 1TBZH 5CHAB 3BEFB 1KTTB 1V2LT 1GMCG 1S82A 2RCEA 3ITIA 3SGBE 1T32A 1GWAA 2Z9IA 2Y5GA 5ESTE 4E7RG 3A8DA 1SGDE 1V2ST 3IWMA 1U6QA 4CHAB 3DFLA 1C1RA 1S6HA 5EG4A 1GJBB 3V7TA 3VGCB 3ATWA 1D3QB 1O34A 5FAHA 1YPHE 1ELVA 1QR3E 1BTHH 3ZVBA 1IQLA 3KCGH 3V12A 3U8RH 3MH4A 1YYY1 3GYMA 1WAYB 1UTQA 3PTBA 2W5EA 2BQ6B 1E35B 2FOEA 1N6XA 3PTNA 2SGFE 3RXBA 1C2FA 1MTSA 4ISOA 1E0FD 3KN2A 1O30A 4AOQA 2BHGA 1C1NA 1XXFA 3R3GB 3HGNA 4NWLA 5AFZH 2PR3A 4GPGA 2ZWLH 1V2MT 1P0SH 4GHTA 1A61H 3I77A 1C2JA 1V2OT 3QZRA 4GLYA 1C2EA 1O5FH 3QUMP 1MKWH 3UOUA 2ZA5A 2F9PA 2A32A 2HNTE 5GPIB 2BXUH 2JH5D 1O3PB 1EZUC 2BD5A 2GMTC 4K1TA 5EPYA 1CVWH 2VWOA 2ZHEH 1O2XA 5JDUB 2UUYA 5F8XA 3RU4E 1WYKA 2H5CA 1QL7A 3ZZAA 4GHQA 1ZTJA 1YCPH 1O2GH 4XE4A 2OD3B 8LPRA 1Z8IB 3FZZA 1ANDA 1PPBH 3KQBA 3MOCA 1KXAA 3SU2A 1OXGA 5F03A 1G32B 2BOHB 2FYQA 1TNGA 4NA7A 3K65B 7ESTE 4WMDA 2FDAA 1PYTD 4M7GA 2ODPA 1DITH 1TQ7B 1UMAH 1C5NH 2ZHQH 1EPTA 1SG8B 3MU4A 1NC6A 3S9BA 4GCHG 4FVBA 1GBFA 1ABIH 2AGIX 3P6ZB 3MNBA 1PPEE 1A7SA 1DSUA 2FOBA 4YESB 3MYWA 1MKWK 1AN1E 1AO5A 1TWXB 3W95A 1E36B 3A7TA 3UREA 2BXTH 1ANEA 2VU8E 3A8CA 9LPRA 1OOKB 3GCTG 5FPTA 1EZSC 2JH0D 2BD2A 5CE1A 1OWHA 1ELCA 1O2IA 1HCGA 3B9FH 2C4FH 4TYDA 1XX9A 1GPZA 1RD3B 3MU1A 1O3CA 2PKAB 2ZPSA 3HKJB 4IGDA 5DP7A 4WXVA 4D9RA 3AW0A 4D7GA 4GSOA 1IQKA 2F9OA 2FYRA 4MNVA 3SBKA 1SFQB 1XUIA 2P59A 1D9IA 3M3SA 4CR9A 1DLKB 2GVFA 4IMQA 3TJNA 1C5LH 1GJDB 3GY6A 1LVOA 4AB9A 1MMJN 3VFEA 1AVGH 1TPOA 2O8MA 3OSYA 1ZRBA 2PUXB 4TY6A 2XTTB 1FY8E 3P8GA 1BOQA 3TH2H 4IS5A 1D3PB 2GZ9A 4OGXA 1ZTLA 1HNEE 1K1OA 3KQCA 2VIDA 4NZQA 3SJKA 2ZU4A 1O38A 1GG6B 1IQGA 1INCA 1OWKA 2BDGA 1O2VA 1LMWB 1BIOA 2ZI2H 5DP3A 3S69A 1O2HA 2FOFA 2HPPH 2Y7ZA 2ZF0H 4LZ4B 2ZFTA 4FVDA 2OC0A 2PTNA 2Y5HA 4X0WU 1C9TA 4ZROA 1F92A 5JBTA 2JETB 1QQUA 2BD7A 5LPEA 1C2MA 1BBRH 3SV7A 5DP9A 5EQRA 1SB1H 1ACBE 1FAXA 1O32A 3A8AA 2XCFA 4FU7A 4K60A 1FIZA 4ABBA 2FOGA 1ESBA 1HRTH 2FS9A 3SI3H 4ZKSU 2ZPRA 4CBNA 1FIWA 1ZYOA 2ZDVH 3RXCA 1TNHA 3SN8A 5EPNA 2J95A 1SLXB 2D8WA 2BY6X 1GBEA 1AFEH 1RRKA 2BQWB 1EX3A 2G4TA 1ZHRA 4ZKNU 1G3BA 3SNBA 5DK1A 1ESAA 1V2PT 1O2YA 1C2DA 2FODA 4I33A 3SJ8A 2OC1A 1XUFA 3KNXA 2GZ7A 1EB1H 3RXFA 4XBBA 1K1PA 1BZXE 3E0NB 3GCHC 1T4UH 2OTVA 1O5EH 1P06A 3G01A 2C90B 1HGTH 3VPKA 1SMFE 1ZGIA 1OX1A 4NA9H 3SGAE 1NZQH 2ZG0H 7GCHG 4YOIA 3OYPA 2GCTC 2O8UA 4ABEA 4D76A 2C3SA 5T3HA 2BY8X 3NWUA 1GI9B 2ZFFH 3AVZA 1C9PA 5E0HA 4X8UH 3MO3A 1DICA 3MFJA 1TGTA 2ZFPH 3GDVA 2B7DH 1RIWB 4UDWH 3F68H 2V3OH 4WXIA 4CRGA 2IN2A 1B0FA 5DKMA 3A89A 1DM4B 3UR9A 1IQJA 4E06H 4XOJA 1GMDF 2ASUB 1A3BH 6GCHG 1Q31A 2BDAA 2GCHG 3GICB 3UUZA 1J17T 3P95A 1WTHD 1C5VA 1FPCH 4DJZB 2WUBA 2D26C 3GY4A 5C67A 1G3CA 3U1JB 1O3DA 1XUKA 4Q7XA 2ODQA 5T6FA 4YOJA 2AMDA 5J4SA 1THSH 2GX4A 4Y8XA 4ZAEA 4DOQA 2Z94A 3ZZ7A 1J8AA 4O3UA 2CJIA 1P3EA 4ZUHA 1ZR0A 1ESTA 1NU7B 4Y8YA 1DWDH 1TMBH 1C1TA 1T4VH 5DPAA 1MTNB 3TJUA 1CA8B 3OY5U 1W2KH 1BTYA 1TRNA 3RM0H 3KEEA 4FUJA 3RXQA 1EZXC 2FS8A 2Z7FE 4JCNA 2HGTH 2QCYA 1C1QA 1SGNE 2XW9A 4O9VA 4X1QU 3PLKA 1AFQC 2ZFSA 4K8BA 2XXLA 1XUJA 3Q00A 3SUEA 2XC5A 1GJ9B 1Q3XA 1G36A 3LJOA 1KTSB 1C1MA 1VCPA 3SW2B 3KGPA 1P10A 1BITA 1HAOH 1QJ1B 1TNIA 4FUEA 1AD8H 2H2ZA 3VEQB 1NRRH 1WBGB 1O3BA 3PO1B 1BMMH 2OLGA 3GYLB 1G2MA 2NU2E 1JBUH 4IN2A 1EOLA 1P09A 5DP4A 1UJ1A 3NZIA 1O33A 1T8LA 4I8HA 1S83A 3SORA 5BRRE 4BTUB 1IAUA 2HLCA 4ESTE 1C1SA 1J14A 4AGJA 2XWAA 3MU0A 1HJ8A 1G3DA 2VVCA 4HI3A 1YCPK 1TA6A 4FUFA 2WPMS 1DXWA 3GCTF 1W0ZU 3LGVA 4X2VA 1LO6A 4Y0ZE 5C1UA 4DT7B 3QTVH 1MCTA 4NIVA 1XM1A 4CHAC 1KLTA 1HJAC 2R0LA 5AFYH 2PUQH 1GJAB 3MU5A 4WF8A 3VGCC 1VJAU 3A7XA 2ZGBH 3M3VA 5K0HA 1UTNA 2GKVE 1EJMA 1SGRE 3DUXH 2GD4B 2B0FA 2VINA 1E38B 5A8YA 2UWLA 4A1XA 1VITF 3ZVFA 1A3EH 1UTOA 2H9TH 2PGBB 2SNWA 4UFDH 4CR5A 1SGTA 2J2UA 1ID5H 1RFNA 4B1TA 4A5TS 2SNVA 1LVBA 1O2ZA 1TQ0B 1Z7KA 3S9CA 3SU1A 4Y79A 1SLVB 1KDQA 1CHOG 1O2RA 1Y3XA 1YBWA 4U32A 1NO9H 2JH6D 1TX6A 4KKDA 1JOUB 2ZU3A 1GL1A 1LKBA 1UTLM 1AVWA 1UVOA 3A86A 4Q7ZA 4AG2A 1O36A 3EAJA 1SHYA 1A5HA 4MPVA 4CBOA 1WV7H 2RA3A 2Z9LA 4UFEH 4MPUA 2ZU5A 5C1XA 1SGYE 2F9VA 1O5DH 2P16A 3H7OA 3RLYH 4DG4A 1Y8TA 2Y81A 1DLEA 1GI7B 3VB4A 2ANMH 2FMJA 1KXCA 2FI4E 3CS7A 3CS0A 3M5LA 4A92A 3ZYEA 3MH5A 4GAWA 1VR1H 3ELAH 1AB9B 3GY2A 1C5YB 2TGTA 1MUEB 4GUXA 1HJ9A 2ZCHP 1O3KA 4VGCC 4NSVA 1GHVH 1FUJA 2C8WB 2XBXA 4AN7A 1GBKA 3WY8A 3LIWA 2TGPZ 2FZZA 2P8OC 1HAIH 5LPFA 2B5TB 4OS6A 1DVAH 2Y5FA 4X6OA 3ZZCA 2A7CA 8GCHG 1Z8GA 1PQ8A 3LH1A 4FUIA 5EODA 5EXNA 2ZHWH 3ZYDA 1UTKA 3TGKE 4Z6AH 4YO9A 3C27B 1NN6A 2QXGA 1EAWA 3E8LA 1CSOE 3RXMA 4B2CA 1TOCB 2BZAA 5JBCS 5HXFA 3BG4C 1SGPE 4MG3A 3ZZ4A 1ORFA 1MBMA 2B9LA 3P17H 3SZNA 1SR5C 1HIAB 4B71A 1Z6JH 4I31A 3RUOA 1SFIA 2OC8A 1C1WH 2R2MB 1YM0A 2A7JA 3BN9A 1YPLH 2HNTC 3BV9B 4XBCA 3CENA 1EXFA 3K6YA 1O3IA 2TBSA 1P01A 1THPB 4RKOB 3DD2H 5ETXA 4J1YA 9ESTA 1BQYA 2BDCA 2WINI 1BHXB 3SNCA 2SGPE 1M9UA 2SGDE 3RP2A 1IQMA 1AHTH 3I29A 5TJXA 1ETTH 3P8FA 3ZVGA 3UQOA 4Y6DA 2VH0A 4AZ2B 5EQQA 1LPKB 1MZAA 1TGSZ 3QGNB 5EXMA 3QX5H 1C5TA 3FP8E 1C5OH 4FU8A 4WH8A 1E34B 2NU3E 1AVXA 2G00A 1IQHA 1AUJA 1W12U 3RMMH 4XDEA 1MZDA 1GI0A 1NRPH 4NZLA 1O39A 3UOPA 2WPIS 2A7HA 1HAXB 2JETC 3LGWA 4TPIZ 2TIOA 3SO3A 4ASHA 3A87A 3GY8A 1ZPZA 3L33A 4ZHAA 5T6DA 4K1EA 3TVJB 1CA0B 1BCUH 1S0QA 2GCTB 4XFQA 2BLQA 2O8TA 2DE9A 1VCQA 1C1VH 3GY3A 3MNXA 1LCYA 2P94A 1XXDA 2H1UA 3CP7A 3IG6B 2A4QA 4F4OC 1WU1A 1YF4A 2C8XB 3A88A 4SGBE 1O35A 4I7YH 1BTUA 1P2JA 4UE7H 2A2XH 3ODFA 4INHA 4U01A 3W94A 1DWEH 3HK3B 2GDDA 1K1MA 4X2XA 3TIUA 1TX7A 1V2NT 1BB0B 1AUTC 1NFWA 1MAXA 4FUBA 1BHXF 2FIRH 4CRAA 2FLBH 4IMZA 4ISLA 1FN8A 4NWKA 3TNSA 1O3NA 2ZDLA 3FANA 1TFXA 4MNXA 1KYNA 3H7TA 1D3DB 4JK5A 1H8DH 1VCWA 1LVMA 1V2UT 3QK1A 2VIWA 1MTNC 1KXDA 4ZHLU 3E1XB 5FHTA 2PGQB 1H9HE 1GHAG 2GDEH 1T8NA 2AERH 1HIAA 4CREA 2AYWA 1P2MA 1NY22 2KAIB 2EI6A 1DDJA 2FTLE 4FU9A 1CBWB 2BM2A 4AYVB 2HWLB 1ELGA 1TNJA 4I8JA 3TK9A 1GDNA 5SGAE 1QRXA 1W3CA 2VH6A 2ZCLP 2STBE 1KSNA 2LNCA 3E16B 1C2HA 5EOKA 1QJ6B 3O8RA 3RXIA 1LTOA 2W7SA 2GV6A 5JB9S 5DP8A 2G52A 1TALA 4B76A 1O3HA 4AORA 1G3EA 1CU1A 1GI8B 1C1PA 3M7UA 3NUMA 1AZZA 1NPMA 2PLXA 3O8CA 5L30H 2ZO3H 1CHGA 5T6GA 2VIPA 1F0UA 3NK8A 5TCAA 5FX5A 1ZMJA 5FPYA 4K1SA 4BAMB 1FJSA 4BANB 4ZMAH 3U1IB 2F91A 2ZHFH 4TWWA 1O3LA 2BLWA 1HAYB 1PFXC 3Q3XA 4F49A 2FPZA 1S84A 1W8BH 1DY8A 1ZSLA 2UUJB 4H6SB 1P8VC 2ZDMA 1OPHB 1MU8B 2ZTYA 2ZQ1A 2C8YB 3SV2H 3IITA 2FLRH 1GI6A 3BG8A 4IC5A 1PQAA 1ARBA 1AGJA 4TPYA 3RXPA 1ZJDA 4Y8ZA 1V2TT 2AFQB 1G37A 4A1TA 2QF0A 1AFQB 1GBLA 3DHKH 1CT2E 1FPHH 1YLCA 3QDZB 2BD8A 3RXOA 1GBBA 3EA7A 1O5BB 5E2PA 2ESTE 4HTCH 3U69H 4DURA 2K1QA 1O2SA 1T7CA 3SV6A 1ZTKA 2M5TA 3SUDA 1PPGE 3TH4H 1P04A 2G81E 3UNQA 2FOCA 2F83A 1EAXA 1GBDA 1WUNH 4JZDH 2FX6A 2BY5X 2WUCA 3DT0H 2Z3CA 2A31A 1CBWC 1GMHF 1BMNH 5PTPA 3BTHE 1FY4A 3S7HB 3P8NA 1NROH 2XRCA 1QBVH 3E6PH 2CF8H 1FY5A 1C2GA 1GJ6A 2QA9E 4GVUA 2YOLA 1PPHE 4XSKU 1NFXA 2OINA 3NCLA 1QURH 4SGAE 3HGPA 4MNYA 1HUTH 3RXEA 3LC3A 4JZFH 1TRYA 3BIUH 3SJ9A 1F7ZA 2J94A 3E91A 4HFPB 4UEHH 5EQSA 1HB0B 4H4FA 1K21H 3A83A 1FZZA 4RKJB 3GY5A 3RXSA 2ZKSA 1ZJKA 2W3KA 2FESH 4OS7A 1RTLA 1XKBC 2XC4A 1TPSA 1OSSA 3FP7E 2QN5T 3GY7A 1SBWA 2ZQ2A 4E05H 1O3JA 1AB9C 1TNLA 1AIXH 2UWPA 1RXPA 5HM9A 1IQFA 1KIGH 3DA9B 4VGCB 1C5UA 1NESE 4MPXA 1AWHB 2GGVB 1LHGH 1WQVH 3M61U 1QCPA 1NFUA 4ABFA 3MHWU 1MTUA 3LPRA 1MKXK 1TMUH 2OQUA 5ABWA 1XVMA 1GHBG 4QT8C 1NU9A 1KXBA 2F9NA 1MQ6A 1G9IE 4IC6A 2CXVA 2XWBI 3MWIU 1BBRK 1OKXA 2WYJA 3P8OA 4X1RU 2Z3EA 5C5NA 1BTWA 3TPIZ 3UWIA 1NRSH 2KAIA 2VWLA 2O8WA 2P3TB 2VB0A 2V35A 1O3OA 1RJXB 3FZDA 2ANKH 2ODYB 1VGCC 1W14U 3OX7U 1C5RA 1Y59T 1ZHMA 3ZZ6A 3RXKA 1GBCA 1O2TA 3SQHE 2BTCE 5FCKA 3ZZBA 1TNKA 4BAKB 2BDYA 3TH3H 2BVXH 2BX4A 1CT4E 1EP5A 1HFDA 1BT7A 2BD4A 4Y0YE 1C5SA 1UVSH 3RMLH 1IQIA 3ODDA 1GHXH 3STIA 1H9LB 3O8BA 4A1VA 2FO9A 1MKXH 5CHAC 3P92A 3SNEA 1ANCA 1GJCB 2C93B 1GDUA 2ULLA 3VXEH 4NIYA 4YT7H 1WOFA 2FX4A 4CRDA 2OUAA 8ESTE 4X6MA 3A82A 5E8EH 1Z8JB 3UIRA 1WSSH 2VJ1A 1DUAA 2W26A 3M7QA 1YC0A 1FY1A 4BAHB 4X6PA 2QY0B 3MU8A 3RXAA 1DWBH 1VZQH 5A09A 2Q6GA 1O3MA 1QA7A 4R0IA 3SU3A 4DY7B 2HNTF 2P3UB 2PKSB 1ZHPA 1QL8A 5A8ZA 2CV3A 2GV7A 4AYYB 1MTWA 3TU7H 5HYOA 2HPQH 3KF2A 1NRNH 1Z71A 1C5MD 1UVPA 3SHCH 4U2WA 4MVNA 5DGJA 1Y5AT 5FCRA 2B8OH 3LKWA 1YPMH 2A4RA 3A7ZA 6CHAB 4I8KA 1OYQA 1C5PA 2FI5E 1EJAA 1N8OB 1P2IA 4TWYA 2BLVA 3PMHB 3JZ2B 1AI8H 1ETRH 1A0LA 1D3TB 3SUFA 1FAKH 1L1GA 4B74A 1DXPA 1PPZA 1ZRKA 4KELA 1C5ZB 2J92A 1C4Y2 1CGJE 1L4DA 1F2SE 2WPLS 1OP8A 1V2WT 7KMEH 4J2YB 3N7OA 2A0QB 4DW2U 3AAUA 5HM2A 1V2RT 3RLWH 1KXFA 2BMGB 1CQQA 1VGCB 4U30A 4I8GA 3TNTA 5JBBS 1SI5H 1BTZA 3FP6E 5I25A 1P9SA 1HAPH 1CT0E 1LHDH 4WH6A 2AEIH 4AB8A 5A0AE 1V3XA 4OS5A 3R0FA 4UD9H 5GJ4B 2GT7A 1BDAA 3QN7A 4WVPE 2TGDA 3BTEE 1FV9A 1P2QA 1TGNA 1UCYK 1GI5A 4ABIA 4AFSA 3ESTA 2BX3A 2O9QA 3VB6A 1A0HB 1O2NA 1SGQE 3T5FH 2PSYA 4NCYA 1ELAA 5FBIA 3L3TA 2VIQA 2A45B 2W7UA 5IYTA 4ZKOU 1E37B 2QIQA 4ISNA 2TGAA 1GHWH 1QRWA 4YLQH 2ALPA 3Q76A 2ZU2A 2ZTZA 1WQSA 2NWNA 5A8XA 2ZC9H 4WWYA 1SQAA 4X2YA 4ISIH 3ZVEA 1EKBB 4ZXYH 1GVKB 1GHBF 2BY7X 3ATIA 3F9FA 3SV8A 4I8LA 1C5QA 1YLDA 4H6TA 3M3TA 2GZ8A 3PLPA 3FFGA 1G2LA 3AASA 3D62A 3PB1E 3TGIE 4BAOB 1YPEH 1ZSKA 1ZGVA 1D4PB 2D1JA 4ZXXH 1BMAA 1K1LA 3SI4H 4BTTB 4BXWA 4ZHMU 1EAUA 3ENSB 1GBTA 3ATMA 3PROA 4LXBH 5C3NA 1UCYH 5EU8A 3SNDA 1SQTA 4BNRA 3OTJE 1SGFA 1K1IA 3VB7A 1P12E 1RTKA 1W11U 1IOEA 4A7IB 4TY7A 1Z1IA 4BTIB 1HBTH 1YPHC 2NU0E 1K28D 3PV4A 3KIDU 1CO7E 2RG3A 1Y5BT 4D8NA 4WMEA 5GIBA 1QNJA 4JYTA 1S85A 4Q80A 1O2PA 5K7RA 1NS3A 2BLOA 4JYVH 1DPOA 3T26A 5DO4H 3EDXB 2J34A 5ESBA 1B0EA 2Y80A 4AFZA 3RXRA 1FY3A 1QBOA 1G30B 4AGKA 2XBYA 3RC6A 1O5CB 2HVXA 1F0SA 1EATA 1FLEE 3EGKH 3KQDA 1W10U 1P57B 3M35A 2FP7B 1H9IE 2OBOA 1NT1A 1SVPA 3BSQA 4NIWA 1P3CA 1GG6C 1O3FA 1KXEA 1LQEA 2CF9H 2VGCC 3LC5A 1KDQB 3VB5A 3ZV9A 1O2LA 4WY3A 1SPJA 1HAVA 1BTXA 2UUKB 4Y7AA 3ZZ5A 5L2YH 1O2UA 2AMPA 1O2WA 2WYGA 2Y82A 4D7FA 1QQ4A 1W0YH 3TLOA 3PLBA 4K8YA 2FWWA 1VITG 3D49H 5DP5A 2WPJS 1V2KT 1B7XB 2BB4A 4FUCA 2G55A 1KLIH 1O31A 3QTOH 1BRUP 2VVUA 3B8JA 4OGYA 1GVLA 3RXJA 1EPTB 2ZZUH 3RXLA 2P3FH 2G8TA 4CRBA 5GDSH 1TOMH 1MD7A 3EE0B 1UK4A 3MNCA 3ZZ9A 3F9EA 1F5LA 3A7VA 2A4GA 1MH0A 3S9AA 4INKA 2AIQA 2ZNKH 7LPRA 3UTUH 4ABGA 3F1SB 2G51A 4MPWA 1AE8H 1GI4A 3SU6A 4DVAU 3T29A 2ZIQH 1GL0E 5C2ZA 1O2OA 3F9HA 1BTPA 1ABJH 3PYHA 1L2EA 8KME2 4YZUA 1THRH 5FXLA 3UNRA 1LHCH 2PFEA 3T27A 4LK4A 3D23A 4X2WA 3D65E 1C1UH 2HOBA 1W13U 3K6ZA 1C4U2 1HXEH 1O0DH 1S5SA 1DFPA 1CGIE 3RU4T 1O37A 1ANBA 2AIPA 1WCZA 1A1RA 5G4BA 1DS2E 2Q1JA 4Y71A 1HPGA 4ABDA 1MBQA 1C4V2 1SGEE 4MNWA 4O03A 2W3IA 3GOVB 3C1KA 4JZEH 2IJOB 1O3GA 2DE8A 5A2MH 1ETSH 1NRQH 1BRCE 1EZQA 2QC2A 3H5CB 3QLPH 3OY6U 1L0ZA 2R9PA 1A4WH 1N6YA 1EASA 1C5XB 1FI8A 4MTBA 5EXLA 3KHVA 2LPRA 1NM6A 2F9BH 1P11E 5AF9H 2FEQH 1Y5UT 2OP9A 4DCDA 1LHFH 3P70B 2ZP0H 2OQ5A 1BA8B 3BTFE 1UVTH 4RN6A 3A85A 4BXSA 4K69A 4UONA 1LDTT 1OS8A 4X1NU 2EA3A 2EI7A 3PO1C 2V0BA 2BQ7B 1QY6A 3Q3YA 2FI3E 3HATH 3BTWE 1FMGA 3FVFB 2AGEX 1TMTH 3PMJA 4INLA 3BIVH 4X8VH 4JZIA 1NFYA 2BDHA 3RXTA 1BRAA 3RM2H 2ZTXA 3LT3A 1K1JA 1O2QA 1TABE 1BJVA 2ALVA 1TRMA 3VXFH 2Q6FA 4BAQB 4PROA 2EC9H 4MLFB 1IQEA
chains in the Genus database with same CATH superfamily
1WTGH 2PKAA 1F5KU 4YM9A 2ANYA 2NU4E 1GMDG 2I6QA 5E0JA 1SL3A 2FTMA 2ZDNA 1OWEA 1SSXA 1T8MA 3ZVAA 4DIHH 4K3JA 1DWCH 1H8IH 1HJAB 1JXPA 3AAVA 4OS2A 4KTSA 1EAIA 1WDIA 2F3CE 2AMQA 2VIVA 2DUCA 3BEUA 1V6DA 1ZOMA 3GDSA 1MCVA 3RXHA 2H9EH 1QBNA 3M5OA 1UVUH 1ZLRA 3ZZ8A 4UFGH 2WPDD 3ZV8A 2XBWA 4THNH 3URCA 2ZPQA 1QGFA 1TA2A 1GCTB 1SLUB 1O3EA 1MD8A 2UUFB 2BDIA 1UTMA 2YNAA 4IBLH 2SGEE 2KCPA 3T25A 3V0XA 1KLJH 4Q2KA 3V3MA 3EQ0H 3BTME 1SGFG 2IOTA 1A5GH 4CRFA 1P2NA 2CMYA 3RDZA 1K1NA 2AGGX 1TONA 1O2JA 1ZMLA 3N99A 2QXHA 1TIOA 3MMGA 1SHHB 1C1OA 4Z0KA 3FAOA 1PYTC 4ABHA 2CHAB 3SNAA 1K22H 1LHEH 1LVYA 1GJ8B 5EW2H 1FXYA 2BYAX 3ZZDA 1DE7H 1YPJH 1O2KA 2F4LA 2QV1A 2G4UA 1GJ4H 2BY9X 1FQ3A 4KP0A 4MDSA 1O5AB 5F6MA 3MTYA 2J5UA 1ELFA 1DANH 2WPKS 5FPSA 2EI8A 2RDLA 4IW4E 4I32A 3H09A 4O3TA 3A84A 5C1YA 1VJ9U 3SJOA 1DSTA 2PKSC 1HAVB 1D6WA 1AKSB 2H5DA 3KL6A 4TSFD 1TLDA 4JYUH 4F55A 5C0UA 5LGOA 3STJA 2CGAA 1KY9A 2M2AA 1ELBA 3ATLA 6CHAC 2A2QH 3RXGA 1N8OC 2HALA 1PQ5A 1GDQA 2QAAA 6LPRA 2VWNA 3RC5A 2TRMA 4AFQA 2WPHS 5DSFA 4KTUA 2NU1E 4FUDA 3DFJA 2YMSC 3E3TA 1RGQA 5AHGH 3Q77A 3F9GA 3A8BA 5T1VA 1BMLA 4A6LA 2R2WU 4NIXA 1TGBA 3SJIA 3LGYA 1GCTC 2ZGXH 1O5GH 3GCNA 1J9CH 4ZH8A 2FOMB 4DGJA 3EE7A 4NG9H 1YWUA 5J4QA 1HAZB 3F3BA 5F53A 4AFUA 1GGDB 2QXIA 1L4ZA 4ZKRU 4ABAA 3WWBA 2A5IA 3UR6A 1GCDA 2FM2A 3TK6A 3PM3A 1OP0A 1S0RA 1ZZZA 3HK6B 2Z9GA 3QWCH 1LKAA 1AE5A 2XBVA 3PWCA 4R8TB 4JMYA 3CNRA 1IHTH 2A4OA 1Y3UA 5GXPA 2ZEBA 1MU6B 3VB3A 3A81A 1T31A 2XC0A 4Y11E 5DJ7A 2J38A 4RI0A 4CRCA 2RDEA 2GT8A 3Q3KA 1P2OA 2A1DB 2P8OB 3BTKE 4Y10E 5C5OA 1CHOF 2JIZD 3BF6H 3HKIB 1QA0A 3AW1A 3ZVCA 1JRSA 4H42U 2QYIA 3BEIB 1C2LA 2KCOA 4B75A 4YT6H 4ISHH 1TYNA 2FOHA 2Z9KA 3RXUA 1UW7A 2VGCB 5C0TA 8GCHF 1UHBB 2H6MA 3EA8A 1UO6A 2AH4X 2SGAA 2UWOA 3N7EA 4NSYA 5EW1H 3T2NA 1TAWA 1PJPA 1YPKH 1YPGH 3U98H 4B2BA 3K2UA 3BG4B 1AMHA 4BOHA 2V3MA 3BTTE 1S6FA 3RMNH 3SQEE 3UNSA 3M37A 4GCHF 2Z6BD 4RT1A 1PQ7A 1CA0C 1S81A 2PSXA 1TGCA 2GTBA 1LQDB 1EP6A 2Y7XA 2VNTA 1GBIA 3LU9B 4YTAA 3RC4A 2OXSA 1FNIA 1Z6EA 1EPTC 1JIRA 1QB9A 3TGJE 3BTGE 3LONA 5H4IB 4E7NA 2ZFRH 1QFKH 2ZGHA 2ILNA 1QHRB 1UTPA 3U9AH 3ZVDA 4AG1A 2ZCKP 3GCOA 1ZMNA 3K9XB 1HAGE 3M5MA 3F6UH 1QRZA 1A0JA 3RU4D 1EUFA 4K2YA 2J9NA 2WV5A 1TE0A 1P05A 1L1NA 4X6NA 1Y3WA 1BJUA 2ZECA 4WJG2 2CN0H 1Z8RA 2FXRA 1AZ8A 1GMHG 1JIMA 1OWJA 1QJ7B 2XNIA 4FUGA 3TITA 1EQ9A 4X1PU 3BTDE 1GGDC 3JZ1B 2H9HA 2PP6A 3I78A 3M7TA 1ZPBA 1CE5A 2VIOA 1TPPA 3M36A 2BVSH 4JK6A 1IHSH 3U8TH 4LOYH 1UCYE 2QXJA 4KGAA 1L1JA 5LPRA 1TPAE 3A7YA 1OWDA 2JDID 5L6NH 2R3UA 1BUIA 2GP9B 1Y3YA 5GWZA 1A5IA 2YMSD 3S7KB 3SGQE 3FOAA 2Z9JA 4NFFA 3S0NA 1P2KA 4CH2B 1K9OE 3MH6A 4XBDA 5CMXH 1W7GH 4CH8B 3DSPA 4O97A 1V2JT 2A5KA 2ZHDA 3RXDA 1VITH 5JBAS 5IK2D 6ESTA 3U8OH 1SC8U 3UPEA 3UWJH 4Q7YA 3MI4A 2A5AA 3HPTB 1DUEA 1HDTH 2OCVB 1OYTH 1ARCA 3SHAH 1JWTA 1GHYH 1HYLA 3LH3A 1BBRE 4MQAA 1O3AA 1HLTH 3EYDA 4NFEA 3LGTA 2EY4C 2Z3DA 1S6LA 1YGCH 3BTQE 3RMOH 2D2DA 3OU0A 1O2MA 1UTJA 5JB8S 1GHZA 1UHBA 1J16A 1BRBE 4ABJA 1GBJA 1MAYA 3RXVA 1A46H 1GMCF 5E0GA 2QGRA 1XUGA 2C8ZB 1FONA 3UQVA 5GCHG 2BD9A 1MTVA 5A0BA 3E90B 1V2VT 1TB6H 1SQOA 5B6OA 2BOKA 2ZDKA 1GI2A 3PWBA 1OWIA 1RS0A 3MH7A 4AX9H 4HGCA 5C17A 1ELEE 1GJ5H 1F0TA 3T62A 3O8DA 4RSPA 3QGJA 2THFB 1H4WA 4K5ZA 1GVZA 2G5VA 4UFFH 3MNSA 1IQNA 3B23B 2GCHF 4B73A 4NGAH 3A7WA 1HV7A 1W7XH 3LJJA 3LOXA 2TPIZ 2PWXA 3ATKA 1SGIB 2FOAA 2EEKA 2F9UA 2ZGJA 5KECA 1SOTA 5A0CA 2P93A 1HXFH 2R0KA 3OAAD 4X8TH 1GBHA 1GHAF 5IDKA 2J4IA 2RA0A 3VG8A 1JMOH 5EGMA 1V2QT 2XYAA 3MO9A 5TCCA 1ZSJA 3A80A 5I46H 2V6NA 3LGIA 5C20A 2ZU1A 4YOGA 1GI3A 3MO6A 1JRTA 1C5WB 4OS1A 2I6SA 4HZHA 1QB6A 1PPFE 2PV9B 1UK3A 2PHBA 1C2IA 4X8SH 1ELTA 1XUHA 1N1LA 1XMNB 2XCNA 3TJOA 1DX5M 3PMAB 1AWFH 1QTFA 1AKSA 1P02A 1D6RA 2ZFQH 4ACBA 2BZ6H 1F0RA 1MQ5A 2G5NA 1T8OA 1H8HD 1RIWC 5FBEA 3T28A 4WMFA 1ELDE 5JYIA 1C2KA 2CHAC 2V3HH 4IN1A 5DP6A 5CDFE 1TBQH 3SUGA 5L2ZH 4FXGH 1XVOA 6GCHF 1QB1A 5FX6A 1K2I1 3NKKA 3SU5A 4KTCA 2K0QA 1H1BA 1SLWB 2KCAA 3GISB 2ANWA 1AQ7A 2STAE 4YLUA 3L6PA 2BD3A 3FO8D 3M5NA 4YXWD 1YKTA 3NPSA 1P03A 1Q2WA 3GCHB 2Q6DA 1EJNA 5BPEA 1AU8A 1EOJA 4DIIH 1A2CH 1XKAC 2BVRH 2L6OA 4B2AA 7GCHF 3LGUA 3NXPA 2Y6TA 3UFAA 1FN6A 1YP9A 4FUHA 2ZDAH 1Z1JA 3LDXH 1J15A 2OC7A 1RTFB 4P00A 5HMAA 1QIXB 2SFAA 2VBCA 2SGQE 3SV9A 5FL7D 1LPGB 2O8LA 1SGCA 2WV4A 2XOKD 4JZ1A 1QL9A 3UY9A 4OS4A 5HGGA 3URDA 5F8ZA 2VVVA 5DG6A 1HAHH 2P95A 5JPMH 2QF3A 1PPCE 1TX8A 1AY6H 2PTCE 1DY9A 2JKHA 1GJ7B 1FDPA 1P9UA 2KZ4A 4Y7BA 2VWMA 5F8TA 3SOSA 1TBRH 1GI1A 1DOJA 2HLDD 2PW8H 1NTPA 4NA8A 2GMTB 1F5RA 1GBAA 3SU4A 2HRVA 3V13A 1UK2A 5LH8A 1EB2A 3SU0A 1B5GH 2ZGCA 1Y3VA 3QO6A 2BDBA 3KQEA 2YNBA 5E2OA 1LPZB 2R3YA 4Y76A 1X7AC 3TK5A 3EA9A 1GBMA 4LZ1H 1SOZA 3NRLA 3ZZ3A 2AS9A 4X1SU 2IPHA 1OP2A 4D9QA 1SQRA 3QZQA 1CGHA 1ZPCA 5GCHF 3TJVA 1DT2A 1YCPM 2OBQA 3E0PB 3GDUA 3KYGA 3PMBB 5AVDA 1TBZH 5CHAB 3BEFB 1KTTB 1V2LT 1FX0B 1GMCG 1S82A 2RCEA 3ITIA 3SGBE 1COWD 1T32A 1GWAA 2Z9IA 2Y5GA 5ESTE 4E7RG 3A8DA 1SGDE 1V2ST 3IWMA 1U6QA 4CHAB 3DFLA 1C1RA 1S6HA 5EG4A 1GJBB 3V7TA 3VGCB 3ATWA 1D3QB 1O34A 5FAHA 1YPHE 1ELVA 1QR3E 1BTHH 3ZVBA 1QZ8A 1IQLA 3KCGH 5KEDA 3V12A 3U8RH 3MH4A 1YYY1 3GYMA 1WAYB 1UTQA 3PTBA 2W5EA 2BQ6B 1H8ED 1E35B 2FOEA 1N6XA 3PTNA 2SGFE 3RXBA 1C2FA 1MTSA 4ISOA 1E0FD 3KN2A 1O30A 4AOQA 2BHGA 1C1NA 1XXFA 3R3GB 3HGNA 4NWLA 5AFZH 2PR3A 4GPGA 2ZWLH 1V2MT 1P0SH 4GHTA 1A61H 3I77A 1C2JA 1V2OT 3QZRA 4GLYA 1C2EA 1O5FH 3QUMP 1MKWH 4FOUC 3UOUA 2ZA5A 2F9PA 2A32A 2HNTE 3F0PA 5GPIB 2BXUH 2JH5D 1O3PB 1EZUC 2BD5A 2GMTC 4K1TA 5EPYA 1CVWH 2VWOA 2ZHEH 1O2XA 5JDUB 2UUYA 5F8XA 3RU4E 1WYKA 2H5CA 1QL7A 5HIZA 3ZZAA 4GHQA 1ZTJA 1YCPH 1O2GH 4Q4LA 2OD3B 4XE4A 1Z8IB 3FZZA 8LPRA 1ANDA 1PPBH 3KQBA 3MOCA 1KXAA 3SU2A 1OXGA 5F03A 1G32B 2BOHB 2FYQA 5HKKD 1TNGA 4NA7A 3K65B 7ESTE 4WMDA 2FDAA 1PYTD 4M7GA 2ODPA 1DITH 1TQ7B 1UMAH 1C5NH 2ZHQH 1EPTA 1SG8B 3MU4A 1NC6A 3S9BA 4GCHG 4FVBA 1GBFA 4HG6A 1ABIH 2AGIX 3P6ZB 3MNBA 1PPEE 1A7SA 1DSUA 2FOBA 4YESB 3MYWA 1MKWK 1AN1E 1AO5A 1TWXB 3W95A 1E36B 3A7TA 3UREA 2BXTH 1ANEA 2VU8E 3A8CA 9LPRA 1OOKB 3GCTG 5FPTA 1EZSC 2JH0D 2BD2A 5CE1A 1OWHA 1ELCA 1O2IA 1HCGA 3B9FH 2C4FH 4TYDA 1XX9A 1GPZA 1RD3B 3MU1A 1O3CA 2PKAB 2ZPSA 3HKJB 4IGDA 5DP7A 4WXVA 4D9RA 3AW0A 4D7GA 4GSOA 1IQKA 2F9OA 2FYRA 4MNVA 3SBKA 1SFQB 3DSOA 1XUIA 2P59A 1D9IA 3M3SA 4CR9A 1DLKB 2J98B 2GVFA 4IMQA 3TJNA 1C5LH 1GJDB 3GY6A 1LVOA 4AB9A 1MMJN 3VFEA 1AVGH 1TPOA 2O8MA 3OSYA 1ZRBA 2PUXB 4TY6A 2XTTB 1FY8E 3P8GA 1BOQA 3TH2H 4IS5A 1D3PB 2GZ9A 4OGXA 1ZTLA 1HNEE 1K1OA 3KQCA 2VIDA 4NZQA 3SJKA 2ZU4A 1O38A 1GG6B 1IQGA 1INCA 1OWKA 2BDGA 1O2VA 1LMWB 1BIOA 2ZI2H 5DP3A 3S69A 1O2HA 2FOFA 2HPPH 2Y7ZA 2ZF0H 4LZ4B 2ZFTA 4FVDA 2OC0A 3OFND 2PTNA 2Y5HA 4X0WU 1C9TA 4ZROA 1F92A 5JBTA 2JETB 1QQUA 2BD7A 5LPEA 1C2MA 1BBRH 3SV7A 5DP9A 5EQRA 1SB1H 1ACBE 1FAXA 1O32A 3A8AA 2XCFA 4FU7A 4K60A 1FIZA 4ABBA 2FOGA 1ESBA 1HRTH 2FS9A 3SI3H 4ZKSU 2ZPRA 4CBNA 1FIWA 5EIYA 1ZYOA 2ZDVH 3RXCA 1TNHA 3DCLA 3SN8A 5EPNA 2J95A 1SLXB 2D8WA 2BY6X 1GBEA 1AFEH 1RRKA 2BQWB 1EX3A 2G4TA 1ZHRA 4ZKNU 1G3BA 3SNBA 5DK1A 1ESAA 1V2PT 1O2YA 1C2DA 2FODA 4I33A 3SJ8A 3MQKC 2OC1A 1XUFA 3KNXA 2GZ7A 1EB1H 3FN8A 3RXFA 4XBBA 2KX4A 1K1PA 1BZXE 3E0NB 3GCHC 1T4UH 2OTVA 1O5EH 1P06A 3G01A 2C90B 1HGTH 3VPKA 1SMFE 1ZGIA 1OX1A 4NA9H 3SGAE 1NZQH 2ZG0H 7GCHG 4YOIA 3OYPA 2GCTC 2O8UA 4ABEA 4D76A 2C3SA 5T3HA 2BY8X 3NWUA 1GI9B 3DSGA 2ZFFH 3AVZA 1C9PA 5E0HA 4X8UH 3MO3A 1DICA 3MFJA 1TGTA 2ZFPH 3GDVA 2B7DH 1RIWB 4UDWH 3F68H 2V3OH 4WXIA 4CRGA 2IN2A 1B0FA 5DKMA 3A89A 1DM4B 3UR9A 1IQJA 4E06H 4XOJA 3ZIAD 1GMDF 5DN6D 2ASUB 1A3BH 6GCHG 1Q31A 2BDAA 2GCHG 3GICB 3UUZA 1J17T 3P95A 1WTHD 1C5VA 1FPCH 4DJZB 2WUBA 2D26C 3GY4A 5C67A 1G3CA 3U1JB 1O3DA 1XUKA 4Q7XA 2ODQA 5T6FA 4YOJA 2AMDA 5J4SA 1THSH 2GX4A 4Y8XA 4ZAEA 4DOQA 2Z94A 3ZZ7A 1J8AA 2QE7D 4O3UA 2CJIA 1P3EA 4ZUHA 1ZR0A 1ESTA 1NU7B 4Y8YA 1DWDH 1TMBH 5EJLA 1C1TA 1T4VH 5DPAA 1MTNB 3TJUA 1CA8B 3OY5U 3F2GA 1W2KH 2V7QD 1BTYA 1TRNA 3RM0H 3KEEA 4FUJA 3RXQA 1EZXC 2FS8A 2Z7FE 4JCNA 2HGTH 2QCYA 1C1QA 1SGNE 2XW9A 4O9VA 4X1QU 3OE7D 3PLKA 1AFQC 2ZFSA 4K8BA 2XXLA 1XUJA 3Q00A 3SUEA 2XC5A 1GJ9B 1Q3XA 1G36A 3LJOA 1KTSB 3U28C 1C1MA 1VCPA 3SW2B 3KGPA 1P10A 1BITA 2WV9A 1HAOH 1QJ1B 1TNIA 4FUEA 1AD8H 2H2ZA 3VEQB 1NRRH 1WBGB 3UB0A 1O3BA 3PO1B 1BMMH 2OLGA 3GYLB 1G2MA 2NU2E 1JBUH 4IN2A 1EOLA 1P09A 5DP4A 1UJ1A 3NZIA 1O33A 1T8LA 4I8HA 1S83A 3SORA 5BRRE 4BTUB 1IAUA 2HLCA 4ESTE 1C1SA 1J14A 4AGJA 5CHBA 2XWAA 3MU0A 1HJ8A 1G3DA 2VVCA 4HI3A 1YCPK 1TA6A 4FUFA 2WPMS 1DXWA 3GCTF 1W0ZU 3LGVA 4X2VA 1LO6A 4Y0ZE 5C1UA 4DT7B 3QTVH 1MCTA 4NIVA 1XM1A 4CHAC 2KM0A 1KLTA 1HJAC 2R0LA 5AFYH 2PUQH 1GJAB 3MU5A 4WF8A 3VGCC 1VJAU 3A7XA 2ZGBH 3M3VA 5K0HA 1UTNA 4P02A 2GKVE 1EJMA 1SGRE 3DUXH 2GD4B 2B0FA 2VINA 1E38B 5A8YA 2QF5A 2LP6A 2UWLA 4A1XA 1VITF 3ZVFA 1A3EH 1UTOA 2H9TH 2PGBB 2SNWA 4UFDH 4CR5A 5C94A 1SGTA 2J2UA 1ID5H 1RFNA 4B1TA 4A5TS 2SNVA 1LVBA 1O2ZA 1TQ0B 1Z7KA 3S9CA 3SU1A 1OHHD 4Y79A 1WXRA 1SLVB 3SZEA 4I86A 1KDQA 1CHOG 1O2RA 1Y3XA 1YBWA 4U32A 3GS9A 1NO9H 2JH6D 1TX6A 4KKDA 1JOUB 2ZU3A 1GL1A 1LKBA 1UTLM 1AVWA 1UVOA 3A86A 4Q7ZA 4AG2A 1O36A 3EAJA 4DT4A 1SHYA 1A5HA 4MPVA 4CBOA 1WV7H 2RA3A 2Z9LA 4UFEH 4MPUA 2ZU5A 5C1XA 1SGYE 2F9VA 1O5DH 2P16A 3H7OA 3RLYH 4DG4A 1Y8TA 2Y81A 1DLEA 1GI7B 1E1QD 3UAIC 3VB4A 2ANMH 2FMJA 1KXCA 2FI4E 3CS7A 3CS0A 3M5LA 2RFKC 4A92A 3ZYEA 3MH5A 4GAWA 1VR1H 3ELAH 1AB9B 3GY2A 1C5YB 2TGTA 3PRDA 1MUEB 4GUXA 1HJ9A 2ZCHP 1O3KA 4VGCC 4NSVA 1GHVH 1FUJA 2C8WB 2XBXA 4AN7A 1GBKA 3WY8A 3LIWA 2TGPZ 2FZZA 2P8OC 1HAIH 5LPFA 2B5TB 4OS6A 1DVAH 2Y5FA 4X6OA 3ZZCA 2A7CA 8GCHG 1Z8GA 1PQ8A 3LH1A 4FUIA 5EODA 5EXNA 1E79D 2ZHWH 2K8IA 3ZYDA 1UTKA 1YLNA 3TGKE 4Z6AH 4YO9A 3C27B 1NN6A 2QXGA 1EAWA 3E8LA 1CSOE 3RXMA 4B2CA 1TOCB 2BZAA 5JBCS 5HXFA 4B6FA 3BG4C 1SGPE 4MG3A 3ZZ4A 1ORFA 1MBMA 2B9LA 3P17H 3SZNA 1SR5C 1HIAB 4B71A 1Z6JH 4I31A 3RUOA 1SFIA 2OC8A 1C1WH 2R2MB 1YM0A 2A7JA 3BN9A 1YPLH 2HNTC 3BV9B 4XBCA 3CENA 1EXFA 3K6YA 1SKYE 1O3IA 2TBSA 1P01A 1THPB 4RKOB 3DD2H 5ETXA 4J1YA 9ESTA 1BQYA 2BDCA 2WINI 1BHXB 3SNCA 2SGPE 1M9UA 1KMHB 2SGDE 3RP2A 1IQMA 2L74A 1AHTH 3I29A 5TJXA 1ETTH 3P8FA 3ZVGA 3UQOA 4Y6DA 2VH0A 4AZ2B 5EQQA 1LPKB 1MZAA 1TGSZ 3QGNB 5EXMA 3QX5H 1C5TA 3FP8E 1C5OH 4FU8A 4WH8A 1E34B 2NU3E 1AVXA 2G00A 1IQHA 1AUJA 1W12U 4TT3D 3RMMH 4XDEA 1MZDA 1GI0A 1NRPH 4NZLA 4AC9A 1O39A 2OK5A 3UOPA 2WPIS 2A7HA 1HAXB 2JETC 3LGWA 4TPIZ 2TIOA 3SO3A 4ASHA 3A87A 3GY8A 1ZPZA 3L33A 4ZHAA 5T6DA 4K1EA 3TVJB 1CA0B 1BCUH 1S0QA 2GCTB 4XFQA 2BLQA 2O8TA 2JJ1D 2DE9A 1VCQA 1C1VH 3GY3A 3MNXA 1LCYA 2P94A 1XXDA 2CK3D 2H1UA 3CP7A 3IG6B 2A4QA 4F4OC 1WU1A 1YF4A 2C8XB 3A88A 4SGBE 1O35A 4I7YH 1BTUA 1P2JA 4UE7H 2A2XH 4M9FA 2IJD1 3ODFA 4INHA 4U01A 3W94A 1DWEH 3HK3B 2GDDA 3KQ5A 1K1MA 2WHXA 4X2XA 3TIUA 1TX7A 1V2NT 1BB0B 4RT0A 1AUTC 1NFWA 1MAXA 4FUBA 1BHXF 2FIRH 4CRAA 2FLBH 4IMZA 4ISLA 1FN8A 4NWKA 3TNSA 3FKSD 1O3NA 2ZDLA 3FANA 1TFXA 4MNXA 1KYNA 3H7TA 1D3DB 4JK5A 1H8DH 1VCWA 1LVMA 1V2UT 3QK1A 2VIWA 1MTNC 1KXDA 2F43B 4ZHLU 3E1XB 5FHTA 2PGQB 1H9HE 1GHAG 2GDEH 1T8NA 2AERH 1HIAA 4CREA 2WZQA 2AYWA 1P2MA 1NY22 2KAIB 2EI6A 1DDJA 2FTLE 4FU9A 1CBWB 2BM2A 4AYVB 2HWLB 2KFWA 1ELGA 2XNDD 1TNJA 4I8JA 3TK9A 1W0KD 1GDNA 2LELA 5SGAE 1QRXA 1W3CA 2VH6A 2ZCLP 2STBE 1KSNA 2LNCA 3E16B 1C2HA 5EOKA 1QJ6B 2J98A 3O8RA 3RXIA 1LTOA 2W7SA 2GV6A 5JB9S 5DP8A 2G52A 1TALA 4B76A 1O3HA 1VKYA 1G3EA 4AORA 1CU1A 1GI8B 1C1PA 3M7UA 3NUMA 1AZZA 1NPMA 2PLXA 3O8CA 5L30H 2ZO3H 1CHGA 5T6GA 2VIPA 1F0UA 3NK8A 5TCAA 5FX5A 1ZMJA 5FPYA 4K1SA 4BAMB 1FJSA 4BANB 4ZMAH 3U1IB 2F91A 2ZHFH 4TWWA 1O3LA 2JJ2D 2BLWA 1HAYB 1PFXC 3Q3XA 4F49A 2FPZA 1S84A 1W8BH 1DY8A 3N7DA 1ZSLA 2UUJB 4H6SB 1P8VC 2ZDMA 1OPHB 1MU8B 2ZTYA 2ZQ1A 2C8YB 2KR7A 3SV2H 3IITA 2FLRH 1GI6A 3BG8A 4IC5A 1PQAA 1ARBA 4F48B 1AGJA 4TPYA 3RXPA 1ZJDA 4Y8ZA 1V2TT 2AFQB 1G37A 4A1TA 2QF0A 1AFQB 1GBLA 3DHKH 1CT2E 1FPHH 1YLCA 3QDZB 2BD8A 3RXOA 1GBBA 3EA7A 1O5BB 5E2PA 2ESTE 4HTCH 3U69H 4DURA 2K1QA 1O2SA 1T7CA 3SV6A 1ZTKA 2M5TA 3SUDA 1PPGE 3KYFA 3TH4H 1P04A 2G81E 3UNQA 3PV2A 2FOCA 2F83A 1EAXA 1GBDA 1WUNH 4JZDH 2FX6A 2BY5X 2WUCA 3DT0H 2Z3CA 2A31A 1CBWC 1GMHF 1BMNH 1BMFD 5PTPA 3BTHE 1FY4A 3S7HB 3OTPA 3P8NA 1NROH 2XRCA 1QBVH 4XD7D 3E6PH 2CF8H 1FY5A 1C2GA 1GJ6A 2QA9E 4GVUA 2EQNA 2YOLA 1PPHE 4XSKU 1NFXA 2OINA 3NCLA 1QURH 4SGAE 3HGPA 4MNYA 1HUTH 3RXEA 4FETA 3LC3A 4JZFH 1TRYA 3BIUH 3SJ9A 1F7ZA 2J94A 3E91A 4HFPB 4UEHH 5EQSA 1HB0B 4H4FA 1K21H 3A83A 1FZZA 4RKJB 3GY5A 3RXSA 2ZKSA 1ZJKA 2W3KA 2FESH 4OS7A 1MABB 1RTLA 1XKBC 2XC4A 1TPSA 1OSSA 3FP7E 2QN5T 3GY7A 1SBWA 2ZQ2A 4E05H 1O3JA 1AB9C 1TNLA 1AIXH 2UWPA 1RXPA 5HM9A 1IQFA 1KIGH 3DA9B 1NBMD 4VGCB 1C5UA 1NESE 4MPXA 1AWHB 2GGVB 1LHGH 1WQVH 3M61U 1QCPA 2AHME 1NFUA 4ABFA 3MHWU 1MTUA 3LPRA 1MKXK 1TMUH 2OQUA 5ABWA 1XVMA 1GHBG 4QT8C 1NU9A 1KXBA 2F9NA 1MQ6A 1G9IE 4IC6A 2CXVA 2XWBI 3MWIU 1BBRK 1OKXA 2WYJA 3P8OA 4X1RU 2Z3EA 5C5NA 1BTWA 3TPIZ 3UWIA 3WW7A 1NRSH 2KAIA 2VWLA 2O8WA 2P3TB 2VB0A 2V35A 1O3OA 1RJXB 3FZDA 2ANKH 2ODYB 1E1RD 1VGCC 1W14U 3OX7U 1C5RA 1Y59T 1ZHMA 3ZZ6A 3RXKA 1GBCA 1O2TA 3SQHE 2BTCE 5FCKA 3ZZBA 1TNKA 4XRNA 4BAKB 2BDYA 3TH3H 2BVXH 2BX4A 1CT4E 1EP5A 1HFDA 1BT7A 2BD4A 4Y0YE 1C5SA 1UVSH 3RMLH 1IQIA 3ODDA 1GHXH 3STIA 1H9LB 3O8BA 5KGOA 2FO9A 1MKXH 4A1VA 5CHAC 3P92A 3SNEA 1ANCA 1GJCB 2C93B 1GDUA 3PV5A 2ULLA 3VXEH 4NIYA 4YT7H 1WOFA 2FX4A 4CRDA 4ACAA 2OUAA 8ESTE 4X6MA 3A82A 5E8EH 1Z8JB 3UIRA 1WSSH 2VJ1A 1DUAA 2W26A 3M7QA 1YC0A 1FY1A 4BAHB 4X6PA 2QY0B 3MU8A 3RXAA 1DWBH 1W0JD 1VZQH 5A09A 2Q6GA 1O3MA 1QA7A 5EJ1A 4R0IA 3SU3A 4DY7B 2HNTF 2P3UB 2PKSB 1ZHPA 1QL8A 2WSSD 2CV3A 2GV7A 5A8ZA 4AYYB 1MTWA 2W6JD 3TU7H 5HYOA 2HPQH 3KF2A 1NRNH 1Z71A 1C5MD 1UVPA 3SHCH 2W6ID 4U2WA 4MVNA 5DGJA 1Y5AT 5FCRA 2B8OH 3LKWA 1YPMH 2A4RA 3A7ZA 6CHAB 4I8KA 1OYQA 1C5PA 2FI5E 1EJAA 1N8OB 1P2IA 4TWYA 2BLVA 3PMHB 3JZ2B 3W1EA 1AI8H 1ETRH 1A0LA 1D3TB 3SUFA 1FAKH 1L1GA 4B74A 1DXPA 1PPZA 1ZRKA 4KELA 1C5ZB 2J92A 1C4Y2 1CGJE 1L4DA 1F2SE 2WPLS 1OP8A 1V2WT 7KMEH 4B6EA 4J2YB 3N7OA 2A0QB 4DW2U 3AAUA 2J97A 5HM2A 1V2RT 3RLWH 1KXFA 2BMGB 1CQQA 1VGCB 4U30A 4I8GA 3TNTA 5JBBS 1SI5H 1BTZA 3FP6E 5I25A 1P9SA 1HAPH 1CT0E 1LHDH 4WH6A 2GJGA 2AEIH 4AB8A 5A0AE 1V3XA 4OS5A 3R0FA 4UD9H 5GJ4B 2GT7A 1BDAA 3QN7A 4WVPE 2TGDA 3BTEE 1FV9A 1P2QA 1TGNA 1UCYK 1GI5A 4ABIA 4AFSA 3ESTA 4OM9A 2BX3A 2O9QA 3VB6A 1A0HB 1O2NA 1SGQE 3T5FH 2PSYA 4NCYA 1ELAA 5FBIA 3L3TA 2VIQA 2A45B 2W7UA 5IYTA 4ZKOU 1E37B 2QIQA 4ISNA 2TGAA 1GHWH 1QRWA 5GNDA 4YLQH 2ALPA 3Q76A 2ZU2A 2ZTZA 1WQSA 2NWNA 5A8XA 2ZC9H 4WWYA 1SQAA 4X2YA 4ISIH 3ZVEA 1EKBB 4ZXYH 1GVKB 1GHBF 2BY7X 3ATIA 3F9FA 3SV8A 4I8LA 3PRBA 1C5QA 1YLDA 4H6TA 3M3TA 2GZ8A 3PLPA 3FFGA 1G2LA 3AASA 3D62A 3PB1E 3TGIE 4BAOB 1YPEH 1ZSKA 2YMSB 1ZGVA 1D4PB 2D1JA 4ZXXH 1BMAA 1K1LA 3SI4H 4BTTB 4BXWA 4ZHMU 1EAUA 3ENSB 1GBTA 3OEED 3ATMA 3PROA 4LXBH 5C3NA 1UCYH 5EU8A 3SNDA 1SQTA 4BNRA 3OTJE 1SGFA 1K1IA 3VB7A 1P12E 1RTKA 1W11U 1IOEA 4A7IB 4TY7A 1Z1IA 4BTIB 1HBTH 1YPHC 2NU0E 1K28D 3PV4A 3KIDU 3SYJA 1CO7E 4ASUD 2RG3A 1Y5BT 4D8NA 4WMEA 5GIBA 2QF4A 1QNJA 4JYTA 1S85A 4Q80A 1O2PA 5K7RA 1NS3A 2BLOA 4JYVH 2HVYB 3WWFA 1DPOA 3T26A 5DO4H 3EDXB 2J34A 5ESBA 1B0EA 2Y80A 4AFZA 3RXRA 1FY3A 1QBOA 1G30B 4AGKA 2XBYA 3RC6A 1O5CB 2HVXA 1F0SA 1EATA 1FLEE 3EGKH 1K0HA 3KQDA 1W10U 1P57B 3M35A 2FP7B 1H9IE 2OBOA 1NT1A 1SVPA 3BSQA 4NIWA 1P3CA 1GG6C 1O3FA 1KXEA 1LQEA 2CF9H 2VGCC 3OEHD 3LC5A 1KDQB 3VB5A 3ZV9A 1O2LA 4WY3A 1SPJA 1HAVA 1BTXA 2UUKB 4Y7AA 3ZZ5A 5L2YH 1O2UA 2AMPA 1O2WA 2WYGA 2Y82A 4D7FA 1QQ4A 1W0YH 3TLOA 3PLBA 4K8YA 2FWWA 1VITG 3D49H 5DP5A 2WPJS 1V2KT 1B7XB 2BB4A 4FUCA 2G55A 1KLIH 1O31A 3QTOH 1BRUP 2VVUA 3B8JA 4OGYA 3F2FA 1GVLA 3RXJA 1EPTB 2ZZUH 3RXLA 2P3FH 2G8TA 4CRBA 5GDSH 1TOMH 1MD7A 3EE0B 1UK4A 3MNCA 3ZZ9A 3F9EA 1F5LA 3A7VA 2A4GA 1MH0A 3S9AA 4INKA 2AIQA 2ZNKH 2KCYA 7LPRA 3UTUH 4ABGA 3F1SB 2G51A 4MPWA 1AE8H 1GI4A 3SU6A 4DVAU 3T29A 4Z1MD 2ZIQH 1GL0E 5C2ZA 1O2OA 3F9HA 1BTPA 1ABJH 3PYHA 5HIYA 1L2EA 8KME2 4YZUA 1THRH 5FXLA 4Q63A 3UNRA 1LHCH 2PFEA 3T27A 4LK4A 3D23A 4X2WA 3D65E 1C1UH 2HOBA 1W13U 3K6ZA 1C4U2 1HXEH 1O0DH 1S5SA 1DFPA 1CGIE 3F2HA 3RU4T 1O37A 1ANBA 2AIPA 1WCZA 5EJZA 2IPQX 1A1RA 5G4BA 1DS2E 2Q1JA 4Y71A 1HPGA 4ABDA 1MBQA 1C4V2 1SGEE 1NBME 4MNWA 4O03A 2W3IA 3F0OA 3GOVB 3C1KA 4JZEH 2IJOB 1O3GA 2DE8A 5A2MH 1ETSH 1NRQH 1BRCE 1EZQA 2QC2A 3H5CB 3QLPH 3OY6U 1L0ZA 2R9PA 1A4WH 1N6YA 1YY3A 1EASA 1C5XB 1FI8A 4MTBA 5B6LA 5EXLA 3KHVA 2LPRA 1NM6A 2F9BH 1P11E 5AF9H 2FEQH 1Y5UT 2OP9A 4DCDA 1LHFH 3P70B 2ZP0H 2OQ5A 1BA8B 3BTFE 1UVTH 4RN6A 3A85A 4BXSA 4K69A 4UONA 1LDTT 4ZCNA 1OS8A 4X1NU 2EA3A 2EI7A 3PO1C 2V0BA 2BQ7B 3AK5A 1QY6A 3Q3YA 2FI3E 3HATH 3BTWE 1FMGA 3FVFB 2AGEX 1TMTH 3PMJA 4INLA 3BIVH 4X8VH 4JZIA 1NFYA 2BDHA 1EFRD 3RXTA 1BRAA 3RM2H 2ZTXA 3LT3A 1K1JA 1O2QA 1TABE 1BJVA 2ALVA 1TRMA 3VXFH 2Q6FA 4BAQB 4PROA 2EC9H 4MLFB 1IQEA
chains in the Genus database with same CATH topology
1WTGH 2PKAA 1F5KU 4YM9A 2ANYA 2NU4E 1GMDG 2I6QA 5E0JA 1SL3A 2FTMA 2ZDNA 1OWEA 1SSXA 1T8MA 3ZVAA 4DIHH 4K3JA 1DWCH 1H8IH 1HJAB 1JXPA 3AAVA 4OS2A 4KTSA 1EAIA 2F3CE 2AMQA 2VIVA 2DUCA 3BEUA 1V6DA 1ZOMA 3GDSA 1MCVA 3RXHA 2H9EH 1QBNA 3M5OA 1UVUH 1ZLRA 3ZZ8A 4UFGH 3ZV8A 2XBWA 4THNH 3URCA 2ZPQA 1QGFA 1TA2A 1GCTB 1SLUB 1O3EA 1MD8A 2UUFB 2BDIA 1UTMA 2YNAA 4IBLH 2SGEE 3T25A 3V0XA 1KLJH 4Q2KA 3V3MA 3EQ0H 3BTME 1SGFG 2IOTA 1A5GH 4CRFA 1P2NA 2CMYA 3RDZA 1K1NA 2AGGX 1TONA 1O2JA 1ZMLA 2QXHA 1TIOA 3MMGA 1SHHB 1C1OA 4Z0KA 3FAOA 1PYTC 4ABHA 2CHAB 3SNAA 1K22H 1LHEH 1LVYA 1GJ8B 5EW2H 1FXYA 2BYAX 3ZZDA 1DE7H 1YPJH 1O2KA 2QV1A 2G4UA 1GJ4H 2BY9X 1FQ3A 4KP0A 4MDSA 1O5AB 5F6MA 3MTYA 1ELFA 1DANH 2WPKS 5FPSA 2EI8A 2RDLA 4IW4E 4I32A 4O3TA 3A84A 5C1YA 1VJ9U 3SJOA 1DSTA 2PKSC 1HAVB 1D6WA 1AKSB 2H5DA 3KL6A 1TLDA 4JYUH 5LGOA 3STJA 2CGAA 1KY9A 1ELBA 3ATLA 6CHAC 2A2QH 3RXGA 1N8OC 2HALA 1PQ5A 1GDQA 2QAAA 6LPRA 2VWNA 3RC5A 2TRMA 4AFQA 2WPHS 4KTUA 2NU1E 4FUDA 3DFJA 3E3TA 1RGQA 5AHGH 3Q77A 3F9GA 3A8BA 1BMLA 4A6LA 2R2WU 4NIXA 1TGBA 3SJIA 3LGYA 1GCTC 2ZGXH 1O5GH 3GCNA 1J9CH 4ZH8A 2FOMB 4DGJA 4NG9H 5J4QA 1HAZB 4AFUA 1GGDB 2QXIA 1L4ZA 4ZKRU 4ABAA 2A5IA 3UR6A 1GCDA 2FM2A 3TK6A 3PM3A 1OP0A 1S0RA 1ZZZA 3HK6B 2Z9GA 3QWCH 1LKAA 1AE5A 2XBVA 3PWCA 4R8TB 4JMYA 1IHTH 2A4OA 1Y3UA 5GXPA 2ZEBA 1MU6B 3VB3A 3A81A 1T31A 2XC0A 4Y11E 5DJ7A 2J38A 4CRCA 2GT8A 3Q3KA 1P2OA 2A1DB 2P8OB 3BTKE 4Y10E 5C5OA 1CHOF 3BF6H 3HKIB 1QA0A 3AW1A 3ZVCA 1JRSA 4H42U 2QYIA 3BEIB 1C2LA 4B75A 4YT6H 4ISHH 1TYNA 2FOHA 2Z9KA 3RXUA 2VGCB 8GCHF 1UHBB 2H6MA 3EA8A 1UO6A 2AH4X 2SGAA 2UWOA 4NSYA 5EW1H 3T2NA 1TAWA 1PJPA 1YPKH 1YPGH 3U98H 4B2BA 3K2UA 3BG4B 1AMHA 4BOHA 3RMNH 3BTTE 1S6FA 3SQEE 3UNSA 3M37A 4GCHF 2Z6BD 1PQ7A 1CA0C 1S81A 2PSXA 1TGCA 2GTBA 1LQDB 1EP6A 2Y7XA 2VNTA 1GBIA 3LU9B 4YTAA 3RC4A 2OXSA 1FNIA 1Z6EA 1EPTC 1JIRA 1QB9A 3TGJE 3BTGE 3LONA 5H4IB 4E7NA 2ZFRH 1QFKH 2ZGHA 2ILNA 1QHRB 1UTPA 3U9AH 3ZVDA 4AG1A 2ZCKP 3GCOA 1ZMNA 3K9XB 1HAGE 3M5MA 3F6UH 1QRZA 1A0JA 3RU4D 1EUFA 4K2YA 2J9NA 2WV5A 1TE0A 1P05A 1L1NA 4X6NA 1Y3WA 1BJUA 2ZECA 4WJG2 2CN0H 1Z8RA 2FXRA 1AZ8A 1GMHG 1JIMA 1OWJA 2XNIA 1QJ7B 4FUGA 3TITA 1EQ9A 4X1PU 3BTDE 1GGDC 3JZ1B 2H9HA 3I78A 3M7TA 1ZPBA 1CE5A 2VIOA 1TPPA 3M36A 2BVSH 4JK6A 1IHSH 3U8TH 4LOYH 1UCYE 2QXJA 4KGAA 1L1JA 5LPRA 1TPAE 3A7YA 1OWDA 5L6NH 2R3UA 1BUIA 2GP9B 1Y3YA 5GWZA 1A5IA 3SGQE 3S7KB 2Z9JA 4NFFA 3S0NA 1P2KA 4CH2B 1K9OE 3MH6A 4XBDA 5CMXH 1W7GH 4CH8B 4O97A 1V2JT 2A5KA 2ZHDA 3RXDA 1VITH 5JBAS 6ESTA 3U8OH 1SC8U 3UPEA 3UWJH 4Q7YA 3MI4A 2A5AA 3HPTB 1DUEA 1HDTH 2OCVB 1OYTH 1ARCA 3SHAH 1JWTA 1GHYH 1HYLA 3LH3A 1BBRE 4MQAA 1O3AA 1HLTH 3EYDA 4NFEA 3LGTA 2Z3DA 1YGCH 3BTQE 3RMOH 2D2DA 3OU0A 1O2MA 1UTJA 5JB8S 1GHZA 1UHBA 1J16A 1BRBE 4ABJA 1GBJA 1MAYA 3RXVA 1A46H 1GMCF 5E0GA 2QGRA 1XUGA 2C8ZB 1FONA 3UQVA 5GCHG 2BD9A 1MTVA 5A0BA 3E90B 1V2VT 1TB6H 1SQOA 5B6OA 2BOKA 2ZDKA 1GI2A 3PWBA 1OWIA 1RS0A 3MH7A 4AX9H 4HGCA 1ELEE 1GJ5H 1F0TA 3T62A 3O8DA 4RSPA 3QGJA 2THFB 1H4WA 4K5ZA 1GVZA 2G5VA 4UFFH 3MNSA 1IQNA 3B23B 2GCHF 4B73A 4NGAH 3A7WA 1HV7A 1W7XH 3LJJA 3LOXA 2TPIZ 2PWXA 3ATKA 1SGIB 2FOAA 2EEKA 2F9UA 2ZGJA 1SOTA 5A0CA 2P93A 1HXFH 2R0KA 4X8TH 1GBHA 1GHAF 5IDKA 2J4IA 2RA0A 1JMOH 5EGMA 1V2QT 2XYAA 3MO9A 5TCCA 1ZSJA 3A80A 5I46H 2V6NA 3LGIA 5C20A 2ZU1A 4YOGA 1GI3A 3MO6A 1JRTA 1C5WB 4OS1A 2I6SA 4HZHA 1QB6A 1PPFE 2PV9B 1UK3A 2PHBA 1C2IA 4X8SH 1ELTA 1XUHA 1N1LA 1XMNB 2XCNA 3TJOA 1DX5M 3PMAB 1AWFH 1QTFA 1AKSA 1P02A 1D6RA 2ZFQH 1F0RA 1MQ5A 2BZ6H 2G5NA 1T8OA 5FBEA 1RIWC 3T28A 4WMFA 1ELDE 5JYIA 1C2KA 2CHAC 2V3HH 4IN1A 5DP6A 1TBQH 3SUGA 5L2ZH 4FXGH 1XVOA 6GCHF 1QB1A 5FX6A 1K2I1 3NKKA 3SU5A 4KTCA 1H1BA 1SLWB 3GISB 2ANWA 1AQ7A 2STAE 4YLUA 3L6PA 2BD3A 3M5NA 1YKTA 3NPSA 1P03A 1Q2WA 3GCHB 2Q6DA 1EJNA 5BPEA 1AU8A 1EOJA 4DIIH 1A2CH 1XKAC 2BVRH 4B2AA 7GCHF 3LGUA 3NXPA 2Y6TA 3UFAA 1FN6A 1YP9A 4FUHA 2ZDAH 1Z1JA 3LDXH 1J15A 2OC7A 1RTFB 5HMAA 1QIXB 2SFAA 2SGQE 3SV9A 1LPGB 2O8LA 1SGCA 2WV4A 4JZ1A 1QL9A 3UY9A 4OS4A 5HGGA 3URDA 5F8ZA 2VVVA 5DG6A 1HAHH 2P95A 5JPMH 2QF3A 1PPCE 1TX8A 1AY6H 2PTCE 1DY9A 2JKHA 1GJ7B 1FDPA 1P9UA 4Y7BA 2VWMA 5F8TA 3SOSA 1TBRH 1GI1A 1DOJA 2PW8H 1NTPA 4NA8A 2GMTB 1F5RA 1GBAA 3SU4A 2HRVA 3V13A 1UK2A 5LH8A 1EB2A 3SU0A 1B5GH 2ZGCA 1Y3VA 3QO6A 2BDBA 3KQEA 2YNBA 5E2OA 1LPZB 2R3YA 4Y76A 1X7AC 3TK5A 3EA9A 1GBMA 4LZ1H 1SOZA 3ZZ3A 2AS9A 4X1SU 2IPHA 1OP2A 4D9QA 3QZQA 1CGHA 1ZPCA 5GCHF 3TJVA 1DT2A 1YCPM 2OBQA 3E0PB 3GDUA 3PMBB 5AVDA 1TBZH 5CHAB 3BEFB 1KTTB 1V2LT 1GMCG 1S82A 2RCEA 3ITIA 3SGBE 1T32A 1GWAA 2Z9IA 2Y5GA 5ESTE 4E7RG 3A8DA 1SGDE 1V2ST 3IWMA 1U6QA 4CHAB 3DFLA 1C1RA 1S6HA 5EG4A 1GJBB 3V7TA 3VGCB 3ATWA 1D3QB 1O34A 5FAHA 1YPHE 1ELVA 1QR3E 1BTHH 3ZVBA 1IQLA 3KCGH 3V12A 3U8RH 3MH4A 1YYY1 3GYMA 1WAYB 1UTQA 3PTBA 2W5EA 2BQ6B 1E35B 2FOEA 1N6XA 3PTNA 2SGFE 3RXBA 1C2FA 1MTSA 4ISOA 1E0FD 3KN2A 1O30A 4AOQA 2BHGA 1C1NA 1XXFA 3R3GB 3HGNA 4NWLA 5AFZH 2PR3A 4GPGA 2ZWLH 1V2MT 1P0SH 4GHTA 1A61H 3I77A 1C2JA 1V2OT 3QZRA 4GLYA 1C2EA 1O5FH 3QUMP 1MKWH 3UOUA 2ZA5A 2F9PA 2A32A 2HNTE 5GPIB 2BXUH 2JH5D 1O3PB 1EZUC 2BD5A 2GMTC 4K1TA 5EPYA 1CVWH 2VWOA 2ZHEH 1O2XA 5JDUB 2UUYA 5F8XA 3RU4E 1WYKA 2H5CA 1QL7A 3ZZAA 4GHQA 1ZTJA 1YCPH 1O2GH 4XE4A 2OD3B 8LPRA 1Z8IB 3FZZA 1ANDA 1PPBH 3KQBA 3MOCA 1KXAA 3SU2A 1OXGA 5F03A 1G32B 2BOHB 2FYQA 1TNGA 4NA7A 3K65B 7ESTE 4WMDA 2FDAA 1PYTD 4M7GA 2ODPA 1DITH 1TQ7B 1UMAH 1C5NH 2ZHQH 1EPTA 1SG8B 3MU4A 1NC6A 3S9BA 4GCHG 4FVBA 1GBFA 1ABIH 2AGIX 3P6ZB 3MNBA 1PPEE 1A7SA 1DSUA 2FOBA 4YESB 3MYWA 1MKWK 1AN1E 1AO5A 1TWXB 3W95A 1E36B 3A7TA 3UREA 2BXTH 1ANEA 2VU8E 3A8CA 9LPRA 1OOKB 3GCTG 5FPTA 1EZSC 2JH0D 2BD2A 5CE1A 1OWHA 1ELCA 1O2IA 1HCGA 3B9FH 2C4FH 4TYDA 1XX9A 1GPZA 1RD3B 3MU1A 1O3CA 2PKAB 2ZPSA 3HKJB 4IGDA 5DP7A 4WXVA 4D9RA 3AW0A 4D7GA 4GSOA 1IQKA 2F9OA 2FYRA 4MNVA 3SBKA 1SFQB 1XUIA 2P59A 1D9IA 3M3SA 4CR9A 1DLKB 2GVFA 4IMQA 3TJNA 1C5LH 1GJDB 3GY6A 1LVOA 4AB9A 1MMJN 3VFEA 1AVGH 1TPOA 2O8MA 3OSYA 1ZRBA 2PUXB 4TY6A 2XTTB 1FY8E 3P8GA 1BOQA 3TH2H 4IS5A 1D3PB 2GZ9A 4OGXA 1ZTLA 1HNEE 1K1OA 3KQCA 2VIDA 4NZQA 3SJKA 2ZU4A 1O38A 1GG6B 1IQGA 1INCA 1OWKA 2BDGA 1O2VA 1LMWB 1BIOA 2ZI2H 5DP3A 3S69A 1O2HA 2FOFA 2HPPH 2Y7ZA 2ZF0H 4LZ4B 2ZFTA 4FVDA 2OC0A 2PTNA 2Y5HA 4X0WU 1C9TA 4ZROA 1F92A 5JBTA 2JETB 1QQUA 2BD7A 5LPEA 1C2MA 1BBRH 3SV7A 5DP9A 5EQRA 1SB1H 1ACBE 1FAXA 1O32A 3A8AA 2XCFA 4FU7A 4K60A 1FIZA 4ABBA 2FOGA 1ESBA 1HRTH 2FS9A 3SI3H 4ZKSU 2ZPRA 4CBNA 1FIWA 1ZYOA 2ZDVH 3RXCA 1TNHA 3SN8A 5EPNA 2J95A 1SLXB 2D8WA 2BY6X 1GBEA 1AFEH 1RRKA 2BQWB 1EX3A 2G4TA 1ZHRA 4ZKNU 1G3BA 3SNBA 5DK1A 1ESAA 1V2PT 1O2YA 1C2DA 2FODA 4I33A 3SJ8A 2OC1A 1XUFA 3KNXA 2GZ7A 1EB1H 3RXFA 4XBBA 1K1PA 1BZXE 3E0NB 3GCHC 1T4UH 2OTVA 1O5EH 1P06A 3G01A 2C90B 1HGTH 3VPKA 1SMFE 1ZGIA 1OX1A 4NA9H 3SGAE 1NZQH 2ZG0H 7GCHG 4YOIA 3OYPA 2GCTC 2O8UA 4ABEA 4D76A 2C3SA 5T3HA 2BY8X 3NWUA 1GI9B 2ZFFH 3AVZA 1C9PA 5E0HA 4X8UH 3MO3A 1DICA 3MFJA 1TGTA 2ZFPH 3GDVA 2B7DH 1RIWB 4UDWH 3F68H 2V3OH 4WXIA 4CRGA 2IN2A 1B0FA 5DKMA 3A89A 1DM4B 3UR9A 1IQJA 4E06H 4XOJA 1GMDF 2ASUB 1A3BH 6GCHG 1Q31A 2BDAA 2GCHG 3GICB 3UUZA 1J17T 3P95A 1WTHD 1C5VA 1FPCH 4DJZB 2WUBA 2D26C 3GY4A 5C67A 1G3CA 3U1JB 1O3DA 1XUKA 4Q7XA 2ODQA 5T6FA 4YOJA 2AMDA 5J4SA 1THSH 2GX4A 4Y8XA 4ZAEA 4DOQA 2Z94A 3ZZ7A 1J8AA 4O3UA 2CJIA 1P3EA 4ZUHA 1ZR0A 1ESTA 1NU7B 4Y8YA 1DWDH 1TMBH 1C1TA 1T4VH 5DPAA 1MTNB 3TJUA 1CA8B 3OY5U 1W2KH 1BTYA 1TRNA 3RM0H 3KEEA 4FUJA 3RXQA 1EZXC 2FS8A 2Z7FE 4JCNA 2HGTH 2QCYA 1C1QA 1SGNE 2XW9A 4O9VA 4X1QU 3PLKA 1AFQC 2ZFSA 4K8BA 2XXLA 1XUJA 3Q00A 3SUEA 2XC5A 1GJ9B 1Q3XA 1G36A 3LJOA 1KTSB 1C1MA 1VCPA 3SW2B 3KGPA 1P10A 1BITA 1HAOH 1QJ1B 1TNIA 4FUEA 1AD8H 2H2ZA 3VEQB 1NRRH 1WBGB 1O3BA 3PO1B 1BMMH 2OLGA 3GYLB 1G2MA 2NU2E 1JBUH 4IN2A 1EOLA 1P09A 5DP4A 1UJ1A 3NZIA 1O33A 1T8LA 4I8HA 1S83A 3SORA 5BRRE 4BTUB 1IAUA 2HLCA 4ESTE 1C1SA 1J14A 4AGJA 2XWAA 3MU0A 1HJ8A 1G3DA 2VVCA 4HI3A 1YCPK 1TA6A 4FUFA 2WPMS 1DXWA 3GCTF 1W0ZU 3LGVA 4X2VA 1LO6A 4Y0ZE 5C1UA 4DT7B