5T6FA

1.90 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (orthorhombic p form)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
165
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protease/protease inhibitor
molecule keywords Genome polyprotein
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
total genus 38
structure length 165
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6fA01
1O3NA 2B0FA 1VCWA 3O8CA 3RLWH 1UTQA 1DSTA 1NC6A 2D8WA 3RMOH 4DY7B 4MDSA 1GBHA 3A8BA 4WMFA 8KME2 1EKBB 2J38A 2A5KA 4IC6A 5GPIB 2TGTA 1O3CA 3ATMA 1TMTH 3ENSB 3PO1B 2IOTA 2R3UA 3NWUA 1NFXA 4MPWA 3VPKA 2BMGB 1NY22 4CHAB 2WPMS 2GZ8A 4Y79A 2PKSC 4GCHF 2G52A 2HPQH 3GY7A 2THFB 7ESTE 1SPJA 4ABHA 1GCTB 1W11U 4UE7H 1HAGE 2QF3A 1O37A 3MMGA 4XBBA 5G4BA 1DANH 1O5BB 1TPPA 3ZZ4A 4MNYA 4UEHH 4AG1A 3DA9B 1C5XB 3BN9A 2V0BA 2B9LA 2ZHFH 1FN8A 1XUHA 2GP9B 5FPTA 2VWMA 3S9BA 1HPGA 1GBCA 4X2XA 3V13A 3GISB 2A2QH 1DLKB 4OS4A 4B74A 5JB9S 2UUJB 2Y7XA 2VGCC 4DGJA 4UFGH 4MNXA 5C67A 2WPHS 1EP6A 1V2ST 2WINI 2AMQA 4ZUHA 3M35A 1P02A 2Z9GA 3I29A 2XNIA 1X7AC 3VXEH 4BXWA 1O3IA 1ZZZA 1ETRH 3VEQB 1ANCA 3LDXH 3SJIA 1EB1H 1HAZB 3UUZA 3A8AA 1GJ7B 4PROA 1ELFA 3LGUA 3RXGA 1LVMA 1N6XA 2BQWB 2J94A 1FDPA 1ESBA 1D3TB 3TK9A 2D1JA 2BLQA 2WYJA 1C1SA 4GCHG 2QGRA 3O8BA 2ZU1A 1N8OB 3VGCC 2NU2E 4AN7A 1YPEH 3T28A 1AB9C 1EZQA 3RXLA 3SV8A 2VB0A 1O2VA 3MOCA 1SL3A 2TBSA 1UVOA 1AUTC 1TNIA 5L30H 1SHYA 3E8LA 3STIA 3BG8A 2FX4A 3P6ZB 2HOBA 4JZFH 5EQQA 1TNJA 1IQGA 4DW2U 1MU8B 4FUIA 2ZFFH 2STAE 4K69A 1C5SA 4NGAH 1ZPBA 3MNCA 1W12U 1YYY1 1EJNA 4ZHMU 2ZP0H 4I32A 4ISIH 4RKJB 1GPZA 2PTNA 1K1PA 1DPOA 4UONA 1TNLA 2G5VA 3SN8A 2ODYB 1AI8H 4IGDA 4YM9A 1NRPH 1YPMH 5GCHF 1BTWA 2P3UB 1QL7A 1DUEA 1KXAA 1AQ7A 1GMCF 4MNWA 5FBIA 4H6SB 4K60A 1S84A 1W10U 1ID5H 1SGDE 4GUXA 2BDCA 1C5UA 3M7UA 1GJCB 1CSOE 4B2AA 5LPFA 1C2GA 1K1LA 2H9EH 2Z9IA 5ESBA 1BITA 3FVFB 3SJ9A 1VGCB 2WV5A 1QURH 1YCPM 2QAAA 1E36B 2F91A 2C4FH 1FI8A 1CA0B 2I6SA 3FP7E 1O3JA 1KSNA 2ZGHA 1FY4A 1HXFH 2HNTE 4D9RA 2HWLB 1UJ1A 3LONA 3TGJE 1QY6A 3T5FH 2ULLA 2PHBA 4R0IA 3RXHA 2QN5T 4U30A 2SNVA 2XBVA 4CRCA 1P04A 1MD7A 2VIQA 1S5SA 3VFEA 3DFJA 1K1MA 3A7TA 1GL1A 1O5CB 1PPFE 3NZIA 1KYNA 4FUBA 4XBCA 1GG6C 1C2DA 1RGQA 2QIQA 2O8TA 5GCHG 1GMCG 1MZDA 4ZXYH 3RXOA 1HYLA 3BTKE 2FOCA 2FMJA 2W7UA 3Q00A 4BTIB 1JRTA 3TVJB 3ZZBA 3JZ2B 2ZDVH 2BLVA 2XBXA 3BG4B 2XBYA 4IMQA 2ZDLA 3RMMH 2JETB 3UOPA 1F0RA 1EAUA 3GCNA 1ZPCA 1CGHA 2FOFA 1GI6A 3EA7A 2HALA 5E2PA 1NFYA 4YT7H 3E1XB 3E90B 1EPTA 3R3GB 1HJ8A 1NTPA 1ELTA 2PSYA 2FESH 2ZPRA 5FAHA 3ATLA 1Y3XA 5ESTE 1A7SA 1A4WH 2Y7ZA 3A89A 4AGKA 4WWYA 2BY7X 4CR9A 1YBWA 1XVOA 2C8XB 3SU0A 2ILNA 7GCHF 3PMJA 1JBUH 1UVTH 1TE0A 4TWYA 1UTLM 3MO3A 4ISOA 1DICA 5DJ7A 3RXPA 4XE4A 2BDYA 3BIUH 3Q3YA 3RXIA 1K1OA 1DSUA 4WF8A 4Y7BA 5DPAA 4WXIA 3RP2A 3SQHE 4DURA 1Y3UA 2OBOA 3R0FA 2BDIA 1UTNA 1THRH 1H9IE 1NM6A 3PTBA 1A0JA 4NZQA 1FIZA 2ZA5A 1ZRBA 1XKAC 2GZ7A 5HGGA 1BZXE 1TGCA 1LTOA 2D2DA 3ITIA 4Y8YA 1LHEH 2OINA 3KCGH 1SFIA 1TRMA 3KQEA 4WY3A 3SGAE 2TIOA 4TPYA 1XUKA 4DIHH 4ZKNU 3CENA 1SMFE 4A1VA 3BTTE 1Z8GA 2ZTYA 1O36A 3IITA 1ZLRA 5GXPA 1U6QA 2ZHDA 1F5LA 2VIDA 1MCVA 1ZGIA 4KTUA 3VB5A 2ZECA 1BTHH 1KY9A 2FPZA 7GCHG 4MLFB 2SGPE 3GY5A 3MU4A 3ZZCA 3GY4A 1O5AB 5EXNA 3TH4H 2VIPA 3T29A 1TGBA 1TONA 1Z8IB 1CQQA 5DGJA 4F49A 4WMEA 1NO9H 3V0XA 9LPRA 1DDJA 2OC8A 1O33A 1GJ4H 4ZROA 2O9QA 3UQOA 1GI8B 1K28D 2XC5A 3FZDA 3NCLA 1HLTH 5EOKA 4E7NA 4AOQA 2TGPZ 4X2VA 5AFZH 3ZYDA 1C5WB 3MH5A 2AGIX 4UFEH 1TPSA 2BM2A 1O39A 1HB0B 4IMZA 5DG6A 1EAIA 1SGRE 3LOXA 3N7OA 2PGBB 1BA8B 3FZZA 1GI3A 2F9OA 1TALA 3T2NA 5DP9A 2A0QB 1AIXH 1ABJH 1HAVB 1S0QA 1S0RA 2FZZA 1Y5AT 2A1DB 4Y10E 1HJ9A 1ZHRA 4K8BA 2A4RA 1IQKA 3PMAB 3UPEA 1L1GA 3MU0A 4VGCB 1O2QA 2PKSB 3AAUA 3VB4A 2NU1E 5J4QA 2Y5HA 3L33A 2BOKA 4HFPB 4Y6DA 3NUMA 1TNKA 1FN6A 3A80A 2VH6A 1Z71A 4AG2A 1DWEH 3VB6A 1P09A 2BD8A 1IHTH 1MKXK 1SLWB 3M5OA 3M61U 2Z3CA 5JDUB 3BTHE 2NU4E 1JIRA 4Y0ZE 5F8ZA 2EEKA 3RDZA 1FY1A 4H42U 5J4SA 4X1NU 2BY6X 3M3VA 1MTVA 4I8JA 2FLBH 1H9HE 1MAYA 5A0BA 1BB0B 5FHTA 5L2YH 2BD2A 1W0ZU 1P2MA 2Y82A 2GVFA 1G32B 1XUIA 1ZMNA 4NWLA 1L4ZA 3F68H 1TLDA 3MH4A 4YZUA 2BY5X 2Z94A 3U1IB 2FODA 3F9FA 2IJOB 1VJAU 4GPGA 1D3QB 1TPOA 2EI7A 2W5EA 5JB8S 1UK2A 2H5CA 2ZDNA 3MYWA 1EPTC 3SBKA 2C8YB 1RIWC 3T27A 1QJ6B 3KEEA 2XYAA 1SGQE 1C4Y2 3BEUA 1GI0A 4NFEA 2CHAC 2TGAA 1AVGH 1M9UA 2BVRH 2ZCKP 4ABEA 3OY6U 1P2IA 3MU5A 1F0SA 4KELA 4OS6A 1BJVA 1HJAB 1FONA 5EG4A 3MNXA 1OOKB 1P2JA 3SNEA 5I46H 1KXFA 1WOFA 1O3MA 1P12E 3D23A 2VWLA 2PUXB 2F3CE 1UK4A 4Z6AH 4AYYB 1BMLA 1C2FA 3FP8E 2ANYA 1UO6A 1BRBE 1O5GH 2KAIB 3DHKH 3LC3A 3TNSA 1P2OA 4THNH 1IQLA 4TYDA 2WPLS 1KDQA 3MHWU 4X1PU 3GICB 3QGJA 3HKJB 4NSVA 2I6QA 1KLTA 2HLCA 3A82A 3TK6A 1GGDC 5C1YA 5K0HA 3IG6B 1ZTLA 3UWJH 1LVBA 1F5KU 2BX4A 5CE1A 1C1TA 1CT0E 2SNWA 4JYTA 1NT1A 2A5IA 2OBQA 1ZJDA 1O3FA 1C1OA 1DT2A 1V2VT 5DP7A 1L1JA 3SNCA 3ZZ7A 1IQIA 1SFQB 1W8BH 1ABIH 2A4GA 5EW2H 1DUAA 4FU7A 5C2ZA 3O8DA 1HXEH 1YF4A 1C5QA 2ZKSA 4ABDA 4BAHB 1TX6A 4I8HA 1GVZA 2ZFPH 2A31A 3ZZ3A 1PPHE 3Q3XA 5DP8A 1H1BA 4AFSA 2GMTB 1DOJA 1V2TT 2BDHA 2DE9A 2ODQA 3TK5A 1ELVA 3ZVAA 3PLKA 2V3HH 1N6YA 2R2MB 2EI8A 3HPTB 2OQ5A 3BTEE 4B75A 1DM4B 1HAOH 1HAPH 1GI7B 1TWXB 3V3MA 2HNTC 3LGTA 1QJ7B 4ZAEA 4I7YH 1GBKA 4I8LA 1PQ5A 2EC9H 1E38B 2B5TB 1K21H 4O97A 2ZCLP 5EXMA 4K2YA 3UOUA 1BTYA 2A4OA 2ZQ2A 4JK6A 1PPGE 5AHGH 3RUOA 2WUCA 3PLBA 1GBFA 1WV7H 3ATKA 3E0NB 4D9QA 3LC5A 1Z8JB 3OU0A 3BTDE 4D8NA 1TGSZ 4YOIA 2Z7FE 4Z0KA 5FXLA 4E06H 1C2LA 4SGAE 1S81A 3SI3H 1FXYA 1P2KA 3TJOA 1G3BA 3MNSA 1SGYE 1FQ3A 4NCYA 2W3KA 3A87A 1RS0A 3P8NA 5A2MH 1OYQA 1V2RT 4J2YB 5B6OA 1QBOA 1GDQA 2A5AA 1GHWH 1C5YB 1QL8A 2ZC9H 1VZQH 1SC8U 4A7IB 1GHXH 3SNAA 4D7FA 1MZAA 1Q3XA 1EAWA 3A86A 1J9CH 1YPHE 1O2KA 3SOSA 1B5GH 1HGTH 4X2YA 2VU8E 4H4FA 1UVPA 5EGMA 2GTBA 2Y5GA 2PGQB 1UHBA 2CGAA 1BBRE 1O3EA 4X6MA 2FIRH 3CS7A 4GLYA 4BAMB 2FOMB 1O3GA 1XVMA 5ETXA 1FPHH 1SVPA 2FDAA 5FX5A 3M7TA 3UREA 4B76A 3BF6H 2DUCA 1MTNB 2QA9E 1JOUB 3GY2A 2ZU2A 3RXUA 3STJA 1GVLA 2JH0D 1LKAA 2W26A 1V2MT 3K2UA 2A7CA 1GBEA 3GY8A 1FY3A 3QLPH 1GJ5H 1HAHH 3H7TA 2BDAA 2G51A 1RTKA 1CU1A 5DP6A 5A8YA 1SGNE 1ZMLA 2AMPA 3A7VA 1EATA 1C5MD 3AASA 3QDZB 1EOLA 2OTVA 1TFXA 4B1TA 1Z8RA 1VCQA 3FP6E 2JH6D 3SI4H 1SGFG 2G81E 1J16A 2VVUA 4TWWA 6GCHF 1O2JA 4B71A 1T8OA 3TITA 1O3BA 4R8TB 3RXAA 3L3TA 2SGAA 2FLRH 1TNHA 1QRWA 1Z6EA 1Y3VA 1BMAA 3ZVGA 3SNDA 1GJBB 2QXJA 4DCDA 4BNRA 2BY9X 4YESB 4OS1A 2LNCA 2TPIZ 1C5NH 4NFFA 1F5RA 4NA7A 2BDBA 1QTFA 1AGJA 1BJUA 1UTPA 1P3CA 2BXUH 3JZ1B 1GBBA 1QQ4A 2HVXA 5C5OA 1OP8A 2PTCE 3Q3KA 2XXLA 2VIOA 3ZZ5A 3GDSA 3TH3H 1W13U 4HGCA 2EA3A 2HRVA 2XWAA 1ZR0A 3SU6A 1O2WA 4K1TA 3ZZ9A 1HCGA 4ABGA 2FI4E 1THSH 3M5LA 3PTNA 3S0NA 3KF2A 1RJXB 3LGYA 3RC6A 3KQDA 1GMDF 1HFDA 1OKXA 4GHTA 1C4V2 1JIMA 1W2KH 4AB8A 3P17H 3A7YA 5HXFA 1NFWA 1EUFA 6GCHG 2CXVA 1ESTA 2XC4A 2GX4A 3VXFH 2OXSA 4YOJA 5AVDA 2V6NA 4FUJA 4JMYA 3LIWA 1SLVB 4CH8B 1C9PA 1O2ZA 2ZGJA 3RMLH 3SV6A 1LHGH 1EOJA 1TOCB 1LPGB 4ISLA 1FZZA 4NA9H 2CJIA 1MAXA 3F6UH 4KGAA 3LH1A 1JXPA 2C8ZB 2CMYA 2P3FH 3ZVEA 5E8EH 2F9PA 2QY0B 1J17T 1C1VH 2NU0E 3B8JA 1F0TA 1SR5C 4OS7A 2ZHQH 2ZQ1A 1EJMA 2P8OB 4MTBA 1ESAA 2K1QA 2TGDA 4K1EA 3RXEA 2ZG0H 4A6LA 4MPVA 2GCHF 3MH6A 1V2KT 3LGIA 1YPJH 3PWCA 1P01A 1RTFB 3MO6A 1HUTH 1TX7A 3P70B 1TBQH 1GMDG 4KTSA 1YP9A 5E0JA 1LKBA 3P92A 3H7OA 1TA2A 4Y8XA 4NZLA 3RXQA 1GJ6A 3ESTA 6CHAC 1XM1A 1C4U2 2Q6DA 4ASHA 1SQTA 4XBDA 1PQAA 2AERH 2FI3E 3T62A 3S7HB 2GCTC 1CBWC 4IS5A 4ZKSU 2FI5E 1AO5A 2WPJS 4NG9H 1ETTH 1P57B 3WY8A 4FUEA 3QN7A 2AH4X 1QQUA 1T7CA 5DO4H 5A09A 3BTFE 1V2JT 4AFQA 2J2UA 4HZHA 2GV6A 2F9UA 5BRRE 3UNSA 2FOEA 1A3BH 2RA3A 2YNAA 3SHAH 3AW1A 3EA9A 1KLJH 1O3KA 1FPCH 2SGQE 4WVPE 4Y71A 2YNBA 1GI9B 5HYOA 1FMGA 3I77A 3ZVBA 2WV4A 3O8RA 1C5RA 2GCHG 3KL6A 2R2WU 2BD7A 1O2HA 1ACBE 4IBLH 4JZDH 4AB9A 1O2NA 1LVYA 3HGPA 3E3TA 1IQJA 1DY9A 4JZIA 4U2WA 1G37A 2GGVB 4UD9H 1C2KA 1GGDB 5A0CA 4UFFH 1V2QT 3D65E 2BQ7B 4ABIA 3UNRA 1JRSA 5GJ4B 1XKBC 3RU4E 1EJAA 1QBVH 4DOQA 5EU8A 1GJDB 1VCPA 1DE7H 1ANEA 1UTKA 2OD3B 4X1RU 1Q31A 2XC0A 2CV3A 3F9EA 3PO1C 1KXEA 1LO6A 3ZVDA 1MMJN 3EYDA 5GWZA 5EPYA 1AKSA 1UCYE 3URDA 4CHAC 3I78A 2BTCE 1IQMA 2OUAA 4X6NA 3BV9B 1GCTC 1GWAA 3OTJE 1IQNA 1Z7KA 2A7JA 1T8MA 1OSSA 2VIVA 3TLOA 1K1NA 2FX6A 1W0YH 3HKIB 3FFGA 3RXMA 4Q7YA 3QO6A 3W94A 1XUGA 3PM3A 3BTME 4CR5A 3TIUA 1MU6B 1A5IA 1T4UH 2VVCA 4DG4A 1OP0A 3GDUA 1UVUH 4OGYA 3TJUA 1AVXA 3BSQA 1K22H 2UUFB 4I33A 2SGFE 3GCTF 2BLWA 5PTPA 3AAVA 1C2JA 1A3EH 1FUJA 3RLYH 1YM0A 1ZHPA 1O31A 1OXGA 2P94A 7KMEH 1AE8H 1AFEH 4NIXA 1YPGH 2QV1A 3M3SA 3M7QA 1QHRB 4MNVA 4ABJA 4NIVA 4Y11E 4CH2B 5SGAE 1A46H 1OWEA 2Q6FA 1GHZA 2O8WA 4NWKA 1NZQH 4X8TH 1DX5M 1GI4A 2Z9JA 1LQDB 4JCNA 2WYGA 4MVNA 1OWIA 1DY8A 1LPZB 5HM2A 2AIQA 4X1SU 3URCA 1IQFA 5DP5A 2Z3DA 4I8KA 2BQ6B 3ZYEA 1SOZA 2WUBA 1F92A 2F83A 1Q2WA 1N8OC 4IC5A 2VWNA 4NSYA 3EDXB 3F9HA 1ZSJA 4O9VA 1KXDA 1QBNA 4KP0A 1YPLH 2H6MA 3RM2H 1D4PB 1AZZA 3M5NA 4JYUH 1SB1H 1G3CA 1AVWA 4O03A 4RN6A 1B7XB 1F0UA 1G2LA 1GMHF 1ZSLA 3M3TA 4BTUB 4D76A 1C5VA 1O2RA 4K8YA 1NU7B 3GCTG 1Z1IA 4ESTE 3MTYA 3SGBE 1SLXB 1QIXB 4KKDA 1QA0A 2ZHEH 4TY7A 4DT7B 1ZTKA 4AX9H 3ATWA 4FUHA 1CT2E 1AUJA 3IWMA 3D62A 4XDEA 1YPHC 5GIBA 1LPKB 4RSPA 1EZUC 1QCPA 1EXFA 3A81A 3TGIE 8ESTE 4YLUA 1ZPZA 1EQ9A 3U9AH 5C5NA 1YC0A 1C9TA 2ZPSA 1MKXH 1VGCC 3SU3A 2VGCB 1HAVA 1NFUA 3FAOA 3HK3B 2TRMA 3K6ZA 4K1SA 1MTWA 4OS2A 1LHCH 2PW8H 4ZXXH 1CA0C 2O8UA 1O2YA 3ZV9A 2VH0A 1HNEE 3ODFA 1J15A 3ODDA 4INLA 1IOEA 2M5TA 1AWFH 2XCNA 4BXSA 4FU8A 7LPRA 6LPRA 1GMHG 1MQ5A 1SGTA 3MWIU 4FVDA 4WXVA 2ZTXA 2ZIQH 4B2CA 2VIWA 1BRAA 4LOYH 1OP2A 1MTUA 2AIPA 2J92A 1MQ6A 1KTTB 3VGCB 1V2UT 1TRYA 1AB9B 3GCHC 4CRAA 1BRCE 3S9CA 1A61H 2IN2A 1ELBA 3ZZAA 2PKAA 3BEIB 1E37B 1QNJA 3RM0H 1OWHA 1QGFA 2UWOA 2PSXA 1YGCH 1EP5A 1EAXA 2ZZUH 3BG4C 1NS3A 2QCYA 1Y3YA 2JETC 1BRUP 1K2I1 3KNXA 1QB1A 2QF0A 1GDNA 3BTWE 3ZZ6A 1VR1H 5K7RA 3GCOA 1UK3A 1GBLA 4B73A 2ZPQA 1A5GH 3MH7A 3RU4T 3VB3A 4X6PA 5A8XA 1ARBA 3K6YA 4ZH8A 3SUDA 3UWIA 5L6NH 4GVUA 2Q1JA 1FJSA 1Y5UT 4XFQA 3NK8A 1QA7A 1TIOA 1GDUA 5C3NA 1LDTT 3LJOA 2WPIS 1FY8E 2PUQH 1RD3B 2A2XH 1ZYOA 5CMXH 5EPNA 1TA6A 2ZU3A 3W95A 4A1TA 5AF9H 2W3IA 1BQYA 1TGNA 1PQ7A 1RTLA 1C1MA 2VNTA 3KHVA 2Y80A 2HNTF 1LCYA 1QB6A 4X6OA 4JK5A 2AYWA 1YKTA 4SGBE 1YLCA 2Y6TA 1O38A 3UR9A 3S69A 2FS8A 2EI6A 1N1LA 1UVSH 1GBTA 3SZNA 1WCZA 4BAOB 1BIOA 2QYIA 1TAWA 4ZMAH 3A83A 1O5EH 1PPZA 2FO9A 1C5ZB 1O2IA 1AY6H 4HI3A 3RC5A 1CHGA 1LMWB 3SNBA 2UWLA 5T6GA 4F4OC 4AORA 3AVZA 5DK1A 1GG6B 2Z9LA 5GDSH 1O3AA 1CA8B 1ZHMA 3PB1E 2XW9A 2GT8A 2Q6GA 3C1KA 1VITH 1B0EA 3SQEE 1GHBF 5EQRA 1MH0A 1HAIH 2OC0A 1G30B 1C1PA 3GDVA 1HIAA 1DLEA 1TX8A 2YOLA 2F9VA 2P93A 2FOHA 3P8GA 4AGJA 4E05H 1WTGH 4NA8A 2XWBI 5L2ZH 4BAQB 2XRCA 2BVXH 3ELAH 1NROH 4O3TA 3ZVFA 1AHTH 2ANWA 3FANA 5JBBS 2PLXA 1T4VH 1SGIB 1G9IE 1G36A 1PQ8A 2W7SA 2G5NA 2NU3E 2ZFSA 1BOQA 1SQOA 1GBMA 1O3OA 2OC7A 8GCHF 1TABE 1O35A 2ZEBA 2AGEX 2PWXA 1ZSKA 3DD2H 2FOGA 3UNQA 5FPYA 1J14A 1OX1A 3S7KB 2RG3A 3MU1A 1K1JA 1BBRK 2ANKH 4ABBA 1C5OH 1BHXB 3SORA 3NPSA 2P3TB 3B23B 5CHAC 3S9AA 4CBOA 1GHBG 1TBZH 1TBRH 1O2TA 1TOMH 4VGCC 5C20A 2B7DH 3U8TH 5E2OA 3LT3A 3LPRA 3OYPA 1DXPA 1TQ0B 1O34A 1P05A 2ZO3H 1BBRH 1SGPE 1A5HA 3U8RH 1WQVH 4UDWH 1BUIA 2F9BH 4IN1A 1PPCE 5F6MA 4KTCA 4ISNA 1XX9A 3OX7U 1DXWA 1ORFA 2UUYA 4Y0YE 1P06A 5T3HA 3ATIA 1P2NA 3DT0H 3LGVA 2FM2A 1INCA 1O2PA 1THPB 4CRBA 5E0GA 3EAJA 1AN1E 1SGEE 2BD9A 3U69H 1TNGA 4I31A 3UQVA 1MTSA 1G3EA 5IYTA 2PR3A 1WSSH 2FOBA 8GCHG 4Y8ZA 2HPPH 4ABAA 4WMDA 3RXBA 1D3DB 1IAUA 1SSXA 1Y59T 2XBWA 5H4IB 4FUGA 1OPHB 1XUJA 5F03A 1WTHD 1QB9A 3CS0A 1C1UH 3G01A 2C8WB 1KTSB 1YCPK 4K3JA 3E16B 3QWCH 1C5TA 2AFQB 1HV7A 1BTUA 4INKA 3RXTA 1C1NA 4RKOB 4CREA 3U8OH 1YPKH 1XXFA 3RXVA 1MCTA 4M7GA 5C1XA 1EZSC 1HAXB 2Z3EA 1UTJA 3GY3A 2RDLA 1L1NA 1HJAC 2ESTE 1MBQA 1YCPH 1AU8A 3QZQA 4CBNA 4Y7AA 1V6DA 1FAXA 1IQHA 1ZTJA 1KLIH 5FX6A 1KXCA 3PROA 1SQAA 4ZHLU 4FUFA 3NXPA 4OS5A 1ELCA 3A7XA 1GJ8B 3DFLA 4U32A 4A92A 1GI2A 1WQSA 3ZV8A 3TU7H 4X8SH 3T25A 1T31A 1QFKH 1W7XH 2BD5A 2BYAX 5I25A 1TPAE 3F1SB 3A85A 3HK6B 2AS9A 5DKMA 2VJ1A 4E7RG 1P2QA 1JMOH 4MPXA 1QRZA 3EGKH 3MI4A 1PPEE 1NRQH 1WUNH 4YLQH 4INHA 2FYRA 3QK1A 1GJ9B 1GJAB 2ZI2H 1O2GH 4U01A 2ZF0H 1ETSH 4YT6H 5DP4A 4X1QU 2LPRA 3HATH 2Z9KA 4BOHA 4CRGA 1ZJKA 1OS8A 1PYTD 2CF8H 1RRKA 1BMNH 4Q7ZA 2OC1A 2SGEE 2ZCHP 1SI5H 3B9FH 2FTMA 1O3HA 3LU9B 3MFJA 1O2XA 3U1JB 2G4UA 2GMTC 4UFDH 1PPBH 2PFEA 1P11E 5F8TA 2BXTH 5C1UA 4Q7XA 1EX3A 3TJVA 4NIYA 2ODPA 4JZ1A 3F9GA 2R3YA 1EPTB 1C1QA 1FAKH 2J95A 4A5TS 1RIWB 2QC2A 1EASA 3MU8A 1OWKA 3A84A 3E6PH 2Z6BD 3RXFA 2CHAB 2VINA 2PV9B 1AFQC 1TRNA 3VB7A 4NIWA 3RU4D 1SGCA 2BB4A 2D26C 3GCHB 1AZ8A 1DS2E 3OSYA 1G3DA 2BLOA 3M36A 3TPIZ 2GKVE 4D7GA 3SJOA 1C2IA 2BY8X 3UY9A 4J1YA 3K65B 5HMAA 1XXDA 2C3SA 2ZU5A 3QTOH 3SU5A 3A8DA 1FIWA 4BANB 2OQUA 5T6FA 3BTQE 3TJNA 1BHXF 1CGIE 1P9SA 5JBAS 4WH8A 2BD3A 1W3CA 4AFUA 5HM9A 3C27B 4FUCA 2JH5D 2BX3A 2C90B 2J9NA 1AKSB 1NRRH 1J8AA 4JYVH 2VWOA 1AD8H 4XSKU 2SGDE 4Q80A 5JBTA 3OY5U 1ELAA 2ZDAH 2H9TH 3BIVH 4GAWA 1F7ZA 4B2BA 1C5PA 1P10A 5FCKA 1DITH 3KQCA 1XUFA 2JKHA 1S83A 1UCYK 1ZGVA 4YO9A 2AEIH 1IQEA 3KGPA 3SV2H 1ANBA 3RC4A 2FYQA 1GHYH 2G8TA 1CGJE 3H5CB 2AMDA 2ZGXH 2CF9H 2G55A 3ZZ8A 3QX5H 1JWTA 3TH2H 5LPRA 1O2MA 5FCRA 3PMHB 1VITF 1UTOA 4AYVB 1UCYH 1MTNC 4AFZA 5FBEA 2A45B 2FTLE 1EZXC 3SUEA 4A1XA 5EODA 1AE5A 1K1IA 2R9PA 2Y81A 3CP7A 1LVOA 1P8VC 2ZNKH 4HTCH 1O5DH 2ASUB 1NPMA 3PWBA 4FXGH 3QUMP 1A0LA 5TJXA 3QZRA 1T8LA 1GBJA 1F2SE 4QT8C 2OCVB 1Y3WA 1V2NT 1SLUB 1UMAH 1HBTH 4OGXA 1S85A 1OYTH 3P8OA 1NRNH 3RXKA 1TMUH 3A8CA 3SJKA 4WH6A 2A32A 3GOVB 1P9UA 3D49H 1SOTA 1E0FD 1O2OA 2RCEA 1ANDA 2ZGBH 1D3PB 1WAYB 1O3DA 2H2ZA 5A8ZA 3V7TA 2BVSH 2A4QA 1C1RA 1OWJA 2P95A 3SV9A 3SO3A 3K9XB 1V2OT 2C93B 2GDEH 2FP7B 1NU9A 2BHGA 1V2WT 2R0LA 1CT4E 2FEQH 4ZKRU 3P95A 2G00A 2ZHWH 1VITG 3LKWA 3LJJA 4LZ1H 1FNIA 2CN0H 3EQ0H 2BD4A 4JZEH 3SGQE 1AWHB 3RMNH 1C2MA 1BDAA 2BZAA 3HGNA 2RA0A 1DWCH 1MUEB 3RXCA 1Y5BT 2XCFA 1LQEA 4DIIH 2BZ6H 4CRFA 4LZ4B 3L6PA 4ISHH 2ZFRH 3E91A 1D6WA 1GVKB 4IW4E 1NN6A 3SU2A 3DUXH 3GY6A 1IHSH 2FS9A 1GHVH 1O2SA 2ZDMA 3GYMA 4XOJA 2UUKB 5TCCA 4GSOA 5CHAB 1D9IA 1NRSH 1DWDH 1DFPA 2FWWA 4MG3A 1ZOMA 1O32A 2V35A 1GI5A 1GBDA 1CHOF 4Y76A 1SBWA 2BDGA 5T6DA 4I8GA 1MBMA 1C2EA 4FU9A 2FOAA 1A1RA 1KIGH 1CE5A 1S82A 3KQBA 5LGOA 3SUGA 2O8MA 2H1UA 1B0FA 2UWPA 4GHQA 4O3UA 1FLEE 2ANMH 4IN2A 3ZVCA 3Q76A 1FY5A 1HAYB 1C5LH 2GDDA 2P8OC 2F9NA 1EB2A 3MO9A 2P59A 4ZHAA 3EA8A 5TCAA 2PKAB 3TNTA 1WU1A 2H5DA 4FVBA 5ABWA 3A7ZA 1SGFA 4X8VH 2ZFQH 3Q77A 3SJ8A 2NWNA 1P0SH 1UTMA 2STBE 3BEFB 3A88A 3LGWA 2GV7A 1SG8B 2FXRA 1KDQB 1GBIA 3M37A 2BOHB 1O2LA 1FV9A 4BTTB 1HDTH 3A7WA 1MD8A 4LK4A 3MNBA 5BPEA 1HRTH 1O2UA 2QXGA 2XTTB 2Y5FA 4ZKOU 4X8UH 1CHOG 1L4DA 9ESTA 1PFXC 1O3LA 1GCDA 4LXBH 1BTXA 8LPRA 2ZGCA 1Z1JA 3SUFA 3SV7A 1QJ1B 1O30A 1WBGB 4MQAA 5IDKA 5E0HA 1H4WA 4YTAA 2J34A 1DWBH 1ZRKA 1GHAF 5JYIA 3LH3A 3U98H 1TGTA 4DVAU 2G4TA 3RXSA 3ZZDA 3EE0B 4X0WU 3UFAA 1CO7E 2P16A 1MKWK 3SU1A 2AGGX 1A0HB 1E34B 3UTUH 1WYKA 5A0AE 4CRDA 4WJG2 1RXPA 2O8LA 5EQSA 1P3EA 1PJPA 5FPSA 1QL9A 2ZWLH 4MPUA 3SU4A 1AMHA 4K5ZA 3RXJA 3V12A 1O5FH 1O0DH 3PMBB 1GBAA 1L0ZA 3T26A 1LHFH 2GZ9A 2HGTH 1MKWH 3KIDU 2WPKS 1P03A 1H8DH 2ALVA 2KAIA 3PLPA 1VJ9U 3QGNB 1ZMJA 2R0KA 3M5MA 2ZU4A 1TYNA 1BT7A 5F8XA 1A2CH 1S6HA 1QRXA 1BMMH 1KXBA 1ELGA 2OLGA 1OWDA 1V2LT 5LH8A 1BTZA 3BTGE 3UIRA 2H9HA 2J4IA 2GD4B 4TY6A 1S6FA 1DVAH 4TPIZ 1G2MA 5JBCS 1V3XA 3KN2A 1ARCA 1D6RA 2ALPA 3PYHA 1TQ7B 4BAKB 2ZFTA 4X2WA 1NESE 1HIAB 4DJZB 1TMBH 2A7HA 1T32A 5JPMH 1Y8TA 1GHAG 1H9LB 6CHAB 3PV4A 1BCUH 3RXRA 1RFNA 2GT7A 3SW2B 2GCTB 1CBWB 1V2PT 4FUDA 1W7GH 2B8OH 2V3OH 1ELEE 1AFQB 1O3PB 2ZDKA 2DE8A 1LHDH 5LPEA 1H8IH 5AFYH 2QXHA 1C1WH 4ABFA 3NKKA 1CVWH 1BTPA 4H6TA 5EW1H 1SHHB 1Z6JH 2OP9A 1XMNB 3AW0A 3GYLB 3UR6A 1C2HA 3SHCH 4AZ2B 1E35B 3QTVH 2QXIA 3E0PB 1K9OE 2SFAA 6ESTA 1PYTC 3RXDA 1GI1A 1L2EA 2VVVA 1ELDE 5EXLA 1UHBB 1TB6H 1GL0E 4YOGA 1T8NA 2ZTZA 5DP3A 1YLDA 2IPHA 3P8FA 4Q2KA 1W14U 3TGKE 1QR3E
chains in the Genus database with same CATH superfamily
1O3NA 2B0FA 1VCWA 3O8CA 3RLWH 1UTQA 1DSTA 1NC6A 2D8WA 3RMOH 3SZEA 4DY7B 3OAAD 4MDSA 1GBHA 3A8BA 4WMFA 8KME2 1EKBB 2J38A 2A5KA 3WWFA 4IC6A 5GPIB 2TGTA 1O3CA 3ATMA 1TMTH 3ENSB 3PO1B 2IOTA 2R3UA 3NWUA 1NFXA 4MPWA 3VPKA 2BMGB 1NY22 4CHAB 2WPMS 2GZ8A 4Y79A 2PKSC 4GCHF 2G52A 2HPQH 3GY7A 2THFB 7ESTE 1SPJA 4ABHA 2KZ4A 1GCTB 1W11U 4UE7H 1HAGE 2QF3A 1O37A 3MMGA 4XBBA 5G4BA 1DANH 1O5BB 1TPPA 3ZZ4A 4MNYA 4UEHH 4AG1A 3DA9B 1C5XB 3BN9A 2V0BA 2B9LA 2ZHFH 3KYGA 1FN8A 1XUHA 2GP9B 5FPTA 2VWMA 3S9BA 1HPGA 1GBCA 4X2XA 3V13A 4RI0A 3GISB 2A2QH 1DLKB 4OS4A 4B74A 5JB9S 2IJD1 2UUJB 2Y7XA 2VGCC 4DGJA 4UFGH 4MNXA 5C67A 2WPHS 1EP6A 3N7DA 1V2ST 2WINI 2AMQA 4ZUHA 3M35A 1P02A 2Z9GA 3I29A 3VG8A 2XNIA 1X7AC 3VXEH 4BXWA 1O3IA 1ZZZA 1ETRH 3VEQB 4F48B 1ANCA 3LDXH 3SJIA 1EB1H 1HAZB 3UUZA 2YMSB 3A8AA 1GJ7B 3OTPA 4PROA 1ELFA 3LGUA 3RXGA 1LVMA 1N6XA 3F3BA 2BQWB 2J94A 1FDPA 1ESBA 1D3TB 3TK9A 5DSFA 2D1JA 2BLQA 2WYJA 1C1SA 4GCHG 2QGRA 3O8BA 2ZU1A 1N8OB 3VGCC 2NU2E 4AN7A 1YPEH 3T28A 1AB9C 1EZQA 3RXLA 3SV8A 2VB0A 1O2VA 3MOCA 1SL3A 2TBSA 1UVOA 1AUTC 1TNIA 5L30H 1SHYA 3E8LA 3STIA 3BG8A 2FX4A 3P6ZB 2HOBA 4JZFH 2KCYA 5EQQA 1TNJA 1IQGA 4DW2U 1MU8B 4FUIA 2ZFFH 2STAE 4K69A 1C5SA 4NGAH 1ZPBA 3MNCA 1W12U 1YYY1 1EJNA 4ZHMU 5EJZA 2ZP0H 4I32A 4ISIH 4RKJB 1GPZA 2L6OA 1K1PA 2PTNA 5C0TA 1DPOA 4UONA 1TNLA 2G5VA 3SN8A 2ODYB 1AI8H 4IGDA 3EE7A 4YM9A 1NRPH 1YPMH 5GCHF 1BTWA 2P3UB 1QL7A 1DUEA 1KXAA 1AQ7A 1GMCF 4MNWA 5FBIA 4H6SB 4K60A 2K0QA 1S84A 1W10U 1ID5H 1SGDE 4GUXA 2BDCA 1C5UA 3M7UA 1GJCB 1CSOE 4B2AA 5LPFA 1C2GA 1K1LA 2H9EH 2Z9IA 5ESBA 1BITA 1NBME 3FVFB 3SJ9A 1VGCB 2WV5A 1QURH 1YCPM 2QAAA 1W0KD 1E36B 2F91A 2C4FH 1FI8A 1CA0B 2I6SA 3FP7E 1O3JA 1KSNA 2ZGHA 1FY4A 1HXFH 2HNTE 4D9RA 2HWLB 1UJ1A 3LONA 3TGJE 1QY6A 3T5FH 2ULLA 2PHBA 4R0IA 3RXHA 2QN5T 4U30A 2SNVA 2XBVA 4CRCA 1P04A 1MD7A 2VIQA 1S5SA 3VFEA 3DFJA 1K1MA 3A7TA 1GL1A 1O5CB 2PP6A 1PPFE 3NZIA 1KYNA 4FUBA 4XBCA 1GG6C 1C2DA 1RGQA 2QIQA 2O8TA 5GCHG 4YXWD 1GMCG 1MZDA 4ZXYH 2XNDD 3RXOA 1HYLA 3BTKE 2FOCA 2FMJA 2W7UA 3Q00A 4BTIB 1JRTA 3TVJB 3ZZBA 3JZ2B 2ZDVH 2BLVA 2XBXA 3BG4B 2XBYA 4IMQA 2ZDLA 3RMMH 2JETB 3UOPA 1F0RA 1EAUA 3GCNA 1ZPCA 1CGHA 2FOFA 1GI6A 3EA7A 2HALA 5E2PA 1NFYA 4YT7H 3E1XB 3E90B 1EPTA 3R3GB 1HJ8A 1NTPA 1ELTA 2PSYA 2FESH 2ZPRA 5FAHA 3ATLA 1Y3XA 5ESTE 1A7SA 1A4WH 2Y7ZA 3A89A 4AGKA 4WWYA 2BY7X 4CR9A 1YBWA 1XVOA 2C8XB 3SU0A 2ILNA 7GCHF 3PMJA 1JBUH 2LP6A 1UVTH 1TE0A 4TWYA 1UTLM 3MO3A 4ISOA 1DICA 5DJ7A 3RXPA 4XE4A 2BDYA 3BIUH 3Q3YA 3RXIA 1K1OA 1DSUA 4WF8A 4Y7BA 5DPAA 4WXIA 3RP2A 3SQHE 4DURA 1Y3UA 2OBOA 3R0FA 2BDIA 1UTNA 1BMFD 1THRH 1H9IE 1NM6A 3PTBA 1A0JA 4NZQA 1FIZA 2ZA5A 1ZRBA 1XKAC 2GZ7A 5HGGA 1BZXE 1TGCA 1LTOA 2D2DA 1E79D 3ITIA 4Y8YA 1LHEH 5C17A 2OINA 3KCGH 1SFIA 1TRMA 1UW7A 3KQEA 4WY3A 3SGAE 2TIOA 4TPYA 1XUKA 4DIHH 3FO8D 4ZKNU 3CENA 1SMFE 4A1VA 3BTTE 1Z8GA 2ZTYA 1O36A 3IITA 1ZLRA 5GXPA 5F53A 1U6QA 2ZHDA 1F5LA 2VIDA 1MCVA 1ZGIA 4KTUA 3VB5A 2ZECA 1BTHH 1KY9A 2FPZA 7GCHG 4MLFB 2SGPE 3GY5A 3MU4A 5EJ1A 3ZZCA 3GY4A 1O5AB 5EXNA 3TH4H 2VIPA 3T29A 1TGBA 1TONA 1Z8IB 1CQQA 5DGJA 3MQKC 4F49A 4WMEA 1NO9H 3V0XA 9LPRA 1DDJA 2OC8A 1O33A 1GJ4H 4ZROA 2O9QA 3UQOA 1GI8B 1K28D 2XC5A 3FZDA 3NCLA 1HLTH 5EOKA 4E7NA 4AOQA 2TGPZ 4X2VA 5AFZH 3ZYDA 1C5WB 3MH5A 2AGIX 4UFEH 1TPSA 2HLDD 2BM2A 3F2HA 1O39A 1HB0B 4IMZA 5DG6A 1EAIA 1SGRE 3LOXA 3N7OA 2PGBB 1BA8B 3FZZA 1GI3A 2F9OA 1TALA 3T2NA 5DP9A 2A0QB 1AIXH 4RT0A 5EJLA 1ABJH 1HAVB 1S0QA 1S0RA 2FZZA 1K0HA 1Y5AT 2A1DB 4Y10E 1HJ9A 1ZHRA 4K8BA 2A4RA 1IQKA 4XRNA 3PMAB 3UPEA 1L1GA 3MU0A 4VGCB 1O2QA 2PKSB 3AAUA 3VB4A 2NU1E 5J4QA 2Y5HA 3L33A 2BOKA 4HFPB 4Y6DA 3NUMA 1TNKA 1FN6A 5C94A 3A80A 2LELA 3KYFA 2VH6A 1H8ED 1Z71A 4AG2A 1DWEH 3VB6A 1P09A 2BD8A 1IHTH 1MKXK 1SLWB 3M5OA 4FOUC 3M61U 2Z3CA 5JDUB 3BTHE 2NU4E 1JIRA 4Y0ZE 5F8ZA 2EEKA 3N99A 3RDZA 1FY1A 4H42U 3OE7D 3NRLA 5J4SA 4X1NU 2BY6X 3M3VA 2F43B 1MTVA 4I8JA 2FLBH 1H9HE 1MAYA 3WWBA 1BB0B 2QF4A 3FKSD 5FHTA 5A0BA 5L2YH 2BD2A 2WV9A 1W0ZU 1P2MA 2Y82A 2GVFA 1G32B 1XUIA 1ZMNA 4NWLA 1L4ZA 3F68H 1TLDA 3MH4A 4YZUA 2BY5X 5CHBA 2Z94A 3U1IB 2FODA 3F9FA 2IJOB 2KFWA 1VJAU 4GPGA 1D3QB 1TPOA 2EI7A 2W5EA 5JB8S 1UK2A 2H5CA 2ZDNA 3MYWA 1EPTC 3SBKA 2C8YB 1RIWC 3T27A 1QJ6B 3KEEA 2XYAA 1SGQE 3SYJA 1C4Y2 3BEUA 1GI0A 4NFEA 2CHAC 2TGAA 1AVGH 1M9UA 2BVRH 2ZCKP 4ABEA 3OY6U 1P2IA 3MU5A 1F0SA 4KELA 4OS6A 1BJVA 1HJAB 1FONA 5EG4A 3MNXA 1OOKB 1P2JA 3SNEA 5I46H 1KXFA 4TSFD 1WOFA 1O3MA 1P12E 3D23A 2VWLA 4Q63A 2PUXB 2F3CE 1UK4A 4Z6AH 4AYYB 1BMLA 1C2FA 3FP8E 2ANYA 1UO6A 1BRBE 1O5GH 2KAIB 3DHKH 3LC3A 3TNSA 3F0PA 1P2OA 4THNH 1IQLA 4TYDA 2WPLS 1KDQA 3MHWU 4X1PU 3GICB 3QGJA 3HKJB 4NSVA 2I6QA 1KLTA 2HLCA 3A82A 3TK6A 1GGDC 5C1YA 5K0HA 3IG6B 1ZTLA 3UWJH 1LVBA 1F5KU 2BX4A 5CE1A 1C1TA 1CT0E 2SNWA 4JYTA 1NT1A 2A5IA 5B6LA 2OBQA 1ZJDA 1O3FA 1C1OA 4TT3D 1DT2A 1V2VT 5DP7A 1L1JA 2V7QD 3SNCA 3ZZ7A 1IQIA 1SFQB 1W8BH 1ABIH 2A4GA 5EW2H 1DUAA 4FU7A 5C2ZA 5CDFE 3O8DA 1HXEH 1YF4A 1C5QA 2ZKSA 4ABDA 4BAHB 1TX6A 4I8HA 1GVZA 2ZFPH 2A31A 3ZZ3A 1PPHE 3Q3XA 5DP8A 1H1BA 4AFSA 2GMTB 1DOJA 4M9FA 1V2TT 2BDHA 2DE9A 2ODQA 3TK5A 1ELVA 3ZVAA 3PLKA 2V3HH 1N6YA 2R2MB 2EI8A 3HPTB 2OQ5A 3BTEE 4B75A 1DM4B 1HAOH 1HAPH 1GI7B 1TWXB 3V3MA 2HNTC 3LGTA 1QJ7B 4ZAEA 4I7YH 1GBKA 4I8LA 1PQ5A 2EC9H 1E38B 2B5TB 1K21H 4O97A 2ZCLP 5EXMA 4K2YA 3DSGA 3UOUA 1BTYA 2A4OA 2ZQ2A 4JK6A 1PPGE 5AHGH 3RUOA 2WUCA 3PLBA 1GBFA 1WV7H 4XD7D 3ATKA 3E0NB 4D9QA 3LC5A 1Z8JB 3OU0A 3BTDE 4D8NA 1TGSZ 4YOIA 2Z7FE 4Z0KA 1COWD 5FXLA 1C2LA 4SGAE 4E06H 1S81A 3SI3H 1H8HD 1FXYA 1P2KA 3TJOA 1G3BA 3MNSA 1SGYE 3ZIAD 1FQ3A 4NCYA 2W3KA 3A87A 3FOAA 1RS0A 3P8NA 5A2MH 1OYQA 1V2RT 4J2YB 5B6OA 1QBOA 1GDQA 2A5AA 1GHWH 1C5YB 1QL8A 2M2AA 2ZC9H 1VZQH 3GS9A 1SC8U 4A7IB 1GHXH 3SNAA 4D7FA 1MZAA 1Q3XA 1EAWA 3A86A 1J9CH 1YPHE 1O2KA 3SOSA 2RDEA 1B5GH 1HGTH 4X2YA 2VU8E 4H4FA 1UVPA 5EGMA 2GTBA 2Y5GA 2PGQB 1UHBA 2CGAA 1BBRE 1O3EA 4X6MA 2FIRH 2AHME 3CS7A 4GLYA 4BAMB 2FOMB 1O3GA 1XVMA 5ETXA 5KEDA 1FPHH 1KMHB 1SVPA 2FDAA 5FX5A 3M7TA 3UREA 4B76A 3BF6H 2DUCA 1SQRA 4FETA 1MTNB 2QA9E 1JOUB 3GY2A 2ZU2A 3RXUA 3STJA 1GVLA 2JH0D 1LKAA 2W26A 1V2MT 3K2UA 5IK2D 2A7CA 1GBEA 3GY8A 1FY3A 3QLPH 1GJ5H 1HAHH 3H7TA 2BDAA 2G51A 1RTKA 1CU1A 5DP6A 5A8YA 1SGNE 1ZMLA 2AMPA 3A7VA 1EATA 1C5MD 3AASA 4F55A 3QDZB 1EOLA 2OTVA 1TFXA 4B1TA 3OEHD 1Z8RA 1VCQA 3FP6E 2JH6D 3SI4H 1SGFG 2G81E 1J16A 2VVUA 4TWWA 6GCHF 2V3MA 1O2JA 4B71A 1T8OA 3TITA 1O3BA 1EFRD 4R8TB 3RXAA 3L3TA 2SGAA 2FLRH 1TNHA 1QRWA 1Z6EA 1Y3VA 1BMAA 3ZVGA 3SNDA 1GJBB 2QXJA 4DCDA 4BNRA 2BY9X 4YESB 4OS1A 2LNCA 2TPIZ 1C5NH 4NFFA 1F5RA 4NA7A 2BDBA 1QTFA 1AGJA 1BJUA 1UTPA 1P3CA 2BXUH 3JZ1B 1GBBA 1QQ4A 2HVXA 5C5OA 1OP8A 2PTCE 3Q3KA 2KCOA 2VIOA 2XXLA 3ZZ5A 3GDSA 3TH3H 1W13U 4HGCA 2EA3A 2HRVA 1NBMD 2XWAA 1ZR0A 3SU6A 1O2WA 4K1TA 2VBCA 3ZZ9A 1HCGA 4ABGA 2FI4E 1THSH 3M5LA 3PTNA 3S0NA 3KF2A 1RJXB 3LGYA 3RC6A 3KQDA 1GMDF 1HFDA 1OKXA 4GHTA 1C4V2 1JIMA 1W2KH 4AB8A 3P17H 2JJ1D 3A7YA 5HXFA 1NFWA 1EUFA 6GCHG 2CXVA 1ESTA 2XC4A 2J98B 2GX4A 3VXFH 2OXSA 4YOJA 5AVDA 2V6NA 4FUJA 4JMYA 3LIWA 1SLVB 4CH8B 1C9PA 1O2ZA 2ZGJA 3RMLH 3SV6A 1LHGH 1EOJA 1TOCB 1LPGB 4ISLA 1FZZA 4NA9H 2CJIA 1MAXA 3F6UH 3UB0A 4KGAA 3LH1A 1JXPA 2C8ZB 2CMYA 2P3FH 3ZVEA 5E8EH 2F9PA 2QY0B 1J17T 1C1VH 2NU0E 3DCLA 3B8JA 1F0TA 1SR5C 4OS7A 2WHXA 2ZHQH 2ZQ1A 1EJMA 2P8OB 4MTBA 1ESAA 2K1QA 2TGDA 4K1EA 3RXEA 2ZG0H 4A6LA 2GJGA 4MPVA 2GCHF 3N7EA 3MH6A 1V2KT 3LGIA 1YPJH 3PWCA 1P01A 1RTFB 3MO6A 1HUTH 1TX7A 3P70B 1TBQH 1GMDG 4KTSA 1YP9A 5E0JA 4HG6A 1LKBA 3P92A 3H7OA 1TA2A 4Y8XA 4NZLA 3RXQA 5T1VA 1GJ6A 3ESTA 6CHAC 1XM1A 1C4U2 2Q6DA 4ASHA 1SQTA 4XBDA 1PQAA 2AERH 2FI3E 3T62A 3S7HB 2GCTC 1CBWC 4IS5A 4ZKSU 2FI5E 1AO5A 2WPJS 4NG9H 1ETTH 1P57B 3WY8A 4FUEA 2KCPA 3QN7A 2AH4X 1QQUA 1T7CA 5DO4H 5A09A 3BTFE 1V2JT 4AFQA 2J2UA 4HZHA 2GV6A 2F9UA 5BRRE 3UNSA 2FOEA 1S6LA 1A3BH 2RA3A 2YNAA 3SHAH 3AW1A 3EA9A 1KLJH 1O3KA 1FPCH 2SGQE 4WVPE 4Y71A 2YNBA 1GI9B 5HYOA 1FMGA 3I77A 3ZVBA 2WV4A 3O8RA 1C5RA 1FX0B 2GCHG 3KL6A 2R2WU 2BD7A 1O2HA 1ACBE 4IBLH 4JZDH 4AB9A 1O2NA 1LVYA 3HGPA 3E3TA 1IQJA 1DY9A 4JZIA 4U2WA 1G37A 2GGVB 4UD9H 1C2KA 1GGDB 5A0CA 4UFFH 1V2QT 3D65E 2BQ7B 4ABIA 3UNRA 1JRSA 5GJ4B 1XKBC 3RU4E 1EJAA 1QBVH 4DOQA 5EU8A 1GJDB 1VCPA 2JIZD 1DE7H 1ANEA 1UTKA 2OD3B 4X1RU 1Q31A 2XC0A 2CV3A 3F9EA 1QZ8A 3PO1C 1KXEA 1LO6A 3ZVDA 1MMJN 3EYDA 5GWZA 5EPYA 1AKSA 1UCYE 3URDA 4DT4A 4CHAC 3I78A 2BTCE 1IQMA 2OUAA 4X6NA 3BV9B 1GCTC 1GWAA 3OTJE 1IQNA 1Z7KA 2A7JA 2QF5A 1T8MA 1OSSA 2VIVA 3TLOA 1K1NA 2FX6A 1W0YH 3HKIB 3FFGA 3RXMA 4Q7YA 3QO6A 3W94A 1XUGA 3PM3A 3BTME 4CR5A 3TIUA 1MU6B 1A5IA 1T4UH 2VVCA 4DG4A 1OP0A 3GDUA 1UVUH 4OGYA 3TJUA 1AVXA 3BSQA 1K22H 4ACBA 2UUFB 4I33A 2SGFE 3GCTF 2BLWA 5PTPA 3AAVA 1C2JA 1A3EH 1FUJA 3RLYH 1YM0A 1ZHPA 1O31A 1OXGA 2P94A 7KMEH 1AE8H 1AFEH 4NIXA 1YPGH 2QV1A 3M3SA 3M7QA 1QHRB 4MNVA 4ABJA 4NIVA 4Y11E 4CH2B 4Z1MD 1A46H 5SGAE 1OWEA 2Q6FA 1GHZA 2O8WA 4NWKA 1NZQH 4X8TH 2QE7D 1DX5M 3OFND 1GI4A 2Z9JA 1LQDB 4JCNA 2WYGA 4MVNA 1OWIA 1DY8A 1LPZB 5HM2A 2AIQA 4X1SU 3URCA 1IQFA 3PRDA 5DP5A 2Z3DA 4I8KA 2BQ6B 3ZYEA 1SOZA 2WUBA 1F92A 2F83A 1Q2WA 1N8OC 4IC5A 2VWNA 4NSYA 3EDXB 3F9HA 1ZSJA 4O9VA 1KXDA 1QBNA 4KP0A 1YPLH 2H6MA 3RM2H 1D4PB 1AZZA 3M5NA 4JYUH 1SB1H 1G3CA 1AVWA 4O03A 4RN6A 4P02A 1B7XB 1F0UA 1G2LA 1GMHF 1ZSLA 3M3TA 4BTUB 4D76A 1C5VA 1O2RA 4K8YA 1NU7B 3GCTG 1Z1IA 4ESTE 3MTYA 3SGBE 4ACAA 1SLXB 1QIXB 4KKDA 1QA0A 2ZHEH 4TY7A 4DT7B 1ZTKA 4AX9H 3ATWA 4FUHA 1CT2E 1AUJA 3IWMA 3D62A 4XDEA 1YPHC 5C0UA 5GIBA 1LPKB 4RSPA 5DN6D 1EZUC 1QCPA 1EXFA 3A81A 3TGIE 8ESTE 1W0JD 4YLUA 1ZPZA 1EQ9A 3U9AH 5C5NA 1YC0A 3F2GA 1C9TA 2ZPSA 1MKXH 1VGCC 3SU3A 2VGCB 1HAVA 1NFUA 3FAOA 3HK3B 2TRMA 3K6ZA 4K1SA 1MTWA 4OS2A 1LHCH 2PW8H 4ZXXH 1CA0C 2O8UA 1O2YA 3ZV9A 2VH0A 1HNEE 3ODFA 1J15A 3ODDA 4INLA 1IOEA 1YY3A 2M5TA 1AWFH 2XCNA 4BXSA 4FU8A 7LPRA 3PV2A 6LPRA 1GMHG 1MQ5A 1SGTA 3MWIU 4FVDA 4WXVA 2ZTXA 2ZIQH 4B2CA 2VIWA 1BRAA 4LOYH 1OP2A 1MTUA 2AIPA 2J92A 2W6ID 1MQ6A 1KTTB 3UAIC 3VGCB 1V2UT 1TRYA 1AB9B 3GCHC 2EQNA 4CRAA 1BRCE 3S9CA 1A61H 2IN2A 1ELBA 3ZZAA 2PKAA 3BEIB 1E37B 1QNJA 3RM0H 1OWHA 1QGFA 2UWOA 2PSXA 1YGCH 1EP5A 5KECA 1EAXA 2ZZUH 3BG4C 1NS3A 2QCYA 1Y3YA 2XOKD 2JDID 2JETC 1BRUP 1K2I1 3KNXA 1QB1A 2QF0A 4I86A 1GDNA 3BTWE 3ZZ6A 1VR1H 5K7RA 3GCOA 1UK3A 1GBLA 2KX4A 4B73A 2ZPQA 1A5GH 3MH7A 3RU4T 3VB3A 4X6PA 5A8XA 1ARBA 3K6YA 4ZH8A 3SUDA 3UWIA 5L6NH 4GVUA 2Q1JA 1FJSA 1SKYE 1Y5UT 4XFQA 3NK8A 1QA7A 1TIOA 1GDUA 5C3NA 1LDTT 3LJOA 2WPIS 1FY8E 2PUQH 1RD3B 2A2XH 1ZYOA 5CMXH 5EPNA 1TA6A 2ZU3A 3W95A 4A1TA 5AF9H 2W3IA 1BQYA 1TGNA 1PQ7A 2YMSD 1RTLA 1C1MA 2VNTA 3KHVA 2Y80A 2HNTF 1LCYA 5FL7D 1QB6A 4X6OA 4JK5A 2AYWA 1YKTA 4SGBE 1YLCA 2Y6TA 1O38A 3UR9A 2J97A 3S69A 2FS8A 2EI6A 1N1LA 1UVSH 1GBTA 3SZNA 1WCZA 4BAOB 1BIOA 2QYIA 1TAWA 4ZMAH 3A83A 1O5EH 1PPZA 2FO9A 1C5ZB 1O2IA 1AY6H 4HI3A 3RC5A 1CHGA 1LMWB 3SNBA 2UWLA 5T6GA 4F4OC 4AORA 3AVZA 5DK1A 1GG6B 2Z9LA 5GDSH 1O3AA 1CA8B 1ZHMA 3PB1E 2XW9A 2GT8A 2Q6GA 3C1KA 1VITH 1B0EA 3SQEE 3OEED 1GHBF 5EQRA 1MH0A 1HAIH 2OC0A 1G30B 1C1PA 3GDVA 1HIAA 1DLEA 1TX8A 2YOLA 2F9VA 2P93A 2FOHA 3P8GA 4AGJA 4E05H 1WTGH 4NA8A 2XWBI 5L2ZH 4BAQB 2XRCA 2BVXH 3ELAH 1NROH 4O3TA 3ZVFA 1AHTH 2ANWA 3FANA 5JBBS 2PLXA 1T4VH 1SGIB 1G9IE 1E1QD 1G36A 1PQ8A 2W7SA 2G5NA 2NU3E 2ZFSA 1BOQA 1SQOA 1GBMA 1O3OA 2OC7A 8GCHF 1TABE 1O35A 2ZEBA 2AGEX 2KM0A 2PWXA 1ZSKA 3DD2H 2FOGA 3UNQA 5FPYA 1J14A 1OX1A 4OM9A 2RG3A 3S7KB 3MU1A 1K1JA 2RFKC 1BBRK 2ANKH 4ABBA 1C5OH 1BHXB 3SORA 3NPSA 2P3TB 3B23B 5CHAC 3S9AA 4CBOA 1GHBG 1TBZH 1TBRH 1O2TA 1TOMH 4VGCC 5C20A 2B7DH 3U8TH 5E2OA 3LT3A 3LPRA 3OYPA 1DXPA 1TQ0B 1O34A 1P05A 2ZO3H 1BBRH 1SGPE 2W6JD 1A5HA 3U8RH 1WQVH 4UDWH 1BUIA 2F9BH 4IN1A 1PPCE 5F6MA 4KTCA 4ISNA 1XX9A 3OX7U 1DXWA 1ORFA 2UUYA 3PRBA 1P06A 4Y0YE 5T3HA 3ATIA 1P2NA 3DT0H 3LGVA 2FM2A 1INCA 1O2PA 1THPB 4CRBA 5E0GA 3EAJA 1AN1E 1SGEE 2BD9A 3U69H 1TNGA 4I31A 3UQVA 1MTSA 1G3EA 5IYTA 2PR3A 1WSSH 2FOBA 8GCHG 4Y8ZA 2HPPH 2IPQX 2K8IA 4ABAA 4WMDA 3RXBA 3DSOA 1D3DB 1IAUA 1SSXA 1Y59T 1YLNA 2XBWA 5H4IB 4FUGA 1OPHB 1XUJA 5F03A 1WTHD 1QB9A 3CS0A 1C1UH 3G01A 2C8WB 1KTSB 1YCPK 4K3JA 3E16B 3QWCH 1C5TA 2AFQB 1HV7A 1BTUA 4INKA 3RXTA 1C1NA 4RKOB 4CREA 3U8OH 1YPKH 1XXFA 3RXVA 1MCTA 4M7GA 5C1XA 1EZSC 1HAXB 2Z3EA 1UTJA 3GY3A 2RDLA 1L1NA 1HJAC 2ESTE 1MBQA 1YCPH 1AU8A 3QZQA 4CBNA 4Y7AA 1V6DA 1FAXA 1IQHA 1ZTJA 1KLIH 5FX6A 1KXCA 3PROA 1SQAA 4ZHLU 4FUFA 3NXPA 4OS5A 1ELCA 3A7XA 1GJ8B 3DFLA 4U32A 4A92A 1GI2A 1WQSA 3ZV8A 3TU7H 4X8SH 1WDIA 2EY4C 3T25A 1T31A 1QFKH 1W7XH 2BD5A 2BYAX 5I25A 1TPAE 3CNRA 3F1SB 3A85A 3HK6B 2AS9A 5DKMA 2VJ1A 4E7RG 1P2QA 1JMOH 4MPXA 1QRZA 3EGKH 3MI4A 1PPEE 1NRQH 3F0OA 1WUNH 4YLQH 4INHA 2FYRA 3QK1A 1GJ9B 1GJAB 2ZI2H 1O2GH 4U01A 2ZF0H 1ETSH 4YT6H 5DP4A 4X1QU 2LPRA 3HATH 2Z9KA 4BOHA 4CRGA 1ZJKA 1OS8A 1PYTD 2CF8H 1RRKA 1BMNH 4Q7ZA 2OC1A 2SGEE 2ZCHP 1SI5H 3B9FH 2FTMA 2J98A 1O3HA 3LU9B 3MFJA 1O2XA 3U1JB 2G4UA 2GMTC 4UFDH 1PPBH 2PFEA 1P11E 5F8TA 2BXTH 5C1UA 4Q7XA 1EX3A 3TJVA 4NIYA 2ODPA 4JZ1A 3F9GA 2R3YA 1EPTB 1C1QA 1FAKH 2J95A 4A5TS 1RIWB 2QC2A 1EASA 3MU8A 1OWKA 3A84A 3E6PH 2Z6BD 3RXFA 2CHAB 2VINA 2PV9B 1AFQC 1TRNA 3VB7A 4NIWA 3RU4D 1SGCA 2BB4A 2D26C 3GCHB 1AZ8A 1DS2E 3OSYA 1G3DA 2BLOA 3M36A 3TPIZ 2GKVE 4D7GA 3SJOA 1C2IA 2BY8X 3UY9A 4J1YA 3K65B 5HMAA 1XXDA 2C3SA 2ZU5A 3QTOH 3SU5A 3A8DA 1FIWA 4BANB 2OQUA 5T6FA 3BTQE 3TJNA 1BHXF 1CGIE 1P9SA 5JBAS 4WH8A 2BD3A 1W3CA 4AFUA 5HM9A 2KCAA 3C27B 4FUCA 2JH5D 2BX3A 2C90B 2J9NA 4Q4LA 1AKSB 1NRRH 1J8AA 4JYVH 2VWOA 1AD8H 4XSKU 2SGDE 4Q80A 5JBTA 3OY5U 1ELAA 2ZDAH 2H9TH 3BIVH 4GAWA 1F7ZA 4B2BA 1C5PA 1P10A 4P00A 5FCKA 1DITH 1VKYA 3KQCA 1XUFA 2JKHA 1S83A 1UCYK 1ZGVA 4YO9A 2AEIH 1IQEA 3KGPA 3SV2H 1ANBA 3RC4A 2FYQA 1GHYH 2G8TA 1CGJE 3H5CB 2AMDA 2ZGXH 2CF9H 2CK3D 2G55A 3ZZ8A 3QX5H 1JWTA 3TH2H 5LPRA 1O2MA 5FCRA 3PMHB 1WXRA 1VITF 1UTOA 4AYVB 1UCYH 1MTNC 4AFZA 5FBEA 2A45B 2FTLE 1EZXC 3FN8A 3SUEA 4A1XA 5EODA 1AE5A 1K1IA 2R9PA 2Y81A 3CP7A 1LVOA 1P8VC 2ZNKH 4HTCH 1O5DH 2ASUB 1NPMA 3PWBA 4FXGH 3QUMP 1A0LA 5TJXA 3QZRA 1T8LA 1GBJA 1F2SE 4QT8C 2OCVB 1Y3WA 1V2NT 1SLUB 1UMAH 1HBTH 4OGXA 1S85A 1OYTH 3P8OA 1NRNH 2WSSD 3RXKA 1TMUH 3A8CA 3SJKA 4WH6A 2A32A 3GOVB 1P9UA 3D49H 1SOTA 1E0FD 1O2OA 2RCEA 1ANDA 2ZGBH 2YMSC 1D3PB 1WAYB 1O3DA 2H2ZA 2WPDD 5A8ZA 3V7TA 2BVSH 2A4QA 1C1RA 4ASUD 1OWJA 2P95A 3SV9A 3SO3A 3K9XB 1V2OT 5HKKD 2C93B 2GDEH 2FP7B 1NU9A 2BHGA 1V2WT 2R0LA 4B6EA 1CT4E 2FEQH 4ZKRU 3P95A 2G00A 2ZHWH 1VITG 3LKWA 3LJJA 4LZ1H 1FNIA 2CN0H 3EQ0H 2BD4A 4JZEH 3SGQE 1AWHB 3RMNH 1C2MA 1BDAA 3U28C 2BZAA 3HGNA 2RA0A 1DWCH 2KR7A 1MUEB 3RXCA 1Y5BT 2XCFA 1LQEA 4DIIH 2BZ6H 4CRFA 4LZ4B 3L6PA 4ISHH 2ZFRH 3F2FA 3E91A 1D6WA 1GVKB 4IW4E 1NN6A 3SU2A 3DUXH 3GY6A 1IHSH 2FS9A 1GHVH 1O2SA 2ZDMA 3GYMA 4XOJA 2UUKB 5TCCA 4GSOA 5CHAB 1D9IA 1NRSH 1DWDH 1DFPA 2FWWA 4MG3A 1ZOMA 1O32A 2V35A 1GI5A 1GBDA 1CHOF 4Y76A 2HVYB 1SBWA 2BDGA 5T6DA 4I8GA 4AC9A 1MBMA 1C2EA 4FU9A 2FOAA 1E1RD 1A1RA 1KIGH 1CE5A 1S82A 3H09A 3KQBA 5LGOA 3SUGA 2O8MA 2H1UA 1B0FA 2UWPA 4GHQA 4O3UA 1FLEE 2ANMH 4IN2A 3ZVCA 3PV5A 3Q76A 1FY5A 1HAYB 1C5LH 2GDDA 2P8OC 2J5UA 2F9NA 1EB2A 3MO9A 2P59A 4ZHAA 3EA8A 5TCAA 2PKAB 5KGOA 3TNTA 1WU1A 2H5DA 4FVBA 5ABWA 3A7ZA 1SGFA 4X8VH 2F4LA 2ZFQH 3Q77A 5EIYA 3SJ8A 2NWNA 3WW7A 1P0SH 1UTMA 2STBE 3BEFB 3A88A 3LGWA 2GV7A 1SG8B 2FXRA 1KDQB 1GBIA 3M37A 2BOHB 1O2LA 1FV9A 4BTTB 1HDTH 3A7WA 1MD8A 4LK4A 3MNBA 5BPEA 1HRTH 1O2UA 1YWUA 2QXGA 2XTTB 2Y5FA 2L74A 4ZKOU 4X8UH 1CHOG 1L4DA 9ESTA 1PFXC 1O3LA 1GCDA 4LXBH 4B6FA 1BTXA 8LPRA 2ZGCA 1Z1JA 3SUFA 3SV7A 1QJ1B 1O30A 1WBGB 4MQAA 5IDKA 5E0HA 1H4WA 4YTAA 2J34A 1DWBH 1ZRKA 1GHAF 5JYIA 3LH3A 3U98H 1TGTA 4DVAU 2G4TA 3RXSA 3ZZDA 3EE0B 4X0WU 3UFAA 1CO7E 2P16A 1MKWK 3SU1A 2JJ2D 2AGGX 1A0HB 1E34B 1OHHD 3UTUH 1WYKA 5A0AE 4CRDA 4WJG2 1RXPA 2O8LA 5EQSA 1P3EA 1PJPA 5FPSA 1QL9A 2ZWLH 4MPUA 3SU4A 1AMHA 4K5ZA 3RXJA 3V12A 1O5FH 1O0DH 3PMBB 1GBAA 1L0ZA 3T26A 1LHFH 2GZ9A 2HGTH 3AK5A 1MKWH 3KIDU 2WPKS 1P03A 1H8DH 2ALVA 2KAIA 3PLPA 1VJ9U 3QGNB 1ZMJA 2R0KA 3M5MA 2ZU4A 1TYNA 1BT7A 5F8XA 1A2CH 1S6HA 1QRXA 1BMMH 1KXBA 5HIZA 2OK5A 1ELGA 2OLGA 1OWDA 1V2LT 4RT1A 1BTZA 5LH8A 4ZCNA 3BTGE 3UIRA 2H9HA 2J4IA 2GD4B 4TY6A 1S6FA 1DVAH 4TPIZ 3KQ5A 1G2MA 5JBCS 1V3XA 3KN2A 1ARCA 1D6RA 2ALPA 3PYHA 1TQ7B 4BAKB 2ZFTA 4X2WA 5HIYA 1NESE 1HIAB 2WZQA 4DJZB 1TMBH 2A7HA 1T32A 5JPMH 1Y8TA 1GHAG 1H9LB 6CHAB 3PV4A 1BCUH 3RXRA 1RFNA 2GT7A 3SW2B 2GCTB 1CBWB 1V2PT 4FUDA 3DSPA 1W7GH 2B8OH 2V3OH 1ELEE 1AFQB 1O3PB 2ZDKA 2DE8A 1LHDH 5LPEA 1H8IH 5AFYH 2QXHA 1C1WH 4ABFA 1MABB 3NKKA 1CVWH 1BTPA 4H6TA 5EW1H 1SHHB 1Z6JH 2OP9A 1XMNB 3AW0A 3GYLB 5GNDA 3UR6A 1C2HA 3SHCH 4AZ2B 1E35B 3QTVH 2QXIA 3E0PB 1K9OE 2SFAA 6ESTA 1PYTC 3RXDA 1GI1A 1L2EA 2VVVA 1ELDE 5EXLA 1UHBB 1TB6H 1GL0E 4YOGA 1T8NA 2ZTZA 5DP3A 1YLDA 2IPHA 3W1EA 3P8FA 4Q2KA 1W14U 3TGKE 1QR3E
chains in the Genus database with same CATH topology
1O3NA 2B0FA 1VCWA 3O8CA 3RLWH 1UTQA 1DSTA 1NC6A 2D8WA 3RMOH 4DY7B 4MDSA 1GBHA 3A8BA 4WMFA 8KME2 1EKBB 2J38A 2A5KA 4IC6A 5GPIB 2TGTA 1O3CA 3ATMA 1TMTH 3ENSB 3PO1B 2IOTA 2R3UA 3NWUA 1NFXA 4MPWA 3VPKA 2BMGB 1NY22 4CHAB 2WPMS 2GZ8A 4Y79A 2PKSC 4GCHF 2G52A 2HPQH 3GY7A 2THFB 7ESTE 1SPJA 4ABHA 1GCTB 1W11U 4UE7H 1HAGE 2QF3A 1O37A 3MMGA 4XBBA 5G4BA 1DANH 1O5BB 1TPPA 3ZZ4A 4MNYA 4UEHH 4AG1A 3DA9B 1C5XB 3BN9A 2V0BA 2B9LA 2ZHFH 1FN8A 1XUHA 2GP9B 5FPTA 2VWMA 3S9BA 1HPGA 1GBCA 4X2XA 3V13A 3GISB 2A2QH 1DLKB 4OS4A 4B74A 5JB9S 2UUJB 2Y7XA 2VGCC 4DGJA 4UFGH 4MNXA 5C67A 2WPHS 1EP6A 1V2ST 2WINI 2AMQA 4ZUHA 3M35A 1P02A 2Z9GA 3I29A 2XNIA 1X7AC 3VXEH 4BXWA 1O3IA 1ZZZA 1ETRH 3VEQB 1ANCA 3LDXH 3SJIA 1EB1H 1HAZB 3UUZA 3A8AA 1GJ7B 4PROA 1ELFA 3LGUA 3RXGA 1LVMA 1N6XA 2BQWB 2J94A 1FDPA 1ESBA 1D3TB 3TK9A 2D1JA 2BLQA 2WYJA 1C1SA 4GCHG 2QGRA 3O8BA 2ZU1A 1N8OB 3VGCC 2NU2E 4AN7A 1YPEH 3T28A 1AB9C 1EZQA 3RXLA 3SV8A 2VB0A 1O2VA 3MOCA 1SL3A 2TBSA 1UVOA 1AUTC 1TNIA 5L30H 1SHYA 3E8LA 3STIA 3BG8A 2FX4A 3P6ZB 2HOBA 4JZFH 5EQQA 1TNJA 1IQGA 4DW2U 1MU8B 4FUIA 2ZFFH 2STAE 4K69A 1C5SA 4NGAH 1ZPBA 3MNCA 1W12U 1YYY1 1EJNA 4ZHMU 2ZP0H 4I32A 4ISIH 4RKJB 1GPZA 2PTNA 1K1PA 1DPOA 4UONA 1TNLA 2G5VA 3SN8A 2ODYB 1AI8H 4IGDA 4YM9A 1NRPH 1YPMH 5GCHF 1BTWA 2P3UB 1QL7A 1DUEA 1KXAA 1AQ7A 1GMCF 4MNWA 5FBIA 4H6SB 4K60A 1S84A 1W10U 1ID5H 1SGDE 4GUXA 2BDCA 1C5UA 3M7UA 1GJCB 1CSOE 4B2AA 5LPFA 1C2GA 1K1LA 2H9EH 2Z9IA 5ESBA 1BITA 3FVFB 3SJ9A 1VGCB 2WV5A 1QURH 1YCPM 2QAAA 1E36B 2F91A 2C4FH 1FI8A 1CA0B 2I6SA 3FP7E 1O3JA 1KSNA 2ZGHA 1FY4A 1HXFH 2HNTE 4D9RA 2HWLB 1UJ1A 3LONA 3TGJE 1QY6A 3T5FH 2ULLA 2PHBA 4R0IA 3RXHA 2QN5T 4U30A 2SNVA 2XBVA 4CRCA 1P04A 1MD7A 2VIQA 1S5SA 3VFEA 3DFJA 1K1MA 3A7TA 1GL1A 1O5CB 1PPFE 3NZIA 1KYNA 4FUBA 4XBCA 1GG6C 1C2DA 1RGQA 2QIQA 2O8TA 5GCHG 1GMCG 1MZDA 4ZXYH 3RXOA 1HYLA 3BTKE 2FOCA 2FMJA 2W7UA 3Q00A 4BTIB 1JRTA 3TVJB 3ZZBA 3JZ2B 2ZDVH 2BLVA 2XBXA 3BG4B 2XBYA 4IMQA 2ZDLA 3RMMH 2JETB 3UOPA 1F0RA 1EAUA 3GCNA 1ZPCA 1CGHA 2FOFA 1GI6A 3EA7A 2HALA 5E2PA 1NFYA 4YT7H 3E1XB 3E90B 1EPTA 3R3GB 1HJ8A 1NTPA 1ELTA 2PSYA 2FESH 2ZPRA 5FAHA 3ATLA 1Y3XA 5ESTE 1A7SA 1A4WH 2Y7ZA 3A89A 4AGKA 4WWYA 2BY7X 4CR9A 1YBWA 1XVOA 2C8XB 3SU0A 2ILNA 7GCHF 3PMJA 1JBUH 1UVTH 1TE0A 4TWYA 1UTLM 3MO3A 4ISOA 1DICA 5DJ7A 3RXPA 4XE4A 2BDYA 3BIUH 3Q3YA 3RXIA 1K1OA 1DSUA 4WF8A 4Y7BA 5DPAA 4WXIA 3RP2A 3SQHE 4DURA 1Y3UA 2OBOA 3R0FA 2BDIA 1UTNA 1THRH 1H9IE 1NM6A 3PTBA 1A0JA 4NZQA 1FIZA 2ZA5A 1ZRBA 1XKAC 2GZ7A 5HGGA 1BZXE 1TGCA 1LTOA 2D2DA 3ITIA 4Y8YA 1LHEH 2OINA 3KCGH 1SFIA 1TRMA 3KQEA 4WY3A 3SGAE 2TIOA 4TPYA 1XUKA 4DIHH 4ZKNU 3CENA 1SMFE 4A1VA 3BTTE 1Z8GA 2ZTYA 1O36A 3IITA 1ZLRA 5GXPA 1U6QA 2ZHDA 1F5LA 2VIDA 1MCVA 1ZGIA 4KTUA 3VB5A 2ZECA 1BTHH 1KY9A 2FPZA 7GCHG 4MLFB 2SGPE 3GY5A 3MU4A 3ZZCA 3GY4A 1O5AB 5EXNA 3TH4H 2VIPA 3T29A 1TGBA 1TONA 1Z8IB 1CQQA 5DGJA 4F49A 4WMEA 1NO9H 3V0XA 9LPRA 1DDJA 2OC8A 1O33A 1GJ4H 4ZROA 2O9QA 3UQOA 1GI8B 1K28D 2XC5A 3FZDA 3NCLA 1HLTH 5EOKA 4E7NA 4AOQA 2TGPZ 4X2VA 5AFZH 3ZYDA 1C5WB 3MH5A 2AGIX 4UFEH 1TPSA 2BM2A 1O39A 1HB0B 4IMZA 5DG6A 1EAIA 1SGRE 3LOXA 3N7OA 2PGBB 1BA8B 3FZZA 1GI3A 2F9OA 1TALA 3T2NA 5DP9A 2A0QB 1AIXH 1ABJH 1HAVB 1S0QA 1S0RA 2FZZA 1Y5AT 2A1DB 4Y10E 1HJ9A 1ZHRA 4K8BA 2A4RA 1IQKA 3PMAB 3UPEA 1L1GA 3MU0A 4VGCB 1O2QA 2PKSB 3AAUA 3VB4A 2NU1E 5J4QA 2Y5HA 3L33A 2BOKA 4HFPB 4Y6DA 3NUMA 1TNKA 1FN6A 3A80A 2VH6A 1Z71A 4AG2A 1DWEH 3VB6A 1P09A 2BD8A 1IHTH 1MKXK 1SLWB 3M5OA 3M61U 2Z3CA 5JDUB 3BTHE 2NU4E 1JIRA 4Y0ZE 5F8ZA 2EEKA 3RDZA 1FY1A 4H42U 5J4SA 4X1NU 2BY6X 3M3VA 1MTVA 4I8JA 2FLBH 1H9HE 1MAYA 5A0BA 1BB0B 5FHTA 5L2YH 2BD2A 1W0ZU 1P2MA 2Y82A 2GVFA 1G32B 1XUIA 1ZMNA 4NWLA 1L4ZA 3F68H 1TLDA 3MH4A 4YZUA 2BY5X 2Z94A 3U1IB 2FODA 3F9FA 2IJOB 1VJAU 4GPGA 1D3QB 1TPOA 2EI7A 2W5EA 5JB8S 1UK2A 2H5CA 2ZDNA 3MYWA 1EPTC 3SBKA 2C8YB 1RIWC 3T27A 1QJ6B 3KEEA 2XYAA 1SGQE 1C4Y2 3BEUA 1GI0A 4NFEA 2CHAC 2TGAA 1AVGH 1M9UA 2BVRH 2ZCKP 4ABEA 3OY6U 1P2IA 3MU5A 1F0SA 4KELA 4OS6A 1BJVA 1HJAB 1FONA 5EG4A 3MNXA 1OOKB 1P2JA 3SNEA 5I46H 1KXFA 1WOFA 1O3MA 1P12E 3D23A 2VWLA 2PUXB 2F3CE 1UK4A 4Z6AH 4AYYB 1BMLA 1C2FA 3FP8E 2ANYA 1UO6A 1BRBE 1O5GH 2KAIB 3DHKH 3LC3A 3TNSA 1P2OA 4THNH 1IQLA 4TYDA 2WPLS 1KDQA 3MHWU 4X1PU 3GICB 3QGJA 3HKJB 4NSVA 2I6QA 1KLTA 2HLCA 3A82A 3TK6A 1GGDC 5C1YA 5K0HA 3IG6B 1ZTLA 3UWJH 1LVBA 1F5KU 2BX4A 5CE1A 1C1TA 1CT0E 2SNWA 4JYTA 1NT1A 2A5IA 2OBQA 1ZJDA 1O3FA 1C1OA 1DT2A 1V2VT 5DP7A 1L1JA 3SNCA 3ZZ7A 1IQIA 1SFQB 1W8BH 1ABIH 2A4GA 5EW2H 1DUAA 4FU7A 5C2ZA 3O8DA 1HXEH 1YF4A 1C5QA 2ZKSA 4ABDA 4BAHB 1TX6A 4I8HA 1GVZA 2ZFPH 2A31A 3ZZ3A 1PPHE 3Q3XA 5DP8A 1H1BA 4AFSA 2GMTB 1DOJA 1V2TT 2BDHA 2DE9A 2ODQA 3TK5A 1ELVA 3ZVAA 3PLKA 2V3HH 1N6YA 2R2MB 2EI8A 3HPTB 2OQ5A 3BTEE 4B75A 1DM4B 1HAOH 1HAPH 1GI7B 1TWXB 3V3MA 2HNTC 3LGTA 1QJ7B 4ZAEA 4I7YH 1GBKA 4I8LA 1PQ5A 2EC9H 1E38B 2B5TB 1K21H 4O97A 2ZCLP 5EXMA 4K2YA 3UOUA 1BTYA 2A4OA 2ZQ2A 4JK6A 1PPGE 5AHGH 3RUOA 2WUCA 3PLBA 1GBFA 1WV7H 3ATKA 3E0NB 4D9QA 3LC5A 1Z8JB 3OU0A 3BTDE 4D8NA 1TGSZ 4YOIA 2Z7FE 4Z0KA 5FXLA 4E06H 1C2LA 4SGAE 1S81A 3SI3H 1FXYA 1P2KA 3TJOA 1G3BA 3MNSA 1SGYE 1FQ3A 4NCYA 2W3KA 3A87A 1RS0A 3P8NA 5A2MH 1OYQA 1V2RT 4J2YB 5B6OA 1QBOA 1GDQA 2A5AA 1GHWH 1C5YB 1QL8A 2ZC9H 1VZQH 1SC8U 4A7IB 1GHXH 3SNAA 4D7FA 1MZAA 1Q3XA 1EAWA 3A86A 1J9CH 1YPHE 1O2KA 3SOSA 1B5GH 1HGTH 4X2YA 2VU8E 4H4FA 1UVPA 5EGMA 2GTBA 2Y5GA 2PGQB 1UHBA 2CGAA 1BBRE 1O3EA 4X6MA 2FIRH 3CS7A 4GLYA 4BAMB 2FOMB 1O3GA 1XVMA 5ETXA 1FPHH 1SVPA 2FDAA 5FX5A 3M7TA 3UREA 4B76A 3BF6H 2DUCA 1MTNB 2QA9E 1JOUB 3GY2A 2ZU2A 3RXUA 3STJA 1GVLA 2JH0D 1LKAA 2W26A 1V2MT 3K2UA 2A7CA 1GBEA 3GY8A 1FY3A 3QLPH 1GJ5H 1HAHH 3H7TA 2BDAA 2G51A 1RTKA 1CU1A 5DP6A 5A8YA 1SGNE 1ZMLA 2AMPA 3A7VA 1EATA 1C5MD 3AASA 3QDZB 1EOLA 2OTVA 1TFXA 4B1TA 1Z8RA 1VCQA 3FP6E 2JH6D 3SI4H 1SGFG 2G81E 1J16A 2VVUA 4TWWA 6GCHF 1O2JA 4B71A 1T8OA 3TITA 1O3BA 4R8TB 3RXAA 3L3TA 2SGAA 2FLRH 1TNHA 1QRWA 1Z6EA 1Y3VA 1BMAA 3ZVGA 3SNDA 1GJBB 2QXJA 4DCDA 4BNRA 2BY9X 4YESB 4OS1A 2LNCA 2TPIZ 1C5NH 4NFFA 1F5RA 4NA7A 2BDBA 1QTFA 1AGJA 1BJUA 1UTPA 1P3CA 2BXUH 3JZ1B 1GBBA 1QQ4A 2HVXA 5C5OA 1OP8A 2PTCE 3Q3KA 2XXLA 2VIOA 3ZZ5A 3GDSA 3TH3H 1W13U 4HGCA 2EA3A 2HRVA 2XWAA 1ZR0A 3SU6A 1O2WA 4K1TA 3ZZ9A 1HCGA 4ABGA 2FI4E 1THSH 3M5LA 3PTNA 3S0NA 3KF2A 1RJXB 3LGYA 3RC6A 3KQDA 1GMDF 1HFDA 1OKXA 4GHTA 1C4V2 1JIMA 1W2KH 4AB8A 3P17H 3A7YA 5HXFA 1NFWA 1EUFA 6GCHG 2CXVA 1ESTA 2XC4A 2GX4A 3VXFH 2OXSA 4YOJA 5AVDA 2V6NA 4FUJA 4JMYA 3LIWA 1SLVB 4CH8B 1C9PA 1O2ZA 2ZGJA 3RMLH 3SV6A 1LHGH 1EOJA 1TOCB 1LPGB 4ISLA 1FZZA 4NA9H 2CJIA 1MAXA 3F6UH 4KGAA 3LH1A 1JXPA 2C8ZB 2CMYA 2P3FH 3ZVEA 5E8EH 2F9PA 2QY0B 1J17T 1C1VH 2NU0E 3B8JA 1F0TA 1SR5C 4OS7A 2ZHQH 2ZQ1A 1EJMA 2P8OB 4MTBA 1ESAA 2K1QA 2TGDA 4K1EA 3RXEA 2ZG0H 4A6LA 4MPVA 2GCHF 3MH6A 1V2KT 3LGIA 1YPJH 3PWCA 1P01A 1RTFB 3MO6A 1HUTH 1TX7A 3P70B 1TBQH 1GMDG 4KTSA 1YP9A 5E0JA 1LKBA 3P92A 3H7OA 1TA2A 4Y8XA 4NZLA 3RXQA 1GJ6A 3ESTA 6CHAC 1XM1A 1C4U2 2Q6DA 4ASHA 1SQTA 4XBDA 1PQAA 2AERH 2FI3E 3T62A 3S7HB 2GCTC 1CBWC 4IS5A 4ZKSU 2FI5E 1AO5A 2WPJS 4NG9H 1ETTH 1P57B 3WY8A 4FUEA 3QN7A 2AH4X 1QQUA 1T7CA 5DO4H 5A09A 3BTFE 1V2JT 4AFQA 2J2UA 4HZHA 2GV6A 2F9UA 5BRRE 3UNSA 2FOEA 1A3BH 2RA3A 2YNAA 3SHAH 3AW1A 3EA9A 1KLJH 1O3KA 1FPCH 2SGQE 4WVPE 4Y71A 2YNBA 1GI9B 5HYOA 1FMGA 3I77A 3ZVBA 2WV4A 3O8RA 1C5RA 2GCHG 3KL6A 2R2WU 2BD7A 1O2HA 1ACBE 4IBLH 4JZDH 4AB9A 1O2NA 1LVYA 3HGPA 3E3TA 1IQJA 1DY9A 4JZIA 4U2WA 1G37A 2GGVB 4UD9H 1C2KA 1GGDB 5A0CA 4UFFH 1V2QT 3D65E 2BQ7B 4ABIA 3UNRA 1JRSA 5GJ4B 1XKBC 3RU4E 1EJAA 1QBVH 4DOQA 5EU8A 1GJDB 1VCPA 1DE7H 1ANEA 1UTKA 2OD3B 4X1RU 1Q31A 2XC0A 2CV3A 3F9EA 3PO1C 1KXEA 1LO6A 3ZVDA 1MMJN 3EYDA 5GWZA 5EPYA 1AKSA 1UCYE 3URDA 4CHAC 3I78A 2BTCE 1IQMA 2OUAA 4X6NA 3BV9B 1GCTC 1GWAA 3OTJE 1IQNA 1Z7KA 2A7JA 1T8MA 1OSSA 2VIVA 3TLOA 1K1NA 2FX6A 1W0YH 3HKIB 3FFGA 3RXMA 4Q7YA 3QO6A 3W94A 1XUGA 3PM3A 3BTME 4CR5A 3TIUA 1MU6B 1A5IA 1T4UH 2VVCA 4DG4A 1OP0A 3GDUA 1UVUH 4OGYA