2K1QA

Nmr structure of hepatitis c virus ns3 serine protease complexed with the non-covalently bound phenethylamide inhibitor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
165
structure length
165
Chain Sequence
TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of a noncovalent inhibitor exploiting the S' region stabilizes the hepatitis C virus NS3 protease conformation in the absence of cofactor.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
molecule keywords NS3 PROTEASE
total genus 24
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2k1qA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k1qA01
4H42U 3AASA 1C2DA 1UMAH 4X1PU 2ZHEH 1YPHE 2UWLA 1ELTA 1RIWB 2FS9A 2XW9A 1LHDH 4XFQA 1ELCA 1NN6A 1Z1IA 1D3QB 1YPMH 1TPSA 3URCA 4IGDA 1BIOA 3F6UH 3KHVA 1AI8H 2AERH 4O3UA 1DLKB 1O3GA 4AN7A 1K1NA 5F8TA 3QTVH 4NA7A 2VWLA 1AZ8A 4UFDH 4ASHA 3EDXB 1MQ5A 1YPEH 1ZYOA 1DITH 4X1RU 2XBWA 1KXDA 7ESTE 2W5EA 1SG8B 2R0LA 5F8XA 3SV8A 1UVPA 3OY5U 1S83A 3V12A 1TX6A 3F9EA 2ZHQH 1UK3A 2ZI2H 3LONA 1JOUB 3ITIA 1TBQH 4FVBA 5GNDA 1ETTH 1ELAA 3RXUA 5I46H 3TJOA 2NU1E 3E90B 3MH7A 1TRMA 2A4GA 1BTYA 1GI2A 4DIHH 1XUGA 3SU5A 1TX8A 1GDUA 4NWKA 2QXIA 1PPBH 4YESB 1BRCE 1GBHA 3EA9A 3UPEA 4IBLH 3T27A 1CVWH 4ABDA 3NUMA 2H9TH 4TWWA 1K9OE 1S81A 4BOHA 1HAOH 3SHAH 2FLBH 1ZRBA 2ZGHA 5A8XA 1ZPCA 3CS0A 1HLTH 1V2LT 1UCYH 1EASA 1YLCA 2BDIA 4MDSA 3LDXH 5FHTA 1DLEA 4ISOA 3UR9A 1G36A 3TH2H 5CE1A 2P8OB 3SZEA 2VH6A 2J9NA 4IMQA 1Y3XA 2ESTE 3GCTF 2QCYA 1AVWA 3LGVA 1D6RA 1PQ5A 1BBRE 2BHGA 2XBXA 1JIRA 4YTAA 1QJ1B 4NIVA 1RXPA 5E2PA 1A46H 3KQBA 2BYAX 1WSSH 2ZDKA 1ZHPA 1MAXA 1W10U 2FDAA 1OWEA 1T8OA 2SGDE 2P94A 1MKXH 2FOAA 1DSTA 2FI3E 1G2MA 1AIXH 3PMHB 2PKSC 1GHBG 2BD4A 3E91A 4AG1A 3LH1A 4JZDH 3LIWA 4E7RG 2O8LA 5C2ZA 1HAPH 5LPEA 3SNBA 4BAHB 4IMZA 1DS2E 4U2WA 1TPAE 3PWBA 1UK2A 1BA8B 3VGCC 5HXFA 1FY5A 4FUFA 1TNLA 3ATWA 4JZFH 1BRBE 1W7GH 1Z8JB 3RXGA 4LK4A 3G01A 2ZDNA 1ETSH 3UNRA 3KNXA 2SGPE 3LJJA 1ELVA 1VGCB 1MTSA 3LOXA 1ELDE 1ZTLA 5E8EH 1BDAA 4B76A 1PYTC 1ZHRA 4D9QA 4UE7H 1QTFA 1XXFA 5T6FA 1E36B 1KLIH 2H2ZA 4O9VA 6LPRA 3GISB 2KAIB 2FYRA 2SGQE 3MU5A 1KXAA 4FUDA 3GYMA 3ZZ6A 4YM9A 3TK9A 3SNCA 4I32A 3O8BA 2PKAB 1HDTH 1NZQH 1PPEE 1UTPA 2FO9A 4ABEA 1SGEE 2Z6BD 3PTNA 5EQSA 1F0TA 1L1NA 1XUFA 2XC0A 1NC6A 4TY7A 1SQOA 3D49H 1Q3XA 3TIUA 1P2QA 1GJ6A 1BTPA 3QO6A 2A31A 4ZXYH 1ARBA 3A88A 5L2ZH 5G4BA 1AB9B 4FUIA 1OKXA 1UCYE 4XBBA 4K8YA 4X6OA 1P2KA 2CGAA 4Y6DA 4PROA 1Z1JA 4OGYA 5C3NA 1V2PT 2AEIH 2OTVA 2BVSH 3L33A 1FN6A 2ZFSA 2FOBA 3BV9B 2XTTB 1SHHB 1O2RA 3A80A 2F9NA 1GVLA 1AFEH 3NZIA 1RTKA 1EUFA 3F1SB 3GY3A 2AIPA 4E06H 2TGPZ 2TGTA 1GHWH 3W94A 3RXLA 2GMTB 1EP6A 4K3JA 3ZV8A 4AFUA 1A3BH 2RG3A 4MLFB 4DURA 4JMYA 1SGDE 4M9FA 3BTGE 4SGBE 1YCPK 1TLDA 3RC6A 1O3MA 5CHAB 1AZZA 1V2WT 5EOKA 5J4QA 1A5IA 3ZZ4A 1CBWB 2ZP0H 3RC5A 5LGOA 1THSH 4X6PA 1K1LA 1C9PA 2W7UA 2AGEX 5A0CA 1A0LA 3BSQA 1Z71A 2AS9A 1TMTH 1HJAC 4Q7YA 2F83A 4HGCA 4VGCB 5F03A 3SORA 2C8YB 1O32A 2SGAA 1W12U 1HIAB 1YKTA 4NWLA 4X8VH 2G5VA 1UTKA 1FY4A 1P8VC 3ZVEA 1SC8U 1TGSZ 1PPCE 4A92A 1Y3VA 3NCLA 1K1PA 4NG9H 3FP6E 1J17T 4I33A 3S9AA 3QN7A 1H8IH 3A89A 3MOCA 3LGIA 1W3CA 5J4SA 2OC0A 1NY22 1NRSH 4X8UH 2WUCA 1CU1A 2ZGCA 3M7TA 1Y3UA 2F9BH 1S6FA 4B1TA 3ZZCA 3S9BA 1O3NA 2XWAA 2Y82A 3ZZ3A 1IQKA 1QRWA 1AE8H 1MBQA 4AFSA 1WQVH 1P57B 2A5KA 1XVMA 4X2VA 4LZ4B 3FP7E 1K1OA 2BD7A 1LPGB 1A2CH 4DY7B 3RXJA 1L4DA 1AMHA 1HPGA 3QGJA 1TALA 4B2CA 1PQ7A 4NZQA 2P16A 3M5NA 1V2MT 2NWNA 3RMOH 1NTPA 1C4U2 3NK8A 5F6MA 3BF6H 5L30H 1NU9A 5FX6A 3SV9A 1EAIA 2Z9KA 1TGBA 4ISIH 3P95A 1P3EA 4A7IB 4J1YA 2IOTA 3MH4A 2GV6A 2FP7B 1LQEA 2NU2E 1O2NA 5EW2H 1B0FA 1QRZA 3SN8A 2VGCC 4K5ZA 4B71A 2IN2A 3MWIU 4IC5A 1TOCB 2Z3EA 3AVZA 3LJOA 1UHBA 5GPIB 2XBVA 3L3TA 1LPKB 5K7RA 2FPZA 1XX9A 2TGDA 1O3EA 3FZDA 1SSXA 2ZCKP 1GGDC 1EPTB 1KY9A 3RDZA 1IOEA 4Y8YA 1KXEA 1LKBA 1VCPA 3K2UA 1P03A 3VB4A 3UUZA 1SHYA 1W11U 1GVKB 1NFYA 1N8OC 4AZ2B 3GCHB 4ABFA 1HAGE 2AMDA 2ZFTA 6ESTA 2BY9X 1P0SH 3EE0B 1XM1A 3TGKE 3BG4C 3T28A 3AAVA 4CRCA 2ZFQH 4RI0A 3PLBA 2TRMA 3PLPA 4I8HA 4AX9H 2DUCA 5FXLA 2A7HA 1ZMLA 3PWCA 4INHA 2CMYA 4YT6H 1BUIA 1HAVB 3MYWA 3P8OA 5C5OA 1P02A 4XSKU 1E38B 1VGCC 2QXHA 1O3PB 1Y3WA 1YM0A 1OYQA 1SGCA 2P95A 1FNIA 3I77A 1JBUH 3PYHA 1KXBA 1IQEA 3BG4B 1GGDB 3DHKH 3ZZBA 3UNSA 3GCNA 3TH3H 4ZHLU 3M5LA 3P8GA 1HAVA 1NRQH 1W8BH 5TCAA 1N6XA 2VWMA 4NZLA 4GHTA 1FY1A 5A0BA 6GCHG 1UJ1A 1GJ7B 2V3OH 3BIVH 3UREA 2G51A 1PPFE 1BTZA 1FAXA 3HK3B 5FBEA 2PUXB 2BLQA 1GPZA 1XUIA 2I6QA 3ZZ5A 2J92A 2GMTC 2Z9LA 3DD2H 1IQNA 1ELEE 3P70B 2C3SA 1AWFH 3ATMA 1LHGH 5ABWA 4MNYA 3RXSA 4Y10E 1JRTA 1KLJH 1L1JA 1MCTA 2F9VA 3GY2A 1WV7H 4RSPA 2OK5A 3T25A 1C5WB 2HOBA 2FZZA 4CREA 3AW0A 3MNCA 2WPHS 2A7CA 2GCHG 1BB0B 5HM9A 1O5FH 2ZU3A 2A7JA 1YYY1 4YOGA 3SU2A 3UY9A 1C5RA 1DSUA 4K1SA 4FU7A 1XMNB 1LMWB 1ZZZA 1UO6A 2FLRH 2GCHF 4HTCH 1YCPM 5T3HA 1UTLM 1TPPA 1M9UA 2Y5GA 4OM9A 5EXNA 1EB1H 2HLCA 1GDNA 1ACBE 1GI5A 5E0JA 2BTCE 1S85A 2G81E 3LGTA 4AFZA 3Q76A 3TVJB 4XBCA 2FXRA 3MU0A 3STJA 3KL6A 5GXPA 3GICB 1A5HA 1O35A 2Y6TA 1GBDA 1UTOA 2FS8A 2OC1A 4CHAB 2O8MA 1ZOMA 3FAOA 4YOIA 1RJXB 2HGTH 2XCFA 1HJ9A 4THNH 5T6DA 1SQAA 1C9TA 2ZO3H 3AAUA 1A7SA 2XBYA 1K2I1 3UQOA 4BXWA 1THPB 5C1UA 4LZ1H 1G2LA 3CENA 2BD9A 1EPTC 1V6DA 2ZTYA 3A8AA 3M3SA 2TPIZ 1SPJA 3QUMP 5ETXA 1ZTKA 3KCGH 1SLWB 4AOQA 1QY6A 2QYIA 1LPZB 1UHBB 2H9EH 2Q6GA 3TJUA 1GMCG 1H8DH 1BMNH 1GCDA 1O3JA 1IQIA 2FESH 3IWMA 5LH8A 1TNIA 1QBVH 5LPFA 1GBKA 2ZGBH 1AKSA 2BY7X 5E0HA 1OXGA 2WZQA 3ZZAA 3D23A 1TE0A 3H7OA 3UWJH 3QTOH 4BAKB 1O3IA 1BMMH 2ZC9H 1ESTA 2GZ8A 3QK1A 2PGBB 1MD7A 3U8OH 4ISNA 4MVNA 1QA0A 1BMAA 2ZZUH 4YO9A 4ZKNU 1GJ9B 2F3CE 4NSYA 2PKAA 4NIYA 3BIUH 3SQHE 3BTEE 1TB6H 2VVUA 2C90B 5B6OA 1RIWC 1P09A 3A81A 5EQQA 3WY8A 2ASUB 3UTUH 1O2MA 2CV3A 3GDUA 1AFQC 4OS6A 3HK6B 2OCVB 4XE4A 4O97A 4FUJA 4DT7B 1C2GA 4DG4A 1EZSC 2FWWA 2TIOA 2FTMA 2Y5FA 4F4OC 1OPHB 1QL9A 2AGIX 1F7ZA 5C67A 1V2UT 3RXAA 1O2UA 2VIVA 1YPLH 1QJ6B 3SJKA 5GCHF 1C2IA 1LHFH 3SNDA 2JETC 1HRTH 1HNEE 1LHEH 3PV5A 2IJOB 2ZFPH 1C5QA 1P2MA 3GCOA 2GGVB 1SBWA 5C1YA 2V3HH 2XC5A 2ZKSA 8KME2 3Q77A 4H6TA 1PQAA 2XRCA 3UWIA 3FZZA 1YPGH 1V2JT 5GDSH 4D8NA 1DXWA 1BOQA 1TFXA 5FPTA 3A8DA 3VB6A 1O39A 1AHTH 2VBCA 3VPKA 1PQ8A 2BY6X 3ATKA 2BDAA 1ZGIA 3IG6B 1B0EA 5BPEA 4ZAEA 5GJ4B 5EPNA 2RDLA 1FY8E 3RMLH 3ODDA 1E37B 1L1GA 2PTNA 3PTBA 2GZ9A 2PUQH 2VWNA 1HIAA 1SOZA 5DP5A 5GCHG 1ANDA 1LTOA 3U1JB 1THRH 1GI8B 1TA2A 1YF4A 3PROA 1S5SA 1Y5AT 4U01A 1O5BB 1GMHG 3MI4A 2P93A 2FODA 4BNRA 2FOEA 1B7XB 2O8WA 1JIMA 1AY6H 3Q3KA 1P01A 3M5OA 3CP7A 1BJVA 1TQ0B 3ZVGA 1SGFA 2PSYA 3A8CA 3BG8A 3T62A 5SGAE 1MCVA 1DWBH 2FYQA 2A5AA 4Y7AA 2OBQA 2Y7XA 1GI1A 1O2ZA 4K8BA 1ZPBA 4KTUA 1CSOE 1BRUP 1O2YA 2BD3A 5HM2A 1QQUA 1F2SE 2Z7FE 1D6WA 3VXFH 2QF3A 1O3KA 3PV2A 3PLKA 3M7QA 4YZUA 2GD4B 1C1OA 1GJBB 1NRRH 3F9GA 1LO6A 4GLYA 1CQQA 1C1VH 3SNEA 4IS5A 3KF2A 4UFFH 3UQVA 1C2KA 1C5ZB 3A85A 3TGIE 1C2LA 1J9CH 3KQCA 1G9IE 2FOGA 2PTCE 5DP4A 1TOMH 2BY8X 3T2NA 4BAQB 1DY9A 4JK6A 3K6ZA 1RRKA 2BDGA 6GCHF 3PMBB 3D65E 1MKWH 1OWHA 1MTVA 1T8MA 1IQJA 1Z6EA 3UNQA 2BDCA 1GMDF 1TMUH 2ZA5A 1QHRB 1UVUH 1P3CA 3HGNA 3ODFA 2TBSA 3SOSA 3O8CA 2BDYA 1HUTH 3MHWU 1C1PA 2BVRH 1O36A 2ZHDA 1LVBA 1PPGE 2R2WU 3VEQB 3MMGA 2ZTXA 3W95A 2ODYB 2PGQB 2ZDVH 1CT0E 3E0PB 7LPRA 2QXJA 1V2VT 2RCEA 2VVCA 4Y71A 6CHAB 1QGFA 1OOKB 1ANEA 2J95A 1GBAA 1J16A 5T1VA 1CHGA 4BTTB 1JWTA 4ESTE 1O5EH 3RC4A 2FI4E 1O0DH 4WVPE 1P11E 2BQ6B 2ZU4A 3MTYA 1SGTA 1GI7B 1C5LH 2ZF0H 3OTJE 1DFPA 2BOKA 1LVOA 3LC3A 3M3VA 2AIQA 2PV9B 3UFAA 4ABAA 2ALVA 2QC2A 4TY6A 5IDKA 1OWJA 1CA0B 1BBRH 3TLOA 2GZ7A 1OWKA 4AFQA 1PPHE 3UR6A 4MNXA 1ZSLA 1C1QA 4Y0ZE 3OYPA 4ZKOU 1MH0A 2ANYA 3NWUA 3A86A 1MD8A 1UTJA 1SGNE 3HKIB 2ZDAH 2HVXA 2AFQB 2Z3CA 4JZIA 1ZPZA 1BITA 2ZCLP 3SUDA 1CT2E 2ZWLH 4QT8C 1F0UA 3BTQE 4WJG2 4ABJA 1EAUA 1A1RA 3SV2H 4XOJA 1L0ZA 1GBJA 1ZJKA 3SUFA 1C4Y2 3HKJB 3GCHC 4X8TH 2VIDA 2BZAA 2QGRA 1QURH 1Y5UT 1ARCA 4K1TA 3T5FH 8GCHG 4U30A 2ZQ1A 1SMFE 2NU4E 3MO3A 1VJ9U 3PMAB 5CMXH 2ZPRA 1SI5H 1ZJDA 4HI3A 1IQMA 1IQHA 4XDEA 3GY5A 1UTMA 2UWPA 3VFEA 8LPRA 1QNJA 1P2JA 1ESAA 3RM2H 1H1BA 1O3CA 3TJNA 3E6PH 1V2KT 5AHGH 2GT7A 3M36A 2FM2A 2Z94A 4AGKA 4ABGA 1DE7H 4NA9H 2OBOA 1KXCA 2J34A 1SGIB 2FX4A 2Z9JA 1C1UH 1T4VH 3RXTA 4LXBH 1ELFA 4X6MA 2QIQA 4CRAA 4IC6A 1O3HA 1WBGB 1YBWA 5AVDA 2G4TA 1G3DA 1W0YH 3V13A 2WPKS 1WCZA 3F68H 2Q6FA 3Q00A 5EQRA 4K2YA 1ZMJA 2NU0E 1O30A 4K69A 1FV9A 4NFEA 1QL8A 3RXCA 1E0FD 1GBEA 1X7AC 1VITF 2QXGA 4MTBA 4KTCA 1J8AA 2F9PA 3EGKH 2QV1A 3NKKA 1P10A 3PV4A 1CT4E 2BB4A 4MPWA 2V0BA 2J38A 1EJNA 4NCYA 1C2EA 2BZ6H 1OP8A 5FAHA 4Y79A 2M5TA 2Z3DA 3SJ9A 1QBOA 1YCPH 2AH4X 1FIZA 2O9QA 1DY8A 1F5RA 3RXKA 2D8WA 1G3CA 1O2SA 5HYOA 1T8NA 3QDZB 2VIWA 1K28D 1DUEA 4TPIZ 1ZTJA 1K21H 2C8WB 1CGHA 1EZXC 4JZEH 4TPYA 4JZ1A 3P8FA 3SUEA 4MNWA 1AVGH 4YT7H 2ILNA 3DFJA 2Y5HA 2VIOA 1C5XB 1GBBA 3EA7A 3JZ1B 4E05H 1GHYH 1C5NH 1EX3A 2Y81A 3FANA 3DT0H 1SOTA 5AF9H 1SGPE 4Y7BA 1O2LA 1C5MD 4AYYB 2A4QA 2EEKA 1W14U 1Z8GA 4AG2A 1DANH 2ZIQH 2AMQA 1K1IA 1O2PA 1O2XA 3U69H 3E16B 1TNHA 2A2QH 3FVFB 1O5DH 2F9UA 3GY4A 1GG6B 1O33A 1GBLA 1BT7A 4LOYH 3H7TA 1XKBC 2R0KA 3Q3XA 2FOMB 4JYUH 1PJPA 1NRPH 2CN0H 2GDDA 4INLA 1LVMA 3SW2B 2HPQH 3B23B 4X1NU 1MQ6A 1SLVB 1ZRKA 1EATA 1JRSA 2XCNA 3A87A 2VWOA 3KEEA 3SU1A 4SGAE 4BXSA 1GBIA 1CA8B 3QLPH 4FUCA 3SU0A 2ANMH 3SU4A 3I78A 2J2UA 1Z7KA 1F5LA 2C8ZB 5DP3A 1MTUA 1TBZH 2ZHFH 2FMJA 3V7TA 1E34B 3GCTG 5LPRA 1TNGA 1V2NT 1C1WH 2BD2A 2A32A 3A7ZA 1LKAA 3LC5A 5GIBA 5EG4A 3ZVDA 4DCDA 4UDWH 2HPPH 4FU9A 3RXOA 1D4PB 4WWYA 1A0JA 1AUJA 1QBNA 1MTWA 1O3LA 1N8OB 2H1UA 2A1DB 2ZDLA 4F49A 4ZMAH 1OWDA 2FIRH 1TWXB 4CBOA 1LCYA 4Y11E 2Q6DA 5DK1A 1FY3A 4B6FA 1H9LB 1BRAA 2VH0A 3B8JA 4CRDA 1A0HB 1J15A 3H5CB 1HAYB 2WPMS 5B6LA 2QY0B 1T8LA 2VJ1A 1FDPA 3S69A 4MG3A 3NXPA 5I25A 2JKHA 3V0XA 3EYDA 1GJAB 3E0NB 3I29A 1GMHF 1CE5A 5E0GA 1SGYE 3TNTA 4ZHMU 1TAWA 1TGNA 2V35A 4KTSA 2VIPA 2JH0D 5JYIA 2BLOA 2AYWA 3STIA 3A8BA 4OS2A 1RTFB 5EGMA 5DPAA 1O2WA 3LGWA 1C5OH 2J94A 3A83A 2Q1JA 2ZU2A 5AFYH 2WV5A 3VXEH 1UK4A 1IQGA 1P2OA 4KKDA 4CRBA 1T4UH 2EA3A 4YLQH 1C5YB 2F91A 4GUXA 4CBNA 3ZVAA 1AD8H 4FXGH 1EJMA 3MU1A 4KP0A 3BTME 9LPRA 2A45B 2A5IA 1KDQA 4H4FA 3TU7H 2C4FH 5A0AE 4GCHF 1BJUA 3C27B 3SO3A 1XUKA 1O2JA 3SI3H 1DOJA 3SGQE 1NT1A 1O2IA 3ENSB 3SGAE 5E2OA 4DOQA 2GV7A 2QN5T 3MNSA 2F9OA 1IAUA 3LGYA 1NFXA 4WXVA 2ULLA 3SHCH 2G55A 3TPIZ 2BD5A 2Y80A 2WPIS 3M37A 2ZPQA 3A7XA 2D26C 1O2QA 1RD3B 4A5TS 1FN8A 1A5GH 4Z6AH 4I31A 1K1JA 1FUJA 4FUHA 1EXFA 2FTLE 3MNBA 1P04A 5FPSA 4JCNA 4ZH8A 3AK5A 2A4RA 1KIGH 1S0RA 4GAWA 2Y7ZA 2OC7A 3M3TA 1GL1A 1YGCH 4FUGA 3SJ8A 4VGCC 1EJAA 2CF9H 1XVOA 3URDA 4Z0KA 1DDJA 1ETRH 3TGJE 2W26A 1GBFA 1K22H 2OQ5A 3RU4T 1YPHC 1BTWA 2R9PA 3K65B 4ZROA 4H6SB 2C93B 4HFPB 1PFXC 1HJAB 1C2MA 1EP5A 2D1JA 5JB9S 4CRGA 1RTLA 3SBKA 1AB9C 1INCA 1NPMA 2ALPA 4AGJA 4JYVH 3RXVA 2D2DA 2FEQH 1TMBH 3A7VA 5DP7A 4A1VA 1OSSA 1SL3A 1F5KU 3M7UA 1VITH 4HZHA 4NFFA 1O2OA 1BTUA 2ZGXH 5HMAA 1NO9H 1NROH 3S7HB 1KTTB 1ZSJA 2JH6D 1GMDG 4ABHA 1TGCA 2EC9H 3BTFE 4ABBA 1G3BA 3PO1C 3BTWE 2OD3B 3SNAA 1TRYA 1K1MA 3O8RA 4WF8A 4M7GA 4RKJB 1D3DB 1GHBF 1GBTA 4R0IA 4D7FA 3M5MA 3A82A 2BLVA 3RP2A 3KN2A 1EOJA 1W13U 5A8ZA 3ATLA 5BRRE 5FCRA 1BBRK 2ZECA 2DE9A 3KQEA 2ZGJA 2ZNKH 4GVUA 1QRXA 4X0WU 1ZGVA 5EU8A 1GJCB 4GPGA 1Z8RA 4WMDA 3T26A 2GX4A 2QAAA 3GY6A 1QIXB 1C2FA 1Y5BT 3MFJA 2FI5E 1TBRH 1EAXA 1WXRA 1HXFH 1MKWK 1P9SA 2HNTE 3QWCH 1DUAA 1G3EA 1DVAH 1GDQA 2VGCB 3ZZ7A 4ISLA 4MPXA 4AB8A 4K1EA 1GMCF 1ESBA 1MZAA 1O2VA 4WH6A 3D62A 4MQAA 1P12E 1DWDH 2P59A 2OP9A 1AN1E 1QB9A 3BEIB 2B9LA 2WYGA 5EPYA 5DGJA 3U8TH 3N7OA 3EAJA 1IQFA 3MU4A 1MUEB 1HFDA 1A3EH 1HCGA 1SFQB 1WAYB 5T6GA 3R3GB 3SU3A 3OSYA 3MU8A 1TABE 2ANKH 2BOHB 3BTHE 1BTHH 1C1TA 3RMNH 4IW4E 1EOLA 4NGAH 3RXIA 1NU7B 4DIIH 2A4OA 4B6EA 3SJIA 2GT8A 1EZUC 2LPRA 3CS7A 1A61H 1KLTA 5EW1H 3B9FH 3S9CA 3BTTE 2ZDMA 1TPOA 5DP9A 2H9HA 4R8TB 4Y8ZA 4RN6A 1WTHD 2CF8H 1HAHH 3RM0H 4ISHH 1BCUH 2B0FA 3RXPA 4ZHAA 2UUFB 1EKBB 1EZQA 3GY8A 4GCHG 3ZZ9A 1NFWA 3MO6A 2FOHA 4NIWA 3SI4H 3UOPA 4CHAC 3TNSA 4TWYA 2WV9A 4I8LA 3SV7A 1AKSB 3NPSA 1QL7A 4GHQA 2G4UA 3U98H 3T29A 2G52A 4CH2B 1OYTH 1FONA 2STBE 4KGAA 4X8SH 3SV6A 1HB0B 1ZHMA 3OY6U 1GI6A 2CJIA 5JDUB 3F9HA 1DT2A 4YLUA 1AE5A 2AMPA 2LNCA 4GSOA 1HJ8A 1GCTC 1TNKA 1C1NA 1C5SA 4Y8XA 1S82A 4Q7XA 1HAZB 4ABIA 1C5PA 1IHSH 2HRVA 1W0ZU 3QX5H 1HGTH 2UUYA 2A0QB 2BX4A 4BTIB 1O34A 3O8DA 1KSNA 3P6ZB 1QQ4A 2W3KA 3FP8E 3KGPA 4UD9H 3RXBA 3LH3A 2XWBI 3ZVFA 1MAYA 2FOFA 1S0QA 2XYAA 1FPCH 5CHAC 3PMJA 1LHCH 1O3OA 3LPRA 2WPLS 2VNTA 2IPHA 1P9UA 1B5GH 3RXMA 4AORA 1C5UA 1CGJE 3S7KB 2QF0A 3VB7A 1FAKH 1RGQA 4U32A 3DFLA 1FPHH 4B2BA 1T7CA 3M35A 2WPJS 2BXUH 5AFZH 1NFUA 4A6LA 2YNAA 8ESTE 1G30B 1GJ8B 3GDVA 1CA0C 1GI9B 1AU8A 3P8NA 2VINA 3ZVCA 1XXDA 2GCTB 2WHXA 2H6MA 3OTPA 1ABIH 1YLDA 3ZZDA 3A7WA 2EI8A 2P3TB 1ID5H 3SZNA 5GWZA 4I8JA 2SNWA 4OGXA 3VGCB 3BEFB 3SQEE 1J14A 1O3DA 1O3BA 2B7DH 2OC8A 4ZUHA 1O31A 4CRFA 2WINI 4NIXA 2G5NA 2B5TB 2OLGA 1WU1A 1FQ3A 1QB1A 5K0HA 4FU8A 1SR5C 1DX5M 3BN9A 1F0RA 4Q7ZA 4XBDA 2WUBA 1W2KH 4X2WA 2IJD1 1Y8TA 5DKMA 1O2TA 1TNJA 1O5AB 3GYLB 1IQLA 1HAIH 3H09A 1D9IA 5EXMA 4IN2A 1T32A 1VZQH 3K6YA 4CH8B 3BTDE 2VU8E 5DP8A 1TQ7B 4D7GA 1W7XH 4ZXXH 2FX6A 2GTBA 4X1SU 4UFGH 3RLWH 3A7YA 3RU4D 5C5NA 1L4ZA 2R3YA 4NA8A 1FI8A 1OWIA 1SB1H 3RXDA 4INKA 2UWOA 4I8GA 5A09A 1FIWA 4OS4A 1DWCH 2O8UA 4K60A 4B75A 1Q2WA 4NSVA 2BD8A 4Q80A 3EQ0H 4Y0YE 1KDQB 3QZQA 1WOFA 2VIQA 2BX3A 2PR3A 3PO1B 3RXQA 1NS3A 1OP2A 2GKVE 1DPOA 3OX7U 2PLXA 1SVPA 3TH4H 1QJ7B 1V2QT 1AFQB 1YP9A 2H5CA 2B8OH 3OU0A 1TRNA 1F92A 3HGPA 4JK5A 5JBBS 1KTSB 1O5GH 1MTNC 2ODQA 4I7YH 2PWXA 1CGIE 1S6HA 2AGGX 5FX5A 4CR9A 1WTGH 4YOJA 2OQUA 1AWHB 1N1LA 1O3FA 2ZU1A 1EQ9A 5DO4H 2A2XH 2OINA 3RUOA 2QA9E 1FLEE 1CHOF 1O2GH 3ZZ8A 1D3TB 1TYNA 3LU9B 2K1QA 2G00A 2GDEH 2BQ7B 2BVXH 1MTNB 1QA7A 2THFB 1P2IA 4OS5A 3RXHA 2VB0A 3VB5A 2CXVA 1IHTH 1GWAA 3A7TA 1H4WA 1VCWA 3V3MA 1GHAF 1TGTA 1MMJN 1TIOA 1D3PB 1GBCA 1MKXK 1YPJH 4BTUB 2R2MB 1FJSA 1OS8A 3UIRA 4D76A 2HWLB 2ZEBA 1ELBA 1BHXB 3PM3A 3BEUA 1HBTH 3SJOA 4UFEH 3UOUA 1ORFA 1U6QA 3U8RH 2YNBA 1ZSKA 2J4IA 1LQDB 3C1KA 1FMGA 4RKOB 4DW2U 1SGRE 1V2RT 3E3TA 1UCYK 1RS0A 1C1RA 1L2EA 2DE8A 1ANBA 3QZRA 2NU3E 3AW1A 3MO9A 7KMEH 2YOLA 2ZQ2A 1MU6B 4O03A 3K9XB 1RFNA 5JBAS 4X6NA 1H9HE 5ESBA 2O8TA 3TJVA 4IN1A 3S0NA 3BTKE 1VITG 1N6YA 5TCCA 2PKSB 4D9RA 1F0SA 1HV7A 4B74A 1AO5A 1G32B 3P17H 1O3AA 1AQ7A 4X1QU 4AB9A 1GG6C 2RA0A 1GI0A 3LGUA 1XUHA 1HYLA 2ZFRH 3KQDA 1AVXA 2RA3A 1GJ5H 2GVFA 4DGJA 1BHXF 1BZXE 4WMFA 4DJZB 1A4WH 1O38A 1QB6A 1Y3YA 5C1XA 2BXTH 2EI6A 5A8YA 4BAMB 1Z6JH 3FFGA 3ZV9A 5EODA 1LVYA 3L6PA 2R3UA 3KIDU 3PB1E 1GVZA 1HXEH 1SGQE 6CHAC 3U9AH 3IITA 2PSXA 2KAIA 2V6NA 3HATH 8GCHF 3VB3A 4WH8A 2G8TA 1OP0A 5FCKA 1DICA 1CBWC 4Y76A 5IYTA 3P92A 1SGFG 1O5CB 2ODPA 1CHOG 2TGAA 4BAOB 5L6NH 1P06A 1VJAU 1GHZA 2W3IA 1S84A 1UTQA 3ESTA 3GDSA 3TITA 1ZMNA 2ANWA 4UONA 2ZTZA 4E7NA 1C1MA 2HNTF 5DJ7A 2BMGB 4A1XA 4A1TA 1BTXA 3SUGA 2ZPSA 1WYKA 4WY3A 1FXYA 2CHAB 3RLYH 5JPMH 3MH5A 3SYJA 4KELA 1GI4A 1MZDA 2ZHWH 2P8OC 2WV4A 3Q3YA 1H9IE 1TA6A 5JB8S 3DUXH 1GI3A 5FPYA 1NRNH 1VR1H 9ESTA 2ZFFH 1NM6A 1CO7E 2UUJB 2BDBA 7GCHG 1V2ST 2GCTC 1JMOH 5A2MH 4FUEA 5DG6A 3R0FA 5C20A 4BANB 1T31A 3RXEA 1OX1A 1E35B 5EXLA 1VCQA 1O37A 1QFKH 4MPUA 3HPTB 5JBCS 4I8KA 3DA9B 2CHAC 4ZKRU 2BLWA 1ZLRA 4O3TA 3U1IB 4X2YA 1GJ4H 2BQWB 1UVTH 1TX7A 1ABJH 3ZVBA 1V2TT 4JYTA 1AUTC 5H4IB 1GCTB 2XC4A 3EA8A 4MPVA 2HALA 3F9FA 3LT3A 4X2XA 4AYVB 1QR3E 4FVDA 1GBMA 3M61U 2PFEA 2P3UB 2SNVA 4FUBA 3E8LA 4J2YB 1G37A 1V2OT 3TK5A 1V3XA 1YC0A 1O2KA 1SQTA 1NESE 2VVVA 5ESTE 5JBTA 5DP6A 3MH6A 1DXPA 3A84A 5PTPA 1GL0E 4DVAU 3QGNB 3ZYDA 2ZU5A 1EB2A 2OUAA 1HAXB 2OXSA 1WQSA 1C5TA 1GHXH 2ZG0H 2UUKB 3RMMH 3MNXA 2BDHA 2Z9IA 2STAE 2PW8H 1C2HA 2PHBA 5FBIA 1P2NA 1BMLA 1KXFA 5TJXA 3RXRA 1C1SA 1XUJA 1ELGA 2JETB 2XXLA 1FZZA 1UVOA 3SU6A 2P3FH 1C5VA 2FOCA 1SLXB 2WYJA 1WUNH 3LKWA 4CR5A 1GHAG 1QCPA 1Y59T 1PYTD 2BY5X 2W7SA 1P05A 4B73A 1JXPA 1SLUB 1ANCA 2GP9B 1Z8IB 1DWEH 2C8XB 1TONA 3SGBE 1XKAC 4WXIA 2I6SA 3JZ2B 2EI7A 1UTNA 3RXFA 1C4V2 2H5DA 1Q31A 4WMEA 3E1XB 2F4LA 4ZKSU 1KYNA 1SFIA 1O2HA 2ZCHP 1MU8B 5L2YH 2Z9GA 2SGEE 1DM4B 3ZYEA 5HGGA 4UEHH 2XNIA 2HNTC 1LDTT 4OS7A 1ZR0A 4TYDA 1UVSH 4MNVA 1BQYA 1C2JA 1YPKH 7GCHF 1EPTA 3ELAH 5F8ZA 1PPZA 2BM2A 1AGJA 3RU4E 1MBMA 3GOVB 2SGFE 3GY7A 1GJDB 4B2AA 3TK6A 2SFAA 1EAWA 3ATIA 2JH5D 4OS1A 4Q2KA 1GHVH
chains in the Genus database with same CATH superfamily
4H42U 3AASA 1C2DA 1UMAH 4X1PU 2ZHEH 1YPHE 2UWLA 1ELTA 1RIWB 2FS9A 2XW9A 1LHDH 2KZ4A 4XFQA 1ELCA 1NN6A 1Z1IA 1D3QB 1YPMH 1TPSA 3URCA 4IGDA 1BIOA 3F6UH 3KHVA 1AI8H 2AERH 4O3UA 1DLKB 2EY4C 3DCLA 1O3GA 4AN7A 1K1NA 5F8TA 3QTVH 4NA7A 2VWLA 1AZ8A 4UFDH 4ASHA 3EDXB 4DT4A 1MQ5A 1YPEH 1ZYOA 1DITH 4X1RU 2XBWA 1KXDA 7ESTE 2W5EA 1SG8B 2R0LA 5F8XA 3SV8A 1UVPA 3OY5U 1S83A 3V12A 1TX6A 3F9EA 2ZHQH 1UK3A 2ZI2H 3LONA 1JOUB 3ITIA 5C0UA 1TBQH 4FVBA 5GNDA 1ETTH 1ELAA 3RXUA 5I46H 3TJOA 2NU1E 3E90B 3MH7A 1TRMA 2A4GA 1BTYA 1GI2A 4DIHH 1XUGA 3SU5A 1TX8A 1GDUA 4NWKA 2QXIA 1S6LA 1PPBH 4YESB 1BRCE 1GBHA 3EA9A 3UPEA 4IBLH 3T27A 1CVWH 4ABDA 3NUMA 2EQNA 2H9TH 4TWWA 1K9OE 1S81A 4BOHA 1HAOH 3SHAH 2FLBH 1ZRBA 2ZGHA 5A8XA 1ZPCA 3CS0A 1HLTH 1V2LT 1UCYH 1EASA 1YLCA 2BDIA 4MDSA 3LDXH 5FHTA 1DLEA 4ISOA 3UR9A 1G36A 3TH2H 1H8HD 5CE1A 2P8OB 3SZEA 2J9NA 2VH6A 4IMQA 1Y3XA 2ESTE 3GCTF 2QCYA 1AVWA 3LGVA 1D6RA 1PQ5A 1BBRE 2BHGA 2XBXA 1JIRA 4YTAA 1QJ1B 4NIVA 1RXPA 5E2PA 1A46H 3KQBA 2BYAX 1WSSH 2ZDKA 1ZHPA 1MAXA 1W10U 2FDAA 1OWEA 1T8OA 2SGDE 2P94A 1MKXH 1YWUA 2FOAA 1DSTA 2FI3E 1G2MA 1AIXH 3PMHB 2PKSC 1GHBG 2BD4A 3E91A 4AG1A 3LH1A 4JZDH 3LIWA 4E7RG 2O8LA 5C2ZA 1HAPH 5LPEA 3SNBA 4BAHB 4IMZA 1DS2E 4U2WA 1TPAE 3PWBA 1UK2A 1BA8B 3VGCC 5HXFA 1FY5A 4FUFA 1TNLA 3ATWA 4JZFH 1BRBE 1W7GH 1Z8JB 3RXGA 4LK4A 3G01A 5KGOA 2ZDNA 1ETSH 3UNRA 3KNXA 2SGPE 3LJJA 1ELVA 1VGCB 1MTSA 3LOXA 1ELDE 1ZTLA 5E8EH 1BDAA 4B76A 1PYTC 1ZHRA 4D9QA 4UE7H 1QTFA 1XXFA 5T6FA 1E36B 1KLIH 2H2ZA 4O9VA 6LPRA 3GISB 2KAIB 2FYRA 2SGQE 3MU5A 1KXAA 4FUDA 3GYMA 3ZZ6A 4YM9A 3TK9A 3SNCA 4I32A 3O8BA 2PKAB 1HDTH 1NZQH 1PPEE 1UTPA 2FO9A 4ABEA 1SGEE 2Z6BD 2HVYB 3PTNA 5EQSA 1F0TA 1L1NA 1XUFA 2XC0A 1NC6A 4TY7A 1SQOA 3D49H 1Q3XA 3TIUA 1P2QA 1GJ6A 1BTPA 3QO6A 2A31A 4ZXYH 1ARBA 3A88A 5L2ZH 5G4BA 1AB9B 4FUIA 1OKXA 1UCYE 4XBBA 4K8YA 4X6OA 1P2KA 2CGAA 4Y6DA 4PROA 1Z1JA 4OGYA 5C3NA 1V2PT 2AEIH 2OTVA 2BVSH 3L33A 1FN6A 2ZFSA 2FOBA 3BV9B 2XTTB 1SHHB 1O2RA 3A80A 2F9NA 1GVLA 1AFEH 3NZIA 1RTKA 1EUFA 3F1SB 3GY3A 2AIPA 4E06H 2TGPZ 2TGTA 1GHWH 3W94A 3RXLA 2GMTB 1EP6A 4K3JA 3ZV8A 4AFUA 1A3BH 2RG3A 4MLFB 4DURA 4JMYA 1SGDE 4M9FA 3BTGE 4SGBE 1YCPK 1TLDA 3RC6A 1O3MA 5CHAB 1AZZA 1V2WT 5EOKA 5J4QA 1A5IA 3ZZ4A 1CBWB 2ZP0H 3RC5A 5LGOA 1THSH 4X6PA 1K1LA 1C9PA 2W7UA 2AGEX 3N7DA 5A0CA 1A0LA 3BSQA 1Z71A 2AS9A 1TMTH 1HJAC 4Q7YA 2F83A 4HGCA 4VGCB 5F03A 3SORA 2PP6A 2C8YB 1O32A 2SGAA 1W12U 1HIAB 1YKTA 4NWLA 4X8VH 4FETA 2G5VA 1UTKA 1FY4A 1P8VC 3ZVEA 1SC8U 2XOKD 1TGSZ 1PPCE 4A92A 1Y3VA 3NCLA 1K1PA 4NG9H 3FP6E 1J17T 4I33A 3FOAA 3S9AA 3QN7A 1H8IH 3A89A 3MOCA 3LGIA 1W3CA 5J4SA 2OC0A 1NY22 1NRSH 4X8UH 2WUCA 1CU1A 2ZGCA 3M7TA 1Y3UA 2F9BH 1S6FA 4B1TA 3ZZCA 3S9BA 1O3NA 2XWAA 2Y82A 3ZZ3A 1IQKA 1QRWA 1AE8H 1MBQA 4AFSA 4ACBA 1WQVH 1P57B 2A5KA 1XVMA 4X2VA 4LZ4B 3FP7E 1K1OA 2BD7A 1LPGB 1A2CH 4DY7B 3RXJA 1L4DA 1AMHA 1HPGA 3QGJA 1TALA 4B2CA 1PQ7A 4NZQA 2P16A 3M5NA 1V2MT 2NWNA 3RMOH 1NTPA 1C4U2 3NK8A 5F6MA 3BF6H 5L30H 1NU9A 5FX6A 3SV9A 1EAIA 2Z9KA 1TGBA 4ISIH 3P95A 1P3EA 4A7IB 2W6ID 4J1YA 2IOTA 3MH4A 2GV6A 2KX4A 2FP7B 1LQEA 2NU2E 1O2NA 5EW2H 1B0FA 1QRZA 3SN8A 2VGCC 4K5ZA 4B71A 2IN2A 3MWIU 4IC5A 1TOCB 2Z3EA 3AVZA 3W1EA 3LJOA 1UHBA 5GPIB 2XBVA 3L3TA 1LPKB 5K7RA 2FPZA 1XX9A 5EJLA 2J98B 2TGDA 1O3EA 3FZDA 1SSXA 2ZCKP 1GGDC 1EPTB 1KY9A 3RDZA 1IOEA 4Y8YA 1KXEA 1LKBA 1VCPA 3K2UA 1P03A 3VB4A 3UUZA 1SHYA 1W11U 1GVKB 1NFYA 1N8OC 4AZ2B 3GCHB 4ABFA 1HAGE 2AMDA 2ZFTA 6ESTA 2BY9X 1P0SH 3EE0B 1XM1A 3TGKE 3BG4C 3T28A 3AAVA 4CRCA 2ZFQH 4RI0A 3PLBA 1EFRD 2TRMA 3PLPA 4I8HA 4AX9H 2DUCA 5FXLA 2A7HA 1ZMLA 3PWCA 4INHA 3F3BA 2CMYA 4YT6H 1BUIA 1HAVB 3MYWA 3P8OA 5C5OA 1P02A 4XSKU 1E38B 1VGCC 2QXHA 1O3PB 1Y3WA 1YM0A 1OYQA 1SGCA 2P95A 1FNIA 3I77A 1JBUH 3PYHA 1KXBA 1IQEA 3BG4B 1GGDB 3DHKH 3ZZBA 3UNSA 3GCNA 3TH3H 4ZHLU 3M5LA 3P8GA 1HAVA 1NRQH 1W8BH 5TCAA 1N6XA 2VWMA 4NZLA 4GHTA 1FY1A 5A0BA 6GCHG 1UJ1A 1GJ7B 2V3OH 3BIVH 3UREA 2G51A 1PPFE 1BTZA 1FAXA 3HK3B 5FBEA 4YXWD 2PUXB 5HIYA 2BLQA 1GPZA 1XUIA 2I6QA 3ZZ5A 1NBMD 2J92A 2GMTC 2Z9LA 3DD2H 1IQNA 1ELEE 3P70B 2C3SA 1AWFH 3ATMA 1LHGH 5ABWA 4MNYA 3RXSA 5KEDA 4Y10E 1JRTA 1KLJH 1L1JA 1MCTA 2F9VA 3GY2A 1WV7H 4RSPA 2OK5A 3T25A 1C5WB 2HOBA 2FZZA 1KMHB 4CREA 3AW0A 3MNCA 2WPHS 2A7CA 2GCHG 1BB0B 5HM9A 1O5FH 2ZU3A 2A7JA 1YYY1 4YOGA 3SU2A 3UY9A 1C5RA 1DSUA 4K1SA 1VKYA 4FU7A 1XMNB 3F2HA 1LMWB 1ZZZA 1UO6A 4RT0A 2FLRH 2GCHF 4HTCH 1YCPM 5T3HA 1UTLM 1TPPA 1M9UA 2Y5GA 4OM9A 5EXNA 1EB1H 2HLCA 1GDNA 1ACBE 1GI5A 5E0JA 2BTCE 1S85A 2G81E 3LGTA 4AFZA 3Q76A 3TVJB 4XBCA 2FXRA 3MU0A 3STJA 3KL6A 5GXPA 3GICB 1A5HA 2YMSD 1O35A 2Y6TA 1GBDA 1UTOA 2FS8A 2OC1A 4CHAB 2O8MA 1ZOMA 3FAOA 4YOIA 1RJXB 2HGTH 2XCFA 1HJ9A 4THNH 5T6DA 2W6JD 1SQAA 1C9TA 2ZO3H 3AAUA 1A7SA 3F2GA 2XBYA 1W0KD 1K2I1 3UQOA 4BXWA 1THPB 5C1UA 4LZ1H 1G2LA 3CENA 2BD9A 1EPTC 1V6DA 2ZTYA 3A8AA 3M3SA 2TPIZ 1SPJA 3QUMP 5ETXA 1ZTKA 2LELA 3KCGH 1SLWB 4AOQA 3WW7A 1QY6A 2QYIA 1LPZB 1UHBB 2H9EH 2Q6GA 3TJUA 1GMCG 1H8DH 1BMNH 1GCDA 5KECA 1O3JA 1IQIA 2FESH 3IWMA 5LH8A 1TNIA 1QBVH 5LPFA 1GBKA 2ZGBH 1AKSA 2BY7X 5E0HA 1OXGA 2WZQA 3ZZAA 2JIZD 3D23A 1TE0A 3H7OA 3UWJH 3QTOH 4BAKB 1O3IA 1BMMH 2ZC9H 1ESTA 2GZ8A 3QK1A 2PGBB 1MD7A 3U8OH 4AC9A 4ISNA 4MVNA 1QA0A 1BMAA 2ZZUH 4YO9A 4ZKNU 1GJ9B 2F3CE 4NSYA 2PKAA 4NIYA 3BIUH 3SQHE 3BTEE 1TB6H 2VVUA 3OAAD 2C90B 5B6OA 1RIWC 1P09A 3A81A 5EQQA 3WY8A 2ASUB 3UTUH 1O2MA 2CV3A 3GDUA 1AFQC 4OS6A 3HK6B 2OCVB 4XE4A 4O97A 4FUJA 4DT7B 1C2GA 4DG4A 1EZSC 2FWWA 2TIOA 2FTMA 2Y5FA 4F4OC 1UW7A 1OPHB 1QL9A 2AGIX 1F7ZA 5C67A 1V2UT 3RXAA 1O2UA 2VIVA 1YPLH 1QJ6B 3SJKA 5GCHF 1C2IA 1LHFH 2K8IA 3SNDA 2JETC 1HRTH 1HNEE 1LHEH 3PV5A 2IJOB 2ZFPH 1C5QA 1P2MA 3GCOA 2GGVB 1SBWA 5C1YA 2V3HH 2XC5A 2ZKSA 8KME2 3Q77A 4H6TA 1PQAA 2JJ2D 2XRCA 3UWIA 3FZZA 1YPGH 1V2JT 5GDSH 4D8NA 1DXWA 1BOQA 1TFXA 5FPTA 3A8DA 3VB6A 1O39A 1AHTH 2VBCA 3VPKA 1PQ8A 3WWFA 2BY6X 3ATKA 2BDAA 1ZGIA 3IG6B 1B0EA 5BPEA 4ZAEA 5GJ4B 5EPNA 2RDLA 1FY8E 2J98A 3RMLH 3ODDA 1E37B 1L1GA 2PTNA 3PTBA 2GZ9A 2PUQH 2VWNA 1HIAA 1SOZA 5DP5A 5GCHG 1ANDA 1LTOA 3U1JB 1THRH 1GI8B 1TA2A 1YF4A 3PROA 1S5SA 1Y5AT 4U01A 1O5BB 1GMHG 3MI4A 2P93A 2FODA 4BNRA 2FOEA 1B7XB 2O8WA 1JIMA 3FKSD 1AY6H 3Q3KA 1P01A 1E1RD 3M5OA 3CP7A 1BJVA 1TQ0B 3ZVGA 1SGFA 2PSYA 3A8CA 3BG8A 3T62A 5SGAE 1MCVA 1DWBH 2FYQA 2A5AA 4Y7AA 4P02A 2OBQA 2Y7XA 1GI1A 1O2ZA 4K8BA 1ZPBA 4KTUA 1CSOE 1BRUP 1O2YA 2BD3A 5HM2A 1QQUA 1F2SE 2Z7FE 1D6WA 3VXFH 2QF3A 1O3KA 3PV2A 3PLKA 3M7QA 1K0HA 4YZUA 2GD4B 1C1OA 1H8ED 1GJBB 1NRRH 3F9GA 2JDID 1LO6A 4GLYA 1CQQA 1C1VH 5FL7D 4IS5A 3SNEA 3KF2A 4UFFH 5HKKD 3UQVA 1C2KA 1C5ZB 3A85A 3TGIE 1C2LA 1J9CH 3KQCA 1G9IE 2RDEA 2FOGA 2PTCE 5DP4A 1TOMH 2BY8X 3T2NA 4BAQB 1DY9A 2CK3D 4JK6A 3K6ZA 1RRKA 2BDGA 6GCHF 3PMBB 3D65E 1MKWH 1OWHA 1MTVA 1T8MA 1IQJA 1Z6EA 3UNQA 2BDCA 1GMDF 1TMUH 2ZA5A 1QHRB 1UVUH 1P3CA 3HGNA 3ODFA 2TBSA 3SOSA 3O8CA 2BDYA 1HUTH 3MHWU 1C1PA 2BVRH 1O36A 2K0QA 2ZHDA 1LVBA 1PPGE 2R2WU 3VEQB 3MMGA 2ZTXA 3W95A 2ODYB 2PGQB 2ZDVH 1CT0E 3E0PB 7LPRA 2QXJA 1V2VT 2RCEA 2VVCA 4Y71A 6CHAB 1QGFA 1OOKB 1ANEA 2J95A 1GBAA 1J16A 2YMSC 5T1VA 1CHGA 3OEED 1SKYE 4BTTB 1JWTA 4ESTE 1O5EH 3RC4A 2FI4E 1O0DH 4WVPE 5HIZA 1P11E 2BQ6B 2ZU4A 3MTYA 1SGTA 1GI7B 1C5LH 2ZF0H 3OTJE 1DFPA 2BOKA 1LVOA 3LC3A 3M3VA 2AIQA 2PV9B 3UFAA 4ABAA 3MQKC 2ALVA 2QC2A 4TY6A 5IDKA 1OWJA 1CA0B 1BBRH 3TLOA 2GZ7A 1OWKA 4AFQA 1PPHE 3UR6A 4MNXA 1ZSLA 1C1QA 4Y0ZE 3OYPA 4ZKOU 1MH0A 2ANYA 3NWUA 3A86A 1MD8A 1UTJA 1SGNE 3HKIB 2ZDAH 2HVXA 2AFQB 2Z3CA 4JZIA 1ZPZA 1BITA 2ZCLP 3SUDA 1CT2E 2ZWLH 4QT8C 1F0UA 3BTQE 4WJG2 4ABJA 1EAUA 1A1RA 3SV2H 4XOJA 1L0ZA 1GBJA 1ZJKA 3DSGA 3SUFA 1C4Y2 3HKJB 2RFKC 3GCHC 4X8TH 2VIDA 2BZAA 2QGRA 1QURH 1Y5UT 1ARCA 4K1TA 3T5FH 8GCHG 4U30A 2ZQ1A 4RT1A 1SMFE 2KCPA 2NU4E 3MO3A 1VJ9U 3PMAB 5CMXH 2ZPRA 1SI5H 1ZJDA 4HI3A 1IQMA 1IQHA 4XDEA 3GY5A 1UTMA 2UWPA 3VFEA 8LPRA 1QNJA 1P2JA 1ESAA 3RM2H 1H1BA 1O3CA 3TJNA 3E6PH 1V2KT 5AHGH 2GT7A 3M36A 2FM2A 2Z94A 4AGKA 4ABGA 1DE7H 4NA9H 2OBOA 1KXCA 2J34A 1SGIB 2FX4A 2Z9JA 1C1UH 1T4VH 3RXTA 4LXBH 1ELFA 4X6MA 2QIQA 4CRAA 1NBME 4IC6A 1O3HA 5DSFA 1WBGB 1YBWA 5AVDA 2G4TA 1G3DA 1W0YH 3V13A 2WPKS 1WCZA 3F68H 2Q6FA 3Q00A 5EQRA 2V3MA 4K2YA 1ZMJA 2NU0E 1O30A 4K69A 1FV9A 4NFEA 4F55A 1QL8A 3RXCA 1E0FD 1GBEA 1X7AC 1VITF 2QXGA 4MTBA 4KTCA 1J8AA 2F9PA 3EGKH 2QV1A 3NKKA 1P10A 3PV4A 1CT4E 2BB4A 4MPWA 2V0BA 2J38A 4ZCNA 1EJNA 4NCYA 1C2EA 2BZ6H 1OP8A 5FAHA 4Y79A 2M5TA 2XNDD 2Z3DA 3SJ9A 1QBOA 1YCPH 2AH4X 1FIZA 3VG8A 2O9QA 1DY8A 1F5RA 3RXKA 2D8WA 1G3CA 1O2SA 5HYOA 1T8NA 3QDZB 2VIWA 1K28D 1DUEA 4TPIZ 1ZTJA 1K21H 2C8WB 1CGHA 1EZXC 4JZEH 4TPYA 4JZ1A 3P8FA 3SUEA 4MNWA 1AVGH 4YT7H 2ILNA 3DFJA 2Y5HA 2VIOA 1C5XB 1GBBA 3EA7A 3JZ1B 3EE7A 4E05H 1GHYH 1C5NH 1EX3A 2Y81A 3FANA 3DT0H 1SOTA 1BMFD 5AF9H 1SGPE 4Y7BA 2JJ1D 1O2LA 1C5MD 4AYYB 2A4QA 2EEKA 1W14U 1Z8GA 4AG2A 1DANH 2ZIQH 2AMQA 1K1IA 1O2PA 1O2XA 3U69H 3E16B 1TNHA 2A2QH 3FVFB 3UAIC 1O5DH 2F9UA 3GY4A 1GG6B 1O33A 1GBLA 1BT7A 4LOYH 3H7TA 1XKBC 2R0KA 3Q3XA 2FOMB 4JYUH 1PJPA 1NRPH 1FX0B 2CN0H 2GDDA 4INLA 1LVMA 3SW2B 2HPQH 3B23B 4X1NU 1MQ6A 1SLVB 1ZRKA 1EATA 1JRSA 2XCNA 3A87A 2VWOA 3KEEA 3SU1A 4SGAE 4BXSA 3U28C 1GBIA 1CA8B 3QLPH 4FUCA 3SU0A 2ANMH 3SU4A 3I78A 2J2UA 1Z7KA 4TSFD 1F5LA 2C8ZB 5DP3A 1MTUA 1TBZH 2ZHFH 2FMJA 3V7TA 1E34B 3GCTG 5LPRA 1TNGA 1V2NT 1C1WH 2BD2A 2A32A 3A7ZA 1LKAA 3LC5A 5GIBA 5EG4A 3ZVDA 4DCDA 4UDWH 2HPPH 4FU9A 3RXOA 1D4PB 4WWYA 1A0JA 1AUJA 1QBNA 1MTWA 1O3LA 1N8OB 2H1UA 2A1DB 2ZDLA 4F49A 4ZMAH 1OWDA 2FIRH 1TWXB 4CBOA 1LCYA 4Y11E 2Q6DA 5DK1A 1FY3A 4TT3D 4B6FA 1H9LB 1BRAA 2VH0A 2QF5A 3B8JA 3KYGA 4CRDA 1A0HB 1J15A 3H5CB 1HAYB 2WPMS 5B6LA 2QY0B 1T8LA 2VJ1A 1FDPA 3S69A 4MG3A 3NXPA 5I25A 2KCYA 2JKHA 3V0XA 1E79D 1GJAB 3E0NB 3EYDA 3I29A 1GMHF 1CE5A 2F43B 5E0GA 1SGYE 5EJ1A 3TNTA 4ZHMU 1TAWA 1TGNA 2V35A 4KTSA 2VIPA 2JH0D 5JYIA 2BLOA 2AYWA 3STIA 5C17A 3A8BA 4OS2A 1RTFB 5EGMA 5DPAA 1O2WA 3LGWA 1C5OH 2J94A 3A83A 2Q1JA 2ZU2A 5AFYH 2WV5A 3VXEH 1UK4A 1IQGA 1P2OA 4KKDA 4CRBA 1T4UH 2EA3A 4YLQH 1C5YB 2F91A 4GUXA 4CBNA 3ZVAA 1AD8H 4FXGH 1EJMA 3MU1A 4KP0A 3BTME 9LPRA 2A45B 2A5IA 1KDQA 4H4FA 3TU7H 2C4FH 5A0AE 4GCHF 1BJUA 3C27B 3SO3A 1XUKA 1O2JA 3SI3H 1DOJA 3SGQE 1NT1A 1O2IA 3ENSB 3SGAE 5E2OA 4DOQA 2GV7A 2QN5T 3MNSA 2F9OA 1IAUA 3LGYA 1NFXA 2L6OA 4WXVA 2ULLA 3SHCH 2G55A 3TPIZ 2BD5A 2Y80A 2J5UA 2WPIS 3M37A 2ZPQA 3A7XA 2D26C 1O2QA 1RD3B 4A5TS 1FN8A 1A5GH 4Z6AH 4I31A 1K1JA 1FUJA 4FUHA 1EXFA 5CDFE 2FTLE 3MNBA 1P04A 5FPSA 1COWD 4JCNA 4ZH8A 3AK5A 2A4RA 1KIGH 1S0RA 4GAWA 3PRBA 2Y7ZA 2OC7A 3M3TA 1GL1A 1YGCH 4FUGA 3SJ8A 4VGCC 1EJAA 2CF9H 1XVOA 3URDA 4Z0KA 1DDJA 5IK2D 1ETRH 3TGJE 2W26A 1GBFA 1K22H 2OQ5A 3RU4T 1YPHC 1BTWA 2R9PA 3K65B 4ZROA 4H6SB 2C93B 4HFPB 1PFXC 1HJAB 1C2MA 1EP5A 2D1JA 5JB9S 4CRGA 1RTLA 3SBKA 1AB9C 1INCA 1NPMA 4Z1MD 2ALPA 4P00A 4AGJA 4JYVH 3RXVA 2D2DA 2FEQH 1TMBH 3A7VA 5DP7A 4A1VA 1OSSA 1SL3A 1F5KU 3M7UA 1VITH 4HZHA 4NFFA 1O2OA 1BTUA 2ZGXH 5HMAA 1NO9H 1NROH 3S7HB 1KTTB 1ZSJA 2JH6D 1GMDG 4ABHA 1TGCA 2EC9H 3BTFE 4ABBA 2IPQX 1G3BA 2LP6A 3PO1C 3BTWE 2OD3B 3SNAA 1TRYA 1K1MA 3O8RA 4WF8A 4M7GA 4RKJB 1D3DB 1GHBF 1GBTA 4R0IA 4D7FA 3M5MA 3A82A 2BLVA 3RP2A 3KN2A 1EOJA 1OHHD 1W13U 5A8ZA 3ATLA 5BRRE 5FCRA 1BBRK 2ZECA 2DE9A 3KQEA 3CNRA 2ZGJA 2ZNKH 4GVUA 1QRXA 3PRDA 4X0WU 4ASUD 1ZGVA 5EU8A 1GJCB 4GPGA 1Z8RA 4WMDA 3T26A 2GX4A 2QAAA 3GY6A 1QIXB 1C2FA 1Y5BT 3MFJA 2FI5E 1TBRH 1EAXA 1WXRA 1HXFH 1MKWK 1P9SA 2HNTE 3QWCH 1DUAA 1G3EA 1DVAH 1GDQA 2VGCB 3ZZ7A 4ISLA 4MPXA 4AB8A 2WSSD 4K1EA 1GMCF 1ESBA 1MZAA 1O2VA 4WH6A 3D62A 4MQAA 1P12E 1DWDH 2P59A 2KM0A 2OP9A 1AN1E 1QB9A 3BEIB 2B9LA 2WYGA 5EPYA 5DGJA 3U8TH 3N7OA 3EAJA 1IQFA 3MU4A 1MUEB 1HFDA 1A3EH 1HCGA 1SFQB 1WAYB 5T6GA 3R3GB 3SU3A 3OSYA 3MU8A 1TABE 5F53A 2ANKH 2BOHB 3BTHE 1BTHH 1C1TA 3RMNH 4IW4E 1EOLA 4NGAH 3RXIA 1NU7B 4DIIH 2A4OA 4B6EA 3SJIA 2GT8A 1EZUC 2LPRA 3CS7A 1A61H 1KLTA 5EW1H 1YY3A 4FOUC 3B9FH 3S9CA 3BTTE 2ZDMA 1TPOA 5DP9A 2H9HA 4R8TB 4Y8ZA 4RN6A 1WTHD 2CF8H 1HAHH 3OE7D 2KR7A 3RM0H 4ISHH 1BCUH 2B0FA 3RXPA 4ZHAA 2UUFB 1EKBB 1EZQA 3GY8A 4GCHG 3ZZ9A 1NFWA 3MO6A 2FOHA 4NIWA 3SI4H 3UOPA 4XD7D 4CHAC 3TNSA 4TWYA 2WV9A 4I8LA 3SV7A 1AKSB 3NPSA 1QL7A 4GHQA 2G4UA 3U98H 3T29A 2G52A 3OEHD 4CH2B 1OYTH 1FONA 2STBE 4KGAA 4X8SH 3SV6A 1HB0B 2HLDD 1ZHMA 3OY6U 4Q4LA 1GI6A 2CJIA 5JDUB 3F9HA 1DT2A 4YLUA 1AE5A 2AMPA 2LNCA 4GSOA 1HJ8A 1GCTC 1TNKA 1C1NA 1C5SA 4Y8XA 1S82A 4Q7XA 1HAZB 4ABIA 1C5PA 1IHSH 2HRVA 1W0ZU 3QX5H 1HGTH 2UUYA 2A0QB 2BX4A 3WWBA 4BTIB 3KYFA 1O34A 1YLNA 3O8DA 1KSNA 3P6ZB 1QQ4A 2W3KA 3FP8E 3KGPA 4UD9H 3RXBA 3LH3A 2XWBI 3ZVFA 5C94A 1MAYA 2FOFA 1S0QA 2XYAA 1FPCH 5CHAC 3PMJA 1LHCH 3N7EA 1O3OA 3LPRA 2WPLS 2VNTA 2IPHA 1P9UA 1B5GH 3RXMA 1SQRA 4AORA 1C5UA 1CGJE 3S7KB 2QF0A 3VB7A 1FAKH 1RGQA 4U32A 3DFLA 1E1QD 1FPHH 4B2BA 1T7CA 3M35A 2WPJS 2BXUH 5AFZH 1NFUA 4A6LA 2YNAA 3N99A 8ESTE 1G30B 1GJ8B 3GDVA 1CA0C 1GI9B 1AU8A 3P8NA 2VINA 3ZVCA 1XXDA 2GCTB 2WHXA 2H6MA 3OTPA 1ABIH 1YLDA 3ZZDA 3A7WA 2EI8A 2P3TB 1ID5H 3SZNA 5GWZA 4I8JA 2SNWA 4OGXA 3VGCB 3BEFB 3SQEE 4Q63A 1J14A 1O3DA 1O3BA 2B7DH 2OC8A 2GJGA 4ZUHA 1O31A 4CRFA 2WINI 4NIXA 2G5NA 2B5TB 2OLGA 1WU1A 1FQ3A 1QB1A 5K0HA 4FU8A 5CHBA 3FO8D 1SR5C 1DX5M 3BN9A 1F0RA 4Q7ZA 3F0OA 4XBDA 2WUBA 1W2KH 4X2WA 2IJD1 1Y8TA 5DKMA 4F48B 1O2TA 1TNJA 1O5AB 3GYLB 1IQLA 1HAIH 3H09A 1D9IA 5EXMA 4IN2A 1QZ8A 1T32A 1VZQH 3K6YA 4CH8B 3BTDE 2VU8E 5DP8A 1TQ7B 4D7GA 1W7XH 4ZXXH 2FX6A 2GTBA 4X1SU 4UFGH 3RLWH 3A7YA 3OFND 3RU4D 5C5NA 1L4ZA 2R3YA 4NA8A 1FI8A 1OWIA 1SB1H 3RXDA 4INKA 2UWOA 4I8GA 5A09A 1FIWA 4OS4A 1DWCH 2O8UA 4K60A 4B75A 1Q2WA 4NSVA 2BD8A 4Q80A 3EQ0H 4Y0YE 1KDQB 3QZQA 1WOFA 2VIQA 2BX3A 2PR3A 3F0PA 3PO1B 3RXQA 1NS3A 1OP2A 2GKVE 2AHME 1DPOA 3OX7U 2PLXA 1SVPA 3TH4H 1QJ7B 1V2QT 1AFQB 1YP9A 2H5CA 2B8OH 3OU0A 1TRNA 1F92A 3HGPA 4JK5A 5JBBS 1KTSB 1O5GH 1MTNC 2ODQA 4I7YH 2PWXA 1CGIE 1S6HA 2AGGX 5FX5A 5EJZA 1WTGH 4CR9A 4YOJA 1WDIA 2OQUA 1AWHB 1N1LA 1O3FA 2ZU1A 1EQ9A 5DO4H 2A2XH 2OINA 3RUOA 2QA9E 1FLEE 1CHOF 1O2GH 3ZZ8A 1D3TB 1TYNA 3LU9B 2K1QA 2G00A 2GDEH 2BQ7B 2BVXH 1MTNB 1QA7A 2THFB 1P2IA 4OS5A 3RXHA 2VB0A 3VB5A 2CXVA 1IHTH 1GWAA 3A7TA 1H4WA 1VCWA 3V3MA 1GHAF 1TGTA 1MMJN 1TIOA 1D3PB 2QF4A 1GBCA 1MKXK 1YPJH 4BTUB 2M2AA 1FJSA 2R2MB 1OS8A 3UIRA 4D76A 2HWLB 2ZEBA 1ELBA 2V7QD 1BHXB 3PM3A 2KCAA 3BEUA 1HBTH 3SJOA 4UFEH 3UOUA 1ORFA 1U6QA 3U8RH 2YNBA 1ZSKA 2J4IA 3DSOA 1LQDB 3C1KA 1FMGA 4RKOB 4DW2U 1SGRE 1V2RT 3E3TA 1UCYK 1RS0A 1C1RA 1L2EA 2KCOA 2DE8A 1ANBA 3QZRA 2NU3E 3AW1A 3MO9A 7KMEH 2YOLA 2ZQ2A 1MU6B 4O03A 3K9XB 1RFNA 5JBAS 4X6NA 1H9HE 5ESBA 2O8TA 3TJVA 4IN1A 3S0NA 3BTKE 1VITG 1N6YA 5TCCA 2PKSB 4D9RA 1F0SA 1HV7A 4B74A 1AO5A 1G32B 3P17H 1O3AA 1AQ7A 4X1QU 4AB9A 1GG6C 2RA0A 3DSPA 1GI0A 3LGUA 1XUHA 1HYLA 2ZFRH 3KQDA 1AVXA 2RA3A 1GJ5H 2GVFA 4DGJA 1BHXF 1BZXE 4WMFA 4DJZB 1A4WH 1O38A 1QB6A 1Y3YA 5C1XA 2BXTH 2EI6A 5A8YA 5C0TA 4BAMB 1Z6JH 3FFGA 3ZV9A 5EODA 1LVYA 3L6PA 2R3UA 3KIDU 3PB1E 1GVZA 1HXEH 1SGQE 6CHAC 3U9AH 3IITA 2PSXA 2KAIA 2V6NA 3HATH 2YMSB 8GCHF 3VB3A 4WH8A 2G8TA 1OP0A 5FCKA 1DICA 1CBWC 4Y76A 5DN6D 5IYTA 3P92A 3FN8A 1SGFG 1O5CB 2ODPA 1CHOG 2TGAA 4BAOB 5L6NH 1P06A 1VJAU 1GHZA 2W3IA 1S84A 1UTQA 3ESTA 3GDSA 3TITA 1ZMNA 2ANWA 4UONA 2ZTZA 4E7NA 1C1MA 2HNTF 5DJ7A 2BMGB 4A1XA 4A1TA 3UB0A 1BTXA 3SUGA 2ZPSA 1WYKA 4WY3A 1FXYA 2CHAB 3KQ5A 3RLYH 5JPMH 3MH5A 3SYJA 4KELA 1GI4A 1MZDA 2ZHWH 2P8OC 2WV4A 3Q3YA 1MABB 1H9IE 1TA6A 5JB8S 3DUXH 1GI3A 5FPYA 1NRNH 1VR1H 3NRLA 9ESTA 2ZFFH 1NM6A 1CO7E 2UUJB 2BDBA 7GCHG 1V2ST 2GCTC 1JMOH 5A2MH 4FUEA 5DG6A 2J97A 3R0FA 5C20A 4BANB 1T31A 3RXEA 1OX1A 1E35B 5EXLA 1VCQA 1O37A 1QFKH 4MPUA 3HPTB 2L74A 5JBCS 4I8KA 3DA9B 2CHAC 4ZKRU 2BLWA 1ZLRA 4O3TA 3U1IB 4X2YA 1GJ4H 2BQWB 1UVTH 1TX7A 1ABJH 3ZVBA 1V2TT 4JYTA 1AUTC 5H4IB 1GCTB 2XC4A 3EA8A 4MPVA 2HALA 4I86A 3F9FA 3LT3A 4X2XA 4AYVB 1QR3E 4FVDA 1GBMA 3M61U 2PFEA 2P3UB 2SNVA 4FUBA 3E8LA 4J2YB 1G37A 4XRNA 1V2OT 3TK5A 1V3XA 1YC0A 1O2KA 1SQTA 1NESE 2VVVA 5ESTE 5JBTA 5DP6A 3MH6A 1DXPA 3A84A 5PTPA 1GL0E 4DVAU 3QGNB 3ZYDA 2ZU5A 1EB2A 2OUAA 1HAXB 2OXSA 1WQSA 1C5TA 1GHXH 2ZG0H 2UUKB 3RMMH 3MNXA 2BDHA 2Z9IA 2STAE 2PW8H 1C2HA 2PHBA 4ACAA 5FBIA 1P2NA 1BMLA 1KXFA 3GS9A 5TJXA 3RXRA 1C1SA 1XUJA 1ELGA 2JETB 2XXLA 1FZZA 2KFWA 1UVOA 3SU6A 2P3FH 1C5VA 2FOCA 1SLXB 2WYJA 1WUNH 3LKWA 4CR5A 1GHAG 1QCPA 1Y59T 1PYTD 2BY5X 2W7SA 1P05A 4B73A 1JXPA 1SLUB 1ANCA 2GP9B 1Z8IB 1W0JD 1DWEH 2C8XB 1TONA 3SGBE 1XKAC 4WXIA 2I6SA 3JZ2B 2EI7A 1UTNA 3RXFA 1C4V2 3ZIAD 2H5DA 1Q31A 4WMEA 3E1XB 2F4LA 2QE7D 4ZKSU 1KYNA 1SFIA 1O2HA 2ZCHP 1MU8B 5L2YH 2Z9GA 2SGEE 1DM4B 3ZYEA 5HGGA 4UEHH 2WPDD 2XNIA 2HNTC 1LDTT 4OS7A 1ZR0A 4TYDA 1UVSH 4MNVA 1BQYA 1C2JA 5EIYA 1YPKH 7GCHF 1EPTA 3ELAH 5F8ZA 1PPZA 2BM2A 1AGJA 3RU4E 3F2FA 1MBMA 3GOVB 2SGFE 3GY7A 1GJDB 4HG6A 4B2AA 3TK6A 2SFAA 1EAWA 3ATIA 2JH5D 4OS1A 4Q2KA 1GHVH
chains in the Genus database with same CATH topology
4H42U 3AASA 1C2DA 1UMAH 4X1PU 2ZHEH 1YPHE 2UWLA 1ELTA 1RIWB 2FS9A 2XW9A 1LHDH 4XFQA 2KZ4A 1ELCA 1NN6A 1Z1IA 1D3QB 1YPMH 1TPSA 3URCA 4IGDA 1BIOA 3F6UH 3KHVA 1AI8H 2AERH 4O3UA 1DLKB 3DCLA 1O3GA 4AN7A 1K1NA 5F8TA 3QTVH 4NA7A 2VWLA 1AZ8A 4UFDH 4ASHA 3EDXB 4DT4A 1MQ5A 1YPEH 1ZYOA 1DITH 4X1RU 2XBWA 1KXDA 7ESTE 2W5EA 1SG8B 2R0LA 5F8XA 3SV8A 1UVPA 3OY5U 1S83A 3V12A 1TX6A 3F9EA 2ZHQH 1UK3A 2ZI2H 3LONA 1JOUB 3ITIA 5C0UA 1TBQH 4FVBA 5GNDA 1ETTH 1ELAA 3RXUA 5I46H 3TJOA 2NU1E 3E90B 3MH7A 1TRMA 2A4GA 1BTYA 1GI2A 4DIHH 1XUGA 3SU5A 1TX8A 1GDUA 4NWKA 2QXIA 1S6LA 1PPBH 4YESB 1BRCE 1GBHA 3EA9A 3UPEA 4IBLH 3T27A 1CVWH 4ABDA 3NUMA 2H9TH 4TWWA 1K9OE 1S81A 4BOHA 1HAOH 3SHAH 2FLBH 1ZRBA 2ZGHA 5A8XA 1ZPCA 3CS0A 1HLTH 1V2LT 1UCYH 1EASA 1YLCA 2BDIA 4MDSA 3LDXH 5FHTA 1DLEA 4ISOA 3UR9A 1G36A 3TH2H 5CE1A 1H8HD 2P8OB 3SZEA 2VH6A 2J9NA 4IMQA 1Y3XA 2ESTE 3GCTF 2QCYA 1AVWA 3LGVA 1D6RA 1PQ5A 1BBRE 2BHGA 2XBXA 1JIRA 4YTAA 1QJ1B 4NIVA 1RXPA 5E2PA 1A46H 3KQBA 2BYAX 1WSSH 2ZDKA 1ZHPA 1MAXA 1W10U 2FDAA 1OWEA 1T8OA 2SGDE 2P94A 1MKXH 2FOAA 1DSTA 2FI3E 1G2MA 1AIXH 3PMHB 2PKSC 1GHBG 2BD4A 3E91A 4AG1A 3LH1A 4JZDH 3LIWA 4E7RG 2O8LA 5C2ZA 1HAPH 5LPEA 3SNBA 4BAHB 4IMZA 1DS2E 4U2WA 1TPAE 3PWBA 1UK2A 1BA8B 3VGCC 5HXFA 1FY5A 4FUFA 1TNLA 3ATWA 4JZFH 1BRBE 1W7GH 1Z8JB 3RXGA 4LK4A 3G01A 2ZDNA 1ETSH 3UNRA 3KNXA 2SGPE 3LJJA 1ELVA 1VGCB 1MTSA 3LOXA 1ELDE 1ZTLA 5E8EH 1BDAA 4B76A 1PYTC 1ZHRA 4D9QA 4UE7H 1QTFA 1XXFA 5T6FA 1E36B 1KLIH 2H2ZA 4O9VA 6LPRA 3GISB 2KAIB 2FYRA 2SGQE 3MU5A 1KXAA 4FUDA 3GYMA 3ZZ6A 4YM9A 3TK9A 3SNCA 4I32A 3O8BA 2PKAB 1HDTH 1NZQH 1PPEE 1UTPA 2FO9A 4ABEA 1SGEE 2Z6BD 3PTNA 5EQSA 1F0TA 1L1NA 1XUFA 2XC0A 1NC6A 4TY7A 1SQOA 3D49H 1Q3XA 3TIUA 1P2QA 1GJ6A 1BTPA 3QO6A 2A31A 4ZXYH 1ARBA 3A88A 5L2ZH 5G4BA 1AB9B 4FUIA 1OKXA 1UCYE 4XBBA 4K8YA 4X6OA 1P2KA 2CGAA 4Y6DA 4PROA 1Z1JA 4OGYA 5C3NA 1V2PT 2AEIH 2OTVA 2BVSH 3L33A 1FN6A 2ZFSA 2FOBA 3BV9B 2XTTB 1SHHB 1O2RA 3A80A 2F9NA 1GVLA 1AFEH 3NZIA 1RTKA 1EUFA 3F1SB 3GY3A 2AIPA 4E06H 2TGPZ 2TGTA 1GHWH 3W94A 3RXLA 2GMTB 1EP6A 4K3JA 3ZV8A 4AFUA 1A3BH 2RG3A 4MLFB 4DURA 4JMYA 1SGDE 4M9FA 3BTGE 4SGBE 1YCPK 1TLDA 3RC6A 1O3MA 5CHAB 1AZZA 1V2WT 5EOKA 5J4QA 1A5IA 3ZZ4A 1CBWB 2ZP0H 3RC5A 5LGOA 1THSH 4X6PA 1K1LA 1C9PA 2W7UA 2AGEX 3N7DA 5A0CA 1A0LA 3BSQA 1Z71A 2AS9A 1TMTH 1HJAC 4Q7YA 2F83A 4HGCA 4VGCB 5F03A 3SORA 2C8YB 1O32A 2SGAA 1W12U 1HIAB 1YKTA 4NWLA 4X8VH 4FETA 2G5VA 1UTKA 1FY4A 1P8VC 3ZVEA 1SC8U 2XOKD 1TGSZ 1PPCE 4A92A 1Y3VA 3NCLA 1K1PA 4NG9H 3FP6E 1J17T 4I33A 3S9AA 3FOAA 3QN7A 1H8IH 3A89A 3MOCA 3LGIA 1W3CA 5J4SA 2OC0A 1NY22 1NRSH 4X8UH 2WUCA 1CU1A 2ZGCA 3M7TA 1Y3UA 2F9BH 1S6FA 4B1TA 3ZZCA 3S9BA 1O3NA 2XWAA 2Y82A 3ZZ3A 1IQKA 1QRWA 1AE8H 1MBQA 4AFSA 1WQVH 1P57B 2A5KA 1XVMA 4X2VA 4LZ4B 3FP7E 1K1OA 2BD7A 1LPGB 1A2CH 4DY7B 3RXJA 1L4DA 1AMHA 1HPGA 3QGJA 1TALA 4B2CA 1PQ7A 4NZQA 2P16A 3M5NA 1V2MT 2NWNA 3RMOH 1NTPA 1C4U2 3NK8A 5F6MA 3BF6H 5L30H 1NU9A 5FX6A 3SV9A 1EAIA 2Z9KA 1TGBA 4ISIH 3P95A 1P3EA 4A7IB 2W6ID 4J1YA 2IOTA 3MH4A 2GV6A 2FP7B 1LQEA 2NU2E 1O2NA 5EW2H 1B0FA 1QRZA 3SN8A 2VGCC 4K5ZA 4B71A 2IN2A 3MWIU 4IC5A 1TOCB 2Z3EA 3AVZA 3W1EA 3LJOA 1UHBA 5GPIB 2XBVA 3L3TA 1LPKB 5K7RA 2FPZA 1XX9A 2TGDA 1O3EA 3FZDA 1SSXA 2ZCKP 1GGDC 1EPTB 1KY9A 3RDZA 1IOEA 4Y8YA 1KXEA 1LKBA 1VCPA 3K2UA 1P03A 3VB4A 3UUZA 1SHYA 1W11U 1GVKB 1NFYA 1N8OC 4AZ2B 3GCHB 4ABFA 1HAGE 2AMDA 2ZFTA 6ESTA 2BY9X 1P0SH 3EE0B 1XM1A 3TGKE 3BG4C 3T28A 3AAVA 4CRCA 2ZFQH 4RI0A 3PLBA 1EFRD 2TRMA 3PLPA 4I8HA 4AX9H 2DUCA 5FXLA 2A7HA 1ZMLA 3PWCA 4INHA 3F3BA 2CMYA 4YT6H 1BUIA 1HAVB 3MYWA 3P8OA 5C5OA 1P02A 4XSKU 1E38B 1VGCC 2QXHA 1O3PB 1Y3WA 1YM0A 1OYQA 1SGCA 2P95A 1FNIA 3I77A 1JBUH 3PYHA 1KXBA 1IQEA 3BG4B 1GGDB 3DHKH 3ZZBA 3UNSA 3GCNA 3TH3H 4ZHLU 3M5LA 3P8GA 1HAVA 1NRQH 1W8BH 5TCAA 1N6XA 2VWMA 4NZLA 4GHTA 1FY1A 5A0BA 6GCHG 1UJ1A 1GJ7B 2V3OH 3BIVH 3UREA 2G51A 1PPFE 1BTZA 1FAXA 3HK3B 5FBEA 4YXWD 2PUXB 2BLQA 1GPZA 1XUIA 2I6QA 3ZZ5A 1NBMD 2J92A 2GMTC 2Z9LA 3DD2H 1IQNA 1ELEE 3P70B 2C3SA 1AWFH 3ATMA 1LHGH 5ABWA 4MNYA 3RXSA 4Y10E 1JRTA 1KLJH 1L1JA 1MCTA 2F9VA 3GY2A 1WV7H 4RSPA 2OK5A 3T25A 1C5WB 2HOBA 2FZZA 4CREA 1KMHB 3AW0A 3MNCA 2WPHS 2A7CA 2GCHG 1BB0B 5HM9A 1O5FH 2ZU3A 2A7JA 1YYY1 4YOGA 3SU2A 3UY9A 1C5RA 1DSUA 4K1SA 4FU7A 1XMNB 3F2HA 1LMWB 1ZZZA 1UO6A 2FLRH 2GCHF 4HTCH 1YCPM 5T3HA 1UTLM 1TPPA 1M9UA 2Y5GA 4OM9A 5EXNA 1EB1H 2HLCA 1GDNA 1ACBE 1GI5A 5E0JA 2BTCE 1S85A 2G81E 3LGTA 4AFZA 3Q76A 3TVJB 4XBCA 2FXRA 3MU0A 3STJA 3KL6A 5GXPA 3GICB 1A5HA 2YMSD 1O35A 2Y6TA 1GBDA 1UTOA 2FS8A 2OC1A 4CHAB 2O8MA 1ZOMA 3FAOA 4YOIA 1RJXB 2HGTH 2XCFA 1HJ9A 4THNH 5T6DA 2W6JD 1SQAA 1C9TA 2ZO3H 3AAUA 1A7SA 3F2GA 2XBYA 1W0KD 1K2I1 3UQOA 4BXWA 1THPB 5C1UA 4LZ1H 1G2LA 3CENA 2BD9A 1EPTC 1V6DA 2ZTYA 3A8AA 3M3SA 2TPIZ 1SPJA 3QUMP 5ETXA 1ZTKA 2LELA 3KCGH 1SLWB 4AOQA 3WW7A 1QY6A 2QYIA 1LPZB 1UHBB 2H9EH 2Q6GA 3TJUA 1GMCG 1H8DH 1BMNH 1GCDA 1O3JA 1IQIA 2FESH 3IWMA 5LH8A 1TNIA 1QBVH 5LPFA 1GBKA 2ZGBH 1AKSA 2BY7X 5E0HA 1OXGA 2WZQA 3ZZAA 2JIZD 3D23A 1TE0A 3H7OA 3UWJH 3QTOH 4BAKB 1O3IA 1BMMH 2ZC9H 1ESTA 2GZ8A 3QK1A 2PGBB 1MD7A 3U8OH 4ISNA 4MVNA 1QA0A 1BMAA 2ZZUH 4YO9A 4ZKNU 1GJ9B 2F3CE 4NSYA 2PKAA 4NIYA 3BIUH 3SQHE 3BTEE 1TB6H 2VVUA 3OAAD 2C90B 5B6OA 1RIWC 1P09A 3A81A 5EQQA 3WY8A 2ASUB 3UTUH 1O2MA 2CV3A 3GDUA 1AFQC 4OS6A 3HK6B 2OCVB 4XE4A 4O97A 4FUJA 4DT7B 1C2GA 4DG4A 1EZSC 2FWWA 2TIOA 2FTMA 2Y5FA 4F4OC 1OPHB 1QL9A 2AGIX 1F7ZA 5C67A 1V2UT 3RXAA 1O2UA 2VIVA 1YPLH 1QJ6B 3SJKA 5GCHF 1C2IA 1LHFH 2K8IA 3SNDA 2JETC 1HRTH 1HNEE 1LHEH 3PV5A 2IJOB 2ZFPH 1C5QA 1P2MA 3GCOA 2GGVB 1SBWA 5C1YA 2V3HH 2XC5A 2ZKSA 8KME2 3Q77A 4H6TA 1PQAA 2XRCA 2JJ2D 3UWIA 3FZZA 1YPGH 1V2JT 5GDSH 4D8NA 1DXWA 1BOQA 1TFXA 5FPTA 3A8DA 3VB6A 1O39A 1AHTH 2VBCA 3VPKA 1PQ8A 3WWFA 2BY6X 3ATKA 2BDAA 1ZGIA 3IG6B 1B0EA 5BPEA 4ZAEA 5GJ4B 5EPNA 2RDLA 1FY8E 3RMLH 3ODDA 1E37B 1L1GA 2PTNA 3PTBA 2GZ9A 2PUQH 2VWNA 1HIAA 1SOZA 5DP5A 5GCHG 1ANDA 1LTOA 3U1JB 1THRH 1GI8B 1TA2A 1YF4A 3PROA 1S5SA 1Y5AT 4U01A 1O5BB 1GMHG 3MI4A 2P93A 2FODA 4BNRA 2FOEA 1B7XB 2O8WA 1JIMA 3FKSD 1AY6H 3Q3KA 1P01A 3M5OA 1E1RD 3CP7A 1BJVA 1TQ0B 3ZVGA 1SGFA 2PSYA 3A8CA 3BG8A 3T62A 5SGAE 1MCVA 1DWBH 2FYQA 2A5AA 4Y7AA 2OBQA 2Y7XA 1GI1A 1O2ZA 4K8BA 1ZPBA 4KTUA 1CSOE 1BRUP 1O2YA 2BD3A 5HM2A 1QQUA 1F2SE 2Z7FE 1D6WA 3VXFH 2QF3A 1O3KA 3PV2A 3PLKA 3M7QA 4YZUA 2GD4B 1C1OA 1H8ED 1GJBB 1NRRH 3F9GA 2JDID 1LO6A 4GLYA 1CQQA 1C1VH 3SNEA 4IS5A 5FL7D 3KF2A 4UFFH 5HKKD 3UQVA 1C2KA 1C5ZB 3A85A 3TGIE 1C2LA 1J9CH 3KQCA 1G9IE 2FOGA 2PTCE 5DP4A 1TOMH 2BY8X 3T2NA 4BAQB 1DY9A 2CK3D 4JK6A 3K6ZA 1RRKA 2BDGA 6GCHF 3PMBB 3D65E 1MKWH 1OWHA 1MTVA 1T8MA 1IQJA 1Z6EA 3UNQA 2BDCA 1GMDF 1TMUH 2ZA5A 1QHRB 1UVUH 1P3CA 3HGNA 3ODFA 2TBSA 3SOSA 3O8CA 2BDYA 1HUTH 3MHWU 1C1PA 2BVRH 1O36A 2ZHDA 2K0QA 1LVBA 1PPGE 2R2WU 3VEQB 3MMGA 2ZTXA 3W95A 2ODYB 2PGQB 2ZDVH 1CT0E 3E0PB 7LPRA 2QXJA 1V2VT 2RCEA 2VVCA 4Y71A 6CHAB 1QGFA 1OOKB 1ANEA 2J95A 1GBAA 1J16A 2YMSC 5T1VA 1CHGA 3OEED 4BTTB 1SKYE 1JWTA 4ESTE 1O5EH 3RC4A 2FI4E 1O0DH 4WVPE 1P11E 2BQ6B 2ZU4A 3MTYA 1SGTA 1GI7B 1C5LH 2ZF0H 3OTJE 1DFPA 2BOKA 1LVOA 3LC3A 3M3VA 2AIQA 2PV9B 3UFAA 4ABAA 2ALVA 2QC2A 4TY6A 5IDKA 1OWJA 1CA0B 1BBRH 3TLOA 2GZ7A 1OWKA 4AFQA 1PPHE 3UR6A 4MNXA 1ZSLA 1C1QA 4Y0ZE 3OYPA 4ZKOU 1MH0A 2ANYA 3NWUA 3A86A 1MD8A 1UTJA 1SGNE 3HKIB 2ZDAH 2HVXA 2AFQB 2Z3CA 4JZIA 1ZPZA 1BITA 2ZCLP 3SUDA 1CT2E 2ZWLH 4QT8C 1F0UA 3BTQE 4WJG2 4ABJA 1EAUA 1A1RA 3SV2H 4XOJA 1L0ZA 1GBJA 1ZJKA 3SUFA 1C4Y2 3HKJB 3GCHC 4X8TH 2VIDA 2BZAA 2QGRA 1QURH 1Y5UT 1ARCA 4K1TA 3T5FH 8GCHG 4U30A 2ZQ1A 1SMFE 2NU4E 2KCPA 3MO3A 1VJ9U 3PMAB 5CMXH 2ZPRA 1SI5H 1ZJDA 4HI3A 1IQMA 1IQHA 4XDEA 3GY5A 1UTMA 2UWPA 3VFEA 8LPRA 1QNJA 1P2JA 1ESAA 3RM2H 1H1BA 1O3CA 3TJNA 3E6PH 1V2KT 5AHGH 2GT7A 3M36A 2FM2A 2Z94A 4AGKA 4ABGA 1DE7H 4NA9H 2OBOA 1KXCA 2J34A 1SGIB 2FX4A