2K1QA

Nmr structure of hepatitis c virus ns3 serine protease complexed with the non-covalently bound phenethylamide inhibitor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
165
structure length
165
Chain Sequence
TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 PROTEASE
publication title Binding of a noncovalent inhibitor exploiting the S' region stabilizes the hepatitis C virus NS3 protease conformation in the absence of cofactor.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 24
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2k1qA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k1qA01
2FEQH 4Y6DA 1F0RA 2HNTF 1BMAA 3LJOA 1BZXE 2M5TA 4A7IB 2HRVA 3BIUH 1SR5C 1O5CB 5C2ZA 1NFWA 3LGTA 4AYYB 2BDCA 3RXOA 2DE8A 7KMEH 3LH1A 4DT7B 2R2WU 5FBEA 1GHZA 1BTWA 1EZXC 4ABAA 1FY1A 4K60A 1HPGA 3LC5A 2ZTXA 2HNTC 3UOPA 3MYWA 1P0SH 1EP5A 3OY6U 4FUHA 1DE7H 1ELFA 1E36B 2ZGHA 1GI9B 1ZLRA 3UIRA 3V3MA 1BQYA 2OXSA 3E90B 3KN2A 2O8WA 3A82A 1G3CA 1HYLA 3F1SB 5A2MH 4ISLA 2WZQA 2VIPA 4WF8A 4BTUB 2OC8A 4AGKA 3A88A 4WJG2 2UUYA 4XSKU 4ISHH 1NTPA 3RXDA 1O2JA 1HJ8A 2ZQ2A 1SHYA 5DP5A 2XRCA 2ZI2H 1GI2A 1MKXK 2PGBB 3M5MA 4CRBA 2V0BA 2PFEA 4CH2B 4DOQA 1GI0A 1ELCA 2A5AA 1JOUB 1O38A 2J9NA 3PO1C 4IW4E 1AO5A 1HAIH 4NSYA 1XXFA 4BOHA 5A0AE 3A7TA 4Q2KA 1ANCA 2VB0A 5E0JA 2IN2A 2SGPE 5EW2H 3VGCC 1DFPA 4ZKOU 3OSYA 4Y76A 5GNDA 1PPGE 4TY7A 1ZYOA 1ZZZA 1GDUA 3U98H 1LKBA 5JDUB 3SW2B 2P8OC 1ZMJA 2ZHEH 1C2DA 2A7CA 2VGCC 4GCHG 1HIAB 2VVVA 3H7TA 1Z8RA 2FZZA 2V6NA 3EDXB 1C1VH 1FAKH 3L3TA 5C67A 4XOJA 2Z9LA 1HAGE 4I8KA 3MFJA 2XC4A 1UTMA 4NWKA 1MUEB 3RXVA 5HGGA 1W0YH 1O2NA 7ESTE 2BZ6H 2Z6BD 1MZAA 1FXYA 1GMCF 3SU1A 1V2PT 3MTYA 1TONA 2D2DA 3QTVH 4A92A 1TGSZ 2NU0E 2ZNKH 4KTSA 1QB9A 2VVUA 3HKIB 3AW1A 4RKJB 3ZZ3A 1GHWH 2GDEH 1DDJA 2ZDMA 4NIXA 2FXRA 2Y80A 4UONA 4I32A 2R3YA 3T25A 4HI3A 1DOJA 1ZGVA 2RCEA 1FPCH 5LPEA 5SGAE 1EAUA 1VJAU 1DX5M 1SGYE 4WH6A 1YF4A 2AEIH 3EA7A 3A7ZA 1TYNA 2EA3A 1HB0B 4JZEH 3SGQE 1FONA 1G30B 1XUIA 3DFJA 1LQDB 1C1UH 3PB1E 3SQHE 3A85A 4DY7B 4HGCA 1G3BA 1O3BA 1AE5A 1GI7B 1UVUH 2B8OH 1WBGB 2AYWA 1MBMA 3RXMA 1KIGH 2ZTZA 3ATMA 1AWHB 3VB4A 5JBBS 4E06H 2OC7A 1KDQB 5G4BA 3LGYA 3A81A 1QJ6B 1QL9A 1LTOA 1GDNA 1KLIH 1TE0A 3RDZA 3UNQA 1A2CH 1AUJA 1EPTB 1G37A 1G2LA 2PTCE 2OLGA 2Z3CA 1BRBE 2BZAA 3RMOH 4UDWH 1WCZA 4DIHH 1B7XB 1DLKB 1UVPA 2OQ5A 2PHBA 2Y7ZA 4Y0ZE 1QBNA 1C5YB 4X1SU 3UR6A 3Q00A 4KELA 1V2WT 2A4OA 1BJVA 2PSXA 3LJJA 2ZF0H 1LPKB 1AU8A 1W7GH 5GJ4B 4X1RU 4ZAEA 1O37A 3LGIA 1F0UA 1HLTH 3C1KA 1ZSJA 1O2SA 2XC5A 1TGNA 1MQ6A 8GCHF 1NESE 1PPFE 1KSNA 4DJZB 3D62A 4BAOB 4LOYH 5EU8A 2Z9GA 5CHAB 1OSSA 4BAMB 1O3NA 2R3UA 3MU0A 3QWCH 2BQ6B 1EP6A 3UNRA 3MU8A 1C5PA 2PW8H 2G81E 1GBHA 1ZPCA 3FZZA 1KLJH 3SV7A 5DP9A 1D3DB 1GI6A 1Z8JB 1O2UA 1CO7E 1P9UA 2JH6D 5I25A 1HAPH 1LHDH 2ZHWH 1ZGIA 1YPGH 3RP2A 3P8FA 5J4SA 4YT6H 3SNAA 1P05A 1C5XB 3RXBA 4ABHA 1G32B 3GCNA 2QGRA 4ABJA 4WMEA 1GBMA 4OS6A 3S7HB 1PQAA 1SBWA 2XCNA 4X6MA 1T31A 2BD7A 2VH0A 1O2QA 1RFNA 3QO6A 2PKAB 5T3HA 1YC0A 3Q76A 4X8UH 2CHAC 2HALA 5GDSH 2GGVB 1ETRH 2O8TA 2VWLA 2THFB 4XBCA 1TLDA 1C4V2 3GY6A 3KQBA 1C5ZB 1GI1A 1S84A 4A1TA 1W12U 1BUIA 2FOCA 1C2HA 3MNBA 1IQMA 2ZP0H 4FUJA 1EUFA 3B9FH 2F83A 2G55A 1GDQA 1P2JA 1ELAA 1DSTA 1GJDB 2AFQB 2QF0A 2BDIA 1FY8E 2J94A 1J14A 5A0BA 2QY0B 2XW9A 1QR3E 2BQ7B 1FPHH 3MO3A 1FI8A 6CHAC 4MPWA 2F9NA 3MU5A 3EYDA 3RXSA 2XYAA 1B5GH 1P11E 5GIBA 2FS9A 1TWXB 2R0KA 1YPEH 2STAE 2WYGA 2P3FH 1T32A 4ISOA 1WV7H 4D7FA 4WXIA 1Z1IA 4OS4A 3QGJA 3IG6B 3RMLH 3GICB 2A31A 3RUOA 2V3OH 1HAYB 2WV9A 4FUBA 4B74A 5TCAA 1YPHC 4FXGH 1VITH 4UFFH 4D8NA 4DIIH 1C2IA 1JIRA 1Z8IB 3BTEE 1F2SE 4YZUA 2CN0H 1KYNA 3P92A 5EXMA 1BRAA 1UCYE 2Z9KA 4R0IA 1T8MA 1K1LA 2BX4A 2O9QA 3MH5A 1L2EA 4WH8A 7GCHF 4NA9H 3NUMA 3B8JA 1WQSA 3B23B 1ZHPA 2AMDA 3UOUA 1ELGA 2BDYA 2TGAA 1UMAH 1O33A 2BD4A 4I8GA 1IHTH 1W8BH 1IHSH 3M7UA 1WU1A 2PKSC 2QYIA 1C9PA 3JZ1B 3TJOA 1V2TT 1FV9A 2OINA 1ZTLA 1DLEA 2EI7A 3R0FA 1O3EA 1HAVB 4FUDA 1QGFA 3BG8A 3TNTA 1QB1A 3PROA 2BD3A 1CBWC 4MVNA 3MU4A 5C5OA 4X6PA 3BSQA 4Z6AH 4TWYA 1WTHD 2D26C 5ESTE 1V2VT 1SGNE 1YLCA 2OTVA 2ZDLA 1QIXB 2VIDA 5E2PA 1XUKA 3T5FH 1AMHA 1YCPH 4GAWA 3ZVAA 3LKWA 1TBQH 3GY7A 4F49A 4B73A 4IGDA 1P2MA 2FTLE 1QRZA 5B6OA 1TX6A 1OWKA 2FLBH 2ANKH 1KXFA 3T26A 1BDAA 1GJCB 3AAUA 3PLKA 3RXUA 1EATA 3PTNA 1HCGA 4JCNA 2XBWA 1KLTA 3SJ8A 1MTNC 1GMHF 1C1PA 1MTUA 1UK3A 1JMOH 3PMHB 1O3CA 1AZ8A 3RU4T 1C5QA 1O31A 3OYPA 4CRAA 2C8ZB 4A6LA 2ZO3H 4NFFA 1ZPZA 3BTHE 1BCUH 4ZROA 1XUHA 3F9FA 1YPMH 1P12E 1HIAA 1O2PA 4MNWA 1ACBE 3SUFA 1HJAC 1GMCG 3RMMH 3W94A 5E2OA 3KQCA 4BXWA 1AHTH 5DKMA 1FQ3A 5DJ7A 5GXPA 3SI4H 1O3AA 1BBRE 4K1EA 3A83A 2W5EA 2WPKS 1Z6EA 4ZH8A 1GHAG 4BAKB 3GCHB 1N1LA 2HPPH 4DURA 3SU4A 3OTPA 1C5VA 4MPVA 1C5UA 1LQEA 3S69A 1BRCE 1QHRB 2STBE 4DW2U 4D9RA 3RMNH 2QCYA 1NFUA 2UUKB 4ZUHA 5AFYH 3MO6A 5AF9H 1QBVH 1SGRE 1YKTA 4ZHLU 3BF6H 1FLEE 1O3FA 2GZ7A 1HBTH 2G51A 3SZNA 9ESTA 3S9BA 1A61H 1S82A 1DUAA 2H9EH 3H09A 5HXFA 3KQEA 3MO9A 1PFXC 3ZVDA 2F9VA 1ZJKA 2BMGB 1TX7A 3MNSA 4AOQA 4MLFB 3U8TH 5EW1H 2ZKSA 3G01A 4AYVB 1KTSB 5DP3A 4X2WA 1Z71A 1O2KA 5AHGH 4BAQB 1KXEA 1CA0B 2J34A 3A8BA 2GV7A 3K2UA 4K2YA 4ZKSU 4WXVA 3OTJE 2IOTA 1SQTA 4BAHB 4E7RG 3RXFA 3WY8A 1ELEE 5EPYA 2F9OA 3UUZA 4O03A 5EQSA 1EPTA 5F8XA 1O2WA 3LIWA 3MNCA 2WPJS 1NT1A 2FI3E 1TPAE 2A5KA 3RXLA 4JK6A 3UR9A 2KAIB 4WVPE 2NU4E 3BG4C 2GCTB 4ZMAH 1RTLA 2ALVA 3QGNB 1Y3XA 8GCHG 3RM2H 2BY5X 5JYIA 4QT8C 1YPLH 1P09A 1B0FA 1FZZA 4H4FA 3A7WA 1BB0B 1BHXB 4NSVA 2CGAA 2JH5D 4OGYA 2UWLA 4X6NA 1P03A 3O8DA 3SU0A 1HAOH 1MD7A 2BDHA 3T28A 2C8XB 2Q6GA 1CA8B 2BLQA 1O3KA 1D3PB 3GCHC 2W3IA 5C20A 1TGCA 3E6PH 1MZDA 3STJA 2VBCA 2LPRA 2ILNA 4GHTA 3ZZ4A 2C4FH 1J8AA 1SFIA 4FU9A 1VZQH 2TBSA 1IQGA 3BN9A 4TY6A 3SJ9A 1JXPA 2PWXA 2BLVA 1O2TA 1T8OA 4X2VA 1ETTH 1QURH 1UTKA 2BD2A 2VU8E 3AAVA 5CE1A 1S0RA 3BEUA 3OY5U 3TH4H 3E3TA 1PPBH 3SUDA 1TNLA 3BV9B 1O3DA 2F9BH 2V3HH 4INLA 2AGEX 3L6PA 1IAUA 3HKJB 2B9LA 5EXLA 1ANBA 3HK6B 1P2QA 1VGCB 1C1WH 3MH6A 2PKAA 3PLPA 1P06A 1ZOMA 2HNTE 1HAXB 4U32A 2G52A 1RTKA 1O2RA 1CA0C 3D65E 4NA7A 2FM2A 1C5RA 3U8OH 2BDAA 2PSYA 5TJXA 4I31A 1UTPA 2WPIS 3KIDU 2BLOA 1RRKA 1SPJA 2QN5T 4XE4A 3M7QA 3FAOA 4JZDH 4Y71A 3TVJB 4B1TA 5F8ZA 1CHOG 3RXEA 3KHVA 3PMBB 1FY4A 3A89A 4DVAU 2FTMA 1YLDA 3ZZ5A 2ZZUH 4PROA 3TGKE 2GMTC 3OX7U 1P8VC 1O5AB 2WV5A 3M35A 4IN1A 1QQ4A 1GBBA 2GDDA 3ODFA 4RI0A 1Z8GA 1J15A 3GY3A 3LGUA 3ZV9A 2ZGCA 1GWAA 4Y79A 3PV5A 1O2XA 2A5IA 1HUTH 2H1UA 3DT0H 1D4PB 5HYOA 1AVXA 1OWEA 1SI5H 2NU3E 3TK9A 5EGMA 4U2WA 4NIVA 2UUFB 1G9IE 2GT8A 2JETB 2ZFSA 1MCVA 7GCHG 9LPRA 3URDA 1P02A 1K2I1 3LU9B 1ELDE 3HK3B 1AB9B 2TPIZ 4MNYA 1TAWA 2RG3A 3GDVA 3SNEA 2ZQ1A 5F6MA 1ZR0A 1TPSA 1EXFA 2QXGA 3FP7E 3L33A 1BMNH 4B76A 2FX4A 1V2JT 1VITF 1GHAF 1LCYA 4GUXA 3E0NB 3LOXA 3QX5H 5LH8A 2AGGX 3SV6A 2OC0A 5FAHA 1BRUP 4NZQA 1AKSB 1SVPA 2FO9A 5TCCA 3TU7H 5C3NA 4D7GA 3SJOA 3JZ2B 1FN8A 1GG6B 3K65B 1N6YA 5FPTA 1VGCC 1HGTH 2VJ1A 3MOCA 1HXFH 4ZXYH 3GY2A 1XXDA 5C1UA 4YESB 1AWFH 1HAVA 3CENA 3ELAH 1P3EA 1IQFA 1VCPA 1HFDA 1UTJA 1Y8TA 4B6FA 2DE9A 1DY9A 3EAJA 2BLWA 1KTTB 3GY5A 1KXDA 1O2MA 5FPYA 2G4UA 4CREA 2GD4B 1E0FD 2QAAA 1TIOA 2TGPZ 3LDXH 1LO6A 4GHQA 5JBCS 2FPZA 2Z94A 2FX6A 3ZZ6A 3PMAB 2ANYA 1KXAA 2G5NA 2W7SA 4BANB 4AX9H 5C5NA 1CHGA 1GMHG 1TGBA 1A3EH 1O2OA 4FU7A 1OS8A 2P3TB 4ISIH 3P6ZB 1PYTD 1JWTA 1SGCA 4OS1A 2LNCA 5DP7A 1CT0E 2BY7X 1A4WH 1QTFA 5FBIA 4A1XA 4B71A 1EASA 2OUAA 3E0PB 3ZZCA 1YYY1 1ZJDA 4CRGA 5T6FA 2XWBI 3KNXA 2ZU3A 1MTVA 1LPZB 2BOKA 4GSOA 1SC8U 1CSOE 4BXSA 2IJD1 1GBDA 5FX6A 4E7NA 2F3CE 2GT7A 1O5DH 4CR9A 2VIQA 4E05H 2YOLA 3FANA 4NIYA 2JETC 4MG3A 1IQIA 1OWHA 5JPMH 3LT3A 4LZ4B 2H2ZA 2H9HA 3U69H 4HZHA 1UHBB 4ESTE 1UVOA 1EJNA 4WMFA 4ZHAA 3ZVGA 1GI4A 3GISB 5ABWA 2ZTYA 2Z9JA 3ESTA 1E38B 1TA6A 2VWMA 3VB6A 1GBIA 1HNEE 3HGNA 3ZVCA 3D49H 4B75A 4X2XA 5AVDA 3PWBA 2W26A 2QIQA 3Q3XA 1SGPE 2R9PA 1VCQA 1CGJE 2ZDVH 4AFQA 3M61U 1G36A 1C2JA 2IPHA 1EOJA 3RXIA 1NPMA 1MAXA 4I8HA 4NFEA 5A09A 1JRSA 1QCPA 4A5TS 3E8LA 2VIOA 1O3JA 3SHAH 1PPZA 2ZWLH 1UTLM 4CHAB 4JZ1A 4JMYA 2FOEA 1IQHA 1GL0E 1B0EA 3SV8A 4AG1A 4MNXA 3SU5A 3K9XB 1MD8A 1NFXA 2RA3A 1FJSA 2J95A 1FNIA 2BHGA 2ZA5A 4VGCB 4IC6A 2FI5E 1AE8H 2XCFA 1GBTA 1K1PA 1WUNH 2Q6FA 3E16B 2FOFA 1TQ7B 5FHTA 1C1QA 4O97A 2B0FA 3GY4A 3SHCH 1N8OB 3FP8E 1QFKH 1DVAH 2YNAA 1EZSC 1EAIA 1EPTC 5LPRA 2GX4A 1C5NH 3GOVB 1SQOA 1ZSKA 3SU6A 1TGTA 3RU4E 5EPNA 1WQVH 3RXPA 1CQQA 1UVSH 2PLXA 3UWJH 4ASHA 3A86A 2A4GA 4YOJA 1TNHA 1OPHB 1ESAA 4I7YH 1UK4A 1GHBF 1XM1A 3RXTA 5LPFA 4AGJA 1ANEA 2ANMH 1O3IA 1C5SA 4R8TB 1NRSH 1RIWB 1FAXA 1CHOF 5I46H 2KAIA 4FVDA 2CMYA 3MU1A 2ZG0H 1A5HA 1H9IE 3NXPA 4X8TH 1SOTA 1Q2WA 1C5TA 1TOMH 1L1GA 1VR1H 3SNDA 1BTZA 3RC5A 1RJXB 3SGAE 1SGFA 4Q7XA 2ANWA 1BT7A 1C4Y2 1AVGH 5CHAC 3T27A 5EODA 1AQ7A 2K1QA 2RA0A 4IMQA 4J1YA 2WPHS 1Y3YA 3P8OA 2OC1A 1HV7A 2VWNA 4H6SB 2FDAA 6GCHF 1SGDE 2ZHQH 1NRQH 1EKBB 4X1PU 1YPHE 1S0QA 3QZQA 1J9CH 1ID5H 2VVCA 2ODQA 2F9UA 4Y8YA 2OBQA 5K7RA 2FOGA 4LZ1H 1CE5A 1W10U 1K28D 1LKAA 1P2OA 3PYHA 3UFAA 1WOFA 1XVMA 3A8CA 1OP0A 4Y7BA 3GDSA 1V2ST 2C93B 4I8LA 1BOQA 3U1JB 1YCPK 2BDGA 2FMJA 4AORA 1THSH 2HPQH 4K8YA 3S7KB 1GGDB 1T4UH 1LMWB 1DUEA 3ZVFA 4NCYA 2QV1A 1HXEH 3I78A 4CBNA 1TNIA 3ZV8A 2BQWB 1T4VH 4D9QA 1QL7A 1O2ZA 2AMPA 1FIWA 2G5VA 1F7ZA 1TQ0B 4X1NU 5T6GA 1TNJA 1ABIH 1SGQE 2QA9E 1GBJA 1SGFG 3KEEA 1GI3A 4A1VA 1C1NA 4TYDA 4ABFA 1AUTC 3S9AA 4NA8A 3VXEH 1AZZA 3ZZBA 3P95A 4ISNA 1G3EA 3Q77A 1C2MA 1TA2A 1Z7KA 3SUEA 3P8GA 3A87A 3U1IB 1GJ6A 3P8NA 2BD5A 3GYLB 1V2OT 2A2XH 2VWOA 2EI8A 4B2AA 2PUQH 2ZHDA 4IC5A 2V35A 2GV6A 2SNVA 4MTBA 1A7SA 4O3UA 3H7OA 3MNXA 4YLQH 3LONA 3TGIE 1O34A 4SGBE 4AFUA 3AK5A 1O2GH 1YBWA 3A8AA 2P93A 1WXRA 2FP7B 1INCA 2AMQA 2FOMB 1O36A 3TITA 1S6FA 3UQOA 1KY9A 4ABDA 3AW0A 3UQVA 1H9LB 2A7JA 3V0XA 2A1DB 1DY8A 4KGAA 2J38A 1GJAB 2O8LA 1O32A 1VITG 1D6WA 2O8UA 1T8LA 1N6XA 1UJ1A 3O8RA 1P2NA 3UWIA 2H5DA 2VH6A 2TIOA 1TABE 1GJ7B 3OU0A 3A7YA 1OYTH 1ELVA 1GHYH 3EA8A 1NFYA 2Y7XA 1YCPM 1QNJA 4XBBA 2HVXA 1GCDA 1OWIA 1GBEA 1EZUC 1BMLA 1DM4B 2H9TH 4FUGA 2FOAA 5A8XA 3I29A 1MCTA 1O3GA 3SQEE 2XBXA 5DP4A 1AFQB 3TJNA 3BTGE 4FVBA 2A7HA 1PYTC 1FY5A 1V2MT 1W0ZU 3URCA 1LHFH 3BTDE 5IDKA 1O2VA 1QA7A 1QJ7B 2FS8A 3HATH 1THRH 1ARCA 3NWUA 2JKHA 2J4IA 3SOSA 2OP9A 3V7TA 4AFZA 1LPGB 3BTQE 1EJAA 1TMTH 3E1XB 2ESTE 4YLUA 2CF8H 2ZDKA 1HJ9A 1T7CA 2QXHA 4HFPB 2BOHB 1CT4E 3RLWH 1GJ5H 3SU2A 4MDSA 1C2EA 2P16A 2WHXA 2ZGJA 5IYTA 4Y11E 1E35B 2P3UB 4RSPA 2ZU2A 1PJPA 3UY9A 1S83A 3LC3A 1KDQA 1C1TA 2GZ8A 3GCTF 2SGEE 3ODDA 5F03A 3VFEA 2OCVB 1V6DA 2SNWA 4NG9H 8KME2 1NRNH 1G3DA 2FI4E 3EGKH 3TIUA 1C4U2 1HRTH 1Y3VA 4K1TA 4X0WU 3A80A 5AFZH 1UCYH 1EAWA 1WYKA 3NK8A 2C8YB 1X7AC 1NS3A 3PO1B 2C90B 2PUXB 4JYUH 1O35A 3BTFE 4BTTB 1V3XA 1GI5A 3I77A 4B2BA 5BPEA 1NZQH 1TOCB 2Y5FA 3O8BA 4MPXA 3RLYH 1SOZA 4Q80A 3TH2H 1FN6A 5GCHG 2BY9X 1ABJH 2ZFTA 3VGCB 1GVZA 3Q3KA 3AVZA 1Z6JH 4K5ZA 3VEQB 3KQDA 4AG2A 1MKWH 2Z7FE 4CRCA 1UHBA 2VGCB 2G8TA 4AFSA 5J4QA 1S6HA 1IQKA 1LHEH 1XUGA 2WPLS 3LGVA 1GHVH 1F5KU 4MQAA 3FVFB 6LPRA 1UTOA 1XUFA 1WTGH 4H42U 5DP6A 2NU1E 8LPRA 1MTSA 2BB4A 1AFQC 1TBZH 4FU8A 1W2KH 1W7XH 1LVBA 1OWJA 1GJ9B 1O2HA 1A0HB 2ZU1A 3NZIA 1SG8B 3BTME 3TJVA 1BITA 1W3CA 4ZKNU 2AGIX 3DFLA 1JBUH 1LHGH 3CS0A 2FOBA 1K9OE 3K6YA 5L6NH 1HAHH 4Y10E 1QRXA 3SJIA 3IITA 2SFAA 3QTOH 1NRPH 1P04A 3ITIA 4K1SA 4FUIA 2GTBA 1BBRK 1EJMA 4OGXA 1Y59T 3A7XA 4NGAH 4Y0YE 2ZECA 1GBCA 1PQ5A 4BTIB 1CGIE 1H1BA 1OP8A 4GLYA 5BRRE 3NCLA 1C1SA 2CXVA 2BVSH 3M3TA 2A45B 1OKXA 1P57B 3KF2A 1A3BH 4IBLH 4UE7H 1GHBG 2HOBA 4ABBA 1SHHB 1YPJH 3F9HA 2FYQA 2ALPA 1S81A 1MU8B 2W3KA 2SGDE 2HWLB 1BHXF 1GJ8B 1F0SA 1TPPA 3ZZ8A 1BBRH 2Y5GA 4TPYA 2GCTC 2VINA 1DICA 1K22H 1VCWA 1CGHA 1O5FH 2GP9B 4DG4A 2R0LA 1O3PB 2EC9H 1PPEE 5C1YA 1C5WB 1MAYA 5E0HA 1ESTA 2ZC9H 3KGPA 2XC0A 4O3TA 1DS2E 1SQAA 3FFGA 3FP6E 4I33A 1GL1A 2BYAX 1OX1A 1O2LA 3UTUH 1L1JA 1RTFB 1SLUB 1V2NT 6GCHG 1AFEH 3SZEA 1SB1H 2D8WA 3EE0B 1EB2A 1MKXH 1V2UT 4AN7A 4TPIZ 1XUJA 3MHWU 4M7GA 1DT2A 3QZRA 1C2GA 2ZFFH 3A84A 2FIRH 2ODPA 4ABEA 1EB1H 1ETSH 2BVRH 2WUBA 3RC4A 5HM2A 4B2CA 2FOHA 5GPIB 3H5CB 3GY8A 1E37B 1BIOA 1RD3B 4U01A 1NN6A 2TRMA 1ZHRA 3DHKH 2I6QA 1K1IA 2WPMS 1ANDA 1EZQA 4NZLA 2FYRA 1S85A 1A46H 1NY22 1RS0A 2TGTA 4JYVH 5B6LA 4O9VA 4KTUA 4CRDA 1V2LT 2HGTH 4XBDA 1F5LA 3EQ0H 3LPRA 2Q6DA 2EEKA 1O0DH 1XKBC 3ATLA 4KTCA 4X8SH 1GJ4H 1O5GH 2JH0D 1L1NA 5A0CA 1GI8B 2ZFRH 4K8BA 1TMUH 2ZDAH 1H9HE 1GBAA 2A4QA 1TMBH 1NC6A 4AB8A 2CHAB 3T2NA 3TGJE 4FUFA 1C5LH 5EQQA 3PTBA 1SMFE 1SSXA 3SBKA 2OQUA 1DWEH 2IJOB 1ZRKA 4H6TA 5L30H 1IQLA 1TRMA 1C2KA 1C2LA 2ZPRA 3TK6A 1D9IA 1O2IA 1QQUA 4CR5A 1TNKA 3RXQA 4U30A 3PV4A 3NPSA 2YNBA 2J92A 3UPEA 3SGBE 2SGFE 2OD3B 2UWPA 3RC6A 4Y8XA 3M36A 3TH3H 5LGOA 1K1OA 1QB6A 1VJ9U 3VB7A 3STIA 1WAYB 5GWZA 3PWCA 5ETXA 5T6DA 1L4ZA 1E34B 4INHA 1UO6A 3MWIU 2ZGXH 3U9AH 1Y5UT 2A0QB 3A8DA 1H8IH 1NO9H 6CHAB 3RXRA 3O8CA 3ZZAA 3TPIZ 4M9FA 1RXPA 3RXAA 3HGPA 1W11U 2FESH 3ENSB 1AB9C 1CU1A 1AI8H 4NWLA 2UUJB 1UTNA 1BTUA 1GJBB 4ZHMU 5GCHF 1Y3UA 1W14U 1S5SA 1GMDF 3BEIB 2F9PA 3SV9A 1ZRBA 1O3MA 1IQNA 1BTHH 1C5MD 2ASUB 4ZXXH 2GVFA 1SGEE 4CRFA 2SGAA 2ZHFH 2BDBA 1L0ZA 2Q1JA 2B5TB 4ZKRU 2VIVA 2OK5A 1GG6C 1THPB 4FUCA 1V2QT 3SORA 1F0TA 1SGIB 1Y5BT 1NU7B 3R3GB 3RM0H 1MQ5A 3FZDA 1P10A 2ZDNA 4JYTA 3VPKA 3CS7A 5A8YA 1SGTA 4THNH 2Y82A 2AIPA 2G4TA 4SGAE 4JZFH 1SLWB 1OYQA 3SN8A 1K1JA 2PKSB 2F91A 3TK5A 1GCTB 5A8ZA 1XMNB 1LDTT 3GCTG 5FPSA 3DUXH 2EI6A 4YOIA 1DXWA 3BTWE 3ZVBA 3GDUA 4WWYA 1GPZA 3MI4A 3N7OA 3P17H 2QF3A 1CBWB 1ARBA 2C3SA 2RDLA 2PV9B 3MH7A 2BD9A 1BTXA 4AZ2B 4DGJA 5JB8S 3HPTB 5T1VA 4IS5A 1K1MA 1K21H 8ESTE 1P2IA 2ULLA 1D3TB 1DWDH 2ZIQH 2FLRH 3S9CA 2TGDA 4WMDA 2Y6TA 4INKA 2GCHG 3K6ZA 4OM9A 1OWDA 3M3SA 3VB5A 5HM9A 1LHCH 3F9EA 5JBAS 1NROH 3KCGH 2A32A 4J2YB 1KXBA 3SO3A 5ESBA 1MTNB 1BA8B 5EOKA 3BEFB 1DITH 1XVOA 2J2UA 2OBOA 5DGJA 3UNSA 5FCKA 1ORFA 4MPUA 4LK4A 3DD2H 4MNVA 3PMJA 2AS9A 1KXCA 1GBLA 3W95A 1HDTH 1C2FA 1LVYA 2ZEBA 3QUMP 1XX9A 2ZFPH 4GVUA 3M5NA 3D23A 7LPRA 5JB9S 3TLOA 1M9UA 2ZPSA 1HJAB 1O30A 1EX3A 1J17T 1D6RA 1ELBA 2A4RA 2B7DH 2CJIA 4GCHF 3VXFH 4KP0A 3NKKA 2P95A 1AVWA 2XTTB 5EQRA 1Y3WA 1L4DA 5DK1A 4CHAC 1MTWA 1TRYA 3M5LA 1TRNA 1SLVB 3F9GA 1UVTH 2QXIA 3QDZB 3ZYEA 1C5OH 2F4LA 3S0NA 4VGCC 4K69A 1V2KT 4X8VH 4X2YA 1QRWA 3M5OA 5DP8A 1F5RA 3PLBA 2P94A 2VNTA 4YOGA 2NWNA 1TNGA 4XFQA 1C9TA 1GCTC 2Z3DA 1Q3XA 1FUJA 4NIWA 4B6EA 1EQ9A 2ODYB 4IN2A 1ZSLA 2AIQA 3MH4A 3RXGA 1N8OC 3C27B 4YT7H 1C1MA 3ZZDA 1GBFA 1GVLA 5H4IB 2CF9H 2ZCLP 4WY3A 1O2YA 5HMAA 3PM3A 3AASA 1QL8A 1Q31A 5E0GA 3SNCA 3TNSA 3SYJA 3ATWA 1QA0A 1AGJA 1MU6B 1FDPA 1GHXH 3F6UH 3SV2H 5K0HA 2AH4X 1A5GH 2SGQE 3KL6A 3GCOA 3EA9A 3SU3A 1A1RA 2BM2A 2R2MB 2PR3A 4GPGA 1U6QA 4Z0KA 4ABIA 5JBTA 4CBOA 2ZCHP 2WINI 1RGQA 2Z3EA 1RIWC 4Q7ZA 1OXGA 1JRTA 2BXUH 3ATKA 3M37A 1ELTA 5E8EH 1PQ8A 2I6SA 1P3CA 1TBRH 3M3VA 1A0LA 2UWOA 1TX8A 2XNIA 2H5CA 4Y8ZA 1OOKB 1MMJN 4UFDH 2BY6X 1DANH 1ZPBA 1YP9A 4OS7A 1PQ7A 1O3LA 3T62A 2XBYA 2ZGBH 2C8WB 2Z9IA 4DCDA 4UD9H 1TB6H 3QN7A 1PPHE 4CH8B 3BG4B 2NU2E 3QLPH 1AD8H 3UREA 4KKDA 4UFEH 1NU9A 2HLCA 4RKOB 3A7VA 1Y5AT 1DWBH 4AB9A 3Q3YA 3QK1A 4XDEA 2Y81A 5EG4A 1ZTJA 2GZ9A 1ESBA 5EXNA 4YO9A 1XKAC 2GKVE 2XBVA 4Q7YA 1UTQA 1YPKH 1FY3A 1V2RT 1YM0A 2ZU4A 4TWWA 1BTYA 2BXTH 4FUEA 1MH0A 2O8MA 1O39A 3ZVEA 4I8JA 1P9SA 1GVKB 1O3HA 1C1OA 4K3JA 1SLXB 2ZCKP 2XWAA 4OS5A 1GGDC 1AKSA 3E91A 4HTCH 1BJUA 2PTNA 3ZYDA 4X6OA 4BNRA 4Y7AA 3IWMA 1F92A 2BD8A 2QC2A 1DWCH 3GYMA 3RXKA 2AERH 4JZIA 2ZFQH 2Y5HA 1OP2A 5C1XA 2WUCA 1DPOA 3ZZ7A 1TALA 2W7UA 3DA9B 2BX3A 2VIWA 1T8NA 3TJUA 2ZU5A 1CT2E 5DO4H 1YGCH 1G2MA 2H6MA 3RXCA 1A0JA 1UCYK 3BTKE 2WV4A 1AY6H 1IQEA 2WYJA 3VB3A 4YM9A 4IMZA 1P01A 4OS2A 5F8TA 2ZPQA 3RXHA 1O3OA 1TFXA 1LVMA 2BVXH 1NM6A 3PV2A 3T29A 5PTPA 1QY6A 5DPAA 5FCRA 3ZZ9A 3P70B 1J16A 5CMXH 1FMGA 4RN6A 1GBKA 1EAXA 1QJ1B 2DUCA 3U8RH 1ZMLA 1LVOA 1MKWK 3CP7A 4YTAA 3SNBA 1C1RA 3SI3H 2PGQB 1SFQB 2BTCE 5FXLA 2CV3A 4X1QU 3SJKA 3LH3A 1Z1JA 5FX5A 1P2KA 5L2ZH 3F68H 4UFGH 1O5EH 2BY8X 3ATIA 3RXJA 2XXLA 2A2QH 3V13A 4F4OC 4ABGA 1W13U 1FIZA 2GCHF 1GMDG 1A5IA 1SL3A 1JIMA 2FWWA 1UK2A 2GMTB 4D76A 1H8DH 1NRRH 1DSUA 1BMMH 1QBOA 2FODA 1MBQA 1K1NA 1AIXH 5L2YH 2P8OB 1PPCE 4UEHH 1DXPA 1IQJA 3M7TA 1O5BB 1WSSH 4LXBH 3MMGA 2D1JA 1ZHMA 1TPOA 3RU4D 1D3QB 3LGWA 2G00A 6ESTA 1ZMNA 1AN1E 1IOEA 1CVWH 1EOLA 1H4WA 3BIVH 2P59A 1BTPA 5DG6A 1HAZB 3V12A 3BTTE 4JK5A 3SUGA 1ZTKA 2QXJA
chains in the Genus database with same CATH superfamily
2FEQH 4Y6DA 1F0RA 2HNTF 1BMAA 3LJOA 1BZXE 2M5TA 4A7IB 2KCAA 2HRVA 3BIUH 2PP6A 1SR5C 1O5CB 5C2ZA 1NFWA 3LGTA 4AYYB 2BDCA 3RXOA 3F2GA 2DE8A 7KMEH 3LH1A 4DT7B 2R2WU 5FBEA 1GHZA 1BTWA 1EZXC 4ABAA 1FY1A 4K60A 1HPGA 3LC5A 2ZTXA 2HNTC 2KCYA 3UOPA 3MYWA 1P0SH 1EP5A 2XOKD 3OY6U 4FUHA 1DE7H 1ELFA 1E36B 2ZGHA 1GI9B 1ZLRA 3UIRA 3V3MA 1BQYA 2OXSA 3E90B 3KN2A 2O8WA 3A82A 1G3CA 1HYLA 3F1SB 5A2MH 4ISLA 2WZQA 2VIPA 4WF8A 4BTUB 2OC8A 3N99A 4AGKA 3A88A 2KM0A 4WJG2 2UUYA 4XSKU 4ISHH 1NTPA 3RXDA 2L74A 1O2JA 1HJ8A 2ZQ2A 1SHYA 5DP5A 2XRCA 2ZI2H 1GI2A 1MKXK 2PGBB 3M5MA 4CRBA 2V0BA 2PFEA 4CH2B 4DOQA 1GI0A 1ELCA 2A5AA 1JOUB 1O38A 5C94A 2J9NA 3PO1C 4IW4E 1AO5A 1HAIH 2LP6A 1XXFA 4NSYA 4BOHA 5A0AE 3A7TA 4Q2KA 1ANCA 2VB0A 5E0JA 2IN2A 2SGPE 5EW2H 3VGCC 1DFPA 4ZKOU 3OSYA 4Y76A 5GNDA 1PPGE 4TY7A 1ZYOA 1ZZZA 1GDUA 3U98H 1LKBA 1YWUA 5JDUB 3SW2B 2P8OC 1ZMJA 2ZHEH 1C2DA 2A7CA 2VGCC 4GCHG 1HIAB 2VVVA 3H7TA 1Z8RA 2FZZA 2V6NA 3EDXB 1C1VH 1FAKH 3L3TA 5C67A 4XOJA 2Z9LA 1HAGE 4I8KA 3MFJA 2XC4A 1UTMA 4NWKA 1MUEB 3RXVA 5HGGA 1W0YH 1O2NA 5CHBA 7ESTE 5KECA 2BZ6H 2Z6BD 1MZAA 1FXYA 1GMCF 3SU1A 1V2PT 3MTYA 2QF4A 1TONA 2D2DA 3QTVH 4A92A 1TGSZ 2NU0E 2ZNKH 4KTSA 1QB9A 2VVUA 3HKIB 3AW1A 4RKJB 3ZZ3A 1GHWH 2GDEH 1DDJA 2ZDMA 4NIXA 2FXRA 2Y80A 4Q4LA 4UONA 4I32A 2R3YA 3T25A 4HI3A 1DOJA 1ZGVA 2RCEA 1FPCH 5LPEA 5SGAE 1EAUA 1VJAU 1DX5M 1SGYE 4WH6A 1YF4A 2AEIH 3EA7A 3A7ZA 1TYNA 2EA3A 1HB0B 4JZEH 3SGQE 1FONA 1G30B 1XUIA 3DFJA 1LQDB 1C1UH 3PB1E 3SQHE 3A85A 4DY7B 4HGCA 1YLNA 1G3BA 1O3BA 1AE5A 1GI7B 1UVUH 3UAIC 2B8OH 1WBGB 2AYWA 1MBMA 3RXMA 1KIGH 2ZTZA 3ATMA 1AWHB 3VB4A 5JBBS 4E06H 2OC7A 1KDQB 5G4BA 3LGYA 3A81A 1QJ6B 1QL9A 1LTOA 1GDNA 1KLIH 1TE0A 3RDZA 3UNQA 1A2CH 1AUJA 1EPTB 1G37A 1G2LA 2PTCE 2OLGA 2Z3CA 1BRBE 2BZAA 3RMOH 4UDWH 1BMFD 1WCZA 4DIHH 1B7XB 1DLKB 1UVPA 2OQ5A 2PHBA 2Y7ZA 4Y0ZE 1QBNA 1C5YB 4X1SU 3UR6A 3Q00A 4KELA 1V2WT 2A4OA 1BJVA 2PSXA 3LJJA 4XRNA 2ZF0H 1LPKB 1AU8A 1W7GH 5GJ4B 4X1RU 4ZAEA 1O37A 3LGIA 1F0UA 1HLTH 3C1KA 1ZSJA 3F2HA 1O2SA 5C0TA 2XC5A 1TGNA 1MQ6A 8GCHF 1NESE 1PPFE 1KSNA 4DJZB 3D62A 4BAOB 4LOYH 5EU8A 2Z9GA 5CHAB 1OSSA 4BAMB 1O3NA 2R3UA 3MU0A 1K0HA 3QWCH 2BQ6B 1EP6A 3UNRA 3MU8A 1C5PA 2PW8H 2G81E 1GBHA 1ZPCA 3FZZA 1KLJH 3SV7A 5C0UA 5DP9A 1D3DB 1GI6A 1Z8JB 1O2UA 1CO7E 1P9UA 2JH6D 5I25A 1HAPH 1LHDH 2ZHWH 1ZGIA 1YPGH 3RP2A 3P8FA 5J4SA 4YT6H 3SNAA 1P05A 1C5XB 3RXBA 4ABHA 4AC9A 1G32B 3GCNA 2QGRA 4ABJA 4WMEA 1GBMA 4OS6A 3S7HB 1PQAA 1SBWA 2XCNA 4X6MA 1T31A 2BD7A 2VH0A 1O2QA 1RFNA 3QO6A 5IK2D 2PKAB 5T3HA 1YC0A 3Q76A 4X8UH 2CHAC 2HALA 5GDSH 2GGVB 1ETRH 2O8TA 2VWLA 2THFB 4XBCA 1TLDA 1C4V2 3GY6A 3KQBA 1C5ZB 1GI1A 1S84A 4A1TA 1W12U 1BUIA 2FOCA 2M2AA 1C2HA 3MNBA 1IQMA 2ZP0H 4FUJA 1EUFA 3B9FH 2F83A 2G55A 1GDQA 1P2JA 1ELAA 1DSTA 1GJDB 2AFQB 2QF0A 3F3BA 2BDIA 1FY8E 2J94A 1J14A 5A0BA 2KZ4A 2QY0B 2XW9A 1QR3E 2BQ7B 1FPHH 3MO3A 1FI8A 6CHAC 4MPWA 2F9NA 3MU5A 3EYDA 3RXSA 2XYAA 1B5GH 1P11E 5GIBA 2FS9A 1TWXB 2R0KA 1YPEH 2STAE 2WYGA 2P3FH 1T32A 4ISOA 1WV7H 4D7FA 4WXIA 1Z1IA 4OS4A 3QGJA 3IG6B 3RMLH 3GICB 1UW7A 2A31A 3RUOA 2V3OH 3ZIAD 1HAYB 2WV9A 4FUBA 4B74A 5TCAA 1YPHC 4FXGH 1VITH 4UFFH 4D8NA 4DIIH 1C2IA 1JIRA 1Z8IB 3BTEE 1F2SE 4YZUA 2CN0H 1KYNA 3P92A 2JDID 5EXMA 1BRAA 1UCYE 2Z9KA 4R0IA 1T8MA 1K1LA 2BX4A 2O9QA 3MH5A 1L2EA 4WH8A 7GCHF 4NA9H 3NUMA 3B8JA 1WQSA 3B23B 1ZHPA 2AMDA 3UOUA 1ELGA 2BDYA 2EQNA 2TGAA 1UMAH 1O33A 2BD4A 4I8GA 1IHTH 1W8BH 1IHSH 3M7UA 1WU1A 2PKSC 2QYIA 1C9PA 3JZ1B 3TJOA 1V2TT 1FV9A 2OINA 1ZTLA 1S6LA 1DLEA 2EI7A 3R0FA 1O3EA 1HAVB 4FUDA 1QGFA 3BG8A 3TNTA 1QB1A 3PROA 2BD3A 1CBWC 4MVNA 3MU4A 5C5OA 4X6PA 3BSQA 4Z6AH 4TWYA 1WTHD 2D26C 2L6OA 5ESTE 1V2VT 1SGNE 1YLCA 2OTVA 2ZDLA 1QIXB 2VIDA 5E2PA 1XUKA 3T5FH 1AMHA 2KCPA 1YCPH 4GAWA 2J98B 3ZVAA 3LKWA 1TBQH 3GY7A 4F49A 4B73A 4IGDA 1P2MA 2FTLE 1QRZA 5B6OA 1TX6A 1OWKA 2FLBH 2ANKH 1KXFA 3T26A 1BDAA 1GJCB 3AAUA 3PLKA 3RXUA 1EATA 3PTNA 1HCGA 4JCNA 2XBWA 1KLTA 3SJ8A 1MTNC 1GMHF 5F53A 1C1PA 1MTUA 1UK3A 1JMOH 3PMHB 1O3CA 1AZ8A 3RU4T 1C5QA 1O31A 3OYPA 4CRAA 2C8ZB 4A6LA 2ZO3H 4NFFA 1ZPZA 3KYGA 3BTHE 1BCUH 4ZROA 1XUHA 3F9FA 1YPMH 1P12E 1HIAA 1O2PA 4MNWA 1ACBE 4FOUC 3SUFA 1HJAC 1GMCG 3RMMH 3W94A 5E2OA 3KQCA 4BXWA 1AHTH 5DKMA 1FQ3A 5DJ7A 5GXPA 3SI4H 1O3AA 1BBRE 4K1EA 2QE7D 3A83A 2W5EA 2WPKS 1Z6EA 4ZH8A 5FL7D 1GHAG 4BAKB 3GCHB 1N1LA 2HPPH 4DURA 3SU4A 3OTPA 1C5VA 4MPVA 1C5UA 1LQEA 3S69A 1BRCE 1QHRB 2STBE 4DW2U 4D9RA 3RMNH 2QCYA 1NFUA 2UUKB 4P02A 4ZUHA 5AFYH 3MO6A 5AF9H 1QBVH 1SGRE 4ACBA 1YKTA 4ZHLU 3BF6H 1FLEE 1O3FA 2GZ7A 1HBTH 2G51A 3SZNA 9ESTA 3S9BA 1A61H 1S82A 1DUAA 2H9EH 3H09A 5HXFA 3KQEA 3MO9A 1PFXC 3ZVDA 4F55A 2F9VA 1ZJKA 2BMGB 1TX7A 3MNSA 4AOQA 4MLFB 3U8TH 5EW1H 2ZKSA 3G01A 4AYVB 1KTSB 5DP3A 4X2WA 1Z71A 3W1EA 1O2KA 5AHGH 4BAQB 1KXEA 3FO8D 1CA0B 2J34A 3A8BA 2GV7A 3K2UA 4K2YA 4ZKSU 4WXVA 3OTJE 2IOTA 1SQTA 4BAHB 4E7RG 2LELA 3RXFA 3WY8A 1ELEE 5EPYA 2F9OA 3UUZA 4O03A 5EQSA 1EPTA 5F8XA 1O2WA 3LIWA 2JJ2D 3MNCA 2WPJS 1NT1A 2FI3E 3DCLA 1TPAE 2A5KA 3RXLA 4JK6A 3UR9A 2KAIB 4WVPE 2NU4E 3BG4C 2GCTB 4ZMAH 1RTLA 2ALVA 3QGNB 1Y3XA 8GCHG 3RM2H 2BY5X 5JYIA 4QT8C 3F0OA 1YPLH 1P09A 1B0FA 1FZZA 4H4FA 3A7WA 1E1QD 1BB0B 1BHXB 4NSVA 2CGAA 2JH5D 4OGYA 2UWLA 4X6NA 1P03A 3O8DA 3SU0A 1HAOH 1MD7A 1NBMD 3DSOA 2BDHA 3OAAD 3T28A 3F0PA 2C8XB 2Q6GA 1CA8B 2BLQA 1O3KA 1D3PB 3GCHC 2W3IA 5C20A 3KYFA 1TGCA 3E6PH 1MZDA 2VBCA 3STJA 2LPRA 2ILNA 4GHTA 3ZZ4A 2C4FH 1J8AA 1SFIA 4FU9A 1VZQH 2TBSA 1IQGA 3BN9A 4TY6A 3SJ9A 1JXPA 2PWXA 2BLVA 1O2TA 1T8OA 4X2VA 1ETTH 1QURH 1UTKA 2BD2A 2VU8E 3AAVA 2J5UA 5CE1A 1S0RA 3BEUA 3OY5U 3TH4H 3E3TA 1PPBH 3SUDA 1TNLA 3BV9B 1O3DA 2F9BH 2V3HH 4INLA 2AGEX 5EIYA 3L6PA 1IAUA 3HKJB 2B9LA 5EXLA 1ANBA 3HK6B 1P2QA 1VGCB 1C1WH 3MH6A 2PKAA 3PLPA 1P06A 2KFWA 1ZOMA 2HNTE 1HAXB 4U32A 2G52A 1RTKA 1O2RA 1CA0C 2EY4C 3D65E 4NA7A 2FM2A 1C5RA 3U8OH 2BDAA 2PSYA 5TJXA 4I31A 1UTPA 2WPIS 3KIDU 3DSGA 2BLOA 4ASUD 1RRKA 1SPJA 2QN5T 4XE4A 3M7QA 2W6ID 3FAOA 4JZDH 4Y71A 3CNRA 3TVJB 4B1TA 5HKKD 5F8ZA 1CHOG 3RXEA 3FN8A 2HLDD 3KHVA 3PMBB 1FY4A 3A89A 4DVAU 2FTMA 1YLDA 3ZZ5A 2GJGA 2ZZUH 4PROA 3TGKE 2GMTC 3OX7U 1P8VC 1O5AB 2WV5A 3M35A 4IN1A 1QQ4A 1GBBA 2GDDA 3ODFA 4RI0A 1Z8GA 1J15A 3GY3A 3LGUA 3ZV9A 2ZGCA 1GWAA 3PV5A 4Y79A 1O2XA 2A5IA 1HUTH 2H1UA 3DT0H 1D4PB 5HYOA 1AVXA 1OWEA 1SI5H 2NU3E 3TK9A 5EGMA 4U2WA 4NIVA 2UUFB 4ACAA 1G9IE 2GT8A 2JETB 2ZFSA 1MCVA 7GCHG 9LPRA 3URDA 4HG6A 1P02A 1K2I1 3LU9B 1ELDE 3HK3B 1AB9B 2TPIZ 4MNYA 1TAWA 2RG3A 3GDVA 3SNEA 2ZQ1A 5F6MA 1ZR0A 1TPSA 1EXFA 2QXGA 3FP7E 3L33A 1BMNH 4B76A 2FX4A 1V2JT 1VITF 1GHAF 1LCYA 4GUXA 3E0NB 3LOXA 3QX5H 5LH8A 2AGGX 3SV6A 2OC0A 5FAHA 1BRUP 4NZQA 1AKSB 1SVPA 2FO9A 5TCCA 3TU7H 5C3NA 2V7QD 4D7GA 3SJOA 3JZ2B 1FN8A 1GG6B 3K65B 1N6YA 5FPTA 1VGCC 1HGTH 2VJ1A 3MOCA 3OFND 1HXFH 4ZXYH 3GY2A 1XXDA 5C1UA 4YESB 1AWFH 1HAVA 3CENA 4I86A 3ELAH 1P3EA 1IQFA 1VCPA 1HFDA 1UTJA 1Y8TA 4B6FA 2DE9A 1DY9A 3DSPA 3EAJA 2BLWA 1KTTB 3GY5A 1KXDA 1O2MA 5FPYA 2G4UA 4CREA 2GD4B 1E0FD 2QAAA 1TIOA 3OEED 2TGPZ 3LDXH 1LO6A 4GHQA 5JBCS 2FPZA 2Z94A 2FX6A 3ZZ6A 3PMAB 2ANYA 1KXAA 2G5NA 2W7SA 4BANB 4AX9H 5C5NA 1CHGA 1GMHG 1TGBA 1A3EH 1O2OA 4FU7A 3NRLA 1OS8A 2P3TB 4ISIH 3P6ZB 1PYTD 1JWTA 1SGCA 4OS1A 2LNCA 5DP7A 1CT0E 2BY7X 1A4WH 1QTFA 5FBIA 4A1XA 4B71A 1EASA 2OUAA 3E0PB 3ZZCA 1YYY1 1ZJDA 4CRGA 5T6FA 2XWBI 3KNXA 2ZU3A 1MTVA 1OHHD 1LPZB 2BOKA 4GSOA 1SC8U 1CSOE 2IJD1 4BXSA 1GBDA 5FX6A 1VKYA 4E7NA 2F3CE 2JIZD 2GT7A 1O5DH 4CR9A 2VIQA 4E05H 2YOLA 3FANA 4NIYA 2JETC 4MG3A 1IQIA 1OWHA 5JPMH 4TSFD 3LT3A 4LZ4B 2H2ZA 2H9HA 3U69H 4HZHA 1UHBB 4ESTE 1UVOA 1EJNA 4WMFA 4ZHAA 3ZVGA 1GI4A 3GISB 5ABWA 2ZTYA 2Z9JA 3ESTA 1E38B 1TA6A 2VWMA 3VB6A 1GBIA 1HNEE 3HGNA 3ZVCA 3D49H 4B75A 4X2XA 5AVDA 3PWBA 2W26A 2QIQA 3Q3XA 1SGPE 2R9PA 1VCQA 1CGJE 2ZDVH 4AFQA 3M61U 1G36A 1C2JA 2IPHA 1EOJA 3RXIA 1NPMA 1MAXA 4I8HA 4NFEA 5A09A 1JRSA 1QCPA 4A5TS 3E8LA 2VIOA 1O3JA 3SHAH 1PPZA 2ZWLH 1UTLM 4CHAB 4JZ1A 4JMYA 2FOEA 1IQHA 1GL0E 1B0EA 3SV8A 4AG1A 4MNXA 3SU5A 3K9XB 1MD8A 1NFXA 2RA3A 1FJSA 2J95A 1FNIA 2BHGA 2ZA5A 4VGCB 4IC6A 2FI5E 1AE8H 2XCFA 1GBTA 1K1PA 1WUNH 2Q6FA 3E16B 2FOFA 1TQ7B 5FHTA 1C1QA 4O97A 2B0FA 3GY4A 3SHCH 1N8OB 3FP8E 1QFKH 1DVAH 2YNAA 2RDEA 1EZSC 1EAIA 1EPTC 5LPRA 2GX4A 1C5NH 3GOVB 1SQOA 1ZSKA 3SU6A 1TGTA 3RU4E 5EPNA 1WQVH 3RXPA 1CQQA 1UVSH 2PLXA 3UWJH 4ASHA 3A86A 2A4GA 4YOJA 2V3MA 1TNHA 1OPHB 1ESAA 4I7YH 1UK4A 1GHBF 1XM1A 3RXTA 3F2FA 5LPFA 4AGJA 1ANEA 2ANMH 1O3IA 1C5SA 4R8TB 1NRSH 1RIWB 1FAXA 1CHOF 5I46H 2KAIA 4FVDA 2CMYA 3MU1A 2ZG0H 1A5HA 1H9IE 3NXPA 4X8TH 1SOTA 1Q2WA 1C5TA 1TOMH 1L1GA 1VR1H 3SNDA 1BTZA 3RC5A 1RJXB 2F43B 1SGFA 4Q7XA 2ANWA 3SGAE 1BT7A 1C4Y2 1AVGH 5CHAC 3T27A 5EODA 1AQ7A 3VG8A 2K1QA 2RA0A 4IMQA 4J1YA 2WPHS 1Y3YA 3P8OA 2OC1A 1HV7A 2VWNA 4H6SB 2FDAA 1SQRA 6GCHF 1SGDE 2ZHQH 1NRQH 1EKBB 4X1PU 1YPHE 1S0QA 3QZQA 1J9CH 1ID5H 2VVCA 2ODQA 2F9UA 4Y8YA 2OBQA 5K7RA 2FOGA 4LZ1H 1CE5A 1W10U 1K28D 1LKAA 1P2OA 3PYHA 3UFAA 1WOFA 1XVMA 3A8CA 1OP0A 4Y7BA 3GDSA 1V2ST 2C93B 1QZ8A 4I8LA 2JJ1D 1BOQA 3U1JB 1YCPK 2BDGA 2FMJA 4AORA 1THSH 2HPQH 4K8YA 3S7KB 1GGDB 1T4UH 1LMWB 1DUEA 3ZVFA 4NCYA 2QV1A 1H8HD 1HXEH 3I78A 4CBNA 5EJZA 1TNIA 3ZV8A 2BQWB 1T4VH 4D9QA 1QL7A 1O2ZA 2AMPA 1FIWA 2G5VA 1F7ZA 1TQ0B 4X1NU 5T6GA 1TNJA 1ABIH 1SGQE 2QA9E 1GBJA 1SGFG 3KEEA 1GI3A 4A1VA 1C1NA 5DSFA 4TYDA 4ABFA 1AUTC 3S9AA 4NA8A 3VXEH 1AZZA 3ZZBA 3UB0A 3P95A 4ISNA 1G3EA 2W6JD 3Q77A 1C2MA 1TA2A 1Z7KA 3SUEA 3P8GA 3A87A 3U1IB 1GJ6A 3P8NA 2BD5A 3GYLB 1V2OT 2A2XH 2VWOA 2EI8A 4B2AA 2PUQH 2ZHDA 4IC5A 2V35A 2GV6A 2SNVA 4MTBA 1A7SA 4O3UA 3H7OA 3MNXA 4YLQH 3LONA 3TGIE 1O34A 4SGBE 4AFUA 3AK5A 1O2GH 1YBWA 3A8AA 2P93A 1WXRA 2FP7B 1INCA 2AMQA 2FOMB 1O36A 3TITA 1S6FA 3UQOA 1KY9A 4ABDA 3AW0A 3UQVA 1H9LB 2A7JA 3V0XA 2A1DB 1DY8A 4KGAA 2J38A 1GJAB 2O8LA 1O32A 1VITG 1D6WA 2O8UA 1T8LA 1N6XA 1UJ1A 3O8RA 1P2NA 3UWIA 2H5DA 3PRDA 2VH6A 2TIOA 1TABE 1GJ7B 3OU0A 3A7YA 1OYTH 1ELVA 1GHYH 3EA8A 1NFYA 2Y7XA 1YCPM 1QNJA 4XBBA 2HVXA 1GCDA 1OWIA 1GBEA 1EZUC 1BMLA 1DM4B 2H9TH 4FUGA 2FOAA 5A8XA 3I29A 1MCTA 1O3GA 3SQEE 2XBXA 5DP4A 1AFQB 3TJNA 3BTGE 4FVBA 2A7HA 1PYTC 1FY5A 1V2MT 1W0ZU 3URCA 1LHFH 3BTDE 5IDKA 1O2VA 3WW7A 1QA7A 1QJ7B 2FS8A 3HATH 1THRH 1ARCA 3NWUA 2JKHA 2J4IA 3SOSA 2OP9A 3V7TA 4AFZA 1LPGB 3BTQE 1EJAA 1TMTH 3E1XB 2ESTE 4YLUA 2CF8H 2ZDKA 1HJ9A 1T7CA 2QXHA 4HFPB 2BOHB 1CT4E 3RLWH 1GJ5H 3SU2A 4MDSA 1C2EA 2P16A 2WHXA 2ZGJA 5IYTA 4Y11E 1E35B 2P3UB 4RSPA 2ZU2A 1PJPA 3UY9A 1S83A 3LC3A 1KDQA 1C1TA 2GZ8A 3GCTF 2SGEE 3ODDA 5F03A 3VFEA 2OCVB 1V6DA 2SNWA 4TT3D 4NG9H 8KME2 5KGOA 1NRNH 1G3DA 2FI4E 3EGKH 3TIUA 1YY3A 1C4U2 1HRTH 1Y3VA 4K1TA 4X0WU 3A80A 5AFZH 1UCYH 1EAWA 1WYKA 3NK8A 2C8YB 1X7AC 1NS3A 3PO1B 4Z1MD 2C90B 2PUXB 4JYUH 1O35A 3BTFE 4BTTB 1V3XA 1GI5A 3I77A 4B2BA 4RT1A 1NZQH 1TOCB 2Y5FA 3O8BA 4MPXA 5BPEA 3RLYH 1SOZA 4Q80A 3TH2H 3OEHD 1FN6A 5GCHG 2BY9X 1ABJH 2ZFTA 3VGCB 1GVZA 3Q3KA 3AVZA 1Z6JH 4K5ZA 3VEQB 3KQDA 4AG2A 1MKWH 2Z7FE 4CRCA 1UHBA 2VGCB 2G8TA 4AFSA 5J4QA 1S6HA 1IQKA 1LHEH 1XUGA 2WPLS 3LGVA 1GHVH 1F5KU 4MQAA 3FVFB 6LPRA 1UTOA 1XUFA 1WTGH 4H42U 5DP6A 2NU1E 8LPRA 1MTSA 2BB4A 1AFQC 1TBZH 4FU8A 1W2KH 1W7XH 1LVBA 1OWJA 1GJ9B 1O2HA 1A0HB 2ZU1A 3NZIA 1SG8B 3BTME 3TJVA 1BITA 4P00A 1W3CA 4ZKNU 2AGIX 3DFLA 1JBUH 1LHGH 3CS0A 2FOBA 1K9OE 3K6YA 5L6NH 1HAHH 4Y10E 1E79D 1QRXA 3SJIA 3IITA 3MQKC 2SFAA 3QTOH 1NRPH 1P04A 3ITIA 4K1SA 4FUIA 2KX4A 2GTBA 1BBRK 1EJMA 2HVYB 4OGXA 1Y59T 3A7XA 4NGAH 4Y0YE 2ZECA 1GBCA 1PQ5A 4BTIB 1CGIE 1H1BA 1OP8A 4GLYA 5BRRE 3NCLA 1C1SA 2CXVA 2BVSH 3M3TA 2A45B 1OKXA 1P57B 3KF2A 1A3BH 4IBLH 4UE7H 1GHBG 2HOBA 4ABBA 1SHHB 1YPJH 3F9HA 2FYQA 4YXWD 2ALPA 1S81A 1MU8B 2W3KA 2SGDE 2HWLB 1BHXF 1GJ8B 1F0SA 1TPPA 3ZZ8A 1BBRH 2Y5GA 4TPYA 2GCTC 2VINA 1DICA 1K22H 3PRBA 1VCWA 1CGHA 1O5FH 2GP9B 4DG4A 2R0LA 1O3PB 2EC9H 4F48B 1PPEE 5C1YA 1C5WB 1MAYA 5E0HA 1ESTA 5KEDA 2ZC9H 3KGPA 2XC0A 4O3TA 1DS2E 1SQAA 3FFGA 3FP6E 4I33A 1GL1A 2BYAX 1OX1A 1O2LA 2K0QA 3UTUH 1L1JA 1RTFB 1SLUB 1V2NT 6GCHG 1AFEH 3SZEA 1SB1H 2D8WA 3EE0B 1EB2A 1MKXH 1V2UT 4AN7A 4TPIZ 1XUJA 3MHWU 4M7GA 1DT2A 3QZRA 1C2GA 2ZFFH 3A84A 2FIRH 4RT0A 2ODPA 4ABEA 1EB1H 1ETSH 2BVRH 2WUBA 5EJLA 3RC4A 5HM2A 1COWD 4B2CA 2FOHA 5GPIB 3H5CB 3GY8A 1E37B 1BIOA 1RD3B 4U01A 1NN6A 2TRMA 1ZHRA 3DHKH 2I6QA 1K1IA 2YMSB 2WPMS 1ANDA 1EZQA 4NZLA 2FYRA 1S85A 1A46H 1NY22 1RS0A 2TGTA 4JYVH 5B6LA 4O9VA 4KTUA 2QF5A 4CRDA 1V2LT 2HGTH 4XBDA 1F5LA 3EQ0H 3LPRA 2Q6DA 3KQ5A 2EEKA 1O0DH 1XKBC 3ATLA 4KTCA 4X8SH 1GJ4H 1O5GH 2JH0D 1L1NA 2KR7A 2WSSD 4XD7D 5A0CA 1GI8B 2ZFRH 4K8BA 1TMUH 2ZDAH 1H9HE 1FX0B 1GBAA 2A4QA 1TMBH 2J98A 1NC6A 4AB8A 2CHAB 3T2NA 3TGJE 4FUFA 1C5LH 3OE7D 5EQQA 3PTBA 1SMFE 1SSXA 3SBKA 5EJ1A 2OQUA 1DWEH 2IJOB 1ZRKA 4H6TA 5L30H 1IQLA 1TRMA 1C2KA 1C2LA 2ZPRA 3TK6A 1D9IA 1O2IA 1QQUA 4CR5A 1TNKA 3RXQA 4U30A 3PV4A 3NPSA 2YNBA 2J92A 3UPEA 3SGBE 2SGFE 2OD3B 2UWPA 3RC6A 4Y8XA 3M36A 3TH3H 5LGOA 1K1OA 1QB6A 1VJ9U 3VB7A 3STIA 1WAYB 5GWZA 3PWCA 5ETXA 5T6DA 1L4ZA 1E34B 4INHA 1UO6A 3MWIU 2ZGXH 5HIZA 3U9AH 1Y5UT 2A0QB 3A8DA 1H8IH 1NO9H 6CHAB 3RXRA 3O8CA 3ZZAA 3TPIZ 4M9FA 1RXPA 3RXAA 3HGPA 1W11U 2FESH 3ENSB 1AB9C 1CU1A 1AI8H 4NWLA 2UUJB 3FKSD 2XNDD 1UTNA 1BTUA 1GJBB 4ZHMU 5GCHF 1Y3UA 1W14U 1S5SA 1GMDF 3BEIB 2F9PA 3SV9A 1ZRBA 1O3MA 1IQNA 1BTHH 1C5MD 2ASUB 4ZXXH 2GVFA 1SGEE 4CRFA 2CK3D 2SGAA 2ZHFH 2BDBA 1L0ZA 2Q1JA 2YMSC 2B5TB 4ZKRU 2VIVA 2AHME 2OK5A 1GG6C 1THPB 4FUCA 1V2QT 3SORA 1F0TA 1SGIB 1Y5BT 1NU7B 3R3GB 3RM0H 1MQ5A 3FZDA 1P10A 2ZDNA 4JYTA 3VPKA 3CS7A 5A8YA 1SGTA 4THNH 2Y82A 2AIPA 2G4TA 4SGAE 4JZFH 1SLWB 1WDIA 1OYQA 3SN8A 1K1JA 2PKSB 2F91A 3TK5A 1GCTB 5A8ZA 1XMNB 1LDTT 3GCTG 5FPSA 3DUXH 2EI6A 4YOIA 1DXWA 3BTWE 3ZVBA 1SKYE 3GDUA 4WWYA 1GPZA 3MI4A 3N7OA 3P17H 2QF3A 1CBWB 1ARBA 2C3SA 2RDLA 2PV9B 1NBME 3MH7A 2BD9A 1BTXA 4AZ2B 4DGJA 5JB8S 3HPTB 5T1VA 4IS5A 1K1MA 1K21H 1H8ED 8ESTE 1P2IA 2ULLA 1D3TB 1DWDH 2ZIQH 2FLRH 3S9CA 2TGDA 4WMDA 2Y6TA 4INKA 2GCHG 3K6ZA 4OM9A 1OWDA 3M3SA 3VB5A 5HM9A 1LHCH 3F9EA 5JBAS 1NROH 1W0JD 5HIYA 3KCGH 2A32A 4J2YB 1KXBA 3SO3A 5ESBA 1MTNB 1BA8B 5EOKA 4FETA 3BEFB 1DITH 1XVOA 2J2UA 2OBOA 5DGJA 3UNSA 5FCKA 1ORFA 4MPUA 4LK4A 3DD2H 4MNVA 3PMJA 2AS9A 1KXCA 1GBLA 3W95A 1HDTH 1C2FA 1LVYA 2ZEBA 3QUMP 1XX9A 2ZFPH 4GVUA 3M5NA 3D23A 3U28C 7LPRA 5JB9S 3TLOA 3N7EA 1M9UA 2ZPSA 1HJAB 1O30A 1EX3A 1J17T 1D6RA 1ELBA 2A4RA 2B7DH 2CJIA 4GCHF 3VXFH 4KP0A 3NKKA 2P95A 1AVWA 2XTTB 5EQRA 1Y3WA 4DT4A 1L4DA 5DK1A 4CHAC 1MTWA 1TRYA 3M5LA 1TRNA 1SLVB 3F9GA 1UVTH 2QXIA 3QDZB 3ZYEA 1C5OH 2F4LA 3S0NA 4VGCC 4K69A 1V2KT 4X8VH 4X2YA 1QRWA 3N7DA 3M5OA 5DP8A 1F5RA 1KMHB 3PLBA 2P94A 2VNTA 4YOGA 2NWNA 1TNGA 4XFQA 1C9TA 1GCTC 2Z3DA 1Q3XA 1FUJA 5DN6D 4NIWA 4B6EA 1EQ9A 2ODYB 4IN2A 1ZSLA 2AIQA 3MH4A 3RXGA 1N8OC 3WWFA 3C27B 4YT7H 1C1MA 3ZZDA 1GBFA 1GVLA 3EE7A 5H4IB 2CF9H 2ZCLP 3WWBA 4WY3A 1O2YA 2KCOA 5HMAA 3PM3A 3AASA 1QL8A 1Q31A 5E0GA 3SNCA 3SYJA 3TNSA 3ATWA 1QA0A 1AGJA 1MU6B 1FDPA 1GHXH 3F6UH 3SV2H 5K0HA 2AH4X 1A5GH 2SGQE 3KL6A 3GCOA 3EA9A 3SU3A 1A1RA 2BM2A 2R2MB 2PR3A 4GPGA 1U6QA 4Z0KA 4ABIA 5JBTA 4CBOA 2ZCHP 4Q63A 2WINI 1RGQA 2Z3EA 1RIWC 4Q7ZA 1OXGA 1JRTA 2BXUH 3ATKA 3M37A 1ELTA 5E8EH 2WPDD 1PQ8A 2I6SA 1P3CA 1TBRH 3M3VA 1A0LA 2UWOA 1TX8A 2XNIA 2H5CA 4Y8ZA 1OOKB 1MMJN 4UFDH 2BY6X 1DANH 1ZPBA 1YP9A 4OS7A 1PQ7A 1O3LA 3T62A 2XBYA 2ZGBH 2C8WB 2Z9IA 4DCDA 3FOAA 4UD9H 1TB6H 3QN7A 1PPHE 4CH8B 2IPQX 3BG4B 2NU2E 3QLPH 1AD8H 3UREA 4KKDA 4UFEH 1NU9A 2HLCA 4RKOB 3A7VA 2RFKC 1Y5AT 1DWBH 4AB9A 4ZCNA 3Q3YA 3QK1A 4XDEA 2Y81A 5EG4A 1ZTJA 2GZ9A 1ESBA 5EXNA 4YO9A 1XKAC 2GKVE 2XBVA 4Q7YA 1UTQA 1YPKH 1FY3A 1V2RT 1YM0A 2ZU4A 4TWWA 1BTYA 1W0KD 2BXTH 4FUEA 1MH0A 2O8MA 1O39A 3ZVEA 4I8JA 1E1RD 1P9SA 1GVKB 1O3HA 1C1OA 4K3JA 1SLXB 2ZCKP 2XWAA 4OS5A 1GGDC 1AKSA 3E91A 4HTCH 1BJUA 2PTNA 3ZYDA 4X6OA 4BNRA 4Y7AA 1EFRD 3IWMA 1F92A 2BD8A 5CDFE 2QC2A 1DWCH 3GYMA 3RXKA 2AERH 4JZIA 2ZFQH 2Y5HA 1OP2A 5C1XA 2WUCA 1DPOA 3ZZ7A 1TALA 2W7UA 3DA9B 2BX3A 2VIWA 1T8NA 3TJUA 2ZU5A 1CT2E 5DO4H 1YGCH 1G2MA 2H6MA 3RXCA 1A0JA 2K8IA 1UCYK 3BTKE 2WV4A 1AY6H 1IQEA 2WYJA 3VB3A 4YM9A 4IMZA 1P01A 4OS2A 5F8TA 2ZPQA 3RXHA 1O3OA 1TFXA 2YMSD 1LVMA 2BVXH 1NM6A 3PV2A 3T29A 5PTPA 1QY6A 5DPAA 5FCRA 3ZZ9A 3P70B 1J16A 5CMXH 1FMGA 4RN6A 1GBKA 1EAXA 1QJ1B 2DUCA 3U8RH 1ZMLA 1LVOA 1MKWK 3CP7A 4YTAA 3SNBA 1C1RA 3SI3H 2PGQB 1SFQB 2BTCE 5FXLA 2CV3A 4X1QU 3SJKA 3LH3A 1Z1JA 5FX5A 1P2KA 5L2ZH 3F68H 4UFGH 1O5EH 2BY8X 3ATIA 3RXJA 2XXLA 2A2QH 3V13A 3GS9A 4F4OC 4ABGA 1W13U 1FIZA 2GCHF 1GMDG 1A5IA 1SL3A 1JIMA 2FWWA 1UK2A 2GMTB 4D76A 1H8DH 5C17A 1NRRH 1DSUA 1BMMH 1QBOA 2FODA 1MBQA 1K1NA 1AIXH 5L2YH 2P8OB 1PPCE 4UEHH 1DXPA 1MABB 1IQJA 3M7TA 1O5BB 1WSSH 4LXBH 3MMGA 2D1JA 1ZHMA 1TPOA 3RU4D 1D3QB 3LGWA 2G00A 6ESTA 1ZMNA 1AN1E 1IOEA 1CVWH 1EOLA 1H4WA 3BIVH 2J97A 2P59A 1BTPA 5DG6A 1HAZB 3V12A 3BTTE 4JK5A 3SUGA 1ZTKA 2QXJA
chains in the Genus database with same CATH topology
2FEQH 4Y6DA 1F0RA 2HNTF 1BMAA 3LJOA 1BZXE 2M5TA 4A7IB 2KCAA 2HRVA 3BIUH 1SR5C 1O5CB 5C2ZA 1NFWA 3LGTA 4AYYB 2BDCA 3RXOA 3F2GA 2DE8A 7KMEH 3LH1A 4DT7B 2R2WU 5FBEA 1GHZA 1BTWA 1EZXC 4ABAA 1FY1A 4K60A 1HPGA 3LC5A 2ZTXA 2HNTC 3UOPA 2KCYA 3MYWA 1P0SH 1EP5A 2XOKD 3OY6U 4FUHA 1DE7H 1ELFA 1E36B 2ZGHA 1GI9B 1ZLRA 3UIRA 3V3MA 1BQYA 2OXSA 3E90B 3KN2A 2O8WA 3A82A 1G3CA 1HYLA 3F1SB 5A2MH 4ISLA 2WZQA 2VIPA 4WF8A 4BTUB 2OC8A 4AGKA 3N99A 3A88A 2KM0A 4WJG2 2UUYA 4XSKU 4ISHH 1NTPA 3RXDA 1O2JA 1HJ8A 2ZQ2A 1SHYA 5DP5A 2XRCA 2ZI2H 1GI2A 1MKXK 2PGBB 3M5MA 4CRBA 2V0BA 2PFEA 4CH2B 4DOQA 1GI0A 1ELCA 2A5AA 1JOUB 1O38A 2J9NA 3PO1C 4IW4E 1AO5A 1HAIH 4NSYA 1XXFA 4BOHA 5A0AE 3A7TA 4Q2KA 1ANCA 2VB0A 5E0JA 2IN2A 2SGPE 5EW2H 3VGCC 1DFPA 4ZKOU 3OSYA 4Y76A 5GNDA 1PPGE 4TY7A 1ZYOA 1ZZZA 1GDUA 3U98H 1LKBA 5JDUB 3SW2B 2P8OC 1ZMJA 2ZHEH 1C2DA 2A7CA 2VGCC 4GCHG 1HIAB 2VVVA 3H7TA 1Z8RA 2FZZA 2V6NA 3EDXB 1C1VH 1FAKH 3L3TA 5C67A 4XOJA 2Z9LA 1HAGE 4I8KA 3MFJA 2XC4A 1UTMA 4NWKA 1MUEB 3RXVA 5HGGA 1W0YH 1O2NA 7ESTE 5CHBA 2BZ6H 2Z6BD 1MZAA 1FXYA 1GMCF 3SU1A 1V2PT 3MTYA 2QF4A 1TONA 2D2DA 3QTVH 4A92A 1TGSZ 2NU0E 2ZNKH 4KTSA 1QB9A 2VVUA 3HKIB 3AW1A 4RKJB 3ZZ3A 1GHWH 2GDEH 1DDJA 2ZDMA 4NIXA 2FXRA 2Y80A 4Q4LA 4UONA 4I32A 2R3YA 3T25A 4HI3A 1DOJA 1ZGVA 2RCEA 1FPCH 5LPEA 5SGAE 1EAUA 1VJAU 1DX5M 1SGYE 4WH6A 1YF4A 2AEIH 3EA7A 3A7ZA 1TYNA 2EA3A 1HB0B 4JZEH 3SGQE 1FONA 1G30B 1XUIA 3DFJA 1LQDB 1C1UH 3PB1E 3SQHE 3A85A 4DY7B 4HGCA 1G3BA 1O3BA 1AE5A 1GI7B 1UVUH 2B8OH 1WBGB 2AYWA 1MBMA 3RXMA 1KIGH 2ZTZA 3ATMA 1AWHB 3VB4A 5JBBS 4E06H 2OC7A 1KDQB 5G4BA 3LGYA 3A81A 1QJ6B 1QL9A 1LTOA 1GDNA 1KLIH 1TE0A 3RDZA 3UNQA 1A2CH 1AUJA 1EPTB 1G37A 1G2LA 2PTCE 2OLGA 2Z3CA 1BRBE 2BZAA 3RMOH 4UDWH 1WCZA 1BMFD 4DIHH 1B7XB 1DLKB 1UVPA 2OQ5A 2PHBA 2Y7ZA 4Y0ZE 1QBNA 1C5YB 4X1SU 3UR6A 3Q00A 4KELA 1V2WT 2A4OA 1BJVA 2PSXA 3LJJA 2ZF0H 1LPKB 1AU8A 1W7GH 5GJ4B 4X1RU 4ZAEA 1O37A 3LGIA 1F0UA 1HLTH 3C1KA 1ZSJA 3F2HA 1O2SA 5C0TA 2XC5A 1TGNA 1MQ6A 8GCHF 1NESE 1PPFE 1KSNA 4DJZB 3D62A 4BAOB 4LOYH 5EU8A 2Z9GA 5CHAB 1OSSA 4BAMB 1O3NA 2R3UA 3MU0A 3QWCH 2BQ6B 1EP6A 3UNRA 3MU8A 1C5PA 2PW8H 2G81E 1GBHA 1ZPCA 3FZZA 1KLJH 3SV7A 5C0UA 5DP9A 1D3DB 1GI6A 1Z8JB 1O2UA 1CO7E 1P9UA 2JH6D 5I25A 1HAPH 1LHDH 2ZHWH 1ZGIA 1YPGH 3RP2A 3P8FA 5J4SA 4YT6H 3SNAA 1P05A 1C5XB 3RXBA 4ABHA 1G32B 3GCNA 2QGRA 4ABJA 4WMEA 1GBMA 4OS6A 3S7HB 1PQAA 1SBWA 2XCNA 4X6MA 1T31A 2BD7A 2VH0A 1O2QA 1RFNA 3QO6A 5IK2D 2PKAB 5T3HA 1YC0A 3Q76A 4X8UH 2CHAC 2HALA 5GDSH 2GGVB 1ETRH 2O8TA 2VWLA 2THFB 4XBCA 1TLDA 1C4V2 3GY6A 3KQBA 1C5ZB 1GI1A 1S84A 4A1TA 1W12U 1BUIA 2FOCA 2M2AA 1C2HA 3MNBA 1IQMA 2ZP0H 4FUJA 1EUFA 3B9FH 2F83A 2G55A 1GDQA 1P2JA 1ELAA 1DSTA 1GJDB 2AFQB 2QF0A 3F3BA 2BDIA 1FY8E 2J94A 1J14A 5A0BA 2KZ4A 2QY0B 2XW9A 1QR3E 2BQ7B 1FPHH 3MO3A 1FI8A 6CHAC 4MPWA 2F9NA 3MU5A 3EYDA 3RXSA 2XYAA 1B5GH 1P11E 5GIBA 2FS9A 1TWXB 2R0KA 1YPEH 2STAE 2WYGA 2P3FH 1T32A 4ISOA 1WV7H 4D7FA 4WXIA 1Z1IA 4OS4A 3QGJA 3IG6B 3RMLH 3GICB 2A31A 3RUOA 2V3OH 3ZIAD 1HAYB 2WV9A 4FUBA 4B74A 5TCAA 1YPHC 4FXGH 1VITH 4UFFH 4D8NA 4DIIH 1C2IA 1JIRA 1Z8IB 3BTEE 1F2SE 4YZUA 2CN0H 1KYNA 3P92A 2JDID 5EXMA 1BRAA 1UCYE 2Z9KA 4R0IA 1T8MA 1K1LA 2BX4A 2O9QA 3MH5A 1L2EA 4WH8A 7GCHF 4NA9H 3NUMA 3B8JA 1WQSA 3B23B 1ZHPA 2AMDA 3UOUA 1ELGA 2BDYA 2TGAA 1UMAH 1O33A 2BD4A 4I8GA 1IHTH 1W8BH 1IHSH 3M7UA 1WU1A 2PKSC 2QYIA 1C9PA 3JZ1B 3TJOA 1V2TT 1FV9A 2OINA 1ZTLA 1S6LA 1DLEA 2EI7A 3R0FA 1O3EA 1HAVB 4FUDA 1QGFA 3BG8A 3TNTA 1QB1A 3PROA 2BD3A 1CBWC 4MVNA 3MU4A 5C5OA 4X6PA 3BSQA 4Z6AH 4TWYA 1WTHD 2D26C 5ESTE 2L6OA 1V2VT 1SGNE 1YLCA 2OTVA 2ZDLA 1QIXB 2VIDA 5E2PA 1XUKA 3T5FH 1AMHA 2KCPA 1YCPH 4GAWA 3ZVAA 3LKWA 1TBQH 3GY7A 4F49A 4B73A 4IGDA 1P2MA 2FTLE 1QRZA 5B6OA 1TX6A 1OWKA 2FLBH 2ANKH 1KXFA 3T26A 1BDAA 1GJCB 3AAUA 3PLKA 3RXUA 1EATA 3PTNA 1HCGA 4JCNA 2XBWA 1KLTA 3SJ8A 1MTNC 1GMHF 5F53A 1C1PA 1MTUA 1UK3A 1JMOH 3PMHB 1O3CA 1AZ8A 3RU4T 1C5QA 1O31A 3OYPA 4CRAA 2C8ZB 4A6LA 2ZO3H 4NFFA 1ZPZA 3BTHE 1BCUH 4ZROA 1XUHA 3F9FA 1YPMH 1P12E 1HIAA 1O2PA 4MNWA 1ACBE 3SUFA 1HJAC 1GMCG 3RMMH 3W94A 5E2OA 3KQCA 4BXWA 1AHTH 5DKMA 1FQ3A 5DJ7A 5GXPA 3SI4H 1O3AA 1BBRE 4K1EA 2QE7D 3A83A 2W5EA 2WPKS 1Z6EA 4ZH8A 5FL7D 1GHAG 4BAKB 3GCHB 1N1LA 2HPPH 4DURA 3SU4A 3OTPA 1C5VA 4MPVA 1C5UA 1LQEA 3S69A 1BRCE 1QHRB 2STBE 4DW2U 4D9RA 3RMNH 2QCYA 1NFUA 2UUKB 4ZUHA 5AFYH 3MO6A 5AF9H 1QBVH 1SGRE 1YKTA 4ZHLU 3BF6H 1FLEE 1O3FA 2GZ7A 1HBTH 2G51A 3SZNA 9ESTA 3S9BA 1A61H 1S82A 1DUAA 2H9EH 3H09A 5HXFA 3KQEA 3MO9A 1PFXC 3ZVDA 4F55A 2F9VA 1ZJKA 2BMGB 1TX7A 3MNSA 4AOQA 4MLFB 3U8TH 5EW1H 2ZKSA 3G01A 4AYVB 1KTSB 5DP3A 4X2WA 1Z71A 3W1EA 1O2KA 5AHGH 4BAQB 1KXEA 3FO8D 1CA0B 2J34A 3A8BA 2GV7A 3K2UA 4K2YA 4ZKSU 4WXVA 3OTJE 2IOTA 1SQTA 4BAHB 4E7RG 2LELA 3RXFA 3WY8A 1ELEE 5EPYA 2F9OA 3UUZA 4O03A 5EQSA 1EPTA 5F8XA 1O2WA 3LIWA 2JJ2D 3MNCA 2WPJS 1NT1A 2FI3E 3DCLA 1TPAE 2A5KA 3RXLA 4JK6A 3UR9A 2KAIB 4WVPE 2NU4E 3BG4C 2GCTB 4ZMAH 1RTLA 2ALVA 3QGNB 1Y3XA 8GCHG 3RM2H 2BY5X 5JYIA 4QT8C 3F0OA 1YPLH 1P09A 1B0FA 1FZZA 4H4FA 3A7WA 1E1QD 1BB0B 1BHXB 4NSVA 2CGAA 2JH5D 4OGYA 2UWLA 4X6NA 1P03A 3O8DA 3SU0A 1HAOH 1MD7A 1NBMD 3DSOA 2BDHA 3OAAD 3T28A 3F0PA 2C8XB 2Q6GA 1CA8B 2BLQA 1O3KA 1D3PB 3GCHC 2W3IA 5C20A 1TGCA 3E6PH 1MZDA 3STJA 2VBCA 2LPRA 2ILNA 4GHTA 3ZZ4A 2C4FH 1J8AA 1SFIA 4FU9A 1VZQH 2TBSA 1IQGA 3BN9A 4TY6A 3SJ9A 1JXPA 2PWXA 2BLVA 1O2TA 1T8OA 4X2VA 1ETTH 1QURH 1UTKA 2BD2A 2VU8E 3AAVA 5CE1A 2J5UA 1S0RA 3BEUA 3OY5U 3TH4H 3E3TA 1PPBH 3SUDA 1TNLA 3BV9B 1O3DA 2F9BH 2V3HH 4INLA 2AGEX 3L6PA 1IAUA 3HKJB 2B9LA 5EXLA 1ANBA 3HK6B 1P2QA 1VGCB 1C1WH 3MH6A 2PKAA 3PLPA 1P06A 2KFWA 1ZOMA 2HNTE 1HAXB 4U32A 2G52A 1RTKA 1O2RA 1CA0C 3D65E 4NA7A 2FM2A 1C5RA 3U8OH 2BDAA 2PSYA 5TJXA 4I31A 1UTPA 2WPIS 3KIDU 2BLOA 4ASUD 1RRKA 1SPJA 2QN5T 4XE4A 3M7QA 3FAOA 4JZDH 2W6ID 4Y71A 3TVJB 4B1TA 5HKKD 5F8ZA 1CHOG 3RXEA 3FN8A 2HLDD 3KHVA 3PMBB 1FY4A 3A89A 4DVAU 2FTMA 1YLDA 3ZZ5A 2ZZUH 4PROA 3TGKE 2GMTC 3OX7U 1P8VC 1O5AB 2WV5A 3M35A 4IN1A 1QQ4A 1GBBA 2GDDA 3ODFA 4RI0A 1Z8GA 1J15A 3GY3A 3LGUA 3ZV9A 2ZGCA 1GWAA 4Y79A 3PV5A 1O2XA 2A5IA 1HUTH 2H1UA 3DT0H 1D4PB 5HYOA 1AVXA 1OWEA 1SI5H 2NU3E 3TK9A 5EGMA 4U2WA 4NIVA 2UUFB 1G9IE 2GT8A 2JETB 2ZFSA 1MCVA 7GCHG 9LPRA 3URDA 1P02A 1K2I1 3LU9B 1ELDE 3HK3B 1AB9B 2TPIZ 4MNYA 1TAWA 2RG3A 3GDVA 3SNEA 2ZQ1A 5F6MA 1ZR0A 1TPSA 1EXFA 2QXGA 3FP7E 3L33A 1BMNH 4B76A 2FX4A 1V2JT 1VITF 1GHAF 1LCYA 4GUXA 3E0NB 3LOXA 3QX5H 5LH8A 2AGGX 3SV6A 2OC0A 5FAHA 1BRUP 4NZQA 1AKSB 1SVPA 2FO9A 5TCCA 3TU7H 5C3NA 2V7QD 4D7GA 3SJOA 3JZ2B 1FN8A 1GG6B 3K65B 1N6YA 5FPTA 1VGCC 1HGTH 2VJ1A 3MOCA 3OFND 1HXFH 4ZXYH 3GY2A 1XXDA 5C1UA 4YESB 1AWFH 1HAVA 3CENA 3ELAH 1P3EA 1IQFA 1VCPA 1HFDA 1UTJA 1Y8TA 4B6FA 2DE9A 1DY9A 3DSPA 3EAJA 2BLWA 1KTTB 3GY5A 1KXDA 1O2MA 5FPYA 2G4UA 4CREA 2GD4B 1E0FD 2QAAA 1TIOA 3OEED 2TGPZ 3LDXH 1LO6A 4GHQA 5JBCS 2FPZA 2Z94A 2FX6A 3ZZ6A 3PMAB 2ANYA 1KXAA 2G5NA 2W7SA 4BANB 4AX9H 5C5NA 1CHGA 1GMHG 1TGBA 1A3EH 1O2OA 4FU7A 3NRLA 1OS8A 2P3TB 4ISIH 3P6ZB 1PYTD 1JWTA 1SGCA 4OS1A 2LNCA 5DP7A 1CT0E 2BY7X 1A4WH 1QTFA 5FBIA 4A1XA 4B71A 1EASA 2OUAA 3E0PB 3ZZCA 1YYY1 1ZJDA 4CRGA 5T6FA 2XWBI 3KNXA 2ZU3A 1MTVA 1OHHD 1LPZB 2BOKA 4GSOA 1SC8U 1CSOE 4BXSA 2IJD1 1GBDA 5FX6A 4E7NA 2F3CE 2JIZD 2GT7A 1O5DH 4CR9A 2VIQA 4E05H 2YOLA 3FANA 4NIYA 2JETC 4MG3A 1IQIA 1OWHA 5JPMH 4TSFD 3LT3A 4LZ4B 2H2ZA 2H9HA 3U69H 4HZHA 1UHBB 4ESTE 1UVOA 1EJNA 4WMFA 4ZHAA 3ZVGA 1GI4A 3GISB 5ABWA 2ZTYA 2Z9JA 3ESTA 1E38B 1TA6A 2VWMA 3VB6A 1GBIA 1HNEE 3HGNA 3ZVCA 3D49H 4B75A 4X2XA 5AVDA 3PWBA 2W26A 2QIQA 3Q3XA 1SGPE 2R9PA 1VCQA 1CGJE 2ZDVH 4AFQA 3M61U 1G36A 1C2JA 2IPHA 1EOJA 3RXIA 1NPMA 1MAXA 4I8HA 4NFEA 5A09A 1JRSA 1QCPA 4A5TS 3E8LA 2VIOA 1O3JA 3SHAH 1PPZA 2ZWLH 1UTLM 4CHAB 4JZ1A 4JMYA 2FOEA 1IQHA 1GL0E 1B0EA 3SV8A 4AG1A 4MNXA 3SU5A 3K9XB 1MD8A 1NFXA 2RA3A 1FJSA