2K1QA

Nmr structure of hepatitis c virus ns3 serine protease complexed with the non-covalently bound phenethylamide inhibitor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
165
structure length
165
Chain Sequence
TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS3 PROTEASE
publication title Binding of a noncovalent inhibitor exploiting the S' region stabilizes the hepatitis C virus NS3 protease conformation in the absence of cofactor.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 24
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2k1qA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k1qA01
1OWIA 4Y11E 1LMWB 4I31A 3UOUA 2Q1JA 3KHVA 2H9EH 2ZDKA 3MFJA 1LQDB 1WCZA 1BBRK 2BY6X 5PTPA 1GJ7B 1NO9H 1CGIE 1P2OA 3SI3H 2FOFA 3LIWA 1LO6A 3IITA 4B73A 1QNJA 2XWBI 2QXJA 4XOJA 1EPTC 2PSYA 1EB2A 1O37A 1O0DH 3H7OA 1KXAA 2OP9A 1BTYA 1NESE 2BD9A 2VBCA 1RFNA 1O2ZA 1VITG 4TWYA 2VIOA 1O3PB 4Y71A 1HAVA 1MAYA 1AQ7A 3BTDE 2V6NA 1BTWA 3KCGH 1T32A 1TBQH 4KKDA 5JBCS 1FY8E 3A8CA 1P2JA 2VNTA 1T8OA 1Y8TA 3SHAH 3E0NB 3ZYEA 5JDUB 1N8OC 2ZFFH 3D49H 1C1NA 5G4BA 1LQEA 1N6XA 3SU3A 1FUJA 3M5LA 4X8UH 3QO6A 1O2TA 3ZYDA 3AW1A 1DICA 1Y5BT 3ZZCA 3QN7A 5JBTA 3E16B 2GT8A 2TBSA 4X1PU 2Z9GA 2KAIB 4XFQA 3PYHA 2ZA5A 1JIRA 3KIDU 1YKTA 2F3CE 4Y79A 1TQ0B 1P05A 2BTCE 8GCHG 5T3HA 7GCHG 2QC2A 1ARBA 1PPFE 3W95A 4A92A 1MTNC 3RXPA 1W0YH 4I8JA 2R0LA 1IQGA 1W2KH 1QB1A 3PTNA 2HPQH 3KL6A 3SZEA 1P9SA 3TIUA 5ETXA 4ZHLU 4U01A 1KLIH 5DP5A 2FLRH 1OP8A 1Z8JB 1C1MA 2SGAA 2WUCA 4K60A 2H5DA 5I46H 1X7AC 1FY1A 1O5FH 1TNJA 3CS0A 1O5GH 1TRMA 1GJAB 1QY6A 1O2GH 2ZTYA 2GGVB 1NRSH 1KXBA 1YF4A 1WSSH 1SGIB 1EP6A 1C1RA 2ZFSA 1E35B 1H1BA 1FAXA 1OWJA 3NCLA 1MMJN 1MTSA 1AWFH 2BXUH 4HI3A 2C8WB 3HGNA 2UUYA 1HAPH 1SI5H 2Z9KA 1MZDA 1CU1A 2J38A 1MBMA 3URCA 1UK2A 4CRDA 2G4TA 4D9RA 5GWZA 1C1WH 1O33A 1FNIA 1O2JA 5JPMH 4CREA 1Y59T 1H9HE 1TRNA 1V3XA 3SJOA 4UFEH 1YM0A 2PTNA 3A7YA 2XWAA 3HATH 1M9UA 4B76A 3RM0H 1GJ9B 1TX7A 2CF9H 1THPB 2ZU2A 3PV2A 3HKJB 1LVBA 4LXBH 2C8ZB 1QJ6B 1DM4B 2H5CA 3I77A 3VEQB 1W7XH 1C5UA 2ZHDA 1DPOA 3DT0H 1QBVH 4NWKA 1B0FA 2FOAA 3E91A 1TGCA 5FPTA 1V6DA 3GYLB 4FUGA 2XYAA 4MPVA 1O32A 2Q6DA 1OYTH 3K6ZA 1MAXA 1GHWH 1HV7A 1YYY1 4WY3A 1BTHH 1HUTH 4DURA 1O31A 3I78A 5J4QA 4ZHAA 3MNCA 2J2UA 2WPHS 1CBWC 1C2KA 3BIVH 1A0HB 3RXHA 2BLQA 4Z6AH 1YPEH 1L0ZA 2ZQ1A 1CA8B 4A1XA 1NS3A 2Z9JA 1D3PB 2VIWA 1H9IE 5B6OA 1TRYA 1TYNA 2UWOA 1ESAA 3R3GB 1GL0E 1PQ7A 4YLUA 3LOXA 1P2KA 4A7IB 4F49A 4IBLH 4GHQA 4UDWH 1AE5A 2V3HH 1EOJA 2ANWA 4BANB 3LH3A 1L4DA 3Q3XA 1FIZA 3PMJA 1FPHH 4TWWA 3GYMA 3EE0B 1DWBH 3AAVA 6ESTA 1S0QA 2VWOA 1GBTA 1O2HA 2VH6A 1E37B 3RXEA 1GCTC 4MQAA 3TNTA 1CT0E 4OS1A 2FI3E 1MKWK 1OP0A 5FBEA 2HOBA 2PWXA 2WINI 5DP8A 4Z0KA 3EA7A 1ESBA 2FEQH 3PMHB 4XE4A 2AMPA 4ISHH 2J4IA 4WJG2 4DIHH 4QT8C 1UVUH 5DKMA 1G3CA 2TGTA 5J4SA 1UHBA 1VJAU 1V2QT 3TITA 1O2MA 2XBYA 1W11U 4FU8A 4ZHMU 1HNEE 3M3TA 3ZZ5A 3CP7A 1ANEA 1GHBG 4FUFA 3TK9A 3GOVB 3BEFB 2ZCLP 2XBXA 1DWEH 2HVXA 2WV4A 1C5OH 1O2KA 3UQOA 2Y5HA 5EQSA 4LK4A 3RC4A 2HLCA 2G81E 4AGKA 2V3OH 1ZPBA 1O3NA 2OBQA 2LNCA 1HIAA 2C93B 1DXWA 1V2OT 5GCHF 4TYDA 3SU1A 5L6NH 2D2DA 4D8NA 2A2QH 2BD2A 3Q3YA 4LOYH 3HPTB 5HXFA 1GBMA 3P92A 3AK5A 1OOKB 5EW2H 1WTGH 1XUKA 4MPUA 5IDKA 4Y6DA 3H5CB 3VGCC 3TJOA 3R0FA 1ZRKA 1FMGA 4UFFH 3MH6A 4Q7XA 1DT2A 2UUJB 4AZ2B 1GJDB 2G51A 1T8LA 1OP2A 3TLOA 1O3JA 3RC5A 2PW8H 4RI0A 5FPSA 2FS9A 5DK1A 2Q6GA 1C1PA 3SJIA 1VITF 3SNDA 1ABIH 1EZQA 3PMAB 4DJZB 1AI8H 2CJIA 5BPEA 3T27A 1GMCG 3P95A 3RXAA 4Y0ZE 3U98H 3ENSB 1XX9A 4YT6H 3F9EA 2A7HA 3RXIA 1CE5A 1P12E 1GJ6A 2JETB 1G3EA 5CHAC 5JBAS 2HWLB 2F9PA 3BTQE 2O8LA 1GI9B 3T2NA 2J92A 1H4WA 1WAYB 2ZDMA 4K1EA 1BT7A 3SO3A 1TX6A 1TNLA 3ATKA 2F9OA 2BOHB 2R0KA 1C2HA 4AYYB 1GI5A 4CRBA 1FZZA 3OYPA 4K5ZA 1BCUH 1F5KU 2Q6FA 2P93A 1FLEE 8GCHF 1O2SA 7GCHF 2P16A 2ZGCA 1PPBH 2ZECA 5C1YA 1IQHA 2PKSB 3BTGE 1G37A 2BDAA 1C2IA 3HK3B 5FHTA 1TE0A 2WPKS 2Y5FA 5BRRE 1DANH 1SGYE 2FX6A 1KIGH 2ZG0H 1TPSA 4A1TA 5EOKA 3VPKA 5HGGA 4A6LA 1O5AB 3RMMH 2W5EA 1HFDA 3AVZA 1MH0A 4MLFB 1SGNE 1BJUA 4UFGH 3RC6A 1C2JA 1C2GA 3A7ZA 4O3TA 1MTWA 1SGTA 2XBVA 2ZF0H 3SHCH 4DT7B 1P11E 4YTAA 2CF8H 1C2LA 1MU6B 1LVOA 2F9VA 1RTFB 4JZFH 4K1TA 1G2MA 3CS7A 2FOEA 1V2RT 3DUXH 1V2LT 2NU4E 3LU9B 4ABJA 2BX3A 1BUIA 1BTPA 4ABGA 1QRWA 2W26A 4K8YA 1QA7A 2A4RA 2GMTC 2ZDLA 2BDYA 1QB6A 3RU4E 1TIOA 1LHEH 1TPPA 1UCYK 1C1QA 4B2BA 3BV9B 1VR1H 1H9LB 1OWKA 2PTCE 4BTTB 2FTMA 2UUFB 1GI8B 1TA6A 3TVJB 2TIOA 3N7OA 3SN8A 3BTME 5FX6A 3EGKH 1O5DH 3B8JA 1NRQH 2WV5A 3SU5A 1V2TT 4I8HA 1A7SA 1EJAA 2IPHA 3SJ8A 3U8OH 2B8OH 2OXSA 5C1UA 1P2QA 1C9TA 7LPRA 1ZTKA 1CSOE 2BDHA 2ODQA 4X1SU 1AUJA 2W7UA 1D3QB 1SFIA 1PPEE 1CVWH 3PTBA 2UWPA 1GI1A 4R0IA 4ZXYH 4AG1A 1C5WB 5E0JA 2NU1E 1A4WH 2TGDA 4H4FA 1HJ8A 2P3UB 3RXCA 3UPEA 2FP7B 3GICB 1ELBA 4NG9H 2D26C 1IQLA 4I7YH 2Z6BD 1LHDH 4AORA 2A5IA 1OKXA 3LC3A 1AFQB 1O38A 1IQJA 4K3JA 3OY5U 2ZFPH 1P2IA 2FTLE 1CO7E 4E05H 4X8SH 1ZRBA 1TLDA 2YNBA 2VH0A 2VVUA 1WV7H 2KAIA 1UVSH 2ASUB 1GI2A 3E3TA 2AGEX 1S83A 1TX8A 4DCDA 1NRNH 2ILNA 2VU8E 6CHAC 1WUNH 3ESTA 1YPHC 4AN7A 4FUIA 1C1TA 2Y6TA 2V0BA 4E7NA 4YT7H 3M3VA 1CHOG 3RLWH 1AUTC 2C3SA 3KN2A 4RKOB 3LDXH 2ZGXH 2P59A 1QTFA 3ATLA 4SGBE 1HCGA 2A5AA 3QDZB 2TGAA 1KXDA 1PPZA 1ANCA 2O8MA 1K1LA 3UY9A 2XBWA 2GKVE 3MU5A 1GG6C 3ZZ7A 1K1OA 1YCPH 2ZFTA 4JYVH 3BEIB 1ZOMA 1K1NA 1GHBF 3PO1B 1W12U 2G4UA 1LKBA 1AVGH 5C1XA 4MNYA 2AGIX 1V2JT 4FU9A 1QJ1B 2VGCB 2XW9A 1XKAC 3NUMA 2A5KA 1FPCH 1EKBB 3A7VA 2HGTH 1KXCA 2Y80A 3QGJA 1UVOA 1KYNA 1MZAA 4WH6A 3S69A 3RMOH 3LH1A 4AFZA 3F1SB 4ZKNU 1RRKA 1V2UT 4KP0A 1O3BA 3IG6B 1BTXA 4AX9H 3A8DA 1IQNA 1A2CH 3F9FA 4WMEA 1FY5A 2FXRA 3ZVGA 4CR9A 1UJ1A 3L3TA 2ODYB 4FUCA 3Q77A 1EZXC 1A0LA 4ZKOU 2W3IA 3ZV8A 4HFPB 4ZXXH 2GCHG 1HAXB 3TU7H 1GBAA 3BTHE 4Y76A 1ELFA 1T8MA 1C5ZB 1FAKH 1P3EA 2OD3B 2GD4B 1HDTH 4KELA 1RTKA 1LVMA 3A84A 1GHXH 2QXGA 3QK1A 1BDAA 1TMBH 4VGCC 1V2NT 2OTVA 2RA3A 1O3FA 2AFQB 3SUGA 5JB9S 1GMCF 5FCRA 4PROA 4ZMAH 2HRVA 3GCNA 1EPTB 1TB6H 2OQUA 3TK5A 3V0XA 3VB4A 1AZ8A 2A0QB 4F4OC 3P8GA 1P0SH 1OWHA 1P2MA 1S85A 1SB1H 2I6SA 2QF0A 1D6WA 1EJNA 2BVRH 4AYVB 3H7TA 2WHXA 1LVYA 1ETSH 1A5IA 1SOTA 4K1SA 1THSH 1GHZA 3AW0A 4HTCH 3STJA 2FYQA 2AERH 2FOMB 1O39A 4CRCA 1N8OB 4ASHA 4IGDA 4BAOB 3UNRA 2RA0A 2ZFRH 2ZIQH 1GGDC 3MYWA 1O2YA 1Y5UT 2Z3DA 1BMLA 1DITH 2A45B 1CA0C 1MKXH 2Y5GA 2UWLA 4GPGA 3UUZA 1EOLA 5TCAA 2GV7A 2Y82A 1GBEA 1ACBE 4XSKU 1Z8IB 1O3KA 3EA8A 1U6QA 2GCTC 4O03A 1AHTH 1NM6A 1XUGA 3RMLH 5GDSH 1GBLA 4TPYA 1C5QA 1MTNB 1XVOA 2ZWLH 1W13U 4X2VA 3DHKH 1D6RA 3PWCA 2NU2E 1ZMNA 2ZEBA 5F8TA 2PGBB 1Y5AT 1EJMA 1AFEH 1HBTH 3FZZA 3KQBA 3VB5A 1AU8A 4CR5A 3RXFA 2DUCA 3VB3A 1TNKA 1GMDF 4H6SB 1SQOA 2HNTE 3U9AH 1Z8RA 4NIWA 3ZVEA 3JZ2B 2Y7ZA 4KTCA 4X1RU 1K1JA 3SNEA 5F6MA 1K1IA 3VB6A 1XMNB 1MUEB 3BG4C 1SG8B 4X6NA 3Q00A 3LPRA 1KLJH 1D4PB 2V35A 3M61U 3PLKA 2EI7A 1GBDA 2BD3A 1EAIA 1F5RA 4NA9H 4YOIA 2PR3A 3W94A 1MTUA 1VZQH 3OY6U 5F03A 3GY4A 2XNIA 5GPIB 2AEIH 2WV9A 1UTOA 3A81A 3ZZ9A 4LZ1H 3SV6A 3RXTA 2FOGA 1QL8A 3C27B 3GCTG 2R3YA 5E2PA 4B2AA 1EAUA 4WMDA 1ELEE 2CMYA 4Y7BA 3ZZ6A 4AOQA 1G9IE 5T6FA 4JZDH 3S9AA 4ISIH 1MU8B 1TBRH 5E0GA 1NFYA 1O35A 1SLUB 5FXLA 4X1QU 2O8UA 2BQ7B 3M5NA 2BB4A 5AF9H 2TGPZ 2ZO3H 3UREA 3HGPA 3TPIZ 3GCHC 5C5OA 2VVCA 1A46H 1O3EA 1WXRA 3BG8A 1C1OA 3LONA 4NFEA 2TRMA 1CBWB 1A3BH 1A1RA 2HALA 4B2CA 1YLCA 1E34B 3GY6A 3T26A 1ZHRA 1BB0B 3M7UA 2XCFA 3FP8E 3KGPA 3TJVA 3SNAA 3FFGA 4D7FA 1XXDA 3O8CA 3RXGA 2P3FH 1UK4A 1HLTH 5EU8A 2QGRA 1W8BH 2F4LA 1SBWA 3DA9B 2GZ9A 2GDEH 3ODFA 1CHOF 1PYTD 5LGOA 3GDVA 4DGJA 3LGWA 4ABHA 2SGEE 1SGRE 1GDNA 1JRSA 1C1SA 3ATWA 1UTPA 2AMDA 2J34A 3UOPA 3M5MA 4K69A 1ELGA 1GCTB 2STAE 1ZJDA 1QQUA 2Z3EA 1LPKB 3NXPA 4NIYA 2SGQE 1YPLH 3LJOA 3V12A 4ABAA 3GISB 3P8OA 1AB9C 1CGHA 3L33A 1ZGIA 3FP6E 3ELAH 3A85A 5E2OA 3SYJA 1C5SA 1YP9A 1ETTH 2A7CA 2BQ6B 1P09A 2ZFQH 1ZYOA 2GX4A 1ELCA 2GP9B 1S6HA 1C2MA 1CHGA 1O2QA 2AH4X 2EEKA 2BZ6H 2SNWA 5GJ4B 2B7DH 2W3KA 1W14U 1XUHA 2YOLA 1AGJA 1S5SA 1BOQA 2IN2A 4CBNA 2A4QA 1TOCB 1NN6A 2EI8A 2ZKSA 1NTPA 4FUBA 3VXEH 3KQDA 2Z9LA 3B23B 4X6MA 4AB8A 3FZDA 4ZAEA 1ABJH 1TALA 4AB9A 3A80A 4NFFA 2GCHF 1NRPH 2ALVA 3RXVA 1MQ5A 3MO6A 4JYTA 3A8BA 3QX5H 5A8XA 3SORA 4ESTE 1VGCC 1SOZA 2JH6D 2BD5A 1IOEA 3SV9A 2OINA 1DSUA 4XBCA 3UQVA 1IAUA 1O2LA 3VGCB 1MD7A 1LPGB 1PYTC 1ZHMA 3JZ1B 3GCOA 2QCYA 1O36A 1J8AA 4MNWA 5EQRA 4M9FA 4JZEH 2CN0H 2ZHFH 3K9XB 3A83A 4GVUA 4OS5A 1FXYA 4MPWA 1EP5A 4Q2KA 4X6PA 1EXFA 1KTSB 1WBGB 3S7KB 3LGIA 2QY0B 3A7XA 5H4IB 1KLTA 4YESB 2ALPA 4X6OA 1O3MA 4A1VA 2G5VA 3U8TH 3S9BA 3SU6A 1SQAA 2PSXA 1G36A 4JMYA 8LPRA 2I6QA 4X8TH 2QAAA 1KY9A 3LGUA 5CHAB 1ZLRA 5EW1H 1SHYA 4I32A 1BRUP 4DIIH 1BMMH 1GVKB 1QA0A 4Y8YA 1UK3A 1Z6EA 1IQKA 1LKAA 2W7SA 1YPMH 3TGIE 1Z7KA 1QQ4A 1BHXF 3F9GA 1QR3E 3SW2B 3Q76A 1W10U 2VIDA 1MTVA 9LPRA 3SI4H 4NZQA 5DPAA 1QBNA 2GVFA 5F8XA 1GDQA 1NU9A 1GHYH 1SPJA 2VINA 3KEEA 4WXVA 2PUQH 3D62A 2CHAC 2G55A 1PQ5A 4AG2A 1C9PA 4X2XA 2ZGJA 3QTVH 1RS0A 5FBIA 4RKJB 1GJ5H 1QBOA 5A0BA 2C8XB 2F9BH 2WZQA 1GMHG 2NWNA 3QLPH 2FX4A 5K7RA 2GDDA 1DXPA 1P2NA 3SJ9A 3UWIA 3P8FA 4WWYA 3A7TA 1GMDG 3ZVBA 5I25A 1XUJA 2GZ8A 3MU4A 3LC5A 1SLXB 3L6PA 2BMGB 2GMTB 1GVLA 2C8YB 1J16A 1F7ZA 1IHSH 1QHRB 2BLWA 2FYRA 3MNSA 4KGAA 1ELAA 3RXSA 3UR6A 2QV1A 5AFYH 5C5NA 3MOCA 4FVDA 3B9FH 5EPYA 4CBOA 2QXIA 4U2WA 1WQSA 1C5RA 4FUHA 1K1MA 2ZTXA 1Z1IA 1PFXC 3VXFH 2VVVA 1FN6A 1GPZA 1SC8U 2VJ1A 3F9HA 2BY7X 3OSYA 1SGFG 2JKHA 3GCTF 3PROA 5JBBS 1V2KT 1EUFA 2WPJS 5TJXA 1TBZH 3K65B 1XM1A 3A87A 5ESBA 1GBHA 3GY7A 5EXNA 2O9QA 3PV4A 1E36B 2HPPH 3BTTE 2R2MB 1EPTA 3ZZ4A 5CE1A 3A89A 2BVSH 3EAJA 4O97A 1F0RA 1VJ9U 1GBBA 1DUAA 3SU4A 3UWJH 2A32A 1QL7A 1KSNA 1SGDE 4E06H 1A0JA 2OC8A 3MWIU 1QRZA 2K1QA 1SHHB 1GI4A 1SVPA 3VB7A 2WUBA 5EG4A 1ESTA 1H8IH 1EB1H 4ISLA 2ZTZA 1T8NA 2WPLS 1BRAA 2OLGA 1HJAC 1F0UA 1C5VA 1RIWC 1YCPK 1LHCH 1TOMH 3MU0A 5DP9A 1CT2E 1HPGA 1O2IA 1TWXB 4HGCA 2ANKH 4OGXA 1CQQA 1L1NA 3ZZBA 4IC6A 1ID5H 2Z7FE 3M37A 1WOFA 1DE7H 4ABBA 1E0FD 1LDTT 2BM2A 4YOGA 5EGMA 1ZSLA 5B6LA 4BAQB 3ITIA 4RN6A 2RCEA 3EA9A 3GDUA 2NU3E 5ABWA 1YGCH 4CHAC 4DOQA 1BQYA 1ZR0A 4B74A 2CGAA 3MHWU 8ESTE 6CHAB 5GXPA 1J14A 3WY8A 5EPNA 2VB0A 1HJ9A 1ZMJA 3T28A 2ZU4A 4IN1A 3QZQA 2O8TA 4YLQH 3GDSA 3MU8A 1TABE 5DG6A 4U32A 3OU0A 3M5OA 1ANDA 2PLXA 3GY8A 1SQTA 1S81A 1GG6B 4IC5A 4AFUA 1PQ8A 1O2WA 1GJ4H 4JK6A 3PV5A 1DSTA 1HRTH 2STBE 1GI3A 1CT4E 2XRCA 1C5YB 2AIPA 3ATMA 1JOUB 3Q3KA 2BDBA 4NWLA 5HM9A 4SGAE 2IJD1 1Q3XA 2P8OC 4KTUA 2JH0D 1OX1A 4NA8A 1GBKA 2BLVA 1A5HA 2FOBA 4ABIA 1VITH 4Q7YA 3SV7A 1Z1JA 3RU4D 1YPGH 4I8LA 4BAHB 4OGYA 1DS2E 1QGFA 4Q7ZA 1C5XB 4XBBA 1NROH 3TK6A 1AVXA 1O2UA 4GHTA 2AS9A 1XXFA 2GT7A 5A0AE 2A7JA 4CH2B 1O5EH 4INLA 2ANYA 2R9PA 4MNXA 4OS4A 1DWDH 1QFKH 3A8AA 3E8LA 3OTPA 4WMFA 1FN8A 1G3DA 3MNXA 3A86A 5E8EH 1OSSA 4K8BA 1BRBE 2SNVA 4BTUB 1UTQA 1Z8GA 3P6ZB 5DJ7A 3O8BA 1DX5M 1ELTA 2ZP0H 3VFEA 3UNSA 1GCDA 1XKBC 1MKXK 1XUFA 4U30A 5E0HA 1K1PA 1N1LA 3MTYA 2Y81A 2H6MA 4IN2A 2G00A 4ISOA 1HAOH 3SUDA 2BVXH 4CRAA 4VGCB 2RDLA 1KXEA 5T6DA 2A31A 2BD8A 1N6YA 3SU0A 5TCCA 1BA8B 1FV9A 3MMGA 1F5LA 4JK5A 3BF6H 1W7GH 1K28D 2ZNKH 4CRGA 1TMUH 1UVPA 2THFB 2B0FA 3H09A 2BY5X 1K22H 1OPHB 3GY5A 4MVNA 5GIBA 4J2YB 2OQ5A 3IWMA 3PLPA 1JBUH 1O2NA 1Z71A 1Q2WA 2BD4A 1P10A 3E6PH 1C5MD 1AN1E 3K2UA 4B6FA 2PUXB 1ZHPA 2ZGBH 4TY7A 5DP4A 5DGJA 1O30A 3G01A 1RGQA 4KTSA 1BBRE 2AIQA 4X2YA 1Y3UA 1TNIA 2FM2A 5C2ZA 1HB0B 1AKSB 3PMBB 1GGDB 3HK6B 3MO3A 5HMAA 1CA0B 1DLEA 4WF8A 1MCTA 1SR5C 2ZU5A 2Z94A 1JRTA 3M7TA 1NFXA 1ZMLA 3LJJA 2CXVA 1AY6H 3U69H 3U8RH 4AGJA 2GCTB 3MO9A 3UNQA 2R3UA 2XC5A 3RU4T 1KDQB 3AASA 4BNRA 4Y7AA 4B1TA 1QURH 1GBIA 1T4VH 1BMAA 1B0EA 1BBRH 3M7QA 1OYQA 5IYTA 5FPYA 2EC9H 3SV2H 1C2FA 5FCKA 3T5FH 1JMOH 1GMHF 3D65E 4GSOA 5DO4H 2SGFE 4DW2U 3ATIA 2IJOB 3LGVA 3NPSA 2AGGX 2ZGHA 1FY4A 3UIRA 3GY3A 1TAWA 2ESTE 1WYKA 2GZ7A 4AFSA 1DVAH 2PV9B 3TGJE 1ZPCA 1HXEH 1ORFA 3BG4B 1HGTH 1TPOA 5A2MH 1Y3VA 4FUEA 2PKAB 2LPRA 2QF3A 1S82A 3DFJA 1ZSJA 4WXIA 1DOJA 1GDUA 2ZHWH 1TNHA 4D76A 1BTZA 1HYLA 1FQ3A 5EQQA 5T6GA 5A8YA 4NSVA 4OS2A 5GNDA 4GUXA 2XC0A 1H8DH 3GY2A 1B7XB 1GJ8B 2BQWB 4MPXA 9ESTA 1SFQB 1ELVA 2ZPQA 3A82A 5LPRA 1GI6A 2BY8X 2VIVA 2Y7XA 1HAHH 1EAWA 5EXMA 3NKKA 2OC0A 4IW4E 1O2RA 2F91A 1P02A 1BITA 3OX7U 2BHGA 3V3MA 4CH8B 1S6FA 4ABDA 4FVBA 1IQIA 1OS8A 3M3SA 1UTMA 4MG3A 1NRRH 2SGDE 1VCPA 2ZDNA 1J17T 2BD7A 5LPEA 3T25A 3EDXB 2UUKB 3QTOH 6LPRA 1TNGA 1FY3A 4GLYA 2FDAA 2FO9A 1GJCB 1SMFE 1F92A 2XCNA 3GCHB 1KTTB 2ZPRA 3RXQA 3QGNB 1DUEA 2NU0E 4B75A 1A3EH 4MTBA 2FWWA 1GVZA 1P06A 4GCHG 2BZAA 1AE8H 3D23A 2F9UA 3MH4A 3KQCA 4BXWA 4UFDH 1TQ7B 2ZCKP 3MH5A 4FUJA 1KXFA 5EODA 2VIQA 2ZI2H 4UEHH 4ZH8A 3O8RA 3ZZAA 1J9CH 3PLBA 2BDGA 3MNBA 1BHXB 3TJUA 1Q31A 2BLOA 1O3OA 4LZ4B 4XDEA 3A7WA 5DP7A 5CMXH 1WQVH 3E0PB 1O3CA 3SOSA 3SZNA 3ZVDA 5C3NA 4H42U 4WVPE 1EZSC 1WU1A 1PPHE 3UFAA 2FI5E 3DFLA 3SGAE 1GWAA 1EAXA 3BN9A 4Q80A 4A5TS 1J15A 3BSQA 3CENA 3K6YA 4B71A 4UE7H 2FIRH 2C4FH 1HAVB 4NA7A 2ZHQH 2WPIS 3SNBA 1HAIH 3PB1E 1IQFA 1BJVA 3RMNH 1RXPA 2ZDAH 1F2SE 1GHAG 4FU7A 1ZJKA 3T29A 1AB9B 1P3CA 3P8NA 1C1VH 4K2YA 4Y0YE 2PHBA 3ZZ8A 4IMZA 1ZTJA 4TY6A 1DY8A 4BAMB 1ZPZA 4FUDA 4JCNA 2J9NA 3P17H 1LHGH 3TH4H 3FANA 3P70B 5A0CA 4ISNA 4AFQA 1V2VT 3OTJE 3SU2A 2H9HA 4YOJA 2BOKA 4M7GA 2VWMA 1O2XA 3NK8A 2SFAA 5DP6A 3RP2A 3ZV9A 2FESH 3SUEA 4OS7A 1DFPA 2C90B 1V2PT 2FLBH 1MBQA 3MH7A 1ETRH 1O5CB 2BX4A 4DG4A 2VWNA 1C5LH 2OC1A 3KF2A 4XBDA 3A88A 1TONA 2A1DB 1C5PA 2G8TA 4ZROA 2H1UA 1LCYA 1IQMA 3ZZ3A 1QRXA 1SSXA 1CGJE 1VGCB 1SLVB 1YPHE 1O3GA 2A4GA 2FODA 3TGKE 4UD9H 2YNAA 4IMQA 3BTKE 5AFZH 4NGAH 1QL9A 4JZIA 6GCHG 4ZKRU 1DDJA 3MU1A 5L2YH 1MKWH 2RG3A 2WYGA 4BAKB 1ZTLA 2Z9IA 2G52A 4E7RG 3BEUA 1TA2A 1V2ST 2DE8A 4OS6A 4JYUH 4H6TA 3RLYH 1FDPA 3SV8A 1D9IA 2ZDVH 2VIPA 1TFXA 1C4Y2 1PPGE 1ZZZA 1NFUA 1VCWA 1GBCA 1UTJA 3EYDA 4NIVA 3QWCH 3UR9A 1V2WT 2J95A 2WYJA 4Y8XA 2FS8A 1YBWA 3T62A 1YCPM 4IS5A 3ZVAA 3BIUH 1P57B 2P3TB 3S7HB 2HNTC 4Y8ZA 1P9UA 2FOCA 1K9OE 2FMJA 3EQ0H 4NSYA 2JH5D 1PPCE 1G2LA 5ESTE 1AD8H 2OBOA 3RDZA 1NFWA 3SGBE 1MCVA 3V7TA 1HAYB 3ZVFA 3U1JB 3S0NA 3QUMP 3LKWA 1RTLA 2JETC 4I33A 1AZZA 3RXJA 1GBJA 1O2OA 3I29A 7KMEH 2QYIA 1O3IA 2IOTA 2SGPE 2ZU3A 3BTWE 3URDA 4NZLA 8KME2 4I8GA 2XTTB 2A4OA 2P94A 1IHTH 3RXMA 1JIMA 4GAWA 1TGNA 1EX3A 1OWDA 3C1KA 4NIXA 1BRCE 1LPZB 1JWTA 1WTHD 1Y3WA 1LTOA 1V2MT 1NZQH 4INHA 1VCQA 2J94A 5HM2A 2ZHEH 2TPIZ 1TPAE 2CHAB 3ODDA 1A61H 1JXPA 1YC0A 3FVFB 1SGFA 2PKSC 4JZ1A 4X8VH 2B9LA 3V13A 1XVMA 3RXDA 4YO9A 1NY22 3RXRA 2ZPSA 2BY9X 4CRFA 4D9QA 3DD2H 1C1UH 1UTLM 2AYWA 1ARCA 5SGAE 3KQEA 1NPMA 1UMAH 2GTBA 2VWLA 1ELDE 1L2EA 3SJKA 5HYOA 3RXUA 1C4V2 1UTNA 2QXHA 1NU7B 1YLDA 3RUOA 4YM9A 1UO6A 1F0SA 1IQEA 3ZZDA 1O3DA 1PQAA 1TGBA 1UTKA 4I8KA 4TPIZ 2OK5A 4BXSA 3TJNA 2GV6A 7ESTE 3MI4A 1QCPA 1UHBB 3RXKA 2ZZUH 1P8VC 4ABEA 4R8TB 3E1XB 2F9NA 1AVWA 1NT1A 1ANBA 1EASA 1HAZB 1O2PA 2Z3CA 3RXBA 3NZIA 2CV3A 2FI4E 1LHFH 1O3HA 1Y3XA 2PGQB 1SGEE 1UCYE 1DWCH 1FIWA 1K21H 3NWUA 3FP7E 5FAHA 1BMNH 2D1JA 3STIA 3BTEE 1K2I1 4UONA 1O3LA 4DY7B 3F6UH 1HIAB 1P04A 1TGTA 1A5GH 2B5TB 2QN5T 1SL3A 3LGTA 4ZKSU 2ZC9H 4GCHF 3SNCA 3FAOA 1O5BB 1Y3YA 1D3TB 1B5GH 2OC7A 2P95A 4NCYA 1SGQE 1BIOA 3SUFA 2R2WU 1HJAB 2M5TA 3AAUA 1RIWB 1AKSA 2BXTH 4B6EA 1C4U2 1G30B 5L30H 4OM9A 1P01A 4O9VA 3SBKA 1NC6A 3PM3A 3KNXA 1E38B 1UCYH 2D8WA 4HZHA 1Z6JH 5A8ZA 1C5TA 1QJ7B 1BZXE 3S9CA 3M36A 1C5NH 3QZRA 1G32B 2FOHA 4X1NU 1O34A 4MDSA 1AMHA 1GI7B 4INKA 4Y10E 1AFQC 1KDQA 1HAGE 4YZUA 4CHAB 2HNTF 2WPMS 3BTFE 1F0TA 2EI6A 1PJPA 2H9TH 1GL1A 1THRH 1C2DA 2XXLA 3E90B 1YPKH 5C20A 1GHAF 3M35A 1S84A 1O3AA 5K0HA 2BDIA 2O8WA 3ZVCA 4X2WA 4BTIB 5L2ZH 3F68H 3TH3H 5EXLA 1SLWB 1W0ZU 2F83A 1GHVH 1EZUC 3SQEE 1TGSZ 1GJBB 1T31A 4MNVA 1OXGA 1FI8A 4D7GA 2OUAA 2PKAA 2OCVB 5F8ZA 1BTUA 2QIQA 3SQHE 1L1JA 1DY9A 1QIXB 2QA9E 1YPJH 1XUIA 1L1GA 5A09A 1ZSKA 1AIXH 4THNH 4J1YA 5DP3A 5LPFA 1O2VA 2P8OB 5AVDA 3SGQE 4WH8A 3PWBA 5JB8S 3RM2H 3TNSA 3PO1C 1D3DB 1AWHB 1INCA 1T4UH 1RD3B 4DVAU 2G5NA 3LT3A 1W3CA 2VGCC 1FONA 1T7CA 4ZUHA 1SGCA 1SGPE 3UTUH 2FZZA 2ZCHP 2PFEA 4X0WU 1G3BA 1MD8A 3RXLA 2FPZA 2H2ZA 2ODPA 1TMTH 2XC4A 2ANMH 2EA3A 5FX5A 1GI0A 2ZU1A 2A2XH 1OWEA 4FXGH 4BOHA 3TH2H 6GCHF 2BYAX 1ZGVA 1GBFA 3O8DA 2AMQA 5JYIA 3HKIB 2ZQ2A 1FJSA 2DE9A 3LGYA 4O3UA 1EQ9A 5C67A 1L4ZA 4ABFA 1DLKB 1RJXB 5LH8A 3U1IB 1C2EA 1QB9A 5GCHG 5T1VA 1MQ6A 4RSPA 3RXOA 1P03A 1AO5A 2ULLA 1HXFH 1UVTH 1S0RA 5AHGH 2BDCA 1EATA
chains in the Genus database with same CATH superfamily
1OWIA 4Y11E 1LMWB 4I31A 3UOUA 2Q1JA 3KHVA 2H9EH 2ZDKA 3MFJA 1LQDB 1WCZA 1BBRK 2BY6X 5PTPA 1GJ7B 1NO9H 1CGIE 1P2OA 3SI3H 2FOFA 3LIWA 1LO6A 3IITA 4B73A 1QNJA 2XWBI 2QXJA 4XOJA 1EPTC 2PSYA 1EB2A 1O37A 1O0DH 3H7OA 1KXAA 2OP9A 3N99A 1BTYA 5F53A 1NESE 2BD9A 2VBCA 1RFNA 1O2ZA 1VITG 4TWYA 2VIOA 1O3PB 2L6OA 4Y71A 1HAVA 1MAYA 1AQ7A 3BTDE 2V6NA 1BTWA 3KCGH 4TSFD 1T32A 1TBQH 4KKDA 5JBCS 1FY8E 3A8CA 1P2JA 2VNTA 1T8OA 1Y8TA 3SHAH 3E0NB 3ZYEA 5JDUB 1N8OC 2ZFFH 3D49H 1C1NA 5G4BA 1LQEA 1N6XA 3SU3A 1FUJA 3M5LA 4X8UH 2M2AA 3QO6A 1O2TA 3ZYDA 3AW1A 1DICA 1Y5BT 3ZZCA 3QN7A 5JBTA 3E16B 2GT8A 2TBSA 4X1PU 2Z9GA 2KAIB 4XFQA 3PYHA 2ZA5A 1JIRA 3KIDU 5FL7D 1YKTA 2F3CE 4Y79A 1TQ0B 1P05A 2BTCE 8GCHG 5T3HA 7GCHG 2QC2A 1ARBA 1PPFE 3W95A 4A92A 1MTNC 3RXPA 2JDID 1W0YH 2KCYA 4I8JA 2R0LA 1IQGA 1W2KH 1QB1A 3DSPA 3PTNA 2HPQH 1FX0B 3KL6A 3SZEA 1P9SA 3TIUA 5ETXA 4ZHLU 4U01A 1KLIH 5DP5A 2FLRH 1OP8A 1Z8JB 1C1MA 2SGAA 2WUCA 4K60A 2H5DA 5I46H 1X7AC 4Z1MD 1FY1A 1O5FH 1TNJA 3CS0A 1O5GH 1TRMA 1GJAB 1QY6A 1O2GH 2ZTYA 2GGVB 1NRSH 1KXBA 1YF4A 1WSSH 1SGIB 1EP6A 1C1RA 2ZFSA 1E35B 1H1BA 1FAXA 1OWJA 3NCLA 1MMJN 1MTSA 1AWFH 2BXUH 4HI3A 2C8WB 2W6JD 3HGNA 2UUYA 3OFND 1HAPH 1SI5H 2Z9KA 1MZDA 1CU1A 5CDFE 2J38A 1MBMA 3URCA 1UK2A 4CRDA 2G4TA 4D9RA 5GWZA 1C1WH 2KCAA 1O33A 1FNIA 1O2JA 5JPMH 4CREA 1Y59T 1H9HE 1TRNA 2KZ4A 1V3XA 3SJOA 4UFEH 1YM0A 2PTNA 1H8HD 3A7YA 2XWAA 5EJ1A 3HATH 1M9UA 4B76A 3RM0H 1GJ9B 1TX7A 2CF9H 1THPB 2ZU2A 3PV2A 3HKJB 1LVBA 4LXBH 2C8ZB 1QJ6B 1DM4B 2H5CA 3I77A 3VEQB 1W7XH 1C5UA 2ZHDA 1DPOA 3DT0H 1QBVH 4NWKA 1B0FA 2FOAA 3E91A 1UW7A 1TGCA 5FPTA 1BMFD 1V6DA 3GYLB 4FUGA 2XYAA 4MPVA 1O32A 2Q6DA 1OYTH 3K6ZA 1MAXA 1GHWH 1HV7A 1YYY1 4WY3A 1BTHH 1HUTH 4DURA 1O31A 3I78A 5J4QA 4ZHAA 3MNCA 2J2UA 2WPHS 1CBWC 1C2KA 3WWFA 3BIVH 1A0HB 3RXHA 2BLQA 4Z6AH 1YPEH 1L0ZA 2ZQ1A 1CA8B 4A1XA 1NS3A 2Z9JA 1D3PB 2VIWA 1H9IE 5B6OA 1TRYA 1TYNA 2UWOA 1ESAA 3R3GB 1GL0E 1PQ7A 4YLUA 2J5UA 3LOXA 1P2KA 4A7IB 4F49A 4IBLH 4GHQA 4UDWH 1AE5A 2V3HH 1EOJA 2ANWA 4BANB 3LH3A 1L4DA 3Q3XA 1FIZA 3PMJA 1FPHH 4TWWA 3GYMA 3EE0B 1DWBH 3AAVA 6ESTA 3WW7A 1S0QA 2VWOA 1GBTA 1O2HA 2VH6A 1S6LA 2RFKC 1E37B 3RXEA 1GCTC 4MQAA 3TNTA 1CT0E 4OS1A 2FI3E 1MKWK 1OP0A 2PP6A 5FBEA 2HOBA 2PWXA 2WINI 5DP8A 4Z0KA 3EA7A 1ESBA 2FEQH 3PMHB 4XE4A 2AMPA 4ISHH 2J4IA 3N7DA 4WJG2 4DIHH 4QT8C 1UVUH 5DKMA 1G3CA 2TGTA 5J4SA 1UHBA 1VJAU 5DN6D 1V2QT 3TITA 1O2MA 2XBYA 1W11U 4FU8A 4ZHMU 1HNEE 3M3TA 3ZZ5A 3CP7A 1ANEA 4F48B 1GHBG 4FUFA 3TK9A 3GOVB 3BEFB 2ZCLP 2XBXA 1DWEH 2HVXA 2WV4A 1C5OH 1O2KA 3UQOA 2Y5HA 5EQSA 4LK4A 3RC4A 2HLCA 2G81E 4AGKA 2V3OH 1ZPBA 1O3NA 2OBQA 2LNCA 1HIAA 2C93B 1DXWA 1V2OT 5GCHF 4TYDA 3SU1A 5L6NH 2D2DA 4D8NA 2A2QH 2BD2A 3Q3YA 4LOYH 3HPTB 5HXFA 1GBMA 3P92A 3AK5A 1OOKB 5EW2H 1WTGH 1XUKA 4MPUA 5IDKA 3ZIAD 4Y6DA 3H5CB 3VGCC 3TJOA 3R0FA 1ZRKA 1FMGA 4UFFH 3MH6A 4Q7XA 1DT2A 2UUJB 4AZ2B 1GJDB 2G51A 1T8LA 1OP2A 3TLOA 1O3JA 3RC5A 2PW8H 4RI0A 5FPSA 2FS9A 5DK1A 2Q6GA 1C1PA 3SJIA 1VITF 3SNDA 1ABIH 1EZQA 3PMAB 4DJZB 1AI8H 2CJIA 5BPEA 3T27A 1GMCG 3P95A 3RXAA 4Y0ZE 3U98H 3ENSB 1XX9A 4YT6H 3F9EA 2A7HA 3RXIA 1CE5A 1P12E 1GJ6A 2JETB 1G3EA 5CHAC 5JBAS 2HWLB 2F9PA 3BTQE 2O8LA 1GI9B 3T2NA 2J92A 1H4WA 1WAYB 2ZDMA 4K1EA 1BT7A 3SO3A 1TX6A 1TNLA 3ATKA 2F9OA 2BOHB 2R0KA 1C2HA 4AYYB 1GI5A 4CRBA 1FZZA 3OYPA 3N7EA 4K5ZA 1BCUH 1F5KU 2Q6FA 2P93A 1FLEE 8GCHF 1O2SA 7GCHF 2P16A 2ZGCA 1PPBH 2ZECA 5C1YA 1IQHA 2PKSB 3BTGE 1G37A 2BDAA 1C2IA 3HK3B 5FHTA 1TE0A 2WPKS 2Y5FA 5BRRE 1DANH 1SGYE 2FX6A 1KIGH 2ZG0H 1TPSA 4A1TA 5EOKA 3VPKA 5HGGA 4A6LA 1O5AB 3RMMH 2W5EA 1HFDA 3AVZA 1MH0A 4MLFB 1SGNE 1BJUA 4UFGH 3RC6A 1C2JA 1C2GA 3A7ZA 4O3TA 1MTWA 1SGTA 2XBVA 2ZF0H 3SHCH 4DT7B 1P11E 4YTAA 2CF8H 1C2LA 1MU6B 1LVOA 2F9VA 3UB0A 1RTFB 4JZFH 4K1TA 1G2MA 3CS7A 2FOEA 1V2RT 3DUXH 3DSGA 1V2LT 2NU4E 3LU9B 4ABJA 5HKKD 2BX3A 1BUIA 1BTPA 4ABGA 1QRWA 2W26A 4K8YA 1QA7A 2A4RA 2GMTC 2ZDLA 2BDYA 1QB6A 3RU4E 1TIOA 1LHEH 1TPPA 1SKYE 2HVYB 1UCYK 1C1QA 4B2BA 3BV9B 1VR1H 1H9LB 1OWKA 2PTCE 4BTTB 2FTMA 2UUFB 1GI8B 1OHHD 1TA6A 3TVJB 2TIOA 3N7OA 3SN8A 3BTME 5FX6A 3EGKH 1O5DH 3B8JA 1NRQH 2WV5A 3SU5A 1V2TT 4I8HA 1A7SA 1EJAA 2IPHA 3SJ8A 3U8OH 2B8OH 2OXSA 5C1UA 1P2QA 1C9TA 7LPRA 1ZTKA 1CSOE 2BDHA 2ODQA 4X1SU 1AUJA 2W7UA 1D3QB 1SFIA 1PPEE 1CVWH 3PTBA 2UWPA 1GI1A 4R0IA 4ZXYH 4AG1A 1C5WB 5E0JA 2NU1E 1A4WH 2TGDA 4H4FA 2J98B 1HJ8A 2P3UB 3OEHD 3RXCA 3UPEA 2FP7B 3GICB 1ELBA 4NG9H 2D26C 3U28C 1IQLA 4I7YH 2Z6BD 1LHDH 4AORA 2A5IA 1OKXA 3LC3A 1AFQB 1O38A 1IQJA 4K3JA 3OY5U 2ZFPH 1P2IA 2FTLE 1CO7E 4E05H 4X8SH 1ZRBA 1TLDA 2YNBA 2VH0A 2VVUA 1WV7H 2KAIA 1UVSH 2ASUB 1GI2A 3E3TA 2AGEX 1S83A 3NRLA 1TX8A 4DCDA 1NRNH 2ILNA 2VU8E 6CHAC 1WUNH 3ESTA 1YPHC 4AN7A 4FUIA 1C1TA 2Y6TA 2V0BA 4E7NA 4YT7H 3M3VA 1CHOG 3RLWH 1AUTC 2C3SA 3KN2A 4RKOB 3LDXH 2ZGXH 3W1EA 2P59A 1QTFA 3ATLA 4SGBE 1HCGA 2A5AA 3QDZB 2TGAA 1KXDA 1PPZA 1ANCA 2O8MA 1K1LA 3UY9A 2XBWA 2GKVE 3MU5A 1GG6C 3ZZ7A 1K1OA 1YCPH 2ZFTA 4JYVH 3BEIB 1ZOMA 1K1NA 1GHBF 3PO1B 1W12U 2G4UA 1LKBA 1AVGH 5C1XA 4MNYA 2AGIX 1V2JT 4FU9A 1QJ1B 2VGCB 2XW9A 1XKAC 3NUMA 2A5KA 1FPCH 1EKBB 3A7VA 2HGTH 1KXCA 2Y80A 2YMSB 3QGJA 1UVOA 1KYNA 1MZAA 2J97A 4WH6A 3S69A 3RMOH 3LH1A 4AFZA 3F1SB 4ZKNU 1RRKA 1V2UT 4KP0A 1O3BA 3IG6B 1BTXA 4AX9H 3A8DA 1IQNA 1A2CH 3F9FA 4WMEA 1FY5A 2FXRA 3ZVGA 4CR9A 2IPQX 1UJ1A 3L3TA 2ODYB 4FUCA 3Q77A 3OEED 1EZXC 1A0LA 4ZKOU 2W3IA 3ZV8A 4HFPB 4ZXXH 2GCHG 1HAXB 3TU7H 4ASUD 1GBAA 3BTHE 4Y76A 1ELFA 1T8MA 5CHBA 1C5ZB 1FAKH 1P3EA 2OD3B 2GD4B 1HDTH 4KELA 1RTKA 1LVMA 4FOUC 3A84A 1MABB 1NBMD 1GHXH 2QXGA 3QK1A 1BDAA 1TMBH 4VGCC 1V2NT 2OTVA 2RA3A 1O3FA 2AFQB 3SUGA 5JB9S 1GMCF 5FCRA 4PROA 4ZMAH 2HRVA 3GCNA 1EPTB 1TB6H 3MQKC 2OQUA 3TK5A 3V0XA 3VB4A 1AZ8A 2A0QB 4F4OC 1YY3A 3P8GA 1P0SH 1OWHA 1P2MA 1S85A 1SB1H 2I6SA 2QF0A 1D6WA 1WDIA 1EJNA 2BVRH 4AYVB 3H7TA 2WHXA 1LVYA 1ETSH 4XD7D 1A5IA 1SOTA 4K1SA 1THSH 1GHZA 3AW0A 4HTCH 3STJA 2FYQA 2AERH 2FOMB 1O39A 4CRCA 1N8OB 3FKSD 4IGDA 4ASHA 4BAOB 3UNRA 2RA0A 5KECA 2ZFRH 2ZIQH 1GGDC 3MYWA 1O2YA 1Y5UT 2Z3DA 1BMLA 1DITH 2A45B 1CA0C 1MKXH 2Y5GA 2UWLA 4GPGA 3UUZA 1EOLA 5TCAA 2GV7A 2Y82A 1GBEA 1ACBE 4XSKU 1Z8IB 1O3KA 3EA8A 1U6QA 2GCTC 4O03A 1AHTH 1NM6A 1XUGA 3RMLH 5GDSH 1GBLA 4TPYA 1C5QA 1MTNB 1XVOA 2ZWLH 1W13U 4X2VA 3DHKH 1D6RA 3PWCA 2NU2E 1ZMNA 2ZEBA 5F8TA 2PGBB 1Y5AT 1EJMA 1AFEH 1HBTH 3FZZA 3KQBA 3VB5A 1AU8A 4CR5A 3RXFA 2DUCA 3VB3A 1TNKA 1GMDF 4H6SB 1SQOA 2HNTE 3U9AH 1Z8RA 4NIWA 3ZVEA 3JZ2B 2Y7ZA 4KTCA 4X1RU 1K1JA 3SNEA 5F6MA 1K1IA 3VB6A 1XMNB 1MUEB 2EY4C 3BG4C 1SG8B 4X6NA 3Q00A 3LPRA 1KLJH 1D4PB 2V35A 3M61U 3PLKA 2EI7A 1GBDA 2BD3A 1EAIA 1F5RA 4NA9H 4YOIA 2PR3A 3W94A 1MTUA 1VZQH 3OY6U 5F03A 3GY4A 2XNIA 5GPIB 2AEIH 2WV9A 1UTOA 3KYFA 3OAAD 3A81A 3ZZ9A 4LZ1H 3SV6A 3RXTA 2FOGA 1QL8A 3C27B 3GCTG 2R3YA 5E2PA 4B2AA 1EAUA 4WMDA 1ELEE 2CMYA 4Y7BA 3ZZ6A 4AOQA 1G9IE 5T6FA 4JZDH 3S9AA 4ISIH 1MU8B 1TBRH 5E0GA 1NFYA 1O35A 1SLUB 5FXLA 4X1QU 2O8UA 2BQ7B 3M5NA 2JJ2D 2BB4A 5AF9H 2TGPZ 2ZO3H 3UREA 3HGPA 3TPIZ 3GCHC 5C5OA 2VVCA 1A46H 1O3EA 1WXRA 3BG8A 1YLNA 1C1OA 3LONA 4NFEA 2TRMA 1CBWB 1A3BH 4Q63A 1A1RA 2HALA 4B2CA 1YLCA 1E34B 3GY6A 3T26A 1ZHRA 1BB0B 3M7UA 2XCFA 3FP8E 3KGPA 3TJVA 3SNAA 3FFGA 4D7FA 1E1RD 1XXDA 3O8CA 3RXGA 2P3FH 1UK4A 1HLTH 5EU8A 2QGRA 1W8BH 2F4LA 1SBWA 3DA9B 2GZ9A 2GDEH 3ODFA 1CHOF 1PYTD 5LGOA 3GDVA 3GS9A 4DGJA 3LGWA 4P00A 4ABHA 2SGEE 1SGRE 1GDNA 1JRSA 1C1SA 3ATWA 1UTPA 1YWUA 2AMDA 2J34A 3UOPA 3M5MA 4K69A 1ELGA 1GCTB 2STAE 1ZJDA 1QQUA 2Z3EA 1LPKB 3NXPA 4NIYA 2SGQE 1YPLH 3LJOA 3V12A 4ABAA 3GISB 3P8OA 1AB9C 1CGHA 3L33A 1ZGIA 3FP6E 3ELAH 3A85A 5E2OA 3SYJA 1C5SA 1YP9A 1ETTH 2A7CA 2BQ6B 1P09A 2ZFQH 1ZYOA 2GX4A 1ELCA 2GP9B 1S6HA 1C2MA 1CHGA 1O2QA 2AH4X 2EEKA 2BZ6H 2SNWA 5GJ4B 2B7DH 2W3KA 1W14U 1XUHA 2JIZD 3KYGA 2YOLA 1AGJA 1S5SA 1BOQA 2IN2A 4CBNA 3PRBA 2A4QA 1TOCB 1NN6A 2EI8A 2ZKSA 1NTPA 4FUBA 3VXEH 3KQDA 2Z9LA 3B23B 4X6MA 4AB8A 3FZDA 4ZAEA 1ABJH 1TALA 4AB9A 3A80A 4NFFA 2GCHF 1NRPH 2ALVA 3RXVA 1MQ5A 3MO6A 4JYTA 3A8BA 3QX5H 5A8XA 3SORA 4ESTE 1VGCC 1SOZA 2JH6D 2BD5A 1IOEA 3SV9A 2OINA 1DSUA 4XBCA 3UQVA 1IAUA 1O2LA 3VGCB 2J98A 1MD7A 1LPGB 1PYTC 1ZHMA 3JZ1B 3GCOA 2QCYA 1O36A 1J8AA 2KM0A 4MNWA 5EQRA 4M9FA 4JZEH 2CN0H 2ZHFH 3K9XB 1W0KD 3A83A 2V3MA 4GVUA 4OS5A 1FXYA 4MPWA 1EP5A 4Q2KA 4X6PA 1EXFA 1KTSB 1WBGB 3S7KB 3LGIA 2QY0B 3A7XA 5H4IB 1KLTA 4YESB 2ALPA 4AC9A 4X6OA 1O3MA 4A1VA 2G5VA 3U8TH 3S9BA 3SU6A 1SQAA 2PSXA 1G36A 4JMYA 8LPRA 2I6QA 4X8TH 2QAAA 1KY9A 3LGUA 5CHAB 1ZLRA 5EW1H 1SHYA 4I32A 1BRUP 4DIIH 1BMMH 2QF5A 1GVKB 1QA0A 4Y8YA 5HIYA 1UK3A 1Z6EA 1IQKA 1LKAA 2W7SA 1E79D 1YPMH 2W6ID 3TGIE 3F2FA 1Z7KA 1QQ4A 1BHXF 3F9GA 1QR3E 3SW2B 3Q76A 1W10U 2VIDA 1MTVA 9LPRA 3SI4H 4NZQA 5DPAA 1QBNA 2GVFA 5F8XA 3FN8A 1GDQA 1NU9A 1GHYH 1SPJA 2VINA 3KEEA 4WXVA 2PUQH 3D62A 2CHAC 2G55A 1PQ5A 4AG2A 1C9PA 4X2XA 2ZGJA 3QTVH 1RS0A 5FBIA 4RKJB 1GJ5H 1QBOA 5A0BA 2C8XB 2F9BH 3WWBA 2WZQA 1GMHG 2NWNA 3QLPH 2FX4A 5K7RA 2GDDA 1DXPA 1P2NA 3SJ9A 3UWIA 3P8FA 4WWYA 3A7TA 1GMDG 3ZVBA 5I25A 1XUJA 2GZ8A 3MU4A 3LC5A 1SLXB 3L6PA 2BMGB 2GMTB 1GVLA 2C8YB 1J16A 1F7ZA 1IHSH 1QHRB 2BLWA 2FYRA 3MNSA 4KGAA 1ELAA 3RXSA 3UR6A 2QV1A 5AFYH 5C5NA 3MOCA 4FVDA 3B9FH 5EPYA 4CBOA 2QXIA 4U2WA 1WQSA 3OE7D 2LELA 1C5RA 4FUHA 1K1MA 2ZTXA 1Z1IA 1PFXC 3VXFH 2VVVA 1FN6A 1GPZA 1SC8U 2VJ1A 3F9HA 2BY7X 3OSYA 1SGFG 2JKHA 3GCTF 3PROA 5JBBS 1V2KT 1EUFA 2WPJS 5TJXA 1TBZH 3K65B 1XM1A 3A87A 5ESBA 1GBHA 3GY7A 5EXNA 1COWD 2O9QA 3PV4A 1E36B 2HPPH 4ZCNA 3BTTE 2R2MB 3DSOA 1EPTA 3ZZ4A 5CE1A 3A89A 2BVSH 3EAJA 4O97A 1F0RA 2GJGA 1VJ9U 1GBBA 1DUAA 3SU4A 3UWJH 2A32A 4RT1A 1QL7A 2F43B 1KSNA 1W0JD 1SGDE 4E06H 1A0JA 2OC8A 3MWIU 1QRZA 2K1QA 1SHHB 1GI4A 1SVPA 3VB7A 2WUBA 5EG4A 1ESTA 1H8IH 1EB1H 4ISLA 2ZTZA 1T8NA 2WPLS 1BRAA 3KQ5A 2OLGA 1HJAC 1F0UA 1C5VA 1RIWC 1YCPK 1LHCH 4TT3D 1TOMH 3MU0A 5DP9A 1CT2E 1HPGA 1O2IA 1TWXB 4HGCA 2ANKH 4OGXA 1CQQA 1L1NA 3ZZBA 4IC6A 1ID5H 2Z7FE 3M37A 3UAIC 1WOFA 1DE7H 4ABBA 1E0FD 1LDTT 2BM2A 4YOGA 5EGMA 1ZSLA 5B6LA 4BAQB 3ITIA 4RN6A 2RCEA 3EA9A 3GDUA 2NU3E 5ABWA 1YGCH 4CHAC 4DOQA 1BQYA 1ZR0A 4B74A 2CGAA 3MHWU 8ESTE 6CHAB 5GXPA 1J14A 3WY8A 5EPNA 2VB0A 1HJ9A 1ZMJA 3T28A 5EIYA 2ZU4A 4IN1A 3QZQA 2O8TA 2KFWA 4YLQH 3GDSA 3MU8A 1TABE 5DG6A 5KGOA 4U32A 3OU0A 3M5OA 1ANDA 2PLXA 3GY8A 1SQTA 1S81A 1GG6B 4IC5A 4AFUA 1PQ8A 1O2WA 1GJ4H 4JK6A 3PV5A 1DSTA 1HRTH 2STBE 1GI3A 1CT4E 2XRCA 1C5YB 2AIPA 3ATMA 1JOUB 3Q3KA 2BDBA 4NWLA 2IJD1 4SGAE 5HM9A 1Q3XA 2P8OC 4KTUA 4YXWD 2JH0D 1OX1A 4NA8A 1GBKA 2BLVA 1A5HA 2FOBA 4ABIA 1VITH 4Q7YA 3SV7A 1Z1JA 3RU4D 5HIZA 1YPGH 4I8LA 4BAHB 4OGYA 1DS2E 1QGFA 4Q7ZA 1C5XB 4XBBA 1NROH 3TK6A 1AVXA 1O2UA 4GHTA 2AS9A 1XXFA 2GT7A 5A0AE 2KCOA 2A7JA 2K0QA 4CH2B 1O5EH 4INLA 2ANYA 2R9PA 4MNXA 4OS4A 1DWDH 1QFKH 3A8AA 3E8LA 3OTPA 4WMFA 1FN8A 1G3DA 3MNXA 3A86A 5E8EH 1OSSA 1H8ED 4K8BA 1BRBE 2SNVA 4BTUB 1UTQA 1Z8GA 3P6ZB 5DJ7A 3O8BA 1DX5M 1ELTA 2ZP0H 3VFEA 3UNSA 1GCDA 1XKBC 1MKXK 1XUFA 4U30A 5E0HA 1K1PA 1N1LA 3MTYA 2Y81A 2H6MA 4IN2A 2G00A 4ISOA 1HAOH 3SUDA 2BVXH 4CRAA 4VGCB 2RDLA 2HLDD 1KXEA 5T6DA 2A31A 2BD8A 1N6YA 3SU0A 5TCCA 1BA8B 1FV9A 3MMGA 1SQRA 1F5LA 4JK5A 3BF6H 1W7GH 1K28D 2ZNKH 4CRGA 1TMUH 1UVPA 2THFB 2B0FA 3H09A 2BY5X 1K22H 1OPHB 3GY5A 4MVNA 5GIBA 5KEDA 4J2YB 2OQ5A 3IWMA 3PLPA 1JBUH 1O2NA 1Z71A 1Q2WA 2BD4A 1P10A 3E6PH 1C5MD 1AN1E 3K2UA 4B6FA 2PUXB 1ZHPA 2ZGBH 4TY7A 5DP4A 5DGJA 1O30A 3G01A 1K0HA 1RGQA 4KTSA 1BBRE 2AIQA 4X2YA 1Y3UA 1TNIA 2FM2A 5C2ZA 1HB0B 1AKSB 3PMBB 1GGDB 3HK6B 1EFRD 3MO3A 5HMAA 1CA0B 1DLEA 4WF8A 1MCTA 3F2GA 1SR5C 2ZU5A 2Z94A 1JRTA 3M7TA 1NFXA 1ZMLA 3LJJA 3F0PA 2CXVA 1AY6H 3U69H 3U8RH 4AGJA 2GCTB 3MO9A 3UNQA 2R3UA 3DCLA 2XC5A 3RU4T 1KDQB 3AASA 4BNRA 4Y7AA 4B1TA 1QZ8A 1QURH 1GBIA 1T4VH 1BMAA 1B0EA 1BBRH 3M7QA 1OYQA 5IYTA 5FPYA 2EC9H 3SV2H 1C2FA 5FCKA 3T5FH 1JMOH 1GMHF 3D65E 4GSOA 5DO4H 2JJ1D 2SGFE 4DW2U 3ATIA 5C94A 2IJOB 3LGVA 2LP6A 3NPSA 2AGGX 2ZGHA 1FY4A 3UIRA 3GY3A 1TAWA 2ESTE 1WYKA 2GZ7A 4AFSA 1DVAH 2PV9B 3TGJE 1ZPCA 1HXEH 1ORFA 3BG4B 1HGTH 1TPOA 5A2MH 1Y3VA 4FUEA 2PKAB 2LPRA 2QF3A 1S82A 4XRNA 3DFJA 1ZSJA 4WXIA 1DOJA 1GDUA 2ZHWH 2XOKD 1TNHA 4D76A 1BTZA 1HYLA 2AHME 1FQ3A 5EQQA 5T6GA 5A8YA 4NSVA 4OS2A 5GNDA 4GUXA 2XC0A 1H8DH 2WPDD 1B7XB 1GJ8B 2BQWB 3GY2A 4MPXA 9ESTA 1SFQB 1ELVA 3F0OA 2ZPQA 3A82A 5LPRA 1GI6A 2BY8X 2VIVA 2Y7XA 1HAHH 1EAWA 2QF4A 5EXMA 3NKKA 2OC0A 2WSSD 4IW4E 1O2RA 2F91A 1P02A 1BITA 3OX7U 2KR7A 2BHGA 3V3MA 4CH8B 2L74A 1S6FA 4ABDA 4FVBA 1IQIA 1OS8A 3M3SA 1UTMA 4MG3A 1NRRH 2SGDE 1VCPA 2ZDNA 1J17T 2BD7A 5LPEA 3T25A 3EDXB 2UUKB 3QTOH 6LPRA 1TNGA 1FY3A 4GLYA 2FDAA 2FO9A 1KMHB 1GJCB 4F55A 1SMFE 1F92A 2XCNA 3GCHB 1KTTB 2ZPRA 3RXQA 3QGNB 1DUEA 2NU0E 4B75A 1A3EH 4MTBA 2FWWA 1GVZA 1P06A 4GCHG 2BZAA 4ACBA 1AE8H 4P02A 3D23A 2F9UA 3MH4A 3KQCA 4BXWA 4UFDH 1TQ7B 2ZCKP 3MH5A 4FUJA 1KXFA 5EODA 2VIQA 2ZI2H 4UEHH 4ZH8A 3O8RA 3ZZAA 1J9CH 3PLBA 2XNDD 2BDGA 3MNBA 1BHXB 3TJUA 1Q31A 2BLOA 1O3OA 4LZ4B 4XDEA 3A7WA 5DP7A 5CMXH 1WQVH 3E0PB 1O3CA 3SOSA 3SZNA 3ZVDA 5C3NA 4H42U 4WVPE 1EZSC 1WU1A 1PPHE 3UFAA 2FI5E 3DFLA 3SGAE 1GWAA 1EAXA 3BN9A 4Q80A 4A5TS 1J15A 3BSQA 3CENA 3K6YA 4B71A 4UE7H 2FIRH 2C4FH 1HAVB 4NA7A 5C0TA 2ZHQH 2WPIS 3SNBA 1HAIH 3PB1E 1IQFA 1BJVA 3RMNH 1RXPA 2ZDAH 1F2SE 1GHAG 4FU7A 1ZJKA 3T29A 1AB9B 1P3CA 2QE7D 1C1VH 3P8NA 4K2YA 4Y0YE 1VKYA 2PHBA 2RDEA 3ZZ8A 4IMZA 1ZTJA 4TY6A 1DY8A 4BAMB 1ZPZA 4FUDA 4JCNA 2J9NA 3P17H 1LHGH 3TH4H 3FANA 3P70B 5A0CA 4ISNA 4AFQA 1V2VT 4ACAA 3OTJE 3SU2A 2H9HA 3F2HA 4YOJA 2BOKA 4M7GA 2VWMA 1O2XA 3NK8A 2SFAA 5DP6A 3RP2A 3ZV9A 2FESH 3SUEA 4OS7A 1DFPA 2C90B 1V2PT 2FLBH 1MBQA 3MH7A 1ETRH 4Q4LA 1O5CB 2BX4A 4DG4A 2VWNA 1C5LH 2OC1A 3CNRA 3KF2A 4XBDA 3A88A 1TONA 2A1DB 4HG6A 1C5PA 2G8TA 4ZROA 2H1UA 1LCYA 1IQMA 3ZZ3A 1QRXA 2KX4A 1SSXA 1CGJE 1VGCB 1SLVB 1YPHE 1O3GA 2A4GA 2FODA 3TGKE 4UD9H 2YNAA 4IMQA 3BTKE 5AFZH 1E1QD 3VG8A 4NGAH 1QL9A 4JZIA 6GCHG 4ZKRU 1DDJA 3MU1A 5L2YH 1MKWH 2RG3A 2WYGA 4BAKB 1ZTLA 2Z9IA 2G52A 4E7RG 3BEUA 1TA2A 1V2ST 2DE8A 4OS6A 4JYUH 4H6TA 3RLYH 1FDPA 3SV8A 1D9IA 2ZDVH 2VIPA 1TFXA 1C4Y2 1PPGE 1ZZZA 1NFUA 1VCWA 1GBCA 1UTJA 3EYDA 4NIVA 3QWCH 3UR9A 1V2WT 2J95A 2WYJA 4Y8XA 2FS8A 1YBWA 3T62A 3FO8D 1YCPM 4IS5A 3ZVAA 3BIUH 1P57B 2P3TB 3S7HB 2HNTC 4Y8ZA 5DSFA 1P9UA 2FOCA 1K9OE 2FMJA 3EQ0H 4NSYA 5C17A 2JH5D 1PPCE 1G2LA 5ESTE 1AD8H 2OBOA 3RDZA 1NFWA 3SGBE 1MCVA 3V7TA 1HAYB 3ZVFA 3U1JB 3S0NA 3QUMP 3LKWA 1RTLA 2JETC 4I33A 1AZZA 3RXJA 1GBJA 1O2OA 3I29A 7KMEH 2QYIA 1O3IA 2IOTA 2SGPE 3EE7A 2ZU3A 3BTWE 3URDA 4NZLA 8KME2 4I8GA 2XTTB 2A4OA 2P94A 1IHTH 3RXMA 1JIMA 4GAWA 1TGNA 1EX3A 1OWDA 3C1KA 4NIXA 1BRCE 1LPZB 1JWTA 1WTHD 1Y3WA 1LTOA 1V2MT 1NZQH 4INHA 1VCQA 2J94A 5HM2A 2ZHEH 2TPIZ 1TPAE 2CHAB 3ODDA 1A61H 1JXPA 1YC0A 3FVFB 1SGFA 2PKSC 4JZ1A 4X8VH 2B9LA 3V13A 1XVMA 3RXDA 4YO9A 1NY22 2CK3D 3RXRA 2ZPSA 2BY9X 4CRFA 4D9QA 3DD2H 1C1UH 1UTLM 2AYWA 1ARCA 5SGAE 3KQEA 1NPMA 1UMAH 2GTBA 2VWLA 1ELDE 1L2EA 3SJKA 5HYOA 3RXUA 1C4V2 4I86A 1UTNA 2QXHA 1NU7B 1YLDA 3RUOA 4YM9A 1UO6A 1F0SA 1IQEA 3ZZDA 1O3DA 1PQAA 4DT4A 1TGBA 1UTKA 4I8KA 4TPIZ 2OK5A 4BXSA 3TJNA 2GV6A 7ESTE 3MI4A 1QCPA 1UHBB 3RXKA 2ZZUH 1P8VC 4ABEA 4R8TB 3E1XB 2F9NA 1AVWA 1NT1A 1ANBA 1EASA 1HAZB 1O2PA 2Z3CA 3RXBA 3NZIA 5C0UA 2CV3A 2FI4E 1LHFH 1O3HA 5EJZA 1Y3XA 2PGQB 1SGEE 1UCYE 1DWCH 1FIWA 1K21H 3NWUA 3FP7E 5FAHA 1BMNH 2D1JA 3STIA 3BTEE 1K2I1 4UONA 1O3LA 4DY7B 3F6UH 1HIAB 1P04A 1TGTA 1A5GH 2B5TB 2QN5T 1SL3A 3LGTA 4ZKSU 2ZC9H 4GCHF 3SNCA 1NBME 3FAOA 1O5BB 1Y3YA 1D3TB 1B5GH 2OC7A 2P95A 4NCYA 1SGQE 1BIOA 3SUFA 2R2WU 1HJAB 2M5TA 3AAUA 1RIWB 1AKSA 2BXTH 4B6EA 1C4U2 1G30B 5L30H 4OM9A 1P01A 2YMSD 4O9VA 3SBKA 1NC6A 3PM3A 3KNXA 1E38B 1UCYH 2D8WA 4HZHA 1Z6JH 5A8ZA 1C5TA 1QJ7B 1BZXE 3S9CA 3M36A 1C5NH 3QZRA 1G32B 2FOHA 4X1NU 1O34A 4MDSA 1AMHA 1GI7B 4INKA 4Y10E 1AFQC 1KDQA 1HAGE 4YZUA 4CHAB 2HNTF 2WPMS 3BTFE 1F0TA 2EI6A 1PJPA 2H9TH 1GL1A 1THRH 1C2DA 2XXLA 3E90B 1YPKH 5C20A 1GHAF 3M35A 1S84A 1O3AA 5K0HA 2BDIA 2O8WA 3ZVCA 4X2WA 4BTIB 5L2ZH 3F68H 4FETA 3TH3H 5EXLA 1SLWB 1W0ZU 2F83A 1GHVH 1EZUC 3SQEE 1TGSZ 1GJBB 1T31A 4MNVA 3F3BA 1OXGA 3FOAA 1FI8A 4D7GA 2OUAA 2PKAA 2V7QD 2OCVB 5F8ZA 1BTUA 2QIQA 3SQHE 1L1JA 1DY9A 1QIXB 2QA9E 1YPJH 1XUIA 1L1GA 5A09A 1ZSKA 1AIXH 4THNH 4J1YA 5EJLA 5DP3A 2K8IA 5LPFA 1O2VA 2P8OB 5AVDA 2EQNA 4WH8A 3SGQE 3PWBA 5JB8S 3RM2H 3TNSA 3PO1C 1D3DB 1AWHB 1INCA 1T4UH 1RD3B 4DVAU 2G5NA 3LT3A 1W3CA 2VGCC 1FONA 1T7CA 4ZUHA 1SGCA 1SGPE 3UTUH 2FZZA 2ZCHP 2PFEA 4X0WU 1G3BA 1MD8A 3RXLA 2FPZA 2H2ZA 3PRDA 2ODPA 2YMSC 5IK2D 1TMTH 2XC4A 4RT0A 2ANMH 2EA3A 5FX5A 1GI0A 2ZU1A 2A2XH 1OWEA 4FXGH 4BOHA 3TH2H 6GCHF 2BYAX 1ZGVA 1GBFA 3O8DA 2AMQA 5JYIA 3HKIB 2ZQ2A 1FJSA 2DE9A 3LGYA 4O3UA 1EQ9A 5C67A 1L4ZA 4ABFA 2KCPA 1DLKB 1RJXB 5LH8A 3U1IB 1C2EA 1QB9A 5GCHG 5T1VA 1MQ6A 4RSPA 3RXOA 1P03A 1AO5A 2ULLA 1HXFH 1UVTH 1S0RA 5AHGH 2BDCA 1EATA
chains in the Genus database with same CATH topology
1OWIA 4Y11E 1LMWB 4I31A 3UOUA 2Q1JA 3KHVA 2H9EH 2ZDKA 3MFJA 1LQDB 1WCZA 1BBRK 2BY6X 5PTPA 1GJ7B 1NO9H 1CGIE 1P2OA 3SI3H 2FOFA 3LIWA 1LO6A 3IITA 4B73A 1QNJA 2XWBI 2QXJA 4XOJA 1EPTC 2PSYA 1EB2A 1O37A 1O0DH 3H7OA 1KXAA 2OP9A 3N99A 1BTYA 5F53A 1NESE 2BD9A 2VBCA 1RFNA 1O2ZA 1VITG 4TWYA 2VIOA 1O3PB 2L6OA 4Y71A 1HAVA 1MAYA 1AQ7A 3BTDE 2V6NA 1BTWA 3KCGH 4TSFD 1T32A 1TBQH 4KKDA 5JBCS 1FY8E 3A8CA 1P2JA 2VNTA 1T8OA 1Y8TA 3SHAH 3E0NB 3ZYEA 5JDUB 1N8OC 2ZFFH 3D49H 1C1NA 5G4BA 1LQEA 1N6XA 3SU3A 1FUJA 3M5LA 4X8UH 2M2AA 3QO6A 1O2TA 3ZYDA 3AW1A 1DICA 1Y5BT 3ZZCA 3QN7A 5JBTA 3E16B 2GT8A 2TBSA 4X1PU 2Z9GA 2KAIB 4XFQA 3PYHA 2ZA5A 1JIRA 3KIDU 5FL7D 1YKTA 2F3CE 4Y79A 1TQ0B 1P05A 2BTCE 8GCHG 5T3HA 7GCHG 2QC2A 1ARBA 1PPFE 3W95A 4A92A 1MTNC 3RXPA 2JDID 1W0YH 4I8JA 2KCYA 2R0LA 1IQGA 1W2KH 1QB1A 3DSPA 3PTNA 2HPQH 3KL6A 1FX0B 3SZEA 1P9SA 3TIUA 5ETXA 4ZHLU 4U01A 1KLIH 5DP5A 2FLRH 1OP8A 1Z8JB 1C1MA 2SGAA 2WUCA 4K60A 2H5DA 5I46H 1X7AC 4Z1MD 1FY1A 1O5FH 1TNJA 3CS0A 1O5GH 1TRMA 1GJAB 1QY6A 1O2GH 2ZTYA 2GGVB 1NRSH 1KXBA 1YF4A 1WSSH 1SGIB 1EP6A 1C1RA 2ZFSA 1E35B 1H1BA 1FAXA 1OWJA 3NCLA 1MMJN 1MTSA 1AWFH 2BXUH 4HI3A 2C8WB 2W6JD 3HGNA 2UUYA 3OFND 1HAPH 1SI5H 2Z9KA 1MZDA 1CU1A 5CDFE 2J38A 1MBMA 3URCA 1UK2A 4CRDA 2G4TA 4D9RA 5GWZA 1C1WH 2KCAA 1O33A 1FNIA 1O2JA 5JPMH 4CREA 1Y59T 1H9HE 1TRNA 2KZ4A 1V3XA 3SJOA 4UFEH 1YM0A 2PTNA 3A7YA 1H8HD 2XWAA 3HATH 1M9UA 4B76A 3RM0H 1GJ9B 1TX7A 2CF9H 1THPB 2ZU2A 3PV2A 3HKJB 1LVBA 4LXBH 2C8ZB 1QJ6B 1DM4B 2H5CA 3I77A 3VEQB 1W7XH 1C5UA 2ZHDA 1DPOA 3DT0H 1QBVH 4NWKA 1B0FA 2FOAA 3E91A 1TGCA 5FPTA 1BMFD 1V6DA 3GYLB 4FUGA 2XYAA 4MPVA 1O32A 2Q6DA 1OYTH 3K6ZA 1MAXA 1GHWH 1HV7A 1YYY1 4WY3A 1BTHH 1HUTH 4DURA 1O31A 3I78A 5J4QA 4ZHAA 3MNCA 2J2UA 2WPHS 1CBWC 1C2KA 3WWFA 3BIVH 1A0HB 3RXHA 2BLQA 4Z6AH 1YPEH 1L0ZA 2ZQ1A 1CA8B 4A1XA 1NS3A 2Z9JA 1D3PB 2VIWA 1H9IE 5B6OA 1TRYA 1TYNA 2UWOA 1ESAA 3R3GB 1GL0E 1PQ7A 4YLUA 2J5UA 3LOXA 1P2KA 4A7IB 4F49A 4IBLH 4GHQA 4UDWH 1AE5A 2V3HH 1EOJA 2ANWA 4BANB 3LH3A 1L4DA 3Q3XA 1FIZA 3PMJA 1FPHH 4TWWA 3GYMA 3EE0B 1DWBH 3AAVA 6ESTA 3WW7A 1S0QA 2VWOA 1GBTA 1O2HA 2VH6A 1S6LA 1E37B 3RXEA 1GCTC 4MQAA 3TNTA 1CT0E 4OS1A 2FI3E 1MKWK 1OP0A 5FBEA 2HOBA 2PWXA 2WINI 5DP8A 4Z0KA 3EA7A 1ESBA 2FEQH 3PMHB 4XE4A 2AMPA 4ISHH 2J4IA 3N7DA 4WJG2 4DIHH 4QT8C 1UVUH 5DKMA 1G3CA 2TGTA 5J4SA 1UHBA 1VJAU 5DN6D 1V2QT 3TITA 1O2MA 2XBYA 1W11U 4FU8A 4ZHMU 1HNEE 3M3TA 3ZZ5A 3CP7A 1ANEA 1GHBG 4FUFA 3TK9A 3GOVB 3BEFB 2ZCLP 2XBXA 1DWEH 2HVXA 2WV4A 1C5OH 1O2KA 3UQOA 2Y5HA 5EQSA 4LK4A 3RC4A 2HLCA 2G81E 4AGKA 2V3OH 1ZPBA 1O3NA 2OBQA 2LNCA 1HIAA 2C93B 1DXWA 1V2OT 5GCHF 4TYDA 3SU1A 5L6NH 2D2DA 4D8NA 2A2QH 2BD2A 3Q3YA 4LOYH 3HPTB 5HXFA 1GBMA 3P92A 3AK5A 1OOKB 5EW2H 1WTGH 1XUKA 4MPUA 5IDKA 3ZIAD 4Y6DA 3H5CB 3VGCC 3TJOA 3R0FA 1ZRKA 1FMGA 4UFFH 3MH6A 4Q7XA 1DT2A 2UUJB 4AZ2B 1GJDB 2G51A 1T8LA 1OP2A 3TLOA 1O3JA 3RC5A 2PW8H 4RI0A 5FPSA 2FS9A 5DK1A 2Q6GA 1C1PA 3SJIA 1VITF 3SNDA 1ABIH 1EZQA 3PMAB 4DJZB 1AI8H 2CJIA 5BPEA 3T27A 1GMCG 3P95A 3RXAA 4Y0ZE 3U98H 3ENSB 1XX9A 4YT6H 3F9EA 2A7HA 3RXIA 1CE5A 1P12E 1GJ6A 2JETB 1G3EA 5CHAC 5JBAS 2HWLB 2F9PA 3BTQE 2O8LA 1GI9B 3T2NA 2J92A 1H4WA 1WAYB 2ZDMA 4K1EA 1BT7A 3SO3A 1TX6A 1TNLA 3ATKA 2F9OA 2BOHB 2R0KA 1C2HA 4AYYB 1GI5A 4CRBA 1FZZA 3OYPA 3N7EA 4K5ZA 1BCUH 1F5KU 2Q6FA 2P93A 1FLEE 8GCHF 1O2SA 7GCHF 2P16A 2ZGCA 1PPBH 2ZECA 5C1YA 1IQHA 2PKSB 3BTGE 1G37A 2BDAA 1C2IA 3HK3B 5FHTA 1TE0A 2WPKS 2Y5FA 5BRRE 1DANH 1SGYE 2FX6A 1KIGH 2ZG0H 1TPSA 4A1TA 5EOKA 3VPKA 5HGGA 4A6LA 1O5AB 3RMMH 2W5EA 1HFDA 3AVZA 1MH0A 4MLFB 1SGNE 1BJUA 4UFGH 3RC6A 1C2JA 1C2GA 3A7ZA 4O3TA 1MTWA 1SGTA 2XBVA 2ZF0H 3SHCH 4DT7B 1P11E 4YTAA 2CF8H 1C2LA 1MU6B 1LVOA 2F9VA 3UB0A 1RTFB 4JZFH 4K1TA 1G2MA 3CS7A 2FOEA 1V2RT 3DUXH 1V2LT 2NU4E 3LU9B 4ABJA 5HKKD 2BX3A 1BUIA 1BTPA 4ABGA 1QRWA 2W26A 4K8YA 1QA7A 2A4RA 2GMTC 2ZDLA 2BDYA 1QB6A 3RU4E 1TIOA 1LHEH 1TPPA 1SKYE 1UCYK 1C1QA 4B2BA 3BV9B 1VR1H 1H9LB 1OWKA 2PTCE 4BTTB 2FTMA 2UUFB 1GI8B 1OHHD 1TA6A 3TVJB 2TIOA 3N7OA 3SN8A 3BTME 5FX6A 3EGKH 1O5DH 3B8JA 1NRQH 2WV5A 3SU5A 1V2TT 4I8HA 1A7SA 1EJAA 2IPHA 3SJ8A 3U8OH 2B8OH 2OXSA 5C1UA 1P2QA 1C9TA 7LPRA 1ZTKA 1CSOE 2BDHA 2ODQA 4X1SU 1AUJA 2W7UA 1D3QB 1SFIA 1PPEE 1CVWH 3PTBA 2UWPA 1GI1A 4R0IA 4ZXYH 4AG1A 1C5WB 5E0JA 2NU1E 1A4WH 2TGDA 4H4FA 1HJ8A 2P3UB 3OEHD 3RXCA 3UPEA 2FP7B 3GICB 1ELBA 4NG9H 2D26C 1IQLA 4I7YH 2Z6BD 1LHDH 4AORA 2A5IA 1OKXA 3LC3A 1AFQB 1O38A 1IQJA 4K3JA 3OY5U 2ZFPH 1P2IA 2FTLE 1CO7E 4E05H 4X8SH 1ZRBA 1TLDA 2YNBA 2VH0A 2VVUA 1WV7H 2KAIA 1UVSH 2ASUB 1GI2A 3E3TA 2AGEX 1S83A 3NRLA 1TX8A 4DCDA 1NRNH 2ILNA 2VU8E 6CHAC 1WUNH 3ESTA 1YPHC 4AN7A 4FUIA 1C1TA 2Y6TA 2V0BA 4E7NA 4YT7H 3M3VA 1CHOG 3RLWH 1AUTC 2C3SA 3KN2A 4RKOB 3LDXH 2ZGXH 3W1EA 2P59A 1QTFA 3ATLA 4SGBE 1HCGA 2A5AA 3QDZB 2TGAA 1KXDA 1PPZA 1ANCA 2O8MA 1K1LA 3UY9A 2XBWA 2GKVE 3MU5A 1GG6C 3ZZ7A 1K1OA 1YCPH 2ZFTA 4JYVH 3BEIB 1ZOMA 1K1NA 1GHBF 3PO1B 1W12U 2G4UA 1LKBA 1AVGH 5C1XA 4MNYA 2AGIX 1V2JT 4FU9A 1QJ1B 2VGCB 2XW9A 1XKAC 3NUMA 2A5KA 1FPCH 1EKBB 3A7VA 2HGTH 1KXCA 2Y80A 2YMSB 3QGJA 1UVOA 1KYNA 1MZAA 4WH6A 3S69A 3RMOH 3LH1A 4AFZA 3F1SB 4ZKNU 1RRKA 1V2UT 4KP0A 1O3BA 3IG6B 1BTXA 4AX9H 3A8DA 1IQNA 1A2CH 3F9FA 4WMEA 1FY5A 2FXRA 3ZVGA 4CR9A 1UJ1A 3L3TA 2ODYB 4FUCA 3Q77A 3OEED 1EZXC 1A0LA 4ZKOU 2W3IA 3ZV8A 4HFPB 4ZXXH 2GCHG 1HAXB 3TU7H 4ASUD 1GBAA 3BTHE 4Y76A 1ELFA 1T8MA 5CHBA 1C5ZB 1FAKH 1P3EA 2OD3B 2GD4B 1HDTH 4KELA 1RTKA 1LVMA 3A84A 1MABB 1NBMD 1GHXH 2QXGA 3QK1A 1BDAA 1TMBH 4VGCC 1V2NT 2OTVA 2RA3A 1O3FA 2AFQB 3SUGA 5JB9S 1GMCF 5FCRA 4PROA 4ZMAH 2HRVA 3GCNA 1EPTB 1TB6H 2OQUA 3TK5A 3V0XA 3VB4A 1AZ8A 2A0QB 4F4OC 3P8GA 1P0SH 1OWHA 1P2MA 1S85A 1SB1H 2I6SA 2QF0A 1D6WA 1EJNA 2BVRH 4AYVB 3H7TA 2WHXA 1LVYA 1ETSH 4XD7D 1A5IA 1SOTA 4K1SA 1THSH 1GHZA 3AW0A 4HTCH 3STJA 2FYQA 2AERH 2FOMB 1O39A 4CRCA 1N8OB 4ASHA 4IGDA 4BAOB 3FKSD 3UNRA 2RA0A 2ZFRH 2ZIQH 1GGDC 3MYWA 1O2YA 1Y5UT 2Z3DA 1BMLA 1DITH 2A45B 1CA0C 1MKXH 2Y5GA 2UWLA 4GPGA 3UUZA 1EOLA 5TCAA 2GV7A 2Y82A 1GBEA 1ACBE 4XSKU 1Z8IB 1O3KA 3EA8A 1U6QA 2GCTC 4O03A 1AHTH 1NM6A 1XUGA 3RMLH 5GDSH 1GBLA 4TPYA 1C5QA 1MTNB 1XVOA 2ZWLH 1W13U 4X2VA 3DHKH 1D6RA 3PWCA 2NU2E 1ZMNA 2ZEBA 5F8TA 2PGBB 1Y5AT 1EJMA 1AFEH 1HBTH 3FZZA 3KQBA 3VB5A 1AU8A 4CR5A 3RXFA 2DUCA 3VB3A 1TNKA 1GMDF 4H6SB 1SQOA 2HNTE 3U9AH 1Z8RA 4NIWA 3ZVEA 3JZ2B 2Y7ZA 4KTCA 4X1RU 1K1JA 3SNEA 5F6MA 1K1IA 3VB6A 1XMNB 1MUEB 3BG4C 1SG8B 4X6NA 3Q00A 3LPRA 1KLJH 1D4PB 2V35A 3M61U 3PLKA 2EI7A 1GBDA 2BD3A 1EAIA 1F5RA 4NA9H 4YOIA 2PR3A 3W94A 1MTUA 1VZQH 3OY6U 5F03A 3GY4A 2XNIA 5GPIB 2AEIH 2WV9A 1UTOA 3OAAD 3A81A 3ZZ9A 4LZ1H 3SV6A 3RXTA 2FOGA 1QL8A 3C27B 3GCTG 2R3YA 5E2PA 4B2AA 1EAUA 4WMDA 1ELEE 2CMYA 4Y7BA 3ZZ6A 4AOQA 1G9IE 5T6FA 4JZDH 3S9AA 4ISIH 1MU8B 1TBRH 5E0GA 1NFYA 1O35A 1SLUB 5FXLA 4X1QU 2O8UA 2BQ7B 3M5NA 2JJ2D 2BB4A 5AF9H 2TGPZ 2ZO3H 3UREA 3HGPA 3TPIZ 3GCHC 5C5OA 2VVCA 1A46H 1O3EA 1WXRA 3BG8A 1C1OA 3LONA 4NFEA 2TRMA 1CBWB 1A3BH 4Q63A 1A1RA 2HALA 4B2CA 1YLCA 1E34B 3GY6A 3T26A 1ZHRA 1BB0B 3M7UA 2XCFA 3FP8E 3KGPA 3TJVA 3SNAA 3FFGA 4D7FA 1E1RD 1XXDA 3O8CA 3RXGA 2P3FH 1UK4A 1HLTH 5EU8A 2QGRA 1W8BH 2F4LA 1SBWA 3DA9B 2GZ9A 2GDEH 3ODFA 1CHOF 1PYTD 5LGOA 3GDVA 3GS9A 4DGJA 3LGWA 4ABHA 2SGEE 1SGRE 1GDNA 1JRSA 1C1SA 3ATWA 1UTPA 2AMDA 2J34A 3UOPA 3M5MA 4K69A 1ELGA 1GCTB 2STAE 1ZJDA 1QQUA 2Z3EA 1LPKB 3NXPA 4NIYA 2SGQE 1YPLH 3LJOA 3V12A 4ABAA 3GISB 3P8OA 1AB9C 1CGHA 3L33A 1ZGIA 3FP6E 3ELAH 3A85A 5E2OA 3SYJA 1C5SA 1YP9A 1ETTH 2A7CA 2BQ6B 1P09A 2ZFQH 1ZYOA 2GX4A 1ELCA 2GP9B 1S6HA 1C2MA 1CHGA 1O2QA 2AH4X 2EEKA 2BZ6H 2SNWA 5GJ4B 2B7DH 2W3KA 1W14U 1XUHA 2JIZD 2YOLA 1AGJA 1S5SA 1BOQA 2IN2A 4CBNA 3PRBA 2A4QA 1TOCB 1NN6A 2EI8A 2ZKSA 1NTPA 4FUBA 3VXEH 3KQDA 2Z9LA 3B23B 4X6MA 4AB8A 3FZDA 4ZAEA 1ABJH 1TALA 4AB9A 3A80A 4NFFA 2GCHF 1NRPH 2ALVA 3RXVA 1MQ5A 3MO6A