5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
4XVUA 1CJKC 2YOLA 2D7DA 1P73A 2QRZA 3EW9A 3BSQA 1UPTA 4JZIA 3SUFA 2WMNB 4NWKA 2FU5C 1F7ZA 3DEFA 1ARCA 5GIBA 3SU3A 1W0JA 3GCHC 1BMFD 3I8XA 1FDPA 4X2YA 4MGKR 1ZHRA 3LVQE 2B7DH 2GWHA 1QGFA 3MJRA 1E4VA 3RXIA 1ZMJA 3AP1A 4AC9A 4A7IB 3OEEA 4DLYA 1W0KD 5KSYA 2O9QA 3VB6A 3QIAA 2ZRJA 1INCA 2EFEB 2N42A 1H65A 1MT0A 3PUVA 3IO3A 5K7RA 1AMHA 2AGIX 3Q3KA 3RXMA 4B3BA 4F92B 4KTCA 1KK3A 2ZGXH 3UIRA 1ZD9A 4JZ1A 3MH7A 4URWR 5IHPA 5CLQA 1DE0A 2QN6A 1E4YA 1JBUH 3U98H 1G41A 1J14A 2PFEA 4IOLA 4I1UA 3SHAH 1XEXA 3E70C 1Z8GA 4B3DA 3QXHA 4JVNA 1UF9A 4ZCLA 2GZ7A 3PCRB 1CHGA 1QRXA 4CR5A 4J2YB 4I8LA 1C5YB 2OCBA 1K1OA 1FUUA 1W36C 1LVGA 2OO7A 3PTBA 4Y76A 1G8HA 3UR9A 4MUBA 3SC3A 4D80A 2WIBA 3M35A 4MNWA 3LKWA 3BE4A 2ZAOA 3EA7A 1N6YA 1RJ9B 1SGFG 3HWSA 1GI2A 5JBAS 1SXJC 2CF9H 1YPHE 2ZM5A 2C93B 1SGIB 2GAOA 5CHAC 4POAA 2VP2A 1O3JA 2P2LA 1KY9A 1O3FA 2QC2A 4WY3A 4HDQB 1PPHE 4RD6A 3QXXA 1G9IE 3RC4A 4OHWA 1ELEE 1VCWA 2A0QB 1QHRB 1KJWA 1GI3A 2RCEA 3MO9A 3PJRA 3FP6E 2ODWA 1OWKA 5KSPA 1XU4A 4GI7A 4H6SB 2O0HA 1XXDA 3TQCA 2OCYC 1QF9A 3DO6A 1X8LA 3GD7A 4PSVA 1OW3B 5BYKA 5C1BA 1ZIOA 4UNSA 3NC1C 3AKEA 5IK2D 1ZPCA 4ZI2A 3I77A 4CEJA 3W34A 2BYAX 1G2MA 2FPZA 2BBOA 2AX4A 5EE9A 4ABDA 1G5RA 1LO6A 3QQ5A 3GY5A 4O0MA 1DOJA 3ZVCA 3MGCA 2QMUA 4P4TA 1ZGVA 1EZXC 2IK8A 2AKAB 3E5HA 3RYTC 2GESA 4LV6A 1F0SA 4GCHG 3FDIA 3IQWA 3SYNA 1P2UA 5DP6A 1Z7KA 1G20E 2IYXA 1QBOA 4B6FA 5FBWB 5DKMA 4TZ6A 4ITRC 2ZDKA 2BDBA 2CF8H 1G36A 1VIAA 3OY5U 4CHAB 3MH6A 1E2LA 2BV3A 5HCNA 4TYQA 4ASUD 1YPKH 1YZQA 3E1SA 3UMSA 4OS2A 3RMLH 5JEDA 1UK3A 4WAUA 4K2YA 3AB3A 4JT2A 2ZUDA 4ZKNU 1K22H 4Q4JB 3NCLA 4Q1DA 3SS8A 1LF5A 3CM0A 1TQ4A 1DICA 2CGAA 3C7KA 1O5EH 1SOZA 1T5IA 3KB2A 2FS8A 1H9IE 4DY7B 3CW2A 1Q20A 3PLBA 1NTPA 3G82C 5EP1A 4RFSA 1G6HA 1FZQA 2GXSA 4ASHA 1XUGA 3U60B 4KAXA 2OQUA 3KJEA 3ZZ5A 3KXKA 4XVRA 2AWOA 2J2UA 1T0HB 4R7ZA 2HVXA 1G4UR 3A88A 4ERNA 4MLFB 5GPIB 1M8PA 4I81A 1MKWK 3A4LA 1DANH 2QTHA 3B8JA 5FOWA 1GIAA 2OBMA 1L4ZA 2Q21A 4F4IA 1YQTA 3TH2H 1ETRH 1RC8A 3GJ3A 4YLUA 1OOKB 1WMSA 4WMEA 4C0LA 2JIZA 1Q2WA 2GXAA 4B34A 3ADBA 5CJ2A 2UUJB 3SJOA 4HB2A 4JVMA 3A7TA 5B64A 3A36A 3LGTA 1N6NA 1Y5BT 1Y59T 4YLQH 1MRNA 1OWJA 3PIRA 1OP2A 1DDJA 4L4UA 1XMNB 2FOCA 4DG4A 4ESVA 1OT3A 4UXHA 2IJD1 1TPPA 1GG6B 2VEDA 4YXWD 3TJOA 2P67A 5EGMA 2PEYA 1SVSA 2WPDA 1LHCH 2YYZA 1OLOA 1EJAA 2JDID 3ASYA 2OLGA 3NH6A 1DEKA 1DWCH 4BOHA 1UM8A 2AGGX 1N5IA 2PKAB 1RW4A 2GVZC 2FSIA 5EODA 4W9MC 3ZZUA 5E4FA 1XZQA 3B1ZA 3PMAB 5CB8A 3WXMA 2AEIH 3AKYA 3BH0A 1EAWA 1NRSH 4M9SA 1T8LA 5A5GA 4F4CA 1EFHA 2ZRNA 2GBLC 1W0JD 2XWAA 3VKWA 2R0KA 4XH9B 3VGCB 2ODNA 2W0MA 1QJ1B 3BF6H 1CA0C 3EZFA 4UXJA 3VX4A 4OS6A 1BMNH 1KI8A 5J4VA 1ELDE 4X1NU 1GITA 2XNDA 3I61A 3OEHD 4AI6A 4PFSA 1GJBB 2DUCA 4B76A 3LWNA 4AFZA 1C5PA 3MCAA 5ABWA 3CRVA 4ABGA 3LD9A 2Z83A 7GCHG 4LJ4A 1GBKA 2WIAA 3M5LA 1E0KA 4P33A 3MWYW 2PT5A 1BO6A 1Z06A 4TT3A 4Z0KA 4TY7A 3U8RH 1OWHA 3HU1A 2UWLA 2XEXA 2JJ1A 3BIVH 4E06H 1NESE 4CYMA 1N6KA 5JB9S 1JEDA 2OD3B 3EAQA 3CX6A 2O8EA 1TLDA 3ODDA 2ZNKH 2G4TA 2HV8A 1OYYA 3W5IA 2RGDA 5GJWC 1SLWB 2QT0A 4D81A 3PMBB 3L6PA 2F1RA 3HJNA 3SZRA 1LPZB 1Z71A 1Z3IX 4KJZA 4FUHA 3LC3A 4UNQA 1HFDA 2ZDVH 1EFRD 1QHXA 3AGPA 1KHTA 4WXIA 2C96A 2NMVA 4BE7B 5H70A 2PJZA 5C18A 2PSXA 2YV5A 2V1XA 4M9XA 5AF9H 1KYIA 2FH5B 3UQOA 4AG1A 721PA 4G5GA 1VKJA 5SZJA 3TVDA 4FU8A 1US8B 4ACBA 5KPDA 4KCGA 4DUGA 2YNAA 1GHVH 3FHCB 4JLOA 2IS2A 1EKBB 5AUNB 2RA0A 3TK9A 3EC1A 4MPUA 3G0HA 3PVSA 2FWRA 3V4RA 1RTFB 1VG9B 3Q5EA 2AH4X 4AY2A 3SJBA 4ISOA 2ALPA 4ABYA 1MD7A 1AZ8A 1D4PB 1LQEA 4ZKDA 2ODPA 2ZCHP 4DLWA 2C03A 3KZ1E 1X86B 2V1UA 4WXVA 3GY6A 4KYUA 1GBTA 2ORVA 1HAIH 3WY9A 2FZ4A 4Q47A 4C0HA 4X8VH 1KI2A 2BDTA 3FAOA 2AYWA 2A5YB 1GBIA 3NZIA 4QHSA 2UUKB 2V8OA 1RIWC 4AZ2B 2ZR7A 1GGDB 3RRYA 3S7KB 2BOVA 3RWOA 4XFQA 3T35A 2CL0X 1MU6B 4BASA 3QKTA 2ZQ5A 5DP5A 2ZFTA 1KLJH 1GBEA 4HUQA 5DHAA 2FF7A 5D3MB 3RRMA 4ZPXA 1CU1A 1EATA 3B6EA 2HNTF 4R2IA 4MITA 5CDFE 1GHBF 4G0NA 1P3CA 1D6WA 3GOVB 4CGZA 2UKDA 2GV6A 1SL3A 1W49A 4M1MA 4SGAE 4Y79A 1GJ9B 5HKKD 2HLDD 5BQ5A 3JVUA 4FVBA 2TIOA 2ZTYA 3OU0A 3CPJB 4LX0A 2QUZA 3E16B 4JZKA 2HRVA 4IOKA 4LJAA 2QORA 4DB4A 3EE0B 3T12A 3GJ6A 1P01A 3AEZA 2G81E 3P4YA 1IQEA 4BRWA 4JS0A 5BYJA 3C8UA 3Q85A 2BLVA 1TFXA 1A0LA 2CCKA 1XUIA 3K65B 1I4TD 4MYUA 4I1SA 1F5RA 1C2JA 1GVZA 1O2UA 5BPEA 2IF2A 1BDAA 4I8HA 1G291 2GTBA 4S35A 2R44A 4FUJA 4MNVA 4KFRA 1YHNA 1YR6A 2EYUA 2DWOA 1AZZA 1KMHB 1O3GA 1S96A 4BRUA 4OJKA 4Q7YA 1ODFA 3THWA 3X1WA 5DP7A 1N0UA 4AFUA 2WJYA 4CIDA 5IDKA 1XX6A 1YU9A 3PITA 4C3ZA 3Q7PA 4AYTA 2VP4A 1DS2E 4Q19A 1B23P 4NBSA 4A0GA 1W48A 2OLKA 3TNFA 3K9LA 2REBA 1P2JA 3AVOA 4FWTA 4A1VA 1ZR0A 3GLIA 1A5HA 3TIFA 2SGQE 1DWBH 3EZ6A 2EWWA 2BVRH 4L9SA 1WB9A 2W00A 3MU4A 4L9WA 1S9HA 3IKJA 2IWHA 1O3KA 4NZQA 2PLRA 3HGPA 1U8AA 2BMFA 3SI7A 1C2EA 4HB4A 2FA9A 1E2FA 1WBBA 2BD7A 2ZIAA 1KDRA 4DSNA 3QKRB 1KSNA 3R8CA 2NU2E 1QFKH 1OPXA 1U81A 2GXUA 1EP6A 4LV8B 1W7AA 1AE8H 2BM1A 1YZKA 1E9AA 1K6MA 4MA4A 3M3SA 3IIMA 4LPSA 1AS2A 1BH2A 3O8DA 1LHDH 3MO6A 2A78A 1HDTH 3H7OA 1RE0A 1AWFH 2ZE5A 2Z9LA 1F2TB 3EA9A 3AGQA 3ZZ6A 2OP9A 3B9QA 3KX2A 1E0SA 2WSSD 4DCSA 5E3HA 2WOOA 4OBEA 2STBE 2PZGA 1YM0A 1JJVA 3CH5A 4MDEA 1SHYA 3ND8A 2KAIA 2J0QA 4IMQA 2ODEA 3NH9A 1O36A 2RGNA 2HLDA 1SB1H 4KLNA 3KN2A 1ZM3A 2QN5T 1CR0A 2PGBB 2ANCA 3QUSA 1VGCC 2FI3E 1MTNC 1NSTA 5G53C 2ZDAH 4V0KA 3BERA 3IQXA 4JKYA 4TL6A 1Y8TA 2XITA 1E99A 3LFUA 3L2OB 2QBYA 4GOKA 4V0LA 5B2ZA 3DL0A 2CJWB 3EA0A 5J5CA 2YHSA 3HPQA 3TH4H 4JLVA 5LPNA 2ZU6A 1IXSB 2EI8A 3NDPA 2HYIC 3BH7A 1YJ5A 5GXPA 5C46F 2SGPE 2R2WU 2QAGA 4ON9A 1N0WA 1VYVA 4QBIA 1KKMA 5LB4A 1WV7H 1TGTA 2CN0H 5G41A 2BD9A 1NVWQ 1P11E 1I2MA 4MQBA 4B35A 1G8YA 4ZIRB 1W0ZU 1FQJA 3NBYC 5L3SB 3ZYEA 5EXLA 5C67A 1ZUNB 2IEYA 2EI7A 4DIIH 3PV0A 1I4LD 3TLXA 1AIXH 4Z8YA 1UTJA 1MTNB 3LJJA 2AXPA 5C4GB 2BY5X 4MDFA 3D8BA 2FNAA 5ETXA 1QQUA 3P6ZB 3TR0A 1E9DA 1YR7A 3Q76A 3RU4D 3UIEA 2IYSA 1HV7A 1Q1ZA 2VIWA 1KLTA 5L3QA 5I46H 1SG8B 4B2CA 3C15C 3ZD6A 1E1RD 4Y0YE 1GRRA 4B47A 4ISIH 2STAE 1FXYA 1P75A 3WP0A 1DOAA 1YCPH 1BTHH 2VWMA 4GHQA 1P6XA 1E35B 4DT1A 3BEUA 1PJRA 4X6PA 1GBFA 4LZ1H 3I3SR 2IYTA 3EARA 1GMDF 3FP8E 2ESTE 2GRJA 3SJKA 1DWDH 1Z0IA 2J94A 5TARA 3I78A 3GCNA 2P8OB 621PA 1TTTA 4QGFA 3MU0A 4Q1BA 1KIMA 2FN4A 2FOGA 2NZ8A 2HJGA 4TQAA 2ZYTX 3MMGA 3DT0H 1QBKC 1HPGA 3OX7U 3RS7A 1N25A 3OEHA 2V55B 3BTFE 1VCOA 1E2EA 2V7QD 3CR8A 3CKLA 3T61A 4UFDH 3N7OA 4C0SA 3QVVA 3ZQJA 2AIPA 1AQ7A 1G9XA 3LJOA 1RKBA 3RXRA 4WA7A 1T8NA 2QGZA 4WOPA 2C04A 2F9LA 2F9UA 2ZFRH 1T5LA 2Q9BA 1XTRA 1FQKA 3KTAB 4O25A 3ZZ7A 1Y3UA 1TNGA 5J4YA 2O0JA 3FVQA 1JPNA 3K70D 2AKYA 3MJHA 4A2QA 1EFTA 4A0FA 1EOLA 2JH5D 3ZZ8A 3UFAA 2Y8EA 1DBSA 2A2XH 3RDPA 1WRBA 4E07A 2DE8A 3RS4A 1S0QA 5C1UA 5KDOA 1A0HB 2ZDNA 1NFUA 1F0RA 4DDUA 5DJ7A 3K0CC 2ZGBH 1XTKA 2ODYB 2GDDA 2FP7B 2I4IA 3NVAA 2QM7A 1PYTC 1H8DH 1TAWA 2H5DA 4HUQB 5FL7A 2A7HA 1NVXQ 1AN1E 2HF9A 3BFKA 1OWDA 5GWZA 3OIVA 1IQPA 3QKSA 4NCHA 4RVCA 3JZAA 1KNQA 4PX9A 3SHCH 3IEVA 5HM9A 3U1IB 4M2LA 2GMTC 2J0SA 5J47A 1LVYA 1MTVA 1LTQA 4RKJB 3GLHB 1MO3A 4Q21A 2H9EH 1BB0B 1N5LA 1DAIA 3LGVA 2EU8A 3P32A 3PFIA 1ZM4A 1ZYUA 4IDHA 3TW4A 3NHBA 1BTUA 2WINI 1C4V2 5J4HA 1JXPA 3RVBA 2KI5A 2Z7FE 2BWJA 3Q9LA 3IHLA 3DKVA 2NGRA 4N1AA 2GD4B 1VG0B 1ZSKA 2ZJBA 4RD0A 1XJQA 2V54A 1IJFA 4D7GA 3F9HA 4A1XA 1IN7A 1NMXA 3K8YA 8GCHG 4P32A 1HXEH 2BCJQ 1OWEA 3GCTF 2W6ID 4GHTA 1M9UA 5DI3A 3S1AA 5FX5A 3LVRE 3MH5A 1LNZA 4HLDA 3SZEA 4LHWA 5T6GA 3SE0A 1PLJA 5HYOA 3B5JA 1F5NA 1Q3HA 3N70A 1GHYH 2R62A 4OQMA 3M5OA 2TPIZ 1OHHD 4UNRA 1J99A 2IWRA 3A37A 1E9SA 3LGYA 5FPKA 5FXLA 4FXGH 4A82A 1FUKA 2TMKA 2HF8A 1SVWA 3ZIAA 1F0UA 1TIOA 2W6JD 1XKAC 1F0TA 1YPMH 5E0JA 4PAOA 1KLIH 1LHEH 4JK5A 3UWJH 3KUDA 4YZUA 5E7JA 1XXHB 1K1MA 3BD9A 2IN2A 1K1JA 1GBJA 4AOQA 2CJWA 3UWKA 1ZM9A 2G1KA 4Q00A 4M22A 3LH3A 4NYJR 1CJTC 4KU4A 1NMYA 1Q3XA 3SGQE 3E6PH 2JKHA 4XSHA 1D9XA 3TK5A 2F6RA 5FH9A 2ERXA 3EIEA 5LGOA 1MD8A 4RFSB 5DYGA 3LGUA 1AJEA 1XCPA 3I29A 1KSJA 1QHGA 3KQUA 1F92A 5PTPA 1ZNYA 1IJEA 1ZAKA 1HH4A 4YDHB 1GJ5H 1YGCH 1G8PA 1C5XB 4WXRA 3KQHA 1V2ST 1Q3TA 4X1PU 4BAQB 1US8A 5HZHA 4TSFA 1XZPA 3PENA 5DSZA 3RANA 2J4IA 1ELAA 4B48A 2ZHQH 1Z6EA 1K5DA 1FMGA 2IUUA 1NN0A 2XXLA 2AFIE 3B13B 4JVSB 2QXHA 1JRTA 1BBRE 1TQDA 1TF7A 2AMDA 3KXIA 3PEWA 3QE0A 4FMDF 1I4DD 5JRJA 1LVOA 3OY6U 4MRSA 2CXXA 4LV5B 1ZBDA 2OAP1 1G19A 3GJ4A 2JLVA 4QFMA 1QBVH 2O8FB 1P2QA 1JPJA 1NY6A 1NMZA 4OHVA 1MBQA 2KSQA 4EUNA 2O8DA 4NCIA 3ENSB 1P04A 2A4QA 2TGPZ 3U1JB 2YWEA 1P2SA 4TYWA 1S0UA 2ODQA 1BBRH 3M3VA 4NG9H 5FOXA 4YOIA 1MOZA 4LY6A 2ZFFH 1T9HA 2OG2A 1KI6B 1OIWA 2ZQ2A 4DT7B 5EXPA 421PA 2OFWA 1S6HA 2AMQA 6CHAB 2BX3A 4MRNA 2ZI9A 2ANWA 1XEWY 3EDXB 1NF3A 4FMDB 1Y3WA 2ZS7A 3KQLA 5EW2H 1GWNA 4RD1A 4HATA 4DUGD 5HMAA 3BN9A 4BXSA 3K0EA 1D8TA 2EWVA 4BAOB 1CBUA 1R7RA 1E34B 1P7CA 3U8OH 1DM4B 4BFXA 1QHSA 4NHOA 4HAZA 3QDZB 2V6NA 4EJSB 2PGQB 1TUIA 1UVSH 3W8NA 1OH7A 1S4QA 2BQWB 2SGEE 1HB0B 1UBGA 3DM9B 3OAAA 3SHWA 4Y0AA 3NHAA 2IUSA 3TLOA 4KO8A 2QQEA 2H57A 1S6FA 3AF1A 2RGXA 1IY2A 3EG5A 3KKQA 1RRPA 3OEED 2DFNA 2QP9X 3VNVA 1P2NA 2HXSA 1FW6A 4TWWA 1IONA 3RXPA 1II9A 3I92A 1SXJA 7GCHF 1SVKA 2Z0MA 1R0XA 3GLGE 1BT7A 1E9FA 1ZU4A 1UAAA 4KBFA 2PT7A 4TYDA 5ESBA 2JLWA 4XSGA 3NTUA 4LJ8A 2BD4A 2JETB 3QVUA 5FUXA 1IBRA 1O2PA 5E8EH 2FI5E 3P17H 4RD4A 4FCWA 4DSTA 1VITG 1P4SA 3ICQB 2ZU1A 4BZQA 2ZJ2A 2ZFSA 1O5FH 1C5SA 1N6XA 3NXSA 1HAGE 1E9RA 2NQ2C 3EC2A 1O2IA 3D31A 1D3QB 3CS7A 1JBKA 1SKQA 1XJCA 2WZQA 4OM9A 4F49A 1P62B 1J2JA 2SGDE 3AVVA 1W0YH 2OBOA 5GADl 1ZZZA 4LGMA 1ESNA 3ZZAA 2YNMA 4Q03A 5L2ZH 5KNDA 1HAVA 3PO1C 1XP8A 4OI0A 2SNVA 3BEFB 1U9IA 5LBIA 2DYKA 3SNDA 1FOEB 5AR1A 3GFOA 1ZW6A 1ZTKA 5JHHB 1ZRKA 3MG9A 1HGTH 4WJG2 4GPTA 3C4JA 1ZUHA 1E2HA 3GP8A 1BJVA 1E79A 3VU9A 2Z6BD 2CVFA 4Z1MA 1S1MA 3E91A 2I6QA 1E32A 2RGBA 1SSXA 3QG1A 1E37B 4M1OA 2HXYA 4QOSA 4IEIA 3TE6A 1GMHF 3C5CA 2YKGA 3O47A 1V2WT 1FNMA 2GKSA 4U30A 1KDOA 1EPTB 4TPYA 1BRCE 4KVAA 3S9CA 1BYUA 4U01A 3H86A 4Y8YA 3FP7E 2PW8H 1WE2A 1KXCA 1W12U 3O8RA 2ZJ8A 4LWZA 4R98A 1OYQA 2DHRA 2F43A 1T4GA 1GCTC 3VR5A 2AHOA 2H16A 1SKYB 1SFQB 4IOJA 3AVUA 3U6KA 2VL7A 3MWJA 1EJMA 1K1IA 4LHXA 3MFYA 4X2WA 3HU3A 4B32A 5A09A 1Z47A 4TWZA 2P3SA 3K0AA 1II8A 1F2UB 1ZIPA 4D4LA 4M1YA 3VX3A 5JJKA 4RCYA 1GDQA 1KAOA 3P8GA 4I8JA 4V0MA 4BFTA 2WV9A 3GLHA 4DLSA 4BWYA 1SGCA 4FN5A 2QE7A 2R6AA 4BLRA 3U7GA 1Z8JB 4K69A 3KCGH 4I8GA 3H2YA 1QDEA 4ABJA 2YC4C 3KKMA 3HU2A 2F91A 4KHZA 3S9AA 1IHTH 2WUCA 1SQAA 2FV8A 4IMZA 2WWXA 4LZ4B 2H9TH 4DLUA 5KHOC 4LSGA 1N2CE 1C5TA 3OHMA 2Z3DA 3C41J 4MKHA 4X8UH 4K1EA 1RJXB 5DE3A 3RLFA 4I31A 2PZFA 1DARA 2UVQA 1WUNH 1U0HC 1C2HA 3EZ2A 1EX7A 2OLJA 1CHOF 3QZRA 2GJ8A 3SUGA 3U7EB 1O2MA 1TOMH 1A5GH 4NFFA 2QMHA 1TADA 2W58A 4QJ5A 4TSFD 2GZAA 2UZIR 3U69H 2J7PA 5F6MA 1NM6A 1TONA 3PLKA 3CPEA 5CDFA 1GDUA 4Q4JA 5FR2A 1TMBH 2ORWA 4A6PA 1SGYE 1DE7H 5DYIA 3KQKA 4M1KA 1XRJA 5E0GA 3H84A 3SV8A 3R20A 1MO4A 1RJ9A 1AVWA 3Q8XB 2EQBA 2XNIA 4B44A 4DCUA 3ZQ6A 2B8TA 5JLJA 1NP6A 3BGWA 4EFLA 1L1JA 3B9FH 4MYCA 1T8TA 4PHGA 1ZJ6A 4HDCA 1RXPA 4OS4A 3FOZA 4LJ7A 1TMUH 5DGJA 3MNSA 2Q6FA 4LYJA 2ZSDA 4DSUA 4FU7A 1UEIA 4JYCA 1GHAF 3RXHA 2WKRA 3RABA 2GV7A 3I8SA 1TALA 3MRSA 2BY7X 3TBKA 5KO2A 2A2QH 1YR9A 5E7IA 1G3RA 1CR2A 2QL6A 7KMEH 1TE0A 1GCDA 3LQRA 2C9YA 3FMIA 1N5KA 2ONJA 3RRNA 3CX7A 2J7PD 2Y5HA 3PG5A 3V0XA 2H1UA 1QA7A 3RXGA 4I7YH 3EA5A 5AUQA 2UUFB 1WQSA 2G8TA 5TCCA 3SV2H 1IXRC 2ZWLH 2IBMA 1FFHA 1SVMA 1AM4D 2YINC 1Z83A 4PPQA 2C2HA 1N3BA 2A4GA 1TX8A 5G4BA 1F2TA 3REFA 4D4JA 3W6OA 4Q2KA 1CA0B 2LKCA 4ZDWA 5M04A 3SOPA 1C5MD 2RHMA 1HLTH 1QBNA 5DGXA 3SUEA 2VB0A 2A5JA 2CK3D 1TABE 3FVFB 2AL7A 2W6IA 3TITA 4IW4E 2V4ZA 4KKDA 1C1UH 4GOXA 2ZETA 2GF9A 2GEUA 3SU1A 3A85A 5EU8A 3MWKA 2K1QA 5EE1A 3AH8A 1RTKA 3A1WA 3QEOA 4YMTA 4JLMA 1K1NA 1NG9A 3CZQA 3AVPA 4AYWA 3T62A 2QT1A 5EXNA 2NO7A 4AG5A 1XD9A 3T29A 2GZDA 3WYGA 3SYLA 1W46A 2HNTE 3FKSD 4PZYA 1HUQA 3SU5A 1TPZA 5DPAA 5HE9A 4ZHLU 1O2VA 221PA 2A7QA 5F03A 3RP2A 2ZHEH 3LX8A 4R0IA 4P4UA 4FUFA 1NG1A 1KSFX 1J7KA 2BVNA 2GJ9A 2HEIA 2BOHB 2GK6A 4DSOA 4BPBA 3DMNA 4WZBE 1SQOA 1GI7B 2OFXA 2ZPRA 3TUIC 2FOMB 1ZC4A 1EP5A 1C1TA 3Q3YA 3QBTA 4NTZA 2ZRDA 4A8JC 3R3GB 2HDNB 1W1WA 1LB1B 2ZJYA 1DTSA 2OC0A 3NWJA 1XD2B 4DEYA 4JL6A 2HCBA 2EI6A 1E2QA 3N5CA 1ACBE 3AUYA 4N0EA 1UVOA 4JLKA 1UVTH 1K8RA 4NONA 3MSXA 1D6RA 1M6NA 1MKWH 2CLCX 5H68A 3ZZCA 3WRYC 2DFLA 1SVLA 4YDSA 2ZSAA 2DR3A 4WVPE 3LOXA 1GHXH 2X2EA 1TWXB 1KYNA 4HLCA 3W6NA 4AB9A 2Y80A 1SHZA 3LH5A 2BC9A 3STIA 3U8TH 5HZKA 1G3EA 3LBHA 3ATWA 1XUJA 1HV8A 3Q77A 3ADKA 2XB2A 3WMFA 1U94A 1UTNA 1RRGA 4MPVA 2WHXA 1RYFA 1P2OA 6ESTA 3GLFB 1UCYH 4PHTA 2OT3B 5EQQA 2J46A 4E03A 2G88A 3H1TA 4EPXA 5JSZB 3AP2A 1TMKA 4URUR 2O8EB 3LQQA 2NOAA 5F2EA 1MKXK 3A8DA 2XBVA 3MHWU 1G3IA 2HJVA 1OXGA 1AS0A 2ZU5A 4Q1CA 1M7BA 4NYIR 3CO5A 4CEIA 1IY1A 3FKQA 4I1VA 1UVPA 1O0DH 3E90B 4BUJA 1S1CA 1X3SA 2TGTA 3BV9B 1GMDG 4BZXA 1TBRH 2WPHS 5AVDA 1TEXA 4GSYA 1GL6A 4DDTA 2BJWA 3OIYA 3VB4A 4XVQA 7ESTE 1O31A 2X1VA 2GJKA 3RU4T 2LPRA 2VP6A 1VJ9U 2ZTZA 3VU9B 3NC0C 5EP2A 4GT1A 4Q4AA 4WZAE 1D2EA 3CNNA 1QG4A 1CBWB 2OESA 3HATH 3AP3A 1J15A 3GLGA 1GM5A 1CJUC 3CB4A 4PXAA 2AFHE 1FP7A 4X8TH 3U9AH 1IQMA 2OM2A 3GCOA 4X6MA 1QHIA 1OKKA 3K9GA 4OHYA 4X8MA 4HFPB 5J4LA 2MMCA 1VGCB 2ANYA 3KEEA 3KL4A 3AW0A 3QOFA 2AIQA 1ZPBA 2WPMS 4WH6A 1CVWH 1NN3A 1CT4E 3GJ5A 3THWB 2NG1A 1HAPH 2OINA 821PA 1H9LB 2XJ9A 2QY9A 5KSZA 1QIXB 2Y6TA 3RU4E 4UFEH 1AIPA 4BFWA 3EA8A 3QKSB 4TQUS 5LPFA 3RSOA 5FPHA 1BHXB 1WU1A 4QJ4A 4Z51A 5SZIA 3JVVA 2SNWA 1HAYB 1O37A 4Q9KA 3T28A 1QB1A 3JZMA 1G1MA 2GNOA 4MKFA 2Q9CA 3IBYA 3KDSE 1O5BB 4A36A 1EQ9A 3GISB 5C20A 1JXOA 1R2QA 3U3OA 1DUAA 4E7RG 1KI6A 2XTNA 2FEOA 3P70B 4ABEA 3L82B 2GA8A 1GI6A 1PZNA 1D5CA 5FOUA 2JJ2A 3UNRA 2JLZA 3SO3A 2RHDA 3K53A 4C2TA 5EG4A 4W7SA 2AK3A 1QURH 4MGYR 3KJHA 3HPTB 3H4MA 1EFUA 2F3CE 4NSYA 3GQBA 1EASA 3BEIB 4EPWA 1KXFA 1F2UA 1CRPA 2ZVPX 3LW7A 1W2GA 1WXRA 2W3IA 1OH5A 4AFSA 1OP8A 2GVDC 3GCTG 4LOYH 2QSZA 4DCNA 3TH3H 2GCNA 1THSH 2FYRA 1H9HE 3DM5A 2F1JA 2CMYA 4MQAA 3QSYA 1EXMA 1WBDA 1SULA 4GVUA 1UTQA 3V7TA 5DIFA 1II8B 1HE8B 2O8WA 3VB7A 3BB1A 2ZRAA 2NTYC 3RHFA 1KY3A 1DFPA 1OWIA 4D25A 1W3CA 1QJ6B 2C8YB 3SEAA 2W6JA 1E2MA 1ZM2A 2FLBH 2A45B 3BJIC 2XZLA 2HLCA 3SU4A 1C5ZB 4XOJA 3K0SA 4L15A 1JJ7A 1O3IA 1G8GA 1HUTH 3HR7A 1PUIA 4HTCH 5H4IB 2ATVA 2BMGB 5ANRB 4OGXA 1OFUX 2RGEA 1MUEB 4JJKA 2Z6VA 1WCV1 2MMGA 3X1YA 1U9IC 1DITH 1FMJA 2FE4A 2REXB 1A61H 2ATXA 3VHLB 3ADDA 3TSOA 2GCTC 5DNYB 3M5MA 4P3YA 3U7FB 3BG8A 1C1NA 1C4U2 4U00A 3M1IA 2XWBI 1XPRA 2J5XA 3GICB 4UFGH 5EPYA 1KJZA 1L1NA 1YRAA 1UVUH 5A4JA 2VWLA 4B2BA 2OBNA 2Z9GA 4ZCIA 1QRWA 1VHLA 5GJCA 2O8UA 2PEZA 9ESTA 1VG1A 2ZI4A 2QPOA 2EYQA 1NVUQ 4JBYA 1VR1H 3RXEA 4INHA 3LNCA 2RCNA 4Z6AH 1YPEH 1CP2A 3A7WA 1E0JA 5SZKB 4NYMQ 3ZYCA 3VNUA 2ODBA 1EFCA 3U61B 4FVDA 4LC1A 1HBTH 5EZ5A 1XVOA 3QXJA 5JMTA 3SJAA 1P05A 1HNEE 1RIWB 2QXIA 3TVJB 4A6LA 3SBKA 3R7WA 2ZSBA 4PANA 2WPKS 3A1VA 2ZTXA 4CEHA 2QF3A 1PQ8A 4Y6DA 1V2NT 1VCMA 4D76A 1Q1QA 1DVRA 1L2TA 1ZRHA 1A82A 3D49H 1ZMNA 2IYQA 5SGAE 2BOKA 1ELCA 3AQ4A 4OHZA 3UPUA 4F93B 3A8CA 3FYHA 2G1JA 1QRAA 4I33A 1E2GA 3ZVLA 2R3UA 1Z22A 2ZI6A 1Z6JH 3D62A 2IPHA 1CT2E 3ZVMA 2J9RA 3A84A 3HYTA 2FFBA 3SZNA 2RGCA 5GCHG 4Q1EA 2EC9H 1XKBC 3SBEA 4F38A 3PV2A 1TL7C 4DIEA 1G2LA 1O2KA 5L2YH 3ONWA 2WOJA 3UOUA 2WWWA 2ZROA 2IS1A 1TB6H 2D06A 1CLUA 3SN8A 4NIXA 1FN6A 4D0GA 5AJVB 2CBZA 1FPMA 1ELVA 3QPVA 3QI2A 3SORA 3BTWE 2IYWA 1KZ7B 1B0UA 4RSPA 2B9LA 3NIBA 2R6DA 4MRRA 4DEXA 3F9EA 4YOGA 3ZVNA 5FOTA 1UTOA 2Q3FA 2UWOA 1RFLA 1IAQA 2Z9IA 4M0LA 4EQ6A 2C9CA 1E3MA 2IA5A 1E6CA 2VGCB 3T1QA 1KK1A 4GOJA 3TIUA 3GEEA 1GJ4H 1VITF 4ZCMA 4NFEA 2W2VA 2Q3HA 3WNDA 1GHAG 1DT2A 4LBWA 1KZGB 3ZYDA 2ZA5A 2OXSA 2XAUA 2VIPA 2IXEA 3KJIA 3BTDE 2GCTB 1NFYA 4U2WA 2FG5A 1O2JA 1DSUA 3I62A 1NBME 8LPRA 2PJRA 3A80A 1OB2A 1UHBA 1BZXE 2ECKA 2GKVE 2VU8E 5AHGH 3IDQA 1C9KA 1ZP6A 2OUAA 3LPRA 4KGAA 3GEHA 3R7WB 5BN3A 1JXMA 5KDLA 4ZROA 4NPHA 4B75A 4RKFA 3CF2A 1LQDB 1YRBA 1GG2A 1QL8A 1ELFA 1O35A 1GSIA 3DPUA 2EVWX 1MABA 4HZUA 2W2XA 1ZHPA 3VMFA 2Q6DA 2GXQA 5JI2E 3UTUH 1QVRA 2A5GA 3F68H 3RXSA 4K60A 5EE3A 1NVVR 1LDTT 4IFEA 5AFYH 3CUEF 5HGGA 3LGWA 1H8HA 5HM2A 4Q7XA 1ZCAA 3LBNA 4M9QA 2QBYB 1JEEA 3LXRA 4K8BA 1FZZA 1DO0A 3A1TA 4DGJA 3FB4A 2FPMA 3RXOA 3UWOA 3ZVGA 3GY7A 4A2PA 2RH5A 1O5CB 1QHNA 3MMPA 1N0VC 3L0OA 4EPRA 4QL3A 3BWDD 5F98A 2B8WA 4ZXXH 1O2QA 2GTPA 3PUWA 1FQ3A 1R5OA 1XMSA 5LD2B 2D8WA 4B3CA 3SNBA 1BA8B 3W94A 3IITA 1YE8A 1T6NA 2WUBA 2ZDMA 4HSEA 4C0QC 4EKDA 3QN7A 3Q5DA 2WM9B 4LHYA 2PL3A 2IXFA 3AKDA 2FPKA 5IDVA 5FPSA 3RXUA 2ZQ1A 1BIOA 1NN6A 1V2OT 2DE9A 1KTVA 4XDEA 1O3OA 1B7XB 1UK4A 1L4UA 5J40A 2JIZD 4FUEA 3RXAA 2BEJA 3IBGA 2BLWA 3ATMA 2VIDA 1V2PT 3THXB 4ZMAH 4GBMA 3F8TA 5FAHA 3EIHA 2ZYVX 5E95A 3ZJYA 1YZLA 2OCPA 4IJMA 4DWJA 1WAYB 3MUFA 4Q7JB 2D74A 4C4PA 2I1VB 4YOJA 1R5NA 1U0JA 1E1QA 4DCDA 3TJNA 5ELXA 3W95A 1FAXA 2JLXA 4OJQA 2C8ZB 1GRQA 4KTSA 4TMVA 2TBSA 4CBOA 6Q21A 2AMPA 4UJ3A 4E7NA 3EZ9A 3SU8A 4V0OA 1HIAA 1DG3A 3M7QA 3PXGA 1DY9A 2GT7A 5FCRA 3AAUA 1YC0A 4MYTA 2QGRA 3CBQA 1G3CA 4PHHA 3K70C 1QVAA 1C1WH 4IC6A 3TNTA 5HCIA 2FZLA 1ZSLA 3I72A 1KXBA 4PQRA 2CEAA 1BBRK 121PA 1XEXB 1BRBE 1THPB 2IYLD 1NLFA 3R0FA 2Z9JA 1T91A 1Z6AA 4LJ5A 1TA2A 6CHAC 1K1LA 2VHQA 3MOCA 3T25A 1N6RA 4KODA 2ZI5A 2VHJA 4R71A 4X8LA 5EXSA 1Q1BA 4A8JA 4WH8A 1UKEA 2XXAB 3QUMP 3HK3B 1X8KA 1XWIA 3UY9A 1AN0A 1ZSJA 1GZSA 4MRVA 4PZLA 4BLQA 4KBGA 2SFAA 2CVHA 1FTNA 2ZREA 2P95A 2ZJ5A 3GJXC 3RMMH 4UJ5A 3CR7A 2FGKA 4FMCF 3SYKA 1GI9B 1TEVA 4V03A 1Q1EA 4A2WA 2B8OH 3PUYA 3S7HB 2ZCKP 1HE1C 4O3TA 1H8EA 2G3YA 1TX7A 3JZ2B 1CKEA 3A58B 8OHMA 1QB9A 2VA8A 2XCNA 1W14U 3FANA 2PX0A 4D2IA 2GHIA 4FW9A 1PVOA 4CVNA 3CP7A 2BDAA 3CPHA 4QBFA 3N2EA 1G7SA 4OGYA 4P4SB 4DJTA 2J7KA 4YMUA 3SGAE 1FIWA 1YLCA 3AK5A 3SJZA 3V9PA 5D3MA 1T8OA 2A3RA 1CJMA 3TK6A 3K0AB 2VHCA 1EXFA 4ARZA 1NIPA 5EJEA 1IM2A 4FUDA 1P9SA 1SGPE 2Y82A 4RY2A 5CK4A 1HYLA 4B71A 1SXJB 3ESTA 2ZG0H 1PV4A 1AUJA 3NWUA 1O2YA 3TJVA 1TGBA 1CULC 3B78A 4RD2A 1HAHH 2HWLB 1NBMA 3CWZA 3URCA 2QP4A 3CNOA 4B3XA 3ADCA 1BRAA 3VR3A 2EFCB 2EW1A 2G4UA 4RZUA 2BM2A 5DO9A 1TNLA 2P8OC 1A3EH 1F48A 2B5TB 1THRH 4NWLA 3SQWA 5L3QB 2AD1A 3TW8B 4Y7BA 2QE7D 3I73A 3D23A 3TJUA 3RS0A 2BD2A 3MLEA 3C16C 1A5TA 4HI3A 2TGDA 3V00A 1QHYA 4V0NA 2X8AA 3UK6A 3RXJA 4M1WA 1XB2A 4CRAA 1G4AE 1TAGA 1SGNE 4YT6H 1NLYA 2JLYA 6LPRA 4C7OA 3IGFA 4TN1A 1LPGB 5FUWA 4KITB 1JALA 3QY0A 2VLIA 3Q72A 1GHZA 1JI0A 2XC5A 2RAPA 3RXCA 2KB0A 4JLPA 3P27A 1WSSH 1ESBA 4C9BA 5FBVB 1OKKD 5GVSA 3M37A 1IQHA 3GYLB 4FCTA 3UREA 4QKQA 2XX3A 3QTVH 3ZD7A 1GJ6A 2O8DB 4OK6A 2V0BA 1ETUA 2G00A 4A0RA 3R8FA 4ABIA 4EDHA 3EQ0H 4FCVA 1UDXA 2GJAA 1O3NA 3RDZA 3FHOA 2CXVA 2ERYA 2FOEA 2ZRCA 1II0A 5LPRA 2QGNA 3L8ZA 1DADA 1VCQA 2IL1A 2NIPA 1G3QA 3FTQA 1W0KA 4Q7MB 1CO7E 4IRUB 2P93A 3SJCA 1A1VA 1KDQB 1E2JA 3ZLJA 2MSCB 1MKXH 4OQNA 4AG6A 2D2EA 1YPJH 1VPLA 4M53A 2D26C 2WPLS 1O2LA 4OHXA 1JR6A 2FX6A 3QBVA 2QG6A 2VVUA 4E5UA 1FX0A 2PBRA 2RG3A 4LK4A 5DN6A 2XJ4A 4TTRA 2G0TA 2VF8A 3U3MA 2ONKA 1QRZA 4I8KA 1BS1A 2SGFE 5EXMA 3BAFA 4RJLA 4Z54A 2ZHDA 2J87A 4JLAA 4B1TA 1CHOG 1C1QA 1HT2E 1ABIH 2XSZD 4PHFA 2G51A 4IOMA 4CRFA 2Y81A 2Z94A 1ABJH 3QJYA 3ZVDA 2J38A 5DN6D 3BTQE 2H5EA 2WMOB 1X7AC 1UCYK 5A8YA 1Z8FA 5HR5A 1DXPA 2WV4A 1LFDB 1ZCBA 2NZJA 3P8NA 1G7RA 4EPYA 3KF2A 4CDGA 3UOPA 4EFNA 1LTOA 4YMWA 2W5EA 3P8OA 2F55A 3PUXA 3QK1A 2W2TA 3SUDA 4F4JA 1NKTA 3IWMA 2P3FH 1SGFA 3DUXH 1EWQA 3P95A 1SXJD 4ZHAA 3KL6A 1RRFA 3ZVRA 2Z3EA 3U44A 1C1PA 4M7GA 1IHUA 2XBXA 3OTJE 4ZH8A 3ZV8A 2A31A 1FPCH 1TU3A 5BXQC 4MPWA 3LW8A 3NUMA 4MKGA 2N46A 4YXWA 2PZEA 1ANEA 2P59A 4B6EA 1Z63A 3I32A 4B73A 2ZCLP 1NFWA 2J34A 4ZDIA 4A1TA 3K6YA 4PSAA 1DELA 2RGAA 3LU9B 3VPKA 5AJXA 3T5DA 1OF1A 2NO9A 3W90A 1MBMA 4H42U 1KMQA 3V13A 1GL0E 3HK6B 1AGRA 1UTMA 3WMGA 4Q4AB 4JYUH 2ZEJA 2MSEB 1G6OA 1OXSC 1SHKA 4DDVA 3QZQA 1UTLM 2CHQA 3X1ZA 1GMHG 3FFAA 3NDBB 1A1RA 3KKNA 1G18A 2A5FA 4HLQB 2PMDA 2ZZUH 1YPLH 4D6PA 1AUTC 3PV5A 1ZNZA 3RM2H 2QENA 4QG7A 3E1XB 1NY5A 1V5WA 4QHYA 1GDNA 1NN1A 1JNYA 1FY5A 2WSMA 2AR7A 4ABAA 4JL5A 1C2FA 1UKZA 2R3YA 1HJ9A 1R8SA 3GJ0A 4NA9H 2DPXA 4P0TA 2BVXH 2C4FH 1QHHA 3NKVA 1GCTB 2QAAA 5C2JB 4M1SA 2OFOA 3M7TA 2VP9A 3OE7D 2UZ3A 5JI3E 1O33A 3WHLA 2AWNA 5CJPA 2HCJB 4L5BA 4XD7D 5K8LA 5CB6A 5DO4H 2QPAA 4Q4LA 2ZECA 1KO7A 3RM0H 2BQ6B 2VSOA 2V6IA 2C8XB 4AN7A 2P94A 5KTYA 3OZXA 1NC6A 3FZDA 2R65A 2OCVB 4IFBA 5AWFC 4D0NA 1FNIA 4XBDA 3Q3JB 2K5UA 2CNWD 3DOFA 2D62A 4NL4H 1XMJA 2ZFPH 3CRW1 1W36D 2R8RA 1XTIA 1N6LA 4GMDA 4IKEA 3ZZBA 3PUZA 1RPZA 1BTWA 4WMFA 1Z6TA 1H8ED 3M5NA 3BS4A 2ZKSA 1F5KU 3WBKA 2RA3A 2X2FA 4DLTA 1O3LA 5IK2A 4LBYA 2FMJA 1TQ2A 2XZOA 2KBEA 1J9CH 2Q6TA 2JLRA 3HKJB 1AO5A 4URZR 4LBZA 1SMFE 3ZIAD 2ZI3A 4LJ9A 2BLQA 4BNRA 3CWQA 1GL7A 3FGNA 2CLDX 2G6BA 4DT1B 3GDVA 1KI1A 1OHHA 1VYTA 3EIQA 4XD7A 2QF0A 2ZUCA 1ZINA 1YF4A 4X0WU 1LMWB 4KSCA 5JHGB 2I3BA 1G3DA 1SI5H 1NJFA 4RSGA 1N6HA 1WQVH 3ZS9A 3RWMB 3RC5A 3X2SA 3SR0A 3KNXA 4A0HA 2VP5A 4JVLA 3RXKA 4ISHH 1N6OA 4CT5A 2XB4A 3U44B 1J70A 4HAWA 2VPPA 2AN9A 3GLFA 2KBFA 1W44A 1MR3F 4OS7A 1QNJA 2IXGA 1BQYA 2ZU4A 2ZRKA 1DLKB 2PH1A 2CJIA 1ELBA 3RAPR 3RMOH 4IBLH 2ZO3H 1TQ6A 2Z43A 4YTAA 5TMPA 3W3ZB 1CEEA 2BY8X 1O39A 2OCAA 4TLBA 2IS6A 1S85A 3S69A 3ECCA 1FLEE 1W2KH 1O3BA 2DBYA 4LCBA 1ZU5A 1OKXA 4DIHH 2H2ZA 1WP9A 2JLQA 4JBXA 4CHAC 4DLVA 2FFQA 3TR5A 2VVCA 2ZYWX 1U0LA 3BTKE 2P3UB 1E9BA 2B92A 1XXHE 1AKSB 1O2ZA 4XTRA 3LONA 2A4OA 4H4FA 3X1XA 2VP0A 3B60A 1KK0A 1BMLA 4JSYA 1KI4A 4Q9LA 4JLBA 4AYYB 1Z08A 1XPUA 2PMKA 1C2GA 3D3QA 2VINA 4AKGA 2QY0B 4G3XA 4YO9A 2GVFA 1A46H 1NROH 3WYAA 4PAQA 3M4YA 2NO6A 1L7VC 4CRCA 2XC4A 2V9PA 1NRNH 1Q31A 1XCMA 1HIAB 4YMVA 1R0ZA 4MNYA 4P4SA 1Y5AT 1ELOA 1KI9A 1U98A 1WXQA 1NN5A 3C5HA 1J8MF 1CGHA 1TNIA 3ATLA 2ZPSA 4BEBA 1T31A 3I4LA 3J81k 1T0JB 2JEOA 4PC1A 1ZD1A 2WJIA 4TTQA 4UNPA 3VXEH 2QROA 1JR3D 1WYKA 2WTUA 4W5HA 4S2EA 1XD2A 5B6OA 3KKPA 3FE2A 1KIGH 2R2MB 3B23B 3EWAA 1TRNA 5FTJA 4XSKU 5JBCS 2WWHA 1GRNA 1AHTH 3RMNH 2IYZA 2Q1JA 3B2EA 2OC8A 3JZ1B 4IDQA 4D7FA 4ZKRU 1OX1A 5TJXA 2QI9C 3D6TB 5KYKA 3K09C 1MMJN 1ZYOA 4A1FA 2GF0A 2QYIA 4MYHA 1LS1A 3QF4B 2VIOA 3GY2A 2ZRHA 3WP1B 4KV9A 3E0PB 1P2MA 2JH0D 4FUIA 4HZUB 1ZC3A 1GI0A 3SI3H 4BEJA 1G30B 5FBLB 3L0IB 1XM1A 4NSVA 5DP8A 3UWIA 3AM1A 1XTSA 4X1SU 1S9DA 5TVKA 1F6BA 1W4AA 1P61B 3C14C 3RS5A 4HDOB 3T26A 1E0FD 5GJVC 5FUYA 2XTTB 1RYHA 2Q3MA 4IGDA 1RD3B 4BTIB 2GCPA 1T8MA 5TY0A 2Y5FA 5FPYA 3VR6A 1ZTLA 4II7A 2J0UA 2AFQB 4MVNA 3Q7QA 1GKIA 1BOQA 1ETTH 3BG4B 3TSWA 1O5GH 3TK1A 5C5OA 2PKSC 4HLUC 5T3HA 1A2CH 1P10A 5LH8A 2TGAA 1CXZA 1G16A 5EW1H 4PPNA 2W0SA 1R6BX 4URVR 1NLZA 2V3OH 1GAJA 1G3MA 4MGZR 1COWD 2ZPTX 4FUCA 1W47A 3AF0A 1V3XA 3KGPA 4BECA 2IS4A 1R0YA 1DUEA 1Q22A 4OI4A 1EZUC 2O5VA 2ZFQH 4D4KA 1NIJA 5J4KA 2WBLC 1RIFA 4Q5IA 3SFVA 2J0UB 1MQ5A 4IVQA 1D3TB 1E2IA 1PPGE 4DDWA 3REGA 3NKKA 4G5RA 1L8QA 3AF4A 1LVMA 1P8VC 4MPXA 3T5FH 1Z2CA 4HB3A 1YCPM 4JKIA 1NBMD 3HGNA 2C5LA 1HJAC 2FOFA 2WPJS 3FFBA 1Q44A 3P26A 3ATKA 2D4HA 1O32A 4TLDA 5JSZA 1O2RA 2BEKA 4F91B 4PC6A 3L3TA 3RC3A 3L0PA 1NL3A 2QTVB 3QKRA 2ZGCA 3AAVA 2BKUA 5TV2A 1GNPA 3MD0A 2EEKA 4Q1FA 1G7CA 2ZI2H 2Z4SA 5G40A 1NRQH 1P06A 1D2NA 1CTQA 1Y5UT 2OQ5A 3SN6A 1XVMA 4GSOA 3TGIE 2WPIS 1P57B 4QGHA 5JWRA 2C95A 2P5SA 1PPFE 4FUGA 1KY2A 2WSSA 1MH1A 4EAQA 3KQEA 3NEYA 2WYGA 1MAYA 3L8YA 2GT8A 4XIGS 5EPNA 3L0SA 1GFIA 2QAGC 2ZJOA 1I2DA 4GZLA 2BDYA 3T2NA 1M34E 2Z3CA 3MU5A 4Q66C 3SJ8A 5EE0A 3OYPA 3DFJA 2PX3A 3B7GA 4NCNA 1EB2A 1NU9A 4KSBA 4BAHB 2ZGHA 2ZUBA 2WICA 2CHGA 2NPIA 3TKLA 1DG1G 1TQ0B 4MG3A 1DAFA 5GCHF 1NRJB 1F2SE 3F3YA 5CHAB 1GWAA 1GOTA 1NPMA 3LO5A 2O8BA 2WKPA 3IG6B 1P9RA 5L6NH 3ATIA 2R9PA 1V2QT 1JIMA 4CREA 3P4XA 1Z29A 1GBMA 1QA0A 4INLA 4NYIQ 5CYOA 2FOBA 4HEJA 4CH8B 3A4MA 1PJPA 2DB3A 4ZDKA 3KQDA 1WBGB 3QGJA 1V6DA 2RGNC 4XOIA 1UTPA 1Y3VA 5KNBA 1V2TT 1KAGA 5JCPA 1E38B 1OXVA 4RZXA 2BCGY 2JASA 2F3RA 1A5IA 2BVSH 2ZS8A 4HB0A 4JLJA 2BTCE 4PC7A 1PYTD 1PLLA 4MUAA 4NDZA 1GL9B 1ZVQA 3OFND 4G1UC 2DFTA 4WWYA 3ZGXA 4DRZA 1XUKA 2XRCA 2OHFA 5HE8A 3ZZ0A 3RXDA 1D3DB 3KXLA 5EP4A 1Z28A 4PC3A 4ZHMU 1QHHB 4O2LA 1ORFA 1O5AB 2CLSA 1HJ8A 4NE2A 4JJZA 2C8VA 521PA 4ZKSU 3BH6A 2JH6D 1KO4A 4PO8A 2XOKA 3UANA 4IDNA 1A0JA 3ZZDA 1HEIA 3CS0A 1W5TA 2ZRLA 1X1SA 4O9VA 3LIWA 2A32A 4DW2U 3DHKH 1MZDA 1UADA 1S81A 1J16A 4QGAA 5JDUB 2FIRH 4GLYA 5JCZA 1D6JA 4LYFA 1RRKA 3PEYA 4XBBA 1MTWA 1ZPZA 1TNKA 3EZ7A 2VWOA 1U99A 4JBWA 2ALVA 1A2KC 1GDDA 1O3AA 1O3EA 2B6HA 1SBWA 4TZ0A 2BDHA 1U2RA 2QEQA 3PQCA 3SV6A 3BIFA 2IUTA 2HPQH 1W4RA 1C4OA 4R9UC 2LNCA 2OAQ1 4YESB 5K8UA 1DSTA 2MSDB 2BXTH 2DCUA 4HAYA 1FTSA 1A4RA 1IQLA 3DOEA 1CRQA 1VHTA 2I6SA 3MU1A 2CV3A 1XBTA 4QXAA 3TAHA 5AJWA 3NBFA 3QLPH 3QTOH 4DHEA 4MKIA 1QQ4A 1BMAA 5JJLA 3WNBA 3RS3A 2O8CA 1TBZH 2QAJA 3MWIU 1H8HD 4IVRA 3MNXA 1UBCA 5JFGA 3GFTA 3MNCA 4I32A 1AGJA 4QHTA 4EQ6B 1P02A 4A9AA 2ULLA 1KOFA 3ZZTA 2BDIA 2BDGA 4Q7LA 1T32A 1Q57A 4TPIZ 2UWPA 5CMXH 1GPZA 3SGBE 4K46A 2OK5A 2XBWA 4LZZA 3W8RA 1R8QA 2EFDB 5DK1A 3K9HA 4NYJQ 2BIFA 2ZR9A 3UG6A 1IN4A 4QGGA 3K0CA 4ISNA 4GP7A 4US2R 1GBDA 4CEJB 1XXHA 1LPKB 4ZKEA 2V6JA 1EFRA 1GI8B 3UR6A 3A1UA 1R10A 1UKYA 1IQFA 4JCNA 5IT5A 4AKIA 2BMJA 3M3TA 3VB3A 1RFNA 4DZZA 1FONA 2C8WB 1H8IH 1A4WH 1QL7A 2J0VA 1PPEE 4TMKA 3CRRA 1UEJA 3NBXX 3Q3XA 3L43A 2FTMA 4AX9H 2Q6GA 3CF0A 2P6RA 1S84A 1G7TA 4Q4HA 3P20A 1WA5A 4NZLA 4C2UA 1FMLA 1SGTA 4X2VA 2VRWA 3ZZ3A 5L3SA 3FPAA 1Z0JA 1BTPA 1EUFA 1N8OC 1PQ7A 1O87A 1TF5A 3IO5A 2V3CC 2J59A 3RXBA 4TYPA 5JS8A 1M2OB 5B58C 4HGCA 1W7GH 2E1RA 1KKLA 2L0XA 3EXAA 4FIDA 3G01A 5D3QA 1IHSH 4I99A 1XFAA 2IW3A 5JZVA 3SU0A 4J0QA 2FODA 1JR3A 2IYRA 4HLUA 1OIVA 3VR2A 1FN8A 3ZDQA 1OFIA 1ID5H 4RFVA 1EESA 5C2ZA 1ZOMA 4QM6A 2O8MA 1C1YA 2FI4E 1EPTA 3UNSA 5AUOB 1YYY1 1TPAE 2ZSEA 2CMKA 4YC7A 2ANKH 3HR8A 2ZJZA 2D7CA 3SQEE 3A8AA 1AI8H 1TRYA 4ZUHA 4WZ6A 1ZD8A 3GLHE 2GDJA 4AD8A 1NFXA 1YR8A 4CW7A 2JDIA 2H9HA 3F9GA 2VNTA 1Z0AA 4B2AA 1ONBA 3IILA 1BTXA 1K21H 4B43A 2JLSA 1CR4A 2FGJA 2LCFA 4CRDA 2BD3A 1JRSA 1GKYA 3VFEA 1NS3A 1Z6YA 3UKDA 3PV4A 2ANMH 4URYR 2FZZA 4NCJA 5FCKA 1G5TA 3C1KA 4X2XA 8GCHF 2QV1A 1C9PA 1BKDR 1ELTA 2BQ7B 2AD5A 1M7GA 1C2KA 2CL7X 2ZP0H 3A6PC 2OBQA 2Z5FA 2QCYA 3LT3A 4KXFB 4E09A 1ANBA 2QRNA 1Z0KA 3RLWH 2P0EA 1E2KA 3FHTA 3UMFA 4H6TA 1JQJC 1OFTA 4DVAU 4NIVA 2C77A 2O8LA 1O5DH 1NRPH 2PV9B 3PMJA 5KSOA 1MTUA 3HPRA 5CK5A 2VHTA 3IIKA 3T06B 1VDZA 1L1GA 2VSFA 4NZYA 4KTUA 5FX6A 3WYFA 1JR3E 1AKEA 3AVTA 2PHBA 1MV5A 2CK3A 3AUXA 2Y7XA 2XBYA 1ANKA 1AGPA 5F9FA 1A3BH 1KK2A 1NI3A 1DPFA 2WWYA 2O52A 3THXA 1QTFA 2CE2X 2G83A 1P2VA 3U5ZB 3VHXA 4PPFA 2G55A 3UXMA 3A81A 1ZUIA 2GZ8A 3U3JA 2RDLA 1KMHA 5FR1A 4BANB 2W26A 2CHAB 4NP6A 3T1VA 2XYAA 1DY8A 3B9PA 1NSFA 2GAAA 4GMXA 3H5CB 3A8BA 4GUXA 4BLSA 1WOFA 3DZDA 4CF7A 3AF3A 1O2SA 2FLRH 3RXQA 4BTTB 4JYBA 2PCJA 3M6AA 4UQOA 5CIQA 2OXCA 1XMIA 3VKGA 4Y11E 4KELA 1GKUB 5F9HA 3WRXC 3CF6R 3ZH9B 3NBZC 2IYUA 2CCGA 3PR1A 1GMCG 2CCJA 3SBDA 3M7UA 1YBWA 1OXXK 1WF3A 5FBRB 3FZZA 1GJ7B 1SVOA 1UKVY 1Z1JA 1ZTJA 2NU4E 1J8AA 1SFIA 1MCVA 3B1WA 5JWOA 4U02A 2QMOA 1P60A 4QBGB 1EWRA 2RB4A 4TMWA 1G3BA 3PYHA 3E2IA 4KP0A 1Z8RA 4L16A 1QL9A 2A4RA 1NY22 2G5NA 3TRFA 5FPTA 5SZHB 1C5OH 3CH4B 4N0DA 1B5GH 3O8CA 1C2DA 5HKKA 4Y8ZA 4K8OA 1AFQB 2NU1E 4C0BA 1IQIA 2ZRGA 1XEFA 4BAKB 2BBTA 4ACAA 3A4NA 1SLUB 1IQJA 1TA6A 3B8HA 1NZQH 4ZKOU 1C5UA 1AS3A 3OE7A 3VR1A 4JMPA 2JLUA 4TTPA 1U8YA 4Y71A 4R8TB 4XTCS 1JMOH 4NKRA 3UMRA 4U5XA 4TWYA 4DCTA 2AERH 2R6FA 1FAKH 5K8IA 3VKHA 4BFZA 1OYTH 2VYFA 3W5JA 1G5PA 2WYJA 3DKPA 4ZO4A 1MCTA 3SJIA 4XJXA 4AGJA 3TGPA 4NA8A 2ANBA 3BXZA 3TMKA 4GL2A 3KFXA 4XE4A 1TYNA 2G52A 2OILA 1E0AA 1KSGA 1DAGA 1MO6A 1J90A 5F3WB 2BZ6H 4FMCB 4CEIB 5JRZA 4YQFA 2ZSFA 1C5RA 4DBLC 1OXTA 4UFFH 1XD8A 3TNSA 5C5NA 3HDTA 1N5JA 3PLPA 1EGAA 5TXGA 4PPGA 2FJUA 3NXPA 1F3OA 3VR4A 4JK6A 4QRHA 2HALA 3KUCA 1YLDA 9LPRA 3AV0B 2CL6X 2YZ2A 4X1RU 5IRCD 1GJDB 1GVLA 3LY5A 4AG2A 5FOSA 2ZE8A 1IOZA 2IHYA 3ASZA 4HAXA 5BN4A 1EB1H 3PEVA 3H0KA 3SQHE 1DAMA 3TAUA 2BDCA 4ZXYH 5EQTA 1E2DA 1X6VA 3QNUA 1IQGA 4PZZA 2OC1A 4M9ZA 1JAIA 3ZS8A 4A4DA 2LWIA 4N3NA 5JJIA 3OIWA 2PUQH 5LB2A 1GMCF 4NMMA 1SOTA 1X1RA 4XWAA 1EZQA 1OSSA 4AB8A 3WNCA 1RZ3A 4O97A 2H6MA 5L3VA 4A15A 4LPKA 3URDA 2J9NA 1VCIA 5TB5A 2NO0A 1NNEA 4UXIA 2GZ9A 4DLXA 1IOEA 1BHXF 3GJ8A 1W4BA 2BX4A 4XBCA 1W8BH 3HYRA 2FFAA 2QTFA 3BBPA 2NO1A 3A87A 4Q9HA 2HNTC 1V2KT 4PTLA 2O8BB 4R2HA 2JETC 2VBCA 1R0WA 3B1XA 5DI3B 5JS7A 1E9EA 3K1JA 1AB9B 5EUQB 4IXMA 3R9WA 1UFQA 3W3AA 4EIWA 5FBEA 3A7VA 3TJZA 2OE2A 2O0KA 3ELAH 1GI5A 1AD8H 2A5IA 1O2HA 2VH5R 2XNDD 2WKQA 4W5JA 1FPHH 3GDUA 5EUMA 3PWCA 1IQKA 1UTKA 1BJUA 5F8ZA 2P6UA 1O2NA 5TCAA 2DWQA 1OFHA 2ZE6A 1HAZB 1Z0FA 5L3RA 1KDTA 4MDSA 4NA7A 1KTSB 4Q80A 3CRQA 3BTHE 4B3FX 5F8TA 1SGWA 1HRTH 1XEWX 2H7VA 4NU0A 1DLEA 4ISLA 2HT1A 1N6IA 2N1BA 1HA3A 5A8ZA 2B0FA 2SHKA 1CGIE 4M4SA 4O3MA 3P1JA 3SOSA 1FX0B 5K8TA 2PTCE 1KI3A 3FMPB 1CSOE 4CZ2A 3QPWA 4DOQA 2ZANA 4PQFA 4QBHA 2YWGA 1N1LA 4Q7KA 2NU0E 4LK2A 2G9NA 3LLUA 4RZ2A 2IOTA 1TX6A 2F4LA 2ASUB 1NO9H 1PPBH 2AK2A 4X1QU 2FTLE 1AVGH 5B6LA 1C5VA 1Z6XA 1C2IA 1D2MA 5T1VA 5F8XA 2F9VA 3T27A 3A7ZA 1DWEH 3B1YA 4LC0A 4SGBE 1JWTA 4DJZB 1FY3A 2VIQA 5FTMA 4A6XA 2GCHF 1K5GA 3TGJE 3MO3A 1C9TA 2BLOA 2C9OA 2QMEA 2VH0A 1XXFA 5DLQC 1IXZA 5TDHA 3FKSA 3RLYH 2A1DB 4B33A 2B21A 3RC6A 3MI4A 4X8SH 5L8VA 3U4QA 2GBLA 4WBSA 3AVWA 3UQVA 1SZPA 1VCNA 2EFHB 4K1TA 4Y10E 3C27B 1KO5A 2BY6X 1RVDA 2F1IA 3I5YA 1KTTB 3Q00A 3ZVAA 4GNKA 1FY8E 2WWIA 3DFLA 4THNH 1HY3A 2PWXA 4K3JA 1UCYE 2P6NA 1ARBA 1CE5A 1O2GH 3DHWC 1R5BA 4K8YA 5K0HA 1E98A 4WVFA 3RSLA 1XTJA 4DCVA 3QX5H 5T6DA 1RTLA 2BD5A 1KDPA 1AB9C 1TGNA 4JYVH 4LJ6A 4DC9A 4NH0A 2GX4A 3LA6A 1KO8A 1PQ5A 4ZDJA 3T5GA 3GJ7A 1OS8A 2PCLA 2EFGA 1IN5A 4D9RA 3K2UA 3SNEA 2VJ1A 3VFDA 2PKSB 2A5KA 1EAIA 1FL9A 2X19A 1ZMLA 3WBJA 1ZRBA 1S83A 1SGRE 2HPPH 2REOA 1BTZA 1YZUA 1YPGH 1DPOA 4UONA 1TF2A 4KFSA 2SGAA 1C1SA 1P9WA 3U2QA 5FHTA 2AGEX 3K6ZA 4D82A 2BXUH 3R9IA 1CA8B 3DZ8A 1DVAH 1YPHC 1XUFA 1TPSA 4WMDA 2XW9A 3RRZA 4HZIA 5EP3A 6GCHG 1BMMH 4KVGA 3BORA 3BTEE 3PM3A 3MFJA 4OI1A 3SV9A 4G5OA 4KFUA 4EJSC 5GNDA 1Q12A 4GDFA 1CJVC 2OSBA 1HYQA 5GVRA 4XWOA 4D4MA 3MU8A 4Q4HB 2ZU2A 1OP0A 2Y5GA 1C5WB 5C1YA 3VB5A 4ABHA 1V43A 2OUKA 2ZITA 3X1DA 2OTVA 1V2JT 3BFVA 2AXNA 1Z07A 3OESA 2GK7A 2ZVQX 1S3SA 4EPTA 2PR3A 3CZPA 1XCGB 1ANDA 1ZHMA 1W5SA 3B1VA 1KXDA 2F43B 1NVVQ 1AZTA 5BRRE 2P16A 2WWGA 1CT0E 2ZE7A 5DH9A 4FWIB 3VGCC 1M74A 1ZNWA 4DLRA 4JZFH 1EZSC 1JOUB 3LRPA 1D9ZA 4Q02A 3SNCA 3BB3A 4JL8A 3O8BA 1WTGH 3KHVA 3KTAA 4AGKA 3M36A 3ZVEA 4M8NE 3RUOA 4JT4A 5EOKA 1G3UA 1T8UA 2F9OA 2GP9B 2IX3A 2Y7ZA 1RS0A 3NPSA 1W13U 1ZM7A 1XMVA 2ILNA 5EZ6B 3ETLA 5E2PA 2RGGA 1QJ7B 4TMXA 3B85A 1O3MA 2H5CA 3QF7A 4JZDH 1E1QD 1MRSA 1C2LA 5A0BA 2YWFA 1E96A 1CIPA 1JQLB 2RKOA 3GLIB 2OEPA 5C3NA 2E9SA 4P31A 1SHHB 1GJCB 2OZEA 1GUAA 1C2MA 2WV5A 4X8OA 3V12A 2GDEH 3UUZA 1A2BA 1O30A 4UD9H 2OBLA 1Q21A 2FSHA 1BITA 3DD2H 4B74A 1EG7A 1AQUA 1RGQA 3QENA 1AKYA 4HYYA 1VYUA 5CE1A 3MH4A 4IN1A 3U6BA 5C4MA 1GP2A 4JSTA 1Y63A 4OQLA 1KXAA 2QNRA 4QNMA 3LXXA 1NT1A 1KSHA 3KFVA 2PSYA 3E0NB 4AYXA 2VIVA 1TQ7B 4ZI3A 3EYDA 4Y7AA 1CF4A 4BFUA 4ABBA 3U4QB 2JATA 1SGEE 4TL8A 3T15A 4B2PA 3BK7A 1L2EA 4EPVA 4K5ZA 4CRBA 3AVXA 3A1SA 1IAUA 3EWSA 3OIUA 5EE5B 4KYIB 1B0FA 1E79D 5C1XA 2F9MA 4GCHF 1AU8A 2VF7A 1FP6A 2IT1A 5E0HA 2QSYA 1BOFA 5A0AE 5LPEA 4K1SA 2R6CA 3GFPA 4K81B 1HURA 4PO9A 4PAMA 4O3UA 1C1OA 3MYWA 2FS9A 1HAOH 3F5FA 1QR3E 3F6UH 3IEUA 1TPOA 1C1MA 3V3MA 2XSZA 1E94E 2V7QA 3GLGB 4OQXA 5JECA 3AF2A 4B3GA 1DX5M 5J4QA 1PLKA 4ILEA 3THYA 4DVGA 1P2TA 2FWWA 3A83A 2J95A 1V2UT 3LX5A 5DI9A 3MNBA 2CHAC 5A2MH 1C5QA 3AASA 1VTKA 5KUTA 3D65E 2QA5A 1S0RA 1JIRA 2GJSA 4TLCA 2W7UA 4QJ3A 2HYDA 3QEJA 2NU3E 3LGIA 3E3TA 1OIXA 3QG5A 1HT1E 4LI0A 2ZU0C 1QZXA 1ZGIA 5I25A 2F83A 1U6QA 1XF9A 3AVZA 1P3JA 1OPHB 3A7XA 4TLEA 2IHBA 3A86A 2QAGB 5BW8A 4H1UA 1KO1A 3GLFE 3F9FA 4H1VA 1MAXA 3SFZA 1OB5A 3OAAD 1Z6GA 3GY8A 4TL7A 5DP3A 5FBIA 2EA3A 3W9YA 1OH6A 1EX3A 4AKHA 4WIAA 1U8ZA 1V2MT 1W7XH 4PROA 1UK2A 2C90B 2B7BA 2HUPA 4JLNA 1O2WA 4F7WA 5CM8B 3GMTA 3CENA 5FOVA 4DKXA 4BGDA 4GRAA 4TYYA 2F9NA 5ESTE 2BHGA 5B30A 4JZEH 5JBQA 3ODFA 4LYAA 2ZS9A 1SVIA 4D9QA 1O3HA 3PTNA 2ZAMA 5FTLA 5FTNA 2BKEA 2BB4A 5CM9C 1HTWA 1A7JA 5DISB 4UKDA 5JB8S 3K0FB 4OQFA 2GILA 1V2LT 3RXVA 1F60A 3M61U 4IXNA 2XNSA 4BFSA 2CHVA 1F5LA 2O8FA 1GHBG 2W7SA 3THOA 4CRGA 2ZDLA 1O3YA 3QXCA 2FOHA 1VECA 1XX9A 2ZXUA 3LDAA 3N2IA 1GGDC 4KFTA 1PUJA 4LHZA 2O8TA 2FPLA 2OV2A 4OKSA 2UUYA 1S2MA 4FMBB 2F7SA 4AIIA 3WMEA 4C7OB 1YCPK 4BLOA 2AS9A 4C0AC 3SHFA 4U7DA 4RKEA 4PO1A 4GP6A 3QXSA 3DMDA 4RD3A 4MNXA 3QGNB 4US1R 4FXPA 1ZLRA 1Z0DA 3DA9B 2FESH 1YVDA 4I1OA 3I5XA 3A7YA 3TVTA 2ZGJA 4HI0E 5JBTA 1HAVB 3SQXA 3P92A 4OK5A 3DDCA 1PPZA 1B0EA 3EPJA 1FJSA 1OH8A 4D8NA 1H1BA 4Q9IA 2ZRPA 1SGDE 3KQNA 3BB4A 1G17A 3T1TA 1O2XA 2ASEA 2ZRMA 4V0ME 2FMXA 1Z5ZA 1L4DA 3BTME 1MQ6A 1TNJA 4QNRA 4UNNA 2ZRIA 2XOKD 2V3HH 2Z4RA 3VAAA 4LHVA 1M7HA 4OS1A 4LUCA 3I1FA 1MU8B 3RNLA 5HXFA 5A8XA 3SV7A 4JLDA 4HZHA 1XDBA 2A7CA 2J41A 4OL0A 1W10U 5KPJA 4DURA 4V02A 4IVPA 2G0NA 5BWMA 5L30H 2FX4A 4URXR 3GDSA 1LF0A 4YMSA 1LKBA 4Q18A 4TMTA 1RRCA 4GPGA 1GTVA 1Q0UA 1UBFA 3MWLA 4UEHH 2BD8A 2H8KA 2KJQA 4AORA 4US0R 1YZNA 2QU8A 4AFQA 4I4LA 3SNHA 5FL3A 2H1LA 1AK2A 3PEUA 1GHWH 1BCUH 1PFXC 1SC8U 1XTQA 4HAVA 2DFKB 2QPTA 2ZYUX 1GL1A 1O2TA 3QO6A 4LRWA 1AFEH 1DXWA 3K0FA 4RZ3A 3RS2A 4PR0A 2ZEBA 2FOLA 1DS6A 4H9GA 2GEDA 5EXTA 1TBQH 4J1YA 4BXWA 3GLIE 1SQ5A 3B82A 2JA1A 2THFB 4Q1AA 4E05H 1P2KA 4ABFA 2ZR0A 1U90A 2ZIQH 2G77B 2IC5A 1EPTC 2FX3A 4Y0ZE 1MTSA 2P5TB 2QP3A 4BFYA 2FXRA 1CS4C 3AVQA 7LPRA 4QT8C 1QY6A 3U3KA 1CBWC 3TH5A 2NPFA 3E8LA 1TUEA 1EJNA 1LY1A 2VGCC 1A7SA 1GILA 1Y3AA 1FI8A 1P03A 1N6PA 1WCZA 1MO5A 2QM8A 1C4Y2 5GJ4B 1X8JA 2BHRA 1SLVB 5KDDA 3G5UA 1ANCA 1E2PA 5IYTA 4JMYA 5HTKA 4C30A 4FUBA 4RCZA 3KB1A 2XXAA 4Q48A 5AJZA 2NWNA 1HCGA 3UNQA 3QPUA 2VH6A 1AFQC 4X6NA 3FMOB 1T4UH 1VITH 1FUJA 3THYB 1HQYE 3HP1A 1WDTA 3V4FA 5FUVA 2GCHG 2WJHA 1K1PA 1L0ZA 3ZZ4A 3BRWD 2DY1A 3LLMA 1PPCE 2HOBA 3ICEA 4MGIR 1J17T 1LKAA 5FL7D 3CONA 3TUZC 4O03A 3IHWA 1GJAB 1GJ8B 2GGVB 3RC8A 1LV7A 4BTUB 5EXXA 1S3GA 1WQ1R 4FI3C 2YWHA 1K2I1 2PTNA 4KLZA 2JJ2D 1T3LA 4ZV4A 1VCPA 1AZSC 2H18A 2BBWA 2C3SA 1C5LH 2VHUA 4FU9A 3RXLA 3BG4C 3VXFH 1LHFH 3PMHB 2CDNA 1YZGA 1W11U 1TMTH 3PB1E 1QCPA 3TUJC 4YONB 2QQ0A 3QWCH 1DAHA 1GI4A 1GVNB 4ZAEA 3GY3A 4YT7H 2BMDA 4BZPA 4TYNA 2WAYA 1CQQA 1LCYA 1TU4A 1QG2A 4EFMA 2Q9AA 5B57C 4CT4B 1ZJKA 4OK3A 2X77A 4CH2B 2ORIA 4AKEA 5DHFA 1C5NH 1XUHA 5H8WA 3GY4A 4EJSA 2A30A 2XZPA 5KOYA 3TU7H 2FYQA 5P21A 1XNJA 1Z8IB 4TLAA 3KQBA 3ND9A 5FFMA 4IN2A 1T4VH 3FFGA 1R4AA 1T7CA 3K9XB 3F1SB 3QKUA 2XGJA 5LD2C 3PWBA 1VIYA 1ETSH 1O38A 3NG1A 2WVJA 4GFDA 1S8FA 2XCFA 1P3EA 3OF5A 4B2IA 1G8FA 3MAAC 5CYPA 2G5VA 6GCHF 1SPJA 3F0TA 3CRMA 3TPIZ 1E2NA 3NK8A 1JAHA 4M21A 3R9XA 5AK0A 1FIZA 3EASA 5FBQB 3LAWA 4DXAA 1VG8A 1Z1IA 4OYHA 5H1YA 1G64A 4D26A 2GZHA 2O8CB 4ESTE 2ZC9H 3AKCA 1ESTA 1EX6A 3KJGA 2Z9KA 3WY8A 1SQTA 1O3CA 1E69A 4GZMA 4HAUA 1E1RA 4LJYA 4A92A 4TMZA 1GBAA 3W6PA 2Q0HA 3KIDU 3NEJA 2GEVA 2IF0A 1P5ZB 1G32B 3RXFA 1EK0A 2PUXB 4WXPA 3TGKE 1OJLA 5BN5A 3KQCA 1DO2A 2J1LA 2JJ1D 2FO9A 4JIMA 2D2FA 3S1AB 2QIQA 3BC1A 4LBVA 4IC5A 1AQYA 2PLXA 4L8GA 2FEMA 2JGNA 4Y0VA 4LXBH 1D3PB 1J8YF 1Y3YA 5E2OA 2HGTH 1OSNA 1GG6C 2YNBA 2FDAA 1P72A 3SI4H 5G3ZA 3GYMA 3H09A 2XC0A 1OE0A 1AVXA 4G5QA 3QF4A 3U7HB 2ZF0H 3MTYA 2ZPQA 3U3RA 1ESAA 2E87A 2PKAA 1GNRA 1FNNA 2FSFA 2H92A 2WJVA 3K70B 1H4WA 2TRMA 3IUYA 1VJAU 5CIWA 1T3SA 1FV9A 2F9PA 3AVYA 2FOAA 1HJAB 4NYMR 2FSGA 2IYVA 2RMKA 4B2LA 1QB6A 2J92A 1PQAA 4Q7ZA 1AA9A 3SU6A 4IW3B 5A0FA 4BAMB 4C0JA 2QZ4A 4QM7A 1TOCB 4NIYA 2BBSA 3UG7A 3S0NA 3SNAA 4BLTA 4RI0A 1BRUP 1IY0A 2YVUA 1GNQA 2BM0A 2WPDD 1XJ0A 4RKOB 2VSXA 5EQRA 3EAJA 5KU1A 3AW1A 4OI2A 2ZRBA 2FEQH 2D1JA 3TSZA 4Q01A 4IS5A 1EOJA 3P8FA 2A9KA 3ZZ9A 1GBHA 3LV8A 4ZIRA 1GI1A 1G37A 4UE7H 3GCGA 1M1YE 5HPYB 3CLVA 1DAKA 3OSYA 1GBLA 3D7MA 4C0KA 2OC7A 5IF9A 4Y8XA 1KJYA 2QXJA 2IYYA 4TQ9A 4F4OC 2JCSA 4UDWH 4MTBA 3BTTE 1O3PB 4TL9A 1SVPA 5DP9A 4WF8A 3HKIB 2PLFA 3SJ9A 4CEHB 2ZI7A 2R6GA 4AK9A 3ZVBA 2VTKA 5T6FA 4X6OA 2GCOB 5E7MA 2KAIB 2ZRFA 3FWYA 2YJTD 3STJA 2A7JA 3BIUH 2J3EA 1GVKB 3T1OA 1BYIA 1D9IA 4IEEA 2F1HA 3VQTA 4BFVA 1KNXA 5FTKA 5KNCA 5GDSH 2BMEA 5FI1B 3OFNA 1O3DA 1JECA 2BJVA 3GEIA 3IPYA 5LDDC 1Z2AA 1S5SA 5JPMH 2BZAA 5FI0B 2ZU3A 4PSKA 1UHBB 4W5WA 4A5TS 1FY4A 1JB1A 3LC5A 4Z8XA 1YP9A 3CX8A 1TGSZ 1BTYA 1O34A 1O2OA 4E22A 1CR1A 4XWKA 2ZHFH 3BTGE 2VQSA 2A5AA 8KME2 4KI0A 5JEEA 5JBBS 4MH0R 5J4SA 3EPLA 1KGDA 3SDZA 2YC2C 1YZTA 3SU2A 4PQYA 3S9BA 3EPKA 2R0LA 5DP4A 2V35A 4MRPA 2I1QA 1ZJDA 1P9NA 3LBIA 2FDCA 1CGJE 3K9NA 4IHQA 4ASUA 3SW2B 4IDOA 2WJGA 2IEZA 1V2RT 1AE5A 4NGAH 4AYVB 3A89A 2ZHWH 4DLZA 2ZJAA 4AURA 4AWXA 1E36B 1P09A 2GETA 4LDJA 2WWFA 2GMTB 4TY6A 8ESTE 4CR9A 3EPHA 2VVVA 3IIJA 1YKTA 3UPEA 3IPXA 1K28D 1SXJE 1BUIA 2B7CA 4HUTA 5GJBA 4D0LB 2XTZA 4JYTA 1ESMA 2H17A 2KWIA 1UDWA 1HQCA 2C99A 2LKDA 3T34A 1OXUA 1XPOA 3L33A 1UBEA 5EQSA 2R9VA 4FINA 4FD2A 4YLGA 2CNWA 3CNLA 3PROA 2A2ZA 5CITA 1UO6A 2IJOB 2WAXA 3EX7C 2DWPA 1TNDA 3PO1B 2D2DA 2J45A 5DG6A 5JYIA 1TRMA 2GCOA 5UKDA 1P0SH 4G5SA 1HXFH 1TNHA 2KE5A 1KDQA 4IDPA 1S82A 2QA9E 4CBNA 1NRRH 4ARZB 1MKYA 2VWNA 1YKSA 1V2VT 2C78A 4DB2A 3KKOA 1NJGA 2VO1A 2CE7A 1SKYE 1EAUA 2YOHA 1W36B 4M9FA 4BLPA 4CRWB 1TX4B 1UJ1A 4VGCC 4RN6A 1SGQE 4M1TA 3K09A 3VEQB 1IN8A 1AWHB 1KI7A 5JWHA 4X8HA 4Q9JA 1W2HA 1LVBA 4NIWA 2OXRA 1N8OB 1MH0A 2F9BH 5A0CA 1BIFA 3UATA 5AUPB 1C1VH 2FM2A 1NU7B 2HT6A 3M0EA 4VGCB 2QXGA 4G01B 1E9CA 2BY9X 2R2AA 1VMAA 4LYHA 2M5TA 1COWA 2A5DA 1P12E 3OTPA 1ELGA 1IN6A 1FY1A 1NKSA 1ZMXA 1G21E 1LW7A 3A82A 4ESHA 1SR5C 5AJYA 4INKA 4NCKA 3LH1A 1W4CA 3SYJA 2W83A 1P9UA 4A8JB 4QC2A 2YOFA 3FMFA 4WW0A 2YOGA 4DIDA 2P65A 2W3KA 1ZNXA 2JJ8A 1GBBA 1MZAA 1P2IA 1AY6H 1L4YA 2D3WA 3BFXA 1C1RA 1VZQH 1OYWA 1IQNA 1SLXB 5CLLA 4YM9A 3GCHB 4NCYA 3VTKA 1UMAH 2F3TA 1KXEA 1MABB 1Y3XA 1DAEA 3TQFA 1HAXB 3WHKA 2P3TB 2FFHA 1UJ2A 1TGCA 3EGKH 4U32A 3GPLA 3ITIA 4Z1MD 1GBCA 4OS5A 5G3YA 3DVLA 1WTHD 2C98A 1OV4A 3RXTA 1LHGH 2WJJA 2XTMA 1K9OE 4O2RA 1EAXA 3BOSA 4GAWA 4LOAA 4BQSA 3H7TA 1AKSA 3A8TA 1BMFA 3ZVFA 2VIIA 1LS6A 4TT3D 5AFZH 1T3HA 2JAQA 3CIOA 4PC2A 2ZTSA 3ZV9A 3LDXH
chains in the Genus database with same CATH superfamily
1PKEA 4IJVA 3T1NA 1PVDA 2JVKA 1T1EA 2NV6A 1O7JA 2C82A 4RGVA 4BX3A 3GWGA 4XVUA 4KP7A 2UVPA 3K5HA 1KKUA 3NBUA 1CJKC 2YOLA 1NBAA 1THTA 1UMDB 2I4NA 2XHZA 5AKKA 3UUWA 2Q4TA 1DRJA 5MGNA 1JI3A 2D7DA 4Y9UA 3WQHA 1P73A 4XYMA 2A1TR 2MYUA 3D6MA 2QRZA 3KOYA 2FXIA 3PE3A 4DR5B 1PFGA 1UPXA 3EW9A 2DULA 4XASA 3DWEX 3O1LA 4E5YA 4MI6A 3BSQA 1CUSA 4Y2GA 1UPTA 2NW6A 4MKXA 4OP2A 4DYHA 4B8ZA 2OC4A 4JZIA 3ZE9A 3KHSA 3SUFA 2EJUA 5KNBH 4N54A 2WMNB 1PN3A 4MVXA 1TXGA 4H4DA 5AVZA 1O0SA 3PYXA 4RETA 4NWKA 1M33A 1L6IA 2FU5C 4IDBA 1F7ZA 3DEFA 1ARCA 6PFKA 5GIBA 3SU3A 9MHTA 1MJ5A 4Y2YA 1PAUA 3H11A 5IJXA 4CNQA 3DE2X 4R71A 2JAXA 5H59A 1MAWA 1W0JA 4FNGA 3UW3A 5CCDA 3GCHC 2VQ6A 2MHCA 4YRQA 3SVLA 5EGNA 1BMFD 1P17A 4HP8A 4F9EA 3I8XA 1EM8B 3NCTA 3OPYA 4L9AA 4FFPA 1FDPA 1RQXA 1OC2A 2B1GA 2R1UA 2PL9A 3M3PA 2JJQA 5KTRA 4R5HA 4X2YA 4K8RB 4MGKR 4GKJB 4C21A 4CKBA 1ZHRA 2YMMA 4EI2A 3LVQE 2VR1A 4R8RA 1ZH2A 3DDSA 5FA8A 2JANA 3RFUA 3IAM1 1HK7A 3IHTA 3LUAA 2B7DH 5IDQA 1O77A 2GWHA 3KLPX 3NT4A 1CY7A 1QGFA 4KXYA 3FR8A 1SWWA 4LZAA 4LFBB 1EP9A 2DBVO 4WY5A 1KE2A 4WD3A 4BXOA 4YJGB 3MJRA 1E4VA 3RXIA 4TM8A 2QTBA 3H7IA 3EUAA 1ZMJA 4AC9A 3AP1A 5GONA 3C3CA 4O3FA 4URHA 1AKNA 4FS3A 4Q3DA 3KYDA 1EPUA 4JB0A 1EHYA 4RE5A 5CFZA 2V6MA 5CX1B 4A7IB 5TF4A 1IZ8A 4DA9A 3ZJUA 3RVRA 1ULBA 4HEQA 4JEIA 3FSJX 5TNXA 4AJPA 2VDOB 4B3GA 4KXWA 1E5DA 1PR2A 4HGYA 3JD2A 3ISTA 3OEEA 4JHXA 1Y1SA 4WY8A 2FR8A 2IITA 4DLYA 1W0KD 5G4KB 4ND7A 1P2BA 2HQOA 2PX5A 4FCCA 2O9QA 2CVQA 2Q07A 4LOHA 5JNRA 5KSYA 2NYAA 2ZUWA 3VB6A 4NEHB 2PFKA 2B4RO 1GL3A 4ENTA 4R40A 1YBHA 1C8BA 3QIAA 4AJLA 2QTRA 1UZUA 4II3A 2ZRJA 5DBEX 3GN2A 4RK5A 2AEJA 3KKKA 1INCA 2OM6A 2WMYA 3R9XB 2RHHA 2EFEB 2IYNA 2N42A 5HIYA 4XCVA 4MHOA 3C1AA 4U6NA 4Q7EA 2FAXA 1DBWA 3U4CA 4BNYA 5KTTA 1H65A 1MT0A 2J31A 3RG2A 5FLEX 2X8LA 1XL1A 3IO3A 3PUVA 3WLPA 5K7RA 3KKLA 2KCPA 1AMHA 1JHRA 4J16A 5I01A 2GEJA 2AGIX 4F4DA 4IUCS 3L7JA 3Q3KA 3RXMA 3PC4A 2FDXA 2C4KA 4B3BA 4XUEA 4F92B 4KTCA 1R6AA 1KK3A 5HFAA 2ZGXH 3NOOA 3UIRA 1ZD9A 5T41A 4JZ1A 2P9FA 4TV8B 3T7JA 2RHLA 3UHOA 5C0UA 3MH7A 1LI5A 4YX9A 3ETJA 4URWR 2JFPA 4WXYB 4ZO7A 1YE5A 5IHPA 3EXHC 1DE0A 2QN6A 5CLQA 2E55A 1E4YA 1U7PA 2W7TA 5EYPB 3RO7A 1R37A 1JBUH 1TA0A 3I9OA 3I04M 3CFYA 4ND1A 4ER3A 3U98H