5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
3I72A 2O8BB 4CHAB 4MITA 2VWLA 1PPGE 1V2TT 3NC1C 1E2FA 2ZAOA 2VHUA 2YOFA 1O2XA 4F92B 3CX8A 1NIPA 2WPIS 3LFUA 5F8XA 1HLTH 3AW1A 4RI0A 3TBKA 4KITB 3H86A 4V0LA 1TADA 5CK4A 1XZPA 3K70D 2SGEE 1DAKA 2GILA 2ZDNA 3BTDE 4KFTA 5IDVA 1U8ZA 4X1PU 1Z6EA 2X2EA 2QG6A 1FQKA 2JIZA 2GVDC 1O3AA 4Y79A 1ACBE 5JI3E 4CEJB 3KQDA 4UFFH 1K21H 1GNRA 3D62A 2Q9CA 1OPXA 4NWLA 1B0FA 2AD1A 1J17T 4R2IA 3SHFA 1X1SA 2FPZA 3U8TH 4JBWA 1VCQA 1FFHA 4RKFA 3OTJE 4Q7MB 1D9XA 1MRNA 1EESA 1O2OA 1P2VA 4Y7AA 3UUZA 5CK5A 1TMUH 1E37B 3LGUA 1L1NA 2W0SA 1I4DD 3ZZ5A 4I99A 4ISIH 3CKLA 4FUHA 2ZXUA 2ZHEH 1OFIA 2SGAA 1AY6H 2V7QA 1W2HA 3VB6A 4ZUHA 1O2WA 3PUZA 2UUJB 1RIFA 1Q1QA 3MG9A 5EXPA 4Q9KA 5L3SA 2OTVA 1ZINA 5H8WA 3HJNA 1C2GA 4CRGA 5EP2A 3UK6A 4AFZA 1T4GA 2NO7A 2FX3A 4ZKSU 1N3BA 1Z0DA 1EFRD 4P3YA 1DS6A 2OBLA 1S3SA 1UK2A 2YWHA 4FXPA 5FUWA 1W3CA 3P70B 1XMJA 3QKSA 3QZQA 1FY3A 1O3FA 1NVXQ 1ID5H 1P9WA 2ZRLA 2FSFA 1P09A 1SXJE 1VITG 1PVOA 1XPOA 2FH5B 1OPHB 3BD9A 1P2JA 1SXJD 3E1SA 4D9RA 2V1UA 3AVTA 4PPGA 1PFXC 3EA8A 3FFAA 3CW2A 1GI1A 4P4SB 4NYMR 2CDNA 3AW0A 4JL6A 1NSTA 3EZFA 5EQTA 3REGA 4R71A 1P06A 3QPUA 4DVAU 1HYQA 4ZIRB 1WQ1R 1VCPA 3GISB 4Y11E 4IEEA 2ZZUH 5FOSA 1LVGA 4PAOA 2VP9A 3VQTA 1FIZA 1KI4A 4ON9A 4ZH8A 4TT3D 1OXXK 2WMOB 1ELAA 2CCJA 2A7JA 3BXZA 3RXCA 7LPRA 3QJYA 1PJRA 1J15A 3R3GB 1KMHB 2QY9A 3RLWH 1GFIA 3QXJA 2WV9A 4R0IA 5JEEA 2VLIA 1BYIA 3C5HA 2OINA 3MFJA 1IHTH 3TK6A 3SJAA 2HT6A 2R9PA 3RM0H 2QBYB 3VR2A 4L15A 3E91A 3SYKA 1SGTA 5J5CA 5GWZA 3X1XA 1BBRE 1NESE 4V02A 4YLQH 3RDPA 4X6NA 3GFTA 3AVWA 1EP6A 3SQXA 1Z0AA 3C15C 2GEUA 1GVZA 1HY3A 4EPTA 2WWWA 3RRNA 4LBWA 2FXRA 1OB5A 1FONA 1AJEA 4DURA 2C90B 1N6HA 3RS0A 3CNOA 3GLFA 1RZ3A 4YTAA 4OQFA 2QRZA 5FX5A 1NVVR 4RD4A 1OH7A 5TARA 1WBBA 4TWWA 4FVBA 4CVNA 2Q9AA 2CBZA 3MD0A 1E38B 1BZXE 3N2IA 5FBLB 3K0AA 4HYYA 2PT7A 3X1WA 1MU6B 3GCOA 1D5CA 3W6PA 2Y6TA 3K9NA 4PAMA 1N2CE 1E96A 2DE9A 3K9LA 1XXHB 3AVPA 1SVLA 4TQ9A 1E2QA 1TQ4A 4KTCA 2G4TA 1CULC 4AKEA 2ZJ8A 1RXPA 1S82A 4CEHB 1RTLA 4FCWA 1Y3AA 1R10A 4KODA 2O8CA 3GCHC 4YMWA 5A0CA 1AKYA 3RXOA 3D6TB 4Q4JB 1Y8TA 4ABEA 4GI7A 4O25A 4LK2A 4B73A 3K70C 1OYWA 4ZHLU 3X2SA 1YLCA 2UUFB 4WXPA 1HBTH 2AWOA 1G9IE 2AERH 2VIWA 2ZGCA 1QA0A 1G3UA 5DYGA 1COWD 5JB9S 1EQ9A 3RXEA 4PPQA 1L2EA 5DPAA 1OHHA 2WWYA 2YC2C 3TR5A 3EQ0H 1ELGA 5EP4A 1QG4A 3PR1A 2AIQA 1C5OH 1LTQA 1N5LA 1PQ8A 4LYFA 3ATWA 1GJDB 1TNIA 1SVPA 2REOA 4JVNA 3NPSA 1PYTD 4D7FA 3A1TA 4I1UA 2GDDA 3P1JA 4ISLA 1EPTA 3PV5A 2FWRA 4LK4A 2A2XH 4Q5IA 5JCZA 4HUQB 4I8JA 2JETC 4Z6AH 3AP2A 2ZREA 1UTOA 4MVNA 3KQUA 4NP6A 4JYCA 4XOJA 1ZM3A 2H9EH 5J47A 4FUBA 1JQJC 4Y71A 3LBIA 4ZAEA 3K9HA 1KIMA 4JLPA 1V2KT 4N0DA 1FUJA 2BJWA 1E2IA 4LJ4A 5K0HA 1OP0A 4KCGA 2R9VA 4Q80A 2Q3HA 1W46A 4IXMA 4D82A 3SUEA 5KNBA 1DSUA 2ZCKP 3UOPA 3CS0A 3MUFA 3I32A 2GJAA 1UCYH 3FZZA 3MJRA 3RWMB 5J4VA 2OILA 1IQJA 4E5UA 3EPLA 4EFNA 4L5BA 2O8WA 1EUFA 1XEWX 3HWSA 2ZE8A 2G5VA 5AR1A 1SXJC 2GZ9A 2OP9A 3RXKA 1DBSA 3TGPA 1MTNB 2WAYA 3GYLB 3VEQB 2Y7XA 2F3CE 1PPFE 4JVMA 4JLJA 2PJRA 3EARA 3VB4A 8KME2 3TSOA 4EJSA 4LSGA 1TNGA 1MABB 4TPIZ 2PZFA 2J59A 1JBUH 4A0RA 4HI3A 4EUNA 2FI4E 1A46H 3A86A 1YVDA 2F43A 5JJKA 4LOYH 2ZSEA 3LPRA 4KAXA 4GHTA 1G3MA 5A09A 4FINA 3CO5A 1EJAA 1DFPA 1FIWA 6CHAB 1UK4A 2F1JA 3SV8A 4RZ3A 3Q9LA 1UBGA 1K28D 1BMMH 3TH5A 4X2YA 1COWA 5J4LA 1CXZA 4ISHH 2WWFA 1ZU4A 3BTGE 4MH0R 3HK3B 2JJ2A 4M9QA 4N0EA 5AJWA 3SUGA 1LVOA 3GY5A 4WZ6A 1KIGH 2DWPA 1CJUC 2WWHA 3GJ5A 5LB2A 2CXXA 3FP7E 3CRQA 2OLKA 2ZR9A 4A4DA 3KCGH 2BD4A 2N1BA 1AVXA 1NN6A 4B44A 4Z51A 1P2NA 3PLPA 4E7RG 5C18A 1K1OA 2QGNA 1D4PB 3HPRA 3HYRA 4LYAA 3RXAA 2BMJA 4ESTE 4BE7B 5ESTE 3W5IA 1E2HA 4RJLA 2BB4A 2ZFSA 3PTNA 1O3EA 2QUZA 3I29A 4ARZB 2HLCA 5JBAS 1QIXB 4PZLA 1TOCB 5EQQA 1VGCB 2ZVPX 5AJVB 4F4JA 1IQIA 1QBVH 5JBCS 1T3LA 3GLGB 3C14C 1E2MA 1F5RA 1XPRA 4GPGA 4JS0A 2D8WA 1R2QA 3U61B 3BERA 2OXRA 1C1WH 1Z6TA 1LVBA 1ZMNA 2AFIE 2CHAB 2ZUBA 1BIFA 3NKVA 1FY8E 3IHWA 4PPNA 2ZS9A 3THOA 2NTYC 4EQ6B 2WVJA 4I8LA 2WPJS 4TMZA 1E2GA 1NM6A 1WAYB 2GJKA 2IYTA 2FO9A 1HIAA 1QNJA 2JLQA 2JJ1D 2RCEA 2H5DA 2FEOA 2SNVA 1NRJB 3J81k 2HT1A 2IYLD 4UXIA 2QAAA 5AFZH 1TX6A 1Y5AT 1T3SA 1Z8IB 3NHAA 3FKSD 2ZI5A 1LFDB 4Y0YE 1D9IA 3C27B 4A2PA 2ODWA 3T1OA 5A8ZA 2X19A 2HPPH 3BIUH 4OHXA 1S1CA 1MOZA 2ZRBA 3MAAC 3T35A 1QBNA 1R5BA 5C4MA 3K6ZA 3AEZA 1G19A 1HH4A 3EASA 4B2CA 5FPHA 3DFJA 2GEDA 3LU9B 1PYTC 1AWHB 4PXAA 4MKGA 3HP1A 2VSXA 2VHCA 1GJ7B 4QJ5A 1ZJKA 2DWQA 1TGBA 2IS1A 3F6UH 2LNCA 4QJ3A 2P8OB 4RKJB 4Q66C 2XXAB 1G18A 3A85A 4I1SA 3ADCA 2BMDA 3URDA 3MWYW 2ZYVX 3U5ZB 1NG9A 3CPEA 4JYVH 1ZM2A 2XJ4A 2IEZA 4A8JB 4GSOA 3TH4H 4H9GA 1AGRA 1OH6A 1C2IA 4JZ1A 2G88A 4KFSA 1XUIA 5CIQA 1G7CA 5EW2H 1D2EA 1LQEA 4GL2A 2FEQH 3GQBA 4NYJQ 2UUYA 1P5ZB 1NRSH 3RANA 1DX5M 1TMKA 1Z22A 1L7VC 2FSHA 2PZEA 3PWBA 4TY7A 4TY6A 3QTVH 3UR9A 2D62A 3OZXA 3VMFA 3GOVB 3TVTA 2PSYA 4OQLA 3BH7A 4QBIA 1T5LA 2OE2A 2CHGA 121PA 2F3TA 2A1DB 1E98A 1WB9A 2P3UB 1VPLA 2JH6D 1KY2A 1CE5A 3FKQA 1T8LA 3MU4A 4DLVA 5TVKA 3E16B 1T9HA 2J94A 4LJ6A 1XZQA 2I6QA 1TGTA 3FYHA 1T8TA 3K9XB 3G01A 5KSZA 3IGFA 2O5VA 3LH5A 4JMPA 1T7CA 1GJ4H 1XFAA 1GHVH 4K81B 2YJTD 4JT2A 4WMDA 2HJGA 4Q1DA 3KX2A 4WW0A 1LDTT 1UO6A 4C3ZA 2XZLA 1O2PA 4JK5A 1LMWB 4FXGH 3T15A 2GWHA 1FOEB 2KI5A 4PX9A 1LVYA 4UONA 3GLHA 1AQYA 3BH0A 4OJQA 2EFCB 3W6OA 2WOJA 1TPOA 4Z1MD 1NVWQ 1DG3A 1DWDH 3CENA 2O8EB 1NMXA 3RXFA 4A36A 4NDZA 4CRWB 2OT3B 1QQUA 1QTFA 1G6HA 4PSAA 1UTJA 5K8UA 2A5YB 1FMGA 1E4VA 1GRQA 2XRCA 2QCYA 2NU0E 4TZ6A 1GJ5H 3ECCA 8LPRA 4DCNA 5I46H 4O9VA 3RMMH 1XB2A 1DAHA 4IN1A 3H5CB 4M53A 4NYIQ 1ZMLA 1V6DA 2DYKA 3ATKA 1O2GH 1GL6A 4JJZA 1W5TA 5EUMA 3KXKA 2PHBA 3BB4A 3PV0A 1W2GA 4LHZA 3H4MA 2PX0A 3WBJA 1ZGVA 3LQQA 1YCPH 3Q3YA 2ZPTX 1RKBA 3U44A 3RDZA 1IJFA 2B92A 5EE5B 2P3TB 2CMKA 1ZAKA 2WWXA 1CR0A 3RAPR 3AF2A 5LBIA 3ZS9A 2WBLC 2J34A 1DTSA 4FU9A 4Q9HA 2VIDA 4MA4A 1GL7A 2TRMA 4GPTA 1GVKB 2VHTA 3NH6A 2CEAA 2BKEA 2K5UA 3QF7A 2VSOA 2GCOB 4QNMA 2DFTA 2GP9B 4OGXA 2ZO3H 4NCYA 1Z0FA 3DPUA 1VYUA 1X3SA 1SLWB 4CRAA 2ZJBA 4DDTA 3SGAE 1O3GA 3HK6B 6GCHF 1Z8RA 2DR3A 5HMAA 4FWIB 1TGSZ 1CGJE 2GZHA 2ANMH 3TJUA 2OEPA 2ZUCA 3V7TA 1OWIA 1C2EA 4NTZA 2OC7A 1ZD8A 3W6NA 2HCBA 3BSQA 1OIXA 2QXJA 1ANKA 2H8KA 2CLCX 1G7SA 2ZHWH 4MDFA 3GY4A 3PMJA 1NF3A 3HU1A 1N1LA 3OEHD 1BH2A 3FP6E 1F2SE 1GNPA 1LNZA 3C16C 5GVSA 3THYA 1OWKA 1ELCA 3DMDA 4TSFA 1W44A 1GBAA 3LD9A 4CEIA 3I78A 4LV8B 2WYJA 5JFGA 1LB1B 3SJ9A 2XWAA 2UZIR 1A5HA 2LCFA 1S8FA 5F8ZA 4IDOA 1P61B 2G1KA 4DOQA 1CTQA 2IEYA 3U69H 3A8CA 3KQHA 2F55A 3PLBA 5FAHA 4D2IA 1SULA 3IIJA 1ELBA 1JRTA 2IUUA 1G30B 1OIWA 4EIWA 2EI7A 3LAWA 3SFVA 4TYPA 4BFXA 1NFUA 3A4LA 2P0EA 3RM2H 4MNVA 3TSZA 1QRZA 3RXSA 1E69A 3S7KB 3ZVCA 2DHRA 4YC7A 2PKAA 3OEED 5LGOA 4FUJA 2BM1A 2ZE7A 4RZ2A 3MU0A 3DZ8A 2VSFA 4Z0KA 2VP0A 1ZCAA 2OM2A 1E3MA 3SOPA 1SGFG 3KQLA 2BBTA 4QM7A 1HT2E 4FW9A 4ZROA 4GZLA 1IQHA 4DB2A 1GG6C 3KN2A 3KQBA 1E2DA 1GBIA 3LIWA 5BYJA 3W3AA 2VIIA 3EXAA 3ZVNA 1GI5A 5G4BA 1TQ7B 4URXR 3Q3JB 3DD2H 2WV5A 2QSYA 3DT0H 3ELAH 4UE7H 3B5JA 2CVFA 2P6RA 3LWNA 4TYNA 3CR8A 1KI1A 1KI9A 3WP1B 1RIWC 2UWOA 1RJ9A 2W0MA 4M7GA 5C46F 3FE2A 1CR2A 2XNDD 1TQ6A 3OX7U 1E35B 3M7TA 2WTUA 1LF5A 7GCHF 2Q21A 4GMXA 4M1MA 3TNTA 4LXBH 2ZUDA 1OWJA 1Q1BA 1O2QA 3M3SA 4BLQA 2BDGA 2GXAA 1HAGE 2HDNB 4G3XA 2O8DB 1N6OA 2O0HA 5M04A 3PUXA 5A8XA 5DNYB 1CA0C 1TIOA 5C1UA 3EDXB 5J4SA 6GCHG 2NO9A 1BS1A 1F0UA 2PEZA 2ZP0H 2F9UA 1ZPZA 3SI7A 4LYJA 4XD7A 3C4JA 1QHYA 3VFEA 4BZPA 2BEKA 4LCBA 1DAFA 4B34A 4NYIR 3AKCA 2RHMA 3ZQ6A 3NTUA 1QHNA 3KQNA 2HALA 4P32A 3SS8A 1KO4A 1N6XA 4DSOA 2W83A 1FQ3A 1NIJA 2BLVA 1V2OT 2JLYA 2BD7A 1PQ5A 1LW7A 4B6FA 3BGWA 4MUAA 1TLDA 1TOMH 4L16A 1FAKH 1J14A 1KDTA 4ILEA 3ITIA 4YDHB 1E1QD 2GAOA 2GV7A 3OEEA 4WVFA 1F5LA 1HQCA 2WOOA 3RS5A 5TJXA 2V6NA 5LPRA 2AEIH 3VR6A 1TBZH 3V4FA 3T1VA 1WBGB 2ZTXA 1P2OA 2A78A 1N6YA 4X8UH 2WJGA 1FV9A 3MMGA 5FL3A 4AX9H 1HUTH 1MCTA 1KNQA 2A5KA 4KLZA 3MO3A 1ZLRA 1A1RA 5F2EA 3DHWC 3BTEE 3R9XA 1TX7A 3A8BA 3LLMA 2ZI7A 2NU4E 5H4IB 4A6XA 4I1VA 3QXCA 3CRVA 4DLWA 2XTZA 5KSOA 2O8BA 1Z2AA 2OQ5A 1JXMA 3RABA 2XTMA 3QXSA 1K9OE 3PFIA 1QHXA 2XNDA 3IIKA 5EP1A 3U3RA 1YZNA 4GRAA 3EZ7A 3VB7A 1Z29A 1EX7A 2ZRJA 2QZ4A 1P11E 4II7A 3B7GA 4KTSA 3R9WA 4B2BA 4DSTA 4DDWA 2F1HA 4Q4AB 4DBLC 3PIRA 1E9RA 4FUCA 5E2OA 4MPUA 4Q01A 2BOHB 4NA9H 1TWXB 1E2PA 4CEJA 4X2XA 4HTCH 2AKAB 3P4XA 1TX4B 4ZKDA 1RFLA 2CLDX 5SZKB 2HUPA 1W8BH 3B1XA 1MD8A 2B7CA 4Q1EA 2YWFA 4R2HA 3ZZ0A 1Z0KA 2IL1A 3KHVA 5FBRB 5JBBS 1GI8B 1QVAA 4BXSA 1KO7A 5E4FA 4A0HA 4ABDA 5E2PA 2ZKSA 5B6LA 2QMHA 4MG3A 2FI5E 3WHKA 2BXTH 1KJZA 4AURA 4MPVA 4A92A 2SGQE 1ZMXA 2WHXA 3AVUA 3KFVA 4O2RA 1G8HA 3QWCH 1KY9A 3EWSA 2N46A 1ZPCA 3AAUA 3RS7A 1U90A 4UJ5A 4HAVA 2A5JA 3WMEA 1SFIA 3A58B 1H65A 1E99A 1M7BA 1KHTA 2GZDA 5G3ZA 5DYIA 4XIGS 4R9UC 4URZR 4IDPA 3PMHB 4KBGA 4BGDA 3ZD7A 1JMOH 1CLUA 4N3NA 5FBVB 1TPSA 2WYGA 1SB1H 1II0A 1IQKA 1ETRH 1DXWA 3DEFA 1B0UA 1KK1A 1ONBA 3C8UA 1VTKA 3L33A 4JMYA 4A7IB 5LB4A 5JHHB 4O0MA 1H1BA 4I4LA 3GFPA 1ZHMA 3NDBB 1P2MA 2GXUA 2OXSA 4JLKA 3GCHB 3QXHA 3MNBA 5GIBA 2EFDB 4YMUA 2GCTC 3ZZAA 4H1UA 1VG9B 1SGNE 1ANDA 1ETTH 1OWEA 4MKIA 3K70B 4CGZA 5EE1A 3QVVA 3B23B 4P4SA 2Y5GA 2IBMA 2EI8A 4TL6A 1Z0JA 4MGYR 3TU7H 3QX5H 2PEYA 4LJAA 4ZIRA 4K46A 3JZ1B 5C3NA 5GPIB 5DP4A 2WJYA 4B6EA 1EXMA 1QB6A 2DFKB 1IOZA 3LA6A 3UWIA 3RRYA 3SQHE 5DH9A 3LONA 3VKGA 2G0TA 5EXSA 1KMHA 2IK8A 2QE7A 4DDVA 1YQTA 3B8JA 2ZI3A 2FEMA 1SGYE 4Y8YA 2H17A 2QBYA 4WZBE 3B78A 1G5PA 2H18A 3VR3A 2JETB 4Q7ZA 3ND9A 1K1IA 2FF7A 3L0IB 4XWOA 2CCKA 2Y80A 2ZTZA 2OCAA 1GBMA 3KKQA 2YHSA 3KZ1E 4EFLA 3UPEA 4BOHA 2OCYC 3A7VA 2FESH 1QCPA 3K0AB 3PG5A 1SLUB 3D7MA 2GK7A 2A5AA 3TRFA 2W3IA 1NKSA 5F3WB 1P9RA 1TPAE 2ZQ5A 4OS1A 4KYUA 2Z3EA 1KSNA 4WXIA 2OD3B 4AG5A 3FMPB 3AKYA 4AI6A 3JVVA 4WWYA 5GJVC 2AK3A 1O39A 1N25A 2G51A 3GDUA 4JZEH 1TB6H 1QB9A 5CJPA 2JA1A 1P2UA 1NZQH 2ZQ1A 1C1PA 1DO0A 5IK2D 4UNPA 2OBQA 1ZUIA 1Q0UA 2ILNA 5DK1A 1A2CH 1EGAA 1XD8A 2Q6FA 2B8OH 4AY2A 2GDEH 2UWPA 2BX3A 1SXJB 1H8ED 4V0NA 1N6PA 4NCKA 1M1YE 2THFB 1N0VC 2ORVA 1XXHA 4NIYA 2ALPA 2AR7A 1TX8A 3TJVA 1E2EA 1P02A 3CZPA 3QKUA 2ATVA 3PUWA 1LHFH 1ZR0A 1NTPA 2E1RA 2PFEA 4IOKA 3A1SA 3IHLA 1E9EA 1XRJA 3H09A 4XVRA 2DY1A 1QRWA 1VZQH 2RCNA 3GFOA 1G2MA 5LDDC 3TMKA 2ZDKA 3DM9B 1XMSA 4MNXA 1FNIA 3VR1A 2IN2A 2ANYA 3VGCC 1E2KA 4XJXA 3BFXA 2PMDA 4MDEA 4A1VA 4R98A 4NG9H 1IBRA 2FS9A 1ZNZA 5EW1H 4IW3B 3GLIA 1U81A 2ZJYA 4QHYA 4TZ0A 1QL7A 1EAXA 3AVVA 1GI6A 4LHVA 1HFDA 1RRGA 2TBSA 1P05A 1FNMA 1EFUA 3P95A 1OS8A 1XUKA 3LRPA 3FB4A 5FPTA 2VVUA 3GJ7A 3EWAA 4M1WA 2OC0A 4PO8A 2ODQA 5LPFA 1QF9A 5KDOA 1OX1A 3U8OH 2GZAA 1K1PA 1C1QA 1A5TA 3B1VA 4HUQA 3HYTA 3F68H 3Q3KA 3VX3A 3ICEA 1UDXA 5JRJA 3DZDA 2C5LA 1IN7A 1Y3XA 2RMKA 2QPOA 4B32A 1EKBB 1SGQE 4G5QA 2R2WU 3B9PA 3GEIA 1W48A 1YBWA 1EWRA 2ZGBH 4TMWA 3NKKA 2RA3A 1ZNYA 1N5JA 2QP9X 3B9FH 3FMFA 1G3QA 2W2XA 2VRWA 3A1WA 1PZNA 4BEJA 1ZUHA 1MKYA 2IPHA 1GCDA 3F9EA 1H8DH 1X86B 3K09A 3UG6A 2ZDVH 2PR3A 1KNXA 1UJ2A 1YU9A 2F43B 5HE9A 1D8TA 1D3QB 2EEKA 5L2YH 3RXVA 3P26A 2PMKA 5CB6A 3M4YA 4JBYA 2BY9X 1OYYA 5DJ7A 3HDTA 1SVKA 4BLOA 1GJ9B 1MKXK 4HLQB 1N6RA 3QG1A 3MFYA 1ZJ6A 2XW9A 2R3YA 1HXFH 3DHKH 3PM3A 2BJVA 4OM9A 1MABA 4BAQB 4WMFA 5FBEA 1FMLA 1H8HA 1HJAC 4ZDWA 2ZROA 1C5QA 3ENSB 3MGCA 4K8BA 4D0NA 2HPQH 2FM2A 5KU1A 2ANWA 4XVQA 5FTMA 4DB4A 1TF7A 3AGPA 2H1LA 5FUYA 5BQ5A 1N6NA 2LWIA 2VHJA 2VH5R 3H7TA 4IGDA 2FP7B 3RWOA 1ZW6A 1Q3XA 3KF2A 3TUZC 3FMOB 2PLXA 1G17A 4NCHA 3C41J 2BVSH 4WIAA 1AFQB 2B21A 1O3BA 2XC5A 2F91A 4DLUA 1CR1A 3PCRB 2PGQB 2PCJA 2YWEA 3MMPA 3ICQB 1NVUQ 1K1NA 1E9BA 4JSTA 4FMCF 3A80A 3THWB 1N6KA 2Z4SA 1G2LA 3TKLA 2J0UB 4D76A 1HAPH 2F9LA 4HUTA 2VVCA 4KTUA 1LS6A 2ODYB 2AHOA 1CKEA 1GBCA 3U9AH 2GEVA 1S6FA 5T6FA 1UJ1A 4WZAE 2A45B 4GOXA 1UDWA 2JKHA 2IHYA 4Q7XA 4GBMA 1QB1A 4CR5A 3BH6A 5JB8S 1Z7KA 5FOTA 5H68A 4AG6A 2PTNA 1KK0A 2BY6X 2QAGB 2BD9A 2ZRPA 1A61H 1HIAB 3SDZA 2A4QA 3QGJA 1DPFA 3SNDA 4YOJA 3GLGA 3SI3H 4OK6A 1Q31A 3P6ZB 1BYUA 2OFWA 2GESA 1CO7E 2ERYA 3SHAH 1HNEE 4A1TA 5DO4H 2PV9B 4OS7A 5A5GA 2ZU4A 2H16A 3UIEA 3RXUA 1YR9A 2Z94A 1R6BX 4AYWA 4GCHF 1V2QT 3RC5A 4NZYA 1RGQA 4A6PA 4QBGB 1BBRK 1G4AE 1D6JA 4KELA 3IILA 1KZ7B 1IY1A 1E2NA 1C5SA 4LBVA 3CH5A 2UZ3A 4E09A 1KKLA 4NFEA 2AXNA 5CLQA 5DN6D 2QU8A 2FIRH 4F49A 5FPYA 1ZHPA 5FHTA 5AWFC 4TQAA 4FMDF 1W5SA 3CWQA 1UK3A 1V2PT 3HU3A 1T8NA 1TL7C 4Z8YA 4ZDIA 3U6KA 2CHQA 1Z6GA 1KKMA 4NBSA 2XBWA 4OS4A 1FDPA 1BUIA 4DJZB 1EWQA 4IVQA 4NA7A 4NCIA 4NA8A 3N70A 3WXMA 3R8FA 1UEIA 1BRCE 2ZETA 2GBLA 5JRZA 3AKDA 3MH7A 2FN4A 1V2MT 5FTJA 2FX6A 3EE0B 4ZI3A 3ZIAA 3ZVBA 3FOZA 1XXDA 1IJEA 1Q22A 4NGAH 4OHZA 2F83A 5I25A 5HE8A 1GMDF 1XTQA 1JJ7A 3HPQA 4BAKB 2WJIA 1W4BA 3AUYA 1U0LA 1Z63A 1BOFA 2D2EA 3OY6U 1EJNA 1HTWA 2VO1A 4A8JA 1WQSA 5JI2E 1UBEA 5CYOA 1PPEE 2CHAC 1ZRHA 5TY0A 3IQXA 1YZUA 2AMQA 2I1VB 1UTNA 1MV5A 3ZVRA 1TAWA 1XKAC 1YGCH 1O3PB 3AF3A 3A36A 5CJ2A 1N0WA 3M7QA 1KSGA 3A7XA 1L4ZA 1B5GH 1S0UA 1OP8A 1GUAA 2Q6GA 1UTMA 1GWNA 4QGGA 3V00A 1L4DA 4Q1AA 1HB0B 3AB3A 5K7RA 4F7WA 1ESTA 2ZM5A 1B0EA 3GLHB 4RD6A 3R9IA 1HURA 1S0RA 3PROA 4Q1CA 4DIHH 1BJUA 4OS5A 3LQRA 1XUGA 1P60A 2FOHA 4X6MA 1ZNXA 1AUTC 1MH0A 4EDHA 4F4OC 4GDFA 3ZZ9A 2DCUA 1VJ9U 2G55A 1G3EA 3SE0A 2PJZA 2CJIA 2QTVB 2GBLC 2ZYUX 5EXNA 2FDCA 2EW1A 3SR0A 1NO9H 3IO3A 4RD2A 3THXB 1QGFA 6ESTA 4OHYA 3PENA 3ZGXA 2YVUA 3EC1A 1F6BA 4Q02A 1AQUA 4DW2U 3ESTA 5DN6A 2JH0D 1IN6A 5PTPA 1TE0A 4P4UA 2Z9LA 1GBDA 1XTIA 2H57A 1C5WB 2G00A 4NU0A 1NI3A 4WJG2 3AGQA 2GMTC 4M1SA 2QTFA 1C1OA 3K6YA 4Q21A 1C5MD 3SNAA 2RA0A 4B76A 2IS2A 4NL4H 1ZRKA 3QSYA 4LC0A 4C2UA 4QM6A 2D26C 3U44B 2ESTE 1XP8A 3DDCA 2D7CA 1AGJA 3KIDU 2A5FA 3KQEA 1NKTA 2IYUA 2QEQA 3I62A 1O3NA 2QMUA 2DUCA 3ZYDA 3GJ4A 1Z6XA 2Q6TA 5FR1A 1YR8A 1UVTH 1G7RA 3FFGA 1BTWA 3EIEA 1ZM9A 2GJSA 1Z06A 5TCCA 2JGNA 2FOBA 4B48A 4KFRA 2Y7ZA 2QP3A 2J5XA 4EPRA 4WH8A 3KQKA 2BY7X 4NKRA 1U0JA 3NEJA 3R20A 4IW4E 1KXEA 3M3VA 3IEUA 3RLYH 4I1OA 2EFGA 4BPBA 2XYAA 5A0AE 2C8XB 1WP9A 1GG6B 2ZU5A 4YXWD 1MU8B 1SPJA 4ITRC 3LVQE 1UTKA 1MKWK 2HLDD 2F9OA 1GMDG 1HAVB 1NLZA 1G8FA 3V12A 1K8RA 2B6HA 1E1RD 2VH0A 1RC8A 1MR3F 4MKFA 1T8UA 5IT5A 1CR4A 3TJZA 1J9CH 1KI8A 1XEXA 4TLAA 3THYB 1NG1A 2QM8A 2D7DA 3E3TA 3MOCA 1DS2E 2AWNA 2C78A 5EZ5A 2IA5A 4JLVA 4EKDA 1GDDA 1ELDE 2STAE 2OC1A 1QJ1B 1WA5A 1QZXA 5TV2A 1KI6A 4JKYA 4L9WA 4C0SA 4DUGD 2FI3E 4PC6A 4KYIB 1BTZA 1YE8A 2HXSA 2J45A 3OESA 2FOAA 2Z83A 3ZZUA 3BOSA 4GLYA 3RXDA 2CE2X 4O97A 4YMSA 3BB1A 1EOJA 4G01B 4CR9A 1W36D 2QENA 1OXSC 1XCPA 1LS1A 4I33A 2ZFRH 4Q9JA 4JJKA 1CA0B 4LV5B 4OQNA 2C98A 4BFSA 2PKAB 4Q7LA 1QBKC 3A6PC 3H2YA 1AN1E 1IHSH 1MTSA 1GVLA 3LY5A 3KJHA 4Q9LA 3BV9B 4UFEH 3IBYA 3GD7A 1DVAH 2RG3A 1DAGA 3BG8A 2IYYA 1A0HB 4AKGA 3KNXA 3P17H 1THRH 1VIAA 1G8YA 4FU7A 3V3MA 4LJ7A 3I4LA 1TNDA 2VIPA 2Y81A 1J7KA 1C1VH 3QUSA 2QGRA 3WRYC 3RC4A 1EP5A 4V0MA 4TMKA 4ZO4A 5KHOC 1N6IA 2HF9A 1SLXB 5KNCA 2ZNKH 4ZPXA 4JT4A 4MUBA 2CN0H 1ZSLA 2X2FA 3TPIZ 1JR3E 2GK6A 4ABYA 1EASA 2RGBA 2BQ6B 4W9MC 2QY0B 1LKBA 1Z8GA 2QI9C 4LI0A 2BD3A 2PW8H 5FOUA 3D49H 2ZE6A 2XOKD 2EVWX 2A7HA 1V2RT 3F9FA 4HAXA 3F1SB 1ZHRA 3CUEF 4AB9A 3PEYA 2JDID 4D0GA 1W49A 4XDEA 1Z28A 1WBDA 1G3BA 1GMHF 2TGDA 4YXWA 1T32A 4B75A 1WYKA 1X8JA 3ZZBA 2BYAX 1MRSA 1FX0B 4B74A 4D9QA 4MQAA 1TAGA 4EFMA 3QEJA 1UMAH 3E70C 6Q21A 2CK3D 3O8RA 3ZJYA 4L8GA 3EAJA 2ODEA 2H9TH 4HDCA 1FY4A 2RAPA 4NHOA 1E79A 2YC4C 5KPJA 1ABJH 4BAMB 4PHGA 1CVWH 2GV6A 2VIQA 3SV7A 4D4MA 3QF4A 3LT3A 4Q47A 1NRRH 2D2DA 1GPZA 1E9AA 2GCHF 2YNAA 3NG1A 3VHLB 2JLUA 1JEEA 1S81A 4DIEA 2IXGA 1L2TA 5HM9A 4ZHMU 4BQSA 4X2VA 1DY8A 5DI9A 1R0YA 2AD5A 4GVUA 1F0SA 1TPPA 2W2TA 3MNCA 4RFSA 1TTTA 2FNAA 1Y5UT 1NVVQ 4W5HA 3E90B 4DT1A 3O47A 3RSLA 2HNTE 2J46A 4A0FA 3CR7A 4NCJA 4YDSA 1PLKA 1Q1EA 4IC5A 2J0QA 1XJQA 1P62B 4URYR 1CBWC 4WAUA 2C03A 2IT1A 3NK8A 1T91A 4HLCA 3L43A 1MO5A 3NWJA 3ZVGA 1BTUA 2UKDA 2VL7A 3MH4A 4IFEA 4LX0A 4GHQA 2ZITA 5EPNA 1NROH 2ZE5A 4Q18A 4B1TA 1C5YB 1XCMA 3SU6A 4PC1A 1SVOA 4V03A 2JLVA 2YOGA 1VG0B 3M37A 1AU8A 1C1NA 1ELFA 2FSIA 3DM5A 3A81A 4QRHA 4HB2A 5B58C 1R4AA 3DOFA 1QVRA 4MNWA 1ZYUA 1HEIA 4D81A 3EZ9A 3EC2A 2P5TB 3T1TA 3L3TA 2XOKA 4E07A 4CT5A 1D6WA 1N6LA 3ZVLA 3L2OB 3K53A 5KSYA 4PO1A 2BBWA 2JDIA 2OV2A 2XAUA 3T5DA 1UVSH 2YYZA 4RN6A 4K1TA 1CHOG 4X8OA 1KAOA 1KMQA 1S6HA 4PANA 1W36C 1SHHB 5JZVA 2IYQA 1PPCE 2GCTB 4IDHA 4BAHB 3WNBA 3PTBA 2FGKA 4HAUA 2WZQA 1L4UA 3UQOA 5EOKA 2VWNA 2XBXA 2ZCLP 2I3BA 2CK3A 2GZ8A 1FZQA 4J0QA 1MCVA 1US8B 2Y5FA 4I81A 1GRRA 2V3OH 3WNDA 4K1SA 2J3EA 2MSCB 1GMHG 4LZ1H 2L0XA 1NSFA 2AIPA 1VCOA 4Q4AA 2V6IA 5FOWA 4JYTA 4XSKU 1WQVH 1D3TB 1DSTA 2JLSA 3GEEA 8GCHF 5DP3A 1JPNA 4RD0A 3M35A 1TBQH 1NT1A 4GFDA 4WA7A 3TH3H 5FL7D 5JWRA 2GZ7A 2BZ6H 3Q76A 5CDFA 2DWOA 3K8YA 1EAIA 2IC5A 4C0KA 3M0EA 3VNUA 1E2LA 4RKOB 4Q4HB 2WPKS 3RNLA 3QZRA 1TABE 3KJGA 4JLNA 2ZDAH 2GT8A 621PA 3ATIA 1MAXA 5A0BA 4WVPE 1P9NA 3VB3A 3IKJA 4INKA 1QRXA 1WTHD 2NMVA 3W34A 1D3DB 1LHEH 4PSVA 1Z6YA 4YT6H 4MYUA 3GLGE 4LV6A 4KLNA 3LV8A 1QY6A 1XTJA 1GBLA 4J1YA 1VG1A 3O8BA 4B3BA 3D8BA 1SVMA 2HYDA 1GP2A 4JLBA 1YZQA 2XCFA 4BTUB 4GUXA 1E4YA 1GBBA 5C20A 2D74A 1W2KH 3IO5A 1VYTA 1Y3YA 1J2JA 3FDIA 1O2UA 4IMQA 4M1TA 4RD3A 2I4IA 5G41A 1FAXA 1GHBG 3A8AA 5E0GA 1JRSA 2BWJA 4CREA 4QG7A 2ZJ2A 2ZJAA 1ZTLA 3LDAA 4QNRA 2ZHFH 3SUFA 3UXMA 5CLLA 3I92A 3FHOA 2A31A 3RXJA 1C5RA 1EB1H 3VHXA 1UTQA 2PBRA 1HV8A 2A32A 2V4ZA 3ZV9A 3P20A 2PWXA 4CW7A 4IKEA 3NUMA 2C95A 1Y3UA 1S9DA 3T5GA 2Q1JA 1GL9B 4X8TH 3VAAA 2NPIA 1RE0A 1A3BH 3W8RA 4Q48A 1KOFA 4INLA 2P2LA 3VGCB 1JXPA 4TYYA 4OYHA 4DLRA 4PZZA 4YT7H 1CJKC 2C96A 5GCHF 1OFHA 1EJMA 3OTPA 3N7OA 1XMIA 4DIDA 3KDSE 2MMGA 2GETA 5JECA 3BEUA 3EPKA 1GNQA 4N1AA 1KXFA 4MGZR 5DKMA 4PHHA 1D6RA 4HAWA 1AVWA 1Q3TA 1HXEH 3FZDA 5FBQB 1K5DA 3KB1A 1S85A 2VYFA 4OK5A 3KXIA 2QXGA 5EP3A 4JZIA 3M5OA 3SOSA 1J8YF 5H1YA 5DIFA 2WUBA 1JAIA 2HOBA 3GCGA 3SJOA 2DPXA 4E05H 2CXVA 1TQ2A 2J9RA 4XVUA 4FUDA 3SYLA 4IBLH 2FOGA 5FL7A 1OFTA 1A7SA 3EZ2A 2XEXA 2V3HH 1T31A 3UWOA 1O3JA 9ESTA 4M9SA 1HT1E 5L3QB 4KHZA 2FE4A 4BASA 2IS4A 2GKSA 2X1VA 1V3XA 1EX6A 1EFRA 2X77A 5E7MA 2ZF0H 2QXHA 8GCHG 3SGBE 3SJIA 2WAXA 4FD2A 1SR5C 1PLJA 4QXAA 4A15A 3GEHA 1GM5A 3K0CA 4FIDA 1E0JA 2WKPA 1BTPA 3C7KA 2JATA 1TMTH 3UR6A 1UPTA 2Z5FA 4XOIA 1MO6A 4MRNA 1Q3HA 1Z08A 1E6CA 3UANA 4JSYA 2W6ID 3M5NA 5BPEA 1SXJA 4C0AC 3WYFA 1C1UH 1BITA 1THSH 4MYTA 2ZFPH 4MNYA 3GLIB 1GBEA 1SQTA 2LKCA 2SHKA 1P2TA 2J95A 3JZMA 1GJ6A 3HKJB 1GG2A 3RXMA 5C4GB 1GBKA 3R8CA 4YO9A 1HJAB 2VGCC 1QL9A 2FX4A 1EFHA 1ZIOA 1YPEH 5C1BA 5L3VA 3UFAA 3PEUA 3U3JA 4V0OA 1B7XB 1ANCA 2O8MA 4TT3A 3FWYA 3R7WB 5FOVA 1LPKB 1Z3IX 5DP6A 1KY3A 1FP7A 1E9DA 4AIIA 2D3WA 1LV7A 1FY5A 2F1RA 2P6UA 1BCUH 5CHAC 1UVPA 5CM9C 1QL8A 3UOUA 1C2LA 4M1KA 3LC5A 221PA 3QXXA 3DL0A 4NZQA 2D06A 4AGJA 3SHCH 1SBWA 3S9AA 1T4UH 1P9UA 2CGAA 1GCTC 4GSYA 3AAVA 4IJMA 4JVSB 1GKUB 1Q44A 4U7DA 3K0CC 3U98H 1JBKA 3BTME 3EYDA 2W6JD 5JJLA 3GJ6A 3CX7A 5B57C 1VDZA 4K69A 1DVRA 3ZVMA 2YV5A 3LXXA 1C2MA 3PITA 5GCHG 2BC9A 4XBBA 3LJOA 2ZDLA 1DOAA 3RMNH 1SQOA 1CHGA 3V13A 1IN4A 3W95A 4WY3A 3P32A 1SQ5A 1NL3A 3M5MA 2GGVB 1AVGH 4POAA 5HCNA 1DDJA 2BD2A 2J2UA 1AI8H 4KO8A 1VHLA 4AKHA 1NRPH 1E9SA 4MTBA 3B1WA 4MQBA 4BLTA 2ANKH 2W5EA 4CT4B 4A6LA 2GAAA 1OSSA 4JKIA 2JLRA 1CT2E 1ZSJA 3ATMA 2IJOB 2A9KA 1IQFA 5L8VA 1MKXH 2REBA 1XDBA 1M2OB 3JZ2B 2W6IA 3S1AB 2WINI 4LYHA 2DBYA 1P6XA 3KTAB 4G5OA 1J90A 1N0UA 3I3SR 2WKRA 1KYIA 5J4YA 5AUOB 2RB4A 1IQPA 1PPHE 4C4PA 2R6AA 2F3RA 1W4RA 3TVJB 3PVSA 1Z47A 1W13U 2RGNA 1HYLA 5CIWA 2NQ2C 3H1TA 4JK6A 4PZYA 1FXYA 1IQGA 1AO5A 4CF7A 4RSPA 1OH5A 2NG1A 2HF8A 1WCV1 3ADKA 3O8DA 1C4V2 1KJYA 2WICA 3LX5A 3B2EA 3AVOA 2OUAA 5HXFA 4TPYA 2ZU3A 1GDNA 4E7NA 3RXIA 3THWA 1R5OA 4M1YA 5B6OA 2ZIQH 1GBHA 2J0UA 1G3CA 4ABFA 1VCMA 1B23P 4RZUA 3WY8A 3T06B 2VF7A 3TITA 3LNCA 4BRUA 3EGKH 2BVNA 1FPCH 3LGVA 1A82A 1MUEB 1GL1A 4FWTA 2XBVA 1KZGB 4D80A 4Q1BA 2IF0A 4GZMA 3A4MA 4PC7A 3ZZTA 2F9VA 4BECA 1U6QA 1O2NA 3P8OA 1XCGB 2QAGA 2GT7A 4IOJA 1AUJA 1FZZA 2ZPRA 4L9SA 4PHFA 2XXLA 1A5GH 4ZKEA 2ZRKA 1HAXB 1L1JA 1P2IA 3RRZA 5BN4A 5FI0B 4RY2A 1MH1A 3TGJE 1Z1IA 4QGHA 4LUCA 2DE8A 4M4SA 4Q7KA 1XJCA 2F9BH 1P12E 1YPJH 4CIDA 1HCGA 1G291 1HV7A 1EFTA 1BBRH 3MTYA 2RGNC 3DVLA 5ANRB 2ZA5A 1BRBE 3P8FA 3T28A 3CBQA 4X6PA 1FUUA 1O5BB 2B7DH 1AFQC 2F7SA 4UDWH 4Y0AA 1O3LA 4HGCA 1F0RA 3T29A 4W5WA 4B3FX 4RKEA 3AF0A 4GAWA 4Q7YA 3A7WA 2AN9A 3IWMA 1W11U 3AVZA 2GDJA 1A1VA 1FL9A 4GNKA 1OYQA 1Q1ZA 1C5UA 4K5ZA 3W3ZB 3PYHA 1P2KA 1EATA 1YPLH 4UD9H 2NO6A 2GMTB 1HJ8A 2ZYWX 2OBMA 2A4RA 1RRCA 3QN7A 1G3RA 1P10A 4AK9A 4O2LA 1ORFA 3MJHA 3W9YA 4B2PA 4B3XA 2GTBA 4WXVA 5HM2A 1PJPA 5J4KA 1E34B 2PT5A 2QAGC 4OS2A 1KSFX 2FOEA 4DC9A 3TUJC 4K1EA 3AH8A 4LOAA 1NBME 2BMEA 5AJXA 2ODPA 4G0NA 2JJ8A 5JDUB 1P3JA 4RFVA 4AN7A 3K9GA 1VR1H 3RXTA 4BFTA 1ZD1A 2A3RA 2OG2A 2B0FA 3LO5A 1BHXF 1D3PB 4M2LA 4JLMA 1BHXB 2BCGY 4LBYA 1KYNA 2MSDB 1TFXA 2WSSD 4LZ4B 1RPZA 1EZQA 3SQEE 1O2LA 2QROA 4PHTA 3B9QA 1UFQA 2H9HA 1XPUA 3U1IB 2ZWLH 5L2ZH 2PX3A 2ATXA 3SV9A 1O2MA 4BWYA 1FPMA 4FMBB 3I5XA 1CRPA 2GXSA 1QJ6B 2A7CA 4X1QU 5F8TA 2P5SA 5FX6A 2JJ1A 1RTFB 4B33A 2EC9H 3MO6A 2FFHA 1W47A 1V2LT 4BFWA 3UQVA 1R0ZA 1DANH 4NSYA 4Y0ZE 1NRQH 1CJMA 2EYQA 1DAIA 3A7TA 1II8A 4JZFH 2Z3DA 1XTRA 3FKSA 3SU2A 1YR6A 1G20E 1CT4E 5AUPB 5FCKA 3TH2H 5DISB 4DLYA 3THXA 1DG1G 2Q3FA 4KVAA 1GAJA 1YC0A 3ZZ6A 1RW4A 1VECA 4YMVA 2ZHQH 4DWJA 2NU1E 3CX6A 4VGCB 3ZZ7A 5HPYB 2ZRNA 3GY6A 3IDQA 2JIZD 1EZXC 3TK9A 1NY5A 2BY8X 4S2EA 4PQRA 1C4Y2 1C5XB 1P75A 2WPHS 1ESAA 1GBTA 2IXFA 4FUGA 3CPJB 1N5KA 4QBFA 2AYWA 3MI4A 3KEEA 1IOEA 3RUOA 2BDYA 2EFHB 2BDIA 2TGTA 2ZSAA 3MWKA 1AD8H 4Y0VA 3UMRA 1L4YA 1Z71A 5D3QA 5EUQB 4UFGH 3MWIU 3MHWU 3F5FA 2BY5X 1TGCA 3FP8E 2ZC9H 1GI2A 2V7QD 1KI7A 5FFMA 2XB2A 4K8YA 3T27A 5EODA 3U7GA 1CGHA 1E9FA 1SHYA 2OO7A 2VA8A 1ELEE 2GVZC 3QIAA 5FBIA 3L8ZA 3U8RH 5DSZA 1O3DA 3IEVA 1AKEA 1XEXB 5BYKA 4CRDA 5FI1B 4XTCS 1OOKB 7KMEH 1VJAU 3C1KA 1O33A 3OIUA 3FFBA 4IXNA 4S35A 1OT3A 5J4HA 4I32A 4KBFA 1SG8B 1VHTA 1ODFA 4J2YB 2C8VA 1GMCF 3HPTB 2R8RA 2GCPA 4Q1FA 2P3FH 3ZVAA 1KI6B 2W58A 1ZZZA 2BVXH 1HAVA 2C2HA 1PQ7A 5JMTA 3GCTF 3SUDA 3GY7A 3QOFA 1MKWH 821PA 3SEAA 2G83A 3LC3A 2Y5HA 3F9HA 4M1OA 2NOAA 2BDBA 1YZKA 1F7ZA 1EB2A 1JOUB 3TAHA 4ABIA 1A5IA 2OESA 3WNCA 5EXMA 3WBKA 1Z07A 5EQRA 2WPLS 1UKZA 2REXB 1TONA 2ZFFH 4PC2A 5HZHA 3NWUA 5FUVA 4Z1MA 2FZLA 3X1ZA 5FTLA 2R0KA 1O5CB 1UCYE 1YHNA 4PSKA 2QGZA 2BV3A 1G7TA 4Y76A 2V0BA 3A82A 1WE2A 4BTTB 3SNHA 1UKYA 2BQWB 3KFXA 1SKYE 4D25A 1AWFH 1DM4B 2IYWA 4MYCA 1T8OA 2ZFQH 2BLWA 1H8IH 5E8EH 5HR5A 5GJBA 4I7YH 1FTSA 1NMZA 1L0ZA 1DE7H 4M8NE 4IVRA 4QKQA 1TNJA 2ZFTA 3LX8A 1AZZA 2J87A 1GHXH 4B3CA 3EA5A 5HYOA 1M7HA 1GGDB 4BFZA 2O9QA 1KLIH 2R6CA 4LY6A 3U2QA 2IHBA 4MKHA 2GJ9A 3QLPH 3RXRA 4TL7A 3FHCB 3GLFE 5EZ6B 3WMGA 4E03A 2WV4A 3BTKE 4ABJA 5TB5A 4XSHA 2WPMS 1SGPE 1HRTH 2XGJA 3CB4A 3A8TA 2AGEX 1CBWB 2XX3A 1SOZA 2FLBH 5IHPA 1KI2A 3QENA 2C8WB 1FNNA 1XEWY 1OLOA 2XB4A 2LKDA 1V5WA 2J92A 5JWHA 1SI5H 3VU9A 1BRAA 3QKTA 1JPJA 1E2JA 1YM0A 2ORIA 1O2IA 2ZSBA 5G40A 1HE8B 1LKAA 3AQ4A 3P4YA 4DCTA 2JLWA 1J16A 5EGMA 3LJJA 4B71A 1SSXA 1FLEE 2V3CC 2ZGXH 1LVMA 3QF4B 3T26A 4HAZA 3TW4A 2XZOA 4NCNA 5E0HA 2XITA 4RSGA 1FX0A 1F5NA 1O36A 1HDTH 4QHTA 1DADA 4LDJA 1JEDA 1ARCA 3OEHA 1BTHH 2BBSA 2NGRA 1OHHD 3TE6A 2ZRMA 1NNEA 1JAHA 4A82A 3Q77A 1AS0A 4CRFA 2P16A 1W36B 1GMCG 3BC1A 1SC8U 4OI0A 1DUAA 4DZZA 2QSZA 5JYIA 1BA8B 4RFSB 2QQEA 4JIMA 3GCTG 4ZHAA 4DT1B 1KJWA 3SBDA 3TIUA 4JBXA 1XUFA 3H7OA 2A7QA 1QQ4A 3DKPA 1RD3B 1ETSH 3NEYA 3MH5A 1AKSB 1QFKH 2D2FA 3BWDD 1CQQA 4AWXA 2EYUA 1AIPA 1NU9A 5H70A 3TK1A 4XWAA 2VWOA 1SGCA 1TBRH 3F3YA 4WF8A 3QEOA 3RS4A 4U30A 2ZRDA 4KGAA 2WJVA 4X6OA 1GI3A 5IF9A 1P4SA 3CP7A 1UADA 2J7KA 3A4NA 2UVQA 2QMOA 3N5CA 5KTYA 2QA9E 4GT1A 3D65E 3EG5A 1QDEA 1SVIA 3BFKA 4NIVA 4C0QC 1P72A 5EG4A 4L4UA 5BWMA 2OCPA 1O3MA 4UKDA 3SI4H 3L0SA 4GMDA 1TNKA 3GDSA 1AGPA 5F03A 2R6FA 1RRPA 2FPKA 2F1IA 3ZZCA 1G36A 5C5OA 1M8PA 1VCIA 4U32A 4CBNA 1SLVB 4HZIA 4PAQA 3UMFA 2YOLA 1NFXA 2XTTB 4XWKA 2IYRA 1ZM7A 4LRWA 2J38A 3W90A 3VNVA 1MMJN 5JBQA 2NWNA 3BEFB 2QN5T 4FU8A 3TVDA 5GJWC 3V0XA 4PR0A 1OW3B 4IC6A 4KSBA 3SC3A 3PMAB 3VKWA 5B2ZA 1O2ZA 3A88A 4X2WA 3ONWA 3BORA 1OV4A 1WV7H 1S0QA 3ZV8A 4H4FA 2ERXA 4YOGA 3UKDA 1FTNA 1D2NA 2R65A 2FFBA 5LPEA 1PUIA 5L3RA 3OSYA 1JECA 4XH9B 1HAHH 3GDVA 4AB8A 1FP6A 4MPXA 4AFQA 3U7FB 5F6MA 7GCHG 2KWIA 1US8A 4A2QA 1UTPA 1CIPA 2JJ2D 1UHBB 4DGJA 5BN3A 2O0JA 2QT1A 3M3TA 1GKYA 1S3GA 2WPDD 3PJRA 3PO1C 4PQFA 1G1MA 2PL3A 1YZTA 3CF6R 3CRRA 1DT2A 1M9UA 4CH8B 2HNTF 1T6NA 1O5DH 4Q00A 5EPYA 3TGKE 3FHTA 2A2QH 3JZAA 1OXGA 4ABGA 5FCRA 1BRUP 2RGGA 1T5IA 2VQSA 4X8HA 4W7SA 3AK5A 4GOJA 4IS5A 2VIOA 2P95A 1BMNH 2PCLA 5ELXA 1F2TB 3LVRE 3FVQA 1W0ZU 1G8PA 1O2VA 4Q4HA 3STIA 1DAMA 4WH6A 3B1ZA 2FFQA 1E1QA 2PTCE 3OIYA 4X0WU 4FUEA 1OWDA 3G5UA 4XE4A 1JIRA 2G1JA 3KL6A 1G4UR 4BEBA 4PO9A 4JLDA 1KTVA 2BHRA 1W7XH 5FXLA 1TGNA 2FMXA 1KTTB 4AFUA 2XSZD 1GI7B 4OGYA 2WM9B 3CS7A 2WWGA 1F2UA 1E94E 1DICA 1DPOA 3MSXA 1Y59T 1WOFA 3MYWA 3RRMA 1P2SA 4AKIA 3QNUA 1NN5A 4TLCA 1A2KC 4RZXA 3LOXA 4K60A 1G16A 3NIBA 1NC6A 2Y82A 1Z5ZA 4NMMA 3SN6A 5CE1A 2J0VA 5KDDA 3GCNA 1O2RA 1XEFA 1A0LA 4HZUA 1LTOA 3I77A 1IN5A 3TW8B 3Q5EA 3IG6B 3RP2A 1AMHA 2ZG0H 5D3MA 3I73A 1EPTC 3OY5U 1KAGA 3PUYA 1C5ZB 4Y10E 4FCVA 3HR7A 2H6MA 2VGCB 1SVWA 1IY0A 4GOKA 4UNSA 3MNSA 1JIMA 2HV8A 2UWLA 3NDPA 1G37A 8OHMA 1EK0A 4M9FA 5DP5A 2FJUA 1O2HA 1FQJA 1LCYA 3MWLA 4QC2A 3SNEA 4MPWA 4M22A 5CHAB 3ETLA 6LPRA 3T62A 1TNLA 2STBE 4PC3A 4X8MA 2WPDA 1O32A 4US0R 1RJXB 2VB0A 1EZSC 4XFQA 2IS6A 2BIFA 4O3MA 4JCNA 1GILA 3L82B 4G1UC 3TQFA 1OKXA 1ZGIA 1GCTB 2BLQA 4ZXYH 1K1JA 3SV6A 4P0TA 1ZMJA 4SGAE 2JCSA 3SZEA 1PV4A 2RGCA 1GBFA 1VKJA 5JCPA 1C9PA 4P4TA 2H92A 3SZNA 1TUIA 4BLPA 5L3QA 4ZCIA 2VP6A 3GY8A 1NLYA 4EJSC 2DFNA 3QUMP 3BB3A 4H6SB 5BXQC 1QHHB 4YONB 4TLBA 3VR5A 4ZDKA 4QBHA 2P93A 3B8HA 3L8YA 4A0GA 1KDOA 4I8HA 1GDUA 1Z8JB 4ESVA 1G5RA 1A3EH 3GLHE 1II9A 3LW7A 2XSZA 4M0LA 3NBFA 3KGPA 5AK0A 2IW3A 1T0JB 5AJZA 1GHZA 2AFQB 2ANBA 3SNCA 1OB2A 3M1IA 3M5LA 1WRBA 4Y8ZA 1XF9A 1O2TA 2ULLA 1G9XA 4PQYA 1P04A 1BQYA 3Q8XB 4YQFA 1YPHE 5DI3A 4LWZA 3BIVH 1C4U2 1U99A 3DKVA 4A9AA 5AF9H 1C1YA 1N8OB 2GF0A 4A1XA 2AMDA 1E0AA 1T8MA 2VPPA 4BTIB 2ZECA 2A5DA 3GMTA 3R7WA 1TNHA 5L6NH 1XWIA 5EJEA 3SU3A 3Q7PA 4HDQB 4TQUS 4BANB 1EG7A 3PXGA 3JVUA 1RRKA 3TLOA 3RC6A 3QGNB 4U02A 3ADBA 1D2MA 5EXTA 3SGQE 3ZH9B 2FZZA 4TLDA 4B43A 4OL0A 1WF3A 1OJLA 5J40A 2CVHA 3C5CA 3GJ3A 5BN5A 1TYNA 2CJWA 4HB4A 1HA3A 1UBFA 2AGGX 4AYXA 3EZ6A 1W4CA 1MBMA 3S9CA 4HDOB 1KXCA 3G82C 4PROA 1MO3A 3I8SA 4BRWA 4C2TA 2MSEB 1M7GA 3K0FB 2XNIA 4C0HA 1TU4A 3GJ0A 4FUIA 1Z0IA 1R0WA 5EQSA 4TL9A 2QF3A 3KUDA 5CM8B 5F98A 2DB3A 4AC9A 4AD8A 4MLFB 3LGIA 2JASA 5IK2A 3I61A 1ELVA 3M36A 3KJEA 4DY7B 4TYDA 2BOVA 3CNNA 1DWEH 3SO3A 2C9OA 1H8EA 2QN6A 4U00A 5F9FA 4LGMA 1GJCB 2ZGJA 1KDQB 1V2WT 1GVNB 2AMPA 4P31A 4KP0A 1EAUA 1ARBA 3Q85A 4OQMA 2XNSA 4DEYA 3CIOA 9LPRA 2W2VA 3M6AA 3M61U 4YLUA 4K3JA 3NZIA 3NXSA 4MRVA 1JXOA 4TSFD 2ZI6A 3SNBA 5JHGB 2TMKA 2HCJB 1DLKB 1LHCH 4DRZA 4X1NU 4H1VA 5LPNA 2BDHA 3M7UA 3S1AA 2BM2A 5DP7A 3PV2A 2ZSFA 3KTAA 1NN3A 1KGDA 2XZPA 2P94A 4IN2A 1YF4A 3B6EA 2QYIA 1AZTA 1WMSA 4FMCB 1U2RA 4YMTA 4DLZA 4A5TS 3F9GA 1GHWH 2EQBA 1SQAA 4A2WA 2RGXA 5LD2C 1V43A 1Z6AA 1S5SA 2F9NA 5KOYA 3EW9A 5HGGA 4XBCA 2PKSB 1XD2A 3K0SA 2ZTSA 3T1QA 5JS7A 2IJD1 2BKUA 4JL5A 2GCNA 1O38A 4K8OA 1CS4C 2OCBA 1QG2A 2RKOA 3A7ZA 2F9MA 2Z4RA 3LDXH 4Y8XA 4YESB 1C5LH 3VB5A 2V35A 1P73A 4B3GA 1EFCA 4HAYA 1IXZA 2BD5A 1R8SA 5CITA 2TIOA 1K22H 3Q72A 4WXRA 4TMVA 1TRMA 1INCA 3UWJH 5FUXA 5GXPA 2IYVA 1SL3A 3V9PA 4H6TA 3ZS8A 1AS3A 2ORWA 5DG6A 1O0DH 4QT8C 1GHAF 5JEDA 1CT0E 3SU8A 521PA 2AL7A 3BBPA 4F91B 5EU8A 2CLSA 3ZD6A 3BAFA 3LW8A 4OI1A 2SNWA 3TNSA 3A89A 3HGPA 3RMLH 1KLJH 1C1TA 3EPHA 1EOLA 1ZSKA 3OHMA 3U4QB 2IXEA 1XNJA 1A0JA 4CDGA 4DLTA 1YZLA 1C2JA 2FLRH 4FMDB 4D4KA 4YLGA 2JLXA 1QA7A 5G3YA 1KTSB 4DLSA 2RDLA 1U9IA 1VG8A 1NY22 1WU1A 4Q4LA 1O3HA 5L30H 2GHIA 4DCVA 1MT0A 5TXGA 2OBOA 5HZKA 5K8IA 1YPHC 1XUJA 2CL0X 1GI9B 1U8AA 3EA0A 2Z9JA 3KKNA 4OI2A 5HTKA 5K8LA 3A1VA 2I6SA 1XXFA 2HYIC 2QORA 4C0JA 1E0KA 2OSBA 2HGTH 2G0NA 2VBCA 5AJYA 1QHRB 2C9YA 2ZAMA 4DLXA 1O2YA 1ANBA 5K8TA 1ZOMA 4TTQA 3BJIC 1TRYA 1XKBC 2VF8A 1YKSA 1SHKA 4XD7D 3GJXC 1YPKH 4CBOA 4UQOA 1P2QA 3CLVA 2GA8A 4TWYA 5E7JA 1A4WH 4WOPA 1SGWA 4Q19A 1Y3VA 2FOFA 1E0FD 2G8TA 2EFEB 4B2IA 2ZU0C 4ZKOU 4HLDA 5GVRA 1X8LA 4CRCA 4JLAA 2ZJZA 3AF4A 4PPFA 1FPHH 3LKWA 4SGBE 4UNRA 721PA 3U3OA 2GX4A 1C2KA 1F0TA 3GP8A 2VIVA 3WRXC 3QKRB 2P3SA 2SGFE 4KSCA 1QR3E 4LHYA 3QY0A 2BHGA 2ZGHA 2Z9GA 1W0JD 3BF6H 2ZSDA 2FGJA 1GHYH 1S9HA 4ERNA 2ZRIA 5EE3A 2OLGA 2VP2A 1VIYA 1U9IC 2C3SA 1Z83A 4LJ9A 2BD8A 1IXSB 3MO9A 2R0LA 1ANEA 2C8YB 4NYJR 4DCUA 1K1LA 5SGAE 2K1QA 4ZCMA 1II8B 1QHGA 3BTWE 4AOQA 1EZUC 3LBNA 3EIHA 4DCSA 4UEHH 1FY1A 1EAWA 3W94A 3I5YA 2AS9A 4I8GA 3Q00A 3EA9A 1OXVA 2GRJA 2QTHA 4FCTA 1YP9A 3EIQA 4DXAA 3BG4C 3SU1A 3TR0A 1OWHA 2SGPE 2NPFA 2D4HA 4UJ3A 3GJ8A 2FA9A 2JEOA 1XMVA 3EA7A 3LLUA 4G5GA 2IUTA 4KV9A 2OAQ1 3SORA 2OCVB 5TCAA 5AUNB 4KFUA 4BFYA 1TEVA 2QL6A 2NU2E 1ELOA 3BIFA 1BJVA 3FGNA 2C93B 4GCHG 4Q7JB 3A37A 3RU4E 2FYRA 1O3OA 4QGAA 1GHAG 1SVSA 2SFAA 3B60A 1CEEA 1PLLA 2EA3A 3SFZA 3RU4D 2JAQA 1YR7A 4TTPA 1RVDA 4UFDH 2O8FA 2QT0A 3PLKA 4D26A 4RD1A 1KK2A 3L0OA 1SFQB 2AXPA 5FTNA 1V2VT 4HATA 5JJIA 3S0NA 1TMBH 1PQAA 2OXCA 4TYQA 1DOJA 3PEWA 4TL8A 2CL7X 1O34A 4KJZA 2KAIA 5A2MH 2P6NA 3NBZC 2ZDMA 2OK5A 4OHWA 3UIRA 1F48A 1AA9A 4QL3A 1V2NT 4C30A 1AQ7A 1PUJA 4LPSA 1HJ9A 4X1SU 2Y8EA 5JSZA 2QAJA 2WSMA 1BDAA 2EWVA 2B8TA 4TTRA 1GTVA 1C2FA 4IVPA 3BN9A 1P57B 5TDHA 2ASEA 3SJCA 1Z2CA 5C2JB 1R8QA 2ZCHP 2NZJA 3VXFH 4O3TA 4Q03A 3URCA 2V1XA 4Y6DA 2V9PA 4ISOA 1FW6A 4DSNA 4MGKR 1AB9C 2XC4A 2R62A 2NU3E 3E1XB 1I4TD 5GJ4B 3TIFA 4I8KA 1MQ5A 1GI0A 1I2DA 3I1FA 4WBSA 3UATA 1X6VA 4CH2B 3UNRA 3HKIB 5SZHB 1W0JA 2CF9H 2XJ9A 3UWKA 1BMFD 2J9NA 4EPVA 3DUXH 3SJZA 1KDRA 2RGDA 1TEXA 1NLFA 3T25A 5KSPA 4ABAA 4V0KA 1ESBA 3ODDA 1O2SA 2BMFA 2ZR0A 3UPUA 1V2JT 2X8AA 5SZIA 1YRAA 3TUIC 3BTFE 1IQEA 4IDNA 3B13B 1C5TA 2O0KA 3QG5A 4VGCC 4JLOA 3BTQE 3SYJA 3NH9A 5LH8A 1UKEA 1XX9A 3Q3XA 2J7PD 4US2R 1JWTA 5AUQA 1M34E 5ETXA 2ZRCA 2ASUB 2KJQA 4C7OA 3RXBA 1FN8A 4X8SH 4Y7BA 3CZQA 2BDAA 3QBTA 3NXPA 1HUQA 5DP8A 5CB8A 1CA8B 3A8DA 4URVR 3EPJA 4AGKA 3BS4A 3CRMA 2BMGB 1DELA 4B2LA 3QO6A 3ZVDA 2QE7D 2G9NA 1YRBA 1JI0A 4U5XA 3RSOA 4F38A 3AM1A 3ATLA 1C2DA 1OIVA 1U98A 3AF1A 3VTKA 3T61A 1AN0A 2ZU1A 4NONA 1RFNA 3PMBB 3MWJA 3STJA 3SU5A 4AG1A 3PV4A 4JYUH 4F4IA 1QJ7B 5L3SB 3BEIB 5EXLA 1OXUA 1CRQA 1IAQA 2O8LA 3X1YA 3RC3A 2H5CA 4URWR 2FOMB 3O8CA 1JR3D 3OIVA 1BIOA 2IWRA 1Q2WA 1CJVC 3VU9B 1YKTA 1EXFA 5AHGH 1OE0A 2ZEBA 3SJKA 1P3EA 4NWKA 3BK7A 2VU8E 4OHVA 4BFUA 4AORA 2A0QB 1K1MA 2OFOA 4D4LA 1VYVA 2C99A 3QKSB 3CH4B 2GJ8A 5GADl 2HLDA 5P21A 3NBXX 3WHLA 3P8GA 3SBKA 4BZXA 4KVGA 3AASA 1SGEE 1E1RA 1J8MF 1XXHE 3QE0A 3S9BA 1BO6A 4CHAC 1Z6JH 1OFUX 3L0PA 3K2UA 1BMFA 1SGDE 4OQXA 3NVAA 1ZP6A 3ZDQA 2G81E 2XBYA 2CF8H 4M21A 5E95A 1MTUA 5E3HA 4XTRA 4AFSA 4H42U 4MGIR 5CYPA 1F92A 3LGTA 1NMYA 4DUGA 1W10U 1SGRE 4MDSA 1BTYA 1XMNB 1O37A 3ZZ4A 1GSIA 3GLIE 1BB0B 2G5NA 2PZGA 1WUNH 4R8TB 3Q5DA 4BZQA 5DHFA 4KKDA 2J7PA 4BLRA 1GGDC 1VITH 2ONKA 3FAOA 1SKYB 2TGPZ 2VINA 2IYSA 3A83A 3MU1A 3RS2A 2E87A 1P03A 1QHSA 1CSOE 1SZPA 3PEVA 4AYYB 2HEIA 4TWZA 3U1JB 1K5GA 1NRNH 2C04A 2Z9KA 1D9ZA 4MRRA 1UVOA 4MYHA 3TJOA 1YPGH 4FUFA 4KXFB 1DWBH 1AKSA 3PO1B 8ESTE 1S1MA 1IQMA 4K2YA 2XCNA 2H2ZA 4XSGA 2V8OA 1KSJA 1JB1A 2W00A 2P59A 5FR2A 3T5FH 2AX4A 1YLDA 5A8YA 1N5IA 1DXPA 5JPMH 3GLFB 2Q6DA 2BLOA 2ZI4A 2ZVQX 1YYY1 1XTSA 2NO1A 4URUR 1KK3A 3IBGA 2ZEJA 1R5NA 4MRSA 1O3IA 1G6OA 1JR3A 1GIAA 5G53C 2ODBA 3LH3A 1P0SH 1BTXA 4NPHA 4CYMA 1H9IE 1Q12A 4QFMA 4DKXA 2FMJA 2QP4A 1LY1A 2V54A 2O8CB 1MTWA 3VKHA 2ZU6A 1A7JA 1DITH 2FPLA 1OF1A 2OHFA 4BFVA 1XD9A 1IONA 1J8AA 1TQ0B 2QV1A 2B8WA 4AYTA 1W0KD 1WSSH 1GJBB 2HRVA 2R6DA 3UG7A 3SYNA 4LZZA 4IDQA 1YJ5A 1ZBDA 3MNXA 2QPAA 3B82A 1XM1A 2BQ7B 1H8HD 4CEHA 1X8KA 2Z7FE 2V6JA 5DE3A 2ZIAA 3NCLA 3QTOH 1BMLA 1LPGB 5EXXA 1GBJA 4Q4JA 3FMIA 2ZQ2A 2G3YA 4AG2A 2A2ZA 4W5JA 2G52A 2BXUH 1WXQA 1I4LD 1ZUNB 1BOQA 2YNMA 1Y5BT 1DY9A 4FI3C 4TN1A 1EPTB 2FTLE 1W1WA 4TLEA 3N2EA 4Q2KA 2IF2A 2FG5A 2XTNA 1IQNA 5IRCD 4DJTA 4PTLA 1UHBA 2RGEA 7ESTE 4GP6A 4DT7B 3RYTC 1G64A 3TQCA 5B64A 1MAYA 1AS2A 4OJKA 2D1JA 4ESHA 1T0HB 3DFLA 1NS3A 2KB0A 2N42A 3SQWA 1NFYA 4RCYA 3WYGA 1NN1A 2QM7A 2ZRHA 1NP6A 1LPZB 2GCHG 1PPBH 1UCYK 2TGAA 5GNDA 1IY2A 3GICB 1G8GA 1KI3A 1P8VC 3SU4A 1O3KA 1UM8A 4YM9A 3UY9A 2IUSA 1KXDA 2C9CA 2IX3A 1J70A 4U01A 3LXRA 2BVRH 5C67A 3CM0A 2UUKB 4XBDA 1W7AA 2BDCA 1F2TA 1CJTC 2BDTA 1U94A 1UAAA 1F2UB 3ZZ8A 2F6RA 1TU3A 5TMPA 1O2JA 2OZEA 2YINC 4G5SA 4JZKA 3LH1A 2Q0HA 2Z43A 1W7GH 1NN0A 2CCGA 3QDZB 3T2NA 2GF9A 4EJSB 5GJCA 1W12U 4LC1A 1KO1A 1OH8A 1SOTA 2Z3CA 1DLEA 4HZUB 5HKKD 4NE2A 1XBTA 2WKQA 3P27A 1NU7B 5KPDA 1TALA 2QMEA 3L6PA 1H9HE 3ZZ3A 2O52A 5D3MB 3UMSA 2ZJ5A 4FVDA 2FV8A 1MZAA 2YZ2A 1C4OA 1V2ST 3H0KA 3A84A 1VCNA 4EPXA 3TSWA 5AFYH 3MU8A 1XVOA 4LJYA 1RYFA 1GWAA 1F60A 1QHIA 3E0PB 1OXTA 2I1QA 2BCJQ 1G21E 4KI0A 3ZYEA 1AZ8A 1W0KA 4THNH 4NSVA 1KLTA 1RTKA 4BXWA 2YWGA 2IYXA 1F5KU 1PPZA 2FS8A 2VP5A 3TNFA 1SHZA 5AVDA 4ISNA 4D8NA 2ZTYA 2VTKA 5T6GA 4R7ZA 2OAP1 2M5TA 2SGDE 2HNTC 3U3KA 4TMXA 3FPAA 4UXHA 3SHWA 1MQ6A 3TGIE 1ZC3A 3CF2A 3ZZDA 1O3YA 3ZIAD 1IXRC 3FTQA 4IOLA 4TYWA 4O03A 2ZS7A 2ZI2H 1X1RA 2G77B 2BM0A 2H1UA 5E7IA 3SU0A 1XUHA 5BRRE 3MU5A 2CMYA 2V55B 3DMNA 5EE9A 3EX7C 3SBEA 4ZCLA 2YNBA 2H7VA 1S96A 5DGXA 4X1RU 2WMNB 2Q3MA 2AK2A 2P65A 4ZKRU 4DVGA 2QIQA 3E6PH 5J4QA 1FI8A 1P01A 2YOHA 1O5AB 1SKQA 2FWWA 2AFHE 4EPYA 1YZGA 3K09C 3P92A 1TPZA 2TPIZ 2ZRFA 5JS8A 1FMJA 1U8YA 1S4QA 3HATH 4FN5A 2R2MB 4BAOB 1ZVQA 4HB0A 4ARZA 1XTKA 2FFAA 4RCZA 1XU4A 4X8LA 1LHGH 4NZLA 1MTNC 4ABBA 2KBFA 4BUJA 5KDLA 4ZDJA 4UXJA 3RS3A 1OKKD 4IRUB 1TF5A 5A0FA 4NIWA 3VFDA 1O35A 1Y3WA 1P9SA 5C1YA 2H5EA 1QHHA 1G5TA 3U60B 3DA9B 2GVFA 5DP9A 5DI3B 2OUKA 1CBUA 3W8NA 4EQ6A 1JR6A 2KE5A 1SMFE 1HPGA 1TRNA 3BE4A 3RXQA 2NO0A 4O3UA 1GOTA 1HAIH 4LJ5A 3KB2A 2ZPSA 2CE7A 5HKKA 4M9ZA 1Y63A 6CHAC 2Z9IA 1E36B 4ACBA 1TUEA 2VHQA 4MRPA 1UF9A 1VMAA 1Z8FA 1QRAA 4LHWA 1AZSC 2HXYA 2Q9BA 3REFA 2ZRAA 1NJFA 4QHSA 3QPVA 3RLFA 2O8TA 1RS0A 2OQUA 5KO2A 4A1FA 4HZHA 5C1XA 3BTHE 1CP2A 3KKOA 2R44A 4HLUA 4JL8A 4EAQA 4ZV4A 2KSQA 4DDUA 3SJ8A 2CJWB 4OKSA 1GKIA 3RHFA 1ETUA 3RXPA 1UVUH 3PUVA 3LBHA 1O5GH 1MTVA 3W5JA 3NC0C 5LD2B 1KXBA 4JVLA 3ZVEA 3BTTE 4ASUD 1IQLA 4OS6A 1VGCC 2G4UA 4CZ2A 2FZ4A 2MMCA 2XXAA 3OIWA 3VR4A 2PLFA 2WJJA 1JALA 1QURH 1W0YH 4ZMAH 1T3HA 1LO6A 4OBEA 4B47A 1CGIE 1X7AC 1K2I1 1UTLM 2JLZA 1NPMA 2VEDA 3WMFA 2HWLB 1O30A 2NZ8A 4B35A 2BEJA 2ZI9A 1DEKA 5ESBA 1THPB 2GNOA 3RVBA 3E5HA 1HGTH 4Z54A 3I8XA 1K6MA 2AGIX 1NFWA 1TA6A 3A87A 2R6GA 1ZPBA 1XJ0A 1WCZA 5FTKA 2FSGA 3K0FA 2CNWD 4QJ4A 5FBWB 5JWOA 1ZIPA 1DO2A 5JBTA 4PFSA 5T3HA 1JJVA 1RRFA 4LPKA 3X1DA 2GKVE 3T12A 3H84A 4INHA 4HI0E 1Z1JA 3LGWA 4QGFA 2XWBI 4BNRA 3IPYA 2VNTA 2ZHDA 3ZQJA 3AKEA 2A4GA 1OKKA 4P33A 3RC8A 3QBVA 4IMZA 1N8OC 1E32A 2QF0A 1ZJDA 2W7SA 2WWIA 4D7GA 1KDQA 2ZANA 5DO9A 4X8VH 4HLUC 1C5VA 3CWZA 1J99A 3NBYC 2CHVA 1O31A 4D4JA 1ZYOA 2WUCA 3OF5A 3HU2A 3WYAA 3UNQA 3GY3A 3AP3A 3AV0B 2ZS8A 3QPWA 4AYVB 1ESMA 1NJGA 1XD2B 5UKDA 3CRW1 3ND8A 1OP2A 3ZLJA 4EPWA 2BX4A 4ZI2A 1W14U 2P8OC 4LHXA 421PA 1ZRBA 5FPKA 3AVQA 3S7HB 1E0SA 2LPRA 2O8EA 2A4OA 1C1MA 4B2AA 1G3IA 5KUTA 1YCPK 4LBZA 3Q7QA 1GI4A 2A5IA 1LQDB 4YZUA 5DLQC 4A8JC 5IYTA 4ASHA 5HCIA 1ZM4A 4CRBA 3OAAD 5E0JA 1UBCA 3BRWD 2GD4B 2PH1A 1SGFA 4OI4A 5IDKA 1G3DA 1MZDA 3G0HA 3KUCA 4D0LB 1GDQA 2J1LA 4V0ME 2IYZA 4M9XA 1C9KA 3K1JA 1LHDH 5CMXH 1LF0A 4JYBA 1P3CA 1ZCBA 2EI6A 5DHAA 2AH4X 2P67A 4C9BA 1V2UT 1XVMA 1HAYB 1KXAA 4HFPB 3AUXA 2ODNA 4ASUA 2QA5A 2C8ZB 2RGAA 1Q57A 1C2HA 1KO5A 2W6JA 4UNNA 1GL0E 3MRSA 4NFFA 5GDSH 1OSNA 4IHQA 3LGYA 3RMOH 3IQWA 5FH9A 2WJHA 4E22A 3ADDA 4WMEA 2VWMA 5KNDA 3AVXA 1AE8H 3SN8A 1ZU5A 3DOEA 3UNSA 2VJ1A 3PB1E 1H4WA 2YKGA 4YOIA 3TAUA 1GJ8B 1HQYE 3GPLA 1O5EH 2FU5C 3U3MA 5T1VA 1S83A 1FUKA 3U4QA 2FPMA 4ABHA 3UREA 2CV3A 1P7CA 2CNWA 3A1UA 2ZPQA 3MLEA 2GCOA 2ZYTX 4AZ2B 1A4RA 2ANCA 2FTMA 3U7EB 1GJAB 2J41A 3K0EA 2ECKA 3BG4B 2B7BA 3TLXA 2R2AA 3D31A 3CPHA 5T6DA 1L1GA 2QQ0A 1RIWB 4CEIB 5KYKA 1MO4A 1R0XA 1M74A 2GTPA 3FANA 1E79D 2KBEA 3KJIA 1GRNA 4IFBA 3PWCA 3WP0A 4NIXA 3CF0A 1AIXH 3HGNA 2PKSC 3EAQA 1S2MA 2NIPA 2F9PA 1WTGH 2AKYA 3TJNA 2FDAA 3DO6A 3OFND 1DUEA 1GITA 3A7YA 3OYPA 4UNQA 2FOCA 1ZC4A 1UKVY 5EE0A 1AHTH 4KU4A 3QK1A 2GXQA 2J0SA 4I31A 1SGIB 2PUXB 5C2ZA 3AVYA 4DG4A 2QPTA 3V4RA 1HAZB 3IIMA 3F0TA 2FODA 2IOTA 3KKMA 2B5TB 1NBMD 1F3OA 1WXRA 1R7RA 1YPMH 1A2BA 2DFLA 1GZSA 3ZVFA 3QI2A 4ACAA 2F4LA 1ZD9A 5FPSA 4HEJA 2C77A 4QOSA 4DCDA 2WIBA 4ZKNU 2EWWA 3E0NB 4C0LA 3IUYA 1IM2A 3OAAA 1TQDA 4OK3A 2ZJOA 2BBOA 2BZAA 1ZNWA 3QKRA 1ZTJA 3ODFA 1YCPM 2Z0MA 1W4AA 4DIIH 1IAUA 3RXGA 2PGBB 1L8QA 1AFEH 3GYMA 2HVXA 1C5NH 3MH6A 2A30A 2ZR7A 2OBNA 4ZXXH 1DE0A 1AB9B 1HE1C 3OE7D 3CNLA 2OC8A 3D23A 3P8NA 2R3UA 1IHUA 5SZJA 4G5RA 1DAEA 1I2MA 1TF2A 1CHOF 4F93B 1RJ9B 2G6BA 4BLSA 1G32B 4NH0A 4F4CA 2HJVA 1DWCH 3MCAA 2IWHA 2VVVA 1Q21A 3S69A 2W7UA 1AK2A 1RYHA 3NHBA 5JLJA 2PLRA 2QXIA 1FN6A 3FVFB 1ZTKA 1KSHA 1EX3A 3RU4T 4NYMQ 1ABIH 2PUQH 5ABWA 3WY9A 4DHEA 2O8FB 3T34A 2W26A 2W3KA 3TK5A 1ESNA 2XC0A 3SZRA 3CONA 3KKPA 1HAOH 4US1R 1DARA 3ASYA 1KO8A 3VX4A 3B85A 4HSEA 1BMAA 4Z8XA 2A5GA 3F8TA 1QBOA 4RVCA 2KAIB 3OU0A 1O3CA 4U2WA 2JH5D 3BFVA 5FOXA 3SV2H 1OYTH 1TA2A 2ALVA 1C9TA 4Q9IA 5A4JA 3QVUA 1CF4A 1MBQA 4JZDH 1O87A 3RXHA 2OLJA 4HB3A 2VH6A 3SW2B 3KL4A 3ZYCA 3K65B 1JNYA 2B9LA 2QC2A 5JSZB 1BKDR 1IN8A 4D6PA 2FOLA 2Z6BD 4DEXA 2O8DA 1Q20A 4DSUA 1C1SA 2ONJA 3E2IA 5CDFE 3OFNA 3R0FA 4LJ8A 5B30A 2FYQA 1S84A 1ELTA 1KDPA 2BOKA 2Z6VA 2C4FH 2QRNA 1VITF 1VCWA 3RXLA 1BT7A 3KQCA 5F9HA 1FJSA 1NBMA 3D3QA 4GP7A 1O2KA 1AM4D 1XX6A 3B1YA 3UTUH 1H9LB 2RHDA 2WIAA 1WDTA 2ZRGA 2ZU2A 1GHBF 3GY2A 1C5PA 1JQLB 2WSSA 3VXEH 1C1RA 1NY6A 2CL6X 4B3DA 1AE5A 1UEJA 2PSXA 2QNRA 1T4VH 3IPXA 3IITA 3ASZA 3KXLA 1MD7A 1G41A 3U7HB 2OFXA 1CU1A 1E9CA 4C0BA 3PQCA 4TMTA 2J4IA 2VP4A 4E06H 5DGJA 3SJBA 3AP1A 3U6BA 3E8LA 2O8UA 2E9SA 1O5FH 3VPKA 3OE7A 4IOMA 4IEIA 1M6NA 2RH5A 2BTCE 5C5NA 3QQ5A 2EU8A 4C7OB 5BW8A 1U0HC 3HR8A
chains in the Genus database with same CATH superfamily
3I72A 2QIPA 4D8UA 1FXWA 2IP1A 2R79A 4MITA 2JRCA 4KWCA 3Q9SA 2V7PA 3O73A 4F92B 3WO1A 4CU2A 2WPIS 5F8XA 3TIXB 1L4GA 3N8DA 3TL6A 5ALWA 2WTEA 5LQMA 5BPHA 4Q0MA 3WRWA 5CK4A 1GUZA 2ZB3A 2SGEE 1YUNA 1WHSB 4DQKA 3TDNA 4FC7A 5IDVA 5CA1A 1Q7RA 2WYUA 2QG6A 1O3AA 4Y79A 5JI3E 5IJZA 4CEJB 1QYWA 4UFFH 2B1JA 1K21H 4GPBA 3OQVA 3V4LA 3D62A 2CJPA 4RWZA 1OPXA 3ICPA 2BFAA 1DWQA 5ALYA 4IHJF 4N41A 1B0FA 1A8UA 3EH2A 3U8TH 3DW1X 4JBWA 1VCQA 1RCTE 1HXHA 3SVTA 5BRJA 2ZCVA 1O2OA 3CCFA 3U7QA 3HE3A 3UUZA 3WWFA 4OB8A 1E37B 1L1NA 1I4DD 3NBUA 4XSVA 4I99A 2CZGA 1CB7A 2ZHEH 1OZGA 3HRIA 4HC4A 4WXYB 2SGAA 1JDSA 4YAFA 4UZEA 1RIFA 1W85A 3O4JA 4Z49A 5KYVA 4J7AA 2FR1A 5JR3A 4Y9TA 3HJNA 4NS4A 3ZW7A 4AFZA 4UE3S 4ZYUA 2FX3A 3JSXA 4KMRA 1O0SA 3SZLA 4OD0A 2H1HA 1F4VA 4MJLA 1HSZA 3WVNA 1UK2A 3T7SA 4FXPA 2XKJE 5EKXA 3KD2A 1W3CA 4S1WA 1B76A 4I55B 2GM5A 1KVQA 4E2WA 1O3FA 2WWVD 2Y9PB 5CFOA 2P9ZA 3REOA 3RVPA 2FY8A 2O1WA 1PVOA 1XPOA 3DB1A 4HMOA 2NV0A 1XAHA 1SXJD 2XDWA 1QUEA 5D3ZA 1G0NA 3K73O 3AVTA 4OP2A 2H6EA 1PFXC 2QD4A 3EA8A 2X8JA 1GI1A 1CS0B 4RA6A 2ZB4A 4NYMR 1PKEA 1M34B 3AW0A 5HWSA 4JL6A 4DPLA 1HOTA 1KHHA 3REGA 4Q63A 3EJWA 2ZOSA 2WA2A 3UCEA 1Y9AA 4FILA 4E6PA 4JELA 2VP9A 2ECFA 2R87A 3P5SA 1FIZA 1SXQA 4ZH8A 3F6PA 2WMOB 1DOZA 5CDGA 2JIBA 5GGYA 1ELAA 1WCIA 3BXZA 5C94A 7LPRA 2Q0SA 1LK5A 3R3GB 2WV9A 5JEEA 3USZA 2OINA 1SUBA 1UP6A 4F86A 2J9YB 2HT6A 2XMPA 2FSUA 1PSZA 1J8DA 3WV5A 1UBSB 2BFDA 5HKLA 1QQBA 5ISMA 4UHDA 3DSOA 3N1UA 4R01A 1P5JA 1EP6A 2WF6A 3FLMA 1JVNA 1Z0AA 3PQ5A 2WWWA 1IZZA 2FXRA 2WVHA 1JN0A 4M60A 1AJEA 3IAS1 3F1KA 1RZ3A 2C4TA 4MQUA 4PLFA 4OQFA 3BPSA 3IP1A 1VL0A 4RD4A 2DU8A 5TARA 1HDCA 2CNNA 1V6CA 3ZW9A 3MD0A 4R6XA 2JIDA 1JTEA 2OXEA 1XK6A 3N2IA 5FBLB 1RYBA 3K0AA 4HYYA 3NDJA 4UVEA 1YJCA 3ZK8A 5J3JA 3VJKA 1E96A 1OREA 2UYGA 3ZEIA 1XXHB 3AIIA 3E35A 4TQ9A 5C7LO 3PR2B 3FDJA 1S82A 5CTJA 1ML3A 5AOVA 5AXDA 1Y3AA 4C4AA 2YHIB 2O8CA 4YMWA 1RLMA 4ABEA 4GI7A 1VSUA 2JAXA 5ECGC 5DWDA 3OWXA 4ZHLU 2WUFA 1UOPA 4OCZA 3GDFA 3LE8A 4KAJA 1G9IE 4X65B 3DMRA 4TZKA 3RFUA 1QA0A 4Q3OA 1JG3A 2H2GA 3RXEA 4PPQA 5DPAA 2WWYA 1DKOA 3EQ0H 3VVBA 2QKYA 3RBZA 3TD6A 1CUJA 3ENNA 2WZCA 2DUMA 3D8HA 4YLYA 4Z7NB 5TLSA 1LTQA 3ATWA 1UMDA 1TNIA 1SVPA 3NPSA 3A1TA 5GIOE 1Y0BA 5CVUA