5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
1KK2A 2CE2X 4Y7AA 2D06A 4A1FA 1PLJA 1HE1C 3LVQE 2FFQA 4H42U 1HNEE 1CBUA 3FOZA 1HT1E 3ZVNA 2NZJA 1N1LA 2ZU1A 2WOOA 4V0NA 1DOAA 2ZJBA 1C5YB 2VWLA 3TLOA 4D9RA 3BIUH 1EFHA 1TAWA 1QA0A 2ZQ5A 1UKEA 5TXGA 4FI3C 2G1JA 2GTPA 1ZMNA 3U8TH 3GLIE 1M7HA 1GMHG 4PX9A 1AB9B 2FU5C 2R6CA 1TA6A 2UVQA 1LKBA 1RIWC 4BAHB 1RRCA 3Q3XA 2GRJA 1AI8H 4QHSA 2X1VA 1RVDA 3EIHA 3QDZB 2WKQA 4KODA 5CK4A 1ZSJA 3VX4A 1Z83A 3H2YA 2OFOA 4DT1A 4DLXA 5EE0A 3W34A 5B58C 1ZZZA 4KTCA 3S1AB 3UK6A 1QG4A 2BY6X 1EUFA 1T8OA 3CBQA 3RHFA 4A6LA 4WOPA 1OPXA 4YMWA 1HRTH 1JPNA 4MGZR 2OBMA 4BAMB 3GP8A 5DP7A 1W2GA 1KJWA 3ZZ7A 4GRAA 5DH9A 2A4RA 2BD8A 3U4QA 4IMQA 1SOZA 1HJAC 2JLWA 2C2HA 1EWRA 2F4LA 3S9BA 1JRTA 3UWJH 2SGEE 3TK5A 4K1TA 2QM7A 4DJZB 1C5ZB 2HWLB 3SUFA 1NIJA 1ZCBA 2PMDA 4AYWA 3A1WA 2F3TA 3MH6A 1Z0AA 1N5KA 4EFMA 4B44A 1GVZA 2H16A 4F7WA 1UBGA 1TADA 4Q7KA 3X1YA 1M1YE 1MKYA 2ODQA 2GDDA 3WBKA 1EX3A 3ZH9B 1TNIA 1JI0A 1JJVA 1E79A 2BXUH 1VYTA 1AK2A 1FPHH 2ZRHA 1PPHE 4MKFA 1QB1A 1VG9B 1BRUP 2Y7XA 2SGFE 5CYPA 1E9AA 2O8LA 1FUUA 2YJTD 1F3OA 1E9DA 3PUYA 3RUOA 3BSQA 2DFKB 2ZZUH 2ZF0H 4B73A 2JKHA 2BM1A 2WM9B 2VGCB 4D7GA 1XMJA 4QGAA 4LI0A 1NMXA 4HYYA 1XD2A 2XYAA 3A88A 3BS4A 1UADA 1DWBH 3NXSA 2IYTA 3P92A 4MUBA 1M74A 1MAYA 3NIBA 1KSGA 1ETUA 1D9ZA 4L15A 3RXAA 5C5OA 3R8CA 1ANCA 1V2OT 2C4FH 1K21H 1M7GA 3TNSA 1MKWH 3R9IA 1SKYB 2VH6A 2C96A 1G3IA 4EPVA 3W5JA 1RFNA 1E2NA 1EFRA 2ESTE 2WSMA 3DD2H 4LV5B 1F92A 4HLDA 3QNUA 3Q77A 4V03A 2ZHWH 3HPRA 3IILA 1JAHA 2CHAB 4ZDKA 1PVOA 1J99A 3SV9A 2J9NA 4Z6AH 4I8GA 5DO4H 1TX4B 2RAPA 4VGCB 1TNJA 3DM9B 3RS5A 3CWQA 1A2CH 3HR8A 1SGNE 1LQEA 3KJHA 3QO6A 4U30A 4IEEA 1BTZA 2ZDVH 1W5SA 5FL3A 1BIOA 3H7OA 3EG5A 3TGPA 3IQXA 1BDAA 2DFTA 1UBFA 3H09A 1YPHC 1KDOA 1BHXB 4F49A 2XNSA 1ELGA 3KCGH 4LJ9A 1HGTH 2G4TA 1ELVA 4QGGA 1OFHA 3RXQA 1KOFA 1KXCA 4BQSA 3SV6A 4TQAA 1GJ7B 1K1LA 2QN5T 4EAQA 1DANH 2FEQH 2XNIA 1A2KC 4PO1A 2VEDA 2ZRMA 2X19A 3QTOH 2CK3D 4FCWA 4OQMA 1IQFA 4I1OA 3VXEH 4OK6A 3UNRA 3KHVA 2Z6VA 1A2BA 2KBEA 1UHBA 4LHXA 4DLZA 1V2ST 4BTTB 1II8A 1VGCB 1AWFH 5EW1H 2XCFA 3ADKA 4XSGA 3SI4H 3ZZAA 3FE2A 4BUJA 5EU8A 3FP6E 5DHAA 5A4JA 4CT4B 4RKJB 1AKEA 5BW8A 1HY3A 2OXCA 3DDCA 1X3SA 4OK5A 1FNIA 1JBKA 1A0HB 4ACAA 3KQBA 2IYQA 2VIIA 4MDSA 2AYWA 2AFQB 5FPKA 1O2VA 3SU3A 2ZS9A 5DYGA 4NKRA 1E1QA 1T7CA 4ISOA 1NKSA 1QRXA 3BIVH 4FVDA 1OH6A 3ADCA 2ZANA 3B7GA 1M9UA 2WWHA 1YZGA 1GITA 1T8MA 2ZI4A 2RH5A 3PLKA 4QHTA 3GLHA 1NP6A 2OM2A 3M37A 4OS6A 5DP9A 1O31A 2FESH 1W36C 2GCTC 2PJRA 5EP4A 2O52A 4TWWA 3DZ8A 1VG1A 1MO5A 4Q4AA 4M4SA 2KBFA 1W5TA 3SGBE 1KTTB 1N6RA 4RKFA 2FX4A 4Q01A 3ZZ5A 3OE7A 4P0TA 1EAIA 4KGAA 2VB0A 1NRPH 1BRBE 2VA8A 4KYUA 1VCNA 1TFXA 2LNCA 3W5IA 1ARCA 1PJRA 3BTQE 2OUKA 1UEIA 5HYOA 4NIYA 3UNSA 2D62A 3EC1A 2QMOA 1MV5A 2FF7A 3OIVA 4ABYA 2XWBI 4B34A 3ASYA 1C5RA 1GHBG 1HUTH 1O3OA 1TPAE 5CHAC 1ZNXA 1RFLA 1VKJA 4TYYA 1Q1EA 2YWEA 4OS1A 2GAOA 4GHTA 2J46A 3RXBA 1S6FA 3ODFA 1NPMA 1HA3A 4YMSA 1JAIA 1TOMH 4A1TA 3CR8A 3B6EA 5FUVA 2TMKA 3CH4B 2PZEA 4MRVA 3BGWA 1NFYA 4CHAB 3GCGA 4DCUA 1TALA 2I1VB 3HKIB 1GBAA 3NPSA 4M21A 3IHWA 4TT3D 3CS7A 4Q5IA 1L0ZA 1AHTH 2IYWA 2ZUCA 1WDTA 4LX0A 3ADBA 2OO7A 3P8NA 5GNDA 2MMGA 4CR9A 1C9KA 2KWIA 4B3BA 3DA9B 4MGYR 3BXZA 5IT5A 1S9DA 3TGJE 4G5SA 5FBEA 2BDAA 2AK2A 2EVWX 1BZXE 4YDSA 2CMYA 2H92A 2CF9H 4POAA 1HAYB 1NJFA 1TBZH 1DS6A 3SUGA 1A4RA 2CMKA 2NU2E 5FXLA 2W3KA 1SL3A 1BOFA 1RJXB 1RRFA 2Z83A 4TMVA 2V3CC 1O2TA 5IDVA 4FXGH 1TF2A 5J5CA 1F0TA 4EFLA 1E9CA 4MUAA 1US8A 1ETSH 3SN8A 4KSBA 5FOVA 1H9LB 1D3QB 1EK0A 2UUFB 5CLQA 4CRCA 1U8ZA 3I4LA 4NYJR 2FODA 1MD8A 4HZIA 4DSNA 1MUEB 2WJGA 3ATWA 2R65A 2ZE6A 4GPTA 1ZSKA 3MG9A 2QEQA 7GCHG 3EIQA 3BC1A 2XSZA 2AEIH 4QOSA 5A5GA 1F5NA 4G3XA 4C0SA 2OAP1 2XZLA 1MOZA 2C95A 2OCPA 4Y71A 2GCOA 1K8RA 2QM8A 1U99A 3OFNA 2IYXA 1SPJA 1GI7B 2ZVQX 1EATA 2QE7D 1EZQA 2H1LA 2B92A 4ZI2A 1RRGA 3R7WA 1P3EA 1E2EA 4U5XA 4ZDIA 3L0IB 1BS1A 4B3XA 5KPDA 1WBGB 2WYGA 5JEDA 2ZXUA 3QXSA 3T2NA 4NSVA 1DXPA 3T5FH 1CBWB 9ESTA 1VIYA 3FYHA 2QA9E 1XPUA 4NL4H 2VP9A 5J4QA 1LHGH 1SKYE 7LPRA 2HF9A 4HZUB 2H9EH 1XD9A 1JPJA 1J8MF 2ZGHA 4Q03A 1QQUA 2REXB 1MU6B 4RY2A 1OS8A 1GBBA 2C03A 2J9RA 4YDHB 1Z6TA 2MSCB 2GTBA 3MU5A 5L3VA 2AHOA 4B47A 2PV9B 1V6DA 4RZ3A 4IDQA 4INLA 3QXHA 5CDFA 4O25A 1R7RA 3EYDA 4ZROA 1KZ7B 4AWXA 3QEOA 2GK6A 1H65A 4WXVA 1Q12A 2XB4A 4L8GA 1Y5UT 2FH5B 4WH8A 1N5JA 2AR7A 1ZJ6A 2ZFTA 5DK1A 4KJZA 5SGAE 2Q21A 2AXPA 4DLVA 1N6HA 2G1KA 1KI4A 4I99A 4RI0A 4IFBA 4OYHA 4Q1FA 1GG6C 2QUZA 1E0FD 2GZ9A 3B1YA 3KX2A 2OD3B 3L0SA 2W2VA 5FBLB 4QBFA 3TIUA 4ZMAH 1OWEA 4NCJA 2I4IA 3HPTB 3LNCA 4DT1B 4TYQA 4TMXA 2BEKA 4NZYA 1UAAA 1DAIA 4RD6A 1GBJA 4QNMA 4XBBA 4V02A 1IQLA 3SYNA 3PR1A 4NZQA 4M9QA 2CLCX 1FAXA 2SNWA 5JWOA 1ETTH 1F7ZA 1K1MA 4OJKA 3QPVA 1UO6A 4IVRA 4HZHA 1FY4A 2G6BA 3SYKA 3ZZ3A 3K6YA 3DOFA 3QBTA 1TONA 5SZHB 3TH4H 2OXRA 2ZAMA 4HEJA 1HTWA 1H4WA 3LLUA 3QOFA 3U60B 4KFTA 2YNAA 3GDSA 1MTUA 1XEFA 1ZU5A 3BOSA 1K1PA 4MITA 5T1VA 4AG1A 1F0RA 2RGNA 1YRBA 1O2ZA 1GG2A 3VAAA 2OXSA 2A7JA 1O3FA 2ZRLA 4Y10E 4JBWA 1M6NA 3OIUA 1TYNA 3AF4A 5EZ5A 1TMUH 3QK1A 2IEYA 1JECA 1Q3HA 4NA9H 1IOZA 4PPNA 2C04A 1RXPA 4MKGA 5C2ZA 5KDOA 1TX8A 1O5AB 2A7HA 3UIEA 1FMJA 3U61B 1C5UA 2H57A 1G5TA 3CX6A 4RVCA 1W48A 5JJLA 2W2XA 1IQNA 3C15C 3PENA 2C8VA 1LVBA 1W4CA 1AFQB 2JLRA 3I61A 1EKBB 2WAXA 2E1RA 4Y0AA 1EJNA 3LJJA 3LC5A 1KGDA 1OYQA 3U3JA 1XD2B 2J87A 2ZEJA 2BLVA 5LB2A 4D2IA 4YO9A 4JLBA 2GJAA 1C5PA 4I32A 3ZVCA 1G3DA 3ZVGA 5HCNA 5CE1A 1ZD1A 1UTPA 3W3AA 3MO6A 3VR3A 3UPUA 3VB5A 3RXGA 1S96A 3PMHB 1U0HC 4XDEA 2ZC9H 4HLUA 3RMNH 2MSEB 3UOPA 4KAXA 1YR6A 2F9NA 2O8MA 2FXRA 3VB3A 1G64A 2ZSFA 4A0FA 3C16C 2VSXA 1O32A 3F68H 4Y8YA 1NI3A 1GTVA 1ZIOA 4TZ0A 3AAUA 2WKPA 2RGEA 1QCPA 5C3NA 4DIEA 2FYQA 4TPIZ 1NBMA 3GEHA 4LBVA 2OE2A 1BYUA 1L1GA 1CVWH 1AUJA 1MTNB 1NS3A 3B82A 1RGQA 2YNBA 1FAKH 1TU4A 3ZZ6A 1OWKA 1SVLA 1T8NA 3GCTG 2BC9A 4FU8A 1KLJH 3A1VA 1IN6A 1DSUA 4LZ1H 2KE5A 3M3SA 1V2MT 1RS0A 3M3VA 3BE4A 5FL7A 2GCHG 2WPDD 4M1WA 1AB9C 1VMAA 3SU0A 3QXJA 4TMTA 2BBSA 2BQWB 1TWXB 4HSEA 3NK8A 2VF8A 4HGCA 3RVBA 4C0AC 3M5NA 2GKSA 2ZDNA 3B9PA 1GDNA 1NRQH 1GL7A 1HV8A 3QXCA 4C4PA 1OJLA 4I31A 3OESA 1A1VA 1UHBB 2AFHE 1YR7A 3AVWA 1II8B 3SJCA 5DGJA 2Q9BA 4AX9H 1KY3A 2F6RA 3NWJA 2Z9KA 2W7SA 3AQ4A 1XTRA 1BJUA 3H86A 2H9TH 1PFXC 2F1HA 4ZDWA 2DR3A 2ORIA 4QGHA 1S0RA 5BYJA 5JJIA 5J4LA 3P8FA 2SGQE 1OXTA 4ESTE 1XCPA 1EFCA 1V2RT 1D8TA 1Q31A 2W83A 4Z0KA 1YR9A 3UG7A 1HT2E 1Z8FA 2DFLA 1IQJA 1Q0UA 1GBCA 3M35A 3SQEE 2AS9A 1AGPA 4N3NA 2BMGB 3GLHB 2B7BA 1P2OA 4GLYA 3AV0B 1T8LA 3TK9A 4H9GA 5EXNA 2AFIE 3RXSA 4DUGA 4LV8B 4Z8YA 4Q4AB 3UUZA 4K2YA 4EPRA 3SFVA 1CGHA 1L4DA 1G2MA 3OU0A 3VKGA 1GI5A 1DELA 5JS7A 1VJAU 2SGAA 2SGDE 1MRNA 1UTJA 1QL7A 1TL7C 4D4LA 4EPTA 1C1QA 2QMEA 2QCYA 2BOVA 3CM0A 3CIOA 4LJ5A 1P03A 3MWKA 1L7VC 2IC5A 1VCMA 1HV7A 2Z3DA 4F93B 4BFWA 3Q9LA 3E0PB 2PSXA 3T27A 3SW2B 2BCGY 3EPHA 1O35A 4PZZA 3KQKA 3MNCA 1AU8A 2VGCC 2STBE 5J47A 1U2RA 3KN2A 4PANA 2Z9IA 3VR2A 1O2MA 2O5VA 1FMGA 4X8UH 1NU9A 1XUHA 4D6PA 1BBRK 4OI0A 1VDZA 1W2KH 3NBZC 3QKTA 4AIIA 3SJIA 1C1SA 3MCAA 3SJZA 1E3MA 2UUJB 2AL7A 2RHDA 2XGJA 1SGQE 1GBEA 3TJZA 2YHSA 1HUQA 1CA8B 3PEYA 2PKSB 5DSZA 2R3UA 2BWJA 3BF6H 3HU2A 3E6PH 4TSFA 5F98A 4LJ4A 5L30H 2FFBA 2QY0B 2IYSA 5DJ7A 4LK4A 4ABGA 2BY5X 1XNJA 1UTQA 2ZFRH 4EPYA 2K1QA 3VPKA 4BE7B 2ZRFA 1G3BA 4KV9A 4X8LA 1K5GA 2CHAC 1GJ4H 3UATA 1O2LA 2JDIA 2A5DA 2CL6X 1Z2AA 1CP2A 1TAGA 1EP5A 5F8ZA 2BVXH 4D0LB 2P3TB 1P2NA 3LX8A 3I29A 1IY0A 4PO8A 3UPEA 1O0DH 3A87A 3AF2A 1IAUA 1XXFA 2JH6D 3BTEE 3P27A 4FUGA 1L4YA 4D4JA 1AJEA 3MD0A 5HM2A 5JDUB 3LFUA 4Q21A 3PWCA 1S6HA 1O3HA 2BD3A 1O3JA 4XH9B 2BX3A 3RXHA 1HYQA 1QFKH 3PUZA 2IL1A 1DLEA 3X1WA 2V1XA 4DCTA 1OXGA 3VX3A 1Z3IX 1K1IA 4QRHA 2OAQ1 3FAOA 3EARA 1P04A 1IY1A 1V2KT 1T31A 4BANB 1HQCA 5E3HA 2H5DA 4Q7XA 1OIWA 1H8ED 2QP9X 4E06H 8GCHF 4OM9A 3DVLA 4JVMA 4ILEA 3R0FA 2ZSEA 1TNGA 3GLGA 1VGCC 2A31A 4B71A 1D9XA 2JLVA 2B7DH 4NWKA 4QBGB 9LPRA 3I8SA 2J0QA 4TQ9A 3QY0A 5HGGA 1BMLA 2GZDA 4C2UA 1R4AA 1KY9A 1O3GA 3KTAB 2FPLA 1GL9B 1NVWQ 1W7GH 4E09A 3GY4A 3TJVA 1Z0DA 1EX6A 2BX4A 2ZEBA 2DCUA 3RMMH 1QVAA 3K0FA 2YV5A 3QF4A 2EYQA 1BQYA 1TB6H 1ZJKA 3EWAA 3MNSA 1JXMA 3MMGA 2IX3A 1II9A 1TEXA 2F1RA 1ESTA 3HJNA 2GXUA 5FTKA 2FYRA 3M7QA 1GI0A 1X7AC 5DISB 1EX7A 1YU9A 1E96A 5DN6D 4TTQA 4MNYA 2ZQ2A 4AGKA 4UXJA 2FP7B 2HYDA 2QTFA 4I1SA 1CO7E 1E38B 3LXXA 1O2UA 3K53A 3UOUA 4JL5A 5AUOB 3MWIU 3Q76A 2B9LA 1AKYA 1DLKB 3VKWA 4DCSA 3WMEA 4B2CA 2IEZA 5A8ZA 1Q20A 3DPUA 4K5ZA 4FU9A 4BXWA 5EXXA 2WIAA 4K69A 1MO4A 1ANDA 3BK7A 1WP9A 4EUNA 2FLRH 1F2SE 4JBYA 4X8HA 2AK3A 1W0JA 3QEJA 1KXAA 8KME2 1CR2A 4E7NA 1GOTA 2WWXA 4CHAC 2Q0HA 1AQUA 1IN4A 4LV6A 4M7GA 1SVMA 1KYNA 2HCBA 3VGCB 3E90B 3MOCA 3A1TA 4V0LA 2ZRCA 3QI2A 1ZUHA 2C9CA 5B6OA 4D80A 1H8IH 1XD8A 3NEYA 3Q72A 3P8OA 1KHTA 1BT7A 4LPSA 3SNHA 2WKRA 1PPGE 1U98A 1GL1A 1CT2E 1KSNA 2QF3A 3U98H 1U90A 3D8BA 1JEDA 1T4UH 1A0JA 2P5SA 3BTFE 2VVCA 2HRVA 3GY2A 1FNNA 4TTRA 4QM6A 4MPWA 3GLHE 2JIZA 2H1UA 2CNWA 2XOKD 3LDXH 2ZG0H 5AUPB 1OYTH 3LW7A 1O2NA 1LY1A 3KJIA 4ZO4A 1KXDA 4GVUA 4Q4JA 2FA9A 1S84A 2EW1A 2GWHA 3DKPA 2SHKA 5LPEA 1A4WH 4ARZA 2Q9AA 4Y76A 5JBCS 3PQCA 2FPKA 2RGGA 3EA0A 3GDVA 2QMUA 1W7AA 2ZFPH 3SUEA 2QRNA 1D4PB 1GMHF 4Y7BA 4R8TB 1RYHA 2FOEA 5FBWB 3ZGXA 2J3EA 3LGUA 1AIPA 4UFFH 3OAAD 5TB5A 1IXZA 4F38A 5CB6A 5JRZA 2P65A 2C77A 2XC4A 5EXTA 4D25A 2RCNA 2ZR0A 3SDZA 1KLTA 2FEMA 3KL6A 4I4LA 1AN0A 4TLAA 3TU7H 1UFQA 2P2LA 1J2JA 2BM0A 1O30A 1PPFE 3IDQA 1N5IA 4NONA 3A7YA 2F9PA 4X1NU 3DM5A 1T3SA 2RA3A 4UFEH 1WQSA 2ZP0H 3PJRA 2XXAB 2QC2A 3Q3KA 2PL3A 1G2LA 3ADDA 2VH5R 2TIOA 5AF9H 5H68A 5HTKA 2Y5HA 4FXPA 3VHLB 4OHZA 4LYFA 2QBYA 4IC5A 1S85A 4FD2A 3SJ9A 2ZCKP 5F8XA 1NN3A 2IYVA 2JJ1A 1OH8A 5EXPA 1E2JA 1NFWA 1L1NA 5JFGA 2B7CA 1O3BA 1DG1G 4HB2A 1MCTA 1Z8IB 1G20E 1C1RA 2ZYTX 1KAOA 1SHKA 2YOGA 1H8HD 2VPPA 2FE4A 5GIBA 4ON9A 2LCFA 1A3BH 2FPMA 3PITA 2YZ2A 1LMWB 3TH3H 1E0AA 3ZYDA 1BA8B 2OC7A 3GCHB 5FHTA 1AO5A 1G19A 1C1OA 5EE5B 4DCNA 1NN0A 5DP3A 5E2PA 2EFCB 4MDEA 2H5EA 4YLUA 2XBWA 2IYLD 1T91A 1P0SH 1OP8A 5GJ4B 1E4VA 1QRWA 3UY9A 1KSJA 1ZPZA 2X77A 1S3GA 2ZROA 5IK2D 3L8ZA 3JZ2B 3A8AA 3LIWA 1VCIA 2ZJAA 3TUJC 2P8OB 1HAXB 4P32A 3WNDA 4K1EA 2Z7FE 5F2EA 1P7CA 5BN3A 1PPCE 3JZAA 4NG9H 2G8TA 3W95A 4MNVA 4KO8A 3QKSB 4AK9A 4TY7A 4DVAU 1GI6A 2KJQA 2R3YA 5EXLA 3T1VA 3AP2A 3TJNA 3SV7A 5A0FA 1BBRH 2W26A 1DAFA 3EZ6A 1BBRE 3UG6A 3QKRA 4XSKU 3E1XB 3L0OA 1TMTH 3LT3A 2YOLA 2AD1A 5L2ZH 1O36A 2ZSBA 3QWCH 4LCBA 1VR1H 5FCKA 1SG8B 1WSSH 5E7MA 3BB3A 3PMBB 4PC1A 4DEXA 4Z8XA 4FUJA 2FOHA 4BNRA 1Z08A 4IOJA 2ZHFH 2FIRH 4MDFA 3AVOA 3ATKA 1HH4A 4Q00A 1EWQA 4R71A 2FJUA 2P3SA 4LY6A 4X8SH 4BFYA 3KKOA 2IWRA 4EJSA 1X86B 2PR3A 2BVRH 2FSHA 3MU0A 5CDFE 1FL9A 1TQDA 1SVKA 3A7VA 3MH5A 5FTNA 1C5WB 4WWYA 3OYPA 1WB9A 2WWIA 3PMAB 1XUGA 1KI9A 1NVVR 4B32A 3EA9A 2FGJA 5KNCA 4HLCA 2ZVPX 1A82A 3NC1C 3VB6A 1TRYA 6Q21A 5GCHG 1K6MA 3IEUA 3AKDA 2YINC 1ZRKA 2QA5A 4A4DA 3RXUA 3E2IA 1EZXC 2HXSA 2QP4A 2O8UA 1K28D 1WA5A 5LDDC 2AXNA 3D3QA 2STAE 2Q6DA 3VEQB 4D9QA 3SQHE 4Q66C 1AFQC 1BTPA 2WJHA 2ECKA 4A0RA 2TBSA 4IXNA 4NHOA 4A2PA 1C5TA 1XZQA 1IY2A 4IRUB 3KL4A 1P9UA 1O2RA 1UM8A 3L0PA 2CCGA 2VO1A 1XCMA 3EZ2A 2QTVB 4MRNA 1KK1A 4KU4A 2XNDA 1XVMA 1K1NA 3DZDA 1BH2A 1Z6XA 4Y8XA 2B5TB 1KO8A 2JH5D 3KQNA 3KKNA 3KFXA 5AK0A 4X2WA 2AN9A 5F8TA 2GXSA 1UVUH 1OFIA 4X8OA 5BPEA 5L3SB 2O8DB 2EI6A 4X6NA 3TNFA 2XZPA 1C5VA 3HWSA 1DY9A 5DIFA 1C2JA 3I73A 4JVNA 2FTMA 2NO7A 1MTNC 6CHAB 1O3PB 3BIFA 1T0HB 2OT3B 3A37A 1ZHMA 4BASA 2A5FA 3LQRA 5T3HA 3ESTA 2ZGXH 2JAQA 2Y8EA 1E9SA 3KFVA 2ZRJA 2YWFA 5TCCA 1QBNA 5JSZA 1AWHB 3IO3A 4NCHA 4UXHA 5EGMA 3AVZA 1E2HA 4JL6A 2ZJ5A 1CIPA 3T61A 2R6FA 2BMJA 2AMDA 3LKWA 2ZETA 2GCPA 1TGTA 1ZOMA 4TYPA 5E95A 3RMOH 5E7JA 4ESVA 2BCJQ 1GSIA 2H2ZA 4X1QU 1E2KA 2GZ7A 1SGCA 1EFUA 1LB1B 1GHBF 3GJ5A 4XVRA 3T06B 2YC4C 3EZFA 2CLDX 2A9KA 4GZMA 4YXWD 1GIAA 4GI7A 3GLGB 3D62A 2FWWA 3RXLA 2J59A 2LKCA 3OIWA 4Q2KA 5E0JA 4B33A 5F03A 2GV6A 2J92A 4KTSA 5JWRA 1Z6EA 1OIVA 2HJGA 4WMEA 5K0HA 4ZXXH 3NKKA 4WMFA 5EZ6B 5H70A 4JYBA 1J14A 3S1AA 1WUNH 1ZM7A 1SGFG 2UWOA 3UQVA 5GVSA 2ZJ8A 4AB8A 1G7SA 3TVDA 4PPFA 3DOEA 1G8HA 5TDHA 4NDZA 1C1WH 3K0FB 4GNKA 4EKDA 2ZYWX 3X2SA 1O2XA 1O5EH 2J7PA 3QF4B 4J2YB 1LF0A 1U8YA 1ZJDA 1SHZA 1TPSA 2Y80A 1NY6A 1C1PA 1C4U2 3TR0A 5AHGH 5E8EH 2VIWA 4Q9LA 1Z63A 3EX7C 1HAHH 1FZQA 1RW4A 3VXFH 4ZXYH 2BDTA 1E0SA 6GCHG 1FTSA 4FUEA 3LH5A 5KO2A 3A4MA 3LDAA 4GOKA 1QG2A 1UMAH 4HUTA 1SVWA 4UFGH 1XBTA 2CL7X 1DE0A 1RE0A 1VYUA 1II0A 3LBNA 1BOQA 5ESBA 1V2NT 5JB8S 1E79D 2GJSA 2V3HH 2F9VA 1WV7H 3Q85A 1E2PA 2FSGA 2GCNA 4LYAA 3GYMA 1BMNH 1H9HE 1VZQH 2YVUA 3F9HA 1QBOA 1C4OA 1DWCH 1FZZA 4XSHA 1DFPA 3BTGE 3Q7QA 3EPKA 3EDXB 4B2BA 1OT3A 3ATLA 4DB2A 5CM9C 4KHZA 1C2IA 1FPMA 1V2QT 1QVRA 1RC8A 1W1WA 2A5GA 2DPXA 3TKLA 3QVVA 3SC3A 3PLPA 1MH1A 1FIZA 1J8YF 2J1LA 3A7WA 2JETB 1Q57A 2WWYA 3S0NA 1N3BA 1UK4A 2VSOA 5A8YA 2BD5A 1F0UA 2Y6TA 1KXBA 3CENA 3LQQA 3EGKH 4LBWA 1P2KA 2I1QA 2G81E 4NYMR 1YZUA 1P61B 1RYFA 1U81A 1KTVA 3MJHA 1TLDA 1QIXB 2WJVA 3B5JA 2ZS8A 1Q44A 2BXTH 1TF5A 2R6DA 5FCRA 1KI8A 3A8CA 2P5TB 2BQ6B 3RC4A 5EUMA 4DBLC 2PKSC 3DO6A 4DXAA 3TVTA 4YOJA 2RGCA 1Z6YA 4K46A 2UUYA 1EFRD 2ERYA 2B21A 3SZNA 2R9VA 3ND8A 1W44A 2ANBA 4Q80A 1A46H 1DM4B 3IEVA 4B6EA 4M22A 4JK5A 3A1SA 4QHYA 2ZDAH 2WIBA 1M34E 1S3SA 3PWBA 4Q4JB 1XUKA 4E03A 4D4MA 3LX5A 4ARZB 3W6PA 3AW0A 4PPGA 4ISLA 3PFIA 3CF2A 5HE8A 3QX5H 3CF6R 3RU4D 3BERA 3ITIA 3MUFA 3WNBA 1ID5H 1ZD8A 1TNKA 2Z9GA 2IXEA 3QJYA 2X2EA 3ZVFA 3BH0A 1TABE 3SV2H 2WWWA 5FOSA 1WBDA 2JLXA 3OZXA 1WXQA 1HB0B 2ATVA 3Q5DA 2EFGA 1P75A 2WPIS 2VHTA 1YPMH 3SHWA 2N46A 2VP4A 1Y59T 3EW9A 3OSYA 5C1YA 1G7CA 5C1XA 1XMVA 4TYDA 3AKCA 2JEOA 4BFTA 1GJ5H 3V9PA 4LYHA 4NU0A 4OHVA 3P8GA 2Q3MA 2WJYA 1E2GA 2AX4A 2GEUA 2ZSDA 4NFFA 2A0QB 4TMZA 1KK3A 3ZS8A 1E0JA 2BY7X 2DY1A 1P06A 4A2WA 1OXXK 4YMUA 1D2NA 4DURA 4ABEA 1CJMA 3S69A 4R2HA 3SYJA 2REOA 2QBYB 4MG3A 4ZHMU 4QGFA 2ZE7A 4PO9A 3SJKA 3P6ZB 3FTQA 1E1QD 5JI2E 3KNXA 1OXVA 1MCVA 3V13A 1E37B 1N6OA 1NRJB 2XTTB 5FTMA 2ZI9A 2XC5A 2FS9A 4FUFA 3RXFA 4JSYA 3DL0A 3M36A 5JRJA 4JZFH 4RSPA 1DAMA 2OHFA 3I77A 2GETA 2ZYVX 2WMNB 5KNBA 2BM2A 4JLAA 1CEEA 2ODNA 2ZI7A 3OE7D 4GSOA 1FQJA 4II7A 3W6NA 4PXAA 1OP0A 4KLZA 2OBOA 4INKA 2DHRA 3T35A 3LLMA 3PTNA 3GJ8A 3IIMA 1CTQA 4ZKOU 4KFUA 5A0AE 4F4JA 4XOJA 2QROA 1P9NA 1R0YA 2IW3A 1KXEA 1MKXK 2QSZA 3ZS9A 1WYKA 3I92A 5LPNA 3FZZA 1YM0A 2WPKS 4AFZA 2R6AA 1A3EH 2QPAA 4IDHA 1AGJA 1PQAA 2JA1A 4BTIB 2BD4A 1T9HA 5D3MB 2V54A 2PSYA 4J0QA 3GLGE 3ZD6A 2QGNA 2GXQA 3GEEA 4GCHG 3QKRB 2YKGA 4CRWB 5B6LA 1GZSA 1F5KU 1DICA 4OS4A 3NXPA 1W10U 2NO6A 1ELTA 3L2OB 1WOFA 3QQ5A 3VGCC 3G5UA 5HCIA 4RKEA 5CMXH 2ANCA 4UNPA 1UDXA 4QJ5A 4FWIB 1SHHB 5G3ZA 3KQCA 3DFJA 3U3MA 1PYTC 2XITA 2FLBH 4A15A 2O8CA 2AERH 2QN6A 4ZAEA 2QU8A 1R8SA 4BPBA 2RGNC 3QKUA 2VF7A 4FVBA 2OTVA 2QXGA 3CO5A 1B23P 3NHBA 1L4ZA 3R9WA 5A8XA 1VG0B 4EJSB 5FH9A 1XJ0A 2ZR7A 5EODA 1YHNA 1XRJA 4EIWA 5JS8A 1G37A 4CZ2A 1VCWA 2ZFSA 4LSGA 4URVR 1Y5AT 2VTKA 4C0KA 5C4MA 3HYTA 4LK2A 3IPYA 5FOWA 3GCTF 3THYA 3KQUA 2AKYA 5G40A 3RYTC 3M61U 3SFZA 2Q6TA 3ICEA 2ZKSA 2CEAA 2JASA 2BVSH 2PBRA 4DLWA 1YPGH 2GCHF 1JQLB 1RRKA 5AFZH 3IHLA 1DO2A 4C2TA 1GHXH 2IA5A 4TTPA 1PQ8A 2XSZD 3A83A 1D2EA 2GESA 3A8BA 1XMNB 4X8TH 1N6LA 2GVZC 2PZGA 3GY8A 4D4KA 3TSOA 3D23A 2J94A 2NO1A 2CHVA 5ELXA 2J0VA 1BMAA 1BYIA 3OFND 4SGBE 1XPOA 1G7RA 4O3UA 1NNEA 2N1BA 3ZD7A 4HLUC 3SZEA 2V7QA 3K9HA 1T4GA 2OINA 4L4UA 2HLDA 2HLCA 2IUTA 1GHVH 1XB2A 3CLVA 1OV4A 4Y6DA 4JLJA 1RKBA 1C2FA 3I32A 2P3FH 1LV7A 3MJRA 4UNQA 1MU8B 3P95A 5KSZA 2F9LA 2G0TA 1HAOH 3T25A 1YKSA 1KXFA 2QGRA 2BD9A 1MQ5A 5C2JB 2YOFA 1G3MA 1U9IA 3RS4A 2EEKA 4Q7YA 1Z28A 3C14C 2ANKH 2BTCE 2ZU0C 3EASA 2FM2A 1G3EA 1KO5A 1D9IA 4C0BA 2CDNA 5AUNB 2VIQA 4IOLA 5EOKA 1K1OA 2FOMB 4HZUA 4DCVA 2VIDA 3ZVMA 1Z22A 4Y79A 1C5LH 4CR5A 5CJ2A 2KAIA 2AWNA 1IQIA 1Z8JB 2L0XA 2N42A 1G4AE 4BLTA 1YPEH 5JSZB 1C1YA 4QFMA 5AWFC 4AGJA 3GCHC 2C99A 2ZTXA 1MRSA 4UQOA 2BJWA 3U69H 1WAYB 1IM2A 1Z8RA 5E7IA 3GEIA 1L4UA 3SBDA 4PAMA 5EPNA 1LHDH 1CSOE 3ZVLA 4URXR 2H8KA 2VLIA 5GJCA 1BMFA 5IF9A 3MU8A 2EWVA 4C0JA 2P8OC 4FUBA 3OX7U 1DVAH 4THNH 1AY6H 1QJ1B 5EP3A 2TGDA 1Q1ZA 1G3QA 3Q5EA 1VTKA 3KQHA 2ZE5A 1P72A 2OCVB 1XUIA 1YZQA 4IFEA 3PIRA 2J95A 3MO3A 5IHPA 2QL6A 3GMTA 3FMFA 3UWKA 4CF7A 1UTKA 1JJ7A 2CV3A 2EI8A 4D82A 3P26A 1P09A 4UFDH 1TPOA 3NDBB 2FV8A 1NU7B 4L5BA 4I33A 1PYTD 2BV3A 3THWB 3UANA 1SKQA 5T6GA 1Z29A 3M5MA 2O8EA 4PROA 1N8OB 1E69A 3HU3A 4HTCH 3WRYC 1IQGA 4M2LA 1CRQA 1TIOA 4B76A 1W46A 4PZYA 2C98A 1VPLA 2R0LA 4JKIA 3AAVA 3NH9A 2EYUA 2IUUA 4A36A 5CIQA 1OHHA 2YOHA 4QJ4A 1HIAB 4E05H 4LOAA 2C8WB 1ZTJA 1ZINA 4CBOA 4OS5A 1HJ8A 1ZAKA 1QQ4A 4JLNA 5I25A 1EP6A 1G5PA 2PEZA 3CRQA 1ELBA 1HQYE 4XD7A 4OGYA 1KMQA 1W0KA 2ZS7A 1OLOA 5F6MA 3VR5A 4BFVA 3N5CA 3SI7A 1EOLA 4DRZA 5C1BA 3CKLA 2XTNA 1O2JA 1THPB 1HAPH 1BJVA 1P62B 1AM4D 1IONA 1GJ6A 5GPIB 3CF0A 4TYWA 4CEHA 1Z71A 4DJTA 4PR0A 1NVXQ 2ZJ2A 4YLQH 3KXKA 4IMZA 3FHCB 2BKEA 2BDGA 4JVSB 1ZHRA 1PPBH 1MO6A 2ZRPA 5JECA 4Q4LA 1GNRA 2DE9A 4ZKDA 2AMQA 3RC8A 1ZLRA 2ZRBA 4PHHA 1NLZA 2Y82A 1CU1A 3F5FA 3BG8A 1NBMD 1G3UA 1FDPA 1T8TA 1N6NA 2YWHA 4V0MA 3DFLA 2C78A 4TWYA 2CJWA 4ABAA 1P01A 3VKHA 2I6SA 1GRNA 6CHAC 4X8MA 1ZBDA 4EPXA 1B0EA 1UTMA 621PA 2FZZA 3U5ZB 4JLMA 3P4XA 1CJVC 1YCPK 1TMBH 3REGA 5F9HA 3RMLH 2ZU4A 1PJPA 2FTLE 3AH8A 4FMCF 3TMKA 3JZMA 7ESTE 2NGRA 5FL7D 2VWOA 4QBHA 2PFEA 1LCYA 3HYRA 3T1OA 3B2EA 5EW2H 1KKMA 2OZEA 1R5BA 1C5OH 2ILNA 1PUIA 3T26A 1S0QA 2NU3E 4ABBA 1B0FA 3UMSA 1LTQA 3B78A 1MKXH 3PUVA 4EQ6A 2FI4E 2ORVA 1BB0B 1I4LD 1O5BB 4J1YA 1F2UA 1HBTH 3BN9A 1R6BX 1XCGB 1N6XA 1WQVH 1GNPA 3NVAA 2E9SA 3UNQA 5C20A 1YCPM 2CE7A 3CP7A 2V9PA 1M2OB 2O0JA 2XTZA 1JWTA 3TJOA 5JYIA 1L8QA 4JYVH 2QP3A 2VHCA 4E22A 5F9FA 1XVOA 2PTNA 3FHTA 4LZZA 3UWOA 3LW8A 5DP4A 5HPYB 5JBBS 1TNHA 1AMHA 1QHXA 3WP0A 3TQFA 2D8WA 4QNRA 3GJ4A 1TQ2A 3M5LA 2C9OA 5K8UA 2LWIA 4AYXA 1TRMA 4AOQA 3NTUA 3R3GB 4URWR 2GT8A 1M7BA 4RZXA 3GYLB 2OBQA 4YM9A 2PCLA 3KUDA 1ETRH 1QRAA 2VRWA 4DSUA 3S7HB 4I7YH 1J8AA 4DUGD 2G4UA 2ORWA 1YBWA 2R44A 3TITA 1ZM2A 1UCYK 1XF9A 3NKVA 1ABIH 4Q1EA 3QZQA 1NM6A 4CDGA 1OB5A 5AJYA 1Q3XA 1J17T 3RWMB 4Q47A 1SB1H 1GBKA 1AQ7A 4K8BA 3BTDE 4PQRA 1AUTC 4F91B 1X8JA 3BTTE 3ZZUA 4US2R 4MGKR 4LZ4B 2C8ZB 3O8BA 2B6HA 3KQEA 1QHIA 2GVFA 1LVMA 2W7UA 2GD4B 4W7SA 4TYNA 3WY8A 1E35B 2ZA5A 5G41A 3ZDQA 1SFQB 1P2UA 2JETC 5JBAS 4GMXA 1CJKC 4A0GA 4XJXA 1R2QA 4YESB 4I8JA 2ZO3H 2QMHA 2P59A 2G3YA 1O38A 1U8AA 4BFSA 2ZRKA 1UKZA 1ORFA 4BGDA 2WSSA 2H17A 4GPGA 3FHOA 1TE0A 3WMFA 1XEWY 2W2TA 2CN0H 3EIEA 4GMDA 1OX1A 1KIMA 1OSNA 2ZHDA 5HZHA 3GJ6A 4PHGA 3G0HA 4ISHH 1YKTA 4NIWA 3ZVDA 4OHYA 4PC7A 1E98A 3M0EA 2O8CB 2ASUB 1A5GH 2GILA 1HLTH 1SFIA 5JHHB 1CT0E 4B3DA 1AZSC 4EDHA 3MH7A 1GJ9B 4TSFD 3MHWU 3HU1A 4HFPB 4NGAH 2FOGA 2BMEA 1GCDA 3PXGA 1K22H 2IWHA 2VHUA 1Z47A 2ZI5A 2VP0A 2D3WA 2IXFA 1FN8A 1W0ZU 3KJGA 2JDID 1KIGH 2PX0A 2GKVE 4ERNA 4MNXA 1GHYH 3TH5A 4TZ6A 4XBCA 5JJKA 4ZV4A 4ASHA 1ZGVA 4WVFA 4DDVA 2OG2A 2P94A 4ZKSU 2F9UA 3B8HA 3THYB 4Y0YE 1DUEA 3CX8A 4TMKA 5EXSA 3C1KA 4UKDA 1XJQA 4DOQA 4M9ZA 2V3OH 3C4JA 2ZFFH 2H5CA 1S5SA 2I3BA 1FJSA 3DMNA 3AF0A 4A1XA 4JL8A 4TWZA 1UKYA 1QR3E 4JLKA 3REFA 2YWGA 2GF9A 4HB3A 2ONKA 3T28A 2W5EA 1OF1A 1ZVQA 4C0HA 3LRPA 3AEZA 4E07A 3WHLA 7KMEH 1A5IA 3KKMA 3THXA 3EPLA 1U94A 4I1VA 1ZNYA 1TX6A 3A36A 1JXPA 1JOUB 1G36A 1BKDR 1GI8B 4A82A 1MBQA 4NWLA 3FKSA 5J4VA 4IW3B 4KXFB 1CXZA 1ELDE 4LPKA 3RABA 1YLDA 2ZI2H 4G5OA 3SR0A 1Z0JA 1W49A 1NG1A 2QXJA 2FI5E 4FUDA 1NC6A 1E36B 3K09C 5C5NA 3SI3H 1ARBA 1AS0A 1LVGA 3AF3A 2QRZA 1O2OA 2GEVA 1P2MA 3OY6U 2IUSA 1X8KA 2HDNB 3J81k 1IAQA 4ITRC 5JMTA 4H6TA 1ELOA 2QIQA 1OKKA 2OLKA 4GBMA 1WMSA 4MYCA 2CXVA 2FS8A 3GJ7A 3TH2H 3FP7E 3KXIA 1O37A 5JEEA 1D2MA 3KTAA 3RRYA 5C46F 3AP1A 3LA6A 4BRUA 5BYKA 1QTFA 4AG6A 2KAIB 2IBMA 1EOJA 4FUCA 1CR4A 2P6RA 4NSYA 2AH4X 3U3KA 5DP6A 2VJ1A 1Q2WA 1ZC4A 1G8GA 4KFRA 4MRSA 1IQKA 1HFDA 3SS8A 1DS2E 4RD2A 1SLWB 3E1SA 1W36D 2GDJA 4AFSA 3SJOA 3QXXA 4H4FA 5GCHF 4OS2A 3AP3A 4HAXA 4UONA 2Z0MA 4IEIA 3ZZTA 3CX7A 3RRMA 2OC0A 3TRFA 4DDUA 3QG5A 1XUFA 2JCSA 2CLSA 3GY6A 1KDQA 3RS0A 1G8YA 4WZAE 4EFNA 1GI1A 1QHHB 1Z5ZA 1LHCH 2C90B 1AD8H 4JYTA 2UWPA 4GP7A 1FIWA 3NG1A 1O34A 1W0JD 4Y11E 3ZIAA 1E0KA 1KI7A 2QORA 1NFUA 1P05A 3OEEA 4PC2A 2V6IA 5K8LA 3W3ZB 2HPQH 2W0MA 2BKUA 4PAOA 1G16A 1U6QA 3CH5A 1C2KA 4MYUA 1PQ5A 1A5HA 2SFAA 1GBDA 1GI9B 1S0UA 3HGNA 3KGPA 1DG3A 4MKHA 4X6OA 2O8EB 1Z1JA 1KJZA 3KQLA 4H1UA 4Q1CA 1NG9A 4CEJA 1W7XH 2ATXA 1I4DD 1GHAG 3SORA 3U44A 1TQ4A 1DSTA 4OI1A 1JQJC 1TQ7B 4JYCA 4EJSC 2RGDA 3SJAA 1ZW6A 4D8NA 2QT0A 3K0SA 2JIZD 4ZCIA 4A8JA 1W4AA 3SOPA 2CNWD 4YOIA 4DIIH 5K7RA 2ZDLA 2HCJB 3NBYC 1ZNZA 3K9NA 4NCIA 1AVWA 4B1TA 3D7MA 1YCPH 4CVNA 4CEIA 2BLOA 4Y0VA 1CF4A 3MFYA 3S9CA 2EQBA 3K8YA 5DI3A 4DVGA 3DHKH 3WXMA 2JLUA 3T1TA 2Q1JA 1H9IE 3PO1B 1COWA 1XUJA 4XIGS 4E7RG 2ZU6A 3SU2A 1RTLA 3FDIA 1ZMLA 1R8QA 4HAZA 1E6CA 1G32B 2A5JA 4B2LA 3NUMA 1XMIA 2A7QA 2XAUA 1Z06A 5KTYA 2O8FA 4XTCS 3TW8B 4U7DA 1JXOA 4FCVA 4CEHB 4M0LA 1LW7A 4OI4A 5IYTA 2OUAA 3KB1A 1W12U 3MO9A 1TNDA 4S2EA 4OQXA 1FPCH 1J90A 2SGPE 2GZHA 4LHVA 1S9HA 5AVDA 2V6JA 4WVPE 1MBMA 4KVAA 1F60A 1W14U 3TJUA 2D2FA 1NTPA 2ZRGA 1ZC3A 2PGBB 2Q3FA 1IQMA 5J40A 4HDCA 5EQRA 1C5QA 2OK5A 2J34A 2OFXA 5JLJA 1EB2A 1NRNH 4NTZA 2GXAA 3MNXA 1W4RA 3F9FA 2HJVA 4FINA 1HXFH 3MLEA 4BAKB 1SZPA 4GSYA 4UNSA 1ZM9A 3BAFA 2JH0D 4FUHA 3CW2A 3O8CA 3VMFA 1NSFA 4URYR 3H84A 5TARA 4WMDA 1N6YA 2CJWB 1FW6A 1R0XA 1OWJA 4LHWA 2JJ1D 2XXAA 3FMIA 3ZLJA 1HAIH 2FZLA 4YMVA 4M1OA 1SVIA 2V0BA 3VQTA 3U7EB 3P1JA 4M9SA 6GCHF 1P02A 3TLXA 3JVVA 1ZRBA 3SJBA 1W8BH 3BEUA 1ABJH 1KKLA 3U1JB 2FOLA 4ASUA 2Y5FA 1P8VC 1RJ9A 2ZPRA 4BLRA 1UCYH 3ZYEA 4U32A 2Q9CA 1C2GA 1FMLA 1FFHA 2EI7A 1UCYE 5H4IB 2RKOA 1XTJA 1SI5H 2UZ3A 1TU3A 2ZTZA 5FBQB 2ZU5A 4L16A 5TMPA 2P6NA 1SHYA 1Z6JH 3U8OH 1J16A 3K9XB 1O3DA 3K70B 4EQ6B 3EA5A 3RXJA 3SQWA 1KNQA 4FU7A 5T6FA 1G6HA 4IOKA 4QBIA 1SGYE 4DSOA 1VCPA 4IJMA 3QN7A 1F2UB 2NO0A 4JZEH 4LHYA 3LH3A 4AC9A 3MH4A 3SUDA 4Q9HA 3TUIC 4NYIQ 3TGIE 2IF2A 3K6ZA 3E0NB 1F0SA 2QAAA 1TGCA 1UBEA 4CRDA 1VITG 3ICQB 1KI1A 1C4V2 4MVNA 5EE1A 1Z7KA 2RB4A 5A09A 2WZQA 3QKSA 1IJFA 5B30A 3VB4A 1E32A 3FMPB 1XXHB 4LWZA 1P11E 4A92A 3URDA 3GFTA 2BY9X 3A1UA 1O3CA 3G01A 4Z1MA 2GP9B 3HK3B 2QAGA 1OKXA 4A9AA 3BTWE 4QT8C 2GEDA 3RWOA 4D76A 2GF0A 1N8OC 1VHLA 1Y3AA 2WUBA 4NCYA 4RFVA 1TEVA 1BO6A 5HMAA 2NZ8A 2PHBA 1DPFA 2ZPTX 3T12A 2EWWA 2QENA 1Z07A 2OBNA 3PV0A 1V5WA 4IDOA 3BV9B 4R9UC 3TNTA 1GGDB 4V0KA 1HAZB 1VCOA 1D5CA 3OY5U 2WVJA 4YXWA 3VFDA 2ZM5A 2AIPA 5LB4A 2FSFA 4RD0A 5PTPA 4KYIB 1HXEH 4W5WA 2WOJA 1THRH 2P16A 4A6XA 2QT1A 3C8UA 3K9GA 3TSZA 1WE2A 1O87A 3Q00A 3AVTA 4U02A 1FUJA 1OH5A 2TRMA 3W9YA 2V6NA 1WRBA 3VNUA 5M04A 5G3YA 2ZJOA 4FMDF 1KK0A 2BIFA 4IHQA 3SU8A 4IGDA 4M9FA 4X2XA 4M8NE 1SVSA 2NQ2C 4M1SA 3WMGA 2O8BA 2HGTH 5DNYB 4TMWA 2XRCA 3K2UA 3IQWA 5FOXA 3B9QA 2PKAB 2UKDA 1U0JA 2V35A 3GY5A 4LBYA 2XNDD 4HB4A 2Z94A 4BFZA 1AE5A 3QUMP 3RSLA 2TGTA 1TPZA 5CLLA 4DW2U 4HDQB 2F7SA 1TUEA 1E1RA 5L6NH 2GHIA 5LD2B 1KDRA 1E9FA 4BWYA 3BD9A 3STIA 2JATA 1FQ3A 1KTSB 2XB2A 1O3LA 2ANYA 3STJA 1A5TA 2ZECA 1ZYOA 3ZZ8A 3RS2A 4RKOB 4KTUA 1NN1A 1WCV1 3GCOA 3FKQA 3AKYA 1WTHD 2F1IA 4JK6A 5L3SA 2O8DA 1MMJN 5EP2A 4A6PA 1QURH 1UTOA 4WBSA 3RXPA 4A5TS 4P4SA 1IOEA 4G5QA 2W6IA 3AB3A 1A0LA 4UDWH 1NMZA 4Y0ZE 3FANA 1JBUH 5HKKA 1QB9A 4Q9IA 3SNDA 1MTVA 1P2SA 1D6RA 1AS2A 3RXEA 1GPZA 4BOHA 1L2TA 2QTHA 2BBWA 4M1YA 5DG6A 4JLPA 3CRMA 1H1BA 4KI0A 1GDQA 4OQFA 1NMYA 1ZGIA 4JZKA 4OBEA 2WJJA 2DUCA 5L3QB 1Q3TA 3SHCH 1GBTA 2C5LA 1N6KA 2WPHS 3THXB 4Q19A 3HK6B 3QTVH 1WBBA 1ZM4A 1Z1IA 1DAGA 1XTKA 5EPYA 3M7UA 4K60A 4RD4A 1JIMA 1SMFE 1YC0A 1G5RA 4XVQA 2ZPQA 3OIYA 1AE8H 4IC6A 1YGCH 1GJCB 3IO5A 3LGVA 1T8UA 4CH8B 4JLDA 2OESA 4GCHF 3N2IA 3VB7A 4AKEA 2ZNKH 1AQYA 4C0LA 2DWQA 1IHTH 3IUYA 1TPPA 2FDAA 1M8PA 2OC8A 3NBFA 1GBMA 4ZKNU 1F48A 2PUQH 4DSTA 4CGZA 2P3UB 2EFDB 1X6VA 2XX3A 2OSBA 2ZFQH 3FFBA 4ESHA 3A80A 1CR0A 3C41J 1MD7A 2QPOA 3RXIA 4ISNA 4B74A 1Y3WA 4MQBA 1A7JA 2HALA 1N25A 2J7PD 4V0ME 3MWLA 5DP5A 2WJIA 2Q6GA 5TJXA 3P32A 2RA0A 1NT1A 3LWNA 4YMTA 3I8XA 5EQTA 3RC5A 1YP9A 3X1DA 2PGQB 4L9WA 2VIVA 1EAWA 3R8FA 2JGNA 3RDPA 1Z6GA 2IS2A 4KVGA 1E94E 1KI6A 3LGIA 4FW9A 1JIRA 2D2DA 3IIJA 3EQ0H 3IITA 2XBVA 4MRRA 4NCNA 3S9AA 1SBWA 3CUEF 1HAGE 1XXDA 3A6PC 1MT0A 4DLUA 1GDDA 1PZNA 8LPRA 1ELAA 2FOCA 4AKHA 1CHGA 1HPGA 4ZIRA 1KDQB 2ASEA 5HM9A 1UTLM 1JNYA 1GNQA 4JZ1A 3I72A 8ESTE 4Z54A 3LY5A 3E91A 2ZSAA 3BJIC 2BY8X 3PV4A 3UXMA 1P4SA 4RD1A 4AFUA 4OKSA 1G8FA 2B8WA 2IK8A 2WPJS 2Z9LA 1R5NA 1EXFA 3BH6A 1EZSC 4W5JA 2THFB 1QL9A 3CNNA 5KYKA 1LNZA 1UTNA 4GOJA 5G4BA 4JLOA 4C7OB 3ZVRA 3E5HA 4BAQB 1VECA 1GMCF 3RXTA 5FUXA 5KDLA 4KITB 4Z51A 1ODFA 1CE5A 2V55B 3RM0H 1YPLH 3SU5A 1JMOH 1RTKA 4PTLA 1ANEA 4FMDB 4WY3A 4QJ3A 1EXMA 4XWOA 3GJXC 4O9VA 4NCKA 5EE3A 2NPFA 1XXHE 4P31A 3K65B 1DBSA 3AGPA 4CEJB 2E87A 1P10A 2ZI3A 5SZIA 3GISB 1LS6A 2SNVA 2IT1A 3SQXA 3U44B 4Q18A 1XMSA 2WMOB 2W0SA 1Q1BA 3K0CA 4K1SA 1WQ1R 3CNLA 4ZH8A 1SQAA 2HNTF 3TAHA 4A8JB 4B35A 1XWIA 2FX6A 1GILA 3FGNA 3ATIA 1N6PA 2CCKA 4M1TA 721PA 2Z3EA 1EG7A 3U3RA 5FAHA 5EUQB 2NPIA 2VHQA 4CEIB 4NA8A 3ZYCA 2BZ6H 1E2IA 5DI3B 1E9EA 1Q22A 1BRCE 2OEPA 3FP8E 2DWPA 1KO1A 1IHSH 3EA7A 2ZRIA 2BLQA 3KZ1E 2ZHEH 3NCLA 3H1TA 1EPTA 3MAAC 1SC8U 3IKJA 2M5TA 3U7FB 2A2XH 2HPPH 1E99A 1JR3A 5KDDA 3HR7A 1Y3XA 2O8FB 5J4SA 2D7CA 1MH0A 4QC2A 4NBSA 3OEHA 1QB6A 4DB4A 4Q7ZA 1N0VC 4D0NA 3LVRE 1GWAA 1AZTA 1SXJA 3U2QA 3SO3A 3KEEA 5ANRB 5P21A 4MPXA 3RU4T 1YZKA 1DAHA 3HKJB 2GGVB 3BFKA 1J15A 1G9XA 3PCRB 3GD7A 1LS1A 2DWOA 1C1TA 2H6MA 3EC2A 2V1UA 3QG1A 3NBXX 4F4IA 4PSKA 1C1MA 1JB1A 4KELA 1SGEE 4DDWA 1WF3A 4C0QC 5JBTA 4RCYA 1S82A 4K81B 4M53A 1DADA 2H18A 1C2HA 3OTPA 1ELFA 1GMDG 1NO9H 3QLPH 1IHUA 4OK3A 2ZREA 2AWOA 3E3TA 2ZTSA 4DEYA 2BD2A 1O2HA 1ZNWA 1LFDB 3ATMA 1U9IC 4OQNA 4URZR 1GUAA 2JJ8A 2BHGA 3RC6A 3V3MA 3K09A 3CPEA 1GRRA 1N5LA 1GVNB 1EESA 1LKAA 3X1ZA 4ZPXA 2LPRA 4Y8ZA 1HE8B 2OC1A 2BMDA 4DZZA 4HB0A 3NZIA 2B8OH 1QL8A 3W94A 1Y63A 2EFEB 4TL8A 2QQEA 4IDPA 2OBLA 1I2MA 1G30B 1KI3A 1RJ9B 1Z8GA 2P93A 2NIPA 3JVUA 3K0AA 2D4HA 1N2CE 5J4KA 1EJMA 2W6JA 3GDUA 3QGJA 2VP2A 2XCNA 8OHMA 2IYUA 4ZKEA 4U00A 2OCBA 5BN5A 2ZJZA 4US1R 4UNNA 3F9EA 1D3DB 4G01B 2EC9H 1SVPA 3RXOA 3ZV9A 4X2YA 2Z4SA 1IQEA 1XX9A 1O2SA 3T5GA 3ND9A 3A81A 3QPUA 1E2FA 1E2MA 1CHOG 3AVPA 4OL0A 1GVLA 2IN2A 4IS5A 4HATA 2JJ2A 2RGAA 3RLYH 5KSPA 1ESAA 4YQFA 3B1VA 1SGWA 1MABA 3RXVA 1P2IA 2QSYA 1NLFA 5FR1A 1J70A 1W47A 5KSOA 1YZNA 3NH6A 1QHGA 3P70B 4LC1A 3GPLA 4B48A 4YONB 5D3MA 3AUXA 4DIDA 4UJ5A 5JPMH 2VYFA 2QPTA 2QAGB 2BYAX 3RLWH 4CRAA 4NYIR 1NN5A 1GKUB 3LO5A 3AW1A 3TBKA 4BZXA 1GHZA 4XWKA 4IKEA 1BTYA 1KJYA 2G00A 2PLRA 2GV7A 5FOTA 1CGIE 1XEWX 4RSGA 2ODPA 4DLTA 2GJ9A 2PT5A 4YOGA 3JZ1B 1C1VH 3S7KB 1JR6A 3VU9A 5L8VA 2C9YA 1FOEB 3ZQJA 3GCNA 3TE6A 2A3RA 4BLOA 1FLEE 3UFAA 1QBKC 4WJG2 2PMKA 3B1XA 1W0YH 2XEXA 2GZ8A 3T29A 2J0UA 1O3IA 3U4QB 5CJPA 3PO1C 3U8RH 1NIPA 1D3PB 3QGNB 1TRNA 1OP2A 1V3XA 2ODWA 2AGEX 1D6WA 1QGFA 5DHFA 3WHKA 4MYHA 4B2PA 4CIDA 1NRSH 1MR3F 3SJ8A 2O8BB 4W9MC 5DGXA 3I1FA 4DKXA 1WXRA 5EP1A 2WUCA 3M3TA 1NSTA 2WWFA 3CZPA 5KUTA 5EE9A 1EQ9A 2Y5GA 1ZP6A 4YTAA 2WHXA 4NIVA 4WH6A 2V7QD 3KQDA 2HLDD 1GAJA 2XJ4A 1T0JB 3A7TA 3LAWA 3PM3A 2RHMA 1X8LA 2BEJA 1FONA 2AD5A 2ZRNA 2BLWA 2NU0E 3L43A 3PG5A 4AZ2B 1SQTA 2F9MA 3D49H 4Q7MB 1S83A 1LDTT 4LJ6A 2NOAA 5C18A 1RD3B 3FB4A 4U01A 2F3RA 5FTJA 2CHGA 1ZTKA 4ZHLU 5DKMA 1P5ZB 2FZ4A 5GVRA 2VWNA 1C5XB 1BRAA 2I6QA 1GBIA 4H1VA 1KZGB 1O33A 4KCGA 3ELAH 2OLGA 4P4SB 2A4GA 3WBJA 1IQHA 4R7ZA 4TY6A 2OQUA 1T3LA 4IW4E 3AVXA 1E2QA 1VIAA 1AIXH 2J41A 1TBRH 4NIXA 2D26C 4X6PA 1SLVB 4URUR 5DE3A 3DMDA 4MRPA 3GLFA 3M6AA 2XWAA 2ZYUX 4WF8A 2QGZA 2XW9A 421PA 3ZZCA 1O2IA 1GFIA 3W8RA 2HF8A 1HAVA 1ZU4A 4FN5A 1P60A 5JWHA 3K70C 3KKQA 2IS6A 2GT7A 3A7ZA 1C5SA 3VHXA 5GJWC 2F1JA 3H5CB 1UDWA 1K1JA 1BMFD 4V0OA 4Q4HA 5B57C 2GBLC 1UVSH 4JJKA 1GI3A 3CRVA 3ETLA 821PA 3SV8A 1GDUA 1FP6A 1G9IE 4MQAA 4B3FX 5B64A 2AKAB 1AFEH 1R0WA 1I2DA 2A2ZA 4HUQA 1GI4A 2A4OA 4PSAA 4KFSA 5KHOC 1LF5A 1O3YA 1ZTLA 3QE0A 1BUIA 1TGSZ 2IJD1 1V2LT 2ZE8A 1SGDE 2J4IA 1P57B 1O5CB 2IF0A 1G4UR 3EXAA 2VWMA 3Q8XB 1B5GH 3WNCA 1IN8A 1NFXA 4A0HA 1NRRH 3GICB 4HI0E 4GAWA 2VP6A 1DDJA 2ZAOA 1W13U 3IBYA 1CA0B 3KF2A 3THWA 4UNRA 1G7TA 3TGKE 4A1VA 4MH0R 1VJ9U 1KYIA 1O3MA 4JZIA 2OP9A 1GGDC 5JHGB 1KI6B 1OHHD 3AM1A 2ZITA 4PQFA 4PZLA 3L33A 4KBFA 3SHFA 2BOHB 3UMFA 4DDTA 2J45A 3QUSA 2F3CE 3HATH 3PEWA 1UK2A 3PV2A 4GFDA 2CK3A 1HIAA 4XD7D 1W0KD 4PHTA 4ZIRB 1ZHPA 2F55A 2PZFA 1OB2A 3B8JA 5LH8A 2DB3A 1Y3YA 4DY7B 4JMPA 3QBVA 3DEFA 3GFPA 4OHWA 1UJ2A 4LBZA 1IN5A 3H7TA 4JKYA 1F5RA 1K5DA 2H9HA 3QPWA 4AG2A 2WYJA 2YNMA 5C4GB 3CZQA 2LKDA 1XTIA 1ZUNB 2J5XA 4BRWA 4Q7JB 4QG7A 1KLIH 1NVVQ 5KOYA 2FN4A 4MKIA 4O3TA 2EFHB 1J9CH 5FPSA 1B0UA 2J7KA 3CRRA 2K5UA 1C2MA 2FMJA 4JT2A 2VIOA 2NTYC 1EASA 1TNLA 1UK3A 3SGAE 1G17A 2CJIA 2Q6FA 2VSFA 1GL0E 4P4TA 1TGBA 4XTRA 3KB2A 2A5KA 1DOJA 1DUAA 4LGMA 2ZWLH 1ZMJA 5F3WB 3QSYA 3ECCA 5LD2C 1DX5M 2WPLS 5G53C 4LJ7A 3VNVA 2PWXA 3D6TB 1SGRE 2F9OA 3FFAA 4GZLA 1C2DA 5FPHA 4DIHH 1I4TD 1ZMXA 3A85A 3FPAA 3B1ZA 4WXIA 2ODBA 1GI2A 3KIDU 2FNAA 2F9BH 3EE0B 1Q1QA 1GBFA 1HYLA 2RDLA 3ZZ9A 5DP8A 1C5MD 4E5UA 1ZRHA 2QYIA 1AVGH 2D2EA 5JI3E 1V2TT 3M1IA 4RN6A 3GJ0A 2YC2C 3FFGA 1GL6A 5KSYA 1C1NA 4JT4A 4PHFA 1T32A 3LXRA 3QVUA 4D26A 4WXPA 2CCJA 1FI8A 4UJ3A 1GCTB 1HEIA 1EPTB 3SGQE 5B2ZA 1C9TA 1N6IA 4CH2B 1QHNA 1NY22 4TLCA 3IWMA 2XBYA 1BTUA 1LVYA 4RFSA 1NJGA 4KSCA 3PUXA 1RPZA 4CRFA 1OXSC 2FG5A 4D0GA 5E0GA 3SNCA 3K70D 1XPRA 2NO9A 1SXJB 2QV1A 5TCAA 4NPHA 2HNTE 4TT3A 4BLPA 1B7XB 3RNLA 2G52A 4BZPA 1C4Y2 3HP1A 4OJQA 2CF8H 1Y5BT 5BXQC 5FX5A 1KMHA 1AVXA 3RRZA 3LGYA 5BWMA 1O2GH 3P20A 3SOSA 3U9AH 2WV4A 5I46H 2H7VA 3U1IB 3SN6A 4YLGA 1MZDA 1OH7A 2NMVA 1P2QA 3IG6B 1US8B 4K8YA 4VGCC 3P17H 2WICA 3AGQA 3V0XA 4IDNA 5DO9A 4FWTA 2BDYA 1S1CA 1P2JA 1GKYA 3SHAH 1NROH 1YF4A 2XTMA 1P2TA 3CS0A 2A1DB 5FBIA 1TQ6A 3TK1A 3C5HA 4YZUA 3TSWA 2IPHA 2IYZA 3TAUA 1GHAF 5FPTA 3DHWC 4XWAA 4SGAE 3MSXA 3BB1A 4ABJA 1EGAA 3F0TA 1EAUA 2Q3HA 1OWIA 2Z6BD 4BXSA 3K0AB 3LPRA 2GCOB 1A7SA 3EZ9A 5BRRE 2XZOA 2REBA 3FVFB 3GY7A 3CWZA 1S4QA 4CRGA 2PJZA 4F92B 3UWIA 2GMTB 1NKTA 1C5NH 1WU1A 4ABFA 3R7WB 2ZQ1A 3B60A 4WA7A 3TK6A 2ZIAA 4BFXA 1A61H 1UF9A 1P9WA 2FDCA 2FEOA 4GUXA 3Q3JB 1ONBA 5JZVA 4QM7A 1VG8A 4B3CA 2QE7A 1D6JA 2HEIA 3IIKA 1GKIA 2QXIA 5ETXA 2BHRA 2ZDMA 4MPVA 3O8RA 4IVPA 1FY5A 3GY3A 5CK5A 3MNBA 1E9BA 1MABB 2G77B 4HAUA 4OGXA 1FX0A 2VIPA 1T6NA 1IQPA 2WSSD 1G1MA 3W90A 4GL2A 2R0KA 3PYHA 3TUZC 2VHJA 3ZJYA 1KDTA 4WZBE 4Q9JA 3TIFA 2GX4A 2NWNA 3SU6A 3BH7A 3WY9A 1DPOA 1P9SA 1W11U 1ZIPA 3WRXC 4JYUH 4C30A 1S81A 3BTHE 1EAXA 5LPRA 4ZCMA 1P73A 3PEUA 2WWGA 3VFEA 3LBIA 2VVVA 3RU4E 1QDEA 1GJAB 4CYMA 4HDOB 1LTOA 4LHZA 2V4ZA 3K1JA 3TPIZ 5E0HA 1A1RA 2OQ5A 2ULLA 2ZCHP 3RM2H 1Z2CA 1ZUIA 5AJWA 1P9RA 2FOAA 4NYMQ 4XE4A 3CPHA 2PH1A 2JLSA 4JBXA 3EPJA 2NU1E 4A8JC 1DITH 3DT0H 1IXSB 5DI9A 1ESNA 5GDSH 4DT7B 3VU9B 2O8TA 2HOBA 2VL7A 5FBVB 5CITA 2VU8E 1IN7A 1MTSA 3E16B 1YZLA 2BDHA 1YLCA 2ZTYA 4UD9H 4BEBA 3C27B 2QF0A 1FV9A 4AORA 3SZRA 1CGJE 1YE8A 2FOBA 3QF7A 2CGAA 2J0UB 4EPWA 3KUCA 1XDBA 4I8KA 3E70C 4TL9A 4KLNA 3RRNA 2WAYA 4DLRA 4X8VH 4L9SA 1KAGA 3B85A 4CW7A 3U7GA 4M1MA 5CIWA 1C2EA 3CPJB 4Q48A 3I5XA 1G291 1J7KA 5ABWA 4X2VA 1O2YA 1HJ9A 1SSXA 2GJ8A 5AJZA 2VP5A 3VTKA 3A7XA 4WAUA 1TX7A 2AGGX 1V2JT 1CQQA 3FKSD 4UXIA 3UQOA 4TLBA 3V4FA 2J0SA 2BDBA 1VITF 1OE0A 2KSQA 2BMFA 5J4HA 2A4QA 3DUXH 5GXPA 4K8OA 4IN1A 3MRSA 4JMYA 1UVPA 2R2AA 4GOXA 1K9OE 1YVDA 3EAQA 1VCQA 4NZLA 1KSFX 3FMOB 1GMCG 2W00A 2WV5A 4ABIA 2BQ7B 1GM5A 2EU8A 3UMRA 1PLLA 1GP2A 2IHYA 3T62A 1BMMH 3H0KA 4ZHAA 1OKKD 1LO6A 4MA4A 1FNMA 5IDKA 3T5DA 4M9XA 2ZRDA 4G1UC 1AN1E 4PSVA 2XBXA 3NEJA 1OYYA 2Z43A 3TW4A 3MYWA 2ZR9A 2NG1A 4O03A 4RZUA 1H8DH 3WYAA 3MU4A 1YJ5A 1UVTH 3G82C 3CNOA 3GLIA 2ZU2A 1KSHA 4PAQA 3M5OA 1IXRC 3SU4A 1HCGA 4ABDA 3M7TA 1QJ7B 4DWJA 4ZDJA 2NU4E 3I5YA 1DT2A 1FY8E 1CLUA 5DLQC 3VR1A 4ZI3A 1XTSA 3F6UH 4YT7H 3GLFB 4KKDA 3A4NA 3D31A 3O8DA 4R2IA 4OI2A 4DCDA 1F6BA 1DE7H 1HDTH 1XP8A 5GADl 1TTTA 1XEXA 5DPAA 1XZPA 1K2I1 1E9RA 1HAVB 5JBQA 4XVUA 1NY5A 3AK5A 3RAPR 1O2WA 3OF5A 2ANMH 1TMKA 1JR3E 1P6XA 4ZKRU 2JLQA 1CBWC 1JEEA 4Q4HB 4X6MA 2DBYA 2P67A 4C3ZA 1CJUC 1LPGB 1QA7A 2G51A 1SXJE 2ODYB 3BG4B 3I3SR 4LXBH 5TY0A 1V2WT 4CT5A 1AKSA 2G5VA 1CKEA 3L82B 4WW0A 1SULA 5SZJA 4TN1A 3ZIAD 1DO0A 4TL6A 4HUQB 3OEED 3BB4A 3F9GA 3RANA 3KJEA 1QHHA 2TGAA 3TVJB 5FOUA 4DGJA 4D7FA 4R0IA 1ANKA 3PEVA 4RD3A 3RSOA 3TQCA 5GJVC 4TL7A 2F43A 5C1UA 4A2QA 3ODDA 3IGFA 2GNOA 3PTBA 4G5RA 4TPYA 2QAGC 3F3YA 4AKGA 3GJ3A 3AVVA 2BVNA 3LJOA 2Z3CA 3M4YA 1YR8A 3N7OA 4IOMA 5FR2A 4PQYA 3LC3A 4X1RU 2CBZA 2A7CA 1ZD9A 1X1RA 5JCZA 1NLYA 2ZUDA 1XKAC 1SLUB 2GVDC 1LHFH 4ISIH 2WPDA 4Q02A 5KNDA 1RIWB 3Q3YA 1NVUQ 4IVQA 1O5DH 2ZGCA 3KXLA 1AS3A 1SQOA 2C3SA 2D1JA 4AI6A 5AR1A 1OYWA 3AF1A 1LVOA 3QIAA 3I62A 4N0EA 2GZAA 4QL3A 1FP7A 1G3RA 1KO4A 2JLYA 1MQ6A 1KI2A 3SNAA 1P12E 3U6KA 5TVKA 1XX6A 3RXKA 3GOVB 5LBIA 4F4OC 5J4YA 1PQ7A 1COWD 1G8PA 1YPJH 2PW8H 2B0FA 2BOKA 1QBVH 5IRCD 1FUKA 2HNTC 5EG4A 3MMPA 3ASZA 2A78A 4MNWA 3URCA 1DAEA 521PA 3P4YA 4AY2A 4N1AA 1S2MA 3ZZDA 1SQ5A 1T5IA 1HJAB 5H8WA 1R0ZA 2Z5FA 3HDTA 1ACBE 3EWSA 4JZDH 4B3GA 1P2VA 4XBDA 3C7KA 4PC3A 3GQBA 4MGIR 5CM8B 3ZQ6A 1GBLA 5EJEA 3SBEA 3AVQA 1F2TA 1D3TB 3T1QA 1MAXA 2XXLA 3RS3A 3WYGA 4KBGA 2PTCE 1LHEH 2JLZA 4Q1AA 1TOCB 1ESBA 2XC0A 3AASA 3EA8A 1S1MA 5FFMA 4P4UA 1GJ8B 4BTUB 4LYJA 1Q21A 2ZCLP 1UJ1A 4DC9A 5FPYA 3LU9B 1OSSA 5HZKA 4MPUA 3K0EA 221PA 1MO3A 3ENSB 4AKIA 3LH1A 4O2RA 2AIQA 2QAJA 1DY8A 4AYVB 1OFTA 2HT1A 3WP1B 5A0CA 2D7DA 4ASUD 2FFHA 1G21E 2ZJYA 1E34B 2CL0X 4D81A 3H4MA 4BFUA 3A84A 1U0LA 4LJ8A 2KB0A 4OHXA 4NA7A 4NE2A 2QI9C 2R9PA 2RCEA 3PLBA 4WZ6A 3NHAA 2OILA 5SZKB 1FY3A 3U6BA 4RFSB 2OFWA 1ZCAA 4NH0A 4B2IA 1E2DA 2RGBA 2HUPA 1HURA 1ZPCA 1QHSA 2IYRA 2FFAA 1BCUH 1CJTC 4HLQB 1O39A 4BEJA 3PROA 2MSDB 3N2EA 2A5IA 1JRSA 1OIXA 1KMHB 4BAOB 1SLXB 4JIMA 2VQSA 3WYFA 1XKBC 4LDJA 3MWJA 3FZDA 3VR6A 3A89A 2GBLA 4G5GA 1XM1A 5ESTE 4F4CA 1FN6A 3EAJA 3NWUA 1GBHA 3LV8A 4MYTA 5FBRB 5A2MH 4Z1MD 1INCA 4DLYA 2IS1A 1GVKB 4FIDA 1EFTA 1KO7A 1RIFA 1LQDB 4RJLA 1XXHA 4YT6H 2QXHA 2CVFA 1LPZB 3ZZ4A 3CB4A 4H6SB 3RXDA 3V7TA 2W3IA 4JS0A 3SNEA 2DYKA 3SYLA 2UWLA 1QY6A 2R62A 3UR6A 4TLEA 2V8OA 5FUWA 1W3CA 1CA0C 4U2WA 3C5CA 2Y81A 3ZVAA 1T5LA 1RRPA 4AN7A 2UUKB 2Y7ZA 2FI3E 4FMBB 3MFJA 4TQUS 1UPTA 1THSH 1ZYUA 3A58B 1ZR0A 1KY2A 2WINI 3LBHA 1QNJA 3L6PA 4WXRA 1QJ6B 5JCPA 2WV9A 4RZ2A 4CRBA 3GLFE 4IXMA 4B43A 4AFQA 2DE8A 1RTFB 2FGKA 5AUQA 1O2QA 4P3YA 3RP2A 2ODEA 5KU1A 3RXMA 1H8EA 2G83A 1ZPBA 2J38A 3A8DA 3QZRA 3GFOA 4NP6A 1FTNA 2ALVA 3FVQA 2O9QA 3X1XA 4Q9KA 4JJZA 2J2UA 4HAYA 1QZXA 2BDIA 3UKDA 2G55A 1F5LA 1NL3A 1O2PA 4LC0A 1UKVY 1FX0B 4YC7A 1NBME 1UVOA 3PMJA 5HXFA 3B9FH 2IJOB 1G6OA 1YPKH 2GK7A 1CT4E 2KI5A 3A82A 1PPZA 5FUYA 3BFVA 2R6GA 4BZQA 5L3RA 2D74A 4QXAA 2PKAA 1GMDF 1E1RD 2F91A 3RS7A 1AZ8A 1W36B 4Q7LA 2GCTB 5LPFA 2QNRA 3V00A 3RXCA 1QF9A 2ZHQH 1DARA 2ALPA 2C93B 2FOFA 3QENA 4IBLH 1JALA 4N0DA 1DEKA 1NZQH 1ELEE 3K0CC 4S35A 5DN6A 5GJBA 1Y8TA 1KNXA 4O97A 2DFNA 2VINA 2BB4A 3TR5A 1NESE 3NC0C 7GCHF 4W5HA 2X8AA 1T4VH 3SNBA 1V2PT 2W6ID 3ZVEA 2GAAA 2YYZA 3BWDD 2IOTA 1LPKB 1AGRA 1SR5C 1UBCA 5K8IA 5HKKD 2ZDKA 4KP0A 1OWHA 1OXUA 5CHAB 1FY1A 2EA3A 3CR7A 1Z0IA 2WTUA 1GCTC 1ZSLA 1PV4A 1EPTC 3PB1E 2Z9JA 1YYY1 4LRWA 4RCZA 3T15A 4AYTA 1O5FH 2C8XB 2G88A 2R2WU 1SGFA 3T34A 5CYOA 5FTLA 2UZIR 1GHWH 3SE0A 4ACBA 2C8YB 3UREA 5EQQA 4OQLA 1SXJC 2FMXA 2VH0A 2Z4RA 1SVOA 1GJDB 4O2LA 1SGPE 1W4BA 1VYVA 1CHOF 3MTYA 5AJXA 5L3QA 3KKPA 2P6UA 2FSIA 4CREA 2ZUBA 4HI3A 2AGIX 4IN2A 2OCYC 1YRAA 3W8NA 3DKVA 2FX3A 3LGWA 2O0KA 1TUIA 1TF7A 1CS4C 3ZV8A 2R8RA 4FMCB 1L1JA 3LD9A 4JVLA 3R9XA 1XFAA 1QHRB 5HE9A 4I81A 2ZPSA 4PC6A 5K8TA 3ZVBA 2MMCA 4C9BA 2XOKA 3MWYW 4DLSA 1XTQA 3E8LA 3B1WA 2BZAA 1OPHB 2PLXA 3PUWA 1GWNA 4UE7H 1YQTA 1C1UH 3GLIB 1PLKA 1EJAA 3LOXA 3BTME 1BIFA 1R5OA 1ZM3A 4AG5A 5C67A 5FX6A 1VITH 3IBGA 2QZ4A 2AMPA 2A45B 2A5YB 3AVUA 4FCTA 4JLVA 1O3NA 3OAAA 2OV2A 3UR9A 3BFXA 4HAWA 2P95A 1O3EA 1CULC 1G3CA 1TGNA 3MU1A 1XEXB 3O47A 1DWEH 2BBTA 2RMKA 4G0NA 4LJAA 4CBNA 4TLDA 4AD8A 2GMTC 3I78A 6LPRA 1C9PA 3Q7PA 4P33A 2ONJA 4O3MA 2FPZA 4I1UA 3AUYA 5UKDA 2ERXA 1TQ0B 3MI4A 3AKEA 1EZUC 3SU1A 1IJEA 2QQ0A 4BLSA 4O0MA 4QKQA 3HPQA 1PPEE 1AKSB 1MKWK 2HT6A 3A8TA 1RZ3A 5D3QA 2VBCA 4LJYA 4X0WU 5E4FA 3CRW1 4GP6A 3AVYA 2FWRA 5BQ5A 2A32A 4Q1BA 2IXGA 1WTGH 2A2QH 4AB9A 1E2LA 2ZGJA 3EZ7A 4MTBA 2ZRAA 2CVHA 2F43B 3N70A 3UIRA 1ANBA 2O8WA 4JCNA 4DHEA 3ZZBA 4HAVA 2G9NA 1O3AA 1H8HA 3VR4A 4FUIA 2RG3A 5E2OA 1WCZA 3A4LA 4XOIA 4C7OA 5CB8A 1X1SA 2HYIC 1V2UT 1PUJA 1QHYA 2IS4A 1SOTA 4OS7A 3THOA 2ANWA 4DG4A 2PLFA 2ZIQH 4UEHH 1Z6AA 2HV8A 1MTWA 4X1SU 1V43A 1YPHE 1AZZA 3CONA 1DTSA 2BDCA 1IBRA 3RLFA 2CHQA 2PT7A 2GJKA 1GG6B 4PFSA 2W58A 1ESMA 3KDSE 4INHA 1TA2A 1L2EA 3D65E 3R20A 1N0UA 1O3KA 2R2MB 5IK2A 5EQSA 1SGTA 3A86A 3OTJE 2O0HA 3K9LA 1YZTA 3LGTA 3B23B 1O5GH 2VNTA 1AA9A 2F83A 4GHQA 5A0BA 8GCHG 1O2KA 2ZGBH 2X2FA 3F8TA 2BBOA 4B75A 4R98A 5LGOA 1JR3D 2ZU3A 2CXXA 3BEIB 3MGCA 3BORA 3OEHD 3RXRA 4B6FA 1BTXA 3L3TA 4US0R 2QG6A 4ABHA 1FQKA 1SXJD 2IHBA 5BN4A 2XJ9A 2HVXA 1DXWA 1XJCA 3B13B 2HXYA 4AYYB 4Q1DA 1W2HA 1VHTA 4GDFA 5AFYH 2G0NA 1Z0FA 3PVSA 2BJVA 5TV2A 1XU4A 4MLFB 2WPMS 3UTUH 1Y3VA 2P0EA 3NDPA 3F1SB 1NN6A 4I8LA 4NYJQ 1F2TB 3ZZ0A 2A5AA 1CR1A 1P3CA 2VVUA 1FXYA 2A30A 1OW3B 1BTHH 1N0WA 5FI0B 2GA8A 2PCJA 3L8YA 1P3JA 3RDZA 1BITA 4BECA 3HGPA 4LOYH 2PEYA 1S8FA 2BD7A 4JSTA 3BTKE 3ONWA 2PUXB 1NF3A 1DAKA 5DYIA 1Z0KA 1C2LA 2TGPZ 4GT1A 2FO9A 2RGXA 5T6DA 4X1PU 2OCAA 1E4YA 4I8HA 3RC3A 5GWZA 3BRWD 4WIAA 1DVRA 2ZI6A 3FWYA 3SEAA 5FI1B 1GJBB 1MZAA 1SGIB 1ELCA 3IPXA 2PX3A 5EXMA 5HR5A 121PA 3BBPA 5KPJA 6ESTA 2W6JD 3PV5A 4K3JA 3SBKA 4ZUHA 1OOKB 2WBLC 3LONA 5H1YA 2TPIZ 3U7HB 1GRQA 1CRPA 2QY9A 1OWDA 3V12A 4NFEA 4LUCA 1TBQH 3V4RA 1QRZA 5JB9S 4PPQA 4ZCLA 2G5NA 1T3HA 4B2AA 2B8TA 3U3OA 3BEFB 1OFUX 3W6OA 1V2VT 2OLJA 1G41A 1BTWA 5L2YH 3BG4C 4NMMA 1R10A 1DWDH 2JJ2D 4M1KA 4XFQA 1UEJA 1EB1H 2GDEH 1BHXF 1Y3UA 3OHMA 5AJVB 4A7IB 1KDPA 1G18A 4BLQA 2IYYA 4AURA
chains in the Genus database with same CATH superfamily
4A1FA 4N3CA 1YMQA 1PLJA 2R66A 4H42U 1HNEE 3HCOA 2AFIA 1HT1E 5K3EA 1V9SA 2HBRA 2ZU1A 3B3JA 4B6QA 3V7FA 3NDJA 1Z7BA 2ZJBA 4KE8A 4EUKA 3TLOA 3BIUH 1EFHA 1TM3E 5JNRA 5TXGA 3WDKA 3QA9A 2GTPA 1ZMNA 1M0TA 3U8TH 2Y1CA 3EQ6A 3FYUC 4AUNA 2R6CA 5FNZA 1E92A 2AHRA 4DEVA 1NV8A 3KEGA 1XRSB 4KIUA 1AI8H 2PUVA 3HB0A 4J2OA 4NBWA 3QDZB 2WKQA 5CK4A 1ZSJA 1U1DA 1JAZA 1YDFA 3H2YA 4C21A 2OFOA 4DLXA 3A9WA 3FWZA 5EE0A 1A9XB 5CA1A 2ZAIA 1XLVA 2HA4A 3LHFA 3S1AB 1FLDA 2X9GA 1S5PA 1K2VN 3CBQA 3M6UA 3HBFA 5DBEX 1OPXA 4YMWA 3TZ6A 2W98A 3ANLA 4MGZR 2PPVA 1NZDA 1W2GA 2IYPA 3KFLA 3AF6A 4WPGA 2WY2D 2GPJA 1O1YA 3KQWA 3P9XA 2O5CA 2A4RA 3H5AA 3U4QA 1XK6A 1SOZA 1BW9B 4BN4A 2JLWA 3PWKA 2FPXA 3KZVA 2YHAA 2O0MA 5CNIA 3QGMA 4HQ0A 1DMSA 1Y1SA 5IU6A 3TK5A 1J20A 1K9SA 1V8PA 2Z58A 4DJZB 1PZMA 5ER6A 1P1BA 4E4TA 3R0VA 1KOGA 1ZCBA 3MH6A 1Z0AA 4Y2UA 1RXSA 4F7WA 2TSYB 1KY4A 3CJRA 1UBGA 3D2BA 5SYAA 4L8FA 5TQVA 2P5UA 4KC0A 4BZWA 2EJBA 4EI9A 2GDDA 2WPNA 2Z2ZA 1JI0A 1YFLA 4IIJF 5FCDA 4JUIA 3NWPA 3Q7TA 4D56A 2ZRHA 3X0DA 1SCUB 4MV4A 1E9AA 2O8LA 1ODCA 1FUUA 1E9DA 3RUOA 3BSQA 1ISIA 2ZCUA 4B73A 3D3WA 4QTUB 2JKHA 3LYUA 4D7GA 1XMJA 4QGAA 2C83A 3EISA 3FYTA 1XD2A 1W75A 3FX2A 2XGSA 3PHIA 3A88A 3BS4A 3T4UA 3NFRA 1M9NA 3OKPA 2Q0SA 3KV1A 1ETUA 4HDKB 3M5CA 1X38A 5C5OA 3QJ5A 1V2OT 1GUYA 3N7DA 1UK9A 1SKYB 3W1EA 2VH6A 4KLRA 1I1HA 3QIVA 3K31A 2OCGA 1EKXA 1EFRA 4HH4A 3DD2H 2WD7A 1K3FA 1YC5A 1Q1GA 3WGGA 2M9MA 4DIKA 5DHPA 3IILA 4OO3A 3R9XB 3MWEA 3KR9A 3GVIA 4Z6AH 2PLAA 4XQ9A 1PW5A 2JAPA 3DM9B 4U4AA 1F2VA 1LQEA 2HA2A 1LDYA 5FL3A 4NZOA 3H7OA 3ZWYA 3RQSA 1HI9A 3IQXA 1BOOA 3EXIB 1UBFA 1DOZA 1KDOA 1RAAA 1DDOA 5HWSA 2JZNA 3LC2O 4BPRA 3R7FA 3KCGH 3EVZA 1MAAA 3U9LA 4QGGA 4HXYA 4FNMA 3RXQA 5KI6A 2P5YA 4Q3BA 3KUXA 4Z9FA 4ETMA 1L5YA 1U7DA 2ON6A 1K1LA 4E2ZA 1BFKA 2FB9A 2XYPA 2P77A 1NXQA 4L0DA 1ETHA 2CK3D 3ZXYA 4FCWA 3W2TA 4AZ3A 2BTEA 2RKBA 3KHVA 2Z6VA 2Z9BA 1A2BA 2KBEA 4A8HA 4DLZA 2SKCA 1II8A 1VGCB 1H9BA 5TQ0B 3RK1A 1PZXA 1PJ3A 3FP6E 2YNMD 3FTDA 4ND8B 3VV2A 2DQKA 4RKJB 3MBKA 3H97A 3Q2OA 1VGQA 5BW8A 1BQEA 3OJXA 1I7NA 1P9LA 3GF4A 2QZJA 3VR6H 1NXWA 1JBKA 3F6BX 1QONA 2ZS9A 4L07A 2ZBDA 2C7PA 1EP2B 4NKRA 2WTNA 4ISOA 4DA7A 1EVJA 3BKWA 1UQUA 1BDIA 3AX6A 4Q63A 1QRXA 3TQIA 4FVDA 2ZANA