5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE PROTEASE NS3
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
2A0QB 2ZPRA 3GICB 1C2JA 1A3EH 3EPLA 2IEYA 4Y0AA 2ZAMA 2AD1A 2BVXH 2F3CE 3DL0A 2ZFRH 2Q21A 2JETB 4TL6A 3SHWA 2ERYA 4D6PA 1W36D 4DG4A 3NBFA 4G5RA 3DT0H 3KQHA 2Z6BD 2Y6TA 4RCZA 1KIMA 4JVNA 1O5EH 3FKQA 2LNCA 4RKJB 2FLRH 2JJ2D 3AF4A 5DYGA 2ZUDA 1O38A 3IPXA 4KP0A 2PT5A 3EC2A 2BOVA 2ZETA 4FUIA 3H2YA 2G6BA 1AUTC 1XX9A 1PPZA 2ZDVH 4QGGA 2FTMA 3AKYA 1HJ9A 2VLIA 3ICQB 2ZP0H 1VKJA 1F0SA 1R8SA 4ZH8A 1OWDA 4ESTE 5FBRB 4LSGA 1R2QA 1V43A 4PROA 1SHZA 1TEVA 3KXLA 5JEEA 2W0SA 1G41A 1P2TA 1T0JB 3FZZA 1DAHA 1BT7A 1IY2A 5C4MA 1OXGA 3EIHA 5AUOB 2QMHA 1HUQA 3TH3H 1P2MA 1XUKA 1QURH 2HV8A 5HR5A 3VMFA 1II8A 4RD4A 4X6PA 1D9XA 4IN2A 4TY6A 3P70B 1RC8A 2A7HA 4JZEH 1U94A 1S1MA 4IDQA 3THOA 3T06B 1P9NA 1AGRA 4UXHA 3RXEA 5EZ6B 1ZCAA 3THWB 1T3LA 2G8TA 3KF2A 3HK3B 1JEDA 2Z7FE 1JI0A 2KAIB 1LKBA 4US2R 1R4AA 3VFDA 4XJXA 1UHBB 5C2ZA 5FX5A 1FPCH 2IHBA 3SJZA 4G5GA 1VCIA 1BMNH 3GJXC 5FL7A 2O8WA 2THFB 3RXQA 3RXBA 5DI9A 3KL4A 4Q4LA 2WZQA 1C2MA 3EZ7A 4JL6A 4ABHA 2IW3A 1DO2A 5CE1A 1EX6A 1N0VC 1GI1A 2P8OC 5DKMA 3SV9A 4H1UA 1RD3B 3ZGXA 3S7KB 2BVRH 2VTKA 5A0BA 1O5GH 2GV7A 1JRSA 1N5JA 1DXPA 1S0QA 1KY2A 3TH5A 2RMKA 2PUXB 4GP6A 3PCRB 4CBNA 3UWJH 1ZD9A 2P6RA 1F0TA 1IQJA 3FMIA 4BASA 3H86A 4MGKR 1TMUH 1RPZA 1TRMA 1XUGA 4VGCB 1OF1A 2GCTB 3TIFA 2PBRA 1AO5A 1O2MA 4NU0A 3HATH 2R6CA 4CRWB 4UFGH 4X2VA 1LHCH 2A3RA 1EJMA 1Q1EA 2NU1E 4D76A 1TF2A 7GCHG 1BTWA 1TNJA 1AA9A 4NCIA 5L6NH 1K1MA 3U7FB 3VXFH 2RGAA 5AJVB 5FBLB 2BY7X 2F9BH 2PLFA 3BERA 9ESTA 2XRCA 3Q77A 3SN8A 2PL3A 1A5GH 3IEUA 2ZU1A 4MPUA 4I1VA 4EPVA 2DWPA 3SYKA 3SQHE 5HZKA 1XXHB 4ABGA 1TQDA 4NYIQ 3OY6U 3SU1A 3QGJA 1O3DA 2GDDA 4J2YB 3GLGE 2BY5X 4DKXA 1QHHB 3MWKA 2R3YA 3DOEA 1IXZA 4LC1A 1UAAA 1EJAA 3MMGA 3AF1A 5FTKA 1Q2WA 1SQ5A 1TNHA 5E7IA 3P92A 1S83A 4B6FA 3QIAA 4MPXA 1L1JA 2Z5FA 1R8QA 4MNWA 4DRZA 1KLIH 1D9IA 4FD2A 2J5XA 2BDHA 3BTEE 1WF3A 2VQSA 4B73A 1NMXA 1ELCA 2O0HA 1UF9A 3ZIAA 2RGGA 1M34E 3ND9A 2ZFSA 1SGNE 5FR2A 4K8OA 3BWDD 2FOBA 4KCGA 1I4TD 1DBSA 1BITA 1TOMH 3HGPA 4X6OA 3PYHA 1PPGE 4AB8A 1AK2A 4BANB 1BTUA 1F92A 1VHTA 6Q21A 2B7BA 1G8GA 1IONA 1HY3A 3FP8E 5EUMA 1AUJA 3VNUA 4PX9A 3GCOA 2W2VA 3LGYA 4B47A 1IJEA 4D8NA 5LB2A 3Q76A 8KME2 2BKUA 4KV9A 3VKHA 1B5GH 3A88A 5LDDC 2IYTA 4IXNA 2NO6A 1AFQB 4I99A 1BYIA 2WSSD 4XBDA 4Q7XA 1Y3VA 3AH8A 1GG2A 3S0NA 4LJ6A 2YWHA 2F3RA 1R6BX 3LOXA 1SVKA 1S0UA 1VG0B 1OX1A 4Q5IA 3BGWA 2GTPA 3TE6A 2FP7B 1DPFA 4UNPA 1UTKA 2BXUH 1E94E 3TIUA 4EPWA 4E06H 4IW4E 4URZR 3AEZA 2FF7A 3QUSA 1N0WA 1EPTC 5DN6D 3GY6A 2OFXA 2CL6X 5G41A 4CEHA 2W6JD 5GPIB 1GBBA 1K5GA 4OS2A 5JB9S 3WYFA 4M1YA 1C2EA 3VR4A 4B2LA 1VMAA 3T5DA 4OI1A 3GYLB 1BZXE 1Z47A 3I29A 1NY5A 1O2RA 1DWCH 5E95A 1SKYB 2K5UA 3FKSA 1P2SA 4K5ZA 4BUJA 4WMDA 1Q3TA 1ZTLA 2GD4B 1YBWA 5A8YA 2B21A 1HAVA 1OXSC 2FX4A 2XB4A 5EZ5A 2EI7A 4U5XA 3LJOA 1H8DH 1RJ9B 3SZRA 5A5GA 3VQTA 4PPGA 3I8SA 2ESTE 4BFSA 2YJTD 3A87A 5HCNA 2JLXA 3U3RA 2ZRHA 4CIDA 1EASA 3VR1A 1O3YA 1G21E 2A31A 2H57A 1Z6AA 5BRRE 3ZZ0A 4IFBA 5IHPA 4LBZA 4NZQA 3CPHA 4KSBA 4V0NA 4K3JA 3EA8A 2GAAA 2UKDA 2BBSA 4ISNA 2W6JA 1G1MA 3GP8A 1QVAA 1GBJA 2WYJA 3KQBA 1G32B 3B1XA 3U61B 1YZQA 3NHBA 4AORA 1MAXA 1O39A 4A1VA 3UTUH 3AKEA 2CF9H 4Y76A 3K8YA 3D7MA 3MMPA 4IDNA 5J47A 1EPTA 3X1ZA 4BZPA 2Y5GA 4NCHA 1SOTA 1KK1A 1QQUA 3BH6A 1EB1H 1W4RA 2ZI9A 2FDAA 5GJCA 1SGRE 4GHTA 4X0WU 1G5PA 3HPQA 1TNIA 2FMXA 1EXFA 1U0JA 2ZDMA 1Z63A 2H5DA 5FOWA 4F91B 2ZI6A 4B2CA 1P9UA 4OHXA 2MMGA 1O2NA 1Z29A 2RAPA 3AVZA 1RTLA 1QBKC 2D2EA 5FUWA 1CBWB 4ABFA 2BMJA 1GJ4H 4V0LA 2GCOA 1UDXA 1DPOA 3SOSA 3RSOA 1ZRKA 4NPHA 3IIKA 2VHCA 1CJTC 2P3UB 1K28D 3ZVRA 2Q9AA 5TJXA 2CMYA 2QAGB 1TPOA 4GL2A 2ZO3H 1HB0B 1F2UB 4PXAA 3QVVA 4DJTA 1TABE 6GCHF 5GJVC 4BFWA 3M37A 3K9HA 1E2NA 1NF3A 2SGEE 4LYAA 2FZ4A 2MSEB 4A7IB 1EK0A 3PMAB 1OWKA 4WXVA 3QF4B 3CPEA 1O33A 5GADl 3BB4A 3QENA 3E91A 3MU0A 4Z54A 3EPJA 4LYFA 4I81A 3V4RA 5FX6A 3QPVA 2VWOA 4PZYA 3PMHB 3NZIA 3RYTC 1GI6A 5P21A 1GITA 3DM9B 1XKBC 2ALVA 1E0AA 2ZFTA 3RC5A 3LXRA 1YZNA 2J7PD 1C5TA 1RIWB 1QRAA 3HKIB 1K2I1 3LW8A 2IYXA 4DGJA 1KXEA 4XOIA 1R5BA 4D82A 1A5TA 2ZI3A 3SV2H 1C5NH 3ZVMA 1Z08A 4RKEA 1ACBE 3K0AA 1GL1A 4ILEA 3P8NA 3SORA 1NS3A 2AMQA 1AE5A 4Z51A 2A5DA 2F43B 4HI0E 1UKZA 2FODA 2OHFA 4DURA 3TNTA 3RRNA 4M1KA 1CR1A 2GEDA 1DO0A 2WJVA 4TL9A 3PUYA 4P3YA 4GPTA 2AMPA 3B60A 1LF5A 4PPFA 2AGEX 3OEEA 3QBVA 3M4YA 4HSEA 3W8NA 1S0RA 2XC5A 3AVOA 2RCEA 1EQ9A 2ZTZA 3M3VA 1PQAA 3KKPA 2EC9H 5EOKA 2IXEA 3NBXX 1ZD1A 1YQTA 2ZR9A 1QL7A 2R3UA 3H4MA 1G3DA 2GAOA 2J0UB 4R9UC 1VITH 3AVWA 3MCAA 3S69A 2J7KA 1O3HA 5FCRA 1GKYA 1N6XA 3AASA 5L3QA 4IN1A 4II7A 1WA5A 3LLUA 2EWVA 4RD6A 3M1IA 1G64A 3SQXA 1JIMA 5AF9H 2XJ4A 1GL0E 2Z9IA 2UVQA 2RDLA 3MUFA 1JR3D 4THNH 1XRJA 2CNWD 1FP6A 1VYVA 1Y3WA 4UNQA 3D65E 2V7QA 4JBXA 4DXAA 1TX4B 2O8EA 2XJ9A 1ZUNB 1XEWY 3S9CA 3RAPR 2ODBA 1J9CH 1TYNA 4K46A 3A8DA 1W4AA 4X8HA 2X8AA 1PVOA 2CLCX 1OH5A 2VGCB 3HR7A 1EAUA 2EI6A 2IF2A 5CDFA 1N5LA 3L2OB 2E87A 1Q44A 4YT6H 4Q4AA 1DICA 1P9SA 5AJYA 3GJ7A 2AIPA 3A82A 6GCHG 2QT0A 3KKQA 3FFAA 3LBIA 3AAUA 2PHBA 1ZRBA 4O3UA 3W5IA 2A7CA 2VF8A 1SL3A 1TONA 3I72A 1J8AA 4IJMA 4PSVA 4TTRA 2QEQA 2WPDD 2GVZC 4US0R 1IQKA 3QKTA 1L2EA 1J14A 5GWZA 2ZRCA 3DKPA 3GY7A 3LDAA 4Q9IA 1T8TA 3IBGA 2A4RA 4MDSA 1TE0A 2GZHA 2NMVA 1XF9A 1T8OA 1TGCA 3AP1A 5LPFA 3UREA 3HPTB 5F8XA 2BDIA 2G4UA 2GP9B 1Y3XA 3I73A 4H6SB 1CE5A 4JK5A 4GOKA 1II8B 5H70A 1KI7A 2H92A 1G9IE 1HAZB 4Q00A 2R9VA 1ZMXA 1Z2CA 4DDUA 3K9LA 5ELXA 2J95A 4ZDWA 1YPKH 4Q4HA 3NXPA 4NE2A 1FPHH 5EP3A 2PEZA 4CREA 4TSFA 1JOUB 4ISIH 3Q8XB 1HAYB 4AYXA 3TK9A 2A5IA 2QRZA 4A2QA 2FA9A 3EC1A 1W14U 1CT2E 2WBLC 3ADCA 4GMDA 1OB5A 4WVFA 3RMOH 2IK8A 3TKLA 2XZLA 1TU4A 2Q3HA 4HTCH 2QA9E 5LPRA 1ZZZA 3DHWC 1QB6A 3PTNA 2Y81A 1LCYA 1LHFH 1CQQA 1A4WH 5E0JA 3TJZA 1T6NA 3TVJB 2N46A 1J99A 2O8MA 2QPOA 2ANWA 5L30H 4IW3B 1LTOA 2D8WA 1GSIA 1GBIA 1HJ8A 5J4QA 1HH4A 4Q1FA 4BZXA 2G83A 2Q6DA 4CH8B 4D25A 3OIUA 3RXDA 3UR9A 4NDZA 1S6FA 3QGNB 2FN4A 4U32A 2CMKA 5FHTA 1J17T 1P04A 2XBWA 3ZLJA 2J9NA 1W8BH 1UEJA 1X3SA 2OUKA 2QA5A 3UWIA 1G6OA 4LRWA 1DS2E 1EB2A 1T5LA 4ON9A 4PC3A 3B7GA 4JLAA 3QXHA 1OP0A 3DMDA 4O2LA 3KGPA 3RXUA 2D7DA 1AD8H 1TMTH 1W0YH 3RXOA 2CK3A 1TAGA 1GKIA 1BA8B 4H6TA 1G3EA 1XD9A 4X2XA 3LQQA 1H8EA 4TPIZ 3M3TA 2ZRJA 2OCPA 1UKYA 1NLZA 1R5OA 2PH1A 4DB2A 3OESA 5H4IB 1OXXK 1G36A 5E4FA 4Q1AA 4R2IA 5SZKB 1E69A 2BLOA 2BMGB 4HI3A 1OSNA 4CR5A 4GT1A 2DFKB 1FY1A 5T6DA 4WXPA 4NKRA 3G01A 4OS4A 3RS7A 1F60A 4B3BA 4C0JA 2FM2A 4W5JA 2REOA 1C1VH 3VR5A 2V54A 2J46A 3QPUA 1OYTH 2ZU3A 3C4JA 4A82A 1XEWX 4GCHF 3M7TA 2QBYA 4IDHA 1S9HA 1XNJA 3C15C 1GVNB 1C5ZB 4XWKA 3E6PH 1DAEA 4NFEA 2RGCA 4FI3C 2VSFA 3L8ZA 3AVYA 1SGFG 4M4SA 2VU8E 2FFQA 1KTVA 4Z1MA 1SLXB 5JEDA 2VH6A 1NKSA 5SGAE 1GHAF 1V2LT 3SHAH 3FZDA 2P65A 5IT5A 2BMEA 3IG6B 3SU6A 1OHHA 3ZVFA 1HV8A 1I2MA 5DP9A 3CWZA 3W34A 1HPGA 4AFZA 3WYAA 4EFMA 1KI2A 4YOIA 2JLYA 1GDUA 5L2ZH 5J4LA 1X8JA 2F83A 5IF9A 3EA5A 3VFEA 1CT4E 4NYJQ 2DCUA 4JL8A 2QU8A 2BBOA 2OQ5A 1ELEE 3CX7A 2G5VA 5GVRA 3V4FA 4Q1BA 1ANDA 2Z9JA 4B75A 1SQOA 5CDFE 3HU3A 3UR6A 4JLNA 1BBRE 3SR0A 1W7XH 2VBCA 4I31A 1HDTH 1W12U 3SE0A 1A5HA 1GI5A 2NZ8A 2VEDA 1J7KA 5ABWA 2WIAA 2J2UA 3PV0A 1DSUA 2GNOA 1SR5C 3PUZA 3Q00A 5TMPA 2WM9B 1GVLA 3MSXA 5JFGA 3CR7A 3TUZC 2VIVA 4Q9KA 1KSFX 3GFPA 3WMFA 2CLSA 4JZKA 2XXLA 2ZNKH 1L8QA 5IDKA 2DR3A 3GCNA 2QG6A 3T25A 1Z0KA 2R2MB 1G3CA 1XB2A 2VSXA 1Y63A 1D3QB 2XNSA 3G82C 2FOCA 1O0DH 1G3IA 1BBRH 1JR3E 2FOAA 1LFDB 3WHKA 2FNAA 2B92A 1S6HA 2WMOB 4CEHB 4FUEA 4TMZA 2BKEA 3UG7A 3GCGA 1P60A 1YCPH 1MTUA 2QAAA 1Y59T 3BXZA 1QDEA 2FSIA 4MG3A 3RHFA 5EP1A 4IOLA 1UTOA 3RXLA 1T4GA 1BBRK 3CLVA 1AQYA 3NVAA 4NIVA 2PUQH 2Z3EA 3IHWA 3QOFA 2Y5HA 1TALA 1KI6B 1J90A 3EAJA 4BAHB 5FPTA 1DY9A 4XBCA 3AP3A 421PA 5FTJA 1O2JA 5KNCA 2OXSA 1WQ1R 1P2UA 3ELAH 2VH5R 3NDBB 1HAPH 2N42A 2PX3A 4DEYA 4G5QA 4DSOA 2E1RA 2OCBA 2BX3A 1XEXA 3OX7U 2GZ9A 3T61A 1YZUA 3SJ8A 1VHLA 3EYDA 4DJZB 1JBUH 1P0SH 3VKWA 5TY0A 1T9HA 2BM0A 3N70A 1EFUA 2ZI7A 3GDUA 4C0QC 4DLZA 1SGWA 2DWQA 4GCHG 1M8PA 4BE7B 2C9CA 4JYUH 3MU8A 3PEUA 1P2NA 1V3XA 2QL6A 1WCZA 1ZOMA 4BLTA 1V2QT 3V9PA 1EPTB 2GKVE 5CYPA 4BLSA 3TGJE 1RS0A 1E1QA 5TXGA 4M8NE 4HLDA 1XZPA 1GJCB 1N3BA 1BS1A 4M9ZA 1MKWK 3E1XB 3TMKA 3GDVA 2GETA 4TTPA 4U00A 3BV9B 3CS7A 3CF6R 2YC4C 4BFXA 4BFVA 2OTVA 1O2GH 2J4IA 3VNVA 1YR9A 1M1YE 1O3PB 1OP2A 1QHYA 3L0OA 2VP4A 2EFCB 1AZTA 1NZQH 4IVPA 1F5LA 3SEAA 3KKMA 2ZFFH 8GCHG 4NZYA 2GCOB 2QROA 4DDVA 1PYTD 1H8HD 3W94A 4PZZA 1Z2AA 3BFVA 4CDGA 3LGWA 2BDCA 3NWUA 2BC9A 2WAYA 4DLWA 2OC0A 3BS4A 3GEIA 4K8YA 2OC7A 3GLIB 1ZAKA 1G30B 1IHTH 4HUQB 2SGDE 4L4UA 2Q9CA 3LJJA 3A83A 4TQ9A 3QE0A 1RJXB 2PR3A 3LX5A 3IKJA 3A58B 2ZJZA 1T31A 2C9OA 1LPZB 1WTGH 2GBLC 4R2HA 1EWRA 4IC5A 4QM6A 2P5TB 4ZKOU 1JMOH 1P2OA 5J4VA 5L3VA 3PFIA 1K5DA 1UK4A 5L8VA 3PMJA 1TPPA 2ZQ1A 4L16A 4NA7A 4JYBA 2VP2A 5H8WA 2EFDB 1YRAA 2QENA 2ASUB 4DCTA 3PEYA 1VGCC 2ZJOA 3REGA 4PC7A 1BH2A 2P59A 5AJWA 3IQXA 2V3OH 4LZ1H 3OHMA 4U02A 1PJPA 3VKGA 1E38B 1RKBA 4ERNA 1H8HA 1P2IA 4YESB 4CRFA 5PTPA 2FZZA 3JVVA 3KJGA 1ABJH 1LVGA 4JCNA 2HUPA 2GXAA 4BXSA 1KI1A 3FHTA 1H65A 1OWIA 2IYQA 3KN2A 5LB4A 2ILNA 3Q3JB 3K0AB 4L8GA 4GOJA 1Z1IA 1SGIB 3GCTF 2J0QA 3P1JA 3HU1A 4EPXA 1SQTA 2GMTC 4M2LA 1SGFA 1EZSC 1K22H 1LS1A 3TR5A 4MKGA 2WWYA 1UCYK 2B8TA 3TH4H 3ZYDA 2G0NA 1LMWB 2CL0X 3KJIA 3TJVA 2D2FA 1S82A 4YMVA 3U98H 1GCTC 1CTQA 1WMSA 1BMFD 3TQCA 4X8MA 2Y80A 4IOJA 4EPYA 4IS5A 2GBLA 3LGUA 1F5KU 4M21A 1AS3A 2ZYVX 1MH0A 2OG2A 1XMNB 1OKKD 1FNIA 3S9AA 1I2DA 2Z0MA 4QRHA 1GJ8B 1FPMA 2Z43A 4MUBA 4OYHA 1TTTA 2W6IA 2OM2A 5EXLA 1W1WA 3ENSB 1L1NA 1L2TA 2IYRA 4CEJA 1YPMH 1AKYA 3MD0A 1A2BA 4PAOA 3WNCA 3A36A 5FBIA 1ZU5A 1DM4B 4HAVA 1C1UH 5HXFA 3SGAE 3NG1A 5L3QB 2CL7X 1VG8A 3OTJE 2FPZA 2BX4A 3MNXA 5KPDA 2FLBH 1GZSA 3QN7A 3VGCC 2OV2A 4AG1A 1ONBA 4GAWA 4B34A 2OZEA 3VR3A 4W5WA 4D80A 4JBWA 3RMNH 4D0LB 2OD3B 1Z8RA 5DP5A 1JBKA 1KXDA 4K1TA 1FAKH 2BV3A 1P75A 1E2PA 2SFAA 1JEEA 2O8EB 2ZDKA 5DI3A 4ESHA 221PA 3B6EA 2BHGA 1KK0A 4A6XA 2OCVB 1ZMJA 1BQYA 4FMCF 3K70B 1AS2A 1VDZA 2QXHA 4FXPA 1LKAA 5F2EA 5FPYA 1K1IA 4X8SH 1Z8FA 3L33A 3TGKE 1ZNXA 1GBEA 2PX0A 4BFZA 2VSOA 4NIXA 4JZIA 3ODFA 2A2QH 4BEJA 3PB1E 3B82A 3SU5A 2B7DH 4X1NU 3QO6A 2P6UA 3OEHD 4G0NA 5ESTE 1TPZA 3TAUA 5BW8A 5C20A 3WXMA 1O34A 1N6RA 3TLOA 1GJ6A 2C77A 4X1PU 3Q72A 5L3SA 2HVXA 1GNRA 1GRNA 1NLFA 5ETXA 3SNAA 1VTKA 1C1MA 2G51A 2B5TB 2ZGHA 1HFDA 1VZQH 1BHXF 2ATVA 1SLUB 4ZDIA 3ATLA 2A5YB 2JA1A 2VH0A 4C3ZA 4I8JA 1DE0A 3K0EA 5FTMA 3BF6H 3OSYA 3NBYC 4JSYA 1O2ZA 3I4LA 2ZKSA 1Y8TA 2NWNA 4AKIA 1UO6A 1COWA 2G81E 4H1VA 2GDJA 4Q4HB 1MQ5A 1ZM2A 5G40A 2QTVB 4JMPA 3K1JA 1X86B 1R0YA 4Y7AA 2JDIA 1GL9B 1JPNA 2O9QA 4BAKB 2ZGBH 3KB1A 1XUIA 3P8OA 1ETSH 1PZNA 5KDOA 3LNCA 3GCTG 1YF4A 4LHZA 1V6DA 3K9GA 1BRCE 5CMXH 4PHTA 4A8JA 4HB0A 3ZZ4A 1XTJA 3VHXA 4PSAA 1IQPA 1L4UA 3LIWA 3R9IA 1O30A 1VYTA 4K1SA 3LBHA 8OHMA 2C9YA 4DIIH 2O8BB 4A5TS 1ESAA 1G18A 3CF0A 5C1YA 2LKDA 3ZVBA 2QMUA 3ZV8A 4INLA 1B0EA 4TYYA 3OIWA 3U7EB 4M0LA 2FDCA 1P09A 1II0A 1MR3F 4HDOB 2OBMA 3SNDA 1XP8A 2PKSC 1W5TA 4FUGA 1NBMA 2F9MA 3UG6A 4F4JA 2V6IA 4ZMAH 4U30A 4DT1A 3ZZ8A 2GZ7A 3TPIZ 2VP5A 3LLMA 1JWTA 1JJVA 3EIQA 1ZJ6A 3BIFA 4DLYA 3EG5A 3ZS9A 4Q9HA 4XWOA 1DANH 2CE2X 3A8CA 1YZGA 1C5MD 1NVVR 5FBVB 3P6ZB 2ANBA 5CLLA 3GOVB 1WQSA 4UXIA 1EAWA 1DAMA 5EXSA 2IT1A 1E4VA 2TMKA 2Z83A 4XVRA 4OHWA 4F4OC 2NOAA 4ZI2A 1TU3A 3F9HA 1B0UA 4Q80A 3GYMA 2ZCKP 5JWRA 5CB6A 4FWIB 5EXXA 3RRMA 5FBQB 5FXLA 1E2EA 1IAQA 4L9SA 2VL7A 4PHHA 1L0ZA 2LWIA 2YWFA 4BLRA 2D7CA 1KYNA 4P32A 3M5NA 1UVSH 3Q7PA 2C96A 5DO9A 4Q7YA 4YM9A 2F9VA 2R6GA 4MKFA 4P33A 5F6MA 4TWWA 4LCBA 1EP5A 3PENA 1CR4A 4QGAA 5FPSA 3GLFA 2ZRLA 4V0OA 3T1VA 3SHFA 4KVAA 1P12E 1AN1E 4WY3A 1O2QA 5EGMA 2QBYB 1JRTA 2B8OH 2XITA 1MO4A 4ZKDA 1AZZA 4GFDA 1H9IE 4X8VH 1PLJA 2D1JA 5E2OA 3NUMA 721PA 4ZIRB 4D0GA 1D6WA 1KJYA 2D4HA 3BTTE 2ZAOA 2XWAA 2JJ1A 4YXWA 4CZ2A 3CM0A 1FONA 1V2JT 3EGKH 2ULLA 4D26A 2ZCHP 3UK6A 3QLPH 5EXNA 4YLQH 3KUDA 4LYHA 2CCKA 1V2PT 4OBEA 1BO6A 5TDHA 1K9OE 3FYHA 3A1SA 5IDVA 2C8VA 2ZSDA 2FXRA 2A32A 4FUJA 3THXA 3DFJA 1P02A 2JEOA 3MNBA 3BTWE 4GOXA 2G1JA 2C93B 2WPIS 3TU7H 3SZNA 3V3MA 1KI4A 3VHLB 2XBXA 1WYKA 4IMZA 3NH6A 1QVRA 4I1SA 2WHXA 1W0KA 2N1BA 3LT3A 4Q1EA 4J1YA 2P3TB 5E0HA 3F9EA 2UWLA 4FINA 4MRPA 2XGJA 1SLWB 5IYTA 3TH2H 1KO7A 3ASYA 2I6SA 3LONA 4EQ6A 1ZUHA 2NU0E 2HXYA 2ZUBA 3U4QA 2FPKA 3BSQA 3E90B 4Q66C 3JZMA 1E9DA 4UD9H 1QCPA 4Q03A 5FOUA 3GEHA 1AKEA 1HQCA 2BM1A 3ETLA 4KTSA 3SS8A 1TQ0B 5F98A 4CRBA 1I4LD 4DVAU 1NVUQ 3R20A 4BGDA 3TK5A 3A1TA 3LXXA 2QTFA 5HE9A 2PCJA 1PUJA 2ZE7A 3NTUA 1MBMA 5DP3A 4YT7H 1VJAU 1MKYA 1ZMNA 1MUEB 1TUIA 1XKAC 4BFTA 4HZIA 3V12A 4KHZA 3GLHA 4Y10E 5G53C 1OLOA 2CHGA 1GILA 2YOFA 1O2SA 5D3MA 1NESE 3TLXA 1DWDH 4Q7LA 2WJIA 1NSFA 1ZPZA 1HAXB 3QPWA 3ITIA 1LDTT 3KQKA 3P26A 3OZXA 5EPYA 1PQ7A 1NFXA 521PA 3DKVA 1QJ1B 3UKDA 4LWZA 1KO1A 1WXQA 1TIOA 1U6QA 3UWKA 3SJ9A 2ODWA 3A7YA 1XCPA 4AKHA 3L0SA 4D2IA 1KGDA 4EAQA 3SJIA 2IX3A 4I32A 2MSDB 1VR1H 1SXJD 3E16B 1MCTA 5C46F 2OINA 1XEXB 2VF7A 4TMWA 3E70C 3QSYA 4Y11E 1J70A 3SNBA 4M1SA 4OL0A 1O3OA 3B1WA 2LCFA 4M9SA 1KDOA 3ND8A 4OS7A 4HLCA 3KQNA 1VPLA 2UUKB 3U1JB 4EPTA 4I1UA 2XYAA 2FWWA 1TQ2A 1A0JA 4LYJA 3LGTA 2B0FA 5F03A 2BLQA 5KHOC 4D9QA 5GJ4B 5FBEA 3D31A 2IWHA 2ZI2H 3E0PB 3UUZA 4ZKEA 1Z6GA 2BQ6B 3PUXA 1T8LA 2WV5A 1GMHF 1EXMA 3F3YA 2AKYA 3SDZA 1SZPA 1Z0JA 4MYHA 3NKKA 1RTFB 3FMOB 1E2FA 3AGQA 1S9DA 3R3GB 5DIFA 1CGJE 2JH6D 5JZVA 5CIWA 3I3SR 4CR9A 2PKAA 4Q1CA 2ZU6A 3LWNA 2JLUA 3TW4A 1FIWA 1NTPA 1P3EA 2DFTA 3ADKA 2XBVA 2HCBA 3AV0B 3Q9LA 2WV4A 3BTME 1ZIOA 4TQAA 1SGYE 4KODA 2ZYUX 3PQCA 4A4DA 1TADA 3EIEA 4WZAE 2IOTA 5TVKA 2GV6A 4KI0A 1VYUA 3RS5A 4F93B 1S1CA 4F4IA 4D4MA 2HNTE 1A7SA 3U69H 1G7SA 2WWXA 2ZEBA 5K8TA 1IN5A 4L9WA 4NA9H 4BZQA 5UKDA 3OYPA 3T5GA 3OTPA 1QFKH 1GBAA 4NHOA 1PJRA 4NWLA 1HCGA 2BY6X 2AEIH 4O3MA 4AYVB 1AN0A 4EDHA 4XH9B 1VIAA 3A86A 1FLEE 1GWAA 1QA0A 4KTUA 3SYLA 1FI8A 1YP9A 3TJNA 1Z6XA 2W2XA 1R10A 1E1RD 1UPTA 1P10A 1WTHD 2AFIE 2B9LA 2GJKA 1NVXQ 2SNWA 4N0EA 4TYNA 4QFMA 4KTCA 1BUIA 3OY5U 4X8LA 1MTSA 1CRQA 1DUEA 3TSOA 2JGNA 1IQIA 2QSZA 3RXSA 5E8EH 2FE4A 4M1TA 1Z0DA 1O3BA 2ZHQH 4LBYA 1XVMA 2QP4A 5B6OA 1G3RA 4JLOA 3F9FA 2GGVB 1UFQA 2WYGA 3HJNA 3P8GA 1TQ7B 1L4ZA 5DP4A 5BPEA 1QHGA 3H1TA 2A7JA 3TITA 2RA3A 3WRXC 3AF0A 2F3TA 3PV5A 1C5QA 3B85A 4H9GA 4N1AA 2G52A 2W3KA 2GILA 4X2WA 2F4LA 1KO5A 2IN2A 1D3TB 3U60B 4HB4A 3DO6A 1C4Y2 3GY8A 4K69A 1O32A 1C2DA 4ISOA 3RDPA 1XTSA 3SOPA 1A0HB 1YR7A 4YONB 1KAGA 5JWHA 2V1XA 4PAMA 4H4FA 5D3QA 1O2WA 1OV4A 2BDBA 5E2PA 1ZIPA 5E7MA 2E9SA 2F6RA 2SGFE 4CEJB 2F1JA 3UIRA 4JLVA 2H7VA 3FDIA 1GMHG 1CJUC 4AGKA 2XAUA 2C5LA 4I7YH 1O3CA 1M2OB 1KHTA 3QZQA 1H8IH 3VAAA 1NRNH 1VGCB 3NDPA 1F2TA 1SGCA 5KO2A 1KKLA 2IS6A 1GI0A 3GY4A 4EJSB 1YZLA 2DFNA 4RN6A 1PV4A 1TGBA 5CJPA 3S1AA 1VITF 2JIZD 4B6EA 5JS7A 1CIPA 1QA7A 2DHRA 2FPMA 3BTDE 3QEOA 2ZR0A 1W7GH 2YWGA 1QHSA 4HAZA 4WOPA 5DI3B 3DOFA 3LBNA 4LV8B 4GRAA 1D6RA 4XTCS 1KMQA 1G8FA 1DG1G 1C5VA 1UTLM 2C8ZB 4PPQA 4ISLA 4FCTA 1K1JA 4QM7A 1NFUA 4GLYA 2GMTB 1AU8A 1CS4C 3L0IB 1R7RA 1K6MA 1VIYA 4NZLA 3STIA 4RZUA 2GCPA 4HDQB 1R0WA 4QBGB 3ZZTA 4I1OA 1U99A 4NSYA 5A0FA 1THPB 1Q1QA 4BNRA 1CA0B 1SVSA 1OE0A 1SB1H 7ESTE 5JRJA 4UNNA 3U3KA 1SHHB 1CVWH 3BK7A 1NJGA 3QI2A 3OAAA 2Q0HA 2GEVA 3X1YA 1LW7A 1O2XA 4URWR 4NGAH 5L3SB 1OYQA 1T5IA 1O3KA 4ABIA 3UXMA 2XXAA 1E2DA 1SXJE 1HYQA 4WW0A 2Y7ZA 4QJ5A 4HZUA 2IS1A 2ZGCA 5JI2E 4EFLA 4AN7A 3BTKE 1TF5A 4UXJA 1O2TA 3VGCB 4A1XA 3PXGA 5FR1A 4A92A 5GXPA 4IBLH 4IDPA 3MU5A 5IRCD 3Q5DA 3BB1A 2I6QA 1YR6A 4RZ2A 4AYTA 2UZIR 3BC1A 1CBUA 3ZYEA 1E2LA 3MO6A 2STBE 2IA5A 4GHQA 1OJLA 1AB9C 1G8YA 3MFYA 4HATA 1KSHA 1IAUA 2V35A 2UUJB 1QNJA 3U3MA 4JSTA 3TRFA 1JJ7A 4A8JB 2QY0B 2TIOA 1BYUA 2IWRA 3KTAA 1CHGA 1U81A 5KTYA 3FB4A 7LPRA 1DT2A 1NN5A 4WXIA 1K1LA 3WP0A 1D4PB 2CCGA 3TSWA 1W4CA 1XMIA 5H1YA 1BMMH 2HLCA 2UUYA 1OW3B 3PUWA 4HZHA 1O35A 3LKWA 4YQFA 2R2AA 2KJQA 2CV3A 4URXR 1BB0B 4D0NA 1OPHB 1V2MT 4NBSA 4DT1B 2KBFA 4DVGA 4YC7A 2ZHFH 2UWPA 1KDQB 2H1UA 4B3FX 3KX2A 2VNTA 1QL8A 2A5FA 4TYDA 2PJRA 2QORA 1AY6H 4WH8A 4KFSA 4D4JA 1W36C 2Z3CA 1DAKA 2FSFA 3TK1A 2NPFA 3U6KA 1KMHA 4Z8XA 4FXGH 4BECA 3CNLA 2AS9A 5LH8A 2F9OA 4YO9A 4Q4JB 1VITG 2ONJA 1LS6A 2KWIA 1EWQA 2CVHA 2IC5A 2W7UA 1O2PA 1HBTH 1IY1A 1FFHA 3ADDA 1MBQA 2BM2A 4DLUA 4AIIA 2JKHA 3ZZ6A 2BZ6H 2PV9B 3QKRA 3SU4A 5BYKA 1MO3A 2V1UA 4IC6A 3X1DA 2QE7D 1XZQA 5KDLA 3LH3A 1NY22 1R0ZA 3OIVA 4WIAA 1NG9A 3MG9A 1W2GA 1DLKB 1IQFA 3EWSA 4NL4H 2O8CB 2JLWA 1GBKA 3LH5A 1DAIA 1Z1JA 4LDJA 1NRPH 2YC2C 1WUNH 3N2EA 1P62B 2QT1A 3IPYA 2H2ZA 1DX5M 1QB9A 4BRUA 2IPHA 3GLFB 1ARCA 4ZCIA 2AIQA 3HYTA 1GBTA 1IY0A 4V0KA 1OFTA 1E9AA 4YLGA 3WNBA 1A1VA 1N6LA 1CJMA 4YOGA 2ZJ8A 4LJ4A 2A5JA 1EFRD 1E35B 2PKSB 1RGQA 2OT3B 4Y8XA 2YOHA 1AVWA 2NU2E 2RKOA 1CO7E 5SZJA 2GVFA 3QKUA 5HM9A 1C2GA 5BQ5A 3MNCA 6CHAC 1QHRB 4PZLA 2QSYA 1MKXK 3A8AA 5JS8A 4YMUA 3THXB 4FU7A 3W6OA 1GTVA 3MTYA 1E9EA 5FTNA 1BCUH 2W00A 4DWJA 4KELA 1P3CA 2GX4A 2OP9A 2JJ2A 3T1QA 3NWJA 2VRWA 2ZSBA 1Z6TA 2WJJA 3NHAA 4K2YA 1UVTH 4RVCA 1FIZA 4EQ6B 3U4QB 4Q01A 5AHGH 1E9BA 1XMJA 4RD3A 1BMLA 1NMYA 4RD1A 3PMBB 4AYYB 4HAYA 1IXRC 2F7SA 2TGTA 3SW2B 3DHKH 3BORA 2XNDD 1OIXA 2EYQA 2WOOA 2ZDLA 2GXSA 5EJEA 1U2RA 1S5SA 1EUFA 3AVTA 5K8IA 1GVKB 1UVUH 1WRBA 1MD7A 1DADA 2CLDX 3ZS8A 1UTJA 3BJIC 4NYIR 1BKDR 2W7SA 5F9FA 3Q3YA 3ZDQA 2JH0D 4PFSA 3GLHB 1C2IA 3K9XB 3ZZ5A 3B8HA 1XMSA 1NI3A 3TR0A 2FOGA 1OWHA 5J4HA 1CA8B 1EATA 1XBTA 5D3MB 3GDSA 3RXFA 1FN6A 1O2HA 4V0MA 1VCNA 1ETUA 1S85A 3W3ZB 1NL3A 1VCOA 1O3LA 2G3YA 1YZTA 4LX0A 3SFVA 4POAA 2EYUA 1O5BB 1UJ1A 4F92B 1PFXC 4GPGA 4OI2A 5CITA 2BYAX 2OBOA 3B1YA 3UNQA 1GJ5H 1YM0A 3QXCA 4MTBA 4C4PA 3HKJB 3SU0A 2ZC9H 4Y0YE 1QBNA 3RXIA 4Q7JB 3KFXA 1O31A 5BYJA 2XNDA 1XJQA 5JCZA 4V03A 1ZSKA 1Z6EA 2BD8A 3CNNA 1GDQA 4JYCA 1YPHC 4QL3A 2ZXUA 3O8DA 1QL9A 4B2IA 2G1KA 2HJGA 3BTGE 1AFEH 3KJHA 3EPKA 2QF0A 1OH8A 4C30A 2BHRA 3QKSB 1XX6A 1FQKA 2W3IA 4F4CA 1YPJH 1QQ4A 1DITH 5CM9C 1CJKC 3PLBA 4CH2B 3A4MA 4ZCMA 3C14C 1C9KA 2I1QA 2DYKA 3WNDA 1GNQA 4AKEA 4B3CA 1U8AA 1SGTA 1Y3AA 2ZU0C 3SBEA 1LY1A 1S84A 4JBYA 1N0UA 5CB8A 3AP2A 3QK1A 3RMLH 3W8RA 4O2RA 4AFQA 3A4LA 5HM2A 3IUYA 4PC1A 4TZ6A 2ZFPH 1G2MA 2C8WB 1FNMA 2PKAB 3RXRA 1E79D 4C0BA 1O3JA 1E2GA 2O8LA 3LD9A 3RM0H 5CYOA 2O52A 2RH5A 1N6IA 3CONA 2ORIA 3T15A 5FI0B 1TX6A 5JBQA 4IMQA 1W4BA 2VHUA 1WAYB 1OS8A 4LV5B 1Z0IA 2ZM5A 3LVQE 4Y0VA 621PA 2GJAA 3WBJA 5HMAA 2V55B 4G5SA 2FS8A 3TNSA 5J40A 4LHWA 4WAUA 1UDWA 1TB6H 3RMMH 2A78A 2NZJA 4D9RA 5LPEA 1P06A 3CF2A 1UBFA 3DZDA 4OQNA 5AJZA 1MZDA 2WWHA 4B48A 4IRUB 4AG5A 1TAWA 5DP8A 2C95A 2BD2A 2D74A 2O0JA 3GEEA 4MRNA 2QMOA 2WWIA 3A80A 4URUR 2WPHS 5J5CA 1GJAB 4TL8A 1GBHA 1KO4A 1J16A 2AN9A 2RA0A 4URYR 1E2QA 1PPFE 5HTKA 4X1QU 4NP6A 3EASA 3LGIA 4GZLA 3A7XA 4XD7D 1LPGB 4Y8ZA 4LC0A 2ZREA 5DK1A 5DPAA 3M0EA 4PQYA 4KBFA 3U7HB 4LUCA 5H68A 2F55A 4FMCB 3RXAA 2ZI5A 2ZWLH 3ZZ3A 3BB3A 3GJ3A 4MGZR 1VJ9U 1WOFA 4RD2A 5JSZA 5LD2C 3ICEA 2IJOB 2FOFA 4JL5A 3TGIE 4AURA 3O8CA 3BG8A 2AHOA 1NN0A 2WSSA 4TMVA 2LPRA 3X1XA 2GXQA 3TQFA 4HAWA 3ATKA 5AFYH 4QBFA 1P3JA 1KJWA 3KB2A 1AMHA 3RRYA 1VCQA 1G4UR 1K8RA 5KUTA 1W2KH 1QJ6B 2GZAA 1AFQC 1KY3A 2EQBA 4Q2KA 3UANA 1ARBA 1ZTJA 2F9LA 3FGNA 3TJUA 5CM8B 3CRMA 4BAMB 1BHXB 3GMTA 2P2LA 3RXJA 5DN6A 3SFZA 1FTNA 3QDZB 2ZS7A 1EGAA 3P32A 4XD7A 2CHAC 1UBGA 1I4DD 1NRRH 3TW8B 1WXRA 1MRNA 2ZE8A 2R44A 4MNYA 3DMNA 3KIDU 1OSSA 1XUJA 4V0ME 1PPBH 3ZZAA 5JJIA 5M04A 3BD9A 1H9LB 3HPRA 1DLEA 1P2KA 4IGDA 2GXUA 2OFOA 4C0KA 3VX4A 1C1SA 2OC8A 3RC6A 4Y71A 5B6LA 2JASA 4B3GA 3KXIA 2R0KA 1SG8B 3V7TA 5B57C 1LVMA 1C5OH 1F2TB 4IXMA 2QI9C 4DUGD 1E2IA 4KFUA 1EFCA 1HV7A 2ZRBA 4AFSA 2CHQA 4X6MA 1C2KA 4IVQA 2H5EA 1PQ5A 3GJ0A 1TBZH 1FQ3A 2PGBB 3S1AB 4A0FA 5DJ7A 5HKKD 2WKRA 4Q9LA 2WIBA 5AWFC 1ZM9A 1SLVB 4URVR 5HCIA 4X8TH 1D2NA 4FN5A 1ZRHA 3A84A 3E8LA 2BQWB 1P11E 4CEIA 3U6BA 1CXZA 1KKMA 1Z07A 2D62A 4X1SU 2ZTYA 2REBA 1Q22A 3V00A 1TQ4A 2HJVA 2W2TA 1XJCA 3UY9A 4I8HA 2FFHA 3U1IB 9LPRA 3AVXA 4TWYA 3AKDA 4Q9JA 2ZJ5A 2IL1A 1P2QA 3TAHA 1U0LA 1UTNA 2X1VA 5JPMH 1QJ7B 1GM5A 4WZ6A 4KJZA 1V2WT 1F6BA 1N6YA 2YNAA 2X2EA 3S7HB 5LBIA 3HWSA 2SGQE 1XXFA 5FAHA 4QC2A 3C5CA 1QHXA 4DUGA 1LVBA 3BFXA 1HT1E 1TNLA 2QAJA 5FPKA 1HRTH 3ZZ7A 1HYLA 2BD7A 2GF0A 2FEOA 3AF3A 5AFZH 4D4KA 2H9HA 1JAIA 3BIUH 4FMBB 3RM2H 1ELFA 2A4OA 3UOPA 4DZZA 4WVPE 1IM2A 2RGXA 2DB3A 2XXAB 1INCA 1TRYA 2QXGA 4DCSA 2OK5A 1AWHB 4HZUB 5DYIA 3NK8A 4PANA 4RD0A 5SZHB 2RGBA 4UFEH 4B2AA 1XVOA 4KITB 1S81A 2K1QA 3HYRA 3OU0A 1QG2A 3WYGA 2ZDAH 1TA2A 1F0UA 1YPHE 4GNKA 4Q19A 1AE8H 5EXMA 2BMFA 4TT3D 4C2TA 1WBGB 3UATA 1MD8A 1P61B 3B23B 1ANKA 2A30A 3MH7A 4LJAA 1KI9A 5GJWC 1OWEA 4PQRA 2FOEA 1GNPA 3KTAB 1HNEE 1GRQA 3MWLA 1OWJA 4AFUA 4S2EA 4CF7A 4P31A 2GF9A 2PLXA 1DVAH 4M53A 3ATMA 1QGFA 3A1WA 4E7NA 3JZ2B 3U44A 2J0VA 3KL6A 4JZDH 4ESVA 1KSJA 2VIDA 1KYIA 4HAXA 1N1LA 4Q7ZA 2XTZA 3A89A 4GBMA 2R9PA 2QV1A 1J8MF 3T5FH 1FV9A 5J4YA 2CEAA 3AVPA 3ZYCA 1YVDA 4Q7KA 2EI8A 2J7PA 2ATXA 3GLGB 3R9XA 1OB2A 1Q57A 1ZINA 1BDAA 2BD3A 2ZG0H 5DGXA 2H5CA 5FL3A 1KMHB 5DSZA 5FOVA 4TLBA 3CRRA 2XOKD 4ACBA 1RZ3A 2ZRGA 1GBMA 4B1TA 1XCMA 2IS2A 2FFBA 2ODQA 4AKGA 3WP1B 1BOFA 2W58A 2OLKA 4DOQA 1MH1A 2ZR7A 4CRDA 1G16A 4EIWA 3FFGA 5CHAB 3Q85A 4OK3A 3B5JA 2DUCA 4MGYR 3QKRB 5C1XA 1S96A 2FFAA 3H09A 1AB9B 2GCHF 3A7ZA 4YMSA 2XCNA 1O36A 1SQAA 2HCJB 1FTSA 3DUXH 4BXWA 2QXJA 1ZYOA 1GIAA 4OS6A 3SJOA 4AG6A 3L8YA 4NA8A 3BEFB 1KTTB 1ZSJA 4CBOA 1ZPBA 1QIXB 1ZMLA 4NYMQ 1R0XA 3RXPA 3ZZBA 1AHTH 1NKTA 4ZO4A 5B2ZA 1FJSA 1NY6A 3SJCA 3QWCH 1GG6C 2VIWA 3W5JA 1E9RA 2NO9A 2XOKA 1G2LA 3UFAA 2V6NA 2ZYTX 2C04A 2REXB 3HR8A 4UNRA 1A7JA 2BTCE 3GCHB 1C5UA 2OXRA 1VCWA 5CIQA 3C7KA 1FMGA 1W36B 1JR3A 1ELTA 3LDXH 4NIYA 1ZM4A 3QVUA 2CNWA 2WPKS 4D7GA 1BTPA 1RRFA 2QMEA 4GSYA 2IS4A 3SU2A 3U8OH 5KNBA 1N6KA 2Q3FA 4MQBA 4QOSA 2GJSA 2CCJA 2ZRAA 1P03A 2WKPA 1QF9A 2WPMS 3M7UA 2WPJS 4MNXA 3DFLA 2IJD1 3TJOA 4LBWA 1O5FH 3ECCA 2P6NA 2CVFA 2HXSA 1Z8JB 3AM1A 3FOZA 1HLTH 3QEJA 1Z7KA 1ZGIA 4CGZA 2ZU4A 4PR0A 4RZXA 2WUCA 3PVSA 1DE7H 3E0NB 2QM8A 2VHTA 2CDNA 3AB3A 1AQ7A 3BAFA 2WPDA 1TWXB 2A5KA 2R62A 1OOKB 4JS0A 1D2MA 5KDDA 4MNVA 1W47A 3I78A 2BOHB 5J4SA 2G4TA 5C1BA 1HQYE 2HPPH 1YC0A 1C1PA 4KU4A 3BBPA 3GJ4A 1VCMA 5A8ZA 1GMCF 4IOMA 4KKDA 1GI7B 1CT0E 3RWMB 2R6FA 121PA 1MU6B 1SKYE 2DWOA 4DIHH 5GNDA 6CHAB 3K09C 2VP6A 3DDCA 2D26C 5DNYB 4NCJA 5K8UA 2JCSA 1NROH 1GI8B 2AGGX 2ZYWX 1AVXA 5EE0A 1Z8GA 3LX8A 1GHXH 4KYIB 2ZRNA 5EU8A 4Z6AH 1WBBA 2YNBA 2VVUA 3EA9A 4KBGA 1P2JA 1E98A 1P72A 1GI9B 5HPYB 7GCHF 2TGPZ 4NYJR 2FTLE 3S9BA 3FMPB 3SBKA 4WXRA 1BTXA 2ZRFA 2GCHG 4DCDA 5A4JA 3H7OA 4BPBA 3JZ1B 4A1FA 2ZEJA 2J41A 2FYRA 2V3HH 2PMKA 1Q21A 4QKQA 2P16A 1LVOA 1V2VT 2OC1A 3CZQA 2A45B 4NCNA 2M5TA 4ITRC 5JYIA 3PEVA 2XX3A 1SFIA 2ZF0H 2ANYA 2P0EA 1XUHA 5KYKA 1Q3HA 4ACAA 2ZHWH 3QX5H 2IUTA 3PR1A 4C0AC 4BTUB 1KDRA 2P8OB 5K7RA 5FL7D 4ZV4A 2YZ2A 5JHGB 1QTFA 1EX3A 2SNVA 2VHQA 3AUYA 4HLQB 3VB7A 5FOTA 2PFEA 4JLDA 4INKA 2F1HA 3T1OA 4UFFH 1G20E 1ANCA 3QXJA 1GOTA 2WJHA 1EOJA 5DH9A 1E4YA 1S4QA 2FPLA 2R2WU 1SPJA 2ZSFA 2ZVQX 1DAGA 2B7CA 3K09A 1BRBE 1XUFA 1S3GA 1ZU4A 3AKCA 5JI3E 1ZD8A 3A6PC 1A1RA 4UONA 3IIMA 3MU4A 2OXCA 4EPRA 5DO4H 1NT1A 2ANCA 5KOYA 4ZKNU 4JLJA 3MFJA 1M7BA 2ZFQH 4QT8C 2ZIAA 4DCUA 2LKCA 1OH6A 2OSBA 1D8TA 3X1WA 3LFUA 1ESMA 1BRAA 1OT3A 2ZZUH 1G5TA 4C7OA 2ZPSA 2OBQA 4YDSA 2C90B 3ZQ6A 4NSVA 3CIOA 1NPMA 1C1RA 2PSXA 3K9NA 3KQCA 1ESNA 1QHIA 4AYWA 1SVPA 1Z0AA 2H9TH 2NGRA 3RXMA 3I1FA 1YCPM 3LC5A 5A0CA 2ZECA 4WJG2 3ZVNA 1GMCG 3SQEE 5DE3A 4GMXA 1EAXA 2GDEH 4B2BA 1UVOA 4LK4A 1T4UH 3LV8A 2QZ4A 3VR6A 4A15A 1C5YB 3UMSA 3ASZA 3PWCA 3VU9A 4E09A 2GK7A 2HNTF 5JSZB 5FH9A 3KEEA 2WVJA 1RVDA 4RKFA 4U7DA 4OQFA 4RFSA 1HAVB 4QHSA 4R0IA 1K21H 2XZOA 3MYWA 3PV4A 1E6CA 4CHAC 4P4SA 3ZIAD 3KCGH 2BIFA 1QHNA 2GWHA 3PLKA 1BTHH 2QP9X 3LGVA 3ZH9B 4M22A 3D62A 2GJ8A 4BTTB 4TYPA 3SBDA 1HA3A 1RXPA 3TUIC 1SKQA 1Y3UA 1GBFA 3M3SA 3U8TH 1TFXA 1AQUA 3RC4A 4CW7A 4OHVA 2C8YB 5EQSA 4ABDA 1FMLA 4XSGA 3F9GA 2FYQA 3F1SB 4YMWA 2VP0A 3R8CA 2QNRA 3SI4H 1MKWH 1ABIH 1TF7A 1CULC 1RRCA 1A2KC 3CX8A 3RSLA 5G3ZA 3DEFA 1LVYA 5L3RA 5JDUB 2Z4RA 3EE0B 1T3HA 1G7TA 2CHVA 4OHZA 1TGNA 4MYTA 1JXPA 5E3HA 1GHAG 2PSYA 4B33A 4L15A 1LV7A 1G19A 4JKIA 4C0LA 1PYTC 2NPIA 1IOEA 1HAGE 1W5SA 3EA7A 2WUBA 1RYFA 5CK5A 4P0TA 4LJ7A 1MTWA 3FPAA 1W7AA 4ASHA 1Z06A 5LD2B 1FUJA 1N2CE 3R8FA 5JHHB 4PC2A 1C1WH 1KI8A 2ZITA 3K65B 4A2PA 2BWJA 2HWLB 4CEIB 1Z71A 2RGNC 4X8OA 3NC1C 1SVIA 1JNYA 2VHJA 2O8TA 4OQXA 2A5GA 4UNSA 1F0RA 4Z0KA 4OJKA 4O3TA 3FKSD 3AVQA 1ELVA 3SYNA 1T91A 4O03A 2O8DA 3URCA 4MDEA 4LZ4B 2G5NA 3IIJA 2AH4X 2ZSEA 1V2OT 3IWMA 3KHVA 3EZ9A 5IK2D 1DOAA 3SC3A 4GZMA 2FWRA 2CHAB 5T3HA 1O3IA 4O9VA 2NO0A 1QRZA 2XEXA 1UCYE 3MO9A 5FI1B 2ORWA 1AGJA 3CNOA 4EUNA 1LTQA 2Q6GA 4TWZA 3AVVA 2AXPA 1YR8A 1PLKA 1VG9B 5C67A 1LNZA 1XPOA 2AMDA 5T6FA 3K0SA 4TLEA 1JQJC 3BE4A 4ZXXH 4XSKU 2A9KA 4DEXA 2YHSA 2V6JA 3T34A 4HUTA 2TGDA 2W83A 2XBYA 5B58C 5EE1A 5DG6A 4JLMA 2XB2A 5F8ZA 1SGQE 1RFLA 1MTNC 1E37B 4KGAA 2WPLS 2ZPQA 4DCNA 2ALPA 4B74A 3EWAA 1ZVQA 1NRQH 4RFVA 5G3YA 4ZPXA 1UCYH 2VB0A 1CLUA 2Q3MA 2RHDA 1KI6A 3BN9A 3FP6E 3M36A 5A2MH 3QXXA 2XTTB 2NQ2C 2RGNA 1E2JA 1C1YA 4LBVA 1E32A 3C16C 5IK2A 4XBBA 4MPWA 3H5CB 2OAP1 3UQOA 1XFAA 3C1KA 1TNDA 3EAQA 3K0FA 1K1PA 3KQDA 2WOJA 4MGIR 2HF8A 1YLDA 1W44A 5C1UA 3U44B 1HURA 1V2KT 4R71A 1E2KA 3TNFA 1UTPA 3WHLA 1DS6A 4C9BA 1LHEH 1ZNWA 1EX7A 1WP9A 1JAHA 1T7CA 2OESA 4D81A 5T1VA 1GPZA 1F3OA 1N8OC 3REFA 4A6PA 3BFKA 1C4U2 2HOBA 4Y79A 2CBZA 3ODDA 5JMTA 1AS0A 1FZZA 1CGIE 1AIXH 2ZRMA 1U8YA 4KLZA 3T26A 1U90A 1P9WA 4PO1A 5C2JB 2WTUA 5EUQB 1OYWA 1IN4A 1FDPA 4BEBA 1G3BA 4UDWH 3ZJYA 1XTIA 3ZVDA 1NNEA 4AK9A 2GHIA 2BOKA 3P4YA 2A2ZA 1RW4A 1V2UT 1O3GA 4OS5A 4AOQA 4F7WA 1Z83A 4JZ1A 1ZP6A 4JT2A 4CRAA 4ZUHA 1IQGA 1BMFA 1TPAE 3VX3A 1O3FA 3CP7A 1XM1A 1A0LA 3SU3A 2WJYA 5JBTA 3B9QA 1WQVH 3SUGA 4MRSA 3I61A 1AJEA 3I5YA 3GLIA 3O8BA 4Q4AB 4HUQA 3LO5A 4I8LA 1OKKA 3H84A 1YJ5A 1ZNZA 5TV2A 3C27B 4X2YA 5TCCA 2IYLD 3E2IA 1SVOA 4MDFA 2J1LA 4P4TA 4JVMA 3NKVA 2OQUA 1W0ZU 1U8ZA 3SO3A 4YOJA 2OE2A 4LJ9A 4TPYA 3EDXB 2OBLA 3P27A 1Q1BA 4ZDJA 1DDJA 2FU5C 1XCGB 2ODNA 5HZHA 1TBRH 3I62A 1NN6A 4IOKA 1CP2A 3GY5A 1NO9H 3OEED 5G4BA 1EG7A 1ZHRA 2VINA 5EXTA 4G01B 1H9HE 2NU3E 4A2WA 2AWOA 2QCYA 2BD4A 4IVRA 4AGJA 4WA7A 2YWEA 3CKLA 1Q20A 3ATWA 3RXKA 1GJDB 1KI3A 2FEMA 1SHKA 3RDZA 3ZD7A 3QY0A 5BN4A 1OFHA 3GFOA 5BWMA 1IXSB 1W10U 2YVUA 4YMTA 4OM9A 4LHXA 3SUFA 2SHKA 2QGRA 1NRJB 1C5XB 1JQLB 1NP6A 1II9A 4FVDA 1PLLA 4DY7B 3EW9A 4LHYA 1OXUA 1RIFA 3K70C 2ZUCA 1BIOA 3P8FA 2FH5B 3RXCA 4MVNA 1CEEA 2RGEA 2WICA 4JLPA 2V7QD 3OEHA 4K1EA 4HEJA 2FI4E 4DSUA 5DGJA 4P4UA 2BD5A 4NCKA 3UQVA 2WJGA 1UMAH 3PEWA 1HIAA 2HNTC 5EQRA 3R9WA 1OXVA 1JALA 4FMDF 1IQHA 3K70D 4DT7B 4CT4B 3D6TB 2VPPA 1GG6B 2QGNA 3GJ8A 2C78A 1ZHMA 4ARZA 3OF5A 1MQ6A 3A7WA 3MJRA 4ZHAA 2RB4A 2ZJYA 2BBTA 1XMVA 2ONKA 2ODPA 4JVLA 2GT8A 1EFTA 1GJ9B 2ZU2A 1ZJDA 4R8TB 2OO7A 1WCV1 2AL7A 3RS0A 1ZPCA 1LHGH 1O87A 1GUAA 2O5VA 5FTLA 2QN5T 1HJAC 2BY9X 2Y5FA 2BY8X 2XCFA 3PUVA 3OE7D 3W9YA 3CH5A 1AZSC 2P3FH 1W2HA 3RXTA 2EW1A 3PWBA 1N5KA 1HTWA 2B8WA 2IF0A 1VECA 4UEHH 1D2EA 3U3JA 3B1ZA 1OKXA 2V3CC 1BRUP 3SGBE 1PPEE 1NM6A 2F9UA 2JLZA 4BLPA 2JH5D 1YLCA 3KUCA 1T0HB 2FIRH 1FNNA 1A3BH 1CRPA 2FO9A 3RXGA 4PPNA 5KSOA 4I8KA 1GI3A 1FAXA 3OFND 1MO5A 1JB1A 3K0CC 3DZ8A 3MO3A 1GFIA 4QGHA 3K6YA 2JLVA 5A8XA 5EE9A 4TSFD 3SJKA 4INHA 3SUEA 3VB3A 1FP7A 1O2KA 3U7GA 4KFRA 2AFHE 2OEPA 3C8UA 1IHUA 1GDDA 3BG4C 4ABJA 1CU1A 1E96A 1E9SA 1ETTH 1UM8A 5E0GA 2D2DA 4TLAA 3WMEA 1ZJKA 1E36B 4ZROA 4U01A 4MA4A 3OE7A 2DBYA 1YGCH 3CX6A 1E2MA 3NEJA 3RC3A 1X7AC 3ZV9A 1SVLA 3ESTA 4IDOA 4MQAA 1RYHA 2F91A 2Q6FA 4DLXA 4NG9H 4AZ2B 1TLDA 3MU1A 4IEIA 3FFBA 3HP1A 1IQMA 1DARA 2OCYC 4ZI3A 4MRVA 2J92A 7KMEH 2RG3A 1IQNA 4GP7A 1F5RA 1AGPA 1OH7A 1HGTH 1K1OA 3OFNA 3RS4A 2DFLA 2Y82A 3GLIE 1HE8B 1QG4A 1NN3A 1ZUIA 3CBQA 1OFIA 3NEYA 4SGBE 5I46H 3RABA 1MABA 2FJUA 3PIRA 2H9EH 2C98A 4AG2A 4OGYA 4C7OB 3K0CA 2ZHEH 2CK3D 2OLJA 4FW9A 2IXFA 1HXEH 3HU2A 3FVFB 3FVQA 4Z8YA 2OAQ1 1H8ED 4C0SA 1C5LH 3RP2A 2KBEA 4CRGA 1RFNA 2BB4A 2YKGA 4GUXA 4DHEA 1C1NA 2O8BA 1FY8E 1RRGA 1Y5UT 3ZZCA 2ZGJA 3FWYA 3G5UA 4FU9A 2TRMA 2DE9A 1O3NA 3IQWA 4M1WA 1DUAA 2ZJBA 2GVDC 3LRPA 3WRYC 4IFEA 2ZCLP 4A36A 4RSPA 3THYA 4GI7A 4A0HA 3DM5A 4DSNA 2BDTA 4TMKA 3T12A 2QRNA 4A6LA 4E05H 3B9PA 3VU9B 4E03A 3KJEA 2FESH 3KXKA 2QN6A 2J94A 4D7FA 2PW8H 4IEEA 1J15A 2G9NA 1IJFA 1P73A 2JLRA 2H1LA 1Z22A 1O3MA 2ANKH 4HFPB 2IYUA 1SXJC 1YKSA 5I25A 4Z1MD 1CSOE 4RFSB 4N3NA 3IDQA 2PTNA 5AUQA 2ZDNA 1IQLA 2F9NA 4MRRA 2IYWA 4HYYA 4DW2U 3AGPA 4ZHLU 1OHHD 5AUPB 4P4SB 3EARA 2AK3A 1DY8A 5J4KA 2EFHB 4E07A 4LOAA 4Y8YA 1KNQA 1TEXA 4M9XA 4KAXA 2W5EA 3P20A 1T8NA 4W7SA 5JLJA 2VIQA 4A1TA 4DIEA 2J34A 4DB4A 1FMJA 1LPKB 1AIPA 4D4LA 4FIDA 1Y5AT 2HF9A 3I77A 3W90A 1GRRA 2FS9A 1G4AE 2C03A 2ZI4A 1XPUA 1FUUA 3ZZ9A 3U5ZB 3K53A 1FY5A 3E3TA 3WMGA 3KQEA 2UUFB 1ZGVA 1S3SA 1GBLA 1YPLH 2XW9A 4M9QA 4OJQA 2MMCA 3NXSA 4O25A 5EW1H 3FTQA 1S8FA 2XTNA 2P95A 4ZIRA 4MKIA 1FZQA 4AX9H 3ADBA 3V0XA 4QXAA 3QJYA 3BTHE 4V02A 1C1OA 4LGMA 4B3XA 3MWYW 2WAXA 4M1MA 2NU4E 1IN8A 3QF7A 1E0KA 2D06A 5TB5A 3CENA 2J87A 2WWFA 5EG4A 1ELBA 1FOEB 1GI2A 1OYYA 4US1R 1SXJA 4K60A 1VCPA 3WBKA 3R7WA 3KQLA 1E34B 1TNGA 1WSSH 2IUSA 8GCHF 4C0HA 1P8VC 4K81B 3FHOA 2Z9LA 3O8RA 4CHAB 4KLNA 1BJVA 2ZGXH 3F6UH 1Z3IX 1Q12A 1KDPA 5BXQC 1G8HA 4X6NA 3VB5A 2O8DB 1G7RA 4MPVA 1D5CA 1X8KA 4OI4A 4QNRA 4HB3A 1D3DB 2EA3A 2A4GA 2FEQH 1NC6A 4TZ0A 2PCLA 3MWJA 3LY5A 2PZGA 3T62A 3AUXA 4DSTA 4DLRA 3KQUA 4UFDH 3SNHA 5CLQA 3TVDA 1GHZA 4JZFH 3UMFA 3W3AA 4OI0A 1H1BA 1UJ2A 3EZ6A 4KFTA 1B7XB 3PLPA 3EXAA 2ZRIA 1QRXA 1O2LA 4B2PA 3RU4D 1KXBA 5KU1A 4E5UA 1HE1C 1TUEA 3ZVAA 3VEQB 1GBDA 2PMDA 2CXXA 2NIPA 2YNMA 4DDWA 2WINI 5DP7A 5EE3A 1UADA 4MH0R 5DP6A 3CPJB 2XWBI 1GVZA 1BOQA 3A1VA 1W11U 1EP6A 2H16A 1G5RA 2KB0A 1DEKA 3CWQA 1E1QD 4LXBH 1P6XA 3SU8A 3IGFA 3MGCA 2Q1JA 3DVLA 2TBSA 1N6HA 1FX0A 1YCPK 4BWYA 2OUAA 2VWLA 3ATIA 1QRWA 4YZUA 2X2FA 2VIOA 1FN8A 1B0FA 2DE8A 1KK2A 1AKSA 5AVDA 2PT7A 3KNXA 1SHYA 4TTQA 5L2YH 1EKBB 4TL7A 5TARA 5JCPA 4EKDA 2ZRKA 2CJWA 3ZVGA 4I8GA 5JBAS 3K0FB 3CRVA 1T32A 4IHQA 2ZS9A 2BEJA 3IHLA 3NIBA 1JPJA 2ZE6A 4ZCLA 3FAOA 3L82B 2ZVPX 2ZE5A 4BRWA 3Q7QA 1E1RA 1MAYA 3M5OA 4KVGA 4Q48A 3UPEA 5EPNA 3Q3KA 4Y0ZE 1ZHPA 1N6OA 2EEKA 4QBHA 1ZW6A 2IYVA 3A85A 3DD2H 2ZIQH 1R5NA 2KE5A 2ZANA 1G3QA 1P4SA 1TA6A 1PPCE 1T8MA 2Z9GA 4B44A 3SNEA 3D3QA 1SMFE 1IQEA 3PTBA 3GFTA 3A4NA 1IOZA 4PHFA 1MTNB 4BFYA 4O0MA 4UJ5A 1E99A 1M6NA 3A81A 3MH4A 3BTQE 1AVGH 1XU4A 4DCVA 2VA8A 1OP8A 4TYQA 2BCJQ 1NIPA 2GZ8A 1UBCA 2AERH 3RWOA 1KSGA 3RRZA 4DBLC 4ABBA 1E9CA 4CT5A 2X19A 4G5OA 1GHYH 1X6VA 2F1IA 5EXPA 5AJXA 1XD8A 3RU4T 5LPNA 1XD2A 3TK6A 1P9RA 1MU8B 1O5DH 1XJ0A 3T28A 1F2SE 1SI5H 1YYY1 2ZA5A 1HT2E 3W95A 3F68H 1NIJA 1GCTB 3TVTA 2GZDA 1ZSLA 2G55A 1GBCA 1GKUB 1W13U 5DHFA 2IYSA 1EZUC 1CJVC 1X8LA 2HALA 3ZVLA 2YOLA 3A7VA 3I92A 4B71A 5DLQC 4WH6A 4PHGA 3SI7A 5JBCS 4AB9A 2DY1A 2JIZA 1N8OB 5FUYA 3R0FA 1KOFA 1V2ST 2QF3A 3DPUA 5KSPA 1CR2A 2VWNA 3KKOA 2SGAA 1YE8A 2I3BA 1US8A 1RTKA 4EJSC 3ONWA 2W6ID 3SV6A 3MH5A 1NN1A 4R98A 4F49A 1OPXA 1BJUA 2Q6TA 5AR1A 3CH4B 4JK6A 5JJLA 1UBEA 4BAQB 2EU8A 1NLYA 4PAQA 2V0BA 4F38A 1GGDC 1ANBA 2IUUA 4FCWA 3SNCA 2GESA 3IITA 4QJ3A 3AAVA 1N6PA 1EZQA 1HAIH 1Z6YA 4R7ZA 1CR0A 2BDYA 2P93A 2P67A 1IHSH 3RC8A 1TL7C 4MLFB 2B6HA 4QBIA 2GKSA 3JVUA 2Z94A 1SVMA 5FOSA 1YPEH 1KXAA 4OGXA 2Q9BA 2FX3A 4XVQA 5EW2H 3QXSA 2DPXA 3M35A 3PM3A 2BD9A 3FHCB 1YPGH 1HIAB 3RVBA 4JLKA 3W6NA 1XPRA 2EWWA 1GHVH 1TGTA 3M5MA 1CA0C 5E7JA 3PITA 4HDCA 1KLJH 1ELOA 4LK2A 4AI6A 4L5BA 4JT4A 5KPJA 4ARZB 1C4V2 1IBRA 3UWOA 4WBSA 4X8UH 1A4RA 2FG5A 1YKTA 2C8XB 3ZVCA 5C5OA 1MV5A 1P01A 1RRPA 5JECA 1KZGB 3AW0A 3ZD6A 2ASEA 4LHVA 3MLEA 1KY9A 2XTMA 2V8OA 3JZAA 3K2UA 4EJSA 1ESTA 1PQ8A 2V4ZA 2W0MA 1WV7H 3SUDA 2JAQA 3NC0C 3PJRA 1GP2A 1NVWQ 2XC0A 2HT1A 1TNKA 4ISHH 1CHOF 3SHCH 4TN1A 1LB1B 1NJFA 3BOSA 1V2RT 3RU4E 3BEIB 3OIYA 4M7GA 4ZKSU 2Y7XA 5KNDA 3NBZC 4HGCA 1COWD 4A8JC 2FZLA 2BEKA 3IO5A 5BN5A 3SQWA 1DTSA 1KXCA 1TBQH 1TX7A 1KLTA 1LQDB 3VPKA 3QNUA 2JDID 3GY3A 3NCLA 1SFQB 3HK6B 2R6AA 4G1UC 2JLSA 1C2FA 3WY9A 5AUNB 4RZ3A 5HE8A 2GJ9A 1PPHE 2OILA 4KO8A 2OBNA 4E7RG 1MKXH 4FUHA 3VXEH 4XSHA 2BZAA 3T1TA 3LPRA 4U2WA 1DWBH 4AD8A 3F0TA 3PO1C 3UPUA 1GJBB 3A7TA 4W5HA 1M7GA 1OIWA 3IEVA 1MZAA 4JJZA 4Q1DA 3W6PA 1Q0UA 3RANA 1G3UA 2A5AA 2XC4A 4LV6A 1XTKA 5ANRB 1YU9A 1GL7A 4B3DA 3T29A 2J0SA 1NBMD 4TMXA 5GDSH 1HJAB 1MRSA 5SZIA 3AW1A 4SGAE 2KI5A 1Q3XA 4XTRA 2QE7A 2PLRA 3B13B 4AY2A 1SGDE 1F5NA 2JETC 1O37A 1NFYA 3WY8A 1HEIA 2BJVA 3URDA 2NO7A 2QQEA 1Z5ZA 4XWAA 4NONA 2A4QA 1GHWH 1FXYA 1ORFA 4YDHB 1MABB 1MT0A 2RHMA 3F8TA 1IN7A 1D9ZA 1SSXA 1XEFA 4RI0A 5F3WB 3RLFA 4JKYA 4PO8A 1O5AB 5CK4A 1EFRA 2PJZA 3T35A 4BLOA 2VVCA 1CGHA 4JIMA 2RCNA 1A5IA 4KSCA 4FVBA 1N6NA 3P17H 2F9PA 1RRKA 3A8TA 3BG4B 3QUMP 5F8TA 4QHTA 1DAFA 3NH9A 1UKEA 3CZPA 2FOHA 4J0QA 4NFFA 4HB2A 1PUIA 1Y3YA 2JATA 3THYB 4HLUC 2OFWA 2J45A 2H6MA 1KDQA 2PZFA 2BJWA 2QPAA 1KDTA 4KXFB 1ZBDA 2BMDA 1GAJA 2FSGA 1JXMA 3N2IA 1L1GA 3STJA 2TPIZ 3RS2A 1FW6A 3RLWH 5JWOA 1CF4A 4S35A 3GISB 3LQRA 2NG1A 2QP3A 2JJ1D 4RJLA 2CGAA 4YXWD 2O8FA 2ANMH 4ZDKA 4QJ4A 4OK5A 1Y5BT 2AR7A 2VIPA 3QTVH 1NU7B 3L6PA 2WKQA 4N0DA 4Q4JA 1UTMA 3RXVA 5FUVA 3TSZA 1CHOG 1E0FD 1MOZA 2GTBA 4QGFA 1BTZA 3Q5EA 3LH1A 2VP9A 1A82A 2HDNB 1QY6A 2Z4SA 2EFEB 4A0RA 4M1OA 3C41J 3KDSE 2QYIA 1XWIA 2FGKA 8ESTE 2O8CA 1W0KD 1X1RA 1MTVA 1HUTH 2O0KA 2ZROA 1ID5H 2BQ7B 2BLVA 3KZ1E 4JYTA 1G7CA 1DOJA 4O97A 2AXNA 2VIIA 3QBTA 3SI3H 1OIVA 1EZXC 1S2MA 3AQ4A 1U9IC 4ABYA 1AI8H 3FMFA 4B43A 3I8XA 3A37A 2CXVA 4Q18A 3AVUA 3G0HA 1BMAA 1EESA 2R8RA 1L4YA 2QPTA 2QM7A 5FUXA 2VO1A 1THSH 4JMYA 1LO6A 3SV7A 3U8RH 4HLUA 1NVVQ 1C9PA 3GQBA 1F48A 4XE4A 2WMNB 3TUJC 1WE2A 2FGJA 4GDFA 4OS1A 2AYWA 1ZM7A 4M9FA 2CN0H 4LJ5A 5FOXA 3B8JA 4FUFA 3B2EA 3AF2A 2QXIA 3E5HA 1P05A 1NG1A 3VB6A 2WWGA 2QY9A 2ZTSA 4VGCC 2FI5E 2GCTC 4NH0A 2R0LA 1SXJB 4NTZA 3MAAC 1SGPE 2J59A 3BTFE 3R7WB 1H4WA 1C1QA 1W0JD 3RLYH 2GEUA 1GHBF 4LPKA 4A0GA 4MKHA 2ZQ2A 3EA0A 1W46A 3THWA 4DIDA 4AWXA 2TGAA 3T2NA 1O5CB 1ELDE 4WMFA 3CUEF 3M7QA 4TQUS 1Q31A 2YINC 2KAIA 1O2VA 5C3NA 3E1SA 2ZRPA 4PSKA 5EE5B 1UHBA 2WV9A 3D8BA 5EQTA 4UQOA 1HAHH 1DVRA 2C99A 6ESTA 1QB1A 4GSOA 4OKSA 2CF8H 1UK2A 1DFPA 5ESBA 3SGQE 3LA6A 1A61H 2STAE 3U2QA 5LGOA 2H18A 1EOLA 3F5FA 1NU9A 5JBBS 1Z8IB 4GVUA 2UZ3A 3C5HA 4G3XA 2IYZA 3CS0A 3U3OA 1GDNA 3EZ2A 1ZCBA 1KO8A 1E79A 1U9IA 4OQLA 2GK6A 1N5IA 1SVWA 2YV5A 2FOMB 5JJKA 4W9MC 1E0JA 4IKEA 2AK2A 1E9FA 4E22A 2HRVA 5JRZA 2I1VB 4FWTA 1YHNA 3V13A 1W0JA 5GVSA 3X2SA 1KXFA 4A9AA 2PZEA 4JYVH 2FX6A 2HLDD 2EFGA 3LAWA 1FX0B 2Z3DA 3MI4A 2WWWA 5GJBA 5C18A 4B76A 1THRH 1WDTA 1ZNYA 3EPHA 1TOCB 4PQFA 1JXOA 4FUBA 2J3EA 2HYDA 1NMZA 1AKSB 4LY6A 3P95A 5T6GA 2L0XA 4X1RU 2H8KA 1C5WB 4WWYA 3ZZUA 5C5NA 2A1DB 2MSCB 2QGZA 4FUDA 3M6AA 4HAUA 1C2LA 3A1UA 2ZHDA 4XFQA 1KNXA 2CJWB 1YRBA 2HPQH 5FFMA 1Z28A 4Y7BA 4K8BA 3HDTA 2QUZA 3P4XA 3M5LA 5HGGA 2JLQA 3QKSA 4XIGS 4Q02A 1G17A 1NBME 3GJ5A 1XXHA 2G77B 2ODYB 1XXDA 4BOHA 3TGPA 1L4DA 3BH7A 4WZBE 4ZAEA 1L7VC 3CO5A 1QHHA 1O2OA 2ZJ2A 1GJ7B 1QZXA 2HYIC 5GCHF 4EFNA 4QNMA 4FU8A 4MUAA 2X77A 3RS3A 2HLDA 3N7OA 2FOLA 1WU1A 3UMRA 4BTIB 2CJIA 1UK3A 2O8UA 2SGPE 2W26A 2CE7A 4OK6A 2YYZA 3MWIU 3H7TA 2C4FH 4DLSA 3SV8A 1GI4A 1C4OA 2I4IA 2ZSAA 3GY2A 1UVPA 2VYFA 4NWKA 1AZ8A 1XTQA 2J9RA 3ZQJA 821PA 3EZFA 2ZTXA 1UKVY 4BFUA 1GHBG 3TBKA 4FMDB 2BDAA 3B1VA 4C2UA 5HYOA 3CW2A 1P57B 1W48A 1MCVA 1NSTA 4YTAA 5EQQA 1FY3A 3RNLA 4NCYA 1FL9A 1SBWA 3GLFE 3KFVA 4LZZA 1M74A 1XD2B 1GL6A 3SN6A 2BDGA 3MNSA 3QG1A 3VTKA 3MOCA 5K0HA 2WSMA 2IYYA 1V2NT 5TCAA 2J38A 1QBVH 1V2TT 2ERXA 3SJBA 1G8PA 2AGIX 1KZ7B 1DELA 1M7HA 2BXTH 3DA9B 1P7CA 4NMMA 1E2HA 1C5SA 4DLVA 1E0SA 5FPHA 1KJZA 4YLUA 4WMEA 2NO1A 1TGSZ 4DDTA 1KK3A 5C4GB 5HKKA 3PG5A 1O2UA 3O47A 4BLQA 1ELAA 2C3SA 1SULA 4DC9A 5FCKA 1FQJA 2KSQA 1HXFH 4PO9A 3H0KA 2G00A 4ZXYH 1US8B 2ZS8A 1V5WA 2IHYA 3QZRA 4AC9A 1ZLRA 4TYWA 1DXWA 3VR2A 1NFWA 1XTRA 4Q47A 1T3SA 2BVSH 1ZC3A 1RE0A 1WB9A 3IBYA 1X1SA 3UNRA 3L3TA 4LOYH 1A46H 1TMKA 1ZM3A 4PTLA 2AFQB 1ETRH 1OFUX 1CBWC 2QQ0A 4TLDA 1GMDF 5A09A 1C1TA 1RJ9A 1ANEA 4FCVA 3CRW1 1U0HC 3LVRE 3PROA 2QIQA 3IILA 3UNSA 2BCGY 2P5SA 1EJNA 1U98A 2NTYC 2QAGC 1C9TA 2P94A 4JJKA 4CVNA 3BIVH 2R65A 2IEZA 1W3CA 1EAIA 3FP7E 4LPSA 1N25A 5EP4A 1G37A 4LJ8A 3T27A 3MRSA 1VG1A 1M9UA 5A0AE 4RCYA 1AWFH 3GLHE 1SC8U 2ZU5A 3SZEA 1O3AA 1P5ZB 4NYMR 3IO3A 3KKNA 2F1RA 1IN6A 1E3MA 1GCDA 1D6JA 3EQ0H 1C2HA 2R6DA 1GWNA 1KIGH 2OLGA 1K1NA 1C5RA 2P3SA 3CR8A 5GCHG 2Z9KA 2RGDA 2PTCE 2PEYA 4XVUA 2ZJAA 3M61U 3UOUA 1W49A 3SYJA 1SOZA 1G3MA 1Z0FA 3L0PA 2ZQ5A 4OQMA 2XSZD 2A7QA 2IXGA 1TMBH 1LHDH 4ZKRU 1O3EA 3OAAD 2XZPA 1FUKA 3QQ5A 3CB4A 4TT3A 2AD5A 4XDEA 2HT6A 1G9XA 3B9FH 2H17A 2BBWA 1RIWC 5F9HA 1JR6A 2AX4A 3VB4A 2FV8A 2ODEA 1BIFA 1UEIA 1A2CH 1TX8A 1KAOA 1TRNA 1GGDB 2HEIA 3NPSA 1TPSA 3MH6A 1AM4D 2G88A 4NIWA 1O2YA 4WF8A 1XDBA 4XOJA 3SJAA 3U9AH 1XXHE 2OCAA 1KSNA 3ZZDA 4UKDA 1EFHA 3ZVEA 3LC3A 2A2XH 4I4LA 2GA8A 2QAGA 2FMJA 1J2JA 4RSGA 1DG3A 3D23A 1F2UA 1ZR0A 4CRCA 3CRQA 3BRWD 4UJ3A 1D3PB 3MJHA 4RKOB 1ODFA 5KSZA 3EX7C 4ABEA 2PGQB 1ELGA 3BEUA 4ABAA 2XSZA 2PWXA 3PV2A 1CKEA 5DISB 1DWEH 1LF0A 3I32A 1UTQA 2D3WA 3QF4A 3FANA 4MYUA 3RXHA 4B35A 1J8YF 1ZTKA 3BH0A 3AK5A 2G0TA 1P2VA 2C2HA 4TLCA 2FI3E 2AWNA 4I33A 1ZC4A 4RY2A 5FBWB 3D49H 1ESBA 3QG5A 5GIBA 3GD7A 2IBMA 5BN3A 1YZKA 3Q3XA 4MYCA 4BAOB 3RUOA 5CJ2A 3QTOH 2GCNA 3FE2A 1MO6A 2VJ1A 3J81k 3UIEA 1F7ZA 2FSHA 3B78A 5CHAC 4H42U 1MMJN 1O2IA 2YOGA 3L43A 2V9PA 2QC2A 2BVNA 4ASUD 1BTYA 1ZYUA 2QTHA 2Y8EA 1GMDG 1JIRA 1LQEA 2Z6VA 2GT7A 1B23P 1Q1ZA 1SGEE 5EODA 1FY4A 4QG7A 4TY7A 4OHYA 2VGCC 2F43A 4BQSA 5B30A 5B64A 2BLWA 8LPRA 1Z6JH 3MHWU 1NRSH 1DSTA 1G291 4TMTA 3HGNA 1T8UA 2VWMA 2ZRDA 1KTSB 1WBDA 1HAOH 3N5CA 2HGTH 3GPLA 2JJ8A 3GJ6A 4PC6A 2XNIA 5KSYA 5AK0A 1QR3E 4LI0A 4QHYA 4FUCA 3PO1B 4UE7H 2EVWX 3LU9B 4JLBA 5K8LA 1C5PA 3A8BA 3I5XA 6LPRA 4MITA 4ZHMU 4CYMA 1JECA 3GLGA 1QBOA 3GCHC 4LJYA 5EP2A 1OXTA 4Q21A 2AKAB 2ORVA 1TQ6A 4KYUA 2J0UA 2GRJA 2UWOA 1G6HA 3K6ZA 2VVVA 2O8FB 4B32A 4Y6DA 4Q7MB 2ZPTX 4DLTA 5JB8S 2ECKA 3LW7A 4ASUA 5DHAA 4JVSB 1T4VH
chains in the Genus database with same CATH superfamily
4JJ4A 1C2JA 2G25A 2IEYA 1I3MA 3S3TA 2BVXH 2Q21A 4UHFA 2JETB 2IEGA 3HJRA 4D6PA 1W36D 1O6GA 4MROA 5KAMA 3DT0H 5JY6A 5DRYA 2R8BA 3N6VA 4HEHA 3R7BA 3DFFA 4RCZA 5IF3A 2A1TS 3LSTA 4QIHA 2FLRH 4D46A 5DYGA 2LVBA 2IPLA 2Z1MA 2ZYGA 4JEHA 4DLPA 3EC2A 3RFCA 3IJ5A 3GP3A 3H2YA 2ZDVH 2EX1A 2Q1UA 5KVVA 5LZ2A 4HNHA 2I6UA 3C6QA 1VKJA 1F0SA 5BSKA 4EHBA 3EF0A 2Q8NA 3PGVA 1OWDA 5FBRB 3OKAA 4H1WA 1TEVA 1E60A 4OAQA 1ZIYA 2B2XA 1JT9A 4GVPA 1UZAA 1ZKDA 4KR3A 1Y5LA 1DIOB 4DV1B 1QC5B 4LRQA 2GKGA 2AN3A 4M1ZA 3EIHA 3WSWA 5AT1A 2WJ3A 3KWJA 4ANFA 1FXSA 5IKPA 3V4ZA 4QOJA 2O0LA 3LCCA 3TH3H 2VJKA 1EZZA 3EBLA 4KNYA 2HV8A 4DXHA 1V1JA 1LBQA 2VCHA 3VYTB 4RD4A 1D9XA 4KLCA 5ECYA 3P70B 5FUMA 5TMBA 1S1MA 1P9NA 2B8NA 1S02A 1AGRA 5FD8A 4UXHA 5C5IA 3THWB 1LQTA 3ZU5A 2R5FA 2CJPA 2QYTA 2Z7FE 3ROXA 1RHRA 2C2MA 2FPWA 1OU4A 2WUWE 3NMUF 2JAHA 5BVGB 4BHTA 3RTCA 4XJXA 5C2ZA 3E6AA 3RF6A 4FBGA 5I4KA 2VYVA 3QA9A 5ALIA 3K9WA 5FYDA 3V8VA 2A6PA 4A23A 3MELA 3Q8WA 2O8WA 1J2RA 3RXBA 4Q4LA 4RHEA 4C4RA 2C5EA 1VE5A 3ILYA 1UMBB 4ABHA 4ZO6A 4JYMA 1SEPA 2P8OC 3SV9A 4H1UA 3CC8A 4F3YA 1RD3B 2ZTMA 3PQ2A 3HUFA 1N5JA 2BGGA 3LTEA 2DPMA 1KY2A 4HS4A 5DM2A 5CFQA 5LJLA 3BZUA 1GQYA 1BVRA 5A9RA 2PUXB 4K6FA 2CNNA 3PCRB 1Y9DA 4WV3A 2P6RA 3LWDA 3H5TA 3KUXA 2ID4A 2PMFA 1NW8A 3LUKA 1ULSA 2ZSIA 1TRMA 4BFLA 1XUGA 1OF1A 4PQEA 1O2MA 4DMMA 1QHFA 2YWBA 4D76A 3HGQA 1TF2A 1Z0UA 2V7VA 3OLZA 5JMOA 4TRJA 1BTWA 1TNJA 3TCNA 5C0OE 4CKYA 1K1MA 2RGAA 4XYEA 3EGWA 3SSOA 2PLFA 2R1ZA 9ESTA 2XRCA 3SN8A 4HYQA 5TF4A 5ITZB 1EK6A 2IUFA 3F2HA 4ER5A 1TQDA 1YUBA 7YASA 4OQDA 2PRSA 4Z49A 5TMDA 2R3YA 4ND8A 2VH1A 2OKCA 1E4EA 1IXZA 3E4DA 1JE0A 1MHTA 1TU0A 1EJAA 5FTKA 3PLAE 3MWDA 4NZNA 3H87A 4QU0A 5AM5A 3KDAA 3RROA 3IA7A 2Z5FA 3WFZA 2Y9MB 4DRZA 1E8MA 4LE2A 5EXEA 4RA9A 5DM70 2J5XA 3V8PA 2BDHA 3BTEE 3OZDA 4B73A 1NMXA 4L8LA 1UF9A 3D0KA 4AN4A 2ABWA 4ZZ1A 3H1AA 5FR2A 4P98A 1A8SA 2PAFA 5AKIA 3HGPA 4H27A 1V2GA 1XTUA 4M7WA 1F92A 2B7BA 3QI7A 1SU8A 4YWJA 4KRGA 1IONA 2BKXA 3FP8E 1IQ0A 5IWCA 4PX9A 3E15A 3GCOA 4B47A 1YVEI 4INZA 3Q76A 3VKHA 4J4TA 4MUHA 4NABA 2QZJA 4I99A 5HIAA 1L0BA 4XBDA 4Q7XA 3SBXA 8LDHA 3AH8A 3N3AC 3IQFA 1SVKA 1D4OA 1OX1A 1MOQA 4Z9YA 1L4EA 2GTPA 2FP7B 4TYMA 4GP9A 3DFKA 1KOGA 1GZUA 4GVLA 2AXEA 1UTKA