5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
3DFLA 2OCBA 4I81A 2XNIA 2TMKA 2W5EA 5I46H 1ZNYA 4AYXA 4TL6A 4B32A 1P10A 2OXRA 4M7GA 1GBLA 3QG1A 3BTGE 3UREA 3RVBA 3LKWA 4CH2B 1ZOMA 2ZFFH 5GJBA 3P20A 2GXAA 1KOFA 3CH4B 5CB8A 4LI0A 3HR7A 1ZSLA 2F9LA 3AF4A 1DVAH 1CT0E 5DISB 2WHXA 2A5IA 1GIAA 1RTFB 1GL9B 1IQEA 2O0HA 3EARA 3BERA 3AH8A 2Z0MA 3PQCA 1XJQA 1CR1A 1T0JB 3KQCA 4UEHH 3M5LA 4JL5A 1ZPCA 2WKPA 1J15A 5HCIA 4MRNA 5CJPA 1O3CA 2F1RA 1TX7A 1P03A 3T61A 4NKRA 1D3QB 3QZRA 4AFZA 2FFHA 1XD2A 2ZJYA 3FYHA 4KFSA 3SUDA 4EPRA 2WBLC 4JLOA 1ZBDA 3LO5A 1A0HB 3P27A 2W7UA 3NZIA 3KQDA 2Q3FA 5EP3A 5EXNA 3RS3A 2VH6A 2PZGA 3LAWA 1ELDE 1EP6A 3NPSA 1NRRH 4TSFD 1MKYA 3B6EA 1II8A 4BECA 4UXIA 1BH2A 1UCYE 3FPAA 2YV5A 3ZVFA 2FOEA 5J4SA 3MH6A 1ZHMA 5JRZA 4DGJA 2AMDA 2FZLA 1KO4A 5CE1A 1M1YE 4GCHF 1I4DD 1ETRH 3I73A 2ZRCA 4HLCA 2VNTA 3AVWA 5JPMH 2XITA 4YOJA 3AKYA 4BLOA 2VH5R 2WJJA 3DMNA 5EQRA 1NFUA 2G52A 1KAOA 3TJOA 3AB3A 1O37A 2BEKA 4PC2A 3QY0A 2OBLA 2HXSA 2V1XA 5SZKB 1Z1IA 4LYAA 4YMSA 3OHMA 1C4V2 4DY7B 1GMHF 1D3TB 2PBRA 5ETXA 2ZI4A 3HR8A 1NRJB 4C9BA 3I62A 1G19A 1AZSC 4LPSA 1EXFA 1O0DH 2HUPA 1MQ5A 5CIWA 4Z8XA 5FBIA 1T4VH 3PEWA 4Q7ZA 1EX6A 3A36A 3BTQE 4KBFA 4MKFA 1BKDR 3PFIA 4DOQA 4IFEA 4ZKOU 2D74A 1SKYE 3PWCA 5E0JA 1CJVC 2P6NA 3ETLA 2ZI9A 1YZNA 2R2MB 5TXGA 1TMTH 2ZE7A 2D1JA 4A0GA 4MYUA 4TLBA 1IHSH 1E9EA 4D7GA 1V2PT 4A0RA 1VPLA 3E1SA 1COWD 1TBZH 4SGBE 4IBLH 1JR3A 5K7RA 7GCHF 1ZCAA 2X2EA 2P67A 2A4RA 2UWPA 3ZVCA 1TBQH 1TPSA 3TK5A 1RYHA 1C5RA 1IQGA 2FX4A 3FANA 3LGIA 3RRYA 5E7JA 4I8LA 4BXSA 1ZUHA 5HZKA 4AG6A 2VHTA 2BX4A 4YXWD 2ZRGA 1SVOA 3CLVA 1P3CA 3GY4A 3M5MA 4G5SA 2RGCA 4V0NA 1O2QA 5GJCA 5ESTE 3I92A 4QT8C 1KSGA 1Z8GA 3NUMA 4TYYA 1HEIA 2A7QA 2Z43A 3RS5A 2ZJOA 2EW1A 4LUCA 5L3SA 1O3DA 2C98A 3DZDA 1F2UB 1CRQA 1GBFA 1G5PA 1O33A 1XEWX 5DI3B 4HAUA 4BPBA 5B2ZA 1O3NA 2CHAC 4PPGA 2Z6VA 4TQUS 1IY1A 2QZ4A 2ZP0H 1P12E 3V7TA 2J34A 3RHFA 1KK0A 4LYHA 4EQ6A 5K8TA 1KLJH 1CA0B 1KMQA 3GFPA 1SGQE 2TGPZ 2ZRHA 3LBHA 1S85A 1D6WA 4A1VA 1S96A 1Z28A 1XX9A 4FUDA 2F9NA 4HAVA 3SUFA 3MHWU 4MGYR 1XTRA 1GJ7B 3VB7A 2AD1A 4QOSA 3RM0H 1GBHA 3K70C 3BAFA 1BMMH 4BTUB 1YRBA 4Z1MD 4YC7A 1TQ0B 3M3VA 1OH7A 4UD9H 4B75A 1W11U 5ANRB 4JS0A 2EFHB 2ZUCA 1NTPA 3SU2A 1GWNA 3B8HA 4DIIH 4Y6DA 2G0NA 2QP4A 1FNIA 3VGCB 1L0ZA 2PCLA 2BQ7B 3MNCA 1W12U 4XSGA 1DANH 4B1TA 1U0JA 1R6BX 1G8HA 5FL7D 2OAP1 2OO7A 2TPIZ 5EXLA 1XXFA 3KXIA 1HGTH 2UVQA 4NP6A 3DMDA 1E94E 1UKZA 2GXSA 1NVUQ 3LX5A 1Y8TA 2F3TA 5JBQA 2ZXUA 2ZJ8A 4OS1A 4JLJA 1SPJA 1SXJD 1P62B 5LD2C 1XZPA 3QGNB 3GCOA 1YZUA 1CBWC 2ZS8A 1YCPM 2OT3B 2VH0A 1C1RA 2ZRIA 2R44A 3LW8A 2JIZD 3T5GA 1R2QA 1SGFA 1TX4B 3SI7A 1G64A 3C14C 2KAIA 2ZCLP 3UWOA 1OHHA 2FE4A 4C0QC 2ATVA 1Z2CA 2V8OA 3C4JA 1MTSA 4WOPA 4JLKA 4FMBB 2ZU6A 1JWTA 5AJWA 3M35A 2EVWX 5A0BA 3KQBA 3A37A 3NXPA 4WMEA 2FSHA 1S82A 4F4CA 4BGDA 3PV5A 1IQFA 4ISIH 3WNDA 1U8YA 4B73A 2FIRH 4YOIA 2HLDA 5KDOA 2WMNB 4US0R 2WIAA 3MH5A 1CU1A 4AKIA 3RXSA 4C0LA 1UDWA 2ZTXA 2JDIA 2E87A 1ZINA 1QFKH 5E7MA 4DKXA 2ODQA 3IEVA 3PLBA 1QHSA 4YMVA 1I4TD 1E1QA 4JZIA 4OS2A 2VEDA 3MO6A 1XMIA 1AIXH 2FN4A 2EEKA 3EAQA 4HZUA 1YHNA 1T31A 3QE0A 4YMWA 1A0LA 2BDAA 1HAHH 1O5CB 1XD2B 2YWEA 1D9ZA 3I5XA 3K0CA 3EZ6A 3H1TA 3ATIA 3HK3B 2DBYA 3E8LA 3PIRA 4JL6A 2Q0HA 4KHZA 1IY2A 2IA5A 3QXHA 4HFPB 1H9LB 1T8OA 4LJ8A 1GUAA 1KI6A 3SZEA 2XZOA 1ETTH 5JBBS 3A1VA 3NBXX 3D49H 5H1YA 1O5BB 3H2YA 3VX3A 1LPZB 2GDJA 3QUSA 3E2IA 2I1VB 1CHOG 2HNTC 3EE0B 1H9HE 2A4OA 5LBIA 3SJCA 3R8FA 4EPXA 4EPYA 4RKFA 3TSWA 4DSTA 4RD1A 4JJZA 2PCJA 1G2LA 5LGOA 2Z9GA 1HAGE 2ZPRA 4C4PA 4JZEH 2ZR0A 4PAMA 3QKRB 3IEUA 3TGJE 2QAGB 1UK2A 3O47A 5JYIA 1ESTA 1YCPH 5HR5A 4ASUA 5E95A 2H5CA 4BRUA 1XZQA 4I31A 3ZLJA 1G9XA 1Z0IA 2NPIA 1GBBA 5GNDA 1Z1JA 1MKWK 4X2WA 1IN6A 4BFTA 1P57B 1IQLA 5EE5B 2OC0A 4OM9A 1G291 1O2TA 4WY3A 4KLZA 2JLQA 2HCBA 2ZDAH 1W48A 2P3TB 2O8UA 1XMVA 5D3MB 1EESA 2MMCA 1UVUH 2ILNA 2OXCA 3TIUA 3ENSB 1M74A 4QNMA 4AIIA 1AS3A 4X6PA 1QHHA 1AIPA 1ANDA 4UFFH 3SJZA 1W0KD 3OX7U 3GLHA 1TF7A 1K9OE 5DP3A 1QB1A 3ZZ6A 4JLBA 2BYAX 4ILEA 4R9UC 2YWFA 4QGGA 5PTPA 1KDPA 4HUQB 3D62A 1M8PA 1P9RA 1WMSA 1O3PB 5KUTA 2QTHA 1GP2A 2ZU3A 4X8SH 2PKSC 3RMNH 3CRQA 2X19A 2F9VA 4P32A 2FOMB 4PSAA 1ZP6A 1DXWA 2VHCA 4NIVA 2Q3HA 2ZUBA 4LHVA 4ABIA 4UFGH 2H1UA 1JAHA 2IYZA 1D9IA 3KJGA 3VB5A 1FP6A 3GP8A 1GL6A 1T3SA 3N2IA 1EOJA 1EX3A 1VGCB 3A8DA 1L7VC 2H18A 3GFTA 2R0LA 1WYKA 1H8ED 4OI2A 3X1WA 2PUXB 4R0IA 1H8DH 2Z5FA 5T3HA 2HF9A 5L8VA 3W6OA 5FOXA 4GDFA 2KI5A 1T91A 4D26A 1CBWB 2OQ5A 2J41A 4XTRA 2XWBI 2WWIA 5JHGB 4AORA 1O2NA 4QHTA 2JLRA 3F0TA 5EW2H 4K60A 4OL0A 4NL4H 2Z3CA 4B35A 4M9ZA 2ZTSA 1XCGB 1Z8JB 2QL6A 1E99A 1MRNA 4LC1A 1WDTA 1N5LA 4A36A 1NZQH 3GQBA 5CLLA 2BD9A 4FIDA 1SKQA 3BTWE 2RAPA 4ABEA 2GT8A 4R98A 2DWOA 2B21A 2ZYVX 3CNLA 4BASA 2PTCE 3RLWH 4XD7A 1TF5A 2G4UA 3L82B 1HY3A 2D06A 4TTPA 1CF4A 5HE8A 3AVOA 4UNPA 4Q00A 3R20A 2WZQA 4BFVA 4D80A 3UPEA 1HURA 3IKJA 2IYRA 3MMPA 2M5TA 2IXEA 1VECA 2ERXA 3T1QA 2WWYA 1X7AC 3SNBA 2TRMA 4EDHA 1Q1QA 3JVUA 3HATH 1NVVR 3M3TA 2FJUA 1Z22A 1GJ6A 2A31A 4AKGA 1FMLA 3KCGH 5KU1A 3VR1A 2VIIA 5J4HA 2XEXA 1DY8A 1G36A 3UATA 2ZUDA 3X1ZA 1TGSZ 3AGPA 2BLWA 5C5OA 2HYDA 3HU2A 5JMTA 1LVBA 3T26A 1QL7A 1R8SA 3T5FH 2AEIH 1K2I1 4NBSA 2WJHA 5E4FA 1HTWA 5KPJA 3MWIU 3BFVA 4BLSA 2GD4B 4R71A 2Y81A 4DVAU 5GPIB 2J7PA 5BYJA 4VGCB 1X8KA 1C5SA 3IIJA 1FUKA 4C0SA 1P9SA 4Q80A 1KMHA 4ACBA 3M1IA 1IN5A 1P75A 2V1UA 2BVSH 2BTCE 2VVUA 2HJVA 4URYR 4ARZB 4A0HA 2QAGC 1YM0A 1MZAA 1PYTD 3UOUA 1ARCA 2P65A 3FZZA 4FW9A 5FR1A 2PUQH 1DOAA 2OUAA 4PO1A 3PLPA 4Z54A 4LJ4A 1W0JD 2IX3A 3OIYA 3G5UA 1K22H 1UHBB 3S1AA 5BN5A 2VP4A 3CZQA 4RFVA 1KXCA 2JETC 3LVQE 1O2ZA 2HXYA 8ESTE 3BG4C 4WZBE 4ZDIA 3NG1A 3RC6A 3UMSA 4DLSA 4ISHH 2SHKA 2NQ2C 5J4YA 4NPHA 2XBYA 2KSQA 4C2UA 4OI0A 3TSOA 4IOJA 2WSMA 2GKVE 3LW7A 4IKEA 3FMPB 1HAVA 4M9XA 2AFHE 2OM2A 2PSYA 1KTVA 2HF8A 4CF7A 1G3IA 3FFGA 1HCGA 4M22A 5GJVC 2ORWA 3OE7D 4TLDA 3ICEA 1RJ9A 3ZYDA 4G0NA 2CCJA 3EPHA 5AUNB 5CYPA 5AR1A 2C04A 3OIWA 4M1OA 1FQ3A 3OF5A 2A4GA 4OQXA 1MH1A 2IYLD 5EE3A 2XXAB 4YT7H 2BLQA 4HDCA 3BEUA 1WBDA 2XBXA 1O30A 2QTFA 3SS8A 2H9EH 1E38B 2ZGJA 4AI6A 2YJTD 1JJ7A 2WV4A 3HKJB 4CEIA 1INCA 1SVKA 2ZGBH 4IFBA 1E4VA 4BLPA 2PKAA 2GETA 2GMTB 1ESAA 3KQHA 4J2YB 1ZAKA 3EZ2A 1DWBH 1QHXA 1HB0B 2W0SA 1N8OC 2EFDB 5C3NA 1G30B 3CP7A 5BXQC 1BJUA 2ZF0H 2Z7FE 1T8TA 1CEEA 4RD4A 3U6KA 5L3VA 2CHVA 1QR3E 2WV5A 2BHGA 1NKTA 5KNCA 4AYVB 1KI1A 4ZDKA 4Z8YA 5KNBA 4H6SB 5G3YA 4DCUA 1AM4D 2UWLA 2WWXA 2K5UA 3PWBA 1O3HA 4AGJA 3LH3A 5KDDA 1ZRBA 1VDZA 2ORVA 4TTQA 4KTUA 1AKSB 1F7ZA 1Z0KA 3CRRA 4MQAA 1DUAA 3CPEA 1UTPA 1WSSH 1CQQA 4A1XA 2DFNA 3ZZDA 4AB8A 1MABA 1IY0A 3NC0C 4DLTA 1KI8A 3DM9B 5F3WB 1TAGA 1FI8A 2FU5C 3AP2A 1QVAA 1II0A 1IXZA 4PQRA 1S5SA 2E1RA 3B1WA 4DXAA 4EJSC 1MU6B 2PL3A 1W49A 4GPTA 3ICQB 3Q3YA 3SFZA 4X8MA 1NN0A 4RN6A 1AGPA 2QMUA 1DX5M 4K5ZA 1S3SA 1ODFA 1NN5A 2ZSFA 2FI5E 1GKYA 1NJGA 4R7ZA 4A0FA 5SZHB 3RUOA 4KITB 1CLUA 1FP7A 1G3QA 3K70D 4BOHA 1TRYA 4A8JC 2SNWA 1P72A 3UK6A 2P3UB 3E90B 1S8FA 4B3GA 4D25A 2QROA 1FIZA 5GCHG 4NA8A 2BZ6H 1GJDB 1NFXA 1RS0A 1GVKB 3K9GA 2D4HA 4BXWA 1HUTH 5CIQA 5L6NH 3THXB 2JLXA 1SGTA 1XTSA 3RXOA 1OXGA 4BLQA 3SQHE 1N6LA 4JVNA 1GBAA 1LHFH 1RFLA 1J2JA 3FHCB 2F55A 4A8JA 2IS6A 2UKDA 1GVNB 2OCAA 2G55A 1RD3B 5E2PA 3R7WA 4QC2A 3F8TA 4ZKNU 2XC4A 8GCHF 4E22A 4KCGA 2QBYA 4A7IB 2P6RA 2QM8A 3L0IB 3KIDU 3A4LA 1S1MA 2GZ7A 2C2HA 3SI3H 2JKHA 4EPWA 1QY6A 4CHAC 1T3HA 2Y5HA 4JZ1A 1E2GA 1ZMLA 5KSOA 4HAWA 1XUHA 1KDTA 1GI7B 5HKKD 3SGQE 5F8ZA 4IDQA 3SHAH 3K9NA 5T1VA 4XSHA 2EQBA 2GESA 1NFWA 1LDTT 4P33A 2WMOB 1NRQH 3I61A 1E0JA 1OYWA 5FHTA 5LPRA 1AA9A 1Q1EA 3GLFB 1UKEA 4JCNA 1GBTA 4IDNA 4ASHA 3QGJA 1QHHB 3KXLA 4WH6A 2X77A 1T5IA 1EXMA 1MCTA 4TYQA 2A32A 2NO9A 6LPRA 5CDFE 2QSZA 5EP1A 2FX3A 1DUEA 3MNSA 1UBCA 4XWAA 1MT0A 3LBNA 1D2MA 3K0AA 2ZEJA 3ODDA 1K5GA 4PC1A 2QU8A 3BF6H 4FN5A 4I8GA 1AI8H 5HTKA 2NMVA 5FPSA 3BTHE 3KUDA 1W36B 1LY1A 2L0XA 3FP7E 1SGNE 4DDTA 2RGNA 3EWAA 1TRNA 1KLTA 4MG3A 4WF8A 2VHQA 4MRRA 3RXLA 2O8MA 1ELTA 5FR2A 1N8OB 3RC8A 5BN4A 5FH9A 1PZNA 4IMZA 5A8YA 2H2ZA 5C18A 3PUXA 2YOFA 2AK3A 3M5NA 1UEJA 4L15A 1D6JA 3SOPA 4NMMA 4X6MA 2ODNA 4JZDH 3VB3A 1DFPA 2AWNA 1NY22 3LXXA 1THRH 1JXPA 3BIFA 4GLYA 4OYHA 4BZPA 1L1GA 4QBGB 4X0WU 1YRAA 1AS2A 3DO6A 1GI1A 4GOJA 1KY2A 1C2EA 1F48A 5FI1B 1EFTA 1S0QA 1N6OA 4EQ6B 4NSVA 3TGKE 3EIQA 1WBBA 3FVQA 4M1YA 2ZVPX 5AK0A 2BY6X 4Q19A 4CEJB 3DPUA 2VF7A 3QK1A 3ZZ5A 2WAYA 2CJWA 1BMLA 5JS8A 1T32A 2WOOA 4GBMA 3A7ZA 3A87A 4GMDA 4Y71A 1P7CA 4ABFA 2Z4SA 1DLEA 4CZ2A 3PXGA 4IHQA 6Q21A 4Y8YA 2GV6A 3TJZA 4HZUB 5TB5A 1ZC4A 2DR3A 1GOTA 4AWXA 2J9RA 1G20E 1DG1G 3B1VA 3U3JA 1TQDA 2BMFA 2ZG0H 1MH0A 3V3MA 1XXHE 1V3XA 2BY5X 1K1IA 1XEWY 3QKRA 2EFCB 4EIWA 3GLGA 1O3BA 1E2HA 1NN6A 1WOFA 4I1UA 1FY8E 3FVFB 2RMKA 1VG9B 2FWWA 1Y5AT 2FOBA 3ZVMA 4A6LA 2ZRAA 2HRVA 4IDOA 1JAIA 1TE0A 4MYHA 3TLXA 1GMCG 2AIPA 3SNEA 3ZVDA 2BB4A 2FSFA 2IBMA 3VAAA 1DEKA 1L4YA 3LGYA 3C16C 1O5GH 2IJOB 1IJEA 1QHNA 4Y7AA 2ZAOA 4H4FA 1EPTA 4PHFA 3ZYCA 1O2IA 2XTNA 3LRPA 2HPQH 4WZAE 3C27B 1V5WA 1V2MT 5LB4A 4L4UA 4CRGA 1BCUH 2CLSA 3I8XA 1QBKC 1GJCB 4LJ6A 1NY6A 2QXIA 4CYMA 3K6YA 5JJIA 3GY7A 2FNAA 2XJ4A 5L3QB 1O2YA 1LKBA 4YONB 1Z47A 1W10U 1N6KA 3ZYEA 2PGBB 3HJNA 3A4MA 2OP9A 2XX3A 4Q18A 3FP6E 1GDNA 4D7FA 2WAXA 2Y82A 1SXJC 2ZRBA 4NZQA 5EE1A 1TEXA 1OB5A 1A82A 3H09A 3VHLB 2ZU0C 2W3KA 2ZRNA 2IEZA 4G1UC 5EE0A 1D5CA 5CK4A 4B43A 3L0SA 3P4XA 1IBRA 1ZJKA 1ZUIA 3O8BA 3EYDA 3K0CC 1NN1A 2DHRA 3OFND 1AJEA 4RZXA 2ZE5A 1T4UH 4YDSA 2B8OH 4GCHG 3Q3KA 3MFYA 5FUYA 2AGEX 1WU1A 4M1SA 2ZRDA 1P2QA 3MO9A 1C4OA 1C1MA 3MWJA 4ABBA 1DELA 2YOHA 1HXEH 2HV8A 1TGBA 4PAQA 2ZE6A 4CDGA 2FLBH 4ZCIA 1M2OB 1QRWA 1HFDA 2C03A 4IN1A 1PLLA 5E2OA 1E2MA 2JA1A 1LV7A 4QM7A 1P8VC 3WHLA 3QJYA 4HAXA 4I8JA 4BAKB 2A5YB 5E0GA 5A0CA 1YR8A 3QQ5A 3SHCH 1TQ7B 4DT1A 1GBEA 2WPLS 4P0TA 1T8NA 3RYTC 2NG1A 2XB4A 4PPNA 1XKBC 1EASA 1IONA 4NCKA 1SVWA 2B7CA 3ZZAA 4IXNA 4IW3B 3WMEA 2ZECA 1P6XA 1QG2A 4GHQA 2W2XA 1ZM2A 5EXPA 5JBTA 4OK3A 4OGXA 1P02A 1KDRA 3M0EA 4FCVA 4XDEA 1GHZA 1Z0DA 1ZM9A 1CTQA 3REGA 1R10A 4Q66C 1NT1A 2WUBA 4NONA 3WHKA 2ZGCA 1JI0A 5TJXA 4HUQA 4IVQA 3MFJA 2VIDA 1KTTB 1IQMA 1P2MA 3MJRA 2OD3B 2AL7A 2DFLA 1KNQA 2ZRFA 4JT2A 1XU4A 4WBSA 1TIOA 1OP8A 3Q76A 4HEJA 1F2TA 3FKSD 1SGIB 2Z9JA 1N6IA 4RSPA 4FCTA 3NKVA 1HAXB 2J87A 1N3BA 1AUTC 1XUGA 2Z9KA 4TMZA 1YR6A 2OBQA 1W4AA 2BOVA 4FMDF 3ZZ3A 2QXJA 3TNSA 2Q9CA 1O2MA 4LZ1H 3QKSB 4IEEA 1TGCA 5EG4A 2PGQB 1J9CH 1Z5ZA 3MH4A 4Q47A 3ZVRA 3IGFA 3U44B 4NCIA 1O39A 1AZZA 4GRAA 4B6FA 2ZREA 2I6QA 4YT6H 4A2QA 4MDFA 4MLFB 2J0UB 1PLKA 1HIAA 1PPHE 3F9EA 1CJMA 2H6MA 1YBWA 5FOUA 1ZPZA 3EZ9A 1WTHD 2BCJQ 3WY9A 4CRAA 4F49A 3Q85A 4GVUA 4URUR 2FEOA 1U98A 5F6MA 4CVNA 2HVXA 2KE5A 2VSXA 2ZM5A 4CGZA 4XBDA 4Y10E 3PMJA 2WIBA 3KJEA 3OZXA 3BH6A 4Q1EA 2VP5A 1Q21A 6GCHG 221PA 1FPCH 2WPJS 1JEDA 1C5UA 1Q2WA 3ZDQA 1O5AB 4JZFH 4Q9HA 1ZJ6A 2BM0A 2FO9A 1O2KA 5EW1H 1G5RA 1GHAF 3O8CA 4NYMR 2QE7D 1O2OA 2IYXA 3KKMA 3T62A 4PX9A 4NA9H 1O3IA 2CL6X 2BDTA 1L1JA 4FUGA 2NZJA 2WJVA 3MWKA 5JB9S 3STIA 4C0KA 3GLIA 4MVNA 2BXTH 5C2JB 1NNEA 1P5ZB 3B1ZA 5L3QA 2QT1A 2FS8A 3TAHA 4GPGA 2VLIA 4Y0VA 1KNXA 2J2UA 2ZIAA 1XNJA 1UMAH 1AVGH 3VR3A 2GT7A 3MI4A 4QBFA 1G3RA 1UTQA 1QQUA 4X1NU 5BYKA 3EA8A 1BTYA 1G3MA 3KZ1E 2BDBA 1PPBH 1GVZA 1NI3A 2AXNA 5EZ5A 5EODA 3K53A 3IDQA 5FPHA 4ISNA 1EG7A 4QG7A 2GCNA 1CA8B 4BEJA 2HLCA 1SMFE 1XCMA 1JRTA 3SZRA 4D9QA 2BIFA 2O8CA 1GSIA 1EPTB 5I25A 1T8UA 2TBSA 1T6NA 1T8LA 4FUIA 1J90A 2IS2A 4OHXA 3RU4T 3JZMA 3AVVA 1W7XH 1DTSA 1HQCA 3E3TA 5JLJA 3W6PA 3SEAA 2QY0B 3QF4A 1Q12A 4D6PA 2GCHF 2X2FA 1GI3A 3P4YA 1OSNA 4YESB 4CRDA 3U3MA 3KX2A 4M8NE 1QDEA 5BRRE 2QPTA 3A8BA 2JH5D 1BRAA 3IQXA 2EFEB 2RA0A 5L30H 1GMDG 1GJ9B 3SHFA 1EAWA 1YKTA 3RRMA 1HAVB 1GKIA 2G0TA 3LVRE 1OWJA 3ATKA 1PVOA 4XVQA 3RDZA 3NBZC 4ASUD 5H8WA 3MLEA 2VB0A 2FS9A 2EA3A 2G83A 1GHYH 2ZETA 3ZZ0A 1PPEE 1Z6TA 1EFCA 4DUGA 3RC4A 4UQOA 1UFQA 2EYUA 1EWQA 2O8FA 5FPTA 1WQSA 3R0FA 2W83A 3ZD6A 3W3AA 4QFMA 2EWWA 1O3KA 3K0EA 4PPFA 2JH6D 3QVUA 2N1BA 2A5DA 1W2HA 5L2ZH 1UTJA 1UJ2A 1C2FA 3SUEA 2VBCA 1C5LH 2ZPSA 5JWOA 3TITA 4C2TA 4AURA 3X1DA 3RRZA 5G3ZA 2WM9B 4U5XA 2GJ8A 1TNDA 3C5HA 4U7DA 1G3UA 4MITA 2ZAMA 1KKMA 1FY5A 1V2QT 2UUJB 1QVRA 3F9FA 1E98A 4VGCC 3SGBE 1O3GA 4Q7JB 1SGCA 1MOZA 4ZI3A 2AYWA 4Y79A 5E3HA 2ZYWX 1SVLA 4FUHA 3MMGA 4LHYA 2YNAA 5J4LA 3V4RA 4NCNA 3JZAA 2IUSA 1TOCB 3QF7A 3TAUA 3BSQA 1O2JA 4PSVA 1ETUA 1FFHA 1YLCA 4D82A 1X1RA 3MD0A 4TLEA 5EQTA 1AHTH 4LJAA 2ZROA 1Q0UA 1Z07A 4X8TH 2ANWA 3LGTA 3R8CA 1GDQA 2GILA 5DGJA 1DS2E 4K3JA 1VG0B 3A1TA 5DHAA 1AWFH 3K0AB 1NBME 2IW3A 2J95A 2BX3A 1C2GA 1C2IA 3CS7A 1SQOA 4KYIB 3VX4A 3HU3A 1U8AA 4AD8A 2HPPH 4MPWA 1EZQA 3K1JA 2ZYTX 4KSCA 1FONA 1C9TA 1CRPA 2VGCB 1ELVA 3HKIB 2LNCA 3PTNA 1E2LA 2ZGXH 4CRCA 4TWZA 4OQLA 2ZSBA 5DO4H 1EB2A 2JLSA 2ZNKH 5JCZA 1QRZA 3A83A 2GJ9A 1CJTC 3GMTA 1RGQA 4GZMA 3BORA 1OX1A 3EW9A 4N0EA 3VKGA 1W5SA 1VZQH 4A15A 1C5OH 4O97A 3NH9A 4BFXA 3GCHB 2BWJA 3LBIA 3I1FA 1MRSA 1NMYA 4Y8ZA 3NC1C 4IN2A 3U98H 1W14U 3UIRA 1ZUNB 1SFQB 2XW9A 4M9SA 2D7DA 1SKYB 4Y0ZE 1SLVB 2FV8A 3BK7A 3PITA 5GVRA 3E70C 4AG5A 1A1RA 2IYWA 3FMFA 1KK3A 4RKOB 1W4CA 3PM3A 3E5HA 1E79D 2OCYC 1K1JA 5FX6A 4KO8A 2GZ9A 3ASZA 3ZIAA 3HDTA 4ZDJA 5EXTA 4UNRA 1O3OA 3AQ4A 2VIQA 4POAA 4Y0YE 1OXUA 4LRWA 3RSLA 1C1NA 1KXEA 1MTWA 4WXVA 3F5FA 2ECKA 2QGRA 4I8HA 1SL3A 4JVMA 1F2UA 3T1OA 1PQ7A 2DE8A 3BFKA 4KV9A 4JKYA 3FB4A 2CL0X 1GBIA 2HDNB 1I2MA 4BE7B 2FI4E 3HYTA 3IIKA 5DLQC 2J46A 1UBEA 2FI3E 2GAOA 4KVAA 4MGKR 4NCYA 3P32A 1SHKA 4D4JA 3MGCA 4M1TA 3CF2A 4O3TA 4LBZA 1WAYB 3V13A 1CP2A 4LZZA 3SYNA 5GJWC 2OLJA 1P2IA 4ACAA 4CREA 1DAMA 5FXLA 1Z06A 4FUCA 2IPHA 1TWXB 2FGKA 4MYTA 2EFGA 3SYJA 3M5OA 5DIFA 3K65B 4EJSB 2OBMA 5B64A 1E35B 1ZW6A 2OUKA 3RXQA 5DJ7A 4TT3D 3A8CA 4UONA 3CB4A 2WPDD 4JYBA 4RZ2A 2H92A 1O5EH 3I8SA 1C4Y2 1XXHA 1MV5A 1N5IA 1O3AA 4BLTA 3K2UA 1FOEB 3EA5A 2BMDA 2ZTYA 1MAYA 3OEHD 4GL2A 2WINI 4HDQB 5EZ6B 2W6IA 2FDCA 3Q5EA 4AFUA 3U4QB 2ANMH 5FAHA 4TMXA 4D0NA 2BY7X 4CRWB 2ANKH 2GZHA 2W0MA 3CM0A 3EC2A 1EZXC 1GCTB 3A80A 1VITH 1RFNA 1QZXA 2I4IA 5A09A 2XJ9A 2ZU4A 1HBTH 1SHYA 1ZGIA 4G5GA 2REBA 2C8ZB 2G51A 4B71A 2OC7A 1GJ8B 4OS4A 1C1SA 2VU8E 3NH6A 2VP9A 5E0HA 2VWLA 3L33A 3MTYA 4DCVA 3ESTA 3NTUA 5FOWA 4ZXXH 3UNQA 4TY7A 1FY3A 3BE4A 3PLKA 2O5VA 2BKEA 3BB4A 1E0KA 2ZFPH 3S9CA 2AFQB 1F6BA 2QQEA 2P6UA 3QXJA 5KSZA 3PR1A 3PUWA 1WUNH 3JZ2B 4IOLA 3VXEH 3OEEA 4LWZA 2XOKD 4CEIB 3F68H 1XDBA 2A4QA 1GVLA 1FTSA 1N0UA 4JSTA 2F43A 1Y5BT 2CNWA 3TVDA 3QTOH 5JI2E 5E7IA 5GDSH 3KKPA 4CEJA 1U94A 1V2RT 1ABJH 1GG6B 4FD2A 2BLVA 3NHAA 3LGUA 1A7SA 2CBZA 1TU4A 1ZJDA 4OJQA 1ORFA 1C1WH 1QB9A 2G77B 1Z8RA 1RKBA 4BLRA 3L0PA 1D3PB 2PT7A 4BNRA 1ZRKA 1GMHG 3SJAA 2VQSA 4QM6A 2YNMA 1R4AA 1LQDB 2CHAB 3RM2H 4BZQA 1NROH 2IWRA 3IILA 4ISOA 1BTHH 3ZJYA 1VG1A 6ESTA 2J0SA 2UZIR 2ZSDA 1XX6A 4BAMB 1GM5A 3Q8XB 4TY6A 2CJIA 3RXPA 3ASYA 5FOSA 1KYIA 2A30A 1P4SA 3UXMA 3CH5A 1QL9A 3MUFA 1ANBA 4X1RU 1GI6A 3TR5A 2PFEA 1WA5A 2V7QA 3E91A 4I32A 1ZCBA 5DPAA 2HNTF 1DLKB 2PTNA 4Q1FA 2PLFA 2C93B 2AMQA 2GRJA 3URCA 5DO9A 5AHGH 2R6DA 3ZGXA 1G8PA 1ZM3A 2QRNA 3HPQA 1HV8A 1SGDE 2ZI6A 7GCHG 3IUYA 1L4ZA 4QJ3A 1NBMA 3HPRA 3EA7A 1II8B 4M4SA 3N70A 1IQNA 2IHBA 2QCYA 1GGDC 1AN0A 5F98A 1ANEA 3THOA 3HK6B 3CUEF 2GCTB 4S2EA 4K81B 2OILA 2IXGA 1ELCA 1GHWH 1WCV1 1ZTKA 4H1VA 4QGFA 5DN6D 2R2WU 1YKSA 1X86B 2G88A 3BTFE 3NK8A 2ERYA 3TJNA 2B6HA 2EI6A 1T7CA 2ZCKP 3B82A 5JJKA 5AVDA 3Q3XA 2ZJ5A 3THWA 2CK3D 2XRCA 5FI0B 3OFNA 3DA9B 1FMJA 3GJ6A 3BXZA 4TQAA 1E6CA 4HB3A 3NIBA 2HLDD 3TK9A 4X6NA 2QY9A 3RC5A 5FPYA 3VU9A 1QBOA 1NVVQ 3KKQA 4ZKRU 4X2XA 2JJ1A 2JDID 3B1XA 8KME2 1YR9A 2EU8A 4U01A 1WRBA 1W46A 1Z6JH 2JASA 1ELOA 4UNSA 3VKHA 3SUGA 1BOFA 1P2TA 1IN4A 2NO1A 1E2DA 3AF1A 4AFSA 1XKAC 1R0XA 4IDPA 3TRFA 2YVUA 1Z3IX 4FUFA 1CR0A 2QAAA 2QF0A 1IM2A 1GI5A 3EA0A 2N42A 1OWDA 4IEIA 1Z6AA 1RRCA 4K1TA 1LTQA 1TNJA 2ZSAA 2ONKA 1XMNB 3WBJA 4DBLC 2ZS9A 3U2QA 1TBRH 3HWSA 3W3ZB 1CVWH 3U3KA 1JBKA 4DG4A 1R0YA 1JXMA 4NIXA 4PR0A 3OESA 1UF9A 1YPMH 2V0BA 3MU0A 1TPZA 2P0EA 1CXZA 2GAAA 1HIAB 4LYFA 3SNAA 2K1QA 4CT5A 3AAVA 3AVZA 4U00A 2BJWA 1R7RA 3RXKA 4DLZA 1DAKA 4HATA 1K1LA 4CEHB 1GITA 4MPVA 1MCVA 4TL8A 1WBGB 3P8OA 1JECA 1P60A 1Z2AA 1OWKA 1TU3A 3SNHA 1O2SA 4B3BA 4XJXA 3VR2A 4K8OA 2AK2A 3T1TA 4FCWA 3GY6A 1KSHA 4MUBA 2UWOA 3QPVA 3VNUA 4NZYA 1JBUH 2ALPA 1O38A 1U2RA 4N3NA 5AFYH 3GY2A 3NCLA 3U1IB 4V0OA 3M6AA 1HXFH 4BAHB 4XTCS 1C2KA 2SGEE 1HJAB 5JSZB 1E2KA 3IHLA 3V0XA 4B74A 1LVOA 2OEPA 4IVPA 4YXWA 2ZIQH 3KTAA 4M9QA 2ZDVH 1OW3B 2FSIA 2P8OC 4TYPA 1JXOA 1YZKA 2OLKA 3U3OA 4OQMA 5FBVB 1E1RA 5EXMA 1FZZA 2PMDA 2ZFTA 3QXSA 1V2VT 3L8YA 1Z29A 1F60A 3GJ3A 3ZZ8A 4C0AC 4PHHA 7KMEH 3RAPR 2GKSA 1NS3A 4RY2A 2G6BA 3CX6A 5J4VA 1PYTC 1D2NA 3VHXA 4LSGA 3GY3A 1VCQA 3NWJA 3W8RA 1NPMA 1SULA 5DP6A 3I77A 5AUPB 2ZWLH 4O3UA 4MNWA 5J40A 1E2NA 3OSYA 2VF8A 1NIJA 1O3EA 1VHLA 4OI4A 5FBQB 2G9NA 5HCNA 4TYWA 2F3CE 1XRJA 3SBKA 2BCGY 4HB2A 1LMWB 1OYTH 2PJZA 5FX5A 5FBRB 4IXMA 2R65A 2PZFA 1GNQA 2OC8A 1EZSC 1AN1E 3GYMA 1VCMA 4AK9A 1YZQA 4NZLA 1EFRA 1O3FA 2FPZA 3CZPA 1E2EA 4YTAA 3EPKA 1AY6H 4I8KA 1TQ6A 1VCWA 1TA6A 4LOAA 1UTKA 2GCOA 1SHHB 5JFGA 3I5YA 2ATXA 2XTTB 2Q9AA 3OTPA 1MTNB 1TUIA 5G40A 1BQYA 4FU8A 4OGYA 5P21A 2F7SA 4O2RA 5GVSA 2CEAA 2ZO3H 3FDIA 1DWEH 1ZMJA 2J1LA 1O2LA 2ZI7A 1G32B 2ZQ1A 4F38A 2SGDE 3B9QA 1FZQA 2BC9A 3THYA 4ITRC 2PT5A 1XFAA 4Z6AH 5BN3A 2H5DA 1LCYA 1BRUP 1ONBA 2OAQ1 3UR9A 3D31A 2NU2E 4QBHA 2RG3A 3VR6A 1ELEE 3FKQA 2BOKA 3WBKA 3EA9A 4M9FA 4FU9A 1F5KU 4I1VA 2MSEB 4B48A 2OLGA 1R8QA 4F4IA 2STBE 1P05A 5CM9C 4NWKA 1S9HA 1OXVA 4X8UH 1MTUA 2AWOA 1KDQB 1K1PA 1CT2E 2IUTA 3CPJB 4A6XA 4W5JA 1A61H 5GWZA 4H9GA 4E07A 2FYRA 1AGJA 4KFTA 4HI3A 3OU0A 1DBSA 3AP3A 1VCPA 2H17A 3TU7H 1VIYA 3ND9A 1Z63A 4G5RA 4OK6A 1KTSB 2KAIB 2KWIA 2HEIA 2YC2C 2VTKA 1GG6C 3B1YA 3SR0A 1FMGA 4GT1A 2ZFQH 1MD7A 2C9CA 2O52A 4P3YA 1DADA 1X6VA 1MAXA 2JJ2D 5JWRA 3CR8A 3QZQA 1Z6EA 2BEJA 1G18A 1GBJA 3C41J 4PAOA 1NESE 3SV9A 1BBRK 2B7DH 7LPRA 1F5LA 2PHBA 2CJWB 4G01B 2WVJA 4GSOA 4XWKA 2ZI3A 121PA 4NFEA 1VCIA 4W7SA 5B6OA 1G3BA 2HWLB 2ZQ5A 2XSZD 2QTVB 2OQUA 3H84A 2HYIC 4KYUA 5A4JA 3SU5A 4FUEA 2V54A 5HE9A 3S9BA 1MO5A 2UUKB 4Y8XA 1OYYA 4NYMQ 3SYLA 1O2UA 2A2QH 3WMGA 3UTUH 1KK2A 1XVMA 4LJ9A 2BVXH 4G5OA 1FN6A 2Y7ZA 1J14A 4DHEA 1L4DA 1NP6A 1HV7A 2ZGHA 2GVZC 1ZM4A 2OFXA 1HYLA 1Q3TA 4TMTA 3C8UA 4LZ4B 5D3QA 1EGAA 4JVLA 5J4QA 5HXFA 3U7FB 3U1JB 1XBTA 3AV0B 4Y11E 1C1QA 1GG2A 1KYNA 5KSPA 2VWOA 3ADDA 5TMPA 3SJKA 1BRCE 1ELGA 1C5WB 5KDLA 5AJYA 5DE3A 3AW1A 4PROA 2NTYC 2GF9A 1GBMA 2V3HH 1JPJA 1LVGA 1E2PA 1ETSH 5AFZH 1Z83A 1OXTA 3W6NA 4D4LA 2WYGA 1VITG 4H1UA 2QPAA 1AE5A 1T0HB 5GXPA 3TGIE 5L3SB 4AC9A 5DYIA 4Q03A 4WXIA 3BRWD 3T15A 4G5QA 1XTQA 4DB4A 4WXPA 3RXHA 1YPGH 4C0JA 3EIEA 3SQWA 2GJAA 3TR0A 2Q3MA 1V2JT 2ZJZA 2LKCA 3DM5A 4DCSA 5H4IB 1SLXB 4YQFA 1HLTH 1W2KH 3TJVA 2AR7A 3ZZ7A 4JLVA 1YYY1 1NU7B 3GDVA 2W3IA 6GCHF 3GPLA 3LD9A 1B0EA 4UKDA 1KXDA 4L16A 2C9OA 4QL3A 4HB0A 4V03A 3A82A 2QEQA 2TGAA 3M4YA 1OIXA 2BD8A 3Q7PA 4LDJA 1JPNA 2FGJA 1O3MA 1GHXH 4PC7A 1EAXA 5C67A 3GY8A 1LQEA 3VKWA 4LHWA 2Y80A 3A81A 1DE0A 3UG6A 2O8BA 4BFSA 2QMEA 1KZGB 4HLQB 3DUXH 3WYAA 3ZVNA 1BMAA 3PYHA 2FM2A 4MPUA 1TNKA 4GOXA 4JZKA 3ZVGA 4MQBA 5EQQA 1QBNA 3TW4A 1P2VA 3CO5A 4UNQA 1KO8A 5DGXA 3AKDA 2QYIA 4HLUA 3PVSA 2QM7A 4Q4LA 2GF0A 3HYRA 5UKDA 3ATLA 2XNDA 1J8AA 2VGCC 2YYZA 3KB2A 1MR3F 5BWMA 5C20A 3MH7A 1Z8IB 4BZXA 1VG8A 1VITF 4Z0KA 4QHSA 2KBFA 4Q1CA 1SVMA 4LBVA 3PROA 3B2EA 2X1VA 4CBOA 4BFYA 5KTYA 2H7VA 2CMYA 2QA9E 4JBYA 4LHXA 1H9IE 2FH5B 1K28D 2GDDA 3W5IA 4JYVH 3STJA 1TYNA 1QRXA 4C3ZA 1Y3XA 5FUWA 5F9FA 1TMKA 1PPZA 1O2HA 1PJPA 5TV2A 2QRZA 1W36D 2O8WA 1SXJA 2QNRA 3KTAB 3MAAC 4LK4A 4Q01A 1C5YB 1FPHH 1NLYA 2F9OA 2F83A 2WWGA 3ATWA 3OY6U 3LY5A 4V0LA 3VR5A 3TK6A 4XBCA 3SV6A 1OKKD 3H0KA 1H4WA 1KY9A 1M9UA 3TJUA 1VMAA 1AS0A 1E9BA 4ABHA 4US2R 4CEHA 2A5AA 1KO1A 4AG1A 2ZRKA 1G16A 1R5NA 4M21A 2BMJA 4AN7A 1JRSA 2XCFA 1AB9B 2IK8A 5EUQB 1GL1A 3NBYC 1OH6A 1OHHD 5FL7A 1ZMNA 1W47A 2G5NA 3A7WA 1GNPA 3AK5A 3EXAA 1TF2A 2GBLC 1B23P 4KFUA 2NIPA 3TW8B 3A8TA 3SU1A 3VEQB 1GMDF 4J1YA 1N1LA 1OE0A 2CN0H 3UMFA 2GP9B 3LU9B 2FFBA 1BITA 1XM1A 5SZIA 5ABWA 1OXSC 2FX6A 5KNDA 4ZKEA 2GTPA 2VP2A 4RZUA 1TB6H 1XD8A 2H8KA 1DAEA 2DE9A 1RC8A 1K6MA 1HJ9A 4FWTA 4QXAA 1FAKH 3CBQA 2H57A 4HB4A 1B0FA 1UCYK 1US8B 1C9KA 1TRMA 3H86A 1T4GA 1NG9A 3MJHA 1ARBA 1UHBA 1Z6GA 4GSYA 3S1AB 3LH5A 2D62A 3ZS9A 5B30A 1TQ2A 2G00A 2FOGA 1E1RD 1JIRA 1RE0A 4HLDA 1Y3WA 1O35A 2ZVQX 1SFIA 1E9CA 1YLDA 1YVDA 2O9QA 1Q1BA 1XEFA 3SFVA 3CWZA 1G5TA 4ZAEA 2GJKA 4BTTB 4ZDWA 2CVFA 2ZITA 2FOHA 4DC9A 3DEFA 2OTVA 1W0YH 1ZNXA 3RWMB 3E1XB 1M7GA 1KKLA 2C8VA 2O8DA 3R9IA 3SNCA 2LPRA 1GRNA 2AGGX 3IBYA 4DIDA 3EPLA 2O8EB 2VHJA 3G82C 1N0VC 2FOCA 1B5GH 3GDUA 4JLMA 2O8EA 2BMGB 1V2KT 4D4KA 1GI2A 2YWGA 2C8XB 4P4TA 3THXA 4HAYA 2ZPTX 1FDPA 5DYGA 2BY8X 2JH0D 4IOMA 1BT7A 3GLGB 3AM1A 2ESTE 2ODWA 4AZ2B 3UMRA 3L3TA 1TMUH 1CJKC 4B3CA 3M37A 3GLGE 1V6DA 4MNYA 1DT2A 1XTIA 3T29A 4KKDA 2DFTA 4X6OA 1N6RA 4TYNA 3RS2A 3VFDA 4D81A 1G4UR 5DI9A 3MYWA 1JIMA 4B47A 1JNYA 1UO6A 4YLUA 2BV3A 3KQLA 1HNEE 2KJQA 2Z3DA 3P8GA 2QGZA 2BD2A 3SYKA 1BUIA 4ZHLU 1LVMA 1TL7C 1DSTA 1V2WT 2ZHEH 2I1QA 2QG6A 3RXEA 1PQ8A 1KI2A 4LJ5A 3RXIA 3AP1A 2ASUB 2OG2A 3B60A 4GFDA 1G3DA 4NG9H 1K1NA 2WPIS 1S4QA 1SR5C 5K8LA 2IC5A 1PLJA 3AVQA 4NU0A 3S69A 2JJ1D 3FOZA 2PEYA 4B2LA 3BTKE 2QENA 1MABB 1D3DB 3B23B 4AGKA 3P17H 5AJZA 4CBNA 2VVCA 3ONWA 2VWNA 2VP6A 4CR9A 2UZ3A 1FLEE 3HP1A 1HE1C 1UVOA 1OSSA 1GI4A 1OFTA 5C5NA 4A4DA 2CCKA 1Q57A 1U0LA 1SSXA 1YF4A 3RXJA 2OV2A 3VGCC 2G81E 1LFDB 2BVRH 2Z4RA 1SGRE 2B8TA 3AW0A 3REFA 1FX0B 5JRJA 2DB3A 3OY5U 1YPHC 1BJVA 1SOZA 1PQ5A 5T6FA 5FTKA 3K9HA 2ZR7A 3HU1A 5C2ZA 4WW0A 3ADCA 3A7XA 3JVVA 3F1SB 3CIOA 4CHAB 3A58B 2V55B 4A82A 1E2QA 1KI3A 4NTZA 4DIHH 1O2WA 2ZEBA 4Q7XA 4ZI2A 1S1CA 2R8RA 3H7OA 3A7VA 3W9YA 1VCOA 1ZM7A 3LOXA 1CS4C 1QJ6B 3WP1B 5L2YH 3VNVA 4HTCH 2GCHG 1A3BH 1XJ0A 1EUFA 1S0UA 1C2JA 2ZKSA 1DE7H 2Z3EA 2R6GA 1KI7A 1QA7A 2CGAA 4OHWA 2OFOA 3MSXA 5F8TA 1BHXF 2BDYA 1W44A 3L0OA 4X8HA 3VB4A 2ZCHP 4MPXA 1C1YA 3U7EB 2A45B 2C95A 3R7WB 2O8FB 1BDAA 4TZ6A 1JR3D 2ANYA 3M7QA 1HJ8A 4F92B 4P4UA 4D76A 4DLXA 2FLRH 5A2MH 5A5GA 1NM6A 1VGCC 2GBLA 2X8AA 1LTOA 1GRQA 2CVHA 1L2TA 1G9IE 1WXQA 1P2NA 2IWHA 3DD2H 2WKQA 5LPEA 2SFAA 3I32A 3BTEE 1XTJA 1BIFA 4WVFA 2B92A 1J70A 3SE0A 3AUYA 1YU9A 3RXAA 2JEOA 5JBCS 2HJGA 1TPAE 2J7KA 1W4BA 2VIOA 4JK5A 3EWSA 1A5GH 1HH4A 2XOKA 5DSZA 2Q6GA 3KF2A 5IK2A 4B3FX 1FIWA 2IOTA 2VWMA 1VYUA 2WJYA 2VIWA 1ACBE 1OS8A 1QIXB 1TX8A 2A5KA 4AYWA 1Z71A 3D8BA 4YLGA 3AF3A 4NYIR 1ZLRA 5AUQA 2D2EA 2GGVB 5EPNA 3W8NA 3P6ZB 1GHBG 5KO2A 2PW8H 3V4FA 1W5TA 2BQ6B 2IYUA 2H16A 3QNUA 4ZHMU 2GXUA 5A8XA 3NBFA 4LV5B 3TVJB 5F8XA 4E5UA 3SU3A 2BVNA 4IJMA 4BFZA 3ADKA 1W3CA 4DUGD 1UBGA 3DHKH 1I4LD 2GDEH 5JB8S 4DIEA 4WXRA 2YOGA 3NDBB 1V2ST 5FL3A 1ZYOA 1E4YA 4B2CA 3KL4A 2QGNA 5FCKA 1T5LA 3BD9A 1KI9A 3W5JA 2BD7A 2FPKA 2BY9X 3TUJC 4U30A 2REOA 4D0GA 1SG8B 1PV4A 4DDVA 1AKYA 1GCDA 1H8HA 3NKKA 1XXHB 2R3YA 3CF6R 4A9AA 1XMJA 3SQXA 1C5XB 2J0VA 5G41A 1P3EA 1QL8A 5IT5A 4LBYA 4INLA 3EC1A 1D2EA 1QBVH 3IO5A 3KDSE 2DWQA 1P2KA 1XEXB 4HZHA 1TOMH 1CKEA 1Q22A 2ZHFH 4G3XA 3IQWA 1E2IA 4QGAA 2C9YA 1VCNA 3CNNA 1WCZA 4KELA 5B58C 4MNXA 2VL7A 5TCCA 1E34B 4XH9B 3BEFB 4PANA 3BN9A 4Q4JB 1Q44A 1A4RA 1AKSA 1O32A 3M7UA 3LFUA 1AGRA 2XNDD 3ZZ9A 4JJKA 4C0BA 1V43A 3CNOA 3I29A 1E9RA 6CHAC 1E1QD 5DP8A 3RRNA 2PJRA 2D26C 2MSDB 4XIGS 3LC3A 3IHWA 4ZXYH 1AD8H 3GJ8A 1TNLA 3TUZC 1W0JA 3ECCA 3MCAA 1DAGA 2IL1A 1GI0A 3MO3A 2PR3A 5FBEA 1IQKA 2C4FH 3ITIA 3K9LA 1OPHB 1IQPA 1OH5A 1UKVY 2F1HA 2JAQA 4LC0A 1FUUA 1FL9A 2SGQE 3RNLA 4URWR 4LV6A 2F1JA 3V9PA 3SBDA 4UXHA 4WH8A 2A7JA 1Y5UT 4DLVA 1II9A 1UJ1A 3TNTA 2FPLA 3QPUA 1MU8B 3SU6A 2A9KA 3SJOA 1OOKB 3KKNA 2CE7A 1GL7A 1AVXA 1P09A 3EZFA 5D3MA 1FJSA 5C4MA 1S81A 3OAAD 2PSXA 4KFRA 3QIAA 1GWAA 4LX0A 3QX5H 3HGNA 3FFAA 4AB9A 1TGTA 8LPRA 1DDJA 2IS1A 4MRPA 5J4KA 5AJXA 3VTKA 1EZUC 5J5CA 4JYCA 2OESA 4WA7A 2FOFA 3QN7A 3K8YA 4ESVA 5SZJA 1CO7E 1O3YA 4IGDA 3GLHB 2CK3A 1RIFA 2NOAA 5LPNA 3RLFA 3BTME 1TNIA 2WOJA 1SVIA 2FG5A 1TX6A 1HAOH 2OHFA 2C96A 1KJYA 1GAJA 3BEIB 2IN2A 4QJ5A 3M3SA 1Z0FA 1OT3A 2VJ1A 3EX7C 1GILA 3F9GA 2JJ2A 4TL9A 2HT1A 3CENA 3KQEA 3HGPA 1I2DA 1SB1H 4RKJB 3QOFA 4BFUA 2V6JA 1M7BA 3I72A 3DKVA 4FUBA 2EC9H 4EFNA 1CR2A 2Z9LA 2XSZA 1GGDB 3C1KA 1G8YA 5TVKA 1SC8U 5C1YA 1DOJA 2IUUA 3GD7A 2G1KA 2BLOA 1IJFA 1MTNC 1OWEA 3CRMA 1AMHA 1P3JA 3ZZTA 1C4U2 3VPKA 1Y3AA 2LKDA 4OHZA 1ID5H 5E8EH 1NMZA 2A2XH 3GCTG 2AXPA 4LCBA 4TMVA 3LQQA 3ZZCA 5TY0A 1FN8A 2SGAA 4TLCA 1TPOA 5FCRA 1C1UH 3P95A 4KTSA 1EATA 5CHAB 3B85A 1DARA 2AGIX 1MQ6A 3LA6A 3ZV9A 1JQLB 1G3CA 2J38A 4MDSA 4IW4E 3UQOA 3LH1A 2Q6DA 3K0FB 4DJZB 3MNXA 2ZSEA 2PEZA 4B3XA 1L8QA 4K1EA 1QRAA 2VP0A 2UUFB 1GI8B 4A92A 1TFXA 1WQ1R 4XOIA 2F9BH 2AERH 2Y7XA 2O0JA 1BZXE 2Q21A 2YINC 5DHFA 2RA3A 3UR6A 3LWNA 5EOKA 3LDXH 3SQEE 5TARA 3PENA 1BB0B 2P95A 1DPFA 3KXKA 3VB6A 5TCAA 3OAAA 5G53C 3W90A 4LY6A 3PO1B 1O2VA 5C1UA 4Q1BA 2GEDA 1SQAA 1NO9H 4NGAH 4M53A 5T6DA 4LJYA 5DI3A 3CRW1 2CXVA 4X2YA 2TGTA 2C8YB 4P4SB 1ZU5A 1AZ8A 2BDIA 2REXB 4C30A 1TNGA 1LF0A 4MDEA 4OS7A 1XB2A 3RC3A 3LJJA 2W7SA 4ERNA 1JQJC 2OXSA 4E05H 2FEQH 1MKXK 3OEED 2AHOA 4ZCMA 3HPTB 2QXGA 2F9UA 2J9NA 1YPLH 3AAUA 3VXFH 4P4SA 2FYQA 4IC6A 2QI9C 1O5DH 2CNWD 4JLPA 4BAQB 1QJ1B 3CW2A 3B9PA 2P94A 1PPGE 1WQVH 4I33A 4HUTA 3RXGA 1C1VH 3KHVA 2H9HA 1SGEE 1GL0E 4JL8A 1DO2A 4EKDA 3A86A 2FTLE 3GISB 1N5JA 4ARZA 3GCTF 4RI0A 4MYCA 2ZU2A 1J7KA 1OWHA 3KQUA 3OIVA 2HGTH 2SGPE 5DP7A 4M1WA 2V35A 1AQUA 1PUJA 3LQRA 4TMKA 1Q3XA 3U8TH 1YGCH 1S0RA 3AASA 1KAGA 3BG4B 1DAFA 4QJ4A 3A1WA 4D2IA 4XFQA 2ANCA 1LW7A 2B8WA 4XBBA 4DDWA 2J94A 1UCYH 3A88A 1RRKA 3H4MA 1ELAA 3WRYC 3D7MA 3L43A 2R62A 3LDAA 2D7CA 1BTWA 3OYPA 2ZI2H 4W5HA 2P16A 4GP6A 4JKIA 4N1AA 4U02A 3QBVA 5IHPA 2RHMA 4KJZA 3T25A 5IRCD 4K8YA 1TLDA 2Y8EA 1IOEA 3AVUA 3DT0H 3JZ1B 4A8JB 1MD8A 2BM2A 3TNFA 1LHEH 5FTLA 3B78A 1SQTA 1KY3A 3W95A 1TPPA 4OHYA 3RXTA 3UNSA 2BKUA 5HYOA 1DWCH 3UY9A 4UNNA 2G8TA 5DP4A 4MKHA 1KMHB 3NVAA 2RDLA 3Q77A 1KI4A 1C5ZB 4RD0A 1HJAC 3T35A 1KHTA 1YZGA 3H5CB 2F91A 1EP5A 3ZZBA 3AVPA 1AKEA 4R8TB 2GK7A 5HM2A 4NYIQ 3OIUA 1FQKA 3FTQA 3AVTA 5HZHA 1AQ7A 2ZJ2A 1UDXA 2F1IA 3K6ZA 4BFWA 1ZSJA 2D8WA 2PX3A 5CLQA 1F5RA 3U69H 1FNNA 1SI5H 4TLAA 2WPMS 3MU1A 2B7BA 4XOJA 2FOLA 3T5DA 821PA 3MU4A 1DWDH 3SJBA 1U9IA 1RRPA 2WTUA 2OZEA 3MRSA 5FBLB 1BIOA 1M7HA 1FTNA 1XPRA 3KKOA 2FZZA 3KB1A 2O8DB 1OYQA 4UE7H 4RJLA 4QRHA 1O36A 4F91B 4ISLA 2BBSA 3RANA 1RW4A 4JT4A 2GHIA 5EJEA 4GAWA 5F03A 2FZ4A 4LGMA 4C0HA 2VIVA 3WRXC 3TQCA 2BD5A 4I1SA 2C99A 1AVWA 1YR7A 3RXVA 1WXRA 1FW6A 2CV3A 1P2JA 2ZFRH 2STAE 1AO5A 1L2EA 1US8A 3RS7A 3M36A 5GIBA 3PV0A 2CF9H 4B44A 1KLIH 2I6SA 2OCPA 2QPOA 2PLXA 2WPHS 1YPKH 4E06H 2AMPA 3O8DA 3RDPA 1TABE 3ZVLA 4A6PA 5AF9H 2V4ZA 2BBWA 4ZH8A 5JEEA 2AX4A 4BUJA 1P2UA 4AFQA 3X2SA 1RJ9B 4X1QU 3UQVA 1S6HA 3G0HA 2NZ8A 1AU8A 5DK1A 1JB1A 3SNDA 1TQ4A 4Q7LA 4KSBA 2IS4A 2ZI5A 2QQ0A 3RS4A 3SDZA 1RPZA 3U3RA 1ZYUA 2W00A 4LPKA 4INKA 1LS1A 3BH0A 4PTLA 2O8CB 4OS6A 2BQWB 3U7HB 4U32A 5DH9A 4TMWA 2IYVA 1FUJA 4E7NA 4PFSA 4AYTA 3B9FH 3SU4A 1UEIA 2PKSB 4TWWA 4ABYA 2XNSA 4QBIA 2VPPA 3CKLA 4F93B 5BW8A 1FV9A 1AFQC 2ONJA 2R6FA 2ZDNA 1IN8A 2WJIA 1GNRA 3AKEA 1UVSH 3PJRA 3A7YA 3LV8A 1XPUA 2QA5A 1ZD1A 1C2DA 4DSNA 2FEMA 3PG5A 1O5FH 2J59A 2NU4E 2CHQA 4LV8B 3RXBA 1JR3E 3GLHE 1G1MA 3FAOA 1XJCA 3Q7QA 4PHTA 2RCEA 2WV9A 1VHTA 2Z6BD 4W9MC 2VINA 2Z94A 2QN6A 2J3EA 1N6PA 2C8WB 2NWNA 1P61B 2HT6A 5FUVA 3A4NA 4A1FA 2O8LA 2J5XA 1O31A 4DWJA 2WPDA 4ZKSU 1D6RA 3AEZA 5FOVA 1OFHA 1ELBA 4B76A 1OF1A 4B3DA 1F3OA 1THPB 3SO3A 3UKDA 1HYQA 4DRZA 3KQNA 1NN3A 3MU8A 3SU8A 1N5KA 5GCHF 4IS5A 1IAUA 1LVYA 1O87A 1FAXA 3BFXA 1XUIA 1X3SA 2Q9BA 1LNZA 3W34A 2R6CA 2J45A 3ZV8A 1VYTA 1HAIH 3KN2A 3GFOA 2FWRA 4Q7MB 3SBEA 1NMXA 2V3CC 5LDDC 3K0SA 421PA 4US1R 1M34E 5CK5A 2RGNC 4XD7D 2P3FH 1CJUC 3PEVA 3B8JA 1YZTA 1YC0A 2ZR9A 3MG9A 1FQJA 2WUCA 1OFUX 2ZE8A 1PPCE 2J0UA 5AUOB 2ZQ2A 1EJNA 2ODPA 2HALA 1U0HC 3K09A 4U2WA 2QAJA 1NF3A 3QVVA 2IF0A 3FHTA 3QKTA 1F5NA 4QHYA 3BBPA 4I1OA 4Q02A 3EDXB 2Y6TA 1SLUB 1YPJH 1UK4A 3FKSA 3GLIE 3I3SR 4KXFB 1JJVA 2IXFA 3UPUA 1RJXB 3CWQA 5DG6A 3GJ4A 1OKXA 2RGGA 1E96A 1MBQA 3ZZUA 3QUMP 3RXMA 4DURA 3T1VA 3CPHA 5JCPA 1P04A 1ZRHA 1NJFA 2RGXA 1A3EH 4FMDB 4P31A 3K09C 1AZTA 3EPJA 2DYKA 4AX9H 3RXDA 1G21E 2GXQA 1ESMA 2PH1A 4THNH 1ZU4A 3IIMA 4DEYA 4Q4AB 1NSTA 3SOSA 2JJ8A 2ZRLA 4B33A 1R0WA 3B13B 4KP0A 4PC6A 1ZHPA 2V6NA 1XP8A 4PQYA 2ANBA 4O9VA 4MGIR 2PX0A 4W5WA 3DHWC 1YZLA 2VSFA 1G8FA 1OWIA 1N6HA 2AS9A 4R2IA 4DLWA 4NDZA 1DS6A 3CX7A 4TWYA 2VO1A 1H8IH 4K8BA 5EQSA 5AWFC 4O2LA 4YM9A 1IXRC 1XTKA 1TTTA 2ZDLA 1R5OA 1NRPH 1GHBF 4BTIB 1LS6A 2LWIA 2GA8A 1HDTH 3RU4D 3GLFE 2YWHA 2NO7A 4EFLA 1QB6A 4CRFA 4FUJA 1EQ9A 1CIPA 1E3MA 3DFJA 3IG6B 3EGKH 1ZVQA 2NU3E 4NYJQ 4KTCA 3RSOA 3AKCA 3QWCH 2CLCX 3AF0A 4GI7A 4X2VA 1T3LA 3PCRB 3WYFA 5C1XA 1HQYE 1KO5A 1GHVH 2QF3A 4NCHA 4X1PU 1SXJB 2ZDMA 3T2NA 1E79A 1COWA 1YE8A 3GEEA 1ABIH 1P11E 1NSFA 4JYTA 4OHVA 1KDQA 2IEYA 4JK6A 1AFQB 1L4UA 2YHSA 1HT1E 4CIDA 5DP5A 2D2DA 4WMDA 3EG5A 3S7KB 3FHOA 3QTVH 2GTBA 4SGAE 2GWHA 3LLUA 3OEHA 4HAZA 1E9DA 1FY4A 1VKJA 1Z0JA 2EI8A 1ZD9A 5HPYB 2IHYA 5JJLA 5CDFA 3PO1C 1DSUA 2XAUA 3LONA 1G7RA 3TIFA 1BBRH 2QC2A 3UWJH 1ZIOA 4MKGA 1V2UT 3TH3H 3LC5A 3VFEA 2WPKS 2XXAA 2AFIE 3UUZA 4E7RG 1TMBH 2WSSD 3PEUA 4GUXA 2V6IA 1QGFA 3VMFA 1IN7A 1MUEB 3U7GA 4FU7A 2Z9IA 3O8RA 1CA0C 4C7OA 1S3GA 3FGNA 3GDSA 3IO3A 3SV7A 1PQAA 2OE2A 4Q48A 4O3MA 1NLZA 2XGJA 2BMEA 4C7OB 1WB9A 3TQFA 4BANB 2AKYA 5L3RA 3X1YA 2GVDC 1ZHRA 4Y7BA 2G1JA 2JLUA 2YZ2A 2BXUH 4Q4AA 2GJSA 3UFAA 2C90B 4I7YH 3N7OA 3DOEA 4M1KA 2TGDA 1RZ3A 5EPYA 3QXXA 3I78A 2P3SA 3PV4A 4ZPXA 5DNYB 5C4GB 2ZA5A 4Q2KA 1OB2A 2BJVA 2GCOB 2E9SA 3RXUA 4RZ3A 2A5FA 2CCGA 4PO9A 3X1XA 5KOYA 1N2CE 1QA0A 1VJ9U 1QTFA 3ND8A 4ABJA 1F2SE 3BG8A 1IQIA 2FA9A 3GICB 4H42U 2WICA 2R0KA 2PLRA 1SBWA 4XWOA 2R2AA 3BV9B 2P5SA 1PJRA 1G3EA 4LBWA 1P9NA 1GTVA 5CB6A 1C5TA 4LK2A 1UBFA 2EWVA 3UNRA 1G37A 5JBAS 3GY5A 4MGZR 1ZGVA 1THSH 3QKUA 4NHOA 4KBGA 4NIWA 1U81A 5CYOA 2GZDA 1AK2A 1D4PB 4GP7A 1ZC3A 3L2OB 2R3UA 2N46A 2ALVA 1KSNA 2WWFA 1TEVA 3F3YA 1SZPA 2BD4A 1N0WA 3T27A 2ZRMA 3ZQJA 2W6JA 3PUYA 3GCNA 1MZDA 4A2WA 3C5CA 1OP0A 2PZEA 2FMJA 3KQKA 4I4LA 5EU8A 1T8MA 1BS1A 1SVPA 2P8OB 2NGRA 2RGAA 4QGHA 2JLYA 3N2EA 1SQ5A 2FTMA 3PMAB 1P2SA 4M1MA 2XTMA 4J0QA 5T6GA 1VR1H 4HZIA 4DSOA 1G6OA 2JLVA 3NXSA 5CHAC 5TDHA 4HDOB 1GBKA 1GDDA 1ANKA 4NWLA 1EAIA 4CR5A 1KDOA 3M61U 2RHDA 5A0AE 4ZHAA 1KSJA 4GHTA 4FINA 4MH0R 4Q7YA 4DVGA 3Q72A 2RB4A 3BTTE 2JLZA 4K2YA 1LF5A 5ESBA 2Y5GA 3ZVEA 3SV2H 1G6HA 2Q6TA 2Q1JA 3THWB 1X8JA 5GJ4B 2ZHWH 1HPGA 1P73A 3P8FA 1TADA 2NU0E 4JLAA 4TQ9A 4CRBA 1OH8A 2A1DB 2D3WA 1Y3VA 5G4BA 2XC0A 1JEEA 2GEVA 5JSZA 2ZU5A 1CHGA 3EASA 3KJHA 2QT0A 3ZS8A 1UTOA 521PA 4DCDA 5AJVB 1YPEH 3P26A 1EFUA 3RS0A 4B2AA 2QBYB 4HGCA 4EAQA 3NEJA 1N6YA 1A1VA 3CF0A 3SGAE 2CXXA 2VYFA 4JLNA 1Z6YA 1Z08A 1G7TA 1GHAG 2A7CA 2NO0A 3M7TA 1IAQA 4Q4HA 4PO8A 1KIMA 3B7GA 3AF2A 3WY8A 1P9UA 1FY1A 2G5VA 3D65E 4L9WA 2QSYA 7ESTE 3BGWA 1BTZA 5B6LA 4KI0A 4ZIRB 3WP0A 1UKYA 2VSOA 3TH2H 4Q9IA 5JECA 4TPIZ 1E9AA 5JHHB 1EJMA 4DCNA 1IQHA 4ABAA 1RTLA 4DSUA 1UPTA 1K21H 1X8LA 1EJAA 5KHOC 5EGMA 2W6JD 4MRVA 3RP2A 1W4RA 3Q3JB 1QHYA 4NCJA 3IITA 3BJIC 5F9HA 3KUCA 3SN6A 3GCGA 2GNOA 2QE7A 1J99A 3IPYA 5EXXA 5CJ2A 4UJ5A 1P06A 3SZNA 4MUAA 4A1TA 4WMFA 1DAIA 2A5JA 3P8NA 1KGDA 1C1TA 4F7WA 3TK1A 4ZIRA 4AKEA 2CMKA 1E0FD 1UVPA 2XBVA 1F0UA 2XB2A 1Y3YA 3LPRA 5C1BA 1R0ZA 1AE8H 4OI1A 4RFSA 1K1MA 1V2OT 1GJBB 2P59A 3QO6A 1SXJE 1QJ7B 1SGYE 3PB1E 1O3LA 2WWHA 2JGNA 4DEXA 1OIWA 4B34A 3E0NB 2ZPQA 1ELFA 1Q3HA 2Y5FA 2ZFSA 2WKRA 2P93A 4PQFA 4TZ0A 5BPEA 2XWAA 4AYYB 5C46F 4JMPA 3WNCA 1Y63A 1C1PA 3QI2A 3LNCA 3QEOA 4Q4JA 4CH8B 4EPTA 2FOAA 4K46A 1V2LT 1AQYA 3BB1A 3LIWA 2R6AA 2EYQA 1A5HA 2DY1A 1J17T 3TKLA 1WV7H 4RCYA 4DDUA 1LHCH 4JBXA 4OBEA 3TH4H 2PWXA 4RVCA 1K8RA 3D6TB 3RMOH 1V2NT 1MMJN 3PEYA 4TT3A 5H70A 3SHWA 4S35A 1S84A 1HUQA 2IT1A 5BQ5A 3GYLB 1ZR0A 3V00A 2TIOA 8OHMA 2DCUA 1O2RA 2O0KA 3CS0A 3BS4A 1IXSB 1C5MD 5HGGA 1YCPK 3IWMA 1MTVA 4H6TA 1WF3A 2W6ID 4JVSB 4ZMAH 3A7TA 1E36B 1M6NA 4JIMA 1DAHA 1GFIA 4URVR 1B0UA 1HAYB 4BAOB 2FPMA 2XBWA 2NPFA 2XTZA 2GCPA 1H65A 5LB2A 3S0NA 2HNTE 3PUZA 4ZROA 3Q9LA 2JIZA 3QG5A 4OS5A 4Y76A 4GZLA 1K5DA 4ESTE 3A8AA 3ZVAA 1GBDA 3TH5A 1G7CA 4ZV4A 1IOZA 4B2PA 3ATMA 4GNKA 1RYFA 4OJKA 1U9IC 1FPMA 5SGAE 3LGVA 1HAPH 2XYAA 5IF9A 2XXLA 1E32A 4RD6A 1PPFE 1A7JA 4NA7A 4FVBA 2DFKB 4II7A 3CX8A 4URZR 1YQTA 1TUEA 1A5TA 1Y3UA 5FUXA 1UADA 2IYSA 4DLYA 1EB1H 1RIWC 9ESTA 4B2IA 2RGDA 1O2PA 1KK1A 1GZSA 4FVDA 2J92A 1MKWH 3TVTA 2BM1A 1Q20A 2RH5A 1L1NA 1OFIA 1TGNA 5B57C 1DICA 4D9RA 1LHDH 1OV4A 1GBCA 4NFFA 5FTMA 3WMFA 1KI6B 4IVRA 1IHTH 1NLFA 2O8TA 5DN6A 1XPOA 2CHGA 2FSGA 3SJIA 2V7QD 2JATA 1FXYA 4LOYH 1XUJA 4Q1AA 1E2FA 1UVTH 3RXFA 1RXPA 3R9XA 3MU5A 3BB3A 2ULLA 2ZS7A 1KXAA 1GJ4H 3KFXA 2ZU1A 2CLDX 1C2LA 4ZO4A 3FMOB 1C5NH 3SU0A 2XZPA 4LJ7A 3NWUA 4EFMA 3LJOA 4WIAA 2IF2A 1RRFA 3WNBA 3H7TA 4OK5A 3T06B 1EK0A 3DZ8A 2ODBA 2ZC9H 2ZTZA 3DDCA 2F43B 5FOTA 2VA8A 2GV7A 3MNBA 1NU9A 1MO6A 4JSYA 4UFEH 5DP9A 1KSFX 1DXPA 4ABGA 2ODEA 4UFDH 1X1SA 3VR4A 1U6QA 2KBEA 2GVFA 3ZVBA 2GCTC 2FDAA 4XSKU 5IK2D 5FBWB 4TYDA 3A1SA 1TAWA 4RSGA 4DJTA 4BEBA 4Q9LA 4Z51A 1QURH 1A4WH 1FX0A 1SHZA 3RABA 4FXPA 1O2GH 4EPVA 9LPRA 3U44A 2EI7A 3ZIAD 1JOUB 4A2PA 4AG2A 1OKKA 4DZZA 4A5TS 1P9WA 4RD2A 1CT4E 621PA 4TL7A 1GI9B 1J8YF 1OXXK 1RVDA 4V0MA 4RFSB 1C1OA 3KFVA 3A1UA 2RCNA 1ZSKA 3BH7A 1QF9A 2AD5A 2CDNA 4FXGH 3CR7A 3LX8A 3UG7A 4M2LA 3SW2B 3BIUH 3BWDD 1MBMA 2JLWA 3U6BA 1HAZB 3S9AA 8GCHG 1QG4A 1LO6A 3QPWA 1MO3A 3F9HA 4BQSA 3UWKA 3E0PB 1GMCF 1ZNZA 4PC3A 2WWWA 3GLFA 3R9WA 4XVRA 1JALA 5EXSA 4XE4A 5HM9A 1YJ5A 5JEDA 1OJLA 3UANA 2W58A 2J0QA 4K69A 3GEHA 3U60B 2VHUA 2OC1A 1P01A 2PV9B 1CGJE 4Q9KA 2W26A 5K0HA 1A0JA 1LPGB 1NFYA 4KAXA 4I99A 1KIGH 2GEUA 1XEXA 3WXMA 1ZPBA 2O8BB 3AGQA 1SVSA 4KODA 5LD2B 4WJG2 3FWYA 2F4LA 3V12A 1E9FA 1H8EA 6CHAB 1NC6A 4Q9JA 1OP2A 1NIPA 1BHXB 4YDHB 1E2JA 1EWRA 3P92A 3VU9B 5ELXA 2FXRA 1XCPA 4HI0E 1S9DA 4DLRA 3EQ0H 721PA 2OBOA 1RTKA 3SJ8A 2B5TB 2ZRPA 3TBKA 2ZHQH 2A7HA 3RU4E 4K1SA 5EP4A 3WYGA 1KXBA 3PMBB 1J8MF 1DITH 3SJ9A 1F0RA 2AKAB 1P0SH 1D8TA 4ZCLA 1PFXC 4DCTA 3S7HB 4PPQA 1XXDA 3TE6A 4X1SU 3IBGA 1ZMXA 2GZAA 4PZZA 5K8IA 2FFAA 3DVLA 1W36C 2V3OH 3UOPA 4UDWH 1BRBE 5H68A 3QLPH 4X8VH 3K9XB 4Z1MA 2VIPA 5FTJA 5IDVA 1XD9A 3K70B 3GLIB 4DW2U 3BIVH 3GEIA 1W13U 1W8BH 3FP8E 2QP3A 2P2LA 1NVXQ 1RIWB 2WJGA 3LGWA 3SORA 4MNVA 1DG3A 2IYYA 3NDPA 1XVOA 1GKUB 1C5PA 1QHIA 1C2HA 1OPXA 1G7SA 1BYUA 2QUZA 2FESH 2HCJB 3NHBA 4JLDA 5FPKA 2OCVB 3EAJA 1NRSH 2GZ8A 2OINA 4NH0A 1EX7A 5HKKA 4EJSA 5KYKA 4JBWA 5FFMA 1HE8B 1T9HA 5EP2A 1TONA 3A84A 1CR4A 2FFQA 1RRGA 4RD3A 4TN1A 4YMUA 4DLUA 1XF9A 3U61B 4DT7B 4F4OC 4URXR 3FMIA 4V0KA 4ON9A 4FI3C 2ZZUH 1UAAA 3KEEA 1DO0A 1NL3A 3A89A 5CM8B 2C78A 4LXBH 2ZJBA 1SGWA 1VTKA 2FMXA 1U99A 5F2EA 3BC1A 3AUXA 1B7XB 3SN8A 4INHA 1CULC 1LHGH 2OBNA 2I3BA 4ESHA 1CGIE 4WWYA 3PTBA 3E16B 1NVWQ 2R9VA 2RGBA 1F0TA 3LXRA 1KJZA 2ORIA 4HYYA 5JI3E 2H1LA 1GJ5H 4ZUHA 1MO4A 1QHRB 2BOHB 2C3SA 4X8OA 4YO9A 2PKAB 4AKHA 3D23A 1N6XA 1G41A 1QQ4A 5IDKA 2MMGA 4IDHA 1ZTLA 5JZVA 4JYUH 4O25A 1CBUA 2JETB 3GJXC 1J16A 4MTBA 4L8GA 1ZZZA 3RMLH 3FE2A 1BA8B 4PSKA 4TSFA 3LT3A 3GCHC 1O34A 1GRRA 2NO6A 4RCZA 4D8NA 1HRTH 3NEYA 4MA4A 5J47A 4UJ3A 3ZQ6A 4BRWA 3U8RH 2QMHA 1FNMA 2J7PD 1EPTC 3IPXA 3PUVA 1F0SA 1BYIA 1ZNWA 1E0AA 1A2BA 1DVRA 4ABDA 2DWPA 3MOCA 4O03A 1Z8FA 2ODYB 3W94A 3RXCA 2F3RA 2F9MA 2QV1A 2WYJA 1BO6A 2RGEA 1LKAA 2XCNA 3ODFA 4KU4A 3RWOA 2Z83A 1WTGH 1BMFD 1C5VA 1G17A 3URDA 1DM4B 4Q7KA 1HT2E 5EE9A 2A2ZA 5K8UA 1NBMD 2QMOA 4D4MA 2W2VA 3SC3A 4KVGA 2MSCB 1SGPE 3CRVA 5HMAA 1AB9C 1BMNH 2BDHA 4YZUA 1BTXA 1F92A 5A8ZA 1IQJA 1Q31A 1JR6A 3SI4H 1W1WA 1WE2A 4N0DA 4Q21A 1UM8A 1ESNA 4IRUB 4BWYA 1V2TT 2QXHA 4ZKDA 4FMCB 1XUFA 3THYB 2QAGA 3RXRA 3TGPA 3Q5DA 1VYVA 2D2FA 1ANCA 1W0KA 1EKBB 2VVVA 2FF7A 1LB1B 3QENA 2ASEA 1XUKA 5EUMA 4YMTA 1SLWB 1SOTA 4Q4HB 1BTUA 3J81k 2XC5A 4WAUA 1N25A 2J4IA 3PMHB 1ZD8A 4FMCF 4V0ME 2V9PA 3EZ7A 3C15C 5M04A 3ELAH 3QF4B 1S6FA 3P1JA 4PZYA 1A2KC 1TALA 1DPOA 4B6EA 3QKSA 2YC4C 1F2TB 5DKMA 2QP9X 1P2OA 5A0FA 2YOLA 1NKSA 2P5TB 2ZYUX 1Z0AA 4AY2A 1UK3A 2UUYA 4L9SA 1C5QA 3T28A 2QORA 2A78A 3SV8A 2AH4X 1MKXH 3ZZ4A 2IJD1 1XWIA 4O0MA 3TSZA 1JMOH 2B9LA 1UTLM 2Q6FA 2XZLA 2YKGA 3VQTA 3F6UH 2AIQA 3LLMA 2F9PA 3GJ5A 3GOVB 5LH8A 3L6PA 4WZ6A 3P70B 1UTMA 3AVYA 3G01A 1ESBA 2B0FA 4AOQA 5IYTA 2ZJAA 4OQFA 1NY5A 4PXAA 4NIYA 4QNRA 2LCFA 5LPFA 5CITA 2OFWA 2VRWA 4M0LA 1NRNH 2SGFE 1U8ZA 2CL7X 4TPYA 4YOGA 1KXFA 1DY9A 4UXJA 2W2TA 4QKQA 2AN9A 1S2MA 4GOKA 3QBTA 4KGAA 4MRSA 2CE2X 1GJAB 1U90A 4L5BA 4NSYA 1YPHE 2BHRA 1BMFA 2H5EA 3K0FA 2BD3A 2A5GA 5JWHA 3PV2A 1KZ7B 3GJ0A 5GADl 3TMKA 2A0QB 2DPXA 1CE5A 3A6PC 1D9XA 3BOSA 3BTDE 4RKEA 3A85A 2C5LA 4MKIA 4LYJA 3ZD7A 1KO7A 2R9PA 1O3JA 1TNHA 1BOQA 2YNBA 1Y59T 3RMMH 4IOKA 1VJAU 4DT1B 1G2MA 2F6RA 3QEJA 1Z7KA 4IC5A 3QXCA 2GK6A 3MWYW 4V02A 4HLUC 1TA2A 2ZDKA 2CF8H 2PMKA 1GPZA 2WSSA 1NG1A 1VIAA 1EAUA 1G8GA 1GDUA 3N5CA 2DUCA 1AUJA 2NU1E 1E37B 2GMTC 2FP7B 4CW7A 1HA3A 1GCTC 3TLOA 3ZH9B 3KL6A 2BBOA 1UTNA 5KSYA 1QHGA 1BTPA 1A5IA 4IMQA 4B2BA 3KJIA 4NE2A 4FWIB 2HOBA 4E03A 3ADBA 3C7KA 1OIVA 3E6PH 1O2XA 1EOLA 3R3GB 5JS7A 3U9AH 4NYJR 2JCSA 1E69A 3T12A 1BBRE 1A46H 3MWLA 4LHZA 2IYQA 1ZTJA 1Q1ZA 3QDZB 1CGHA 4HSEA 4EUNA 3TUIC 1WP9A 1C2MA 3DOFA 3GJ7A 3DL0A 4E09A 1SGFG 4PHGA 1G4AE 3CONA 3DKPA 4JMYA 5JDUB 4OQNA 2KB0A 3OTJE 2BDCA 1W7GH 4Y0AA 4OKSA 1QCPA 1R5BA 3AVXA 3FFBA 4D0LB 2BZAA 2G4TA 2IYTA 2ZRJA 1XMSA 2OK5A 1PUIA 3L8ZA 1H1BA 4Q5IA 4PZLA 1W0ZU 3U4QA 3T34A 3QSYA 2FODA 4R2HA 2QIQA 3UWIA 3UIEA 3U5ZB 4KLNA 4X8LA 3D3QA 1IHUA 1EFHA 3I4LA 1CSOE 3KNXA 1KJWA 1N6NA 1AFEH 3Q00A 4GMXA 4WVPE 4Q1DA 3KGPA 4TTRA 1CHOF 3FZDA 1W2GA 1LPKB 1W7AA 1ZIPA 1QNJA 4F4JA 3RLYH 1YP9A 2BDGA 2RKOA 4XVUA 1Z6XA 5CMXH 2A3RA 2SNVA 2GX4A 2ZANA 2ZHDA 2BBTA 1EFRD 4CT4B 2OSBA 3U8OH 1AWHB 3EIHA 5FTNA 1C9PA 3B5JA 2C77A 1H8HD 1K1OA 1E9SA 3OE7A 2THFB 4YLQH 2G3YA 2H9TH 4DB2A 1A2CH 5KPDA 2QN5T 1E0SA 1S83A 1OLOA 3TPIZ
chains in the Genus database with same CATH superfamily
2ZTVA 4WMLA 3DFLA 2OCBA 3SIRA 3W3AH 3HO1A 1YNSA 3O82A 3R3HA 4I81A 2XNIA 2TMKA 2W5EA 5I46H 2Q2NA 1ZNYA 4AYXA 1R15A 3WWPA 2PHZA 5E7QA 4C3VA 2QXYA 1TYBE 2E4XA 5H0IA 1K9VF 1T1JA 2B4KA 3CQ9A 2YQ5A 1TZ2A 3ELWA 4TL6A 4XCXA 1USVA 4IIBA 4O29A 3ZE7A 4B32A 4XCVA 3PDCA 1P10A 4PYRA 1LI5A 2O06A 3PGA1 1MAVA 2HI0A 3G2HA 4WXYB 2R96A 3GP5A 2OXRA 2GJGA 1RCUA 1J07A 3ES9A 2V7BA 4M7GA 4MR8A 1GBLA 3QG1A 1YACA 3BTGE 1ZD3A 3UREA 4CM6A 3RVBA 2O23A 3PD0A 3V32A 3CUWA 4BX8A 5HILA 4KI7A 3O8LA 2IZ1A 2P9QA 3LKWA 2NU9B 5FNZA 4CH2B 3CUTA 5E6RA 2DT5A 4K03A 1ODLA 2EIXA 1KS9A 4F56A 5JS2A 5BR1A 1ZOMA 3RRJA 3EHEA 4EECA 4TMYA 2ZFFH 3UJ3X 5JBIA 3CVWA 5GJBA 3WWOA 3P20A 2GXAA 1E3LA 1KOFA 4BO6A 1A9XB 2P9GA 3BMOB 4HAIA 5IVIA 3UJBA 2DWUA 3CH4B 1I2CA 2NQ8A 2FQ1A 1NT2A 2V6FA 5CB8A 3HCBA 3STVA 5C37A 4LI0A 3HR7A 3BMXA 5LQUA 1ZSLA 3S3TA 1CE8A 1VBMA 2FF5A 2HPVA 2EKDA 1SXHA 2F9LA 1PN3A 1QQ6A 3AF4A 3D0KA 3PWZA 1N57A 1DVAH 1FYVA 4YRDA 2YJNA 1QU2A 4NDAA 5FX2A 1N1EA 4UCWA 1CT0E 1NGSA 5DISB 4MIYA 1CDDA 1XFDA 2C5HA 4L0MA 2WHXA 3L4EA 3N2ZB 4ZD6A 1N34B 4Y2HA 4ECAA 2WF9A 1IWOA 3AETA 5CFPA 4H6VA 4ARUA 3R6LA 3REQB 3WISA 4KQJA 1DFGA 2A5IA 1DT3A 1GIAA 2D7JA 4M8KA 2R751 5THQA 1W94A 1RTFB 4D56A 2L2QA 1MF7A 2VDPB 3GV0A 4DT4A 5IC5A 3K31A 1GL9B 4M0CA 4YMHA 4DS3A 1WVIA 4CQLA 1IQEA 3EIWA 4R3UC 2O0HA 3D8UA 3GN1A 1IK6A 3EARA 4FHCA 1AG9A 1PT6A 4UMDA 5EI5A 4K5QA 2UVPB 1DXQA 4TZKA 1GQSA 3BERA 3AH8A 2Z0MA 3PQCA 3T6KA 1XJQA 2HIGA 4CR6A 4DCJA 2Z8ZA 4EG5A 3TJMA 1FIUA 5HM6A 1CR1A 4D9IA 3HSYA 1TKAA 1VL8A 3AJRA 4TRRA 1T0JB 4AMZA 3KQCA 1YQGA 3SS7X 4ETIA 3I9V1 4YHHB 3FOEC 4UEHH 3M5LA 1BDIA 4JL5A 1ZPCA 2WKPA 4I5GA 1VB5A 2P4EA 3MT0A 3WKBA 4AZSA 2X8JA 1J15A 5HCIA 1JF8A 2P27A 4I9GA 1DEXA 1LVUA 3AHEA 4MRNA 3AUAA 5CJPA 1RM4A 4B6GA 1O3CA 4WINA 4TYNA 2O2ZA 3IR5A 1Y1SA 4WDRA 4PRYA 4GOMD 4W8HA 2F1RA 3L6OO 1HEUA 1R9JA 1TX7A 1P03A 3EDRA 3RARA 3T61A 4NKRA 2Z58A 1D3QB 4IF4A 2XPCA 4WE3A 3QZRA 4AFZA 3ZZNA 2FFHA 3RADC 3BX1A 2AW5A 1WUKS 4M89A 1XD2A 3NHSA 2QTWB 1W1IA 2ZJYA 3DWIA 2E82A 3FYHA 1A88A 4TWIA 4KFSA 3FOAA 5FUMA 1RBMA 1EB8A 1EDEA 1FRQA 3CBGA 3SUDA 2O7QA 4KWTA 2PS9A 4EPRA 4JT8A 2GERA 2WBLC 2QNBA 4CM3A 4JLOA 1SBZA 3JSAA 1ZONA 1P29A 4MWZA 5ARCA 1N2SA 1ZBDA 3A4YA 3LO5A 4JR1A 4R8RA 1A0HB