5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
2C5LA 2AK2A 3UTUH 2YV5A 4KI0A 3OHMA 2Z3CA 2J0UA 3RS7A 2O8LA 2SGQE 1CIPA 5FPHA 1Q22A 2DFKB 2BD5A 2QGNA 1W0KA 2H1UA 2C8XB 5F6MA 4DCSA 3A37A 2TRMA 5DSZA 2IA5A 4OI1A 1VCPA 3B1YA 4EKDA 2ULLA 3LC5A 1C2LA 1Z6XA 5AUOB 1SOZA 1HFDA 1OPHB 1XUJA 2VWLA 4HAWA 1O3DA 2YVUA 5FL7A 2JH6D 3ZZDA 1E96A 2W83A 1NSTA 1F60A 4ISIH 4R0IA 2F9LA 3SHAH 4M7GA 1ID5H 1OP0A 1GKUB 3ELAH 4OS2A 1CQQA 2GWHA 2BDGA 1A3EH 6GCHG 2LNCA 3BE4A 4I99A 3VKGA 3KQEA 1C1OA 2P59A 1E2FA 1V2ST 2Z9LA 1BOQA 2BY5X 2VGCB 5FHTA 2G88A 1ETUA 5CLLA 1XJQA 2ZP0H 1ABIH 1MT0A 3TITA 4OK6A 1EKBB 1W1WA 4NKRA 2PTNA 4OQMA 5C2JB 3VKHA 1KO7A 1KI1A 2WKPA 5FTMA 3BG4C 4B3XA 2OFOA 3RXCA 1ZHMA 3B9FH 3QI2A 1JEEA 1BTPA 1ZBDA 4C9BA 2RGNA 1F2UA 1AIXH 3VAAA 4JJKA 1HB0B 1FN8A 2FSIA 2F3RA 3MFYA 4F7WA 3RSOA 4OS7A 1GTVA 3M0EA 2J1LA 3TUJC 2OCBA 1F5NA 5ESTE 3K8YA 5DH9A 2GXUA 1GI5A 1S0UA 1HLTH 2FZZA 2HLCA 2CJIA 1NU9A 3RLWH 3MSXA 1BKDR 3CR8A 3SN8A 1YHNA 4O03A 4MTBA 2PBRA 3HYTA 1T4GA 2ORWA 3OEED 1SFIA 4IVQA 5DP3A 4TYPA 3RU4D 1VCNA 1JR3A 3ZV8A 2W6ID 3FOZA 4XSHA 3L0IB 4GI7A 1C2HA 2O8BB 1P10A 1KO4A 4B43A 3AEZA 2THFB 1BB0B 2BTCE 2IYYA 1HAZB 4FU9A 1F7ZA 3MNXA 2ZETA 2FA9A 3TPIZ 3UQOA 3A1SA 1VCOA 2PMKA 2J92A 4PQFA 4FINA 3MLEA 4B6EA 4JK5A 5H1YA 1UADA 1CTQA 2Q6TA 4Y0ZE 1GMHG 4GVUA 4K2YA 4VGCB 2QQEA 1OXTA 1GHWH 4KXFB 3RC5A 2AMPA 2FX6A 1E94E 2WPLS 3K9LA 1Z0AA 2RA0A 4PHFA 2PGQB 1JJVA 2ZQ1A 3GCTF 3X1DA 1YE8A 2IEYA 4TT3D 3VXFH 3T5FH 1Q44A 3A8TA 4BRWA 4XDEA 1LF0A 4JLNA 1MTNB 2V35A 1XMSA 1G3RA 1W0JA 4DIIH 1TL7C 3KQDA 2P6UA 7KMEH 3LRPA 1MO6A 3ASZA 3FZDA 3UQVA 4URVR 2Q0HA 1YRAA 1T8NA 1GP2A 4Q18A 3IHLA 1D6WA 4Y10E 1SKYE 3TVTA 3RU4E 3A7WA 5FAHA 5HE9A 1HE8B 3RLYH 3BXZA 1LQEA 1H8HA 2ZUBA 3OEHD 1QBVH 1O2LA 1ELGA 2LKDA 3RMNH 1UJ2A 1W2GA 4Y76A 1UBGA 4MNVA 4NTZA 3RXHA 1S84A 2B8TA 2VH0A 1SGFG 4FU8A 2J7KA 2VO1A 2CHQA 3AV0B 3W3AA 2BBOA 421PA 3W8RA 3BTME 3U98H 1C4OA 3UNRA 1MOZA 2QPTA 2WKQA 1EASA 1SLWB 2ZTSA 1CJMA 1X8LA 4IW4E 4P33A 2XNIA 1WAYB 1SGRE 1P2IA 3FE2A 3AVTA 2VNTA 3BIFA 4E7NA 5JBAS 1QHRB 1CVWH 2BOKA 5GADl 2ZRIA 4KO8A 1QGFA 4TYQA 3PEVA 2CNWA 1SR5C 4MITA 3VPKA 1J7KA 3ZDQA 2FO9A 3L2OB 1N8OB 1FI8A 2FPKA 2IX3A 4M4SA 4K1TA 3PLKA 4IC5A 3SZNA 4S2EA 4ABDA 3EZ6A 1KI9A 4RZ2A 1J70A 4KVAA 3AAUA 4LJ9A 4B2IA 1O2OA 3K2UA 1XKAC 1KTSB 4KGAA 4Q9HA 1O2GH 4MGIR 3SV6A 5TARA 1J15A 1G30B 3VXEH 4Q80A 4GFDA 4INLA 3IG6B 1WCZA 4RKOB 2W7SA 1A5GH 1AMHA 2NQ2C 4UXJA 4X8SH 1Z3IX 4FN5A 2P2LA 1A3BH 2ZCKP 1V2LT 1TB6H 5KDLA 3A80A 3ATLA 1NFUA 1KSNA 3DD2H 1Z7KA 3SJZA 1PV4A 1P2KA 4M2LA 3RNLA 2BOVA 2IYSA 1TNKA 2ZRJA 3IUYA 3DFLA 3FMPB 2DFLA 3GYMA 3QF4A 2EA3A 3U6KA 1O3AA 4YDSA 4TY7A 3ZYDA 1P6XA 2JLQA 3E2IA 3M5NA 1AQUA 3ZVAA 3RM2H 3WNDA 2ONKA 1Z8IB 1KI6A 2BDAA 3SQXA 5T1VA 4PZYA 4POAA 4OHVA 4JYCA 2J0VA 3RXPA 1C5UA 3UNSA 1OWIA 4Q03A 4TYWA 1GMHF 1FP6A 2SGAA 3A1TA 4DSTA 4V0ME 3I92A 1AIPA 2BVXH 3PTNA 1YR6A 3H5CB 2GZ9A 2ZROA 1GJCB 2Z6VA 3C15C 2PCJA 1MBQA 1MO5A 4R8TB 2RCNA 3W5IA 3QF7A 1ZPBA 5DI3A 3P8GA 4MVNA 1AY6H 2R9VA 5J4YA 1ZSLA 5FBVB 4LYFA 3RRZA 1KYIA 2Z5FA 1P72A 5JEDA 1NJGA 1KGDA 1N5LA 5EQRA 2PSYA 1LW7A 1CLUA 5J4HA 3SBEA 2CLSA 4MKFA 1QJ7B 4YT6H 2A5DA 4AGKA 4LJ5A 4ZO4A 4P3YA 5DP7A 5KNDA 2HF8A 2IS6A 3LGIA 4A6LA 2W5EA 1XCMA 2WPKS 2QGRA 3IBYA 5L2YH 1D3TB 3AUYA 3SJKA 3K0AA 2IJOB 5EGMA 4A2PA 2QF0A 3MI4A 2CXXA 1DOAA 1GHVH 4ZUHA 3UG7A 1Y3UA 1OH5A 3QY0A 2IXFA 3GY3A 3PTBA 3WP0A 3ODFA 4BQSA 3TK5A 4XWOA 4Q1DA 3CRW1 4ZKOU 3EA5A 1LVOA 4ZI2A 4NIVA 4PFSA 3GJ0A 4NPHA 2EEKA 4FCWA 4L16A 3AVUA 4D8NA 4OGXA 1Z63A 4V0KA 1MZAA 3CM0A 5B57C 1TGNA 4XVRA 2UWPA 3KFVA 2V55B 5CIQA 4TPIZ 1OFUX 3GLHE 3AVZA 2ZDAH 3A8DA 2CBZA 4JLBA 2OP9A 4HEJA 1P2OA 3BC1A 3HPRA 2VP6A 1W4BA 5TXGA 2VP0A 2GEUA 1FOEB 2CHAC 1UKZA 1HJAC 4TL9A 3QJYA 5EJEA 3BEIB 3SU0A 3T2NA 1R10A 3IGFA 2JLUA 4GOXA 4IN1A 3O8CA 6Q21A 3PIRA 3MJHA 1U98A 2QF3A 1Z6AA 5ELXA 3MWJA 2JJ2A 1O87A 1Y3VA 5F3WB 2YWHA 4KFRA 2BKUA 2W2XA 1BTUA 2Y80A 1GL0E 4D0GA 2EWWA 3ZZAA 1FNNA 2C98A 1TE0A 4HLQB 3CONA 2NPFA 2GD4B 1E0AA 3B82A 1R8QA 1JOUB 4MYUA 4SGAE 2UWLA 5IDVA 4EFNA 4OJKA 1KMHA 1JBUH 3LIWA 3ZYEA 1L2TA 1JNYA 1P7CA 3GJ5A 4MNYA 2ZEJA 1SVKA 1T8UA 1EFCA 1GKIA 4IXNA 1P60A 2A45B 3TW4A 5FL7D 5KU1A 4PHGA 2R62A 4JJZA 1AB9C 5JRJA 1HDTH 3QQ5A 5CE1A 2FS8A 4HB3A 4QJ3A 1OP8A 1VHTA 4NIXA 1SB1H 2ZS8A 5DP9A 1Z8RA 3TK9A 1RJ9A 2B7DH 2ZIQH 2QG6A 1G2LA 5L3VA 1TNGA 4XE4A 2H1LA 4CRBA 1TTTA 4GL2A 1AE8H 1Y5UT 3KJHA 3QPWA 1KK1A 5IK2A 5JECA 3LQQA 5CK5A 1II0A 3HK3B 3B6EA 3B1WA 4YOJA 1NBMA 3HU2A 4LOYH 2B0FA 1U2RA 4FVDA 3K70D 1EB2A 4HAXA 1HAOH 3U3JA 2O8DA 1YLCA 3TR5A 2D74A 4D9RA 2SFAA 4MGYR 4NYIQ 4Q1AA 2JETB 4HLUA 1II9A 3KNXA 4HUQB 1FFHA 1UCYK 1C2FA 1OYQA 4GLYA 3ZVMA 4HLUC 1UTJA 1PPCE 4BLRA 3UXMA 4IFBA 3DM9B 1ZHPA 2C77A 1X7AC 5A8YA 1KJYA 4IXMA 3HPTB 3R8CA 3BERA 2D7CA 4PTLA 3S9AA 2HRVA 4B35A 2QM8A 1DLKB 2RGXA 1R0ZA 3SUGA 3EA9A 1B0EA 1FL9A 2ZPRA 4L9WA 2FX4A 2JCSA 1GBHA 3KQUA 4PR0A 1G36A 4BRUA 3W5JA 3EE0B 4YXWD 4GMDA 2XXAA 1CRQA 3T25A 4KODA 2FEOA 3RSLA 3M6AA 1DY9A 1JR3D 1S2MA 3VR5A 3NKVA 2ZHFH 2WICA 5G41A 2I6SA 2JASA 2Z94A 4ZH8A 3TGIE 1TF7A 1G3UA 4U7DA 1TMBH 4Q4JB 2O8TA 5F8XA 1HE1C 3K0FA 2BZAA 2QMOA 1IOZA 4OJQA 1PQ7A 2ZU0C 2ZSFA 2NO1A 5FPSA 1JJ7A 2G3YA 3CPJB 4NCJA 3MFJA 2G5VA 3B9QA 4Q7MB 2WWWA 1QA0A 1W48A 1TNLA 2OLGA 4W5HA 4FUCA 1QJ6B 4OKSA 3EC2A 2GDEH 4Q02A 1SGEE 3CENA 2B7CA 3TE6A 1ZMJA 1VJAU 2F91A 1EZXC 3O8BA 2VF8A 1OSNA 2OAQ1 1AO5A 5HPYB 2ZRNA 5JI3E 1GBKA 2QIQA 2OBMA 2ZDKA 3EC1A 5CIWA 1W0ZU 1OPXA 3CRVA 4XD7D 1J8AA 1F2TA 4IW3B 1UK3A 1Y3AA 2G77B 2PKSB 3B8HA 1GBAA 1NIJA 1ANBA 3MYWA 1V2QT 2KAIB 1P09A 3DPUA 4P4SB 3FP8E 4WW0A 2VU8E 2X1VA 4LUCA 1O31A 3CB4A 1Q1EA 2FODA 1NN5A 3QKSA 4KFUA 3MHWU 1BOFA 2QP9X 1H9HE 4BFZA 4D25A 2GZ8A 1XM1A 1FIZA 1CBUA 4IN2A 821PA 1Z0KA 1H8HD 1M74A 2CE2X 3SUFA 2VVCA 3I72A 1L4UA 1Z71A 3OEHA 1J99A 4RI0A 3IIJA 2ODBA 2XB2A 1TPSA 3GCHC 1RRGA 2ZDNA 2JLYA 2NU4E 3WNBA 3EX7C 1Y3WA 2ZRBA 2GA8A 3B23B 3VB7A 4JKIA 2A7JA 3PV5A 3GLIE 2CMKA 1QQUA 2IYLD 1GI8B 4NCIA 2DE9A 2Q3HA 1P3EA 3FP6E 3KKOA 2OC8A 3L3TA 1XFAA 2WPHS 1QL8A 1P5ZB 3FVQA 1UTNA 1R5OA 1A2KC 1DEKA 2IYUA 4A1TA 1A0LA 3ENSB 5BQ5A 4M22A 1QB6A 3PM3A 2FP7B 2TGPZ 3SU2A 1Q2WA 2VH5R 3TQCA 1AU8A 4ZKDA 3KQLA 2F9UA 2GCTB 2IHYA 2ANKH 3THXB 1EJMA 4MGKR 3H0KA 1JQLB 5AHGH 5F2EA 3ZQ6A 1FNIA 4JVMA 4TLCA 2DWPA 3TNFA 4LV5B 2QY0B 4V0OA 2Q9BA 1W2HA 2OXCA 2HVXA 2KE5A 4P31A 1O5FH 1SGIB 1Y5AT 3Q9LA 4B2CA 4Y0YE 3EAQA 3TRFA 4TTPA 1G6HA 1QZXA 2OO7A 4DIEA 2RHMA 2G8TA 2GF0A 3P95A 5FI1B 3QWCH 4Z8XA 2FE4A 2I1VB 3WMFA 1IXRC 1ZSKA 3QGNB 1AUTC 2O8BA 2ZPTX 4GHQA 1E2HA 1V3XA 1Z2CA 5JRZA 2VJ1A 1A61H 1TADA 1BMNH 1KSFX 3IPXA 1QRAA 4LZ1H 2ZZUH 1GVZA 1C5NH 1XX9A 3EZ7A 3U3OA 1W3CA 4GSOA 3VB5A 2XWBI 1NFWA 1IQIA 4LZ4B 4ZHAA 4KBFA 3IIMA 1NU7B 5HXFA 1GVLA 3GDVA 3THOA 4Y79A 1XTSA 1P2TA 2VYFA 4QXAA 1CT2E 1OH8A 1DWCH 3W90A 3EG5A 1W7GH 4C0LA 3BBPA 3IIKA 3EAJA 2PR3A 1CP2A 2WOOA 4Y7AA 3AKYA 4LYAA 3T1TA 4GZLA 4LJYA 3CRMA 3NEJA 2HDNB 2SNWA 1ZGIA 2BLQA 3WNCA 2PJRA 1R7RA 5DO4H 1UEJA 5EW1H 4D80A 2ZA5A 2JAQA 4J2YB 3DMNA 1ZNZA 1DAHA 4ZDIA 4HAZA 1T7CA 4RVCA 1VZQH 3GCTG 3SBKA 1U0LA 3JZ2B 2JEOA 1V43A 4QHYA 2HXYA 5CHAC 5C3NA 4EPYA 5TV2A 2GCHF 4ABHA 1NNEA 1G3MA 2BX4A 2REXB 4TQ9A 2FG5A 3P32A 1NG1A 2GP9B 5KPDA 4TN1A 4UNQA 4XWKA 3EPLA 1N1LA 4NCKA 3TMKA 4EJSC 1UF9A 1NN1A 1MH0A 1QHIA 4IOMA 1I4TD 3QEJA 4CBNA 1QB1A 8ESTE 1Y3XA 2F1HA 5JB8S 2ODQA 3GEEA 2YOGA 3CRRA 2ERXA 3SQHE 1GBDA 3KQBA 2WV9A 4LC1A 4MQAA 2PLXA 4XSKU 4JL8A 1C2DA 2Y7XA 2AFIE 1SL3A 5L30H 2BLVA 2FOFA 3UANA 1RXPA 4TWWA 1IHSH 2WJIA 4NH0A 1KDPA 2O9QA 2WVJA 3S69A 5EQQA 2W3IA 4K8OA 4QG7A 1W44A 2A3RA 2QN6A 4NDZA 5D3MB 4O2LA 1BDAA 1E35B 4Q9JA 2ANWA 2XW9A 4CH2B 1XCPA 1IJFA 1BRCE 1N6LA 3PUXA 3GJ7A 1DS2E 2BM2A 5DN6A 1YU9A 4ILEA 4IOKA 2AHOA 1Q20A 3RC6A 2WPDD 4PO8A 1YKTA 1GITA 5FR2A 3BTQE 1A5IA 1SVWA 2EFEB 3P70B 4CRFA 1LNZA 2GJSA 2OV2A 1CGIE 3LGWA 1COWD 2EVWX 3GPLA 1OB5A 2ZRLA 4PAOA 2QSYA 3AGPA 4AG5A 5B2ZA 1P12E 1AVGH 3MCAA 4AK9A 3M3VA 5C4MA 3KUDA 1E37B 4F4JA 4A8JB 4AYYB 2AMQA 4GCHG 1YPGH 1F0UA 1AHTH 1ZM4A 1VG8A 1XMVA 1WUNH 2ZS9A 1KK2A 4AFZA 2WMNB 3GY7A 3BK7A 3RXGA 1EATA 6LPRA 4A92A 4N3NA 4Q66C 5IK2D 4FUGA 1FXYA 1HY3A 2OCPA 5UKDA 3S7HB 4PZZA 5AUPB 1OXGA 1W36B 4TLAA 1OIWA 2FYQA 3ZZCA 1ZMNA 1Z28A 3DO6A 3WYGA 1LVMA 3T1QA 2IF0A 2Y82A 4Q1FA 1J90A 4BWYA 2VP5A 1NMZA 1E2LA 3HGNA 3RP2A 1ANCA 4Y11E 3AW0A 5A8XA 1ZU5A 4ABGA 4A4DA 1KXEA 4FVBA 2BQWB 2HNTF 1KSGA 3VGCC 3B1VA 2GBLC 1HGTH 1DG1G 4QM7A 1D2NA 1H8IH 2GCNA 1LKBA 1XNJA 3WMEA 1G41A 1MBMA 5A0BA 3ZZ3A 1F2SE 2A5AA 4Q9KA 2FOLA 1K28D 1AS2A 4DOQA 1KLTA 3E90B 3RUOA 2C8WB 3OIWA 3NHAA 3RYTC 9ESTA 3DHKH 5FBWB 4PHHA 5L2ZH 4G3XA 1HYLA 2PX3A 4I4LA 5C5OA 4NZYA 1FUUA 3TH4H 1K1IA 4JT2A 3GP8A 1VYUA 3VQTA 1ELBA 3TSWA 5F9FA 1GI9B 1QURH 2AWOA 2ZECA 2OBQA 2GK6A 4OGYA 2V8OA 4IVPA 5EE0A 3RVBA 4IRUB 3THYB 1ABJH 2VBCA 3MUFA 2GETA 1SVSA 5C1XA 5L3SB 4BLQA 4XJXA 3U2QA 2CK3A 1E36B 2QMUA 1S4QA 3LXRA 4AGJA 1S5SA 1YR7A 4GUXA 1O2UA 1H8DH 5T6DA 1K21H 1A4RA 1MTWA 2W2VA 1RRFA 2BY8X 2BQ7B 4DVGA 2GZ7A 4O25A 3PEUA 2DCUA 2R6AA 2GGVB 2ZJOA 2YC2C 4ZIRA 1BMFD 1XU4A 2QN5T 5DISB 4FUEA 3M1IA 1ZTLA 7LPRA 1P0SH 3KKPA 3KL4A 1G6OA 4D4KA 2ZDLA 2OD3B 1DAKA 2C90B 1TFXA 4ZKRU 4JYBA 2QI9C 4KYIB 2WYJA 4URWR 1IQFA 3AVWA 2J5XA 1AI8H 2W6JA 1YPJH 1OF1A 2OFWA 4M1SA 3QOFA 1GJ6A 4LX0A 2DYKA 5DPAA 2ECKA 1QG4A 1ZW6A 1GI1A 5EZ5A 3UNQA 2UUFB 2YOFA 1HXFH 1OYTH 1ESAA 4LBZA 1ANDA 1GG6C 1QHNA 2KJQA 4X1RU 2XSZA 4CEIA 4QKQA 1QBKC 2QE7A 1P3CA 4E09A 3OYPA 1NSFA 3ZD6A 1P8VC 1YZGA 1SG8B 3FPAA 1O2TA 3ADKA 4QNRA 1W10U 5F03A 2V1XA 1D9IA 2ZDVH 2ANYA 4TMXA 4JZFH 1V6DA 1GGDC 5JEEA 2D62A 1W11U 5EUQB 3SW2B 5DI3B 3AK5A 2HYDA 2XCNA 3R9XA 5A0CA 1MRSA 2XBWA 2ALVA 1RIWC 4FU7A 1UTLM 4TZ0A 4CR5A 4ISLA 1G8HA 3TBKA 4BTUB 4BPBA 2XTMA 1JXMA 1M34E 5GJVC 2PJZA 1GBCA 1LV7A 2A7HA 5JJLA 2ZI9A 4B33A 2VWOA 4LHYA 3RXEA 1Z83A 1SQ5A 1EZSC 4CVNA 1JPNA 4CF7A 2WTUA 1L2EA 3VU9A 2ZR9A 4CHAC 1O2KA 1XX6A 3ICQB 1KJZA 1TIOA 4K46A 4Q48A 4FUHA 4WIAA 2VWNA 1NZQH 4P4SA 2ZQ2A 3TKLA 4B3GA 1JIMA 2JH0D 1OP2A 5CB8A 3KJIA 2ODNA 1GI0A 4Q9IA 4LJ4A 1GJ4H 5DK1A 4ABJA 4QL3A 1KXAA 3THYA 4JMPA 5JPMH 4MA4A 2BQ6B 3W9YA 1ETSH 4BTIB 3U44A 1CJVC 2HPQH 1JRSA 4DDTA 3BEFB 3C16C 1BYUA 2ZUCA 1G3DA 1LHCH 2E87A 1YC0A 3BH0A 1C2IA 3RS4A 2NZJA 1PLLA 3RXDA 2ZVQX 1UTQA 1FY1A 2BDCA 1JMOH 1VITH 1A1VA 3AM1A 1T32A 2HT1A 1QRWA 2NG1A 2UUYA 1DAIA 4B3BA 1VCQA 4DJZB 3A6PC 2XTNA 1XRJA 3QBVA 4WMFA 3I8XA 1Z29A 4KP0A 1CHOF 3HWSA 4M1MA 1ANEA 2BVSH 4ZKNU 1YRBA 5C1BA 2SHKA 2HALA 2QMHA 5AJXA 2HCJB 2W58A 4AYXA 4Q1BA 3QIAA 2B8WA 3R7WB 2VP4A 1NIPA 4OQXA 3HR7A 2PEZA 1KK3A 3BAFA 2A2ZA 1TPPA 1OWDA 2PEYA 2B92A 4MUBA 2R3UA 1PFXC 2DR3A 3ATWA 4OS6A 4M9SA 4US1R 2Z3DA 2O8MA 1Z0IA 3RXKA 4XSGA 4M21A 3SJIA 4RFVA 1EP5A 1ELFA 1AKSA 2AMDA 1E1RD 5LDDC 4B73A 1QFKH 4L8GA 1BS1A 1E4YA 2D2FA 2XOKD 2Q6DA 1FAXA 2QMEA 3GISB 3QZQA 1QJ1B 2ZYWX 2BMDA 2GJKA 3RRMA 2QYIA 2XZOA 5T3HA 2RDLA 4MDSA 1TUIA 2KAIA 1R2QA 3OU0A 1MTVA 3HDTA 3RM0H 3U3MA 1TX8A 4B2PA 3C1KA 4TSFD 4DSOA 1E9AA 1GUAA 1A7SA 5EE9A 1N6YA 1UTPA 3UUZA 3OZXA 3Q72A 1WBBA 3ADDA 1G8GA 4E06H 2H5DA 1IXSB 7ESTE 1GI2A 2GVFA 2F3TA 5FOVA 3BJIC 1V2RT 3ATKA 3L0SA 2AIQA 4BFVA 1J16A 3L43A 2G00A 1B23P 3CS0A 2RGCA 4LSGA 5FR1A 3S9BA 2IJD1 4ZKSU 3H09A 3P26A 3F1SB 2O8EA 2NZ8A 5KNCA 4TWZA 4B44A 4BLSA 5CDFE 1EP6A 4EJSA 4KTSA 1TQ0B 3PMHB 1UPTA 1G17A 4UEHH 2JATA 1HNEE 2IWRA 1C5QA 1ONBA 1BMLA 3ZS9A 5LPRA 4WWYA 1HCGA 2WSSD 2WWIA 4JYUH 3E1SA 3TH3H 1NVXQ 2XRCA 5BPEA 1W36D 3AVVA 2GBLA 4JZIA 1IY0A 5HKKD 3K09C 4TL6A 2UZIR 1AKSB 4H6SB 4LDJA 3MGCA 3HATH 1NRQH 2Y5HA 1SXJC 1RW4A 1O34A 2GCOB 2P67A 4MUAA 1O0DH 3PENA 3CZPA 2CGAA 4UDWH 5KUTA 2BC9A 2A4OA 1EGAA 1LB1B 1VJ9U 2XGJA 5CK4A 4QHSA 2P3TB 3X1ZA 4ZXXH 2C99A 3E6PH 1EWRA 3R9IA 1PJRA 4DCNA 3V13A 1RJ9B 4DLXA 5D3MA 4I1SA 1N0UA 3QENA 4C0SA 5K0HA 2QAGA 1QL9A 1RIFA 2P3SA 2YWFA 5C20A 2AXPA 1O2XA 2BD9A 3SEAA 3O8RA 2JDID 4ESVA 5CYPA 1W14U 3CF0A 5SZIA 1DXPA 1GMDG 4UKDA 1KY3A 3D8BA 2HYIC 5HZKA 2IYWA 4MPUA 3A4MA 4JVSB 1XB2A 1TGSZ 1OLOA 1OKXA 4B1TA 5KOYA 1NTPA 1C4Y2 3L33A 1NI3A 2STAE 2N46A 1THSH 2XX3A 2AD1A 4UJ3A 1P9NA 2FX3A 1FUKA 5EUMA 1AGRA 2E1RA 4HZIA 4CEHA 4M1KA 1G8FA 4PC7A 3UPEA 2R8RA 3EXAA 4QBIA 4NYMQ 3MNSA 2CLDX 4Z0KA 2N42A 5EQTA 3S1AB 5LD2C 3EA0A 4D26A 5AJYA 5JZVA 1ZCBA 4L4UA 4X2YA 2H17A 2Y5GA 3OE7A 1XMIA 5EODA 4LY6A 3RHFA 3LV8A 3CPEA 2BY7X 2OILA 4EQ6A 2W26A 2FESH 4I1VA 2FV8A 3I62A 3LH3A 3BN9A 3MH5A 2H5CA 4BASA 3O8DA 1P2SA 5DLQC 3SI3H 3RXAA 1TMTH 1O2RA 2J4IA 4ASUD 1NM6A 8KME2 1F6BA 1L4ZA 5J47A 2XBVA 4NFEA 1Y5BT 3DL0A 1K8RA 1KO1A 3V0XA 2MSDB 5AFYH 3SGBE 3A58B 3F9FA 4K1SA 2XC5A 4RZ3A 5TDHA 4G5SA 3R8FA 2JJ8A 3N5CA 1E0SA 1SLXB 4YONB 3ZD7A 3MAAC 4I8KA 1O5BB 1E0KA 2RGAA 1P3JA 1DSUA 1CHGA 1QB9A 2NO9A 2FI4E 2PZGA 1KZ7B 2QP3A 5B58C 4TL7A 1G21E 1AVXA 4KFSA 4A0HA 1ELEE 2X8AA 2CF9H 2CK3D 2G0TA 1LHFH 2ESTE 1F92A 2F9BH 2QSZA 2ZIAA 5H8WA 2NMVA 3SU8A 3X1YA 1XJCA 1Z6EA 3RRYA 4F91B 1LVGA 4JBYA 1DDJA 2NU1E 1GMDF 1EX3A 3BEUA 1GNQA 2VIOA 2GRJA 3BH7A 1NKSA 1MTSA 1NN6A 4JKYA 2OBLA 3QPUA 4BAQB 3ZIAD 2IT1A 3SV7A 3C8UA 1KLIH 4ITRC 4QGGA 4JL6A 1D2MA 4LHXA 1M7BA 4UD9H 5JSZB 1SVOA 4A5TS 1C1WH 3VTKA 1LPZB 2ZGJA 3DUXH 3M3SA 4BFWA 1Q3TA 4QFMA 3NWUA 3TGKE 2W6JD 2ZRKA 4PPFA 4Q1CA 3P20A 3ZVBA 1ELCA 1R0YA 4D0LB 3RWOA 2BV3A 5AK0A 4Y6DA 3SDZA 5DKMA 5ESBA 5DHFA 2GCHG 3D7MA 3T28A 2OFXA 1Q1QA 4IOLA 1TAWA 4C0QC 4ABIA 2AERH 1MQ6A 1W7AA 1KI6B 1X8KA 1JXOA 3KB1A 1EZUC 4PHTA 3D3QA 2IPHA 4DCDA 1OYWA 2ZJZA 3CLVA 1KYNA 5AFZH 4IMZA 3NBXX 3LFUA 3SNCA 2VIPA 2GILA 3T35A 4LV8B 1EZQA 4US2R 2QUZA 3ZZ4A 1YGCH 2QRNA 4EAQA 3QXHA 3U60B 1W4CA 2PT7A 2H7VA 2ORIA 3FKSA 4OQNA 4KELA 4NYJQ 1ZGVA 3M3TA 1ETTH 2XZPA 4M9ZA 1M1YE 2JJ1A 4PC1A 4K3JA 4LGMA 1C1TA 4VGCC 2WOJA 2F55A 1XBTA 3LNCA 5JCPA 3UIEA 1NT1A 1KZGB 5EXSA 1E2EA 2IYRA 1VG0B 4MRNA 3KJGA 4AYVB 2HLDD 3T61A 1WQ1R 1NJFA 2AWNA 4C3ZA 1K2I1 1FY4A 1UDWA 1F0SA 2FZLA 5JSZA 2FI5E 4XH9B 3SU6A 1GBMA 4YQFA 4UNPA 1WXQA 5L3QA 3VNUA 3E1XB 2Q21A 2VSFA 1TUEA 3V4FA 4ZDKA 1ZD8A 1U94A 1QG2A 4CYMA 2ZWLH 3ZVEA 4E05H 1GDUA 1IN4A 3K0FB 3W6PA 5KO2A 1NVVR 3RABA 1P9RA 2WWHA 4TL8A 4HLDA 1MTUA 4OK5A 2RGNC 3TVDA 1YBWA 3K9GA 3Q5DA 1MUEB 2CXVA 1ESMA 4GOKA 3VGCB 1E79D 1C1SA 1ZM3A 2O5VA 1PQ8A 4DLVA 1MKWH 3ATMA 4MNXA 3KJEA 2G5NA 2R9PA 1GRNA 1WTHD 1UO6A 1OIVA 4HDOB 4LJ8A 2DPXA 2GV6A 5KSZA 1G7SA 3M5OA 1K5DA 4Q4LA 2WJVA 1D3DB 2EWVA 2ZRFA 3LLUA 3BF6H 1NF3A 1C9TA 3G82C 4RCYA 3KFXA 3E3TA 2Z9GA 4THNH 8GCHF 1SXJD 3FKQA 2WUCA 2FU5C 2SGFE 4LBWA 1R5NA 1D6JA 3VU9B 1KDOA 2JGNA 4BAKB 1KY2A 2D2DA 3D65E 4YMSA 1Z22A 2O8DB 1GBFA 3IO5A 2XOKA 1KKLA 4BUJA 1KDQB 1XMJA 2ZYTX 5G3YA 2FYRA 2BDTA 1HQYE 3CUEF 1X3SA 2QXJA 1NFYA 1AFQB 4O3MA 4IEEA 3UOPA 2ZGHA 1SGNE 1U8AA 5A5GA 3F0TA 5DIFA 1Q31A 3IDQA 4OS1A 3LAWA 3W94A 2FSGA 2IK8A 3M61U 5DNYB 1BQYA 1L0ZA 1S9DA 1HRTH 4HUQA 1AZ8A 3VNVA 4Z6AH 1O33A 1K1PA 1XEXA 1KXBA 2CCJA 5F98A 4AC9A 4OHXA 3RMMH 4EPRA 3B13B 1UHBB 1YP9A 1KSHA 1NRNH 3PVSA 1N25A 2NTYC 3A88A 5BW8A 2ZJ8A 3CS7A 4BE7B 9LPRA 5GVRA 2PFEA 2FTLE 1W0YH 3U3RA 5JWOA 1OFHA 2TIOA 1THRH 1AGJA 3PFIA 4I8JA 1SXJB 3BFXA 3M5LA 4FMDF 1MR3F 2NGRA 2GXQA 1DY8A 5EOKA 1XVOA 2YHSA 5AWFC 1G5TA 2IL1A 2UUKB 2VIIA 1LS6A 1D9ZA 2VEDA 4NSVA 1GCDA 4I32A 2K5UA 2WYGA 1KDQA 4LZZA 3OFNA 1P73A 1CXZA 1T3LA 3RXRA 3LGVA 2A4RA 3GY4A 4FI3C 2ODWA 1OKKA 5A0FA 4AG6A 1SHKA 3CW2A 1IXZA 1Z6TA 2RGBA 3P8OA 3LBNA 1UK2A 3W34A 4CR9A 2VIVA 2SGDE 4GSYA 1BO6A 1WQSA 3SR0A 1W2KH 2ZCLP 5EG4A 1XEWX 3L0PA 1LF5A 1F3OA 1CR0A 5KYKA 3BTFE 2FMJA 4Z8YA 1FNMA 2ZFSA 4I31A 2QBYA 1U90A 4DLWA 1GL1A 1F2TB 4FW9A 5GJCA 2ZSEA 1HEIA 1X1RA 3BIVH 3GLIB 2CL6X 2O8EB 1E2DA 2FH5B 2OG2A 5GXPA 2Y6TA 4H6TA 3BSQA 1QHYA 2WWFA 4OHZA 1PQ5A 4DDWA 4PSKA 1XKBC 1R0XA 1UVOA 5JBQA 1FX0B 4Z1MD 2HNTE 4PROA 2VF7A 3C41J 3KKMA 4DKXA 1NMXA 1CBWB 4TLDA 3PR1A 1ZUNB 3RXOA 3P92A 1FQJA 4UJ5A 1WSSH 3GMTA 5SZHB 1Y3YA 3ZZ7A 1N6XA 2J0UB 1WTGH 2ZUDA 2OCYC 1TQDA 1QHXA 2A5JA 4EPVA 3A36A 4P4TA 1FPCH 1HUTH 1FQKA 4OL0A 1TBQH 1QDEA 2HT6A 1E2NA 4LXBH 1P2QA 2QTVB 2CMYA 3PO1B 1E9RA 4SGBE 5FTLA 2JKHA 5H70A 1A1RA 2Y81A 1QHHB 4O3TA 4TPYA 1S82A 4AIIA 4RKJB 1AZTA 1Z6YA 2GXSA 5LB4A 1OOKB 3AW1A 1C2MA 1EAIA 4DLTA 4RKFA 3SFZA 1L4DA 2A4GA 1TA2A 4OS4A 2RGGA 3VHLB 4A1XA 3M37A 1KKMA 1M2OB 3KCGH 3QTVH 2OXRA 4B76A 2KWIA 4X2WA 2YJTD 2ODEA 1GI4A 5FBEA 1ESTA 4WXIA 1TAGA 3DVLA 4M1OA 3CF6R 4H1UA 3T27A 1KDRA 1N5IA 2GVZC 1DLEA 3VR4A 3MRSA 4YMVA 1D9XA 5FOXA 2PL3A 4Z51A 3B9PA 2IXEA 2QXIA 1J8YF 1DSTA 2V7QD 3FHOA 3EZ9A 1G7TA 3N2IA 1AQ7A 1BRAA 5AVDA 1P06A 1GSIA 3PLPA 1DS6A 1ELDE 2CHGA 5E7MA 1O2PA 4DT1A 2QAGC 3DT0H 2YINC 1RE0A 2QT1A 4FMCB 2ZRAA 1EJNA 1U0HC 2P3FH 1EFUA 1XPUA 1E9BA 4DEYA 1KOFA 2OEPA 1OWKA 1NRSH 1JRTA 3LBHA 4RKEA 5KDDA 1UTMA 2ZFTA 4A8JA 2AKAB 2ZI5A 4CEJA 1HIAA 1KO8A 4MGZR 1C4V2 3J81k 4WVPE 1XCGB 3OSYA 1EXMA 3TJVA 2XNSA 1ZHRA 4WH8A 2B6HA 3RWMB 4B32A 1O2ZA 1XF9A 3DKPA 1SHZA 3E16B 1DUEA 2C78A 4HB4A 2NU0E 1XD2B 6CHAB 1Z5ZA 4UFDH 5BN4A 3V9PA 3U7EB 5G3ZA 3EIQA 4AI6A 3Q3YA 4ARZA 3W3ZB 5D3QA 2BX3A 4GZMA 1O3KA 1V2TT 3FVFB 5PTPA 2F9OA 4PPQA 2BVRH 4HTCH 2ANBA 4NCNA 3QXCA 1M8PA 1UMAH 3THWB 1CULC 4FMDB 3EZFA 4JZKA 1V2PT 1WQVH 3FHTA 4A0RA 2IS4A 2TGAA 2F9MA 5EXMA 5JBTA 1THPB 4R9UC 1GJDB 3BOSA 1XPOA 2J3EA 1ZP6A 4HUTA 4C2TA 3SU3A 1OE0A 2ZJAA 5G53C 1F5LA 4K8YA 3NPSA 1SFQB 1A5TA 2FSFA 3SU5A 2NO6A 4MNWA 4BAMB 4OI0A 3ZVDA 1WXRA 1BTXA 3SOSA 4HB2A 1W46A 4Q00A 2B9LA 2GTBA 1C2EA 3MO6A 1A2CH 1PUIA 4EIWA 1N5JA 4KSCA 5EXLA 1A82A 4DURA 5J40A 3IO3A 6ESTA 4F4CA 2GDDA 2XJ9A 4DSNA 1SGWA 3PO1C 4UFGH 3U44B 5F9HA 4C7OA 3CPHA 2EYUA 4C0AC 2JIZD 1FJSA 4B2LA 5JS8A 2PKAA 3EPJA 4X6MA 1WU1A 1VPLA 4G5RA 3U8RH 2ZFFH 3RXSA 3NHBA 3AP2A 1XXHB 3NUMA 2D2EA 3DZ8A 4FMCF 1V2MT 3Q00A 3NBZC 3U4QA 1OXVA 2P8OC 1PZNA 1E2IA 1R8SA 1OHHD 1DO0A 1SI5H 2VHQA 2OCVB 1K22H 7GCHF 2ZEBA 3QPVA 3EWSA 4XWAA 3E5HA 2HWLB 3LJJA 4Q5IA 3ND8A 3WP1B 1DBSA 5JBBS 1N2CE 1KK0A 3A84A 2J7PA 4WMDA 2L0XA 3SNHA 1AS0A 4IKEA 1K6MA 1Z8FA 4MPVA 4LJ7A 1TU3A 2J0QA 2PWXA 4JZ1A 1IAUA 1BH2A 4N0DA 2FFQA 2A2XH 4JZDH 5BXQC 1CJKC 4JL5A 2YNAA 4Y8ZA 4ABAA 3TQFA 1OYYA 1K5GA 3GJXC 1EFRD 3VMFA 1H9IE 2AK3A 2HJVA 5HYOA 3QGJA 2AL7A 3MNCA 3U9AH 4AN7A 4BFUA 1PPEE 2FWWA 1W0KD 1TBZH 4M9XA 2OESA 1NP6A 4ABFA 4G5OA 4YM9A 4P4UA 3W6OA 2ZU6A 4YOIA 1VGCB 3URDA 2HUPA 2PSXA 3E91A 3LY5A 3LW7A 4QBFA 2GXAA 1GRQA 3AF1A 2OINA 1E2PA 4JYVH 2GVDC 5FFMA 1EX7A 2JA1A 3BB1A 4H42U 2H2ZA 1SGYE 2B21A 1GHBF 3K0SA 1O2JA 1PYTD 4C0JA 2JLVA 2DFTA 4GT1A 1WBGB 3LU9B 3A87A 4AORA 3BB3A 1TPAE 3SGAE 2BDIA 2BBTA 4BOHA 1ORFA 3IILA 2ANMH 3ZS8A 5GVSA 4JLKA 4WA7A 1ZTKA 4FMBB 1HAIH 1GBIA 4MKIA 3TGJE 3K0AB 1BITA 3KL6A 1EUFA 4BFSA 1IN8A 1LO6A 3PUVA 3GDUA 1NY5A 3LW8A 1J17T 3ZZ6A 5B30A 1RC8A 4BTTB 1AVWA 2AD5A 3SNBA 1LCYA 2LPRA 4BECA 2Z7FE 5GDSH 3GCHB 2H9EH 1OV4A 4YMUA 4B3DA 4RSGA 4YT7H 1NN0A 1T3SA 1ZPZA 4OHWA 2OQ5A 1WBDA 4BANB 2FJUA 4K8BA 4F93B 2OC7A 3GLFA 2VHCA 2XITA 4ZIRB 4DUGD 1XUHA 4CRWB 1AKYA 4WOPA 1BBRE 1XEWY 2OSBA 5M04A 1O2HA 1P01A 1BHXB 4J0QA 3E0PB 1K1OA 2ASEA 5KNBA 2FGKA 3WRXC 4IMQA 721PA 1GOTA 1TPOA 5FOSA 2D8WA 4M9FA 1TGTA 2ILNA 2ATVA 1TU4A 4MLFB 4S35A 1NMYA 1TBRH 1ZM7A 1ESNA 3SJAA 4TYYA 3SQWA 3PEWA 4A0GA 1XZQA 4D6PA 1GG2A 3ZZTA 3URCA 3U6BA 1C2JA 4G5QA 1N6PA 3T15A 2PZEA 2OT3B 2W2TA 5EE1A 5DP5A 2GK7A 4DCUA 1TRNA 2BWJA 1DAMA 1TEXA 4ARZB 1GDNA 1N5KA 1HUQA 1OKKD 1MKXH 5FBLB 2FZ4A 2IHBA 1NPMA 3LVQE 3E70C 2J9RA 3AUXA 2QGZA 1PPBH 1C5ZB 1MU6B 1SLUB 4FUDA 1UTOA 4UNNA 2O8CA 4KFTA 3UWIA 1A46H 3KN2A 1Z07A 4Q47A 4GNKA 2ZFQH 2WWGA 3I73A 2BD3A 2VLIA 2QORA 1Z6JH 3UR6A 2BBWA 2XTTB 2J34A 1TNHA 2CF8H 3L8ZA 2G4TA 4Q9LA 1U9IA 2VVUA 2ERYA 4CEJB 1D2EA 3GQBA 2PW8H 2BVNA 1LS1A 4FUFA 1FTNA 4E03A 4NA7A 2QPAA 1PJPA 1I4DD 2BMEA 1LVYA 3A8AA 4Z1MA 1HBTH 3ZVRA 1IOEA 2BJWA 4C0KA 2GKVE 2BLWA 1DG3A 3A7ZA 1N6HA 3IEUA 1V2UT 1C9KA 2QQ0A 1W0JD 4DCVA 5J4KA 4QC2A 3OESA 4I1OA 1D3PB 2A5FA 3GYLB 1IN6A 1M9UA 2G81E 2DFNA 1O32A 1FPHH 1QIXB 4ZHMU 1ZRKA 1C1RA 1BMAA 1UVTH 1FDPA 1ZR0A 2BKEA 2D06A 1YCPM 2AR7A 3CBQA 1JECA 4JLAA 3MWKA 3K6YA 3LJOA 2BXUH 3RC8A 4OQFA 3GJ6A 1TMKA 1CBWC 3MWIU 1HAVA 3N7OA 5E2OA 1TYNA 3QXXA 5IRCD 4TLBA 2P5SA 1UKEA 1EPTA 3UATA 2LKCA 1I2DA 4HZUB 1E38B 2QZ4A 4F92B 4XVQA 3NG1A 4R7ZA 3W8NA 4D7FA 1E2MA 1ACBE 3TH5A 2SNVA 2HXSA 1YJ5A 5G4BA 4I8HA 3KTAB 4TTQA 1US8A 1A7JA 4QGHA 4ISNA 3LXXA 1S96A 1OWHA 1XUKA 3BD9A 2GCPA 2VHTA 3EIHA 2H16A 1QVAA 4NA9H 3H86A 1L1GA 1NRRH 3NTUA 2ZI2H 4U00A 1ZPCA 2EI8A 4MRVA 3K0CA 3CWQA 3RRNA 1ZAKA 3CF2A 1O3JA 3NH9A 3JZAA 1TX7A 3GLFB 1VIYA 2ZJ5A 1DITH 2WV5A 1FMLA 1Z8JB 1FZZA 4A6XA 2WJHA 2NU2E 4ACAA 4Y8XA 4PQYA 1O5CB 1XTQA 3A82A 3B78A 2F1RA 2ASUB 3TUZC 1G20E 3ITIA 1U8YA 1EAUA 2ZAMA 4A1FA 1C5XB 2J9NA 1HH4A 2QEQA 4NZLA 1IY2A 1U8ZA 4LYJA 1BJVA 2QTFA 2REBA 3U8OH 1VIAA 5FBRB 4NYJR 1SGDE 2IUUA 1A4WH 1CSOE 2ZE7A 5TCAA 1SKQA 1TPZA 1XUFA 5GWZA 1ZJDA 2CDNA 1O2IA 4LHWA 3U7FB 3LVRE 2OBOA 1LMWB 1TGBA 2J41A 4Q1EA 1ZJKA 4GP6A 4LK2A 1ELVA 4WBSA 1EESA 2OCAA 3CR7A 1ZSJA 1O2VA 3GY5A 1EB1H 4EDHA 2OM2A 2CJWA 4YLQH 1AN1E 3PXGA 2QTHA 2OC1A 4WF8A 1BTZA 3G0HA 4AWXA 3C5CA 2A9KA 3BTGE 3FTQA 3R3GB 1GHXH 1VHLA 4FCTA 1HJ9A 2I6QA 1C1YA 4CDGA 3AVPA 1A5HA 1G291 4XBCA 1AD8H 1DELA 2QM7A 2PKSC 4G5GA 1TRMA 2DUCA 2C3SA 3HK6B 3U3KA 3RDZA 1O3YA 1J8MF 4AG2A 2WUBA 5KTYA 3K09A 1T4UH 1C5VA 4D4JA 2BZ6H 5EXTA 1UAAA 1KTTB 5H68A 2P8OB 4JLJA 1TQ4A 1CA8B 8LPRA 1GL6A 5KSYA 3LH1A 2IXGA 1BZXE 1TOMH 4GOJA 1U0JA 2ZFRH 2WIAA 2VRWA 1N6IA 1ETRH 3K53A 4B3FX 5FTNA 5LBIA 1G8PA 3F6UH 4JLDA 1XD2A 2FOBA 2ZRHA 2F1IA 3QKUA 4DG4A 1NRPH 2EI6A 2ZANA 3T26A 3Q5EA 1RPZA 4GMXA 5CJPA 2ZHWH 1AA9A 4M8NE 2O8FA 5FUVA 3KHVA 2V3OH 4NCHA 1C4U2 3T62A 1ZC4A 3PITA 4DJTA 3ADBA 4E22A 1QY6A 1IHUA 4X6OA 1ZD9A 3SHCH 1QBNA 2J7PD 5HCNA 5EP1A 1C2KA 3SYKA 3SJCA 3R9WA 1SOTA 4Y0AA 4BGDA 2RG3A 2O8WA 1Z0JA 3KUCA 2DE8A 5DG6A 4BZQA 1FPMA 4V02A 3SNAA 1WYKA 1BT7A 2WINI 1WA5A 3LX8A 1PPFE 2D7DA 3VFEA 5GNDA 4HI0E 2JLRA 4PAMA 1MABA 3SV8A 4R2HA 4JMYA 5LH8A 2V9PA 1UTKA 2FNAA 2IBMA 4ABBA 3OTJE 1W4AA 3QKSB 4MRSA 2ATXA 1J14A 1JQJC 3SNDA 2GZHA 1IQMA 3LGYA 2BD7A 3LONA 2WZQA 2FN4A 4DXAA 3SO3A 3MJRA 5E7IA 5T6FA 3F9EA 1OXXK 3GCGA 4YLGA 4LYHA 3UMRA 4NWKA 5I25A 2IYVA 2GF9A 5A4JA 1NC6A 1G3CA 2R2AA 4X8LA 3KQHA 1FP7A 2R65A 1LHGH 1WV7H 1W47A 3CX6A 4CBOA 3B8JA 1RFLA 5FTJA 1AGPA 1TF5A 2J87A 1NO9H 1G2MA 4PO9A 5AUQA 1N6NA 3NXPA 1HAHH 3M4YA 4JS0A 4QBGB 5HCIA 3QN7A 2PTCE 1KDTA 4NYMR 3ASYA 4CGZA 2ZYUX 2V3CC 1LPKB 1QHGA 1UJ1A 3PLBA 1NY6A 2BCJQ 2H5EA 1G3EA 1II8A 4GCHF 3IEVA 1EFTA 3AVYA 3EA8A 2BMFA 4AD8A 3EQ0H 3MU0A 3REGA 4AKEA 1Q12A 2NWNA 1M7GA 2A5YB 1RZ3A 2ALPA 3I1FA 3X1WA 1NRJB 4EPWA 1HAGE 1ARBA 2SGEE 4G0NA 2JLZA 3M35A 5JYIA 4U30A 1O3BA 4DUGA 3HR8A 4AB8A 4N0EA 2IN2A 3SE0A 3A8BA 2VTKA 1TEVA 1RTLA 3BTHE 2XC0A 2ZHEH 1TNDA 1QL7A 3KEEA 3S7KB 3V00A 2D1JA 3UPUA 2Z83A 4Q4AB 1B0UA 1Y63A 3QBTA 2QV1A 3M7UA 5FUYA 3K1JA 1SZPA 2BM1A 2O0HA 4JBWA 3GJ8A 5J4QA 4U01A 4KHZA 2ZJBA 4PSAA 2WM9B 3EW9A 3SC3A 1IM2A 1C5RA 4YXWA 3NDPA 1NKTA 2WHXA 1GMCG 1G3IA 2EFDB 3T1VA 4X1SU 4PAQA 2GAOA 1HQCA 3RXIA 2G4UA 3A8CA 2VH6A 5CLQA 5TY0A 2A1DB 3E8LA 1OB2A 2GJ9A 1MKWK 3FWYA 5DYGA 1OS8A 4TWYA 5GJBA 4ZMAH 1BRBE 3SYNA 4INHA 1EAWA 1DAFA 4WVFA 3U7HB 1C5PA 3M7TA 1DICA 2PLRA 2QT0A 2AX4A 4ISOA 1T91A 2Z9IA 1PPZA 2ZC9H 3EYDA 2XJ4A 1OX1A 4D7GA 2BBSA 3TGPA 4CRDA 1E0JA 4INKA 1O2SA 1SGQE 1SVIA 3WHLA 1ZUIA 3TJNA 3PMAB 4PPNA 3ND9A 3X2SA 4PANA 1BA8B 3HKIB 3QG1A 2EFGA 5CYOA 1PQAA 4XD7A 1GHZA 3RDPA 1ESBA 5JLJA 1Y59T 4A2WA 2VSOA 3PUYA 1SGCA 3PUZA 4JLPA 2Z9JA 1IBRA 1T0HB 4NHOA 2HEIA 2WKRA 4LI0A 1QTFA 2KI5A 3A4LA 4JBXA 1P4SA 2ZU1A 1KNQA 1ZYUA 1XEXB 2CEAA 3K6ZA 5H4IB 1XUGA 3NIBA 3Q3JB 2CV3A 1XTKA 2WWXA 2Q9AA 2XWAA 3LQRA 1O5DH 5B6LA 3LDXH 2J38A 2JJ2D 3K0EA 3DA9B 3NH6A 4M9QA 1DOJA 4B47A 4C0BA 4JSYA 2CJWB 1YCPH 3NDBB 3WY8A 1D4PB 3EIEA 1DO2A 4GPGA 2ZVPX 3U5ZB 1AN0A 4JIMA 3MNBA 4PC6A 3C5HA 1LKAA 4I81A 1G37A 3T34A 3TSOA 1D8TA 5DP6A 3ZV9A 1HJ8A 1X8JA 2QC2A 3HPQA 3MG9A 1AQYA 2J59A 5ABWA 3PROA 3P1JA 4QRHA 3SZRA 4URUR 5CB6A 4DLRA 1NLFA 4XTRA 1F2UB 3BS4A 2PGBB 1AM4D 1O3GA 4ESHA 3A4NA 4TY6A 3I78A 1A0HB 1QR3E 4K1EA 2K1QA 4YMTA 1GRRA 4IC6A 4ISHH 4IOJA 2VQSA 4X6NA 2F9PA 3I32A 1XD9A 1UBCA 2MMGA 2AFQB 4CEHB 1MCVA 2X77A 4URZR 2WAYA 3UWOA 1W4RA 1YZUA 2V0BA 5FPKA 4HAUA 1FV9A 4Q19A 2GZDA 3K70C 3SUDA 3PCRB 1C5MD 1N6OA 2G9NA 4NIWA 5JJKA 1VCMA 1MD7A 4MDFA 1NBMD 1CS4C 3P4YA 2GDJA 1GHYH 4DLYA 3DM5A 1ELAA 3RMOH 3UMFA 5HE8A 4B6FA 4R98A 1JPJA 4ZCIA 3ZZ9A 2BMGB 1DM4B 2XEXA 3H84A 1Q21A 1LDTT 2RAPA 3ETLA 4N1AA 3I61A 3A89A 2TMKA 4AKIA 1TOCB 2FM2A 3H1TA 3TLXA 1TRYA 1H1BA 1L1JA 4X0WU 4A0FA 3F5FA 4DRZA 3SS8A 4AFSA 3VFDA 2J46A 3ECCA 1TWXB 3UIRA 5EXNA 1RTFB 4IS5A 1XEFA 2YNBA 1E3MA 1ZJ6A 4HYYA 3IPYA 4NZQA 5JFGA 3LPRA 3GEIA 4NMMA 4R2IA 2FMXA 1XWIA 2Z4SA 1WF3A 1KY9A 1OT3A 4BXWA 5JHHB 4Q4JA 1KSJA 4MG3A 1TMUH 1ELOA 2X2FA 1G3QA 2QROA 1VYTA 1O2YA 1KAGA 1WP9A 2GX4A 2QY9A 3RS3A 3B2EA 4NP6A 2Q9CA 5CHAB 2QXHA 2NIPA 5K8IA 1M7HA 3L8YA 2VIWA 3QNUA 1GI6A 3OIUA 3FFAA 3GJ3A 1V2WT 1MRNA 3D31A 1ZVQA 3QDZB 1GBLA 4DWJA 1L7VC 2O52A 4JZEH 2WPIS 1E69A 5BRRE 4I8LA 1NS3A 1NBME 1P05A 5TJXA 1JWTA 5FX5A 4RD6A 3K70B 1BYIA 4GRAA 2FOEA 3TNSA 3EGKH 4NIYA 4LOAA 3BORA 1VDZA 4DSUA 2QXGA 1DWEH 1S0RA 5FL3A 5FOTA 1DT2A 2HJGA 1KAOA 5JWHA 4Y7BA 3OY6U 4RJLA 4XVUA 4IDOA 1UEIA 2ZJYA 3SUEA 1XVMA 1QRXA 5JHGB 2C95A 3BTWE 3W6NA 2WJGA 1G3BA 4DLSA 3MWLA 1KLJH 5EU8A 1YZLA 3RXQA 5AUNB 4A9AA 1EOLA 3LA6A 2BCGY 2Q1JA 5L8VA 1Q1ZA 3OY5U 5LPNA 4NFFA 2B7BA 1TALA 2XAUA 1GJ5H 2OXSA 3SQEE 2BIFA 3QTOH 2YKGA 3HKJB 1DX5M 4JVLA 3JVVA 3P8FA 1FZQA 2G83A 3K9HA 1GJBB 3CWZA 4IDPA 1E0FD 1O2QA 4AKGA 3EASA 1CA0B 3NEYA 1NVUQ 4K69A 1QBOA 1O37A 3DZDA 2BHGA 3QLPH 1MCTA 2GJ8A 3PEYA 3QVVA 4ZHLU 1GJ7B 3R0FA 2IUTA 4HLCA 4ZCMA 1AUJA 3EA7A 3C7KA 3UK6A 4BFXA 3MH4A 2AKYA 4B3CA 1LTOA 1X1SA 4DDUA 2BY9X 5IT5A 1XXDA 3QZRA 2C03A 4LCBA 2P0EA 3AVXA 2P16A 3SNEA 1Z06A 2AXNA 3H7OA 2VGCC 2ZS7A 1QRZA 3TJZA 2XC4A 2OUKA 1RGQA 2ZSDA 5DN6D 3A1WA 5E0GA 5DI9A 1ZTJA 4YLUA 1CE5A 1GI3A 1LY1A 2ZRPA 2BHRA 4HFPB 4OS5A 1N8OC 2QA9E 1ZLRA 5GJWC 2Q6GA 3EDXB 3VX4A 1OIXA 2W0MA 1ANKA 3KQCA 4WAUA 4LJAA 5DGXA 3BTDE 1S85A 3VEQB 4BEBA 2AGGX 4E7RG 4L5BA 3QEOA 1SKYB 4F4IA 1BBRH 1T9HA 4KTUA 1C5YB 3ZVLA 2ZHDA 4RD3A 2I4IA 2DWQA 1O3NA 2OLKA 3DMDA 4P32A 4ZDJA 4URXR 1UCYH 3ZJYA 1BIOA 4UNRA 3GLHB 4Q4HB 4DIHH 4MRPA 2AGEX 1CJTC 3T5GA 1FTSA 2Q3MA 4DVAU 1QF9A 4X8OA 5JS7A 4FWTA 4AURA 4NU0A 1O30A 1SGPE 3AKEA 2FIRH 2J2UA 2XCFA 4HZHA 2M5TA 4NE2A 2WV4A 4JVNA 1W7XH 2YOHA 2P6RA 3IKJA 5JBCS 4Y0VA 1GMCF 1DE0A 1BTYA 4X8HA 3RS2A 4IEIA 2QL6A 2VIDA 1A0JA 3OIYA 4DEXA 4V03A 3HU3A 4Q7ZA 3LLMA 1VCIA 4TMTA 1MKYA 5JCZA 2OC0A 3SFVA 2P93A 4YOGA 2C9YA 5E8EH 1XUIA 1KHTA 1MTNC 3M5MA 1S3SA 2FPLA 4RFSB 2D3WA 4L9SA 2A2QH 1S8FA 2ZU2A 4FWIB 4PO1A 2A5KA 4DT7B 5DO9A 2AIPA 5EW2H 4A7IB 4V0MA 1W13U 1UVUH 2TGDA 1G5PA 1TNIA 2VL7A 2FDAA 1T4VH 1PLKA 4JCNA 5K8LA 3BRWD 1MKXK 5C1UA 4C2UA 4X8UH 3VB4A 1S83A 3PV0A 4LRWA 4RD2A 1N6KA 4WZAE 3NC0C 2F9VA 3I77A 3OX7U 3JZ1B 4RFSA 1DAGA 3PWBA 3FANA 1KMQA 2XBYA 1OH7A 5C5NA 1X86B 1SHHB 1WE2A 5FCRA 1EPTC 5HMAA 1JI0A 5F8TA 4WMEA 3V12A 1DXWA 2PLFA 1KJWA 3GLFE 1PYTC 1D3QB 4DBLC 4EQ6B 1E9EA 1WMSA 1HAPH 4D4LA 1AZSC 4WXPA 1UHBA 2W0SA 4ZDWA 3KZ1E 1PUJA 1T0JB 3ZZ8A 5BYKA 3RMLH 1S6FA 2TPIZ 1O3FA 3STJA 3UG6A 2D26C 5L3RA 3MU8A 2H57A 1MAXA 4JLMA 2ZSBA 1C5SA 5AF9H 4J1YA 1OJLA 4R71A 5LD2B 3SYLA 3Q8XB 1T5IA 1TF2A 4M1YA 2RCEA 4QM6A 1HJAB 2AH4X 1GBTA 2XNDA 5FI0B 4A8JC 2PT5A 3F9GA 3SN6A 4JYTA 3NCLA 2IW3A 3VB6A 5KSOA 1OSSA 4EFLA 1HTWA 1ZNYA 2YWEA 2E9SA 1TABE 3QSYA 4NWLA 3V3MA 2OZEA 4BNRA 3AF3A 1Y8TA 4LK4A 4JT4A 3I5XA 2WWYA 1ZNWA 3WBKA 3NZIA 1E2KA 1K1MA 3KXLA 2A31A 4DGJA 2QE7D 1UCYE 5LPEA 5IF9A 1SLVB 1H8EA 2FOAA 3KDSE 3MO9A 3HU1A 2JLWA 2EC9H 2WPDA 3LX5A 2Z3EA 1C5LH 4RD1A 1BJUA 3Q3XA 3BGWA 1ODFA 3ESTA 2V6JA 5ANRB 4O3UA 5E0HA 4MPWA 2VSXA 1COWA 3FZZA 1G18A 4LWZA 2LCFA 5K8UA 2G1KA 2GCOA 3KXKA 4L15A 4MYHA 3MMGA 1R6BX 3GCOA 5BN5A 4DCTA 4H9GA 5J4SA 4KITB 4E07A 1G4AE 3OAAA 2OAP1 1ZUHA 1ZINA 1EK0A 2Y8EA 3AF2A 3DDCA 3FAOA 1IQPA 4TMWA 1AKEA 1CR4A 3C4JA 1VKJA 5F8ZA 3LDAA 5K7RA 4D0NA 3RC3A 3FHCB 1MMJN 2ZQ5A 4QHTA 2FOGA 2C8VA 1GG6B 2P95A 1E2GA 4KU4A 4X2VA 5L3SA 1T8MA 1ZIPA 1CJUC 1GBEA 3RAPR 4HDCA 2P6NA 4FUJA 2A30A 1L1NA 2FOMB 4WZBE 3GLGE 1ARCA 1HPGA 1GI7B 1I4LD 3QKTA 3SI4H 1YPEH 3QVUA 5E7JA 3GY6A 4Z54A 3CH5A 1GAJA 1U6QA 4MYCA 3AKDA 3GICB 1GGDB 3M36A 2C8ZB 1MH1A 1O3MA 1T6NA 1JEDA 2YWGA 4LPKA 3EPHA 1G5RA 3RLFA 1DADA 4UQOA 5EZ6B 1N0WA 1XXHE 2ZSAA 2CVHA 2PV9B 3SZEA 3OIVA 1YR9A 1E2QA 1XDBA 4GBMA 5SZKB 3VR1A 4CRCA 1QHSA 5FOUA 2C8YB 1JIRA 1AJEA 3Q7QA 4RN6A 1BUIA 4RY2A 1S0QA 2RMKA 4ACBA 1MQ5A 5DGJA 2YZ2A 2KBFA 1ZRHA 4GPTA 1WOFA 5C67A 3SOPA 2P65A 3ZVNA 2VVVA 4PX9A 1RS0A 3LOXA 2GKSA 2IS2A 5I46H 5B64A 2P94A 5IDKA 1JR3E 3K9XB 4DB2A 2R3YA 1S9HA 3NXSA 1YPMH 2RGEA 1YQTA 1CHOG 2REOA 4ERNA 5DHAA 1E99A 1C9PA 2GAAA 2UUJB 1MD8A 1XZPA 1DAEA 2ODYB 3BG8A 3GY8A 4AFUA 1Z2AA 2XXLA 4C0HA 2Z6BD 3UWJH 1DE7H 2QAAA 2ZRGA 1GM5A 4FCVA 4H1VA 4AZ2B 1M6NA 3RXVA 4TSFA 4KAXA 1XD8A 4PC3A 4DIDA 3AP1A 2V1UA 1H4WA 3CZQA 4M1WA 1W5TA 5C18A 2WSMA 5LB2A 2NO7A 1RYFA 1BMFA 4WXVA 1B0FA 1J9CH 4ZAEA 2P5TB 2N1BA 1K1NA 3RC4A 1FIWA 3UMSA 1QQ4A 4X1QU 1FUJA 1O5EH 1RKBA 5CITA 1CA0C 4US0R 1LQDB 5CMXH 2V4ZA 5FUWA 1XXFA 5FBIA 4CIDA 3MMPA 1LVBA 4D81A 1KTVA 1F5KU 1RD3B 3TH2H 2EQBA 5DJ7A 1EXFA 3SYJA 3CO5A 2EI7A 1FW6A 5J4VA 4AYWA 1LHDH 5GIBA 3DKVA 2GEVA 3MU5A 3N2EA 1CO7E 4W5WA 2FXRA 1HT1E 2ZCHP 4UXIA 1F0RA 4PQRA 4A82A 3A83A 1NLZA 2WSSA 1GHAG 3T06B 4YTAA 1V5WA 3PWCA 4IJMA 2XSZD 1T31A 1GL7A 1ZM2A 2KSQA 2WMOB 2VP2A 5EE3A 3U8TH 1C2GA 2XYAA 2QNRA 1IY1A 5HKKA 4A36A 2FPMA 1P9SA 3FP7E 4EUNA 4WY3A 2ZRDA 1KI8A 1RVDA 1EG7A 4IHQA 2G51A 3T29A 5FXLA 4CRGA 2BM0A 4KLNA 4LJ6A 1NG9A 3TUIC 2ZI4A 1ZD1A 4PC2A 1HAYB 4IDQA 3GLIA 1P57B 2R6GA 4ZI3A 1O2NA 4AFQA 2IYQA 2EFCB 5T6GA 3K0CC 4NONA 2BMJA 2F1JA 3AVQA 4NA8A 3ICEA 4X6PA 1G7RA 1KI3A 2MSCB 3IBGA 3LC3A 2ZGXH 4DY7B 2ZE8A 3PV2A 1CT4E 3I4LA 3Q3KA 3A7YA 5KSPA 1EQ9A 5EPYA 1VITG 1Q3XA 1UBEA 1E2JA 4QNMA 1SGFA 1RIWB 4EPTA 5FPTA 3VR2A 1DUAA 5DE3A 1OFIA 2Q3FA 3NWJA 5EP2A 4OI2A 4WJG2 2C04A 4DW2U 2J95A 2IUSA 1YVDA 3K65B 6GCHF 2QRZA 5JJIA 1HV8A 2FFHA 2ZU4A 1YM0A 4I1UA 1C1VH 3GFPA 4O0MA 1CU1A 3U1IB 2ZITA 3TAHA 2A32A 3D6TB 3S0NA 4D2IA 3G01A 1G9IE 4Q7KA 3PQCA 3JVUA 4HZUA 4LBVA 3OE7D 2IOTA 1H65A 1ZC3A 5HZHA 4KJZA 2H9TH 4AY2A 2HNTC 5HM2A 3CP7A 1IHTH 3SI7A 1VG9B 1YPLH 2R0KA 3VKWA 3CNLA 4ZPXA 1ZMXA 3QO6A 1IONA 2WAXA 5EXPA 3NVAA 2CE7A 1D6RA 1P11E 2AYWA 1P04A 1J2JA 4B48A 4ASUA 3BWDD 1P62B 2F83A 1KI4A 3KTAA 1K9OE 2ZHQH 2ZRCA 1DWBH 1QVRA 4AKHA 2V6IA 1GILA 2BYAX 3TK1A 3AB3A 3D49H 3GY2A 2IS1A 1HYQA 1S1MA 2FFAA 1UVSH 3QKRB 1V2VT 1E1RA 1Q1BA 3RU4T 2FF7A 1L8QA 1OXSC 4F38A 1JAHA 4XOIA 2HV8A 2OBNA 1GWNA 4TMZA 1P9WA 3L82B 5FOWA 2FS9A 2C2HA 2GTPA 4X1NU 4PZLA 3B7GA 1OH6A 5DP8A 4NYIR 1V2KT 5TCCA 3QG5A 2R6CA 2QPOA 2NOAA 3MO3A 1SVMA 1KI7A 3Q77A 1AWFH 5GCHG 1S1CA 3DOFA 2OTVA 2C4FH 5FTKA 1OWJA 1XXHA 2IWHA 3T1OA 4HB0A 3THWA 1NY22 2ZTZA 2VIQA 1OXUA 3QE0A 2BEJA 4B71A 4OM9A 5A09A 5FH9A 3U61B 5SGAE 4NGAH 3O47A 2RB4A 4WZ6A 1AFEH 5E95A 1Q57A 2AN9A 1IQNA 1CT0E 4OK3A 1E98A 4IFEA 1KI2A 4D4MA 2Z43A 2VA8A 3FDIA 5EQSA 2H92A 3BG4B 2LWIA 2JETC 4F49A 5FBQB 3VR6A 1SMFE 1ZRBA 1N0VC 4KLZA 4YO9A 4XBBA 3D62A 3KX2A 1FMJA 4I33A 1E9CA 1MO4A 2EW1A 4JLOA 2ZDMA 2RA3A 3NKKA 4U32A 3DOEA 4ESTE 1T8TA 2HCBA 3TIFA 3ZIAA 1FN6A 4CT4B 2HF9A 2JLSA 1IN7A 3SORA 3ZZUA 2QAJA 3A85A 4TYNA 3AASA 1HAVB 1SSXA 3ODDA 1GJ9B 2ZU3A 4C30A 2XNDD 2Q6FA 2PX0A 4ASHA 1HV7A 4HATA 4A15A 4BEJA 4IDHA 3E0NB 2PZFA 1NLYA 1AE5A 4DDVA 1XPRA 3W95A 3R7WA 3PJRA 3T12A 1BCUH 3LO5A 1OWEA 1SGTA 2DWOA 4IDNA 4NL4H 1K1JA 1XMNB 3CH4B 3A7XA 5AR1A 2STBE 3ADCA 1V2OT 1IQGA 3LKWA 4CW7A 1G16A 3VX3A 2C93B 2R6FA 3ZVCA 2QP4A 2C9OA 1GDQA 3B60A 2DHRA 1ZMLA 2UVQA 2VWMA 1H8ED 4EPXA 2ZNKH 4MKGA 5EP3A 2QCYA 3KB2A 2XB4A 1KIGH 2F3CE 2GJAA 1W12U 3CKLA 1I2MA 2ZXUA 5GPIB 3C27B 1CGHA 1DANH 1SHYA 1GNPA 3LGUA 2GV7A 3AF4A 1RTKA 1JB1A 3FKSD 4GP7A 1RJXB 3PMBB 2Z9KA 1ELTA 2JJ1D 5JMTA 621PA 3WMGA 3CRQA 5FCKA 5JI2E 1DWDH 4Y71A 2JDIA 2IF2A 2B8OH 3GLGB 1SC8U 4TQUS 4KV9A 3OAAD 1RFNA 2HLDA 4XFQA 4AB9A 3EPKA 1AFQC 1WCV1 4LHZA 3PG5A 3F9HA 2IEZA 4A2QA 4UE7H 1UFQA 4BZXA 3DEFA 1GBJA 1C1QA 1LTQA 3JZMA 1ZCAA 3ZLJA 5P21A 3WBJA 2BJVA 3UREA 4G1UC 4HAYA 1RRPA 2ZTXA 4MYTA 2RH5A 1PPHE 1V2NT 2ZPQA 2H8KA 4EFMA 3P6ZB 2UKDA 4TZ6A 1G4UR 2GZAA 3EWAA 3IWMA 4U02A 1KO5A 2V6NA 1R0WA 3B5JA 1HAXB 3KKNA 1YZKA 4KTCA 1Z1IA 2PCLA 2OQUA 4E5UA 1CEEA 1AS3A 4MH0R 5EP4A 3CX8A 2WJJA 1VG1A 3GDSA 2GMTB 5HGGA 1U81A 2BDHA 4UXHA 4NBSA 1SQTA 1O3CA 1SXJE 1KMHB 4MDEA 1E79A 3H2YA 3V4RA 1PPGE 1E34B 3BTEE 1P03A 5JB9S 1CF4A 3KIDU 2FDCA 2RGDA 3QXJA 2SGPE 2WIBA 1SQAA 1FY8E 5E0JA 1YYY1 4K5ZA 4O97A 1QHHA 4XIGS 2CL7X 3A7TA 3MWYW 1IQHA 5KDOA 3AAVA 1VECA 5C2ZA 1UK4A 4MPXA 3X1XA 3ZGXA 3T5DA 3K9NA 4BAHB 1O5GH 1SXJA 1HT2E 4TTRA 4FXGH 3BFKA 2ZJ2A 4AG1A 4CEIB 3H7TA 1CR2A 4A6PA 3TAUA 1Z0FA 2GCTC 3F68H 1G1MA 3GFOA 1SBWA 3L0OA 3TR0A 1GDDA 1TX6A 1GWAA 1FX0A 3HP1A 4ZXYH 3TK6A 2EFHB 2ZAOA 1P9UA 3A1VA 3BTKE 3TJUA 3GOVB 3FMOB 3REFA 3H4MA 3SV9A 4CH8B 2UZ3A 4V0LA 2WBLC 3N70A 4QOSA 4QBHA 2J0SA 2FTMA 3KF2A 2KB0A 5IHPA 1DTSA 2GMTC 4CHAB 2QENA 3F3YA 5TMPA 3SJ8A 1GZSA 1LFDB 4DB4A 1BMMH 3RXMA 1GFIA 2FSHA 2NO0A 1GPZA 1AZZA 1Z8GA 1XTJA 3NC1C 4DLZA 5HM9A 5A2MH 5J4LA 1TGCA 1O3LA 4AOQA 1GCTB 1DFPA 4YC7A 3PB1E 4XOJA 2G52A 2VPPA 2ZE5A 3A7VA 2IYZA 2RHDA 1YPKH 2F6RA 1P2VA 4X2XA 5CM9C 2ZR0A 3WRYC 1EWQA 1TQ6A 4CZ2A 3PUWA 3RXBA 3D23A 5G40A 4Q7LA 1ZIOA 4XTCS 3BB4A 2WPJS 2ZPSA 3SV2H 1JXPA 3KKQA 1E4VA 4YDHB 1T8OA 1T3HA 3U7GA 4GDFA 1XTIA 1YLDA 3SU1A 4ZROA 5KHOC 1GBBA 3C14C 4Q2KA 5C1YA 1P2NA 4JLVA 2BDBA 4K81B 1BTWA 2Y5FA 4AYTA 2QU8A 3WYAA 2ZI6A 1IQLA 3UFAA 4D76A 3QUSA 1FMGA 1S81A 3EZ2A 2PH1A 3OTPA 1UVPA 5LPFA 4M53A 2GNOA 5A8ZA 4YESB 4B75A 1WRBA 1CGJE 1N3BA 3NBFA 5TB5A 1E9DA 3AF0A 1TQ2A 2EYQA 2ZRMA 4V0NA 1Q3HA 3SJBA 4AX9H 2XXAB 3GLHA 4Q4HA 5EE5B 1F5RA 1INCA 1GNRA 3QF4B 3A81A 4CRAA 1P75A 3FYHA 3RXFA 4FUBA 3TNTA 3ZVFA 4OQLA 4EJSB 1G8YA 2WPMS 5EPNA 1GJ8B 2FWRA 3A86A 5K8TA 2VB0A 3GD7A 3U4QB 1TNJA 2UWOA 5AJWA 1VTKA 5E4FA 1MV5A 1YZTA 2BEKA 3AH8A 3KGPA 3AP3A 4I7YH 2JLXA 1KXDA 1SQOA 1GIAA 4PXAA 1GHBG 1W5SA 2V54A 4BLPA 2ZO3H 2BLOA 1AK2A 1EX6A 1E1QA 2A7CA 4BFYA 4LV6A 4DC9A 2ZFPH 4RSPA 3EARA 1TQ7B 4JK6A 3GLGA 2HGTH 4URYR 2FOHA 2H6MA 1SVPA 1NESE 1SULA 1V2JT 3WXMA 2W7UA 1RYHA 1GJAB 1H9LB 3TJOA 4O2RA 5BN3A 1BHXF 3S9CA 1YKSA 1O3OA 1O3IA 3AQ4A 5L3QB 1II8B 1DPFA 3MH6A 2GHIA 4QGAA 1MZDA 3BTTE 2FI3E 1HA3A 1KXFA 4UFFH 2DY1A 3LWNA 5JDUB 2AGIX 4CREA 3B1XA 3QUMP 1FAKH 3Q7PA 2O8CB 4OBEA 4ON9A 1P2UA 2ZG0H 1EOJA 5C46F 2J94A 4TYDA 2F9NA 1JR6A 1TA6A 1E9FA 1IQJA 4Q4AA 1VITF 4PPGA 2YC4C 2GESA 1BIFA 4ZV4A 1Z47A 5BYJA 1XTRA 2XZLA 3UKDA 3VB3A 5CDFA 2A5GA 5FPYA 5FX6A 5CJ2A 3ZZBA 5FUXA 2VHJA 4BFTA 3U1JB 1LPGB 3DHWC 2Z4RA 4ZKEA 3SJ9A 1NVVQ 2VP9A 3BFVA 1KNXA 2F43A 2NU3E 2J45A 1L4YA 3QK1A 3TW8B 1XJ0A 3IHWA 5JWRA 4IGDA 2G1JA 2CCKA 1EFHA 4Q21A 3QKRA 3I5YA 1RRKA 1IAQA 4MRRA 1QCPA 2X2EA 1YZNA 1NROH 2DB3A 1MABB 2I1QA 5SZJA 2R0LA 4BAOB 4MKHA 1VYVA 4NSYA 2H9HA 2ORVA 1O3PB 3IQXA 1IJEA 3LBIA 1FLEE 3KQKA 3I3SR 3LD9A 1WB9A 1Z08A 3NBYC 5GJ4B 1GVNB 3GEHA 1TLDA 4LPSA 3CNNA 1YF4A 5ETXA 1ZZZA 1ZM9A 1UBFA 3MH7A 4D9QA 6CHAC 3ONWA 4NG9H 2AEIH 3HGPA 1UKVY 1F48A 4TMVA 3WHKA 2O8UA 1O36A 4WH6A 3I29A 2P3UB 3SBDA 4WXRA 2YNMA 8GCHG 2VHUA 2X19A 2GT7A 2ZTYA 1T8LA 1O35A 3KXIA 1JALA 2R44A 2ZE6A 5LGOA 3RXUA 3FMIA 1PLJA 4LBYA 3ZYCA 1P61B 1T5LA 1YCPK 3NK8A 1DVRA 4Q7YA 1VMAA 1GCTC 4B74A 2BXTH 4RZXA 1C5OH 1JAIA 3AGQA 4FIDA 1VR1H 1NN3A 2CN0H 2QBYB 3ZVGA 4O9VA 3OFND 2CL0X 1SPJA 1G32B 3LGTA 2WJYA 3PMJA 3OEEA 4IBLH 1EAXA 3P8NA 1C5WB 2ZU5A 5DP4A 2W6IA 2HOBA 3LT3A 4X8MA 2IC5A 3CX7A 4KVGA 1MO3A 2AFHE 1TX4B 1P2MA 2R6DA 3KQNA 4II7A 4CT5A 2JH5D 1RRCA 5BWMA 3ZZ0A 1PVOA 121PA 3SHFA 4Q7XA 4B2BA 5E2PA 3G5UA 4BZPA 2CVFA 3UOUA 3SGQE 2G0NA 4PSVA 1W36C 2GEDA 2EU8A 5HTKA 3ZQJA 1ZYOA 5CM8B 1O38A 1C1UH 4TQAA 2PHBA 4RZUA 2XBXA 2I3BA 3L6PA 4ABEA 3RS0A 3FFGA 2JIZA 1HXEH 1AB9B 2Y7ZA 3M7QA 2FLRH 4TT3A 1DARA 2YOLA 1YZQA 4QGFA 3IQWA 5C4GB 4K60A 2KBEA 4YZUA 3ZZ5A 4D82A 4OI4A 2ZREA 4JSTA 2MSEB 3TIUA 2F4LA 1CKEA 5DYIA 5B6OA 3MOCA 2PKAB 2A78A 3CNOA 1D5CA 1YR8A 3FGNA 3LH5A 5A0AE 2R2WU 3Q85A 4HSEA 4QJ4A 4C7OB 1NFXA 4KSBA 4KBGA 3P4XA 3SU4A 5J5CA 2ONJA 1FQ3A 2ZGBH 2C9CA 1TONA 3F8TA 4U2WA 2BB4A 2OK5A 4F4OC 2AS9A 3ATIA 5L6NH 3AKCA 4BXSA 1O39A 1UKYA 2ZF0H 1W49A 2FPZA 2OUAA 1WDTA 1Z1JA 2DBYA 4C4PA 4I8GA 1QA7A 1O2WA 1FONA 1B5GH 4HGCA 3RANA 2D4HA 2C96A 1U9IC 2FGJA 5GCHF 2O0JA 1O3EA 1EFRA 2BY6X 2FFBA 3S1AA 4P0TA 3PYHA 1FY3A 1O2MA 4FXPA 3I8SA 1ZNXA 1OFTA 1R5BA 2CNWD 4OYHA 1VCWA 5KPJA 1MU8B 1UDXA 2OE2A 2BD8A 2V7QA 1KIMA 3MU1A 5E3HA 1HURA 1C5TA 2O0KA 3THXA 1E6CA 1O3HA 1SVLA 4LC0A 4QT8C 1Q0UA 2ZKSA 1K1LA 1AWHB 1FY5A 2FLBH 1EPTB 2G55A 3RXLA 3B1ZA 2A0QB 2VINA 1X6VA 4XBDA 1ZOMA 1O5AB 4HAVA 2BD2A 3ZH9B 2W00A 2H18A 4GHTA 1DVAH 3CIOA 4ZCLA 1IN5A 3SHWA 2IYXA 2F43B 5EXXA 3GCNA 221PA 2IYTA 5AJZA 4X8VH 3QX5H 2QAGB 4FD2A 3BH6A 1UM8A 5HR5A 1C1PA 4B34A 2A4QA 8OHMA 2G6BA 5TVKA 3P27A 2GT8A 2PUXB 4Y8YA 3MTYA 3HYRA 3TSZA 3B85A 3PV4A 4UFEH 1XP8A 2CLCX 3FMFA 1F0TA 1E32A 3P17H 3UWKA 2ZM5A 1N6RA 1CRPA 3RS5A 3WY9A 2CCGA 1NL3A 3FB4A 1IQKA 4MQBA 1JBKA 2BOHB 2ZI7A 3AVOA 1GL9B 3OF5A 3DFJA 1P02A 2OHFA 2A7QA 4M1TA 2TGTA 1US8B 2CHVA 3QXSA 3VR3A 1C1NA 3V7TA 2FEMA 3WYFA 2TBSA 4U5XA 1BTHH 3MU4A 1C1MA 4ABYA 1U99A 4H4FA 3A1UA 1YPHE 1BBRK 4HI3A 2RKOA 2F7SA 2CHAB 4W9MC 5AJVB 2ANCA 3U69H 1Z0DA 2BDYA 2NPIA 3STIA 1E9SA 2QA5A 1ZU4A 4FUIA 4W7SA 1W8BH 2ZR7A 2OLJA 3SJOA 2YYZA 2Z0MA 3UR9A 1EJAA 4UONA 2PUQH 4KKDA 1A2BA 4Q01A 2B5TB 3BV9B 2ZGCA 1QNJA 1Z6GA 3UY9A 5IYTA 4KYUA 4OHYA 4RD4A 2BD4A 1HIAB 3RXTA 2R2MB 2ODPA 1MAYA 1G19A 2XTZA 1R4AA 3Q76A 4G01B 1S3GA 1OW3B 2PMDA 4TMKA 1GHAF 4RCZA 1KXCA 2V3HH 4YMWA 1P2JA 4UNSA 1VGCC 4W5JA 2FOCA 4BLOA 3GFTA 1YPHC 4RD0A 2O8FB 3MD0A 7GCHG 1LHEH 1GKYA 1B7XB 1DPOA 4DHEA 1OHHA 3IITA 3VHXA 1NVWQ 4DLUA 2FEQH 3RXJA 3TVJB 4DT1B 4HDQB 4LHVA 1G64A 1E1QD 4DZZA 3GJ4A 1CR1A 2A5IA 4BLTA 3BIUH 4IVRA 2ZI3A 3HJNA 4KCGA 4TLEA 2W3KA 3TLOA 4A1VA 1BRUP 1G9XA 4GAWA 1S6HA 1IQEA 3TU7H 4QJ5A 4X1PU 4B2AA 1GVKB 4X8TH 2MMCA 2HPPH 3FFBA 4NCYA 4Q7JB 4M0LA 2ZYVX 1G7CA 521PA 3R20A
chains in the Genus database with same CATH superfamily
2C5LA 2OP1A 4WVLA 2AK2A 3UTUH 1Y1QA 1E8DA 2PGNA 2YV5A 3KLBA 3OHMA 2Z3CA 4KI0A 2EV9A 1AMOA 4F4FA 2OGWA 2J0UA 3RS7A 2GD2A 5LR6A 1X74A 2WF9A 3EWIA 3OQVA 3KHKA 4QBTA 2O8LA 2WZBA 2SGQE 1CIPA 5FPHA 1VB5A 1WEHA 4MX8A 1Q22A 5H9VA 1XR3A 4KR9A 3M4NA 4DN6A 5B55A 5K6RA 3TGLA 5JHHB 1VSVA 3IEMA 2DFKB 2BD5A 3COWA 5ARBA 3FBWA 4JIGA 3GHHA 3QU4A 5JXIA 2AR9A 5G2OA 4JOBA 1XVVA 4R1OA 2JD0A 1MBZA 2QGNA 3CLTD 1QYCA 1W0KA 3I1IA 3KHSA 2H1UA 1HNNA 2O48X 4KUEA 4LRQA 2C8XB 5F6MA 1FSZA 4DCSA 4LK3A 3A37A 2TRMA 2QTVA 2O2HA 3EGXA 4DQDA 5DSZA 4XE5A 2IA5A 2Q8PA 3ESCA 4OI1A 1VCPA 3B1YA 4EKDA 2ULLA 1LVHA 3LC5A 2DP4E 1WMBA 1PJTA 5TMEA 1ENZA 2H51A 1E3EA 2A9OA 1L7NA 3QEMA 2H1CA 3LT0A 1VP3A 1VHWA 1U7TA 4QWWA 4HGNA 4RTKA 1C2LA 1Z6XA 1J09A 2DKFA 1SOZA 3DE4X 4ID3A 2JAXA 1HFDA 1OPHB 1XUJA 3IQZA 5FNVF 2BGTA 2RBKA 3RNOA 4BO1A 2P40A 4CODB 2VWLA 2QI9F 4JXXA 2YZGA 2B4KA 4CIVA 3NIFB 5EKTA 4HAWA 1L7BA 3ZHTA 3LUHA 1Y42X 1O3DA 3U7QA 4EATA 2QX8A 2YVUA 2XQGA 3LF2A 1GZ5A 1XCJA 2JH6D 1E9VA 1F8GA 2WDZA 4HQ6A 3ZZDA 1GUZA 1NR1A 4QYSA 5HIIA 1E96A 3I4FA 3JW8A 4YAUA 2W83A 3OZUA 2IYAA 3QMVA 1TCBA 2PMCA 4HS4A 3H65A 1NSTA 3HKDA 3RI3A 1T8RA 3INTA 1F60A 4ISIH 4MQFB 3BXHA 1Y9JA 5A1TA 4YRCA 1CV2A 1C0PA 4R0IA 2F9LA 2FPGA 3OP1A 4ZZ2A 3RS9A 3W1VA 3SHAH 3ZV6A 3J81A 1ZD4A 4M7GA 2Q1YA 1WDMA 4DGSA 1ID5H 1QR2A 2ZAYA 4U8GA 4HDMB 5AKZA 5JS2A 1OP0A 1GKUB 3G9QA 2ZKIA 1IVYA 2E7ZA 1ADGA 4Y2YA 3ELAH 4OS2A 3D64A 1CQQA 3U9SA 3MAJA 4EF5A 2GWHA 2BDGA 1PNTA 1SQ0A 3ETHA 1ZHOA 1A3EH 6GCHG 3QHQA 4AJKA 2LNCA 2IEIA 4PZ9A 3BE4A 4GZ3A 2DQYA 2HRBA 4I99A 4C76A 4CKBB 3VKGA 1XZKA 3IQGX 4A73A 3KQEA 4ZOEA 1C1OA 2DH5A 3FNFA 3PE4A 1KAQA 4YQYA 1X38A 2P59A 1WHTB 1C2YA 1VJGA 1E2FA 1GNVA 1V2ST 2PZ8A 2XF2A 2ZJ6A 4OMDA 3FHJA 1Z4JA 2Z9LA 3NT4A 2JGLA 1BOQA 2BY5X 2VGCB 1HG0A 1W581 5FHTA 2H5JA 3RTGA 4MPPA 5JC8A 2YJ4A 2G88A 2X76A 5BMOA 4DOMA 4EPVA 2ZM6B 1Z4KA 1DQRA 3A2KA 3GFSA 3MUEA 1ETUA 5CLLA 4Z4IA 4I6JA 2H5IA 4C7BA 3L4EA 1W4LA 1U1EA 3TOVA 2QJRA 3D7KA 4YRPA 1XJQA 2ZP0H 3G8YA 3KP1A 1W29A 1T26A 1GHTA 4QXQA 1ABIH 3EVZA 1NW3A 1MT0A 4GMHA 3TITA 3GAMA 4OK6A 1EKBB 1W1WA 4NKRA 5D5QA 4NJEB 2PTNA 3BZWA 4NFHA 4OQMA 5C2JB 4G67A 4L3WA 1SQRA 1S2IA 2FPIB 3VKHA 1KO7A 1ADJA 1KI1A 1V7ZA 1X7GA 2BEVA 3W06A 3RV3A 3DQPA