5FPYA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 5-bromo-1-methyl-1h-indole-2-carboxylic acid (at21457) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords SERINE PROTEASE NS3
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 202
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpyA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpyA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpyA03
4NCHA 1XJQA 4WY3A 1EJNA 3SNEA 1XD9A 3GEIA 2GZDA 3AGPA 1CJMA 1GI9B 2GESA 1VZQH 1KAGA 3EW9A 4IGDA 2ZI9A 1J99A 3A4LA 1SMFE 3EE0B 2H18A 4BFVA 3GLIA 2BWJA 1O31A 2C9CA 2OCAA 4V02A 4OJKA 3BH0A 3WNBA 1MO4A 4A9AA 2TIOA 4QT8C 2VHUA 4X8TH 1UCYK 3SJAA 4L5BA 1QG4A 2FODA 3GCTG 3BG4B 3ZD7A 1ZMLA 3M7UA 5KNDA 3CH5A 2EQBA 3PEYA 4F38A 4AKGA 3P95A 3CNNA 3I77A 1ESNA 1ZU5A 4QRHA 2QP4A 2L0XA 1GMDG 1C5OH 2XTNA 4S2EA 4HDQB 3KNXA 3EC1A 4EFMA 3EA9A 1C5PA 2IX3A 1RVDA 3ZQJA 1AZ8A 4HLUC 1TABE 1X7AC 1W36B 8LPRA 2F9LA 3ETLA 5FBIA 4Q2KA 1ONBA 2VH0A 3VEQB 2BLWA 2CF9H 4YLQH 2A0QB 221PA 3R8CA 4PPNA 1BOQA 3TW4A 3F9EA 3D49H 4Z0KA 4X2YA 4FN5A 1K1OA 1DWDH 2ZRMA 3RC5A 4BTUB 3RXGA 2Q9BA 3CW2A 4RN6A 1EZSC 5FXLA 2Y5FA 3U8TH 2J3EA 1EPTB 5C1YA 1C1WH 1M9UA 1MABA 3M7TA 4V03A 2CJIA 3OAAA 4U2WA 2BVXH 4V0ME 1TX7A 3KKNA 5JS8A 4A0FA 3TIUA 1A1RA 3Q77A 1KO7A 2XGJA 2ZSDA 5B57C 2G51A 1MQ5A 2JGNA 5FTMA 1CKEA 1WDTA 1O3IA 1GL1A 4YXWD 2EYQA 1KI7A 1SGPE 2ZAOA 2Q9CA 3RRNA 1ZVQA 4P33A 5DHFA 4EFNA 3L0IB 4I1VA 1BJUA 4XSHA 3JZ2B 5FUWA 3ZZ8A 3ADDA 1A82A 1GI8B 2D1JA 2QAGB 2FX3A 3FVQA 1BUIA 5GADl 1O3FA 2ZRDA 3C4JA 1IQNA 3V7TA 1RFLA 3A4NA 3QXSA 4XBDA 4RD0A 2SGAA 2SGPE 3KQNA 4GHTA 3V4FA 1OP0A 1DXWA 2O52A 4A7IB 2P3FH 1WOFA 4AWXA 2OE2A 3I4LA 4HB3A 2ZE6A 1S96A 4HFPB 3ZZ4A 3BTGE 3C1KA 2ZTYA 2VSXA 4B2IA 3AKEA 2Z6VA 1O3DA 1XXHA 1DY9A 5TXGA 3A85A 3HK6B 1RGQA 1RIWB 1TQDA 1Z6GA 1U98A 2FPMA 2BJWA 1Z2CA 5JCZA 2WZQA 3FB4A 3FHCB 3STIA 4LV6A 3FP7E 4GPTA 3U2QA 3GJXC 3SV9A 2GKVE 4A6XA 5G3YA 5HMAA 5DGXA 1E35B 3CS0A 5AUOB 3DZDA 4AYTA 1I4TD 1TEVA 4FUJA 5HPYB 4TMTA 1ETSH 4ZHAA 2XYAA 1BTHH 1KXAA 3KKOA 3URDA 3UWOA 4BFYA 2J94A 3O8DA 4I33A 4LV5B 1NKTA 3LVRE 2G4TA 4X8SH 2K1QA 3NPSA 1E9SA 4PPGA 4IRUB 1S3SA 1YU9A 2ZRKA 1VR1H 1Z06A 2HLCA 1LY1A 3BTHE 2BMEA 5GXPA 4XD7D 4I7YH 3T1VA 1ESBA 1QZXA 3SR0A 3K6ZA 1KK2A 5KHOC 4JT2A 1ELAA 2JETB 1F5RA 3ND9A 1N6NA 2J9RA 5KTYA 1IY2A 1FIZA 3VX4A 2ZSAA 3W3AA 1NMYA 2PTNA 2PWXA 2WINI 3G5UA 1D5CA 3SGQE 1W0KA 3HU2A 2ZTSA 3SGAE 1Z08A 2CL6X 1S1MA 1HAGE 2ZVQX 2FSHA 2HLDA 2JLYA 1MO3A 2IC5A 4YTAA 2ZE8A 5D3MA 2O8EB 1GCDA 1UDXA 1H1BA 1F2TB 4Q02A 1SVMA 4TL9A 1ZLRA 2GETA 2ODPA 1GHWH 3SNAA 2R6CA 3F1SB 1UEIA 2FYRA 3O8RA 3SU2A 4JLKA 3KTAB 1UBGA 3SU6A 1O32A 5AFYH 2N1BA 1ZHRA 4HLQB 3H1TA 2XC0A 2EFDB 5JWRA 3LU9B 1ABIH 4TWYA 2OBLA 2FS9A 4NFEA 5CJPA 3OFNA 3GDSA 3RS3A 4RFSA 2PL3A 5J5CA 3RC3A 5DP3A 4JKIA 2OAQ1 1HV7A 3ZV8A 1R8QA 1V2PT 2ZQ2A 3NDPA 5HGGA 3FZDA 3PEUA 1GGDB 3SORA 3RXEA 4JLOA 3T35A 1MCVA 1GHBF 1TPAE 5C46F 1BTZA 4CRCA 4DY7B 4WVFA 4ZIRB 1RFNA 3GJ6A 1G3CA 2GV6A 1GG6C 4U7DA 1M8PA 1TONA 1ESTA 1L0ZA 4LJYA 2Y5GA 4EQ6B 1B0UA 4BZQA 1HGTH 3F3YA 3FVFB 2ATXA 5DI3A 1OIWA 5T6DA 5CB8A 1SQAA 3QK1A 3PUWA 2E9SA 1P02A 2TRMA 1PPEE 4MNXA 1PQAA 1R5OA 1C5SA 4URZR 5AJYA 2J41A 1U8ZA 2QXGA 2F43A 8GCHG 1FW6A 3P70B 1H8EA 1O33A 3VKWA 2HCJB 1VCNA 1FONA 4UFGH 1G5RA 1I4LD 5EP2A 4NKRA 5JEDA 5AUQA 2HPQH 2Q3HA 1KMHA 4LOAA 4MQAA 2IYZA 5DYIA 1H9HE 1TALA 1YZUA 4LWZA 1NO9H 2CLSA 5ETXA 5HYOA 4KYUA 4ZCLA 1QY6A 1II0A 2A7JA 4RD4A 2R2MB 2B7BA 1DICA 4NA8A 4WWYA 2UZIR 3RM0H 4KI0A 2B8WA 4QOSA 5IDKA 3PIRA 2ZU6A 5G41A 2BBOA 4M1TA 2GCHG 1LHCH 2E1RA 3G0HA 2ZFRH 4JLAA 4AZ2B 3T06B 2W83A 3QDZB 1VCOA 2JKHA 4M1OA 1W0JD 2OLJA 3KDSE 2BOHB 4E7RG 4NYMR 4KBGA 1GBCA 2ODBA 1A2BA 1U94A 4Y7BA 3K70D 3P92A 2A3RA 3TUJC 3IDQA 4KFSA 3H84A 1G7CA 4Q1CA 4PROA 1O2HA 2BDAA 2DE9A 5H8WA 1JI0A 3ATMA 3HR8A 4P0TA 5K8LA 3AKCA 1XMSA 5IT5A 2FOAA 1NVXQ 1YGCH 1UKYA 4DB4A 3GLFA 3VR6A 2H17A 3RWMB 3EIHA 5F3WB 4ITRC 5I46H 4Q9KA 4A2QA 1E2EA 2ZJAA 5M04A 1P9RA 5EXPA 2WKRA 1T8NA 2ZPTX 3SOSA 1FQJA 4GZLA 3UIRA 4RJLA 1XEWY 4AG6A 3CB4A 2RCEA 1UKEA 1G16A 1NBMA 1E2LA 1K2I1 2XJ4A 4BLTA 4E03A 5ABWA 1Y3UA 1HDTH 1ZM3A 1GBMA 3BXZA 4G0NA 3W95A 4AG2A 4QGFA 4AURA 3H7TA 1Z0DA 2Y6TA 1LMWB 1RZ3A 3QXJA 1X8KA 2JASA 3A8DA 1VCQA 4JL5A 1T8MA 4Q9LA 1O3EA 2G1KA 5A2MH 3K9LA 1XVOA 3REFA 2PBRA 2B8TA 4WH8A 3A7VA 1AZTA 2XB2A 4FIDA 3VGCC 2O8DB 1NIJA 2ZFQH 5CDFA 1KI4A 4RD2A 4AKIA 2GZ9A 1ANKA 2IYWA 2LKDA 3A87A 4OS7A 5JS7A 4IOMA 2XSZD 3FP6E 2NO7A 4QJ3A 2IHBA 5BYKA 3ZVAA 2ANKH 3F9HA 1MV5A 3VR1A 1AWFH 1O3MA 4DT1A 3U69H 2WIAA 4LHZA 1UBFA 1B0EA 2OCVB 1IQIA 4BRUA 2JDIA 4UNSA 2IYVA 4YO9A 4TYNA 2VWOA 1ELDE 1XWIA 3A81A 4MKIA 1SLXB 1N5IA 1XB2A 3VX3A 1AKSA 2A4OA 4DIHH 2NIPA 3T61A 4D4JA 1O2OA 1P3CA 3VHXA 3T1OA 4FD2A 3VU9B 1CBWC 1DAFA 3DMDA 1SGYE 1GVLA 1R0WA 2ZROA 3BIVH 2BKUA 4CGZA 1C5QA 1SXJA 1G7SA 1RJ9B 5KSOA 4DIDA 2X77A 1RIFA 4YMVA 3U3KA 2BZAA 3TVDA 4Q19A 4Q7YA 3AUYA 1C2KA 1ZNWA 3ENSB 3KQKA 1UJ1A 2BCJQ 5DP6A 2LWIA 1VITH 4M9ZA 2TBSA 1KI8A 1FMGA 1YLDA 1R7RA 1ZGIA 2F9OA 5TARA 5FTKA 2SGEE 1TEXA 3K0FB 2HOBA 2IUTA 5IK2D 3NEYA 3DM9B 1ELOA 4BGDA 1OYQA 4FU9A 2GCTC 5JSZB 2WV5A 4PQFA 1WF3A 2O8TA 1GBHA 3QPVA 3P20A 4M9QA 1R5BA 4R71A 3E2IA 3SHCH 1GPZA 2BOVA 1O2WA 1K1JA 1QFKH 1US8A 3OY5U 1S6FA 3TQFA 3LPRA 4OS5A 1QURH 3T5DA 4ASUA 4V0MA 3NDBB 4OJQA 3NBXX 1CHGA 3S7KB 3RXFA 4A1FA 5TVKA 1CJVC 3HPQA 2X1VA 2ODEA 1SGNE 1E1QA 1TAGA 1EATA 4M1YA 1C1VH 2PX3A 4NTZA 3AVOA 2P3TB 1C2MA 2CF8H 2VO1A 3UR6A 2WPDD 2AD5A 2C9YA 2ZEBA 1A7JA 4RD1A 1GFIA 3MH6A 2VRWA 4O9VA 3OE7A 1Z2AA 3UWIA 2F1IA 1FY4A 2ZI6A 1XKBC 1Z6JH 4CYMA 1BBRK 3GCHC 1EQ9A 2BMFA 1BHXF 3BTDE 2EFEB 1T8OA 2QQ0A 3E6PH 2GT7A 2IYTA 5EUMA 4QG7A 2J95A 2CHVA 1GP2A 1SI5H 1BYUA 5AJXA 1GKYA 3MNCA 4UNNA 4BWYA 4C2UA 2OC8A 2KAIB 4UNPA 4CEJB 1KK3A 1XU4A 1G3EA 3MNSA 1GSIA 4BPBA 3U8RH 3LT3A 4MYUA 5I25A 4O3MA 4X1NU 1P9WA 1NNEA 1KY9A 2CLDX 3UWKA 4NPHA 2P8OC 2BX4A 3RNLA 2VWMA 1OXUA 2OFWA 3PUXA 4HAYA 2YOFA 3BEIB 4MUAA 4HZHA 1EP6A 3S9CA 2QM8A 4CRDA 1JXOA 1UFQA 2R6GA 3UY9A 1F60A 3UIEA 5GJCA 4YT7H 2ZDLA 3ZIAA 4ABYA 2P6RA 4A92A 4O25A 3LLUA 4E22A 3AEZA 4CRAA 3MCAA 5JJLA 2M5TA 3Q5DA 4X2VA 1KI3A 1Z6EA 4DLRA 2CL7X 1J15A 1AQUA 3UXMA 1KSJA 1XNJA 4FUHA 1OV4A 4F91B 1U0LA 1NRSH 4UFFH 4GBMA 1KXEA 1E9DA 3OEHD 2O8CB 1Z0IA 4Z1MA 1HTWA 3S9BA 2KBFA 1SGWA 1UEJA 2V3OH 1NG9A 1DDJA 1GDDA 3LX8A 4IFEA 3P6ZB 5EU8A 1S81A 1BZXE 1BQYA 4DXAA 2D62A 3H09A 2A5GA 5EQTA 2QGNA 3AK5A 2GWHA 2ZJ2A 2QG6A 4Y76A 8KME2 1G7TA 5C2JB 3NIBA 4WXVA 3X1DA 3G01A 4ZUHA 4XOJA 1O35A 1W48A 1HUTH 3GEEA 1EFRD 1R4AA 2R6AA 2CHQA 2XITA 1GIAA 4C0LA 3MUFA 3GPLA 4RVCA 5HXFA 3UK6A 2OCPA 4GLYA 2FEQH 1AZZA 2C8VA 3FFBA 2V8OA 1TF2A 1V2ST 1O39A 1SSXA 3UPUA 2GJ9A 5GJ4B 1VJ9U 1UDWA 1RTKA 1PPBH 2ZHFH 2AL7A 1PPHE 2JLXA 2CVFA 1SOTA 5D3QA 4JYTA 1P6XA 1HIAA 1IN7A 3KL6A 4P31A 3SU1A 1SKYE 3QPWA 4BE7B 2O9QA 1UVPA 3I72A 3A8BA 3EWSA 3A86A 1HE8B 3K0EA 2QEQA 1T8TA 3TQCA 1BTUA 4AYYB 3RMMH 3A8TA 3X2SA 1IJEA 4KITB 1N6PA 4NH0A 4NIXA 4JYBA 1S85A 4NIWA 1E2HA 3DA9B 2G9NA 1TGTA 3RXUA 3RXOA 2FH5B 4MYCA 1LQEA 4D7FA 1FI8A 4XH9B 1RKBA 4PHGA 1JWTA 4WMEA 3SFVA 1LHGH 3LXRA 4LOYH 1AQ7A 3AVUA 1CA0C 3DVLA 1GBFA 1QHGA 1ZM4A 4OK6A 4OM9A 4LHVA 2VB0A 1TNKA 1O5EH 1DS6A 1V5WA 5DN6A 4YOGA 1M74A 3U3JA 3C14C 1D9XA 2WICA 4TN1A 2JLRA 3HYRA 2QBYA 2QZ4A 4AORA 2OLGA 3PWCA 3K0CA 1TFXA 4LYHA 4IJMA 2FTMA 1TUIA 2ZI2H 3TGKE 1R5NA 4CRWB 4K5ZA 2VU8E 3FTQA 3N2EA 1XKAC 1TX8A 4CZ2A 1LV7A 3KB2A 2CNWA 1HURA 1GJAB 2QENA 3MU5A 2DYKA 2ZI5A 1WTGH 3EG5A 1ELFA 2GA8A 4Y0ZE 5SGAE 2P5TB 2GV7A 1ZC4A 1J17T 2IS2A 4ZI2A 1ARCA 4B6EA 4DDTA 1YRBA 3L0PA 4MRRA 1GJCB 1YKTA 2FMJA 1O5FH 1DG3A 2ZGBH 2ONJA 5C4GB 3S69A 2EFHB 4N3NA 4AFQA 3CIOA 2BD2A 4F7WA 3T5FH 2ZJ8A 5A0BA 4HDCA 1S0QA 3V13A 5B30A 1IHUA 1XPOA 2CJWB 2BM1A 2XNDD 4BAOB 2ILNA 2ANCA 1EWQA 1TPZA 3QF7A 4B48A 3EPKA 2BDIA 1COWD 5CHAB 3PO1C 3A7TA 3LA6A 4B3XA 1KSFX 2J4IA 2VEDA 1C5ZB 1MUEB 1DS2E 1RD3B 1XXFA 4TLBA 1NLFA 3MD0A 1LO6A 4KJZA 4IMQA 4R2HA 3SI7A 3VAAA 1WAYB 2PKSC 4AC9A 1BMMH 3FMFA 3PV2A 3ZZ5A 5EXNA 3EXAA 5ANRB 4GOXA 3PV5A 4XTRA 4PSAA 621PA 3K9GA 1TNHA 4CBNA 1E2JA 2HCBA 3SE0A 4EPRA 4BRWA 3QUSA 4BLRA 4MPWA 3SO3A 3IILA 4X8LA 3HJNA 1HBTH 3PUZA 1EPTA 1SLVB 1YP9A 4M53A 2BTCE 5J4KA 2O8BB 3UMFA 4X0WU 2GEVA 1DSUA 4XWOA 4H42U 4ZH8A 2IYSA 2QTFA 4ZKEA 4HZIA 2ASEA 1IONA 1BA8B 3TK5A 3BIFA 1FP6A 1N8OC 3B2EA 1QBNA 3AVXA 4GAWA 3DHKH 4NGAH 1A7SA 2GMTB 2A2XH 1PJPA 2ZREA 2ZP0H 2CMKA 2IYYA 2IF2A 2FOCA 1KOFA 3M7QA 1JRTA 2HJGA 1XP8A 3N5CA 2FI3E 2Y7ZA 2IHYA 4Q9JA 3V3MA 1FMLA 1AA9A 3U9AH 2QAGA 5SZHB 1SB1H 4GZMA 1C5WB 1NSTA 5JCPA 3R8FA 1DX5M 2Q6TA 2WWFA 1ZRHA 3ZJYA 1AY6H 1GDUA 1O38A 5AUPB 1AO5A 1MKWK 1TQ7B 3QKRB 2CCJA 3GD7A 3U6KA 4OQLA 1GWNA 1QVRA 2C9OA 3GLGE 3AVQA 3HATH 1KTTB 3T62A 3RLYH 4VGCC 3SGBE 1W4BA 4A6LA 3QLPH 2NU2E 1NRJB 3MWIU 3O47A 2RA0A 2TMKA 4FUBA 3AF3A 4I8HA 2IS6A 4Z54A 3OAAD 2XWBI 1LW7A 4RCZA 3QTOH 3B7GA 3MU1A 3VB7A 4B2PA 4PQYA 2ZRFA 4KFTA 4NYJR 2ERYA 2IUUA 1S9HA 5E3HA 2G8TA 3K6YA 4CHAB 3CLVA 4ZHMU 4AX9H 2BV3A 1Q3TA 1U9IA 1WRBA 3AVYA 2O8LA 1GHYH 3C41J 1J2JA 4UFDH 2BDCA 3A88A 1CS4C 1C1UH 4JBYA 1V6DA 4FVBA 3TR0A 4NCYA 4EFLA 1SQOA 3GY8A 1RRPA 4D0LB 4US0R 1HT1E 4IMZA 2WJGA 3KXIA 5F8ZA 1ZPCA 2NU1E 5CITA 3RYTC 5DP5A 3CKLA 3Q76A 3LGTA 3ATIA 3W34A 1W36C 4INKA 4HLCA 1KJZA 7KMEH 2PLXA 1YRAA 3L0OA 4PR0A 1EAWA 4K2YA 2H16A 2KJQA 2WJHA 4JKYA 4YXWA 1E2GA 4Y0YE 4ZROA 2CLCX 3RSLA 4EPWA 1ETRH 1ELTA 2PT7A 1NVVR 3KX2A 1ZMJA 2BY6X 5JRJA 1EPTC 1A5TA 9ESTA 4DT7B 3W9YA 2HUPA 1AGRA 1GRQA 4JLVA 3X1ZA 5EP1A 1I4DD 1ETTH 2OBQA 2ORWA 1ETUA 2CK3D 5AJZA 1GBEA 1R10A 3VKGA 3T25A 4PC6A 4ABEA 1OFIA 1S84A 4B3CA 1ZTJA 3PJRA 3OU0A 4UXIA 1NL3A 1S8FA 1RYFA 2A2ZA 1Q1BA 4DZZA 1N1LA 1E6CA 1MKYA 4DLTA 5HKKD 1A61H 1BYIA 3LGWA 2J87A 4F92B 5A0CA 4TPIZ 2RGNA 1YZTA 2QM7A 3MAAC 3QKUA 3KTAA 4TLDA 3RANA 4JZDH 2CHAB 4GT1A 2ODYB 2ZJ5A 2IWHA 2J7KA 4JSTA 1OX1A 1JR6A 2O0HA 1L4YA 2JLWA 3ZZ6A 1GJBB 5EQQA 1BCUH 4FUCA 2Z9IA 1YQTA 3LFUA 3RU4E 1IN5A 3GFTA 2J1LA 3MH7A 4DLUA 2SGDE 2W00A 4Z8YA 5LB2A 1FAKH 5FH9A 3EPHA 5ELXA 1D3DB 1NS3A 2VP6A 5FOWA 2VVUA 2BBTA 2OHFA 4YMUA 4B76A 1ELCA 4TYWA 2W3KA 2IOTA 1ZD9A 1UVOA 4NBSA 2W6ID 1PPCE 1W0KD 4CIDA 2ZTZA 2R2WU 4WH6A 4ZIRA 3PLBA 2FSIA 2DR3A 3ASZA 3TITA 4CW7A 4JT4A 4B2CA 1WCZA 1RIWC 3F6UH 4EQ6A 1AMHA 1O3GA 1Y59T 1KK1A 6GCHF 1H9LB 4PX9A 1EZUC 1YPHC 3QEJA 2OV2A 1P04A 2Z3EA 1U9IC 5CB6A 3RXTA 1KYIA 3STJA 1QBKC 1YJ5A 1VCMA 2FPLA 3SN6A 4NU0A 2HDNB 2DWPA 2PMDA 4F4IA 2FDCA 1U2RA 4Q00A 4YC7A 1U81A 2CL0X 1M7BA 3ELAH 4NONA 5KPDA 3HR7A 2OQ5A 3VXEH 3KL4A 2WYJA 3OFND 3VMFA 2ZWLH 2YWGA 2ATVA 4AN7A 3BERA 1XD2B 1NM6A 2P6UA 2ZDMA 4LHWA 2WWYA 3WP0A 4YQFA 4A2WA 5JB9S 3IUYA 2QY0B 3O8CA 2IYUA 2JETC 3ZVRA 2D3WA 3P4XA 2UUKB 4KHZA 4DGJA 1UM8A 3PFIA 3TSZA 2WSMA 2H57A 3B9FH 1AI8H 3S7HB 2VIOA 3GY2A 3AB3A 1A0HB 1TPSA 2WTUA 4KFRA 1GI0A 1H4WA 2ODNA 5FL3A 1PZNA 4M9SA 3QTVH 5CM8B 4ABDA 3NBFA 2Q1JA 4AYXA 1CHOF 4J1YA 4X1SU 4II7A 3RXKA 4BECA 4HAXA 1O34A 1IAQA 2SFAA 4L9SA 4OI0A 1AHTH 1NU7B 3U98H 1QHNA 1O0DH 4O3TA 3HPTB 5EJEA 1OW3B 1GI3A 2JAQA 2YYZA 1N6HA 1OPXA 3KJEA 4Q4HB 1Q20A 1IJFA 4X1RU 1A5IA 1XFAA 2RGNC 3D7MA 3QBVA 4PZZA 2Q21A 2IS4A 1QHSA 1E34B 3E5HA 3RUOA 1C2DA 4DCNA 2GXUA 3E8LA 4AD8A 2WPMS 3B78A 4IVQA 2GDDA 3ASYA 3DDCA 2C8XB 3M37A 5AK0A 1CJKC 3QNUA 3AH8A 1SGIB 4I8JA 1ZP6A 2W5EA 1NT1A 5EPYA 2W2VA 3GOVB 4DSTA 3LW8A 2C99A 2XZPA 3KFVA 1OH6A 2DPXA 1CT4E 4BAMB 1GGDC 3AKYA 1TNLA 4MNYA 1MBMA 1D2MA 3SYNA 3KB1A 1MO6A 4FVDA 1UBCA 4LRWA 1IQHA 3SI4H 1KDQB 3LGYA 3PLKA 4Q7JB 3CR7A 3SDZA 3ZVNA 1ZU4A 4PZYA 2O8DA 2RGCA 4IS5A 3MG9A 4FCTA 1RRCA 1FIWA 1T31A 4AFZA 1HRTH 3LQQA 5AJVB 1OYYA 2EI8A 2FFBA 1TA2A 4GUXA 3CO5A 1GL9B 2A5YB 1WBGB 1DOJA 1C4U2 2G55A 1W0JA 1VTKA 3RLFA 2BQ7B 1Z6XA 1U8YA 4Q7ZA 1GJ8B 3LX5A 1KHTA 5EE5B 2SNWA 2JJ1A 1RTLA 1ZSLA 3VU9A 1TL7C 1NBMD 1GL0E 4FUIA 3A1WA 3A36A 1LVMA 2FOFA 4POAA 3R9WA 2BCGY 3CNOA 3W6NA 4HYYA 1RJ9A 5C1XA 3OYPA 1G32B 1ZR0A 2QY9A 2OINA 2NU3E 2FSFA 3U7HB 1GI4A 4GMXA 3GDUA 4M0LA 4ZO4A 1ANEA 4FW9A 1C1SA 5GCHF 3MWJA 1HYQA 5BXQC 3SJBA 1LQDB 1KSNA 3K0FA 3ATWA 4RD3A 3IGFA 3ZYDA 3LXXA 1GNRA 3LRPA 1PLKA 3IIJA 5J47A 4JSYA 5HM2A 4B44A 4AB8A 4GVUA 1KI6B 1N0UA 5JSZA 1WP9A 2QE7A 1HXEH 5CK5A 4H1VA 1FNMA 3MNXA 2ZANA 4X2WA 3GLIE 2B0FA 3U3MA 4Y0VA 1DO2A 1E4YA 5CYOA 3SNHA 5JI3E 2JDID 3TUIC 5BPEA 2H5EA 5DNYB 2QTVB 1AIXH 4TT3A 3EZ9A 4AKEA 4LI0A 1YF4A 1BMNH 1KIGH 2GP9B 1P05A 4OYHA 2AMQA 1TNDA 3WRXC 5L3SB 5CE1A 3BIUH 1F5KU 2F9VA 1VYTA 2RH5A 3EARA 3IBGA 2LPRA 3R9XA 1ZMXA 3UPEA 4WMDA 4ZDIA 4C30A 3IEVA 2QRZA 4DLZA 1NMXA 5DP7A 2C98A 2XTMA 2YOGA 2GF0A 2V3HH 1CGJE 1SXJD 4L9WA 1EXMA 4IN2A 1G8FA 2ZFTA 1O2ZA 1OH5A 2ZRLA 2XSZA 3NK8A 2ZR7A 2HVXA 5L2ZH 3P17H 2QN5T 2PJZA 1UTKA 4D81A 1BMFA 1C2FA 4V0KA 3VR3A 1CO7E 3QEOA 4PHFA 1ZMNA 5E2OA 1E0SA 2V6JA 1T3LA 5K0HA 3BSQA 2PT5A 1ZIPA 5JJKA 1TQ6A 3ZZ7A 2R9VA 4DOQA 4LYFA 3X1XA 1DLKB 3AASA 2GDEH 1P09A 1E96A 3VB5A 4O2LA 1KO1A 3FAOA 3AVPA 4D8NA 1TRMA 1P9UA 1T0JB 2F1HA 2ZCLP 5DSZA 1F5LA 1QJ1B 4Q4JB 2KAIA 2AGEX 2Y7XA 4X8VH 2CE2X 4CEJA 1T8LA 3MH5A 3ZVFA 3V9PA 2NO6A 3RXRA 2JIZD 3CF0A 1C9PA 4X1PU 2ZPRA 5EE9A 4LK2A 1UTOA 2FU5C 4XSKU 1QQ4A 4K3JA 1GI6A 1O2JA 3OSYA 2XC4A 1HAOH 3U44B 1F0RA 3RC6A 1NY6A 1ZUIA 1A3EH 2BZ6H 3CPHA 3ZVCA 3DUXH 1QQUA 1E1QD 4PZLA 2ZCKP 1O2MA 5FPKA 3EGKH 1NJFA 4BASA 4V0NA 3TRFA 3TSOA 3PB1E 2HYIC 5FX5A 3FFAA 3N7OA 3P27A 2I6QA 1D2EA 3P4YA 5J4LA 2XCNA 4JK5A 1L2EA 4AY2A 1SGFG 3OE7D 3OZXA 1L1GA 4J0QA 2XBYA 2AH4X 4CRFA 1OHHA 1IN6A 3RXVA 3ICQB 3Q8XB 1W47A 2CXXA 2VIVA 1S6HA 3GYLB 1NFXA 3IPXA 1GNPA 2ZYVX 1AUJA 4OQFA 2O8CA 1R0YA 4WF8A 4GP6A 4CEIB 2A4GA 1SXJB 4DDUA 3CX8A 2VP0A 4DDWA 3LO5A 1QHYA 3KEEA 3RXBA 1O2NA 4YDHB 4AKHA 3AP1A 2HRVA 1XXHE 2MSDB 2PHBA 2HF8A 3FOZA 2FTLE 5TJXA 4F4JA 3IQWA 4HATA 1G6OA 3LBNA 3SQHE 3PUYA 4A1TA 1SKQA 1HAXB 1L1JA 2ZKSA 1E32A 4ZHLU 4JLBA 2H1UA 4DJTA 3CWZA 3DL0A 4JVLA 1QBVH 4FU8A 1RTFB 3ZS9A 5A8ZA 4F49A 4ZV4A 3RRYA 4OBEA 1XMNB 4Y71A 3DKPA 1GBAA 3ZIAD 1BT7A 2HYDA 2DBYA 4PAQA 2BC9A 3PXGA 1M6NA 1JB1A 1HUQA 1GDQA 1YE8A 3BFXA 5EW1H 2BDYA 3ZQ6A 4PHTA 1Z8RA 4MNVA 4B71A 3MNBA 1ZM2A 2O8MA 1GG2A 2QP9X 2QV1A 4I99A 1SQ5A 1ZNYA 1FPMA 1XCGB 3C27B 3LH3A 1NU9A 4LCBA 1T4VH 1O3OA 3L6PA 4NA7A 5HCNA 2OXCA 3IIMA 3E1XB 2G83A 4DDVA 2NQ2C 5EXTA 1QB6A 3AVZA 2A31A 5FBVB 3PMJA 1LF5A 1PPFE 1NC6A 4G3XA 4L15A 4DJZB 2ZO3H 3GP8A 3K1JA 4LJ5A 1LPZB 4MRSA 2VQSA 1XBTA 2H9EH 1HAPH 2GXQA 3OEHA 3PQCA 3GY3A 4Q4AB 4ZCMA 5F2EA 4JYCA 2XBVA 3RC8A 1SVSA 4LZ1H 5FOTA 4B1TA 1GM5A 5J4SA 3CBQA 1J9CH 2OESA 4MNWA 2WKQA 2A5IA 2XJ9A 2GK6A 1NN1A 5E95A 1CT2E 1QA7A 2IN2A 1T0HB 2ERXA 4AGKA 1O3YA 3P8GA 2FX6A 2VLIA 4MGYR 1CBUA 3LONA 5JEEA 1CR2A 1BO6A 4UJ3A 2FPKA 2G4UA 2WWHA 1MH1A 3PVSA 1VPLA 5DGJA 2W7SA 1TOCB 2DCUA 4FUGA 1GVKB 4D25A 2QYIA 2NO9A 5HZHA 1K1MA 3ZYEA 2PH1A 2BD8A 3GY6A 2JH5D 2YZ2A 2CBZA 5KYKA 3M35A 1DBSA 2GHIA 4FMDF 3JZAA 4NFFA 2BY8X 4NWKA 4H6SB 2ODQA 2P2LA 1F2UB 3RMNH 1KLIH 2PGQB 3CH4B 3IHWA 1RXPA 2RAPA 1XM1A 1YCPH 3BWDD 3DPUA 3BJIC 4NP6A 3AF0A 4BFXA 3B1XA 1FNNA 4LV8B 3KJHA 1E9RA 4TY6A 4ASHA 4EPTA 5H4IB 2FM2A 4YDSA 5GIBA 5GJVC 1P73A 1CGHA 3EPJA 5H1YA 2CJWA 5DN6D 2GJKA 1ZTKA 3SJZA 3J81k 2R0KA 1G3IA 3ZS8A 3PUVA 4PFSA 4BAHB 4FI3C 3N70A 1QDEA 1H8HD 4JCNA 1RE0A 4NCJA 3RXSA 2ZFSA 3K0SA 4H4FA 3EA7A 1P11E 2GTPA 1EJAA 1KSGA 5H68A 1MT0A 4OHVA 1A4RA 2XNSA 3ZD6A 4IW4E 2OEPA 2FA9A 3U6BA 3MU8A 2ZFPH 4FUEA 3RXHA 1RPZA 2FOMB 4LUCA 1OYWA 4WW0A 3MHWU 2H6MA 3K8YA 1MRSA 1WSSH 1F3OA 3PROA 4TQUS 1IM2A 4ZKDA 3ZZTA 2DHRA 1YPKH 3NHBA 3ADBA 1Q44A 4O2RA 1GI2A 2WVJA 3UNSA 2NOAA 1MQ6A 3F5FA 4EKDA 5AFZH 3SEAA 2O8BA 1CGIE 3B5JA 1HQYE 3KZ1E 2F6RA 2ZPSA 1EX6A 4ZI3A 2JEOA 2WIBA 1U0JA 4F4CA 1M7GA 1FY8E 3OIVA 2G77B 1GHXH 3UFAA 1O3NA 1P06A 2F1JA 2P0EA 3RVBA 1ACBE 3TJOA 5J4VA 2D06A 3PEVA 3Q7PA 4QGGA 4MKFA 1FP7A 1KYNA 3GJ0A 4TLEA 3ZYCA 4B43A 1ZIOA 5TCAA 1CR4A 3GLFE 3HKJB 6LPRA 2J5XA 2OFOA 4EPXA 1TX4B 1C5UA 4Q5IA 1OXVA 5E7MA 1W36D 2R3YA 1X8LA 3X1YA 3CWQA 5BRRE 6GCHG 4DCVA 1GCTB 2WUCA 1GZSA 1NBME 4KXFB 2VYFA 3QKRA 1E79A 4RKOB 3KXLA 1NY5A 4A2PA 3A7ZA 1NF3A 2ANWA 1GMCG 2A5AA 1F7ZA 3IO3A 2HJVA 2XNDA 3A6PC 5B6LA 4BTIB 3BC1A 3FPAA 3S9AA 5JHHB 1VECA 4YMTA 1OKKD 2AWOA 2W6JD 3NKVA 4CR5A 4M1MA 1DPFA 1UJ2A 4A1XA 4WZBE 4AG5A 1MRNA 3IKJA 4ZAEA 2AIPA 5CDFE 1JIRA 3LGUA 4U32A 5CYPA 3BEUA 2GEDA 2V54A 1P61B 4G5SA 1KNQA 3JZMA 2V9PA 4K81B 5FTNA 4KCGA 2Y8EA 3RWOA 4NE2A 3SHWA 4DEXA 2QT0A 1XEXB 4PPQA 2ANBA 3BN9A 3URCA 2FOHA 1OB5A 1PPGE 2JA1A 1UTNA 4LHYA 4UNQA 4ZKOU 4PAOA 3MWYW 1EOLA 4IDQA 1IHTH 2GTBA 2FLBH 2XRCA 4QKQA 1G8PA 4NSVA 4G01B 3FKSA 3GFPA 5FPYA 5CHAC 1FUJA 3B9PA 1TBQH 1CHOG 2GEUA 1G3MA 4UD9H 1YLCA 4HI0E 5LBIA 2STAE 1SXJE 1XTKA 4HAZA 1SULA 4YM9A 4A15A 5T6GA 4BXSA 2NPFA 1GDNA 1JQJC 4ZDKA 2ULLA 1LNZA 4M7GA 1ZCBA 5DK1A 1ZHPA 2B9LA 1VGCB 3MJHA 4UE7H 2ZGXH 5FOVA 1O2IA 4FCVA 1GILA 2ZE5A 1GL7A 1W3CA 2KI5A 2NU0E 1QCPA 2TPIZ 3KQHA 1WCV1 1QHRB 1O30A 2OCBA 1MZAA 1TGCA 1V2QT 1S0RA 3VQTA 3CM0A 1UTMA 3U5ZB 1WBDA 1E2KA 1KKMA 3KQEA 1UO6A 1OXGA 1L4DA 1V3XA 2EWWA 3PMAB 4BAQB 1A2CH 2GMTC 3BB1A 2IXEA 1BDAA 3JVUA 4S35A 2OILA 2RGBA 4KV9A 4OS1A 2A7QA 1JPNA 3A58B 4C7OB 1E0KA 1GWAA 1SL3A 2NPIA 2UUJB 1IQGA 2XCFA 3MH4A 1A0JA 1OWEA 3ADKA 5B64A 4C0AC 3QZQA 3CRW1 1SGEE 4X6NA 2A4QA 1ZD1A 4QBIA 3EZ7A 2P59A 2GCPA 1GI7B 3FZZA 5E8EH 1AQYA 4YLUA 5FBEA 3QBTA 2XW9A 3SNBA 2UWPA 4I1UA 1B0FA 1TWXB 3SJ9A 3I29A 4Y8XA 1SGDE 3VHLB 3E0NB 2I4IA 1BTXA 4IC6A 2RA3A 2XTZA 1YPJH 5F8XA 2B8OH 4Y0AA 2BXTH 3KKQA 3ZV9A 1KTVA 1ZPBA 1GMDF 1TRNA 1WXRA 2BBWA 5JWHA 4HUTA 4LJ8A 1SGTA 3Q3YA 2IYLD 3LQRA 5H70A 3B60A 3WYAA 2XX3A 4ISLA 2EA3A 1YZGA 2Z43A 1P2IA 3FANA 2WV9A 2KE5A 4CHAC 2NU4E 5K8IA 2B92A 1Q57A 4TTRA 1BIOA 2A5JA 4BZXA 2GVZC 4QM7A 4NYMQ 1JR3D 3GJ4A 2EFGA 3THOA 4K46A 2FV8A 1Z07A 4XBBA 5F8TA 1FDPA 3IHLA 1ESAA 1G9XA 2PKAB 5JPMH 4TYQA 2Z3DA 1GJ6A 3PLPA 1LB1B 3MWLA 4D7GA 3IQXA 2CEAA 2DFTA 721PA 1IBRA 2MSEB 4L8GA 1J7KA 1E2PA 1HA3A 4ABFA 1GHZA 4B74A 4FMCB 1EAXA 1GHVH 1NP6A 2QCYA 1W44A 5EE0A 3B8HA 2CK3A 3GJ3A 3BRWD 1DT2A 2ZAMA 3AUXA 4Q7XA 3PWBA 1P5ZB 4KBFA 1XD2A 3TR5A 2ZI4A 3C15C 3UREA 1D8TA 4TMKA 3Q5EA 1OKXA 3OIWA 1Y63A 1ZZZA 4ON9A 3SU8A 1NPMA 3MYWA 1D3QB 3EAJA 1QHHB 1BOFA 5HKKA 1OWKA 5TY0A 5DG6A 2WUBA 4QJ5A 4LPKA 2WYGA 3T29A 2ZRNA 3A8CA 1C1PA 3UWJH 2H5DA 3A7YA 3T26A 2YHSA 3SFZA 2G0NA 1WV7H 1BIFA 4BFZA 3TAHA 5JZVA 1GVZA 2XWAA 5KU1A 3TJNA 1ZNXA 4TZ6A 2AFIE 2THFB 5EE3A 2ALPA 1UTQA 2CHGA 7ESTE 1TMUH 3RU4T 1Y5UT 4LXBH 1OF1A 1OYTH 4Q4LA 1QHIA 4RSGA 1TPPA 2BDTA 1SFQB 1UTLM 2WMNB 2R8RA 1O2SA 2ANYA 3TU7H 2W26A 4ABIA 5LPFA 4B3BA 1AE8H 1THRH 5FTLA 2EU8A 2R6DA 3QVVA 1Q1EA 2SNVA 4Q4HA 1NRPH 3MO3A 4E07A 1O5DH 2W6IA 1HAHH 5L6NH 2CHAC 3PM3A 1QJ7B 3WMGA 2PLRA 1DAIA 1XX9A 3SU4A 3THXB 2NZ8A 5TDHA 4CH2B 1SVIA 5JB8S 1P2TA 3SBKA 4W7SA 1G291 1K5GA 1UBEA 1QG2A 2ZHEH 4IFBA 4LZ4B 3VR5A 1DE0A 1N25A 4QBFA 2QPOA 3H7OA 3SQXA 2GCNA 2FO9A 2WPLS 2QTHA 2A32A 3KXKA 2GT8A 2OD3B 1G5PA 3VB4A 1DAGA 1WA5A 3EYDA 2BM2A 2J2UA 1KDOA 1MU8B 4ZPXA 3F9GA 2ZGCA 1HNEE 4CDGA 3HK3B 1RW4A 4A82A 4ABAA 2VINA 3NTUA 1ZUHA 1KDQA 1Y3AA 3FFGA 1S1CA 5FTJA 1SG8B 3QGJA 4OHZA 1MTNB 3NKKA 1S2MA 3HDTA 2FOEA 4MDEA 1KGDA 1HXFH 4Y10E 4Q1AA 4LGMA 4M22A 3OEED 1GBLA 4RD6A 3PMBB 3R3GB 4TL7A 1N6LA 3TH3H 4Q80A 2JH0D 4U01A 1JNYA 1Q1QA 2H9TH 3QPUA 3F9FA 3SZNA 1NI3A 4RSPA 1Y3YA 2P95A 2I3BA 2BB4A 4ZKNU 1LVYA 2BXUH 1J90A 4TYPA 5LPEA 1EJMA 1UAAA 1CR1A 5JECA 2P93A 1AUTC 3DM5A 4B73A 2C4FH 1EWRA 3AGQA 1WB9A 2O8WA 4E06H 3VFEA 4IVPA 3AVTA 1Z28A 5TMPA 3OTJE 4W5JA 1TADA 3TJUA 3TNTA 1QL8A 1MU6B 3D23A 4OGXA 2Z4RA 1P75A 2QU8A 5JLJA 4EIWA 4N0DA 3A1UA 2J45A 4PQRA 2AERH 2C03A 7GCHG 2YNMA 5K7RA 2J0UB 3EC2A 4QBGB 5FCKA 1T5LA 1CE5A 1G3BA 1K8RA 1OFUX 2QSZA 5BN3A 2FNAA 4Q9HA 1XCMA 2PX0A 1BRCE 1IY0A 4Q7KA 1W13U 1Z0JA 3K9HA 3SJ8A 1Z0AA 5CK4A 3AAVA 1KZGB 2OBMA 3U7GA 2BIFA 3W6OA 2ZIQH 1THPB 1KI6A 1BRAA 1YCPK 4HAWA 4Y6DA 1BRBE 2OT3B 1L1NA 2FWRA 2GAOA 4Y79A 1HQCA 1A46H 2J7PD 3TK9A 2J92A 1G9IE 4E09A 2FFQA 3BK7A 2BHRA 4JL8A 2QMEA 3LC5A 1DM4B 2Q6GA 1E9EA 4FMBB 1OFHA 1W5TA 2FXRA 5EP3A 3B8JA 3WBJA 1DAHA 5L3SA 2JJ1D 4V0LA 1J16A 1L7VC 1LCYA 1E1RD 4OQNA 3LC3A 3SYJA 5KUTA 4GL2A 3SOPA 4AYWA 2NG1A 2R44A 2AS9A 1AS3A 2DFLA 4QGAA 3MO9A 4I8GA 4JJZA 3D6TB 4TL6A 1O2PA 3IITA 4Q01A 1XUJA 2ZU2A 1TU4A 4JS0A 4TY7A 1NVWQ 1SGFA 2J0QA 8GCHF 4DCUA 2C77A 4GRAA 3LV8A 1T32A 4LJ6A 1BTYA 3DMNA 2FS8A 2OBNA 1UVTH 4I32A 2GRJA 4DSNA 1LVOA 2VTKA 1B5GH 3GJ5A 5A8XA 3WHKA 4AIIA 1Z8FA 2PSYA 2QE7D 5F6MA 3K53A 3KIDU 9LPRA 1HV8A 3HGPA 2Y80A 5KNCA 1TUEA 2AMDA 1AN0A 1E37B 1THSH 4OI4A 4IEEA 1LKAA 2ZHQH 2ZGJA 4Q4JA 4TT3D 2GCHF 1DPOA 1Z29A 3BTKE 1TPOA 2OUKA 4JL6A 1QBOA 4LBWA 5AR1A 2NZJA 1KO8A 1KAOA 5C2ZA 1QL7A 2BX3A 3W6PA 3LOXA 4O3UA 4P3YA 1WU1A 1ZPZA 1DG1G 3U44A 2V3CC 5HM9A 2AKYA 1O2XA 4EJSB 1K9OE 5C20A 2QAJA 5DJ7A 2F1RA 1DADA 1CU1A 3LNCA 2YNBA 1BMFD 2BDBA 4XBCA 1KLTA 2R9PA 4X6OA 2ZS7A 3AF2A 1EB1H 1QIXB 1Y5BT 4BTTB 5EXLA 3OIUA 2JJ2D 2BDHA 1EESA 1Y3XA 1XTIA 1P57B 4NDZA 2GVDC 2QGRA 2BD4A 1M34E 4AYVB 3KQCA 1P12E 3ITIA 3A4MA 1GAJA 4KVAA 1P2QA 2D26C 5B58C 4CEIA 5EG4A 1C2EA 2V6NA 2TGDA 2IPHA 4P4UA 3OESA 2BY5X 5C3NA 4V0OA 3VR2A 1Z7KA 2OO7A 4K8OA 1O36A 2O8FB 4UONA 5FOUA 2GZAA 5FI1B 2RGXA 1SC8U 4B75A 1YPHE 3ZVGA 5DI9A 2FLRH 4LZZA 1II9A 4G5OA 3CONA 2AX4A 3BTQE 4JLPA 3QX5H 1N0VC 2C3SA 3BB3A 3L3TA 1E9AA 4FXGH 2J0SA 4DCDA 2IYQA 5ESTE 1ANDA 3E16B 3PCRB 3RRMA 1DE7H 1P2MA 2Z0MA 3DOEA 4Q66C 3RHFA 2GILA 2OCYC 3H4MA 5FPHA 1OHHD 5F98A 1DAEA 1KNXA 3ATLA 3EZ2A 4PO8A 4FUFA 1X1SA 1XTSA 1DLEA 2JIZA 3GICB 4IVRA 6ESTA 1MAXA 3L43A 3P1JA 2JLZA 4XVRA 1MTSA 2BY9X 2ORVA 2A1DB 5A0AE 2QQEA 1KZ7B 1ZINA 1V2MT 2ZM5A 3MU4A 5JYIA 1WUNH 4B2AA 2UWOA 4Q03A 1JMOH 1IQJA 2AYWA 3LY5A 1O2UA 3W5IA 1KDPA 1W0ZU 4INHA 3A1VA 2QROA 1NMZA 3RXLA 2XOKD 1T4UH 5IF9A 4X8HA 4CR9A 4KSCA 3AF1A 2QXJA 4IN1A 2PLFA 4PSKA 3SN8A 4W5WA 1Q31A 4OS2A 1OP8A 4LPSA 2ZITA 1P01A 2AK3A 5A09A 3QENA 1BRUP 4UEHH 4B3DA 4H1UA 3U60B 2BD9A 4Q4AA 5KNBA 1KO5A 2VHTA 3UANA 1H65A 4QBHA 4DLXA 4UQOA 2IA5A 2FIRH 1V43A 2GZHA 4HUQB 3ONWA 2WAXA 2QUZA 3SBEA 3R20A 1IQPA 4MKHA 2Q3FA 3R0FA 4R8TB 4A0GA 5IRCD 1VITF 1W2KH 2VGCB 2IYRA 1YPMH 1KSHA 5AHGH 2ZU1A 3D62A 1JAIA 1ZRKA 2OZEA 5GJWC 1LTOA 2FGKA 1C2LA 1Q21A 2QORA 1O5GH 1E4VA 5B2ZA 3UOUA 1Z83A 5PTPA 4BANB 3K0AB 1DWCH 1XMJA 1QL9A 3KKPA 4JZIA 2ZRCA 1E0JA 2Z3CA 3LBIA 2VWNA 3LWNA 1IOZA 4CRBA 1SVKA 3BTEE 1UK3A 1SPJA 1SXJC 4OK5A 4OGYA 3NG1A 1WBBA 3T28A 4B33A 4MLFB 1IQFA 3PV4A 2H5CA 3SW2B 4WIAA 3WP1B 3ZVBA 1EP5A 4AI6A 4NZQA 1J8YF 2Q6DA 1FTSA 3MLEA 4US1R 1F2UA 2DWQA 2X2FA 1N6KA 3UKDA 2AN9A 2HT1A 2HXYA 1GJ5H 1HYLA 1RS0A 2AEIH 2IS1A 2J0VA 2X8AA 2A78A 4LDJA 4KKDA 2IJD1 3GLHB 2B21A 2WHXA 1C5LH 1C9TA 2C2HA 4IDNA 3SJKA 1GHAF 3M5MA 4UXJA 1GTVA 3T1QA 1FQ3A 1EOJA 4DUGA 1JBKA 2ZETA 3CZPA 3DEFA 3NCLA 2VH5R 3KKMA 2QF0A 2Y5HA 4XWAA 5EXXA 3B82A 2BLOA 1HJ8A 5AJWA 3I8XA 1BKDR 1K21H 5K8TA 5JI2E 2P6NA 1C5MD 4OL0A 2O5VA 2VF7A 2ZRIA 2ZSEA 2XXAB 2JLVA 4B2LA 3NC0C 4KTCA 2AHOA 2LNCA 4AGJA 1KLJH 5LPRA 1O2TA 5FOXA 3PYHA 2QXIA 5A4JA 2DFNA 4PANA 3VB3A 2QXHA 4UNRA 2VWLA 1G17A 2PV9B 2VIIA 4WOPA 2OXSA 4YONB 1IN4A 3PITA 1C5VA 4C3ZA 3QUMP 1TNJA 5TV2A 3WXMA 4X8UH 4NSYA 1CEEA 1FFHA 3MMPA 3UNRA 1EGAA 4NYJQ 3B23B 4UFEH 1MR3F 3TBKA 2RKOA 5AUNB 8OHMA 4KYIB 3LVQE 3ODFA 2QAAA 3PTBA 3TJVA 3TMKA 5FFMA 2XNIA 1GMHF 4BLOA 1CT0E 1HFDA 3MO6A 3SJOA 5LB4A 1PJRA 2R65A 4DURA 5CLQA 1V2JT 3LDAA 2C90B 2F3CE 1J8MF 3E3TA 1N6IA 4JYUH 1DELA 2FSGA 3QY0A 4ESTE 4TMWA 1EZXC 3TGIE 2F9UA 1SVWA 1O3JA 3AVWA 1DAMA 3SV2H 2HWLB 1IXRC 1SLUB 4QM6A 1BBRH 1W4CA 4Y11E 3M5NA 1IN8A 1XUIA 1KXCA 3E90B 5G40A 3ZZ9A 4R2IA 2YINC 3SU5A 1H8HA 3FMPB 4ZDWA 5EP4A 3TE6A 4TQ9A 1DWBH 2HNTE 1FZZA 4KLZA 4B3GA 2IEZA 1NVVQ 4BAKB 4B35A 3SUDA 3F0TA 3SNCA 3QKSB 1L8QA 3SV8A 2QRNA 2ZQ1A 3R7WB 5GNDA 3T2NA 1QNJA 1O2RA 5EUQB 4WXIA 1XEXA 3T27A 2YV5A 3CRMA 2KSQA 3Q7QA 3E1SA 3KQDA 4IDHA 3ND8A 4DCTA 1XUGA 3DOFA 1ZM7A 4OHYA 3Q3KA 5A0FA 4FCWA 1TNGA 2D7CA 4MUBA 1FPHH 2Z4SA 1MH0A 4I81A 2QNRA 3SHAH 2X2EA 1E79D 1UMAH 1EFCA 5DISB 1OH7A 2FYQA 2VNTA 2ZA5A 3AP2A 3AW0A 1C5TA 3F68H 2O8UA 1KXBA 1G7RA 2GJ8A 1JXMA 1JXPA 4X6PA 5DYGA 1K1LA 2FESH 2G88A 1OIXA 4P4TA 1HAVB 1ELBA 3QXXA 2Z83A 4DCSA 3HP1A 4GFDA 1YCPM 4ZKSU 1D6RA 2Q3MA 2WWIA 4FWIB 4IC5A 1M1YE 1P2UA 1OWJA 1TTTA 2GZ7A 4LYJA 3N2IA 4HB2A 1IQKA 4HAVA 4ISOA 2FI5E 2FE4A 2FZ4A 1F0UA 1G36A 1O2LA 1AGPA 2IW3A 2ZPQA 3L0SA 3PENA 4IXNA 1LDTT 3ZZUA 1W46A 4BQSA 1E3MA 4Q18A 2Q9AA 3FKSD 1UTJA 4C7OA 1SQTA 3FHOA 1OKKA 4MG3A 1NFWA 2W6JA 1V2RT 2CXVA 1KI9A 2FFHA 3U3OA 2QMOA 2VIDA 4LJ4A 4X6MA 4DB2A 4JVMA 1KK0A 5EW2H 2A7CA 2C96A 1QR3E 1BB0B 1UHBB 2VHJA 1GCTC 821PA 3WRYC 2SGFE 3CUEF 1KXDA 2IXFA 3A1TA 3OX7U 2VPPA 1GHBG 4WXPA 4NYIR 1IQMA 1A5GH 1GBDA 5L3QB 3CF6R 2ZHDA 5CMXH 1U8AA 4D82A 1H9IE 2QI9C 1F92A 2QSYA 3D65E 2ZR9A 3CF2A 1YM0A 2LKCA 3KCGH 3K0CC 2P94A 6CHAB 1TBZH 1AB9B 5HR5A 5AVDA 3JVVA 3CPEA 3RS4A 2A30A 1P2JA 1VCWA 4JLMA 3I61A 3JZ1B 3GEHA 5BWMA 2XEXA 2UWLA 2XAUA 2ZRBA 1D2NA 2VL7A 2QMHA 5G4BA 3M3VA 5FPTA 4UKDA 2HGTH 4YOIA 1NIPA 2A7HA 1DANH 1K22H 4JLNA 1HB0B 2PKAA 1KO4A 4NZYA 4BFSA 3KN2A 4F93B 2MMGA 1AD8H 2WKPA 4FINA 5DP9A 5L3VA 2YJTD 4XVUA 5C18A 1C4OA 1C1QA 1EUFA 4DVGA 2OAP1 2ZIAA 3P26A 3ZZBA 5B6OA 3BG4C 3A82A 1HAYB 4GOKA 1CVWH 2R6FA 3UATA 2JCSA 5KOYA 1CQQA 4TPYA 2ZQ5A 1C1YA 3WHLA 2BY7X 1C1OA 1FX0B 2FEMA 1QHHA 5CJ2A 1VGCC 1HAIH 1OLOA 1NLYA 1S3GA 3HGNA 1AU8A 2WJYA 1Y8TA 1KI2A 1OSNA 4D26A 3GLHE 2WMOB 1AFQB 2ZR0A 5C5OA 5P21A 1VKJA 1KTSB 4TZ0A 1Q3HA 4MDSA 1DTSA 3WYGA 2Z9JA 4K1TA 4LX0A 2ZDKA 1SZPA 4CT5A 2V7QA 2GCOB 3LAWA 1FUKA 1ZJKA 4MITA 2GKSA 2EYUA 3K9XB 4G1UC 2IBMA 3S0NA 1GJ7B 1X1RA 2CCGA 3BV9B 3VNUA 4RKJB 3M1IA 3MI4A 1GKIA 1VHTA 3FMIA 4D4LA 1OIVA 1KY2A 4MGIR 2MSCB 3GJ7A 3H5CB 3QGNB 4JBWA 6Q21A 1Z71A 3FGNA 1XX6A 3THXA 3RXJA 1A0LA 5DH9A 3MFYA 1TQ2A 1NJGA 1XUHA 1SVLA 4MGKR 1JR3A 1N6XA 1P3EA 1D9ZA 5CLLA 2D4HA 2QAGC 5FL7A 3M5LA 2QF3A 3BD9A 2V4ZA 3SJIA 2C8WB 2BM0A 1T5IA 2BVRH 1GJ4H 2D8WA 1C1TA 1C5NH 1E38B 1ELVA 3S1AB 1OB2A 1BBRE 5BYJA 1ZC3A 3BFVA 4G5QA 1SKYB 5JBQA 3I1FA 5FOSA 2YC2C 4Y8ZA 4U02A 1WXQA 5G3ZA 2Z9LA 1GNQA 1Z47A 3QXCA 3VNVA 3G82C 3V4RA 3TVTA 3BOSA 1G8GA 4DSUA 2QN6A 2PFEA 2AK2A 1UK4A 3QVUA 3KUDA 2ZI7A 4I1OA 3WMEA 1XTQA 4LBYA 1ESMA 4DLSA 5FAHA 1E2MA 2EW1A 1Z1IA 2ZE7A 4HGCA 1O3HA 4WJG2 2PSXA 1DOAA 2FZZA 2RDLA 4Q1FA 4MVNA 3NEJA 1DWEH 1HJAB 1W7XH 1Z0FA 2OSBA 2IF0A 4U5XA 3RMLH 3SUGA 1ZM9A 1G20E 2H1LA 3KHVA 1ZGVA 1FY5A 3QG1A 5FI0B 1GBTA 1MKWH 1FPCH 1TQ4A 3M4YA 2KBEA 3SZEA 1BHXB 1KDRA 3U1JB 2WM9B 1V2NT 1P72A 2J0UA 3A84A 1CIPA 1ZAKA 3EDXB 4KVGA 3BG8A 1DEKA 1NLZA 5JMTA 2ZYWX 1OE0A 2VIQA 1XMIA 1TLDA 1XZPA 4BLSA 1R8SA 3V00A 4JK6A 2QPAA 2AXNA 4ESVA 3UTUH 1LKBA 3TVJB 5GPIB 1SFIA 3W3ZB 2PEYA 4QGHA 4BZPA 1U99A 2BVNA 4KSBA 4KODA 3QKTA 1DVAH 2AKAB 421PA 2AR7A 2VHCA 2YC4C 4IW3B 3SC3A 1T3SA 1EZQA 3VR4A 3SBDA 3X1WA 4ABGA 2GGVB 1N5JA 2OFXA 2RCNA 3Q3XA 4QJ4A 4A8JB 1TF5A 3LGVA 2C5LA 3M0EA 2HF9A 1SLWB 1R0XA 4DEYA 1Y5AT 2H9HA 1JOUB 1NKSA 3MJRA 1N5KA 4C2TA 4IHQA 3QSYA 2ZYUX 1M2OB 1BMLA 3LD9A 3K70B 1P2OA 3I8SA 4WVPE 4JMYA 3OEEA 2RGEA 4L4UA 1WQ1R 4X2XA 1MTVA 4TMXA 4GSOA 5C67A 3RXMA 3BTME 3CP7A 2EI7A 1VG8A 1XJ0A 2D2FA 2F3RA 2DFKB 2Z9KA 3L8YA 2FMXA 1X3SA 1AJEA 1O37A 1P2KA 1AK2A 5BN5A 4TSFA 4JVSB 2IYXA 3TJZA 2JLQA 4GHQA 5E7IA 4WA7A 2ZZUH 3BTFE 1S82A 1W49A 4D2IA 4B6FA 5EE1A 1QA0A 1V2VT 1XEWX 1ELGA 1RRFA 2W0SA 3QQ5A 1MTNC 4LSGA 3QO6A 2F91A 1OWDA 3THWB 4C0BA 2DE8A 1VITG 3RS0A 1MD8A 3FKQA 2NMVA 1TMKA 3UNQA 2QA9E 4I8KA 4G5GA 1QTFA 3TSWA 3IO5A 1ZNZA 1P03A 4KELA 2WJIA 5FBWB 3M6AA 5JWOA 4L16A 2ONKA 3KQBA 1Z6YA 1CR0A 2JLUA 3IIKA 1Z6TA 3SV6A 3B9QA 3LH5A 4TLCA 1CJUC 4Q7MB 1AS0A 3MMGA 4A36A 2CCKA 4TMVA 1II8B 3SJCA 3DD2H 3DT0H 4CEHB 4YZUA 4Q47A 2ECKA 3U61B 3A83A 1DUAA 3GY7A 5C4MA 1XEFA 5KSYA 4EJSA 4HI3A 2ZEJA 4M9FA 1O2QA 4I8LA 1YR6A 1ZJ6A 4X8MA 4IKEA 2P16A 2TGAA 2TGPZ 1VYUA 3U3RA 4OQXA 2J7PA 1EK0A 3CX6A 3I92A 1NESE 2G1JA 4GCHF 2VP4A 2EC9H 4WZAE 2WJJA 2DWOA 1AM4D 3UMSA 4MPUA 1GHAG 2X19A 4IDOA 4TQAA 1TAWA 2WSSA 2PZEA 5JBAS 1E1RA 3BF6H 2NO1A 1PFXC 3NXSA 3GLGB 4DIEA 2UKDA 1UVUH 4ABBA 1HLTH 4TYYA 3PMHB 4NA9H 1RYHA 2PGBB 1VG9B 4LC1A 1C1MA 2AGIX 2REBA 3EZ6A 2QMUA 1W11U 1G5TA 5TCCA 4LHXA 4DVAU 3RC4A 2O8FA 1TGNA 4EAQA 1HEIA 2ZRHA 3B13B 5FR2A 3WY8A 3U4QB 4W5HA 2OC7A 4NIYA 4QL3A 1HAZB 1LVBA 4R7ZA 5KO2A 4WAUA 1ZRBA 1EFHA 2Z7FE 2F7SA 4R9UC 1YZKA 4D80A 1E9FA 1AE5A 3Q72A 3RU4D 4NHOA 3U1IB 2BJVA 2WBLC 2ZUDA 1GKUB 1LFDB 5BN4A 5J4HA 1T3HA 4NL4H 3AF4A 3SQWA 1K28D 3DKVA 4H9GA 1LVGA 2V55B 3GCGA 1ZUNB 1W7AA 1C2JA 1BTPA 1Z3IX 4KTSA 1KJWA 2H7VA 2GDJA 3MOCA 2CN0H 4QNRA 1DARA 4XOIA 3A89A 1AVXA 4XSGA 4D0NA 2BDGA 2BD3A 2CVHA 1YR8A 5EXSA 3U7FB 1KDTA 1AIPA 2NTYC 2WPIS 4HDOB 4DKXA 2FGJA 1GMHG 1E0AA 4OQMA 4QXAA 1G8HA 1XD8A 4MRPA 1EAIA 3KJIA 1AS2A 4LBZA 3RRZA 4F4OC 4IOJA 1Q1ZA 1CLUA 3M3SA 3RS5A 1S0UA 7LPRA 2AFQB 1XZQA 1PYTC 1O5AB 2VF8A 1A5HA 2FWWA 1W2GA 2JH6D 1LF0A 2JJ2A 2GF9A 1AVWA 3SYLA 1U90A 1MAYA 2W3IA 2RHMA 2ZDNA 1WE2A 4LBVA 2G3YA 3WY9A 1CRPA 2HNTC 1YVDA 3LJOA 1YKSA 4Z51A 2G00A 3THYB 5HE9A 2Z9GA 2VJ1A 4EJSC 1Z5ZA 4OHWA 1YYY1 4HUQA 1Q12A 4DHEA 5KPJA 4ARZB 2HPPH 2ZF0H 4CH8B 5FBQB 1J14A 2ZI3A 521PA 4C0SA 5F9FA 1EXFA 2H92A 4MYTA 4XE4A 5JBBS 1OOKB 4E05H 3ZZCA 1G41A 1C5YB 1K1PA 3K0AA 2RMKA 1P8VC 2B6HA 3GFOA 3U8OH 2GBLA 3P8OA 4GMDA 1OFTA 3GQBA 3PEWA 1D9IA 1SVOA 5DP8A 1IXZA 1F0TA 1ARBA 2Z5FA 3T34A 4MPXA 2RB4A 5EZ5A 4D4MA 5EPNA 2J38A 5DO9A 4AG1A 1NRRH 1W5SA 3BE4A 3PR1A 4JYVH 2R0LA 2HT6A 2UVQA 3A8AA 4TTPA 1X86B 3K09A 1WYKA 4HSEA 3GJ8A 1S4QA 4Q1DA 2OLKA 1IOEA 3GLHA 4MPVA 2PCLA 4PC2A 3CPJB 3QZRA 1H8IH 1V2LT 1GOTA 3AKDA 1DXPA 4YMWA 5LD2B 1K1NA 3TLOA 1J8AA 5FCRA 3BH6A 2RGDA 1W4AA 2G5VA 3NWJA 4TWZA 1G3RA 1E99A 1F0SA 4QHYA 2XOKA 4URUR 1MTUA 1FQKA 4YOJA 5GDSH 3T1TA 2ZVPX 1JEEA 2QP3A 4C0QC 1TOMH 3B6EA 1LHFH 3K65B 1E36B 4HB0A 4PO9A 1ZBDA 4JIMA 4DC9A 3SV7A 2SHKA 3CZQA 3UUZA 4PC1A 2HALA 4ABJA 2FZLA 3EPLA 4FXPA 4BLPA 4HZUB 4K8BA 1QB1A 4ABHA 3ATKA 2LCFA 2XXAA 1OWHA 1OSSA 3PV0A 3RDZA 1MKXH 4M1WA 1YZLA 1OPHB 2VSFA 3RAPR 1NN0A 1SHZA 1W2HA 5E2PA 3BGWA 2P5SA 2JATA 3MFJA 3D8BA 2XZLA 4HB4A 1IQLA 1JRSA 5E0GA 1PPZA 1D3TB 5F9HA 1SHYA 5E0JA 1MBQA 2RHDA 2ZJYA 4X1QU 3R9IA 1UK2A 2R62A 2CMYA 1FMJA 1P60A 2P3SA 1FAXA 4MTBA 5FUVA 4DUGD 5L3RA 4Q7LA 1HE1C 3EA0A 2WOJA 4C0KA 3GCNA 2GJAA 1TBRH 1N6RA 3EX7C 1WQSA 2B7CA 1C5XB 1VIYA 4XJXA 2DY1A 3TGJE 2REOA 1YPLH 3T12A 4JLDA 1IHSH 4O0MA 3A1SA 1LS6A 1C1NA 1MOZA 2VGCC 3DFJA 4ESHA 5DHAA 4Q48A 4NWLA 1N6YA 1FN6A 3KGPA 1F6BA 1E69A 5EXMA 4NG9H 2ZECA 4INLA 5EZ6B 2WPHS 4AFSA 4HAUA 1UKVY 1N6OA 5L30H 3L82B 2ZCHP 4XTCS 4MKGA 4HLDA 2ZRAA 2AGGX 2GBLC 5TB5A 3RXDA 4DSOA 3GY4A 2PUXB 3M61U 3K2UA 5GWZA 1NROH 3LBHA 4NMMA 4MRVA 2EEKA 1EX3A 4GI7A 4MA4A 1N2CE 1LPKB 4JJKA 2WOOA 2C8ZB 1VMAA 1RRKA 4DRZA 3Q85A 2N46A 2BMJA 2GJSA 5FHTA 3K09C 3QKSA 5JBTA 2VHQA 1S9DA 4YESB 3T15A 2SGQE 3R7WA 4DIIH 4GDFA 2A2QH 4KFUA 2R2AA 2ESTE 2HV8A 4DLWA 1Q3XA 2ASUB 2G6BA 3QIAA 1BITA 4AK9A 3QF4B 3BBPA 4E7NA 3ICEA 1CSOE 1TNIA 1LS1A 1PQ5A 2BOKA 3ADCA 2OC0A 3C7KA 4WMFA 1OXTA 2K5UA 3BEFB 3SU0A 4KO8A 1C2HA 1SOZA 5FUXA 4BLQA 1G3DA 1HCGA 2QA5A 3FYHA 1XDBA 4R98A 2ZU4A 5LH8A 2ZRGA 3NXPA 1O5CB 1FV9A 3PG5A 1V2TT 3ZVDA 2VIPA 2ZUCA 5JDUB 3HU3A 1XPUA 2YWHA 1X8JA 2IWRA 3GY5A 1G3QA 4M9XA 4OKSA 4ILEA 4I31A 3U7EB 4P4SB 4B2BA 2W2TA 4M2LA 4KU4A 1ZJDA 1HAVA 1V2UT 3A7WA 1D6WA 1MO5A 2ZRPA 2WAYA 3RSOA 3A37A 2P3UB 3VFDA 3C8UA 1TB6H 4D6PA 1QF9A 5SZIA 2IK8A 1LHDH 1DO0A 4SGAE 3E0PB 3QJYA 4LK4A 4BFUA 4RZXA 3WYFA 3KQUA 2EI6A 2EFCB 1GUAA 3LGIA 3NC1C 3TH2H 2ZDVH 1O87A 1P4SA 3L2OB 3UR9A 4SGBE 1FY1A 3TUZC 1Z6AA 1Z0KA 1NN3A 3H86A 3WNCA 2FOBA 1V2OT 3GLIB 3HU1A 1M7HA 5EQSA 1SGRE 1KXFA 2N42A 1O2VA 2FPZA 1GBJA 4OHXA 1P0SH 4ZKRU 5EODA 1G6HA 1KMQA 4PC3A 1D6JA 3NH9A 5BQ5A 1G19A 1NFUA 1XVMA 3RXPA 1YBWA 1AKEA 1ZYUA 4K60A 2PCJA 2AWNA 2NWNA 2A9KA 1W4RA 1EAUA 1NTPA 3W5JA 1ANCA 3CS7A 1R0ZA 5ESBA 3ZVMA 1UHBA 3SZRA 1XXDA 2QIQA 1G21E 4ACBA 2B7DH 2IJOB 5L3QA 4Y8YA 2UZ3A 2VP2A 2A5DA 1PUIA 3RXAA 4IOKA 3REGA 1Z8JB 4C0HA 3IWMA 5HTKA 1CULC 2QC2A 1NN5A 3CR8A 1NN6A 4OS6A 1EB2A 1V2KT 3EA5A 2REXB 1TA6A 4TYDA 4LJAA 1VG0B 4PSVA 1OS8A 3I78A 5FBLB 1NZQH 1ELEE 1OH8A 1GL6A 3EIQA 2O8EA 3SHFA 1PQ8A 3MRSA 2WWXA 1L2TA 1F2TA 4BUJA 4K8YA 3IG6B 1QRAA 3C5CA 2GX4A 1UADA 1O3CA 3SNDA 1HY3A 1V2WT 1EASA 1MABB 1O5BB 5BW8A 2W7UA 3ZVLA 1XMVA 1NG1A 4MRNA 4URYR 1TE0A 1AFEH 3HWSA 5C1BA 2ZU5A 2BLQA 3BS4A 1B7XB 1VIAA 3EZFA 1ABJH 4E5UA 4A6PA 5IHPA 2W58A 2JLSA 3RM2H 4CBOA 1E2NA 1XJCA 3VB6A 8ESTE 3WNDA 3AVVA 4RZUA 1C9KA 3PTNA 4RKEA 1AVGH 1D4PB 5T3HA 5JFGA 5K8UA 1Z22A 3GCOA 2C04A 1TX6A 2ZDAH 4URXR 4QHTA 2AD1A 5FX6A 1Z63A 1GBBA 4UJ5A 1FX0A 2J46A 1G3UA 4THNH 3SUFA 4C0JA 1G2LA 2IXGA 2OUAA 4IOLA 4EPYA 2HLDD 4J2YB 2Q6FA 5KDDA 2D7DA 3OTPA 1KIMA 1BMAA 4ZXYH 4XD7A 2GVFA 1XF9A 2DUCA 2ZG0H 1DFPA 3B1VA 1P3JA 1FUUA 3Q3JB 1EFTA 4YMSA 2G81E 1GMCF 2GCOA 3EIEA 3CRQA 2AIQA 2F9MA 5CIQA 4DWJA 1OXSC 3BTWE 1FLEE 1XXHB 1GG6B 4OS4A 3NHAA 2NO0A 4W9MC 2PZGA 4D0GA 2ZTXA 2BEJA 3SUEA 1QB9A 1YZQA 4RZ2A 4IEIA 3AV0B 2G0TA 1CP2A 1JAHA 3UQVA 3MWKA 2XXLA 3TK6A 3AW1A 4K1EA 5DLQC 2YWEA 1EKBB 3M5OA 3FE2A 4I1SA 1MMJN 3NUMA 5L2YH 1GI1A 2ODWA 1U0HC 4Q9IA 2FX4A 4UDWH 4A0HA 1ORFA 4BFTA 4YT6H 1ZSJA 3A7XA 4CT4B 5SZJA 2PEZA 3UG6A 1EG7A 1W12U 3BTTE 1JJVA 2BHGA 1ZD8A 3LDXH 4Y7AA 3QG5A 3IBYA 1T7CA 2OQUA 3RABA 1A4WH 6CHAC 1FY3A 4A4DA 2ZUBA 3BB4A 1AB9C 2ZJBA 5C1UA 3NZIA 1W14U 2ZJZA 4TL8A 3LLMA 3WBKA 1ZTLA 3S1AA 1C2GA 2C95A 3TGPA 2UUYA 1YZNA 3GCTF 2V7QD 4JZKA 2Y82A 1B23P 3TK1A 3CX7A 1K5DA 1O3BA 4K69A 2ZSBA 1JECA 1H8ED 3CENA 4Q1EA 4GPGA 5EOKA 4GCHG 1GBIA 3ZZ0A 2E87A 3GDVA 3OY6U 2YOHA 2VSOA 3FHTA 5JBCS 4MH0R 1SHHB 4CRGA 1VJAU 4NCNA 3RS2A 1JALA 3IPYA 2HEIA 1KKLA 4BOHA 1KY3A 1NY22 4A1VA 1HT2E 4TLAA 1OJLA 5D3MB 2FDAA 2EWVA 3KJGA 1GITA 1SGQE 1XUFA 2ZU3A 1XUKA 3I32A 4B3FX 2PJRA 4MDFA 3T5GA 4EDHA 2VVCA 3KFXA 2BVSH 3LW7A 4JMPA 3E91A 4M1SA 3BORA 2BMGB 3B1YA 1AN1E 1FTNA 5GCHG 5FL7D 4US2R 1AGJA 4BXWA 3AAUA 3RXCA 2ZS8A 2CV3A 1Q22A 4BEJA 1CTQA 3DHWC 1UKZA 1IY1A 2Q0HA 5LPNA 4P32A 3CNLA 2C8YB 2ZJOA 1K1IA 2OC1A 2VP9A 1UTPA 3KUCA 4RFSB 2PR3A 1AFQC 2ORIA 1AZSC 1L4ZA 2ZU0C 2V1UA 3SU3A 4DBLC 4PC7A 1TGBA 2IEYA 2BEKA 2CGAA 3ZGXA 3L8ZA 1CA8B 1MCTA 4ZXXH 1SBWA 3I5YA 3FWYA 1XRJA 4B47A 1LPGB 1FNIA 1LTQA 1PQ7A 1SGCA 2QGZA 1S83A 1JIMA 3VGCB 2WJVA 1T6NA 5E0HA 4YLGA 2OG2A 1NFYA 4AFUA 4A8JA 5DI3B 1E2FA 2PW8H 5EGMA 2P65A 3W90A 2QT1A 2RG3A 3ZH9B 1QHXA 3Q00A 1MZDA 3MTYA 4XWKA 1O3AA 2F43B 1WMSA 3TNSA 1PLLA 2Z6BD 5HE8A 1DAKA 4HTCH 3TKLA 1UCYH 5EQRA 2I1QA 3O8BA 3HYTA 1Z1JA 1WQVH 5IDVA 3P8NA 1KMHB 4DG4A 5LDDC 2ZYTX 1GJ9B 2ZS9A 1ZOMA 1MKXK 4EUNA 1CBWB 2GZ8A 1VG1A 2F9BH 1JQLB 4RKFA 2V1XA 4N0EA 1A3BH 4ZMAH 2D74A 3LIWA 5JJIA 1T8UA 1Z8IB 2BYAX 3QXHA 4NIVA 1JPJA 1G2MA 5HZKA 3TPIZ 2WWWA 3RXIA 1E0FD 2V35A 3VXFH 1D3PB 1N0WA 2W0MA 1NRQH 3THWA 1JEDA 2GK7A 1P7CA 2H2ZA 4PHHA 1OT3A 1QRXA 3SYKA 1G8YA 1UPTA 2WPKS 1KI1A 2IT1A 4PAMA 4G5RA 3MSXA 5T6FA 1FOEB 4C4PA 1QGFA 4CREA 1U6QA 2QPTA 121PA 2CE7A 2QL6A 2GCTB 5DO4H 5KSZA 3QE0A 1NSFA 5FBRB 3AM1A 4D9QA 2ZC9H 3QWCH 1VYVA 1II8A 5GVRA 2RGAA 1FZQA 2XB4A 2H8KA 4CEHA 3BH7A 1XCPA 4WBSA 3VKHA 1FXYA 2WPJS 1HJAC 1GBKA 3ZZAA 2XBWA 4A0RA 2ZRJA 4Z8XA 4TTQA 2KB0A 2OM2A 2Y81A 5JHGB 2O0KA 1AKYA 5AF9H 4TSFD 3AP3A 1A2KC 1E9CA 2VBCA 1P2NA 3GLFB 3GYMA 4KTUA 4NZLA 1C2IA 3SI3H 3D31A 2AXPA 4QNMA 3M3TA 2VVVA 2RGGA 3LH1A 4WXRA 2A5FA 4PXAA 3W8NA 4ACAA 3UG7A 2F83A 4ZCIA 4FMCF 5J4YA 3GLGA 4B34A 2OK5A 1YR9A 1T9HA 1PYTD 4QFMA 4PTLA 2VA8A 4ISNA 4FWTA 4JVNA 3GCHB 2PUQH 4ASUD 3EA8A 1R6BX 2FOGA 2WWGA 1P10A 3HPRA 3U4QA 5G53C 1TMTH 4DLVA 5IK2A 3OIYA 4IXMA 4A8JC 2JJ8A 4K1SA 2VIWA 2FOLA 2C78A 3ZDQA 2FG5A 1ZW6A 3FMOB 1E2IA 1ZSKA 1CJTC 5CIWA 4DT1B 1FJSA 4O03A 3K70C 1G4AE 1SVPA 1W8BH 2F4LA 2YWFA 2IUSA 2W2XA 2GD4B 5FUYA 5J4QA 4QC2A 4KAXA 2P8OB 1FL9A 1AKSB 1QRWA 3C5HA 3V0XA 4ZDJA 1Y3VA 1HPGA 3M36A 2WSSD 4URVR 3D3QA 3AQ4A 4BNRA 3VPKA 3F8TA 1PV4A 2D2DA 3OHMA 1VDZA 1BH2A 4R0IA 1MTWA 4FMDB 2R3UA 4KLNA 4DW2U 4D9RA 3QOFA 2XZOA 1G18A 1OWIA 1PUJA 2YNAA 2F9NA 4JZFH 4URWR 2BBSA 1F2SE 2XBXA 3TLXA 3B85A 4N1AA 1TF7A 2D2EA 1RC8A 2WPDA 2J9NA 1S5SA 3ODDA 4GP7A 7GCHF 1T91A 3I62A 1W10U 1XPRA 1YPGH 2BKEA 1DSTA 5DP4A 1OP2A 1ZCAA 2OXRA 3QN7A 3OF5A 4I4LA 3DZ8A 1PVOA 1BJVA 2VH6A 4EPVA 4PPFA 1IQEA 5AWFC 3THYA 2A4RA 1HH4A 5HCIA 1CF4A 5LGOA 1XTRA 4JZ1A 1US8B 2BD7A 2ANMH 2GXAA 1QJ6B 1H8DH 2PZFA 1C4V2 4ARZA 1E9BA 4Z1MD 2WV4A 5SZKB 2ZSFA 1BS1A 5J40A 1W1WA 4FU7A 1F48A 3NVAA 1DVRA 3TAUA 4OI2A 5DPAA 1GRNA 4LYAA 5CM9C 4AB9A 3WMFA 1Q2WA 1C5RA 3MU0A 1Z8GA 4NCIA 1K6MA 4OK3A 3MGCA 4ERNA 3I5XA 2FN4A 1TYNA 1RRGA 2V0BA 3TH5A 3IEUA 4ISIH 1X6VA 4X8OA 2F9PA 4LC0A 2OP9A 3EQ0H 1P2VA 3UOPA 5DE3A 1P2SA 2BD5A 2FJUA 5KDOA 2ZGHA 4OI1A 1C1RA 4M21A 2KWIA 3L33A 3NBYC 4ISHH 5DKMA 1GJDB 3KF2A 3ESTA 4LJ7A 1GRRA 4BFWA 5KDLA 1CRQA 1E94E 1NVUQ 3BFKA 1O3LA 4Q1BA 4AOQA 2FP7B 2GNOA 2G5NA 1YPEH 1VCPA 3EWAA 4JLJA 1W7GH 1P9SA 2I6SA 4TWWA 1O3PB 3LKWA 5KSPA 1O2KA 4QHSA 4IDPA 4XDEA 3KQLA 1AWHB 1TGSZ 4XVQA 4LY6A 1F5NA 3LJJA 4IBLH 1Q0UA 2YVUA 3EAQA 1SR5C 2GXSA 1O2GH 1G30B 3DFLA 2J59A 2CDNA 1PLJA 1DITH 2TGTA 1CA0B 3RDPA 3B1WA 2C93B 3H0KA 2IL1A 4D4KA 1EFRA 3NWUA 1NRNH 4MYHA 3CRVA 2P67A 1UCYE 1DUEA 1WTHD 1G4UR 4HZUA 5UKDA 4U30A 1JBUH 5A8YA 1ID5H 1G1MA 3CRRA 1EFUA 4HEJA 3GISB 2Z94A 1N3BA 1I2MA 5L8VA 4RI0A 1QVAA 5GJBA 1RJXB 1ANBA 4JZEH 3FP8E 4RZ3A 2V6IA 4Q21A 1T4GA 2G52A 4RY2A 4MQBA 4JBXA 1O3KA 3W8RA 1YR7A 3RLWH 3RP2A 1E2DA 4LJ9A 1JJ7A 3BAFA 1SHKA 2BLVA 2FFAA 1GI5A 4H6TA 2B5TB 4M1KA 4MGZR 2A5KA 3TH4H 4O97A 2GAAA 4KP0A 4Z6AH 4RFVA 2EVWX 4C9BA 1CXZA 1N5LA 2ZFFH 3HKIB 5A5GA 5F03A 1EX7A 1TMBH 2AFHE 1TU3A 5DIFA 1ODFA 2ZHWH 5E7JA 4KGAA 3RXQA 2I1VB 5IYTA 2CNWD 2NGRA 2O0JA 2F55A 1UF9A 2YOLA 5JRZA 4TMZA 1J70A 3P32A 3ZVEA 1VHLA 1MD7A 3VTKA 5C5NA 1JR3E 2HNTF 3TNFA 4U00A 3UQOA 4DLYA 1INCA 4FUDA 1G64A 2MMCA 3UMRA 3FDIA 3P8FA 3PO1B 3NBZC 1TRYA 4M4SA 1P9NA 1G37A 3ZZDA 2YKGA 4CVNA 4HLUA 1LHEH 3SS8A 3A80A 3SQEE 4B32A 5GVSA 4XFQA 1YHNA 2PKSB 1L4UA 3RS7A 2STBE 3W94A 2ZXUA 1O2YA 4A5TS 3C16C 1GVNB 2ZNKH 1HIAB 2XTTB 3EASA 1TIOA 2FF7A 3V12A 2F3TA 2AMPA 4WZ6A 2PTCE 3DO6A 3ZZ3A 4PO1A 3E70C 3Q9LA 4D76A 2ALVA 5FPSA 1KJYA 1E2QA 2BMDA 3ECCA 1Y3WA 3QF4A 5FR1A 4UXHA 1R2QA 4M8NE 5LD2C 3TIFA 1VCIA 2A45B 1IAUA 2HXSA 1XTJA 4NCKA 2BQ6B 2OBOA 2FEOA 2J34A 3K9NA 1N8OB 1P62B 1FN8A 5E4FA 1TQ0B 3NH6A 1ZYOA 4GSYA 4CF7A 4RCYA 3ZLJA 1DY8A 3QI2A 2BQWB 1C4Y2 3RMOH 1HJ9A 2DB3A 1W0YH 1OXXK 5T1VA 2OTVA 1I2DA 3I73A 4XIGS 1BTWA 2QBYB 3H2YA 1IXSB 3B1ZA 2XC5A 3I3SR 2PMKA 1YC0A 1ZHMA 1COWA 3GMTA 4P4SA 4GOJA 1A1VA 2UUFB 2VP5A 1E98A 4NYIQ 4BEBA 2FI4E 3TW8B 4GNKA 1UVSH 1QRZA 4VGCB
chains in the Genus database with same CATH superfamily
1W88B 4H0FA 4G9GA 1CZRA 1XJQA 4WY3A 1EJNA 4FGKA 5K09A 2W2LD 4PGHA 2GZDA 1DB3A 1RMQA 2IHTA 5E3JA 1FIUA 4HQNA 2WA1A 1U1FA 4WVLA 3DVQX 4IGDA 1J99A 3M6XA 1SMFE 1L4GA 1YKFA 2BEVA 2H18A 4BFVA 1O31A 4L0CA 1XDUA 2X4DA 5HTOA 3AESB 3FNQA 3WNBA 4DUPA 4QT8C 5AVQA 2WFLA 4LAFA 4L5BA 3TW6A 2FODA 3N99A 3PRBA 4QOHA 3M7UA 3FBWA 3UA3A 4TKUB 3OZBA 4MI1A 3IBTA 4DBVO 3CNNA 2OQVA 1ESNA 1SN7A 1ZU5A 2LW7A 3UJNA 1BSVA 1GMDG 4S2EA 4JI2B 4P98A 1VQ1A 3KNXA 4BIIA 1FFBA 4TUYA 4HLUC 5DM4A 1EAYA 1X7AC 1ZRSA 4PFKA 3Q9UA 5FBIA 5HIZA 4Q2KA 1XZMA 2OYRA 1WZUA 4EVQA 4JK3A 2CF9H 4BZZA 2R7LA 1NUSA 1CWUA 221PA 3R8CA 4PPNA 1A9OA 2Q5JA 5DGHA 6LDHA 1QIJA 2AZXA 4BKOA 4CETA 4TM8A 3P9NA 4GPBA 4BTUB 3CW2A 3NONA 3AEQB 2XUGA 4ZQEA 1EZSC 1A88A 2BAGA 3U8TH 5DYWA 1K6IA 1M9UA 4CTNA 4ZVSA 1S89A 3T3DA 3WIBA 3M7TA 1TM5E 5FKJA 3W8DA 3OAAA 4K9PA 1H9CA 4B81A 3WK4A 3GUYA 3CGWA 3Q77A 5DASA 4KDCA 3B8EA 4L3VA 5HFNA 3DTNA 5B57C 3INRA 1ID8A 5DGDA 1KQNA 2PIDA 3W5BA 1ZICA 1CKEA 4EF5A 1WDTA 4J07A 4YRPA 2EYQA 1KI7A 1NR1A 1SGPE 2ZAOA 1NJ2A 2Q9CA 1CJCA 3IAS6 4P33A 5DHFA 5AOBA 1BJUA 4XSHA 3H8WA 3ADDA 1GNTA 1BUIA 1R6UA 2GA9A 5GADl 3QUBA 3RIMA 2YWJA 4LYYA 4YRIA 2I55A 2SGAA 2SGPE 3KQNA 4GHTA 1Y8RA 4MUYA 3V4FA 1RVV1 3UWDA 1Y1SA 4A7IB 1FNSA 3BXHA 1XL0A 2XGOA 3MJCA 1WOYA 1N78A 1CQZA 2ZE6A 2WU8A 5M3BA 4DQ0A 5BR7A 3Q8KA 3C6KA 3KOZA 4C7XA 1WV0A 5IG2A 3ZZ4A 1T6BY 3VSDA 4HTFA 4DQXA 1J09A 3UXYA 4FJ1A 1GNLA 3AKEA 4H0NA 2NV2B 3EEIA 5TXGA 5JQGF 2ZQYA 3GY0A 3A85A 1RIWB 1XRLA 2CMHA 4ZGGA 3MOIA 1TQDA 1QAMA 1M76A 1QZ8A 5IWAB 2FPMA 1T9CA 3STIA 4NDAA 4LV6A 3FP7E 5CX1A 4F2WA 3SV9A 3KHKA 3RC7A 3ZWXA 3VVCA 5HMAA 5DGXA 3CS0A 5AUOB 2HEGA 4QQKA 3HVIA 5LP6A 3R8XA 5HPYB 4TMTA 1BTHH 4ZFNA 4W5RA 4G36A 4L8VA 1N9GB 3KELA 2F1OA 2J94A 2K1QA 1KHHA 3SSNA 2FX2A 1E8NA 5F4BA 5EFZA 3BTHE 5GXPA 3JAKB 4XD7D 4I7YH 4Q05A 1ESBA 3DXFA 4WD3A 2C07A 4JT2A 1ELAA 4Z49A 3DO5A 2HSGA 3ND9A 1N6NA 2J9RA 4IP0A 5SV2A 4FT4A 2JFUA 2YUTA 1NMYA 1L5RA 3WK8A 2PWXA 3UAVA 4MWGA 1X7YB 1NATA 1UBNA 4IUBS 4LXYA 2ZTSA 5F1YA 1H9BA 3RUPA 1Z08A 3ZBTA 2VYVA 3K9BA 3UKOA 2ZVQX 5TIIA 4YJ2F 1TUGA 2IC5A 1AKRA 3QLUA 1H3NA 1PL7A 2JF0A 4IGKA 4DIUA 3OH8A 4JROA 1F2TB 4Q02A 2GX6A 2EKQA 4R3NA 4TTSA 1DI0A 5M29A 3F1SB 3ZK7A 3D6FA 3O8RA 3OJXA 2HHAA