1Q2WA

X-ray crystal structure of the sars coronavirus main protease
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
295
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nonstructural polyprotein pp1a
publication title X-Ray Crystal Structure of the SARS Coronavirus Main Protease
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 88
structure length 295
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1q2wA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA02
2A0QB 1D4PB 2ANWA 3UREA 2PSXA 5HYOA 1LVOA 3SORA 1F5KU 1T8MA 3ZZ9A 4I8KA 3UPEA 2ZPSA 4MPWA 1O2QA 1YGCH 3BG4B 1G36A 1O3EA 1ESAA 1KXEA 3UR9A 1UHBB 2BD5A 4Y0ZE 3AAVA 1GI8B 1OWHA 3RXRA 1AFQC 3BN9A 1AD8H 1ZJDA 1EOJA 1GI5A 2QAAA 1CA8B 3BEFB 4TWYA 1L1JA 4IBLH 1H9LB 1O35A 1Z8IB 2SGFE 1AY6H 1ACBE 3K65B 4U32A 2AEIH 1SVPA 1L1GA 2PWXA 2PUXB 2BQ7B 1C2HA 1INCA 2VH0A 3MU8A 1YC0A 2SGDE 1OPHB 5DKMA 3MYWA 2NU0E 1C2DA 4MPUA 3RU4E 4UE7H 4M7GA 3QK1A 1EAIA 1S0QA 2UWLA 2H9HA 5A8YA 2V3OH 1W7XH 3SUGA 3AW0A 2WPJS 3FP6E 3MH4A 3V13A 3E91A 2GV7A 1Y5AT 1P9SA 1ESBA 4DG4A 4RKJB 3GCNA 4AFQA 3U8OH 1O2YA 2ZHWH 5FBEA 1O39A 1HXFH 2H9TH 3E3TA 1HYLA 2M5TA 4O3TA 4X1NU 3VXEH 1S81A 5GWZA 2J34A 1K2I1 1EZQA 1W7GH 2C8WB 2OC1A 5EQSA 1YLCA 4NZQA 1HAZB 4LZ4B 3HGNA 2FI5E 2OD3B 5DGJA 1GVLA 4ABBA 1TBZH 1SLWB 2D2DA 1S6FA 2SGAA 4J1YA 3SJ8A 3SV2H 1LQEA 2Z3DA 1O5DH 3LC5A 4FUGA 2VINA 3EQ0H 5GCHF 1KLTA 3MH6A 1K9OE 3KQCA 1JRSA 1KLJH 1NM6A 4KELA 4CR5A 1IQKA 3IG6B 3E90B 2Z3CA 1W0YH 1NRQH 2ZDNA 1ZMNA 3GDSA 2VNTA 1MCTA 4DIIH 1EAXA 2BDCA 1AIXH 3KCGH 1BB0B 1SGYE 2FPZA 5ESTE 3MOCA 3TITA 3KQEA 5HMAA 5L2ZH 1SOZA 3LH3A 3RM0H 4JCNA 4GPGA 1DT2A 3MFJA 4WXIA 2RG3A 2GZ9A 3LGIA 2RDLA 1JXPA 3PMBB 2RA0A 1OYQA 1AI8H 1ZPZA 5FX6A 4MPXA 2FESH 3CP7A 2PHBA 2FX6A 1HLTH 2G4UA 1Z8RA 4B2AA 5DK1A 1Q3XA 2JH5D 1BRCE 1FZZA 2ZFQH 3ESTA 1G37A 6CHAB 1BDAA 3T62A 1O33A 9ESTA 2H5DA 3QGNB 1X7AC 2ZEBA 3SHAH 3P6ZB 5C2ZA 3BSQA 2PGBB 2BD2A 1FPHH 1XKAC 1MTWA 1XUIA 2K7XA 4BAQB 2Y81A 1O2JA 5C1XA 3V12A 1W13U 4H6SB 1N1LA 4LOYH 4AGJA 1BBRE 2ZU5A 2QXHA 5FBIA 1BRBE 1VCPA 3GY2A 1O2ZA 1NZQH 3TNSA 1F0SA 4X1RU 4JK5A 4B2BA 4NA8A 1UVSH 4CBNA 1UVUH 5CHAB 1C1MA 1P04A 1O2KA 1KXBA 3BTTE 3UTUH 1FNIA 2SGEE 4KTSA 4NWLA 3LGWA 1UK3A 1K1NA 1O2WA 3TIUA 3RXQA 2XBVA 4IW4E 1DSUA 2PGQB 1C1OA 1ZSLA 3ZVFA 2DUCA 4ZHMU 2VH6A 3GDVA 1E38B 1IQFA 3BTWE 3TJNA 1GL0E 3SU2A 1YPMH 1BHXF 1AU8A 1XXDA 4NSYA 2PV9B 4XFQA 5TCCA 1CHOF 5FAHA 3PTNA 2A5IA 2BZAA 1O3OA 2BD3A 4BANB 1T31A 1P2NA 2FOCA 1V2LT 5EOKA 1ARBA 3TVJB 1O5CB 4A6LA 1K22H 5L30H 2AGGX 3VB6A 1TYNA 6CHAC 2HNTF 1O3LA 1FI8A 1TBRH 2J92A 1PPEE 1YF4A 1DX5M 1ANEA 1QL7A 3MU5A 1RTFB 1CHOG 5ETXA 2J94A 1AHTH 1HJAC 2Y5GA 1TNIA 2WV5A 1OP0A 4NIXA 3MU0A 3BTHE 2O8TA 3U69H 2FYQA 1OP2A 2ZU4A 3P8OA 3MU4A 4R8TB 2TGPZ 3MO3A 1PFXC 5CHAC 5H4IB 1MCVA 2QXIA 2Z9IA 2GP9B 5EU8A 1DDJA 4Q7ZA 1AVWA 1O38A 3RDZA 3URCA 4FUFA 1BMNH 4JYVH 1O3PB 2WPKS 1VCWA 1BMAA 4K8YA 4Y71A 5J4SA 1V2UT 2Z9GA 1GBMA 6ESTA 2WYJA 2VB0A 3BG8A 1EJMA 2FLRH 3ZZ6A 1MKWK 4AFUA 1BRUP 3F1SB 3M3TA 3JZ1B 2XC5A 1C9TA 1THPB 3SV7A 4A7IB 1NRNH 1O3IA 1TRNA 1O2MA 1C4V2 3GCTG 4FUEA 3D49H 2A45B 2ANYA 2BVXH 5E2OA 4LZ1H 3SJ9A 3B9FH 1ELCA 3KIDU 2XW9A 1ESTA 2A4QA 1G3EA 4FVDA 4O3UA 4FUBA 1NRSH 1ANCA 2A7CA 4ASHA 1BT7A 1O2TA 4X0WU 4X8UH 5A0AE 4AZ2B 2Z9LA 1ETSH 1FMGA 1HAHH 4E7NA 1Y5UT 2FOHA 3ZVDA 1BTPA 3MMGA 1JWTA 1S83A 3DHKH 1EAUA 1MZDA 1W3CA 1Z8GA 1O30A 5HM9A 4Y10E 2P16A 1QJ1B 4K5ZA 1OS8A 3ZVBA 3K2UA 1EP6A 3RXLA 8GCHF 3BEUA 1H8DH 5K7RA 1FY4A 2EEKA 1W10U 2ZTZA 1NROH 7GCHG 1TNJA 1LHEH 4BAMB 1FY8E 2TRMA 5JB8S 1DWBH 1Q31A 1SGTA 1SQTA 4YLQH 2ANKH 1OSSA 3AAUA 3SQEE 1XUJA 3HGPA 3DFJA 1SGDE 2WV4A 8GCHG 1DFPA 1TMTH 3STJA 2XWAA 4OS6A 3SU6A 5A0BA 4GAWA 2V0BA 1MTNB 2F9OA 1QL9A 1S82A 2W26A 2ILNA 1BMLA 2AYWA 1QQ4A 5EGMA 1YM0A 5DP9A 4GHQA 4NZLA 1ZR0A 3O8CA 1QURH 1BUIA 2ZF0H 1V6DA 1KDQA 2A5AA 2ZDVH 4YT7H 3R3GB 1UTNA 1YCPH 2BY7X 1A5IA 1CT4E 3TK9A 5T6GA 1SOTA 1AGJA 5EQRA 2XBWA 2GDEH 4TPIZ 1DM4B 2Z6BD 3O8BA 4XBDA 1C5VA 1XUGA 1GMDF 1RTLA 3G01A 3ATIA 3ITIA 1PPFE 4X6PA 2G81E 1H4WA 2CV3A 4MTBA 2ZQ2A 3LONA 4AX9H 2Q6DA 1UTQA 2FM2A 1L0ZA 1LKAA 1ZTLA 1P01A 3L3TA 1ANBA 2W7SA 2ZGBH 2FOBA 1TLDA 1ELFA 1BTXA 1NFWA 3P8NA 4TWWA 4MNWA 1GMCF 2XC4A 4GUXA 3BTDE 1MU8B 1BA8B 1HAXB 1GMDG 1Y3VA 2ZDKA 2PKAB 4SGAE 3ZZ7A 3MNBA 2TGDA 3A7YA 4DVAU 4KKDA 2OXSA 2BDGA 2R2MB 3RM2H 3SU3A 4A1XA 1GI9B 4Q80A 3SNDA 2QF3A 6GCHF 1T4VH 3U8TH 1Z71A 4FU9A 1Z1JA 1L1NA 1SPJA 5JBBS 1C5TA 2F9BH 3FP8E 3H5CB 3V7TA 3UQOA 5DP7A 3TGJE 1KYNA 1MTNC 4U2WA 1GMCG 2BOKA 2FZZA 3SNBA 8ESTE 1FY1A 1GI3A 4D8NA 3MI4A 3TNTA 2AERH 1DXPA 3PTBA 3M5MA 2BD8A 1TMBH 2WPHS 1E36B 2QXGA 5AVDA 1QJ7B 1TA6A 1O3NA 3SN8A 2ZFRH 1KLIH 1S0RA 2CN0H 3DT0H 1D9IA 4CHAB 1ZSKA 1GDUA 3SGQE 4IN2A 2C3SA 2VU8E 5EXLA 4CRDA 1V2NT 2XNIA 1AN1E 2BVRH 3QUMP 2XRCA 2F83A 3LC3A 4B74A 1A5HA 5EG4A 1B0FA 4B75A 2R2WU 2TPIZ 1GBAA 3RMLH 3NUMA 3EA9A 2Y80A 1C2EA 1UCYK 3BF6H 3TK5A 2FXRA 2P95A 3A87A 1F7ZA 4LK4A 4I8GA 3SGBE 4K1TA 1TQ7B 1V2TT 1TNGA 3CS7A 4F49A 2O8WA 2SGQE 2P3TB 2ZU1A 5L2YH 3BTGE 1P2IA 1O3BA 5EW1H 1UTKA 3QO6A 1YPGH 4CRAA 5F03A 1A0LA 3OX7U 1LPGB 3ZV8A 2QCYA 1J8AA 1O2PA 5I46H 2B7DH 3TLOA 1O3CA 1QL8A 1ZMLA 3SUEA 1GCTB 1GI7B 1OYTH 3MHWU 1AMHA 2ZIQH 3RLYH 2G5VA 3GYMA 1EJAA 3T28A 3SU0A 1GBTA 4I31A 1CU1A 1DE7H 1O3FA 3TH4H 1KTTB 1DICA 4KTUA 4GHTA 1RXPA 1ETTH 2XCFA 2NWNA 2ASUB 4DJZB 5AFYH 1C5SA 1C5XB 1GBHA 1LVYA 1A3BH 1EASA 1NESE 6LPRA 4D7GA 1P05A 1VZQH 4CHAC 1MQ5A 1VITG 1BTWA 2PW8H 4MNYA 2GVFA 1Z6EA 5JDUB 4ISIH 1RFNA 1HAPH 1KXAA 1V3XA 1RIWB 3EA7A 1C4Y2 2SGPE 1U6QA 2Z94A 4Y8ZA 4IC5A 1GBKA 4XSKU 2BDBA 1FAKH 3UWJH 4IC6A 4NIWA 3KL6A 1XVMA 4BTTB 1YBWA 2QF0A 3M5NA 4I33A 4WJG2 1ZGIA 1XVOA 3RXAA 4BNRA 2ZTXA 1XX9A 1A0JA 4AG2A 1AE8H 1LKBA 1GGDB 5C3NA 3HKIB 2PUQH 4A1VA 2UUKB 1ZGVA 3MO6A 3SZNA 1HXEH 1O3AA 4BXWA 3U98H 4R0IA 3A88A 1YPLH 1D3DB 1DS2E 1SBWA 1E37B 2ZFFH 4CH8B 4U30A 3O8RA 2UWOA 2WUCA 1GCTC 4I8HA 1XUHA 2J95A 2VWLA 3SNCA 2PR3A 1YPEH 1TX8A 4UFDH 1C9PA 1UHBA 4ABDA 1BTYA 2H5CA 2FODA 4BTIB 2OP9A 4FU7A 3GY5A 4X1PU 3ZZ4A 3PB1E 1QCPA 3S0NA 3GY4A 1C1PA 2J38A 2OTVA 1F5LA 3KN2A 2FOEA 1JIMA 3NPSA 3SU4A 5GJ4B 1ZMJA 2VWNA 5GIBA 2WUBA 2BLQA 3QWCH 3HK6B 4MLFB 5DP8A 4RSPA 2HVXA 1ID5H 1Z7KA 3KQDA 1GVZA 1C5RA 1W12U 4MDSA 1P2QA 1RIWC 2YNAA 1XKBC 2PKSC 1YPHC 1DWEH 1QA7A 1TE0A 4OS7A 2FI3E 4JZ1A 1TGBA 4Y11E 3Q3YA 4TPYA 4Q7YA 2LNCA 2FTMA 2HNTE 3K6ZA 2FEQH 4IGDA 1P2JA 5FX5A 3VPKA 3MH5A 1VR1H 2PTCE 5ESBA 4IN1A 3W95A 4O03A 4CRFA 3BG4C 1A5GH 3OTJE 1ETRH 4Z6AH 1T8OA 2STAE 1C1VH 1F2SE 1SFQB 2A31A 1UTPA 3A7TA 2A2XH 1NPMA 3GISB 3F9HA 2CGAA 2XWBI 1S6HA 2FOAA 3LJOA 2ESTE 1JOUB 2P3UB 1UO6A 1TRYA 1HAVB 4INLA 4I8JA 5GPIB 4AB8A 4X2XA 2PSYA 2P8OB 1NU7B 4KTCA 3ZYEA 2ALVA 3UOPA 1PJPA 5T6FA 2SNVA 1HAVA 3T29A 1DY9A 1V2RT 4Y8XA 4GVUA 2AMPA 1C1UH 3GY6A 2EA3A 2YNBA 3GOVB 3MH7A 4YLUA 3P8GA 3LIWA 3M7QA 2ZQ1A 2V3HH 1MKXK 1C1RA 4JMYA 5JBCS 2RCEA 2V6NA 4DT7B 1W11U 4NA7A 1J17T 2O8MA 1MQ6A 4ISHH 2GCTB 2BXTH 2ZDMA 1K1PA 2KAIB 3P95A 1UTMA 4ZKRU 1QB1A 3FFGA 1A0HB 1LVBA 1P12E 3UFAA 1IQNA 4WWYA 1WQVH 2J2UA 2LIZA 4ABJA 4X6MA 5E8EH 4NIVA 4ABGA 1K1OA 1GHBF 5HXFA 5HGGA 3TK6A 2BB4A 1ELDE 4F4OC 1RS0A 1SMFE 1P8VC 2HRVA 4AG1A 2VIWA 4UD9H 1CBWB 4TY6A 4DCDA 2QY0B 2R0LA 2TIOA 1HJ9A 1SGPE 4K8BA 1H9HE 2CF8H 3TJUA 2SNWA 1B5GH 2P8OC 2I6QA 1BTUA 1SLXB 1EPTB 4FUJA 3E6PH 1GHBG 1N8OB 5FPTA 1UJ1A 2DE9A 3BTQE 1BBRK 1GBEA 1TX7A 3BTEE 3TGKE 1GI4A 1P03A 4Y8YA 1V2MT 3E16B 1AZ8A 2ZC9H 2VGCB 3I77A 1GHVH 2GCTC 1H1BA 3LKWA 1OWIA 2VJ1A 1TNHA 3SGAE 1RRKA 4H6TA 3M35A 2ULLA 1ZPBA 2YOLA 4IMQA 1DWCH 1AKSB 1HIAB 2D8WA 4THNH 2PLXA 4KP0A 1CO7E 1FY3A 5FCRA 4XDEA 4NWKA 3UUZA 4ABHA 3ZZBA 2ZU2A 4HI3A 1T32A 4H4FA 1TGTA 3U1IB 3SU1A 1IAUA 1HGTH 2GX4A 1CBWC 3UIRA 4WH6A 1K21H 3UWIA 3E0PB 4WMFA 4HTCH 3RC6A 1QB9A 3Q76A 2UUYA 2Y7XA 3T2NA 1GCDA 3B23B 1EAWA 1SHYA 1THRH 3LDXH 3PMHB 2R9PA 3A84A 2R3YA 2IOTA 4FU8A 1KTSB 3A8DA 2HALA 8KME2 3W94A 4XBCA 1BTHH 1SGCA 1EPTC 3GCTF 3EA8A 1DVAH 3SBKA 2VVCA 1OWJA 1C5OH 1GG6B 1D3QB 5LH8A 1MD7A 1DWDH 4UDWH 1SI5H 3VB5A 1O3JA 1ORFA 2BXUH 4E7RG 1EX3A 4LXBH 2OQUA 2C93B 3PMJA 4K3JA 2P93A 2G55A 4JZFH 3RXGA 4AYYB 4X1QU 3RXJA 1G9IE 3FAOA 2XC0A 4OS5A 3AVZA 3RXDA 1FXYA 4WXVA 3SV6A 4FVBA 2BDAA 2FS9A 3GCOA 2D1JA 4UFEH 2C8YB 4Y7AA 1G3CA 3QTVH 1ANDA 3I29A 4HZHA 4RKOB 1DITH 1LHFH 3WY8A 2O9QA 2ALPA 2AFQB 2ZDAH 5G4BA 2BD4A 5ABWA 1UVOA 4ABIA 3P70B 4NGAH 3ZZ5A 1HAYB 7GCHF 3SJKA 3RMMH 3NZIA 3SQHE 1UTJA 3VGCB 1EATA 1QRWA 1P09A 3PM3A 1TPSA 1B0EA 4INHA 1RGQA 3ZZDA 1GWAA 1D6WA 1BJVA 1C2GA 1K1MA 2WPMS 1TOMH 2TGTA 4UFGH 3AW1A 1LCYA 1LQDB 3ZVAA 1T7CA 4K60A 4OGXA 2G51A 1MH0A 3SUDA 4BAKB 1TAWA 1ZRKA 3GYLB 5LPRA 1KXCA 1C4U2 1C1NA 1IQHA 3SI3H 2ZNKH 1GG6C 5DP4A 4I32A 1C5NH 3F68H 1HBTH 4I7YH 1SGRE 2OBQA 3A8BA 2R0KA 4OS1A 3N7OA 3JZ2B 1QBOA 2UUFB 3T25A 2BQ6B 2ZU3A 2G5NA 3RXPA 3E1XB 1O3DA 2XTTB 1WAYB 1IQGA 5F8ZA 4JZEH 3A89A 1ZPCA 5L6NH 1DSTA 1E34B 2FOGA 2GTBA 1P0SH 7ESTE 2V35A 1MTSA 1FN6A 3RXVA 1QRXA 1JRTA 2SFAA 3ATMA 4YOJA 2H9EH 1MTUA 1C5MD 4NFFA 1C2FA 2ZCHP 2FOFA 5PTPA 4D7FA 1P02A 2NU3E 3GDUA 3OU0A 1L4ZA 2AIQA 1D6RA 3IWMA 4K69A 4K1SA 1GBFA 1Y3WA 2FI4E 3QLPH 1O3GA 4ZKNU 3L33A 4WMDA 1O2OA 4ZHLU 1FV9A 4D76A 1SGIB 1XUFA 2FDAA 2P59A 2QN5T 1CT0E 5E2PA 2BD9A 2BHGA 1A3EH 1G3DA 5E0JA 3LGYA 1P06A 2JETB 2F9VA 1HPGA 1AVXA 4NSVA 1HCGA 1NU9A 2CF9H 4MPVA 5A0CA 1Z1IA 3F9EA 1SSXA 2XBYA 1SG8B 3P8FA 5C67A 4ZAEA 1AVGH 1SQAA 1FLEE 1PYTC 2H6MA 2GKVE 3BIVH 1IHSH 1KXDA 3GY8A 2AMDA 1O5AB 5J4QA 1C5QA 2WPIS 1IQEA 2Q1JA 4MG3A 4NA9H 3ATWA 3LT3A 1BHXB 4VGCB 1V2QT 5TJXA 3CENA 4ZH8A 3UOUA 1C2MA 2BM2A 4KGAA 4YO9A 2FO9A 4FUCA 1FIWA 1DOJA 3EE0B 3VEQB 2ZA5A 3UNRA 2PKAA 4YOIA 3Q77A 5AF9H 4MQAA 2J4IA 4NCYA 1C5UA 3ZV9A 5GDSH 4HFPB 2W3KA 2FX4A 2GD4B 1YPKH 1TFXA 1ZJKA 4YTAA 4ABAA 1ZHPA 1CGIE 1UVPA 1O2UA 3T5FH 3T27A 1J15A 3M5LA 3M5OA 5CMXH 1GJAB 1GHXH 2G4TA 2QA9E 4QT8C 1GDNA 5HM2A 2Y5FA 5AHGH 1PQ5A 1AZZA 1P2OA 1O34A 3ZVEA 2HLCA 3MNCA 3S9AA 4ZROA 1ZZZA 2J9NA 1C5WB 3D62A 4Y7BA 3QTOH 3RMOH 2HOBA 2CMYA 3QZRA 2AGIX 2XCNA 3TJVA 1GBLA 3DUXH 4CREA 2FP7B 1GJBB 2JETC 5C5OA 2AS9A 2ZTYA 5LGOA 2ZHFH 4O97A 2XYAA 3UY9A 2FS8A 1UK2A 1GMHG 3SNEA 2XXLA 4GSOA 5I25A 1LPKB 4IMZA 1WOFA 1LHCH 1ABJH 3AASA 2HPQH 5A8XA 2QGRA 1XMNB 1A7SA 1O2IA 2GDDA 4ZKSU 2FIRH 3C1KA 4B1TA 1EZUC 2ODQA 4VGCC 3EDXB 1GI2A 2ZGJA 1VITF 3FP7E 1CQQA 2C8ZB 1K1LA 1A46H 1EB2A 5EXMA 1MBQA 1WTHD 1W14U 2A7JA 1SHHB 1O2LA 2F3CE 3SI4H 5DPAA 1ABIH 4TYDA 2Z9KA 2A2QH 4U01A 1XXFA 4RN6A 1CE5A 2Y82A 2ZPRA 1K1JA 5DP5A 2BQWB 3VB7A 3A86A 2OC8A 1WUNH 3RU4T 4B71A 1G2MA 3LJJA 2A7HA 1Q2WA 1GJCB 3CS0A 1YCPM 1C1TA 3FZDA 1V2JT 3ZVCA 1S85A 3LGUA 1MBMA 1IHTH 2BDHA 1HB0B 1E0FD 3M3VA 4O9VA 1FIZA 1QRZA 4AORA 2FWWA 1MZAA 1TBQH 2GGVB 3A80A 3TH2H 1QIXB 3PO1B 1ELAA 3KEEA 5LPEA 2NU1E 5DP6A 3E0NB 2A4GA 4X8SH 3ELAH 1L4DA 5TCAA 3A8AA 4K2YA 1GHWH 1LHDH 3EGKH 4H42U 1M9UA 1FJSA 1EZXC 2QYIA 9LPRA 1T4UH 3PWCA 1QB6A 4ISLA 4INKA 3GY3A 2R3UA 2JKHA 3RXHA 2OCVB 2BOHB 1O5GH 1AWFH 2WYGA 1KIGH 1JIRA 1TGCA 2A32A 2H2ZA 3OYPA 2ZGXH 1QBVH 1A4WH 1P9UA 1TWXB 3Q00A 1PPGE 5A8ZA 3RC4A 3RXTA 4ISOA 3PLBA 4K1EA 4XBBA 4E06H 1GPZA 1KY9A 1YCPK 3MNSA 1UTLM 1GBDA 4AB9A 1TPAE 4DGJA 3KGPA 4YZUA 2PTNA 2BDYA 1OKXA 2ZDLA 4NIYA 4FUDA 1EOLA 3ZVGA 4JYTA 4X8TH 2A1DB 2FOMB 1ZOMA 2AGEX 1O2RA 1FDPA 4WMEA 1NT1A 1HNEE 2ZP0H 2UWPA 4DW2U 1BRAA 4AOQA 2A5KA 1DLEA 5EXNA 2VWMA 5CE1A 1YKTA 3F9FA 1H9IE 1JBUH 4BOHA 1C5YB 1MMJN 5C1YA 3ENSB 5SGAE 3NKKA 5JB9S 1MKWH 1GHAF 4JZDH 3PO1C 1O37A 1C2JA 3V0XA 2BD7A 2FYRA 1GGDC 1BCUH 2D26C 2STBE 1CSOE 3SHCH 1QQUA 1CGHA 3M36A 1MAYA 1O2SA 1YYY1 3A83A 4X1SU 7KMEH 1T8NA 5E0GA 1QNJA 1TNKA 4XOJA 5AFZH 2C90B 1Y3YA 3S7KB 3ZZAA 3LH1A 2GZ8A 2ZCKP 1BTZA 5DG6A 2OUAA 5DO4H 2QV1A 3ZYDA 1GHAG 2GV6A 1SLUB 2A4RA 4YT6H 4Y79A 1PYTD 3U9AH 2ZGHA 1O3HA 4BTUB 4CRGA 2ZHDA 5GXPA 3PLKA 1ELTA 2W7UA 1GI1A 3A7VA 1E35B 1IQMA 1NRPH 1O5EH 2ZFSA 3MTYA 4WVPE 2Q6FA 1TRMA 1W2KH 2ZFTA 1AB9B 3M37A 1PPZA 3URDA 4UONA 1S84A 2OINA 4CRBA 5A2MH 1HDTH 2XBXA 4Q7XA 3R0FA 1AUTC 1IQIA 3T26A 1B7XB 1IOEA 1YP9A 1VJ9U 2VIOA 1J9CH 1DUEA 3A85A 1TX6A 2ZECA 3A7XA 2O8UA 3VXFH 5F6MA 3SOSA 2BTCE 2CHAB 1ZTJA 3RXEA 1ZRBA 1W8BH 3RXMA 3SO3A 2F9UA 1O3MA 1QFKH 2EC9H 1V2ST 5GCHG 2F9PA 2Z3EA 1UK4A 1RD3B 2B8OH 1LTOA 2GMTB 4HGCA 1P3EA 5JYIA 3ODFA 1N6XA 1NO9H 1VITH 4AYVB 3S9BA 3Q3XA 2BDIA 2AMQA 1Z8JB 3D65E 2KAIA 1QY6A 4Y6DA 3QN7A 1QJ6B 1DUAA 2EI8A 2NU4E 1GJ5H 1XUKA 5BPEA 1O2XA 3IITA 1EB1H 2Q6GA 3KQBA 1PPBH 1Y59T 2PFEA 2VVUA 1SLVB 3Q3KA 2GT8A 4ZHAA 4E05H 4FUHA 3SJIA 1KSNA 1WCZA 2ZKSA 2ZHQH 4PROA 1YPHE 1L2EA 2ZPQA 1PPCE 1UVTH 2B5TB 4AFSA 1HJAB 3PMAB 1GBIA 1ARCA 3DD2H 3RU4D 3FZZA 4NFEA 1AB9C 1EZSC 1JMOH 1GBBA 5B6OA 1F0UA 1N6YA 1W0ZU 2LPRA 1O2NA 2OBOA 4OGYA 3U8RH 3ZZCA 3RC5A 3QDZB 2BVSH 3PV4A 4YM9A 1IQJA 3BTKE 4FUIA 2FMJA 3O8DA 1AFEH 2FTLE 1GJ7B 1K28D 1EPTA 3UQVA 2I6SA 3UR6A 4WY3A 1GJDB 3SUFA 1LHGH 2BY5X 2W5EA 2H1UA 4OS2A 1Y5BT 3RP2A 1PQ7A 2QIQA 1BIOA 2CHAC 1ELBA 2C8XB 1H8IH 2ZO3H 2VIPA 4X2YA 5C1UA 3K6YA 2GMTC 2OLGA 4DOQA 1SGNE 1AO5A 3STIA 4AFZA 2W3IA 1EUFA 3RXIA 3RUOA 1GL1A 1AKSA 1HIAA 1OP8A 2Y7ZA 1HRTH 3FANA 4B73A 3M7UA 1OOKB 1MD8A 2RA3A 2BX4A 1C1WH 1C5PA 1A2CH 2EI6A 3BIUH 3GY7A 1WU1A 3A82A 1P57B 2P3FH 5EODA 1C2IA 1N8OC 1AQ7A 1WBGB 4GCHF 2ZZUH 3ATLA 5FXLA 5FPYA 1C5ZB 1GHZA 1V2PT 4X2WA 4ZXYH 1VGCB 1ZSJA 4JK6A 2GCHF 4YOGA 5IYTA 1GVKB 1UCYH 3GICB 3VFEA 1GJ4H 2NU2E 3TJOA 5LPFA 1QGFA 3MU1A 3A7ZA 2B0FA 1TA2A 5BRRE 4TY7A 1J14A 5FHTA 1NS3A 5EPNA 2BMGB 1IQLA 4GLYA 2VGCC 3RXUA 2EI7A 1GBCA 2ZFPH 1TGNA 1AWHB 1BJUA 3ZZ8A 3S69A 4GCHG 1A61H 2IN2A 1O5FH 2B9LA 1GDQA 3LGTA 2ZI2H 2K1QA 5T6DA 3I78A 3LOXA 1EXFA 1O32A 2GCHG 1SR5C 1O31A 3M3SA 2A4OA 1THSH 1GJ9B 2O8LA 3RLWH 2THFB 2BY6X 3U1JB 1G3BA 2TGAA 1OWDA 3SNAA 1FY5A 1XM1A 3HK3B 4JZIA 1ELEE 5JBTA 3TH3H 1EKBB 2VWOA 2VIDA 3P92A 2ZG0H 1SGQE 1SQOA 1EJNA 1AUJA 3OY5U 2WPLS 1DXWA 1SGFG 2Y6TA 3RXSA 1DLKB 4XE4A 4AGKA 1NFYA 4A5TS 1LVMA 4BAHB 2F91A 3F6UH 2BLWA 3NCLA 2JH0D 2WINI 1F0TA 3ATKA 3RXOA 2ODYB 1CVWH 1G30B 3KF2A 1O0DH 1S5SA 1UMAH 1GHYH 3H7OA 4BXSA 1FUJA 2AIPA 1V2WT 1TPOA 1VGCC 3TU7H 2IJOB 1HUTH 3S7HB 4ABEA 4UFFH 1OXGA 1ELVA 3C27B 2JH6D 1FN8A 1SGEE 3ZZ3A 1F5RA 4ZMAH 1WYKA 1SFIA 1FPCH 2IPHA 1HAOH 5C20A 4CRCA 2P94A 2ANMH 3TGIE 1TGSZ 3BEIB 5T3HA 1O3KA 2GT7A 5E0HA 4JYUH 5F8XA 1FAXA 2QXJA 1NTPA 1LPZB 2F9NA 1QR3E 4MNVA 1K1IA 5JPMH 4Q2KA 1VJAU 3P17H 3M61U 1O2HA 3EYDA 4D9RA 4DURA 1KDQB 1O5BB 2BLVA 1OWEA 3DA9B 4SGBE 1F0RA 1P10A 3D23A 3VB4A 1QBNA 3BV9B 4B76A 4NG9H 1ELGA 1LMWB 4DY7B 3VB3A 2QC2A 1HFDA 1OX1A 1DANH 1O2VA 3VGCC 1TIOA 2BY8X 4MVNA 2CXVA 3EAJA 2C4FH 4WH8A 1CHGA 1HAIH 4ABFA 1Y8TA 3DFLA 1P3CA 5DP3A 1GBJA 4A92A 3RXCA 1TABE 3V3MA 3KHVA 1MU6B 1Z6JH 2G00A 4DIHH 2HGTH 2FLBH 1CGJE 4YESB 4B2CA 4Y0YE 1AE5A 1F92A 1NY22 1DY8A 1Y3UA 1HJ8A 4I8LA 1P2KA 3SW2B 1MUEB 3A7WA 1BITA 2ODPA 1WV7H 1QHRB 1HAGE 5DJ7A 1LO6A 3HPTB 5JBAS 1RJXB 2BLOA 3K9XB 3F9GA 4ZKOU 1TB6H 4CBOA 1D3TB 3QZQA 1EP5A 2ZGCA 1SB1H 1NFXA 1TALA 2Z7FE 2BZ6H 3A8CA 3LU9B 4MNXA 3SV8A 1BMMH 2HWLB 3LGVA 4X2VA 2VVVA 3UNSA 1NFUA 3ODDA 1GJ8B 3MWIU 1BOQA 4Z0KA 3PLPA 4AN7A 1P2MA 3QX5H 4A1TA 1FONA 3SJOA 3E8LA 2DE8A 1TOCB 1EQ9A 2AH4X 3M7TA 1CA0B 1TQ0B 2BX3A 5K0HA 1GMHF 1BZXE 1QTFA 1DPOA 1C1QA 3H7TA 1C2KA 4WF8A 4ZXXH 1G2LA 5C5NA 3BTME 3NWUA 3S9CA 1C1SA 1OWKA 2G8TA 1UCYE 1D3PB 3B8JA 5EW2H 1PQAA 1NN6A 2Y5HA 6GCHG 1UTOA 4CH2B 4X6OA 1Y3XA 8LPRA 1HV7A 3RXBA 1TMUH 1WTGH 5IDKA 3OY6U 4Y76A 1C5LH 1GI0A 1TPPA 3GCHB 2GZ7A 1MKXH 3PYHA 4OS4A 1V2KT 1YLDA 4BAOB 1G32B 1QA0A 2OC7A 1WSSH 1T8LA 1MAXA 1ZHMA 1GI6A 3MNXA 4J2YB 3PROA 4X6NA 2Z9JA 1ZHRA 1O2GH 4ESTE 1J16A 1WQSA 4ZUHA 5EPYA 1NRRH 7LPRA 1ZLRA 5FCKA 1YPJH 4IS5A 5F8TA 3SU5A 3OSYA 3HATH 3TPIZ 3BTFE 1AFQB 2UUJB 3KNXA 4D9QA 3L6PA 2ZHEH 3RXKA 2G52A 1SGFA 3PWBA 2HNTC 3NXPA 3QGJA 1SL3A 3NK8A 3EBNA 4FXGH 1PQ8A 3RXFA 4ISNA 1C2LA 1CT2E 1FQ3A 1CA0C 2VIVA 1A1RA 2CJIA 3MO9A 3A81A 2HPPH 1LDTT 2OC0A 1O36A 1V2VT 1RTKA 1BQYA 2BYAX 5A09A 3HKJB 1KXFA 5EQQA 3RMNH 1MTVA 1ZYOA 1BBRH 1ZTKA 1V2OT 2TBSA 2BY9X 1GJ6A 2VIQA 1NC6A 3FVFB 3LPRA 1TONA 3UNQA 3GCHC 2OQ5A 5FPSA 1TNLA 1SC8U 1VCQA 1P11E 2PKSB 2ZCLP 4X8VH 4UEHH 1PPHE 2ZWLH 3SV9A 4CR9A
chains in the Genus database with same CATH superfamily
2A0QB 1D4PB 2ANWA 3UREA 2PSXA 5HYOA 1LVOA 3SORA 1F5KU 1T8MA 3ZZ9A 4I8KA 3UPEA 2ZPSA 4MPWA 1O2QA 1YGCH 3BG4B 1G36A 1O3EA 1ESAA 1KXEA 2L74A 3UR9A 1UHBB 2BD5A 2V3MA 4Y0ZE 3AAVA 1GI8B 1OWHA 3RXRA 1AFQC 3BN9A 1AD8H 1ZJDA 1EOJA 1GI5A 2QAAA 1CA8B 3BEFB 4TWYA 1L1JA 4IBLH 1H9LB 1O35A 1Z8IB 2SGFE 1AY6H 1ACBE 3K65B 4U32A 2AEIH 1SVPA 1L1GA 2PWXA 2PUXB 2BQ7B 1C2HA 1INCA 2VH0A 3MU8A 1YC0A 2SGDE 1OPHB 5DKMA 3MYWA 2NU0E 1C2DA 4MPUA 3RU4E 4UE7H 4M7GA 3QK1A 1EAIA 1S0QA 2UWLA 2H9HA 5A8YA 2V3OH 1W7XH 3SUGA 3AW0A 2WPJS 3FP6E 3DSGA 3MH4A 3V13A 3E91A 2GV7A 1Y5AT 1P9SA 1ESBA 4DG4A 4RKJB 3GCNA 2WZQA 4AFQA 3U8OH 1O2YA 2ZHWH 5FBEA 1O39A 1HXFH 2H9TH 3E3TA 1HYLA 2M5TA 4O3TA 4X1NU 3VXEH 1S81A 5GWZA 2J34A 5C0UA 1K2I1 1EZQA 1W7GH 2C8WB 2OC1A 5EQSA 1YLCA 4NZQA 1HAZB 4LZ4B 3HGNA 2FI5E 2OD3B 5DGJA 1GVLA 4ABBA 1TBZH 1SLWB 2D2DA 1S6FA 2SGAA 4J1YA 3SJ8A 3SV2H 1LQEA 1SQRA 2Z3DA 1O5DH 3LC5A 4FUGA 2VINA 3EQ0H 5GCHF 1KLTA 3MH6A 1K9OE 3KQCA 1JRSA 1KLJH 1NM6A 4KELA 4CR5A 1IQKA 3IG6B 3E90B 2Z3CA 1W0YH 1NRQH 2ZDNA 1ZMNA 3GDSA 2VNTA 1MCTA 4DIIH 1EAXA 2BDCA 1AIXH 3KCGH 1BB0B 1SGYE 2FPZA 5ESTE 3MOCA 3TITA 3KQEA 5HIYA 5HMAA 5L2ZH 1SOZA 3LH3A 3RM0H 4JCNA 4GPGA 1DT2A 3MFJA 4WXIA 2RG3A 2GZ9A 3LGIA 2RDLA 1JXPA 3PMBB 2RA0A 1OYQA 1AI8H 4ACBA 1ZPZA 3KQ5A 5FX6A 4MPXA 2FESH 3CP7A 2PHBA 2FX6A 1HLTH 2G4UA 1Z8RA 4B2AA 5DK1A 1Q3XA 2JH5D 1BRCE 1FZZA 2ZFQH 3ESTA 1G37A 6CHAB 1BDAA 4RT0A 3T62A 1O33A 9ESTA 2H5DA 3QGNB 1X7AC 2ZEBA 3SHAH 2EY4C 3P6ZB 5C2ZA 3BSQA 2PGBB 2BD2A 1FPHH 1XKAC 1MTWA 1XUIA 2K7XA 4BAQB 2Y81A 1O2JA 5C1XA 3V12A 1W13U 4H6SB 1N1LA 4XRNA 4LOYH 4AGJA 1BBRE 2ZU5A 2QXHA 5FBIA 1BRBE 1VCPA 3GY2A 1O2ZA 1NZQH 3TNSA 1F0SA 3N7DA 4X1RU 4JK5A 4B2BA 4NA8A 1UVSH 4CBNA 1UVUH 5CHAB 1C1MA 1P04A 1O2KA 1KXBA 3BTTE 3UTUH 1FNIA 2SGEE 1WXRA 4KTSA 4NWLA 3LGWA 1UK3A 1K1NA 1O2WA 3TIUA 3RXQA 2QF5A 2XBVA 4IW4E 1DSUA 4M9FA 2PGQB 2RDEA 1C1OA 1ZSLA 3ZVFA 2DUCA 4ZHMU 2VH6A 3GDVA 1E38B 1IQFA 3BTWE 3TJNA 1GL0E 3SU2A 1YPMH 1BHXF 1AU8A 1XXDA 4NSYA 2PV9B 4XFQA 1W0KD 5TCCA 1CHOF 5FAHA 3PTNA 2A5IA 2BZAA 1O3OA 2BD3A 4BANB 5KGOA 1T31A 1P2NA 2FOCA 1V2LT 5EOKA 1ARBA 3TVJB 1O5CB 4A6LA 1K22H 5L30H 2AGGX 3VB6A 1TYNA 6CHAC 3KYGA 2HNTF 1O3LA 1FI8A 1TBRH 2J92A 5EIYA 1PPEE 1COWD 1YF4A 1DX5M 1ANEA 1QL7A 3MU5A 1RTFB 1CHOG 5ETXA 2J94A 1AHTH 1HJAC 2Y5GA 1TNIA 2WV5A 1OP0A 4NIXA 3MU0A 3BTHE 2O8TA 3U69H 2FYQA 1OP2A 2ZU4A 3P8OA 3MU4A 4R8TB 4ACAA 2TGPZ 3MO3A 1PFXC 5CHAC 5H4IB 1MCVA 2QXIA 2Z9IA 2GP9B 5EU8A 1DDJA 4Q7ZA 1AVWA 1O38A 3RDZA 3URCA 4FUFA 1BMNH 4JYVH 1O3PB 2WPKS 1VCWA 1BMAA 4K8YA 4Y71A 5J4SA 1V2UT 2Z9GA 1GBMA 6ESTA 2WYJA 2VB0A 4TT3D 3BG8A 1EJMA 2FLRH 3ZZ6A 1MKWK 4AFUA 1BRUP 3F1SB 3M3TA 3JZ1B 2XC5A 1C9TA 2OK5A 2IJD1 1THPB 3SV7A 4A7IB 1NRNH 1O3IA 1TRNA 1O2MA 3ZIAD 1C4V2 3GCTG 4FUEA 3D49H 2A45B 2ANYA 2BVXH 5E2OA 4LZ1H 3SJ9A 3B9FH 1ELCA 3KIDU 2XW9A 1ESTA 2A4QA 3OTPA 1G3EA 4FVDA 4O3UA 3UAIC 4FUBA 1NRSH 1ANCA 2A7CA 4ASHA 1BT7A 1O2TA 1SKYE 4X0WU 4X8UH 5A0AE 4AZ2B 2Z9LA 1ETSH 1FMGA 1HAHH 4E7NA 1Y5UT 2FOHA 3ZVDA 1BTPA 3MMGA 1JWTA 1S83A 3DHKH 1EAUA 1MZDA 1W3CA 1Z8GA 1O30A 5HM9A 4Y10E 2P16A 1QJ1B 2LELA 4K5ZA 1OS8A 3ZVBA 3K2UA 1EP6A 3RXLA 8GCHF 3BEUA 1H8DH 5K7RA 1FY4A 2EEKA 1W10U 2ZTZA 1NROH 7GCHG 1TNJA 1LHEH 4BAMB 1FY8E 2TRMA 5JB8S 1DWBH 1Q31A 1SGTA 1SQTA 4YLQH 2ANKH 3PRDA 1OSSA 3AAUA 3SQEE 1XUJA 3HGPA 3DFJA 1SGDE 4RI0A 2WV4A 8GCHG 1DFPA 1TMTH 3STJA 2XWAA 4OS6A 3SU6A 5A0BA 4GAWA 2V0BA 1MTNB 2F9OA 3F2GA 1QL9A 1S82A 2W26A 2ILNA 1BMLA 2AYWA 1QQ4A 5EGMA 1YM0A 5DP9A 4GHQA 4NZLA 1ZR0A 3O8CA 1QURH 2M2AA 1BUIA 2ZF0H 1V6DA 1KDQA 2A5AA 2ZDVH 1BMFD 3R3GB 1UTNA 1YCPH 4YT7H 2BY7X 1A5IA 1CT4E 3TK9A 2LP6A 5T6GA 1SOTA 2WSSD 1AGJA 5EQRA 2XBWA 2GDEH 4TPIZ 1DM4B 2Z6BD 3O8BA 4XBDA 1C5VA 1XUGA 1GMDF 1RTLA 3G01A 3ATIA 3ITIA 1PPFE 4X6PA 2QF4A 2G81E 1H4WA 2CV3A 4MTBA 2ZQ2A 2KCYA 3LONA 4AX9H 2Q6DA 1UTQA 2FM2A 1L0ZA 1LKAA 1ZTLA 1P01A 3L3TA 1ANBA 2W7SA 2ZGBH 2FOBA 1TLDA 1ELFA 1BTXA 1NFWA 3P8NA 4TWWA 4MNWA 1GMCF 2XC4A 4GUXA 3BTDE 1MU8B 1BA8B 1HAXB 1GMDG 1Y3VA 2ZDKA 2PKAB 4SGAE 3ZZ7A 3MNBA 2TGDA 3A7YA 4DVAU 4KKDA 2AHME 2BDGA 2OXSA 2R2MB 3RM2H 3SU3A 4A1XA 1GI9B 4Q80A 3SNDA 2QF3A 6GCHF 1T4VH 3U8TH 1Z71A 4FU9A 1Z1JA 1L1NA 1SPJA 5JBBS 1C5TA 2F9BH 3FP8E 3H5CB 3V7TA 3UQOA 5DP7A 3TGJE 1KYNA 1MTNC 4U2WA 1GMCG 2BOKA 2FZZA 3SNBA 8ESTE 1FY1A 1GI3A 4D8NA 3MI4A 3TNTA 2AERH 1DXPA 3PTBA 3M5MA 2BD8A 1TMBH 2WPHS 1E36B 2QXGA 5AVDA 1QJ7B 1TA6A 1O3NA 3SN8A 2ZFRH 1KLIH 1S0RA 2CN0H 3DT0H 1D9IA 4CHAB 1ZSKA 3FKSD 1GDUA 3SGQE 4IN2A 2C3SA 2VU8E 5EXLA 4CRDA 1V2NT 2XNIA 1AN1E 2BVRH 3QUMP 2XRCA 2F83A 3LC3A 4B74A 1A5HA 4FETA 5EG4A 1B0FA 4B75A 2R2WU 2TPIZ 3WWBA 1GBAA 3RMLH 3NUMA 3EA9A 2Y80A 1C2EA 5C17A 1UCYK 3BF6H 3TK5A 2FXRA 2P95A 3A87A 1F7ZA 4LK4A 4I8GA 3SGBE 4K1TA 5EJZA 1TQ7B 1V2TT 1TNGA 3CS7A 4F49A 2O8WA 2SGQE 2P3TB 2ZU1A 5L2YH 3BTGE 1P2IA 1O3BA 5EW1H 1UTKA 3QO6A 1YPGH 4CRAA 2XOKD 5F03A 1A0LA 3OX7U 1LPGB 3ZV8A 2QCYA 1J8AA 1O2PA 5I46H 2B7DH 2KR7A 3DSOA 3TLOA 1O3CA 1QL8A 1ZMLA 3SUEA 1GCTB 1GI7B 1OYTH 5DSFA 3MHWU 1AMHA 2ZIQH 3CNRA 3RLYH 2G5VA 3GYMA 1EJAA 3N99A 3SU0A 3T28A 1GBTA 4I31A 1CU1A 1DE7H 1O3FA 2K8IA 3DCLA 3TH4H 1KTTB 1DICA 4KTUA 4GHTA 1RXPA 1ETTH 2XCFA 2NWNA 2ASUB 4DJZB 5AFYH 4F48B 1C5SA 1C5XB 1GBHA 1LVYA 1A3BH 1EASA 1NESE 6LPRA 4D7GA 1P05A 1VZQH 4CHAC 1MQ5A 1VITG 1BTWA 2PW8H 4MNYA 2GVFA 1Z6EA 5JDUB 4ISIH 1RFNA 4Q4LA 1KXAA 1V3XA 1HAPH 1RIWB 3EA7A 1C4Y2 2SGPE 1U6QA 2Z94A 4Y8ZA 4IC5A 1GBKA 4XSKU 2BDBA 1FAKH 2KZ4A 3UWJH 4IC6A 4NIWA 3KL6A 1XVMA 4BTTB 1YBWA 2QF0A 3M5NA 4I33A 4WJG2 1ZGIA 1XVOA 3RXAA 4BNRA 2ZTXA 1XX9A 1A0JA 4AG2A 1AE8H 1LKBA 1GGDB 5C3NA 3HKIB 2PUQH 4A1VA 2UUKB 1ZGVA 3MO6A 3SZNA 1HXEH 1O3AA 4BXWA 3U98H 4R0IA 3A88A 1YPLH 1D3DB 1DS2E 1SBWA 1E37B 2ZFFH 4CH8B 4U30A 3O8RA 2UWOA 2WUCA 1GCTC 4I8HA 1XUHA 1K0HA 1NBME 2J95A 5EJLA 2VWLA 3SNCA 2PR3A 1YPEH 1TX8A 1WDIA 4UFDH 1C9PA 1UHBA 4ABDA 1BTYA 2H5CA 2FODA 4BTIB 2OP9A 4FU7A 4YXWD 3FN8A 3GY5A 4X1PU 3ZZ4A 3PB1E 1QCPA 3S0NA 3GY4A 1C1PA 2J38A 2OTVA 1F5LA 3KN2A 2FOEA 1JIMA 3NPSA 3SU4A 5GJ4B 1ZMJA 2VWNA 5GIBA 2WUBA 2BLQA 3QWCH 3HK6B 4MLFB 5DP8A 4RSPA 2HVXA 1ID5H 1Z7KA 3KQDA 1GVZA 1C5RA 2KCPA 1W12U 4MDSA 1P2QA 1RIWC 2YNAA 1XKBC 2PKSC 1YPHC 1DWEH 1QA7A 1TE0A 4OS7A 2FI3E 4JZ1A 1TGBA 4Y11E 3Q3YA 4TPYA 4Q7YA 2LNCA 2FTMA 2HNTE 3K6ZA 2FEQH 4IGDA 1P2JA 5FX5A 3KYFA 3VPKA 3MH5A 2WV9A 1VR1H 2PTCE 5ESBA 4IN1A 3W95A 4O03A 2IPQX 4CRFA 3BG4C 1A5GH 3OTJE 1ETRH 4Z6AH 1T8OA 2STAE 1C1VH 1F2SE 1SFQB 2A31A 1UTPA 3A7TA 2A2XH 1NPMA 3GISB 3F9HA 2CGAA 1W0JD 2XWBI 1S6HA 2FOAA 3LJOA 2ESTE 1JOUB 3AK5A 2P3UB 3F0OA 1UO6A 1TRYA 1HAVB 4INLA 4I8JA 5GPIB 4AB8A 4FOUC 4X2XA 2PSYA 2P8OB 1H8HD 1NU7B 4KTCA 3ZYEA 2ALVA 2QE7D 3UOPA 1PJPA 5T6FA 2SNVA 2EQNA 1HAVA 2PP6A 3T29A 4F55A 1DY9A 1V2RT 4Y8XA 4GVUA 2AMPA 1C1UH 3GY6A 2EA3A 2YNBA 3GOVB 5KEDA 3MH7A 4YLUA 3P8GA 3LIWA 3M7QA 2ZQ1A 2V3HH 1MKXK 1C1RA 4JMYA 5JBCS 2RCEA 2V6NA 3UB0A 4DT7B 1W11U 4NA7A 1J17T 2O8MA 1MQ6A 4ISHH 2GCTB 2BXTH 2ZDMA 1K1PA 2KAIB 3P95A 1UTMA 4ZKRU 1QB1A 3FFGA 1A0HB 1LVBA 1P12E 3UFAA 1IQNA 1YLNA 4WWYA 1WQVH 4Z1MD 2J2UA 2LIZA 4ABJA 4X6MA 5E8EH 4NIVA 4B6FA 3N7EA 4ABGA 1K1OA 1GHBF 5HXFA 5HGGA 3TK6A 2BB4A 1ELDE 4F4OC 1RS0A 1SMFE 1P8VC 2HRVA 4AG1A 2VIWA 4UD9H 1CBWB 4TY6A 4DCDA 2QY0B 2R0LA 2TIOA 1HJ9A 1SGPE 4K8BA 2K0QA 1H9HE 2CF8H 3TJUA 2SNWA 1B5GH 4B6EA 2P8OC 2I6QA 1BTUA 2JIZD 1SLXB 1EPTB 2XNDD 4FUJA 3E6PH 1GHBG 1N8OB 2GJGA 5FPTA 1UJ1A 2DE9A 3BTQE 1BBRK 1GBEA 1TX7A 3BTEE 3TGKE 1GI4A 1P03A 4Y8YA 1V2MT 3E16B 1AZ8A 2ZC9H 2VGCB 3I77A 1GHVH 2GCTC 1H1BA 3LKWA 1OWIA 2VJ1A 1TNHA 3SGAE 1RRKA 4H6TA 3M35A 2ULLA 1ZPBA 2YOLA 4IMQA 1DWCH 1AKSB 1HIAB 2D8WA 4THNH 2PLXA 4KP0A 1CO7E 1FY3A 5FCRA 4XDEA 4NWKA 3UUZA 4ABHA 3ZZBA 2ZU2A 4HI3A 1T32A 4H4FA 2J97A 1TGTA 3U1IB 3SU1A 1IAUA 1HGTH 2GX4A 1CBWC 3UIRA 3NRLA 4WH6A 1K21H 3UWIA 3E0PB 4WMFA 4HTCH 3RC6A 1QB9A 3Q76A 2UUYA 2Y7XA 3T2NA 1GCDA 3B23B 1EAWA 1SHYA 1THRH 3LDXH 3PMHB 2R9PA 3A84A 2R3YA 2IOTA 4FU8A 1KTSB 3A8DA 2HALA 8KME2 3W94A 4XBCA 1BTHH 3F3BA 1SGCA 1EPTC 3GCTF 3EA8A 1DVAH 5FL7D 3SBKA 2VVCA 1OWJA 1C5OH 1GG6B 1D3QB 5LH8A 1MD7A 1DWDH 4UDWH 1SI5H 3VB5A 1O3JA 1ORFA 2BXUH 4E7RG 1EX3A 4LXBH 2OQUA 2C93B 3PMJA 4K3JA 2P93A 2G55A 4JZFH 3RXGA 4AYYB 4X1QU 3RXJA 1G9IE 3FAOA 2XC0A 4OS5A 3AVZA 3RXDA 1FXYA 4WXVA 3SV6A 4FVBA 2BDAA 2FS9A 3GCOA 2D1JA 4UFEH 2C8YB 4Y7AA 1G3CA 3QTVH 1ANDA 3I29A 4HZHA 4RKOB 1DITH 1LHFH 3WY8A 2O9QA 2ALPA 2AFQB 2ZDAH 5G4BA 2BD4A 1E79D 1UVOA 4ABIA 5ABWA 3P70B 4NGAH 3ZZ5A 1HAYB 7GCHF 3SJKA 3RMMH 3NZIA 3SQHE 1UTJA 3VGCB 1EATA 1QRWA 1P09A 3PM3A 1TPSA 1B0EA 4INHA 1RGQA 3ZZDA 1GWAA 1D6WA 5IK2D 1BJVA 3U28C 1C2GA 1K1MA 2WPMS 1TOMH 2TGTA 4UFGH 3AW1A 1LCYA 1LQDB 3ZVAA 1T7CA 4K60A 4OGXA 2G51A 1E1RD 1MH0A 3SUDA 4BAKB 1TAWA 1ZRKA 3GYLB 5LPRA 3VG8A 1KXCA 1C4U2 1C1NA 1IQHA 3SI3H 2V7QD 3PV2A 2ZNKH 1GG6C 5DP4A 4I32A 5HKKD 1C5NH 3F68H 3MQKC 1HBTH 4I7YH 1SGRE 2OBQA 3A8BA 2R0KA 4OS1A 1YY3A 3N7OA 3JZ2B 1QBOA 5DN6D 2UUFB 3T25A 2BQ6B 2ZU3A 2G5NA 3RXPA 3E1XB 1O3DA 2XTTB 1WAYB 1IQGA 5F8ZA 4JZEH 3A89A 1ZPCA 5L6NH 1DSTA 1E34B 2FOGA 2GTBA 1P0SH 7ESTE 2V35A 1MTSA 1FN6A 3RXVA 1QRXA 1JRTA 2SFAA 3ATMA 4YOJA 2H9EH 1MTUA 1C5MD 4NFFA 1C2FA 2ZCHP 2FOFA 5PTPA 4D7FA 1P02A 2JJ1D 2NU3E 3GDUA 3OU0A 1L4ZA 2AIQA 1D6RA 3IWMA 4K69A 4DT4A 4K1SA 1GBFA 1Y3WA 2FI4E 3QLPH 1O3GA 4ZKNU 3L33A 4WMDA 1O2OA 2JDID 4ZHLU 1FV9A 4D76A 5CHBA 4XD7D 3OE7D 1SGIB 1XUFA 2FDAA 2P59A 2QN5T 1CT0E 5E2PA 2BD9A 2BHGA 1A3EH 1G3DA 5E0JA 1MABB 3FO8D 3LGYA 1P06A 2JETB 2F9VA 1HPGA 1AVXA 1YWUA 4NSVA 1HCGA 1NU9A 2CF9H 4MPVA 5A0CA 1Z1IA 3F9EA 1SSXA 2XBYA 1SG8B 3P8FA 5C67A 4ZAEA 1AVGH 1SQAA 4P00A 1FLEE 1PYTC 2H6MA 2GKVE 3BIVH 1IHSH 1KXDA 3GY8A 5CDFE 2AMDA 1O5AB 5J4QA 1C5QA 3EE7A 2VBCA 2WPIS 1IQEA 2Q1JA 4MG3A 4NA9H 3ATWA 3LT3A 1BHXB 4VGCB 1V2QT 5TJXA 3CENA 5HIZA 4ZH8A 3UOUA 1C2MA 2BM2A 4KGAA 4YO9A 2FO9A 4FUCA 1FIWA 1DOJA 3EE0B 3VEQB 2ZA5A 3UNRA 2PKAA 4YOIA 3Q77A 5AF9H 3H09A 4MQAA 2J4IA 4NCYA 1C5UA 3ZV9A 5GDSH 4HFPB 2W3KA 2FX4A 2GD4B 1YPKH 1TFXA 1ZJKA 4YTAA 4ABAA 2KCAA 1ZHPA 1CGIE 1UVPA 1O2UA 3T5FH 3T27A 1J15A 3M5LA 3M5OA 5CMXH 1GJAB 1GHXH 2G4TA 2QA9E 4QT8C 1GDNA 5HM2A 2Y5FA 5AHGH 1PQ5A 1AZZA 1P2OA 1O34A 3ZVEA 2HLCA 3MNCA 3S9AA 4ZROA 1ZZZA 2J9NA 1C5WB 3D62A 4Y7BA 3QTOH 3RMOH 2HOBA 2CMYA 3QZRA 2AGIX 2J5UA 2XCNA 3TJVA 1GBLA 3DUXH 4CREA 2FP7B 1GJBB 2JETC 5C5OA 2AS9A 2ZTYA 5LGOA 2ZHFH 4O97A 2XYAA 3UY9A 2FS8A 1UK2A 1GMHG 3SNEA 2XXLA 4GSOA 5I25A 1LPKB 4IMZA 1WOFA 1LHCH 1ABJH 3AASA 2HPQH 5A8XA 2QGRA 1XMNB 1A7SA 1O2IA 2GDDA 4ZKSU 2FIRH 3C1KA 4B1TA 1EZUC 2ODQA 4VGCC 3EDXB 1GI2A 2ZGJA 1VITF 3FP7E 1CQQA 2C8ZB 1K1LA 1A46H 1EB2A 5EXMA 1MBQA 1WTHD 1W14U 2A7JA 3WW7A 1SHHB 1O2LA 2F3CE 3SI4H 5DPAA 1ABIH 4TYDA 2Z9KA 2J98B 2A2QH 4U01A 1XXFA 4RN6A 1CE5A 1QZ8A 2Y82A 2ZPRA 1K1JA 5DP5A 2BQWB 3VB7A 3A86A 2OC8A 1WUNH 3RU4T 4B71A 1G2MA 3LJJA 2A7HA 1Q2WA 1GJCB 3CS0A 1YCPM 1C1TA 3FZDA 1V2JT 3ZVCA 1S85A 3LGUA 1MBMA 1IHTH 2BDHA 1HB0B 1E0FD 3M3VA 4O9VA 1FIZA 1QRZA 4AORA 2FWWA 1MZAA 1TBQH 5KECA 2GGVB 3A80A 3TH2H 1QIXB 3PO1B 1ELAA 3KEEA 5LPEA 2NU1E 5DP6A 3E0NB 2A4GA 4X8SH 3ELAH 1L4DA 5TCAA 3A8AA 4K2YA 3DSPA 1GHWH 1LHDH 3EGKH 4H42U 1M9UA 1FJSA 1EZXC 2QYIA 9LPRA 1T4UH 3PWCA 1QB6A 4ISLA 4INKA 3GY3A 2YMSD 2R3UA 2JKHA 3RXHA 2OCVB 2BOHB 1O5GH 1AWFH 2WYGA 1KIGH 1JIRA 1TGCA 2A32A 2H2ZA 3OYPA 3SZEA 2ZGXH 1QBVH 1A4WH 1P9UA 1TWXB 3Q00A 1PPGE 5A8ZA 4HG6A 3RC4A 3RXTA 4ISOA 3PLBA 4K1EA 4XBBA 4ASUD 4E06H 1GPZA 1KY9A 1YCPK 3MNSA 1UTLM 1GBDA 4AB9A 2WPDD 1TPAE 4DGJA 3KGPA 4YZUA 2PTNA 2BDYA 1OKXA 2ZDLA 4NIYA 4FUDA 1EOLA 3ZVGA 4JYTA 3OEHD 4X8TH 2A1DB 2FOMB 1ZOMA 2AGEX 1O2RA 1FDPA 4WMEA 1NT1A 1HNEE 2ZP0H 2UWPA 4DW2U 1BRAA 4AOQA 2A5KA 1DLEA 5EXNA 2VWMA 5CE1A 1YKTA 3F9FA 1H9IE 1JBUH 4BOHA 1C5YB 1MMJN 5C1YA 3ENSB 5SGAE 3NKKA 5JB9S 1MKWH 1GHAF 4JZDH 3PO1C 1O37A 1C2JA 3V0XA 2BD7A 2FYRA 1GGDC 1BCUH 2D26C 2HVYB 4ZCNA 2STBE 1CSOE 3SHCH 1QQUA 1CGHA 3M36A 1MAYA 1O2SA 1YYY1 3A83A 4X1SU 7KMEH 1T8NA 5E0GA 1QNJA 1TNKA 4XOJA 2F4LA 5AFZH 2C90B 1Y3YA 3S7KB 3ZZAA 3LH1A 2GZ8A 2ZCKP 1BTZA 5DG6A 2OUAA 5DO4H 2QV1A 3ZYDA 1GHAG 2GV6A 1SLUB 2A4RA 4YT6H 4Y79A 1PYTD 3U9AH 2ZGHA 1O3HA 4BTUB 4CRGA 2ZHDA 5GXPA 3PLKA 1ELTA 2W7UA 1GI1A 3A7VA 1E35B 1IQMA 1NRPH 1O5EH 2ZFSA 3MTYA 4WVPE 2Q6FA 1TRMA 1W2KH 2ZFTA 1AB9B 3M37A 1PPZA 3URDA 4UONA 1S84A 2OINA 4CRBA 5A2MH 1HDTH 2XBXA 4Q7XA 3R0FA 1AUTC 1IQIA 3T26A 1B7XB 1IOEA 1YP9A 1VJ9U 2VIOA 5T1VA 1J9CH 1DUEA 3A85A 1S6LA 1TX6A 2ZECA 3A7XA 2O8UA 3VXFH 5F6MA 3SOSA 2BTCE 2CHAB 1ZTJA 3RXEA 5F53A 1ZRBA 1W8BH 3RXMA 3SO3A 5B6LA 2F9UA 1O3MA 1QFKH 2EC9H 1V2ST 5GCHG 2F9PA 2Z3EA 1UK4A 1RD3B 2B8OH 1LTOA 2GMTB 4HGCA 1P3EA 5JYIA 3ODFA 1N6XA 1NO9H 1VITH 4AYVB 3S9BA 3Q3XA 2BDIA 2AMQA 5C0TA 1Z8JB 3D65E 2KAIA 1QY6A 4Y6DA 3QN7A 1QJ6B 1DUAA 2EI8A 2NU4E 1GJ5H 1XUKA 5BPEA 1NBMD 1FX0B 1O2XA 3IITA 1EB1H 2Q6GA 3KQBA 1PPBH 1Y59T 2PFEA 2VVUA 1SLVB 3Q3KA 2GT8A 4ZHAA 4E05H 4FUHA 4RT1A 3SJIA 1KSNA 1WCZA 3PV5A 2ZKSA 2ZHQH 4PROA 1YPHE 1L2EA 2ZPQA 1PPCE 1UVTH 2B5TB 4AFSA 1HJAB 3PMAB 1GBIA 1ARCA 3DD2H 3RU4D 4OM9A 3FZZA 4NFEA 1AB9C 1EZSC 1JMOH 1GBBA 5B6OA 1F0UA 1N6YA 1W0ZU 3F2FA 2LPRA 1O2NA 2OBOA 4OGYA 3U8RH 3ZZCA 3RC5A 3QDZB 2BVSH 2KFWA 3PV4A 4YM9A 1IQJA 3BTKE 4FUIA 2FMJA 3O8DA 1AFEH 2FTLE 1GJ7B 1K28D 1EPTA 3UQVA 2I6SA 3UR6A 4WY3A 1GJDB 3SUFA 1LHGH 2BY5X 2W5EA 2H1UA 4OS2A 1Y5BT 3RP2A 1PQ7A 2QIQA 1BIOA 2CHAC 1ELBA 2C8XB 1EFRD 1H8IH 2ZO3H 2VIPA 4X2YA 5C1UA 3K6YA 2GMTC 2OLGA 4DOQA 1SGNE 1AO5A 3STIA 4AFZA 2W3IA 1EUFA 3RXIA 3RUOA 1GL1A 1AKSA 1HIAA 1OP8A 2Y7ZA 1HRTH 3FANA 4B73A 2HLDD 3M7UA 1OOKB 1MD8A 2RA3A 2BX4A 2W6JD 1C1WH 1C5PA 1A2CH 2EI6A 3BIUH 3GY7A 1WU1A 3A82A 2YMSB 1P57B 2P3FH 5EODA 1C2IA 1N8OC 1AQ7A 1WBGB 4GCHF 2ZZUH 3ATLA 5FXLA 5FPYA 1C5ZB 1GHZA 1V2PT 4X2WA 4ZXYH 1VGCB 1ZSJA 4JK6A 2GCHF 4YOGA 5IYTA 1GVKB 1UCYH 3GICB 3VFEA 1GJ4H 2NU2E 3TJOA 5EJ1A 5LPFA 1QGFA 3MU1A 3A7ZA 2B0FA 1TA2A 3GS9A 5BRRE 4TY7A 1J14A 2JJ2D 5FHTA 1NS3A 5EPNA 2BMGB 1IQLA 4TSFD 4GLYA 2VGCC 3RXUA 2EI7A 1GBCA 2ZFPH 1TGNA 1AWHB 1BJUA 3ZZ8A 3S69A 5C94A 4GCHG 1A61H 2IN2A 1O5FH 2B9LA 1GDQA 3LGTA 2ZI2H 2K1QA 5T6DA 3I78A 3LOXA 1EXFA 1O32A 2GCHG 1SR5C 1O31A 3M3SA 2A4OA 1THSH 1GJ9B 2O8LA 3RLWH 2THFB 2BY6X 3W1EA 3U1JB 1G3BA 2TGAA 1OWDA 2KX4A 3SNAA 1FY5A 1XM1A 1H8ED 3HK3B 1ELEE 4JZIA 5JBTA 3TH3H 1EKBB 2VWOA 2VIDA 3P92A 2ZG0H 1SGQE 1SQOA 1EJNA 1AUJA 3OY5U 2WPLS 1DXWA 1SGFG 2Y6TA 3RXSA 1DLKB 4XE4A 4AGKA 1NFYA 4A5TS 1LVMA 4BAHB 2F91A 3F6UH 2BLWA 3NCLA 2JH0D 2WINI 1F0TA 3ATKA 3RXOA 2ODYB 2YMSC 1CVWH 1G30B 4Q63A 3KF2A 1O0DH 1S5SA 3SYJA 1UMAH 1GHYH 3H7OA 4BXSA 1FUJA 2AIPA 1V2WT 1TPOA 1VGCC 3TU7H 2IJOB 1HUTH 2CK3D 3S7HB 4ABEA 4UFFH 1OXGA 1ELVA 3C27B 2JH6D 1FN8A 1SGEE 3ZZ3A 1F5RA 4ZMAH 1WYKA 1SFIA 1FPCH 2IPHA 1HAOH 5C20A 4CRCA 2P94A 2ANMH 3TGIE 1TGSZ 3BEIB 5T3HA 1O3KA 2GT7A 5E0HA 4JYUH 5F8XA 1FAXA 2QXJA 1NTPA 1LPZB 2F9NA 1QR3E 4MNVA 1K1IA 5JPMH 4Q2KA 1VJAU 3P17H 3M61U 1O2HA 3EYDA 4D9RA 3FOAA 4DURA 2L6OA 1KDQB 1O5BB 2BLVA 1OWEA 3DA9B 4SGBE 1F0RA 2RFKC 1P10A 3D23A 3VB4A 1QBNA 3BV9B 4B76A 4NG9H 1ELGA 1LMWB 4DY7B 3VB3A 2QC2A 1HFDA 1OX1A 1DANH 1O2VA 3VGCC 1TIOA 2BY8X 4MVNA 2CXVA 3EAJA 2C4FH 4WH8A 1CHGA 1HAIH 4ABFA 1Y8TA 3DFLA 1P3CA 3OEED 2KM0A 5DP3A 1GBJA 4A92A 3RXCA 1TABE 3V3MA 3KHVA 1MU6B 1Z6JH 1UW7A 2G00A 4DIHH 2HGTH 2FLBH 1CGJE 4YESB 4B2CA 4Y0YE 1AE5A 1F92A 1NY22 1DY8A 1Y3UA 1E1QD 1HJ8A 4I8LA 1P2KA 3SW2B 1MUEB 3A7WA 1BITA 2ODPA 1WV7H 1QHRB 1HAGE 5DJ7A 1LO6A 3HPTB 5JBAS 1RJXB 2BLOA 3K9XB 3F9GA 4ZKOU 1TB6H 4CBOA 1D3TB 3QZQA 1EP5A 2ZGCA 1SB1H 1NFXA 1TALA 2Z7FE 2BZ6H 3A8CA 3LU9B 4MNXA 4P02A 3SV8A 1BMMH 2HWLB 3LGVA 4X2VA 2VVVA 3UNSA 1NFUA 3ODDA 1GJ8B 3MWIU 1BOQA 4Z0KA 3PLPA 4AN7A 1P2MA 3QX5H 2KCOA 4A1TA 1FONA 3SJOA 3E8LA 4AC9A 2DE8A 1TOCB 1EQ9A 1VKYA 2AH4X 3M7TA 1CA0B 1KMHB 1TQ0B 2BX3A 5K0HA 3OFND 1GMHF 1BZXE 1QTFA 1DPOA 1C1QA 3H7TA 1C2KA 4WF8A 4ZXXH 1G2LA 5C5NA 3BTME 3NWUA 3S9CA 1C1SA 1OWKA 2G8TA 1UCYE 3F0PA 1D3PB 3B8JA 5EW2H 5GNDA 1PQAA 1NN6A 2Y5HA 6GCHG 1UTOA 4CH2B 4X6OA 1Y3XA 8LPRA 1HV7A 3RXBA 1TMUH 1WTGH 5IDKA 3OY6U 4Y76A 1C5LH 1GI0A 1TPPA 3GCHB 2GZ7A 1MKXH 3PYHA 4OS4A 1V2KT 1YLDA 4BAOB 1G32B 1QA0A 2OC7A 1WSSH 1T8LA 1MAXA 1ZHMA 1GI6A 3MNXA 4J2YB 3PROA 4X6NA 2W6ID 2Z9JA 1ZHRA 1O2GH 4ESTE 3F2HA 1J16A 1WQSA 4ZUHA 5EPYA 1NRRH 7LPRA 1OHHD 1ZLRA 5FCKA 1YPJH 4IS5A 5F8TA 3SU5A 4I86A 3OSYA 3HATH 3TPIZ 3BTFE 1AFQB 2UUJB 3KNXA 4D9QA 3L6PA 2ZHEH 3RXKA 2G52A 1SGFA 3PWBA 2HNTC 3NXPA 3QGJA 1SL3A 3NK8A 3EBNA 4FXGH 1PQ8A 3RXFA 4ISNA 1C2LA 1CT2E 1FQ3A 1CA0C 2VIVA 1A1RA 2CJIA 3MO9A 3A81A 2HPPH 1LDTT 2F43B 2OC0A 1O36A 1V2VT 2J98A 1RTKA 1BQYA 2BYAX 5A09A 3HKJB 1KXFA 5EQQA 3OAAD 3RMNH 1MTVA 1ZYOA 2WHXA 1BBRH 1ZTKA 1V2OT 2TBSA 2BY9X 1GJ6A 2VIQA 1NC6A 3FVFB 3LPRA 1TONA 3UNQA 3GCHC 2OQ5A 5FPSA 1TNLA 1SC8U 1VCQA 1P11E 2PKSB 2ZCLP 3PRBA 4X8VH 4UEHH 1PPHE 2ZWLH 3WWFA 3SV9A 4CR9A
chains in the Genus database with same CATH topology
2A0QB 1D4PB 2ANWA 3UREA 2PSXA 5HYOA 1LVOA 3SORA 1F5KU 1T8MA 3ZZ9A 4I8KA 3UPEA 2ZPSA 4MPWA 1O2QA 1YGCH 3BG4B 1G36A 1O3EA 1ESAA 1KXEA 3UR9A 1UHBB 2BD5A 4Y0ZE 3AAVA 1GI8B 1OWHA 3RXRA 1AFQC 3BN9A 1AD8H 1ZJDA 1EOJA 1GI5A 2QAAA 1CA8B 3BEFB 4TWYA 1L1JA 4IBLH 1H9LB 1O35A 1Z8IB 2SGFE 1AY6H 1ACBE 3K65B 4U32A 2AEIH 1SVPA 1L1GA 2PWXA 2PUXB 2BQ7B 1C2HA 1INCA 2VH0A 3MU8A 1YC0A 2SGDE 1OPHB 5DKMA 3MYWA 2NU0E 1C2DA 4MPUA 3RU4E 4UE7H 4M7GA 3QK1A 1EAIA 1S0QA 2UWLA 2H9HA 5A8YA 2V3OH 1W7XH 3SUGA 3AW0A 2WPJS 3FP6E 3MH4A 3V13A 3E91A 2GV7A 1Y5AT 1P9SA 1ESBA 4DG4A 4RKJB 3GCNA 4AFQA 3U8OH 1O2YA 2ZHWH 5FBEA 1O39A 1HXFH 2H9TH 3E3TA 1HYLA 2M5TA 4O3TA 4X1NU 3VXEH 1S81A 5GWZA 2J34A 1K2I1 1EZQA 1W7GH 2C8WB 2OC1A 5EQSA 1YLCA 4NZQA 1HAZB 4LZ4B 3HGNA 2FI5E 2OD3B 5DGJA 1GVLA 4ABBA 1TBZH 1SLWB 2D2DA 1S6FA 2SGAA 4J1YA 3SJ8A 3SV2H 1LQEA 2Z3DA 1O5DH 3LC5A 4FUGA 2VINA 3EQ0H 5GCHF 1KLTA 3MH6A 1K9OE 3KQCA 1JRSA 1KLJH 1NM6A 4KELA 4CR5A 1IQKA 3IG6B 3E90B 2Z3CA 1W0YH 1NRQH 2ZDNA 1ZMNA 3GDSA 2VNTA 1MCTA 4DIIH 1EAXA 2BDCA 1AIXH 3KCGH 1BB0B 1SGYE 2FPZA 5ESTE 3MOCA 3TITA 3KQEA 5HMAA 5L2ZH 1SOZA 3LH3A 3RM0H 4JCNA 4GPGA 1DT2A 3MFJA 4WXIA 2RG3A 2GZ9A 3LGIA 2RDLA 1JXPA 3PMBB 2RA0A 1OYQA 1AI8H 1ZPZA 5FX6A 4MPXA 2FESH 3CP7A 2PHBA 2FX6A 1HLTH 2G4UA 1Z8RA 4B2AA 5DK1A 1Q3XA 2JH5D 1BRCE 1FZZA 2ZFQH 3ESTA 1G37A 6CHAB 1BDAA 3T62A 1O33A 9ESTA 2H5DA 3QGNB 1X7AC 2ZEBA 3SHAH 3P6ZB 5C2ZA 3BSQA 2PGBB 2BD2A 1FPHH 1XKAC 1MTWA 1XUIA 2K7XA 4BAQB 2Y81A 1O2JA 5C1XA 3V12A 1W13U 4H6SB 1N1LA 4LOYH 4AGJA 1BBRE 2ZU5A 2QXHA 5FBIA 1BRBE 1VCPA 3GY2A 1O2ZA 1NZQH 3TNSA 1F0SA 4X1RU 4JK5A 4B2BA 4NA8A 1UVSH 4CBNA 1UVUH 5CHAB 1C1MA 1P04A 1O2KA 1KXBA 3BTTE 3UTUH 1FNIA 2SGEE 4KTSA 4NWLA 3LGWA 1UK3A 1K1NA 1O2WA 3TIUA 3RXQA 2XBVA 4IW4E 1DSUA 2PGQB 1C1OA 1ZSLA 3ZVFA 2DUCA 4ZHMU 2VH6A 3GDVA 1E38B 1IQFA 3BTWE 3TJNA 1GL0E 3SU2A 1YPMH 1BHXF 1AU8A 1XXDA 4NSYA 2PV9B 4XFQA 5TCCA 1CHOF 5FAHA 3PTNA 2A5IA 2BZAA 1O3OA 2BD3A 4BANB 1T31A 1P2NA 2FOCA 1V2LT 5EOKA 1ARBA 3TVJB 1O5CB 4A6LA 1K22H 5L30H 2AGGX 3VB6A 1TYNA 6CHAC 2HNTF 1O3LA 1FI8A 1TBRH 2J92A 1PPEE 1YF4A 1DX5M 1ANEA 1QL7A 3MU5A 1RTFB 1CHOG 5ETXA 2J94A 1AHTH 1HJAC 2Y5GA 1TNIA 2WV5A 1OP0A 4NIXA 3MU0A 3BTHE 2O8TA 3U69H 2FYQA 1OP2A 2ZU4A 3P8OA 3MU4A 4R8TB 2TGPZ 3MO3A 1PFXC 5CHAC 5H4IB 1MCVA 2QXIA 2Z9IA 2GP9B 5EU8A 1DDJA 4Q7ZA 1AVWA 1O38A 3RDZA 3URCA 4FUFA 1BMNH 4JYVH 1O3PB 2WPKS 1VCWA 1BMAA 4K8YA 4Y71A 5J4SA 1V2UT 2Z9GA 1GBMA 6ESTA 2WYJA 2VB0A 3BG8A 1EJMA 2FLRH 3ZZ6A 1MKWK 4AFUA 1BRUP 3F1SB 3M3TA 3JZ1B 2XC5A 1C9TA 1THPB 3SV7A 4A7IB 1NRNH 1O3IA 1TRNA 1O2MA 1C4V2 3GCTG 4FUEA 3D49H 2A45B 2ANYA 2BVXH 5E2OA 4LZ1H 3SJ9A 3B9FH 1ELCA 3KIDU 2XW9A 1ESTA 2A4QA 1G3EA 4FVDA 4O3UA 4FUBA 1NRSH 1ANCA 2A7CA 4ASHA 1BT7A 1O2TA 4X0WU 4X8UH 5A0AE 4AZ2B 2Z9LA 1ETSH 1FMGA 1HAHH 4E7NA 1Y5UT 2FOHA 3ZVDA 1BTPA 3MMGA 1JWTA 1S83A 3DHKH 1EAUA 1MZDA 1W3CA 1Z8GA 1O30A 5HM9A 4Y10E 2P16A 1QJ1B 4K5ZA 1OS8A 3ZVBA 3K2UA 1EP6A 3RXLA 8GCHF 3BEUA 1H8DH 5K7RA 1FY4A 2EEKA 1W10U 2ZTZA 1NROH 7GCHG 1TNJA 1LHEH 4BAMB 1FY8E 2TRMA 5JB8S 1DWBH 1Q31A 1SGTA 1SQTA 4YLQH 2ANKH 1OSSA 3AAUA 3SQEE 1XUJA 3HGPA 3DFJA 1SGDE 2WV4A 8GCHG 1DFPA 1TMTH 3STJA 2XWAA 4OS6A 3SU6A 5A0BA 4GAWA 2V0BA 1MTNB 2F9OA 1QL9A 1S82A 2W26A 2ILNA 1BMLA 2AYWA 1QQ4A 5EGMA 1YM0A 5DP9A 4GHQA 4NZLA 1ZR0A 3O8CA 1QURH 1BUIA 2ZF0H 1V6DA 1KDQA 2A5AA 2ZDVH 4YT7H 3R3GB 1UTNA 1YCPH 2BY7X 1A5IA 1CT4E 3TK9A 5T6GA 1SOTA 1AGJA 5EQRA 2XBWA 2GDEH 4TPIZ 1DM4B 2Z6BD 3O8BA 4XBDA 1C5VA 1XUGA 1GMDF 1RTLA 3G01A 3ATIA 3ITIA 1PPFE 4X6PA 2G81E 1H4WA 2CV3A 4MTBA 2ZQ2A 3LONA 4AX9H 2Q6DA 1UTQA 2FM2A 1L0ZA 1LKAA 1ZTLA 1P01A 3L3TA 1ANBA 2W7SA 2ZGBH 2FOBA 1TLDA 1ELFA 1BTXA 1NFWA 3P8NA 4TWWA 4MNWA 1GMCF 2XC4A 4GUXA 3BTDE 1MU8B 1BA8B 1HAXB 1GMDG 1Y3VA 2ZDKA 2PKAB 4SGAE 3ZZ7A 3MNBA 2TGDA 3A7YA 4DVAU 4KKDA 2OXSA 2BDGA 2R2MB 3RM2H 3SU3A 4A1XA 1GI9B 4Q80A 3SNDA 2QF3A 6GCHF 1T4VH 3U8TH 1Z71A 4FU9A 1Z1JA 1L1NA 1SPJA 5JBBS 1C5TA 2F9BH 3FP8E 3H5CB 3V7TA 3UQOA 5DP7A 3TGJE 1KYNA 1MTNC 4U2WA 1GMCG 2BOKA 2FZZA 3SNBA 8ESTE 1FY1A 1GI3A 4D8NA 3MI4A 3TNTA 2AERH 1DXPA 3PTBA 3M5MA 2BD8A 1TMBH 2WPHS 1E36B 2QXGA 5AVDA 1QJ7B 1TA6A 1O3NA 3SN8A 2ZFRH 1KLIH 1S0RA 2CN0H 3DT0H 1D9IA 4CHAB 1ZSKA 1GDUA 3SGQE 4IN2A 2C3SA 2VU8E 5EXLA 4CRDA 1V2NT 2XNIA 1AN1E 2BVRH 3QUMP 2XRCA 2F83A 3LC3A 4B74A 1A5HA 5EG4A 1B0FA 4B75A 2R2WU 2TPIZ 1GBAA 3RMLH 3NUMA 3EA9A 2Y80A 1C2EA 1UCYK 3BF6H 3TK5A 2FXRA 2P95A 3A87A 1F7ZA 4LK4A 4I8GA 3SGBE 4K1TA 1TQ7B 1V2TT 1TNGA 3CS7A 4F49A 2O8WA 2SGQE 2P3TB 2ZU1A 5L2YH 3BTGE 1P2IA 1O3BA 5EW1H 1UTKA 3QO6A 1YPGH 4CRAA 5F03A 1A0LA 3OX7U 1LPGB 3ZV8A 2QCYA 1J8AA 1O2PA 5I46H 2B7DH 3TLOA 1O3CA 1QL8A 1ZMLA 3SUEA 1GCTB 1GI7B 1OYTH 3MHWU 1AMHA 2ZIQH 3RLYH 2G5VA 3GYMA 1EJAA 3T28A 3SU0A 1GBTA 4I31A 1CU1A 1DE7H 1O3FA 3TH4H 1KTTB 1DICA 4KTUA 4GHTA 1RXPA 1ETTH 2XCFA 2NWNA 2ASUB 4DJZB 5AFYH 1C5SA 1C5XB 1GBHA 1LVYA 1A3BH 1EASA 1NESE 6LPRA 4D7GA 1P05A 1VZQH 4CHAC 1MQ5A 1VITG 1BTWA 2PW8H 4MNYA 2GVFA 1Z6EA 5JDUB 4ISIH 1RFNA 1HAPH 1KXAA 1V3XA 1RIWB 3EA7A 1C4Y2 2SGPE 1U6QA 2Z94A 4Y8ZA 4IC5A 1GBKA 4XSKU 2BDBA 1FAKH 3UWJH 4IC6A 4NIWA 3KL6A 1XVMA 4BTTB 1YBWA 2QF0A 3M5NA 4I33A 4WJG2 1ZGIA 1XVOA 3RXAA 4BNRA 2ZTXA 1XX9A 1A0JA 4AG2A 1AE8H 1LKBA 1GGDB 5C3NA 3HKIB 2PUQH 4A1VA 2UUKB 1ZGVA 3MO6A 3SZNA 1HXEH 1O3AA 4BXWA 3U98H 4R0IA 3A88A 1YPLH 1D3DB 1DS2E 1SBWA 1E37B 2ZFFH 4CH8B 4U30A 3O8RA 2UWOA 2WUCA 1GCTC 4I8HA 1XUHA 2J95A 2VWLA 3SNCA 2PR3A 1YPEH 1TX8A 4UFDH 1C9PA 1UHBA 4ABDA 1BTYA 2H5CA 2FODA 4BTIB 2OP9A 4FU7A 3GY5A 4X1PU 3ZZ4A 3PB1E 1QCPA 3S0NA 3GY4A 1C1PA 2J38A 2OTVA 1F5LA 3KN2A 2FOEA 1JIMA 3NPSA 3SU4A 5GJ4B 1ZMJA 2VWNA 5GIBA 2WUBA 2BLQA 3QWCH 3HK6B 4MLFB 5DP8A 4RSPA 2HVXA 1ID5H 1Z7KA 3KQDA 1GVZA 1C5RA 1W12U 4MDSA 1P2QA 1RIWC 2YNAA 1XKBC 2PKSC 1YPHC 1DWEH 1QA7A 1TE0A 4OS7A 2FI3E 4JZ1A 1TGBA 4Y11E 3Q3YA 4TPYA 4Q7YA 2LNCA 2FTMA 2HNTE 3K6ZA 2FEQH 4IGDA 1P2JA 5FX5A 3VPKA 3MH5A 1VR1H 2PTCE 5ESBA 4IN1A 3W95A 4O03A 4CRFA 3BG4C 1A5GH 3OTJE 1ETRH 4Z6AH 1T8OA 2STAE 1C1VH 1F2SE 1SFQB 2A31A 1UTPA 3A7TA 2A2XH 1NPMA 3GISB 3F9HA 2CGAA 2XWBI 1S6HA 2FOAA 3LJOA 2ESTE 1JOUB 2P3UB 1UO6A 1TRYA 1HAVB 4INLA 4I8JA 5GPIB 4AB8A 4X2XA 2PSYA 2P8OB 1NU7B 4KTCA 3ZYEA 2ALVA 3UOPA 1PJPA 5T6FA 2SNVA 1HAVA 3T29A 1DY9A 1V2RT 4Y8XA 4GVUA 2AMPA 1C1UH 3GY6A 2EA3A 2YNBA 3GOVB 3MH7A 4YLUA 3P8GA 3LIWA 3M7QA 2ZQ1A 2V3HH 1MKXK 1C1RA 4JMYA 5JBCS 2RCEA 2V6NA 4DT7B 1W11U 4NA7A 1J17T 2O8MA 1MQ6A 4ISHH 2GCTB 2BXTH 2ZDMA 1K1PA 2KAIB 3P95A 1UTMA 4ZKRU 1QB1A 3FFGA 1A0HB 1LVBA 1P12E 3UFAA 1IQNA 4WWYA 1WQVH 2J2UA 2LIZA 4ABJA 4X6MA 5E8EH 4NIVA 4ABGA 1K1OA 1GHBF 5HXFA 5HGGA 3TK6A 2BB4A 1ELDE 4F4OC 1RS0A 1SMFE 1P8VC 2HRVA 4AG1A 2VIWA 4UD9H 1CBWB 4TY6A 4DCDA 2QY0B 2R0LA 2TIOA 1HJ9A 1SGPE 4K8BA 1H9HE 2CF8H 3TJUA 2SNWA 1B5GH 2P8OC 2I6QA 1BTUA 1SLXB 1EPTB 4FUJA 3E6PH 1GHBG 1N8OB 5FPTA 1UJ1A 2DE9A 3BTQE 1BBRK 1GBEA 1TX7A 3BTEE 3TGKE 1GI4A 1P03A 4Y8YA 1V2MT 3E16B 1AZ8A 2ZC9H 2VGCB 3I77A 1GHVH 2GCTC 1H1BA 3LKWA 1OWIA 2VJ1A 1TNHA 3SGAE 1RRKA 4H6TA 3M35A 2ULLA 1ZPBA 2YOLA 4IMQA 1DWCH 1AKSB 1HIAB 2D8WA 4THNH 2PLXA 4KP0A 1CO7E 1FY3A 5FCRA 4XDEA 4NWKA 3UUZA 4ABHA 3ZZBA 2ZU2A 4HI3A 1T32A 4H4FA 1TGTA 3U1IB 3SU1A 1IAUA 1HGTH 2GX4A 1CBWC 3UIRA 4WH6A 1K21H 3UWIA 3E0PB 4WMFA 4HTCH 3RC6A 1QB9A 3Q76A 2UUYA 2Y7XA 3T2NA 1GCDA 3B23B 1EAWA 1SHYA 1THRH 3LDXH 3PMHB 2R9PA 3A84A 2R3YA 2IOTA 4FU8A 1KTSB 3A8DA 2HALA 8KME2 3W94A 4XBCA 1BTHH 1SGCA 1EPTC 3GCTF 3EA8A 1DVAH 3SBKA 2VVCA 1OWJA 1C5OH 1GG6B 1D3QB 5LH8A 1MD7A 1DWDH 4UDWH 1SI5H 3VB5A 1O3JA 1ORFA 2BXUH 4E7RG 1EX3A 4LXBH 2OQUA 2C93B 3PMJA 4K3JA 2P93A 2G55A 4JZFH 3RXGA 4AYYB 4X1QU 3RXJA 1G9IE 3FAOA 2XC0A 4OS5A 3AVZA 3RXDA 1FXYA 4WXVA 3SV6A 4FVBA 2BDAA 2FS9A 3GCOA 2D1JA 4UFEH 2C8YB 4Y7AA 1G3CA 3QTVH 1ANDA 3I29A 4HZHA 4RKOB 1DITH 1LHFH 3WY8A 2O9QA 2ALPA 2AFQB 2ZDAH 5G4BA 2BD4A 5ABWA 1UVOA 4ABIA 3P70B 4NGAH 3ZZ5A 1HAYB 7GCHF 3SJKA 3RMMH 3NZIA 3SQHE 1UTJA