1Q2WA

X-ray crystal structure of the sars coronavirus main protease
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
295
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nonstructural polyprotein pp1a
publication title X-Ray Crystal Structure of the SARS Coronavirus Main Protease
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 88
structure length 295
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1q2wA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA02
2AFQB 1D6WA 3H7OA 3LOXA 1P03A 4XE4A 1DPOA 3VXFH 1TAWA 2XYAA 3F9FA 2BMGB 1BTHH 5HGGA 2Z9LA 2A7HA 1GI6A 2CGAA 3E8LA 4X1PU 1GI0A 4UFEH 1Y3WA 1GBTA 1GBLA 5HMAA 1TIOA 4IC5A 1EZQA 2XNIA 1BT7A 1UTLM 3M5OA 4ESTE 1LCYA 3BTWE 2Y7ZA 4X2WA 1CT0E 2GV6A 3QGJA 1LVMA 1MQ5A 2H9TH 1D3TB 1NC6A 4A5TS 3ZZAA 1RRKA 2G4TA 3MH5A 3Q00A 2OBQA 8ESTE 2EC9H 2QF0A 1XX9A 2F9VA 3M5NA 1ZRBA 1EOLA 1IQJA 1QNJA 2XC5A 5F03A 2R2MB 3V12A 3SNAA 2R9PA 1TB6H 4MPUA 3RXFA 4A1VA 2P8OB 5EXNA 1C5VA 3OY6U 1C9TA 1QY6A 1V2ST 1ZZZA 2C4FH 1P2QA 2PSYA 4MNVA 3K6ZA 1GBFA 1YC0A 2ZHFH 3P8GA 1QCPA 3BG4B 3H7TA 3TIUA 3OSYA 2OC7A 2FZZA 2VIDA 3EA8A 4X2YA 2Y82A 1P2NA 2B8OH 3LGUA 1RD3B 1TX8A 5EG4A 2BY5X 5C67A 1UK4A 5HYOA 4ZKSU 3KL6A 3L6PA 1EZXC 5GXPA 3E1XB 1VITG 5EW1H 4WJG2 4Y79A 4MLFB 1B0EA 1QJ6B 1RFNA 1UTPA 4AG2A 4BAQB 3UTUH 1QRZA 2LNCA 5FCKA 3BSQA 1FMGA 1AFQC 1CBWB 1SR5C 2BD5A 4UFFH 3Q76A 1O0DH 1G2MA 1SPJA 2Y5HA 1TRMA 5GJ4B 1BTXA 1FXYA 3GCHC 3A7ZA 1OP0A 2PGQB 1A3EH 1QIXB 2B0FA 4MPVA 1FN6A 4UFDH 4BOHA 1S5SA 5AVDA 2ZCKP 3IWMA 1CE5A 1O2JA 1UTQA 1CQQA 3FZDA 4O3TA 2F9NA 4NA8A 3Q3YA 3V0XA 1FAKH 1S85A 2ZFRH 4Q2KA 1C5YB 1C5RA 3M7UA 1HBTH 2C8ZB 2XTTB 1UTKA 3ATLA 3OY5U 1BTPA 4PROA 1OWJA 1SHYA 1TQ0B 2XBYA 4OS5A 1WSSH 1LVYA 1SGTA 1YCPK 1MKXK 1V2QT 1EX3A 2OUAA 5JBBS 1DXWA 4H42U 3S9AA 1KXBA 1HIAB 1QQ4A 1FUJA 1ZMNA 2VNTA 2AGEX 3ZVDA 1V2JT 1Q2WA 1EASA 1MTNC 1GHAG 2BZ6H 4NGAH 1EUFA 2Q6FA 2PR3A 2AS9A 1VITF 3F9GA 1PPBH 2P3TB 4ZXYH 3A87A 1AD8H 5CHAB 1O2WA 1CO7E 1ZSJA 4Y7BA 1Y5UT 2KAIB 3LH1A 1YPEH 4XFQA 1SL3A 1T8MA 3STJA 2GV7A 2HOBA 1DLEA 1V2RT 4WH8A 1H9HE 1SB1H 1AE5A 5DK1A 2ZPRA 3ZZ6A 1P2MA 3FP6E 4K3JA 3UOUA 1SSXA 4ABHA 2BDBA 2BYAX 3TJNA 2QIQA 3RLYH 1ABJH 5DP7A 3FAOA 3UPEA 1A2CH 4WH6A 3SU3A 1AQ7A 1ZTJA 3KQEA 4RN6A 1YYY1 2BVXH 1C5SA 2WPHS 1GGDB 3A83A 3PMAB 3AASA 1O3OA 1TWXB 2G00A 2JKHA 1GBAA 4ZH8A 4XBCA 2Y81A 1GCTC 1AWFH 4IC6A 1QGFA 3F68H 1BMAA 3FP8E 4NA7A 1AKSB 1GHAF 1GJ7B 1TRNA 3U9AH 5HM9A 3K65B 4KGAA 5EXLA 1EJMA 3LGWA 1P10A 2ASUB 4YOJA 4ZMAH 2Z9JA 2SNWA 1GJ5H 3SV7A 1O3FA 9ESTA 3VXEH 1Q31A 3RMMH 4H4FA 2ZC9H 3RP2A 2H2ZA 4LZ1H 1DVAH 1G32B 1GBEA 1OP2A 2V0BA 3E6PH 2ZGXH 5L2YH 2ZCHP 2I6SA 1W13U 3SUDA 3UWIA 4D9RA 4DURA 1C1UH 2ZDAH 1BTYA 1O3NA 1KSNA 4ZUHA 2P3UB 3QK1A 1GI5A 5A0CA 2J95A 4YOGA 2G51A 3Q3XA 3DFLA 2NU2E 3ZZ7A 3V3MA 1YPGH 4FUCA 2ALPA 2GT7A 4ABFA 1SGEE 1XUGA 1L1JA 1QB9A 2C8WB 4ABGA 1P2IA 5EW2H 1A5IA 2D8WA 1F0RA 4Y6DA 1CHOG 1C5UA 5E2PA 2FP7B 2NU3E 3EE0B 4Y0YE 1TALA 3T26A 2BDIA 3TH3H 1VGCB 5JBCS 1OWHA 1E36B 1AFQB 1MKWK 2UUJB 2BY6X 2Z94A 3HATH 3SN8A 4BTIB 5LGOA 3LPRA 1CA0C 1NRQH 1TPAE 3ZZ4A 4TWWA 1NFXA 1P05A 1DANH 4A1XA 2VWNA 1CVWH 1EB2A 3DUXH 4CBNA 1ID5H 4ZROA 3BTME 1ETRH 3VFEA 1XKBC 4KTUA 3KHVA 2HALA 4VGCB 1WTGH 1DUAA 3EGKH 2VGCB 4OS6A 3U8RH 2BLQA 1MU8B 1DXPA 3RXJA 4NA9H 2BD9A 4D8NA 1C5QA 2P59A 2R3UA 4IN2A 3LH3A 2PKSB 3SJKA 4WMFA 3RU4E 1DDJA 1QQUA 1QBVH 3D49H 1RTKA 1AI8H 1O30A 4I33A 1P9SA 2W7UA 1PFXC 2YOLA 3H5CB 1EKBB 3R0FA 3P92A 1V2UT 4FUJA 2Z3DA 1CHOF 3ODFA 1GHWH 2ZCLP 1ZYOA 2JETC 1AE8H 3RC4A 4FUBA 1GDQA 4ABEA 3SO3A 2FESH 4FUGA 3SJOA 3ODDA 5A8YA 2UUYA 1WV7H 3NCLA 1O3PB 1H8IH 1PPGE 1NU9A 3EYDA 1GG6B 2J9NA 4IN1A 1ZMLA 4CRGA 1ANCA 2QXHA 1EAXA 2EI6A 3W95A 1SLUB 4AB9A 3GDSA 2CXVA 1EZSC 1G37A 2ANKH 3BTDE 1MQ6A 5ABWA 3SZNA 1C1QA 2CV3A 1QA0A 3HKIB 1ABIH 2WPIS 1GVZA 4K5ZA 5GDSH 3F1SB 4FUEA 2SGQE 1GHZA 1F7ZA 1G9IE 1Z1JA 1NRRH 2V35A 2H5DA 3SNEA 3RXIA 3SGBE 1S83A 4JYUH 2BD4A 4CH2B 3V13A 1TBRH 1TLDA 3NWUA 2C93B 2KAIA 2FMJA 2G5VA 4B71A 2ZPQA 4ISIH 5DG6A 1NTPA 1K28D 2XBWA 1QHRB 3ELAH 1YKTA 2QYIA 1FONA 1MH0A 3UQVA 3ZZ5A 2J92A 4DY7B 3P6ZB 3SJIA 2G4UA 2PV9B 1QB1A 3QZRA 4X8SH 1GVLA 2PWXA 3MU1A 1JIMA 8KME2 1ARBA 1AVGH 3U8OH 1WAYB 1NY22 2P8OC 1EAUA 2G52A 1HJAC 1UHBB 2K1QA 3P95A 2ESTE 2QN5T 2ZU3A 3F9EA 2QXJA 3ZVFA 2GDEH 4KP0A 3QDZB 4U30A 1LHEH 1O2VA 2V3OH 1OXGA 4JCNA 4MG3A 1GJ9B 5SGAE 2J4IA 1FY3A 2A4GA 1GL1A 1TX6A 7KMEH 2CHAB 4WWYA 1VJ9U 4A1TA 2A0QB 2J38A 4Q7ZA 1H1BA 1O2UA 4Q7YA 1BOQA 2JH5D 1O5DH 4FU8A 1O38A 2GZ7A 4NSVA 1MTUA 1ORFA 2BLVA 4TWYA 1HXEH 1OX1A 3N7OA 3NPSA 1QRWA 3ZV9A 1G36A 2FPZA 3TGIE 3SUGA 1TNJA 4HI3A 3SQHE 3RM0H 1H9IE 2AGGX 3ENSB 1AFEH 1BJUA 1WYKA 4X8TH 3TU7H 1OWDA 1NS3A 1O3AA 4X0WU 3UUZA 1SOTA 2XCNA 4GHQA 1P11E 2BOKA 1D9IA 1W11U 1ELBA 5C5NA 1WQVH 3DFJA 3TVJB 4WF8A 1WUNH 5JB8S 3A8CA 4CR5A 1GBHA 1UTJA 2W7SA 1NFWA 1O2RA 1SQTA 4MTBA 1SC8U 1SBWA 1UCYH 1V2WT 1DUEA 1Q3XA 1MTWA 2GZ8A 3SV9A 4XDEA 1UO6A 3AW1A 1P8VC 3F6UH 5HM2A 1OWEA 1A3BH 3QN7A 3SJ9A 3ZYEA 4DG4A 2VWOA 1DX5M 2BM2A 2JETB 1F0UA 4ZHLU 1FJSA 5CHAC 1GJCB 4K1SA 1MZAA 2BVRH 3SNBA 2XW9A 3PV4A 1M9UA 2C8XB 3SV8A 3RXTA 2Y80A 3P8OA 3MOCA 4MQAA 3A82A 2PKAB 4I8GA 5LPEA 5A0AE 3UREA 5L6NH 1T31A 1Z8RA 5IYTA 3EQ0H 1PPEE 1TPOA 2A1DB 1UCYK 1MAYA 2BD8A 2ZHEH 4X1RU 4D7FA 2ZHQH 3ESTA 1EPTC 1S6HA 2H6MA 2J34A 3O8DA 3MO6A 1ESBA 1UCYE 2XC4A 2ZIQH 1UVTH 1UTOA 2QF3A 1A4WH 2WV4A 1C2DA 1K22H 4CRBA 2OQUA 3RXQA 1KXDA 3D23A 1GGDC 1PPCE 2O9QA 1VZQH 2BLWA 3U8TH 1QJ7B 1BUIA 1YPMH 3MU8A 4CRFA 4OS4A 1V2OT 3QUMP 2P95A 3JZ2B 4NG9H 2Q1JA 1C1RA 5C1XA 1ZPCA 2G5NA 3R3GB 1K21H 4MDSA 1ZMJA 1AU8A 1PPHE 2BY7X 1C5OH 1EP6A 2VWLA 1C5LH 1MAXA 2IN2A 3MTYA 3G01A 4E7RG 1HFDA 3BEUA 4Q7XA 1PYTD 4YLQH 5TCCA 3UR6A 2ANWA 1O31A 2QAAA 2FLRH 1TA6A 3RC6A 2Y7XA 4Y8XA 1HYLA 1GWAA 3BTTE 3S69A 1QURH 3T62A 2ZPSA 4Z6AH 5JBAS 4MNYA 5EPYA 1TNIA 1RGQA 3GDUA 1EATA 1K1LA 4AFUA 2ZTYA 3FFGA 1GHYH 2TBSA 5FX5A 1Y8TA 5JBTA 1HJAB 4E05H 1EXFA 1SGCA 1SGNE 1HUTH 1TE0A 3K2UA 1O2QA 1ZTLA 1EAIA 1ZHMA 3LONA 4B74A 1XMNB 1V6DA 3GYMA 2QY0B 1SLVB 1EZUC 4JK6A 2JH0D 3RXDA 2ZU2A 1IAUA 3RXKA 5DJ7A 3SJ8A 2ZDKA 4I8HA 5ESBA 2RA3A 1F5RA 2P16A 1K1MA 1GJAB 4AGJA 8GCHG 5JPMH 1KY9A 2FLBH 3JZ1B 1Y5BT 1YGCH 2EI7A 2HLCA 1F0SA 3MH4A 1VGCC 3KN2A 1ZHRA 3TK6A 1YCPH 1E37B 1MKXH 1H4WA 3HK6B 3ZVAA 1UTNA 2HNTE 4O03A 1OS8A 3SU1A 1D3QB 3RXPA 4UD9H 1BA8B 1IQIA 1S82A 1BHXB 2GDDA 3PROA 1MBMA 1JXPA 5FHTA 1K2I1 1TMBH 3MH7A 5T6FA 1UHBA 1L1GA 3SBKA 3LC5A 3SORA 2W3IA 4VGCC 3SV2H 2BTCE 1JRSA 2YNBA 2SGFE 2VGCC 3SGQE 4FUDA 2ULLA 1ZJKA 2XXLA 2OLGA 3TNTA 1P02A 2GVFA 2PKSC 1TPPA 2HVXA 1O3HA 2VJ1A 2Z3EA 1ZSKA 1K1JA 2OC0A 1MD8A 3CENA 4AN7A 1O2TA 1KDQA 2GKVE 3M5MA 1ELCA 1FIZA 1O3BA 3SNCA 5LPFA 1ZPBA 4Y8ZA 4ZKOU 1V2NT 1GBKA 3SI3H 2FOMB 4YZUA 4IMZA 8GCHF 3MWIU 1RXPA 1C5PA 1YLCA 1TBQH 1BB0B 1INCA 4B2BA 1C1NA 1O2HA 1ZHPA 1F5LA 2AYWA 2R0KA 4X6PA 3WY8A 1KIGH 1GG6C 1K1IA 2F9UA 2ZNKH 3RDZA 1OKXA 1Y3UA 2FOFA 1SLWB 1SGRE 3HGNA 1C2MA 4FVDA 2ZP0H 2XRCA 2DUCA 3LGVA 1EPTB 3U69H 5DP5A 2OINA 7GCHG 1W8BH 2VIPA 1MU6B 2XBXA 4AZ2B 2AMQA 3LJOA 1MTVA 1DE7H 2OXSA 3STIA 1L4ZA 3EA9A 3A84A 1SFQB 4NZQA 1KLJH 2RG3A 2JH6D 4AX9H 1AVXA 1GI4A 1QR3E 2BDCA 4IMQA 2VVCA 1AMHA 3LC3A 4BTTB 1W3CA 1BZXE 2AH4X 3CS7A 3RXRA 3TLOA 1CA8B 2HRVA 3KGPA 2XBVA 3RLWH 2F9PA 3AW0A 4ABBA 1AN1E 3RMLH 3F9HA 4YM9A 1ELFA 1TONA 1MTSA 3TGJE 3OTJE 3E91A 4JK5A 1BBRK 3M36A 4AFSA 1O2SA 1KLTA 2VIWA 2XWBI 1QB6A 1YCPM 1LPKB 2ZHDA 1BBRE 2AEIH 2PKAA 4ISOA 1O3LA 2BB4A 5C2ZA 4ABDA 3SUEA 2A5AA 5E2OA 1XKAC 4RKOB 1DWEH 2H1UA 4DOQA 2VIVA 2A2QH 1D3PB 4IS5A 1SGFA 1A61H 3AAVA 3AVZA 1O3JA 1THSH 2I6QA 2O8TA 5GPIB 2GCTB 1O36A 4BAOB 1TMUH 2ZO3H 1MKWH 2TGDA 5DPAA 4LZ4B 4ZXXH 4I8KA 1IHTH 7GCHF 3SNDA 5DP8A 3ATIA 4OGYA 1GMDG 2F9OA 4B76A 2DE8A 4TY6A 2CHAC 1LPZB 2A45B 4AFQA 1EJAA 1A0LA 1TNLA 3L33A 4FXGH 2ZZUH 3VB3A 1MCVA 1O5BB 2G81E 1C1PA 2QV1A 3B9FH 1BTWA 3RXBA 3SQEE 2ZFPH 1C5TA 4ZHAA 1BMLA 9LPRA 2BZAA 1D3DB 1OYQA 3M35A 1F0TA 1V2LT 2ZA5A 1QFKH 3A8DA 2TGAA 1DITH 2B5TB 1ZOMA 1RIWC 4FVBA 1NFUA 1C5MD 1ZGVA 4X8UH 4WVPE 2Q6DA 1ANDA 5K7RA 3BIUH 4UE7H 4D76A 1AWHB 1DLKB 2P94A 1SG8B 1NPMA 2A5IA 1P06A 1BMNH 2BY8X 2XC0A 3FP7E 2C90B 3RXUA 1HAPH 4AOQA 3HKJB 2SGPE 1NO9H 3BTHE 1SFIA 5EQSA 2GD4B 3PO1B 4AG1A 5A09A 4XBBA 1AGJA 4I32A 4A7IB 1SI5H 4XBDA 3GY7A 3M3SA 2EA3A 4X1SU 1V2PT 1GMDF 1P12E 2VINA 5FX6A 2AERH 1GBCA 4KTCA 2Y5FA 1SGIB 1E0FD 3GISB 3MNCA 2VIQA 2ODYB 1C9PA 5FPTA 1A0HB 2HNTC 1N6YA 2FIRH 4CR9A 3MNSA 2QXIA 2ZECA 2F9BH 2Z9GA 2NU0E 5K0HA 1Y5AT 2BLOA 3C27B 1O2GH 1TBZH 3TJVA 4TYDA 2DE9A 3PLPA 3RXHA 1Z7KA 1C1WH 1GCDA 1YPLH 5BPEA 1NRNH 4JZ1A 2PW8H 1LHDH 4E7NA 4NFEA 1Z8GA 2BD2A 2THFB 2AIQA 1V2TT 2G55A 3VGCB 4GUXA 2BQ6B 3PWCA 4X1QU 1VR1H 1SLXB 3T29A 3SU4A 4Y11E 3SHAH 5EGMA 1EP5A 1HAGE 5FBEA 5HXFA 1YBWA 6CHAB 5FAHA 3QLPH 1YPJH 3A86A 3PLBA 2C8YB 1DICA 5LH8A 2ZDMA 2QA9E 1HIAA 3SGAE 1UK2A 2BDGA 1C2EA 5EQRA 5LPRA 2A2XH 1SGDE 4B2CA 1C5NH 5G4BA 1KXAA 1O34A 1ETTH 1GI3A 1O5CB 4U01A 5E8EH 3P8NA 1C4V2 2K7XA 1IQGA 1XUHA 3GCNA 2BDHA 2Z6BD 5L30H 1IQMA 1GJ8B 1PPZA 4A92A 3S9BA 3I29A 4JYVH 3A85A 3ATWA 2SGDE 1Z1IA 3LGTA 1AUJA 1C1TA 1FAXA 2GMTB 4X2XA 2TRMA 1IHSH 3DT0H 4CRDA 2TPIZ 1L0ZA 3MYWA 4MPWA 1GPZA 1S6FA 1ZSLA 1F5KU 1LKBA 4DT7B 1FY8E 1C2JA 4GPGA 2Z7FE 1TNKA 1O2YA 1EPTA 1A1RA 1XVMA 3MNXA 1GHXH 5ESTE 1Z71A 1THPB 5DP9A 2EI8A 4I8LA 5DO4H 3BTQE 2TGPZ 2FTMA 1E34B 1O3GA 1ELGA 4AYYB 1RTFB 1BMMH 4HZHA 2VVVA 1K9OE 1GI2A 1HV7A 1BQYA 5DP4A 3IITA 4F4OC 1EQ9A 1A46H 1NRPH 1BTZA 1HDTH 2TIOA 1N8OB 3ATMA 1CGIE 1XUFA 1JIRA 1AKSA 2GZ9A 4TY7A 2FS8A 3LGIA 2WPLS 3MU4A 1C2FA 5TJXA 1TMTH 4GLYA 5FXLA 2F83A 3A7XA 4OS7A 1W10U 2Q6GA 2R3YA 3TJOA 1W7GH 4NIVA 3VB6A 1PJPA 3PMJA 3RMOH 4X8VH 2FOBA 3A8BA 4O3UA 1HLTH 4BTUB 1XVOA 3URDA 3SU5A 4UONA 2ANMH 1O5FH 4I8JA 1A0JA 1DWDH 1RIWB 4BAHB 3P70B 1ESTA 3A88A 3FVFB 3UNRA 1O3IA 2ZU1A 3KQCA 1GI1A 4BAKB 1HAZB 4IW4E 3UR9A 2O8LA 1S81A 3BN9A 1RJXB 3MH6A 1SGFG 3M3TA 2FOAA 1GBBA 1O3DA 4BNRA 5GCHG 4A6LA 2GCHG 1H8DH 1P09A 1G30B 2VH0A 1UVSH 4THNH 1W0YH 4JMYA 1TGCA 2CF8H 2GTBA 1BRAA 4K69A 4JYTA 2A4RA 2LIZA 3TH2H 2PHBA 2ZG0H 3MU5A 4XSKU 3RXVA 2OP9A 3MO9A 3CP7A 1DSTA 7LPRA 1C2HA 4E06H 3MHWU 3TNSA 4ZHMU 4DIIH 1FDPA 3GDVA 4D7GA 3UOPA 2FODA 1IQNA 3SV6A 2B7DH 1LPGB 5F8XA 2HNTF 3RXSA 1O5AB 1YPKH 2V6NA 4YT7H 2BXTH 1HB0B 2FO9A 1L4DA 1K1OA 4FUIA 1QBOA 4Y7AA 5DP6A 2O8MA 2CF9H 3UNSA 1LO6A 1FY5A 2H5CA 3VB7A 1HPGA 3P8FA 3RUOA 2AMPA 3U1IB 5GWZA 1O2XA 5AHGH 1AZ8A 3GY8A 3ZVGA 3QO6A 2PFEA 1JBUH 2OQ5A 1ANEA 1ZLRA 4FU7A 5E0GA 1P04A 5L2ZH 1JRTA 1AIXH 1XUKA 3AAUA 1NZQH 1NT1A 4K1TA 3B8JA 4R0IA 4QT8C 2QC2A 1RS0A 4FUHA 1AUTC 2GCHF 2O8UA 2NU4E 2WINI 2STAE 1T8OA 3KEEA 1T8LA 1VJAU 1GI9B 3P17H 2IJOB 5EXMA 3CS0A 2ZKSA 4X6MA 4UFGH 1EJNA 1Y3VA 2CJIA 3MU0A 5I46H 1KXFA 1OPHB 2ZFQH 5C5OA 2FOEA 1HAXB 2AGIX 3PTBA 1D4PB 2EEKA 3W94A 3UWJH 4ABAA 3ZZ9A 3EA7A 3RU4D 1JMOH 1O2IA 3QWCH 2HPQH 3V7TA 3ZVCA 2V3HH 2BVSH 1C4Y2 2ZGHA 1THRH 1MBQA 2VVUA 3GY3A 5AF9H 1AB9B 2PGBB 1ZJDA 5AFZH 1CSOE 1NM6A 1O5GH 1J14A 1YF4A 3M7TA 2OC1A 1F2SE 1O35A 3RXMA 4BXWA 2HGTH 2ANYA 1IOEA 2FYQA 1B7XB 2QXGA 2GCTC 1TNHA 4ABIA 1SQOA 3FZZA 2AIPA 4GSOA 1WOFA 1BJVA 3T5FH 1B5GH 1C2IA 1CHGA 1S0QA 2J2UA 3RXCA 1JWTA 5JYIA 3MNBA 1VCWA 1GMCG 4Q80A 2J94A 1ACBE 1OWIA 4TPIZ 3BEIB 2ZDLA 1O2LA 1SOZA 4CHAB 1EAWA 3ZZDA 5EU8A 1WBGB 4DJZB 2W3KA 1FPHH 2SGAA 4RKJB 3TK9A 2UWOA 1QBNA 3KF2A 1TGTA 2VU8E 2ZDVH 2ZGBH 1ARCA 1IQLA 1TOCB 3SU2A 3B23B 1LHGH 3ZYDA 2SNVA 2FYRA 1QL9A 1NESE 2FEQH 1L2EA 2ODPA 3BIVH 4RSPA 5C1UA 3GY2A 1H9LB 1OSSA 4DCDA 4JZDH 2ZI2H 4KKDA 2WYJA 1CU1A 1A5HA 4MPXA 1GHBG 4K8BA 4I31A 1A5GH 2H9HA 3OYPA 1SGYE 4J1YA 3S0NA 4ISNA 1BHXF 3BTFE 5F8TA 1CT2E 1EOJA 1LVOA 2A4QA 1TRYA 2CN0H 3BF6H 3PMHB 3KQBA 5H4IB 2D26C 1G3BA 5ETXA 3PO1C 3QTOH 3O8CA 1O2ZA 1O3EA 1GMCF 1WTHD 1XUJA 3UFAA 2FI4E 2H9EH 2BX3A 1O3KA 1NN6A 1T8NA 1Z6EA 3BG8A 1UVPA 4X6OA 4CRAA 1YPHE 2NWNA 1G3EA 1O2MA 1IQKA 1C2LA 2XCFA 1O39A 1AVWA 4DGJA 4X6NA 2BD3A 1LKAA 1FPCH 5PTPA 5TCAA 2ZGJA 3A8AA 2ZTZA 2FOCA 1HAVB 3PYHA 1TABE 2ZFTA 3LDXH 1B0FA 2PTNA 4ZKNU 2OC8A 1LHFH 4AFZA 3K6YA 4B2AA 1VCPA 1AHTH 3VGCC 3M61U 1BBRH 2UWPA 1GHVH 1TFXA 4ISHH 3GCOA 3T25A 1GHBF 1G3DA 1ZTKA 4YT6H 4K60A 3GY4A 5EODA 4MVNA 1W14U 2A32A 3E90B 2QGRA 6CHAC 3NK8A 3O8RA 5FCRA 1TYNA 2D1JA 1FNIA 1XUIA 1PQAA 2G8TA 4X2VA 2ZFSA 1GJ4H 1HXFH 1S84A 1O5EH 1DY8A 1C2GA 3MMGA 2Z9IA 1YM0A 1HNEE 2RDLA 1GJBB 4H6SB 8LPRA 3IG6B 2Z3CA 1GBDA 1TGSZ 1KTSB 1HJ8A 1P0SH 1Y3XA 1XXFA 1W2KH 3RM2H 4JZEH 4O97A 2VIOA 4MNXA 2A7CA 2WUCA 1S0RA 1O37A 3RMNH 4Z0KA 5A0BA 1LVBA 5A8ZA 4K2YA 2NU1E 2GMTC 1NRSH 1FN8A 3U1JB 5C3NA 2PLXA 1T4VH 3E0NB 3ZVBA 5BRRE 1SGQE 2R0LA 3M5LA 4INKA 1C5ZB 4JZIA 1LQDB 2UUFB 3EDXB 1IQEA 4INHA 2VWMA 5B6OA 1SGPE 4B75A 1HCGA 1C5XB 1BIOA 1FV9A 5GIBA 3DD2H 1ANBA 1CGHA 2ZU4A 3S7KB 1TGNA 2BX4A 3HK3B 3LU9B 5EOKA 4NWLA 4OS2A 4WXVA 3A7YA 3ZVEA 1T7CA 4HFPB 2PSXA 4XOJA 2OBOA 1DFPA 1VITH 1N8OC 1V2KT 1XXDA 1Z8IB 2P3FH 5J4SA 2BQWB 1TNGA 1WQSA 3MO3A 3RC5A 1VCQA 3SI4H 1PQ8A 3GICB 3PM3A 5A8XA 3TITA 3GY6A 4SGAE 1C1VH 3ATKA 4ASHA 1QJ1B 3GYLB 1WCZA 1DOJA 3TGKE 1PPFE 1HGTH 1G3CA 5A2MH 2PUQH 5AFYH 2OTVA 4YTAA 1P2JA 3KQDA 1ELEE 2O8WA 1TA2A 1HAYB 2UWLA 1O3CA 2RA0A 2ODQA 1C1MA 3BTGE 2FTLE 1YP9A 1V2MT 2M5TA 1BDAA 1V2VT 1F92A 2A5KA 1LMWB 2GGVB 1C4U2 1T32A 2ZHWH 1CGJE 3PMBB 5T6DA 1P3CA 2W26A 4F49A 4CH8B 3VB5A 4LOYH 4JZFH 2ILNA 4X1NU 5J4QA 1MZDA 4R8TB 1PQ7A 3RXGA 3GCHB 1O2NA 1NFYA 1GBIA 1K1NA 1DY9A 3UY9A 5CE1A 2CMYA 4WY3A 4CRCA 4WXIA 2ZQ2A 4HTCH 3FANA 2BDYA 5FPSA 3UNQA 2OCVB 4IBLH 6ESTA 2GP9B 4ZKRU 3VB4A 1GL0E 1KTTB 1O2KA 5DGJA 1IQFA 1LQEA 1Z6JH 1RTLA 1C1OA 2ZEBA 2GT8A 3VPKA 4BANB 4UDWH 2FDAA 4B1TA 1KYNA 5FBIA 1ETSH 2BD7A 2FX4A 4GHTA 3Q3KA 2ZGCA 5JDUB 1BRCE 3UQOA 1QTFA 3HPTB 3SU6A 4WMEA 3ZZBA 1GDUA 2UUKB 1UMAH 4DW2U 4AGKA 3TPIZ 1MTNB 2VH6A 3OX7U 2IOTA 3GCTG 3PWBA 4LXBH 1DWBH 1O2OA 2IPHA 3U98H 2BOHB 1P01A 3NKKA 5E0JA 3LJJA 4MNWA 2PTCE 2F3CE 1ZGIA 1FY4A 2BQ7B 3Q77A 1BCUH 3RU4T 2R2WU 4Y76A 4AB8A 1O3MA 1ZPZA 3EAJA 3TH4H 1E35B 1BITA 1ELVA 1GI7B 1YPHC 2WUBA 5I25A 5CMXH 3D65E 1TPSA 1Y59T 2YNAA 2ZTXA 3OU0A 4I7YH 4GCHG 1G2LA 4Y0ZE 1FLEE 1V3XA 4YESB 1IQHA 3UIRA 4FU9A 2VB0A 4OGXA 1FQ3A 2W5EA 1UK3A 2LPRA 1J16A 3RXAA 2WPMS 4YOIA 3KCGH 1HAVA 2Z9KA 1MMJN 3MI4A 1J9CH 1TOMH 3S7HB 3ZZ3A 2FOHA 4NIWA 3LT3A 3SHCH 4BXSA 3KNXA 1TX7A 1XM1A 2QCYA 1AO5A 5C1YA 4YO9A 3NUMA 1MD7A 4GAWA 1AB9C 4U32A 3LIWA 1WU1A 1ELAA 4J2YB 4CREA 2SFAA 4LK4A 2FX6A 2ZFFH 3URCA 1DT2A 1Z8JB 2P93A 1SQAA 4K1EA 3LGYA 1GCTB 1P3EA 4ISLA 2ZQ1A 1KXEA 1UVUH 1A7SA 3SUFA 1TGBA 3I77A 3GCTF 1N1LA 1C5WB 2FOGA 3GY5A 1C1SA 2FI5E 3I78A 3E3TA 2BHGA 1K1PA 6GCHG 3RXEA 1MUEB 4OS1A 4O9VA 4KTSA 3RXLA 2GX4A 1DWCH 1GBMA 3O8BA 3QZQA 2BY9X 1EB1H 3EBNA 1FZZA 1NU7B 1L1NA 4ABJA 3A7TA 2A31A 4CHAC 2Y6TA 3LKWA 4GCHF 1MCTA 3A81A 1AZZA 1O32A 3BV9B 3NXPA 1CT4E 4M7GA 2SGEE 1U6QA 2TGTA 5E0HA 4Y8YA 4K8YA 3TJUA 2WYGA 4FUFA 1DM4B 1UTMA 5DP3A 1AY6H 3C1KA 4YLUA 4ZAEA 1FIWA 3BG4C 4H6TA 3SW2B 4NIXA 3PLKA 1LDTT 4NCYA 1SVPA 2AMDA 1P2KA 1FI8A 3M37A 1DSUA 3ZZCA 4NFFA 3BEFB 1P2OA 2A4OA 1ZR0A 4Y10E 4DIHH 6LPRA 3BTKE 1KDQB 1C2KA 1P57B 1P9UA 1PQ5A 3A80A 3BTEE 3GOVB 4UEHH 3T2NA 2A7JA 1N6XA 2FS9A 1QA7A 1ELDE 1LTOA 3E0PB 3M7QA 2OD3B 1DS2E 1QRXA 5EPNA 1OYTH 2BDAA 1O33A 1CBWC 5T6GA 3D62A 1GJDB 5T3HA 1HRTH 2F91A 6GCHF 3L3TA 4BAMB 1JOUB 5JB9S 1ZRKA 1UVOA 3MFJA 4D9QA 4NSYA 4B73A 1CA0B 4DVAU 4SGBE 1GDNA 1SHHB 3DA9B 2FWWA 2D2DA 1O2PA 1NROH 4U2WA 2B9LA 2HPPH 1GJ6A 5EQQA 3QTVH 2XWAA 1SMFE 1UJ1A 1ESAA 1TQ7B 1FY1A 3SU0A 4GVUA 3S9CA 2C3SA 1ELTA 3ITIA 3HGPA 1E38B 1J15A 2WPJS 1W0ZU 5F6MA 1J8AA 1GMHG 3NZIA 4KELA 3TK5A 1HAIH 4NWKA 2BXUH 4NZLA 4INLA 5C20A 5IDKA 1HAOH 2HWLB 2WPKS 2STBE 1HAHH 4TPYA 2PUXB 1W7XH 2ZF0H 1T4UH 2ZWLH 1QL8A 1W12U 1HJ9A 1GBJA 3A89A 2RCEA 3KIDU 2FXRA 1YLDA 3ZZ8A 3M3VA 7ESTE 1D6RA 3ZV8A 2Y5GA 2FI3E 4Y71A 1BRUP 2ALVA 1OWKA 1KLIH 5GCHF 1KXCA 1GVKB 1BRBE 3K9XB 3RXOA 1BTUA 3T27A 1QL7A 5DKMA 1Y3YA 3DHKH 4IGDA 2ZDNA 3QGNB 2FM2A 3VEQB 4HGCA 1OP8A 3QX5H 3E16B 1J17T 2ZU5A 1OOKB 4NIYA 4AYVB 1LHCH 5FPYA 1X7AC 1GI8B 3T28A 4AORA 3SOSA 1PYTC 5F8ZA 3PB1E 3A7WA 3A7VA 4CBOA 2WV5A 3PTNA 1GMHF 4WMDA
chains in the Genus database with same CATH superfamily
2AFQB 1D6WA 3H7OA 3LOXA 1P03A 4XE4A 1DPOA 3VXFH 1TAWA 2XYAA 3F9FA 2BMGB 1BTHH 5HGGA 2Z9LA 2A7HA 1GI6A 2CGAA 3E8LA 4X1PU 1GI0A 4UFEH 4RI0A 1Y3WA 1GBTA 1GBLA 5HMAA 1TIOA 5HKKD 4IC5A 1EZQA 2XNIA 1BT7A 1UTLM 3M5OA 4ESTE 5EJ1A 1LCYA 3BTWE 2Y7ZA 4X2WA 1CT0E 2GV6A 3QGJA 1LVMA 1MQ5A 2H9TH 1D3TB 1NC6A 4A5TS 3ZZAA 1RRKA 2G4TA 3MH5A 3Q00A 2OBQA 8ESTE 2EC9H 2QF0A 1XX9A 2F9VA 3M5NA 1ZRBA 1EOLA 1IQJA 1QNJA 2XC5A 5F03A 2R2MB 3V12A 3SNAA 2R9PA 1TB6H 4MPUA 3RXFA 4A1VA 2P8OB 5EXNA 1C5VA 3OY6U 1C9TA 1QY6A 1V2ST 1ZZZA 2C4FH 1P2QA 2PSYA 4MNVA 3K6ZA 1GBFA 1YC0A 2ZHFH 3P8GA 1QCPA 3BG4B 3H7TA 3TIUA 3OSYA 2OC7A 2FZZA 1FX0B 3EA8A 2VIDA 4X2YA 2Y82A 1P2NA 2B8OH 3LGUA 1RD3B 1TX8A 5EG4A 2BY5X 5C67A 1UK4A 5HYOA 4ZKSU 3KL6A 3L6PA 1EZXC 5GXPA 3E1XB 1VITG 2LP6A 5EW1H 4WJG2 4Y79A 4MLFB 1B0EA 1QJ6B 1RFNA 1UTPA 4AG2A 4BAQB 3UTUH 1QRZA 2LNCA 5FCKA 3BSQA 1FMGA 1AFQC 1CBWB 1SR5C 2BD5A 4UFFH 3Q76A 2HVYB 1O0DH 2F4LA 1G2MA 1SPJA 2Y5HA 1TRMA 5GJ4B 1BTXA 1FXYA 3GCHC 3A7ZA 1OP0A 2PGQB 1A3EH 1QIXB 2B0FA 4MPVA 1FN6A 4UFDH 4BOHA 2K8IA 1S5SA 5AVDA 2ZCKP 3IWMA 1CE5A 1O2JA 1UTQA 1CQQA 3PRBA 3FZDA 4O3TA 2F9NA 4NA8A 3Q3YA 3V0XA 1FAKH 1S85A 2ZFRH 4Q2KA 1C5YB 1C5RA 3M7UA 1HBTH 2C8ZB 2XTTB 1UTKA 3ATLA 3OY5U 1BTPA 4PROA 1OWJA 1SHYA 1TQ0B 2XBYA 4OS5A 1WSSH 1LVYA 1SGTA 1YCPK 1MKXK 1V2QT 1EX3A 2OUAA 5JBBS 1DXWA 4H42U 3S9AA 1KXBA 1HIAB 1QQ4A 1FUJA 1ZMNA 2VNTA 2AGEX 3ZVDA 1V2JT 1Q2WA 1EASA 1MTNC 1GHAG 2BZ6H 4NGAH 1EUFA 2Q6FA 2PR3A 2AS9A 1VITF 3F9GA 1PPBH 2P3TB 4ZXYH 5C94A 3A87A 1AD8H 5CHAB 1O2WA 1CO7E 1ZSJA 4Y7BA 1Y5UT 2KAIB 3LH1A 1YPEH 5C17A 4XFQA 1SL3A 1T8MA 3STJA 2GV7A 2HOBA 2IJD1 1DLEA 1V2RT 4WH8A 1H9HE 3F2GA 1SB1H 1AE5A 3GS9A 5DK1A 2ZPRA 3ZZ6A 5CHBA 1P2MA 3FP6E 4K3JA 3UOUA 1SSXA 4ABHA 2BDBA 2BYAX 3TJNA 2QIQA 3RLYH 1ABJH 5DP7A 3FAOA 3UPEA 1A2CH 4WH6A 3SU3A 3EE7A 1AQ7A 2KX4A 1ZTJA 3KQEA 2KCOA 4RN6A 1YYY1 2BVXH 1C5SA 3OFND 2WPHS 1GGDB 3A83A 3PMAB 3AASA 1O3OA 1TWXB 2G00A 2JKHA 1GBAA 4ZH8A 4XBCA 2Y81A 1GCTC 3F3BA 1AWFH 4IC6A 1QGFA 3F68H 1BMAA 3FP8E 4NA7A 1AKSB 1GHAF 1GJ7B 5C0TA 1TRNA 3U9AH 5HM9A 3K65B 4KGAA 5EXLA 1EJMA 3LGWA 1P10A 2ASUB 4YOJA 4ZMAH 2Z9JA 2SNWA 1GJ5H 3SV7A 1O3FA 9ESTA 1WDIA 3VXEH 1Q31A 3RMMH 4H4FA 2ZC9H 3RP2A 2H2ZA 4LZ1H 1DVAH 1G32B 1GBEA 1OP2A 3FO8D 2V0BA 3E6PH 2ZGXH 5L2YH 2F43B 2ZCHP 2I6SA 1W13U 3SUDA 3UWIA 4D9RA 4DURA 1C1UH 2ZDAH 1BTYA 1O3NA 3F2FA 1KSNA 4ZUHA 2P3UB 3QK1A 1GI5A 5A0CA 2J95A 4YOGA 2G51A 3Q3XA 3DFLA 2NU2E 3ZZ7A 3V3MA 1YPGH 4FUCA 2ALPA 2GT7A 4ABFA 1SGEE 1XUGA 1L1JA 1QB9A 2C8WB 4ABGA 1P2IA 5EW2H 1A5IA 2D8WA 1F0RA 4Y6DA 1CHOG 3F2HA 3DSGA 1C5UA 5E2PA 2FP7B 2NU3E 3EE0B 4Y0YE 1TALA 3T26A 3DCLA 2BDIA 3TH3H 1VGCB 5JBCS 1OWHA 1E36B 1AFQB 1MKWK 2UUJB 2BY6X 2Z94A 3HATH 3SN8A 4BTIB 5LGOA 3LPRA 1CA0C 1NRQH 1TPAE 3ZZ4A 4TWWA 1NFXA 1P05A 1DANH 1W0JD 2GJGA 2VWNA 4A1XA 1CVWH 1EB2A 3DUXH 4CBNA 1ID5H 4ZROA 3BTME 1ETRH 3VFEA 1XKBC 4KTUA 3KHVA 2HALA 4VGCB 1WTGH 4I86A 1DUAA 3EGKH 2W6JD 2VGCB 4OS6A 3U8RH 2BLQA 1MU8B 1DXPA 3RXJA 4NA9H 2BD9A 4D8NA 1C5QA 2P59A 2R3UA 4IN2A 3LH3A 2JIZD 2PKSB 3SJKA 4WMFA 3RU4E 1DDJA 1QQUA 1QBVH 3D49H 1RTKA 1AI8H 5B6LA 1O30A 4I33A 1P9SA 2W7UA 1PFXC 2YOLA 3H5CB 1EKBB 3R0FA 3P92A 1V2UT 4FUJA 2Z3DA 1CHOF 3ODFA 1H8HD 1GHWH 2ZCLP 1ZYOA 2JETC 1AE8H 1YY3A 3RC4A 4FUBA 1GDQA 4ABEA 3SO3A 2FESH 4FUGA 3SJOA 3ODDA 5A8YA 2UUYA 1WV7H 3NCLA 1O3PB 1H8IH 1PPGE 1NU9A 3EYDA 1GG6B 2J9NA 4IN1A 1ZMLA 4CRGA 1ANCA 2QXHA 1EAXA 2EI6A 3W95A 1SLUB 4AB9A 3GDSA 2CXVA 1EZSC 1G37A 2ANKH 3BTDE 1MQ6A 5ABWA 3SZNA 1C1QA 2CV3A 1QA0A 3HKIB 1ABIH 2WPIS 1GVZA 4K5ZA 5GDSH 3F1SB 4FUEA 2SGQE 1GHZA 1F7ZA 1G9IE 1Z1JA 1NRRH 2V35A 2H5DA 3SNEA 3RXIA 3SGBE 1S83A 4JYUH 5FL7D 2BD4A 4CH2B 3V13A 4ASUD 1TBRH 1TLDA 3NWUA 2C93B 2KAIA 2FMJA 2G5VA 4B71A 2ZPQA 4TT3D 4ISIH 5DG6A 1NTPA 1K28D 2XBWA 1QHRB 4P00A 3ELAH 1YKTA 2QYIA 1FONA 1MH0A 3UQVA 3ZZ5A 2J92A 2JJ1D 4DY7B 3P6ZB 3SJIA 1WXRA 2G4UA 2PV9B 1QB1A 3QZRA 4X8SH 1GVLA 2PWXA 3MU1A 1UW7A 1JIMA 8KME2 1ARBA 1AVGH 3U8OH 1WAYB 1NY22 2P8OC 1EAUA 2G52A 1HJAC 1UHBB 2K1QA 3P95A 2ESTE 2QN5T 2ZU3A 3F9EA 2QXJA 3ZVFA 2GDEH 4KP0A 3QDZB 4U30A 1LHEH 1O2VA 2V3OH 1OXGA 2QF4A 4JCNA 1GJ9B 4MG3A 5SGAE 2J4IA 1K0HA 1FY3A 2A4GA 1GL1A 1TX6A 7KMEH 2CHAB 4WWYA 1VJ9U 4A1TA 2A0QB 2J38A 4Q7ZA 1H1BA 1O2UA 4Q7YA 1BOQA 2JH5D 1O5DH 2L6OA 4FU8A 1O38A 2GZ7A 1VKYA 4NSVA 1MTUA 1ORFA 2BLVA 4TWYA 1HXEH 1OX1A 3N7OA 3NPSA 1QRWA 3ZV9A 1G36A 2FPZA 3TGIE 3SUGA 1TNJA 4HI3A 3SQHE 3KYGA 3RM0H 1H9IE 2AGGX 3ENSB 1AFEH 1BJUA 1WYKA 4X8TH 2IPQX 3TU7H 1OWDA 1NS3A 1O3AA 4X0WU 3UUZA 1SOTA 2XCNA 4GHQA 1P11E 2BOKA 1D9IA 1W11U 1ELBA 5C5NA 1WQVH 3DFJA 3TVJB 4WF8A 1WUNH 3N99A 5JB8S 2KM0A 3A8CA 4CR5A 1GBHA 1UTJA 2W7SA 1NFWA 1O2RA 1SQTA 4MTBA 1SC8U 1SBWA 1UCYH 1V2WT 3NRLA 3OAAD 1DUEA 1Q3XA 1MTWA 2GZ8A 3SV9A 4XDEA 1UO6A 3AW1A 1P8VC 3F6UH 5HM2A 1OWEA 1A3BH 3QN7A 3SJ9A 3ZYEA 4DG4A 2VWOA 1DX5M 2BM2A 2JETB 1F0UA 4ZHLU 1FJSA 5CHAC 1GJCB 4K1SA 1NBMD 3OTPA 5T1VA 1MZAA 2BVRH 3SNBA 2XW9A 3PV4A 1M9UA 2C8XB 3SV8A 3RXTA 2Y80A 3P8OA 3MOCA 4MQAA 3A82A 2PKAB 4I8GA 5LPEA 5A0AE 3UREA 5L6NH 5C0UA 1T31A 1Z8RA 5IYTA 3EQ0H 1PPEE 1TPOA 2A1DB 1UCYK 3W1EA 1MAYA 2BD8A 2ZHEH 4X1RU 4D7FA 2ZHQH 3ESTA 1EPTC 1S6HA 2H6MA 2J34A 3O8DA 3MO6A 1ESBA 1UCYE 2XC4A 2ZIQH 1UVTH 1UTOA 2QF3A 1A4WH 2WV4A 1C2DA 1K22H 4CRBA 2OQUA 3RXQA 1KXDA 3D23A 1GGDC 1PPCE 2O9QA 1VZQH 2BLWA 3U8TH 1QJ7B 1BUIA 2KFWA 1YPMH 3MU8A 4CRFA 4OS4A 1V2OT 3QUMP 2P95A 3JZ2B 4NG9H 2Q1JA 1C1RA 5C1XA 1ZPCA 2G5NA 3R3GB 1K21H 4MDSA 1ZMJA 1AU8A 1PPHE 2BY7X 1C5OH 1EP6A 2VWLA 1C5LH 1MAXA 2IN2A 2M2AA 3MTYA 3G01A 4E7RG 1HFDA 3BEUA 4Q7XA 1PYTD 4YLQH 5TCCA 3UR6A 2ANWA 1O31A 2QAAA 2FLRH 1TA6A 3RC6A 2Y7XA 4Y8XA 1HYLA 1GWAA 3BTTE 3S69A 1QURH 3T62A 4FOUC 2ZPSA 2WSSD 4Z6AH 5JBAS 4MNYA 5EPYA 1TNIA 1RGQA 4Z1MD 3GDUA 1EATA 1K1LA 4AFUA 2ZTYA 3FFGA 1GHYH 2TBSA 5FX5A 1Y8TA 5JBTA 1HJAB 1YWUA 1EXFA 4E05H 1SGCA 1SGNE 1HUTH 1TE0A 3K2UA 1O2QA 1ZTLA 1EAIA 2JJ2D 1ZHMA 3LONA 4B74A 1XMNB 1V6DA 3GYMA 2QY0B 1SLVB 1EZUC 4JK6A 2JH0D 3RXDA 2ZU2A 1IAUA 3RXKA 5DJ7A 3SJ8A 2ZDKA 4I8HA 5ESBA 2RA3A 1F5RA 2P16A 1K1MA 1GJAB 4AGJA 8GCHG 4Q4LA 5JPMH 1KY9A 2FLBH 3AK5A 3JZ1B 1Y5BT 4B6FA 1YGCH 2EI7A 2HLCA 1F0SA 3MH4A 1VGCC 3KN2A 1ZHRA 3TK6A 1YCPH 1E37B 1MKXH 1H4WA 3HK6B 3ZVAA 1UTNA 2HNTE 2VBCA 4O03A 1OS8A 3SU1A 1D3QB 3RXPA 4UD9H 1BA8B 1IQIA 1S82A 1BHXB 2GDDA 3PROA 1MBMA 1JXPA 5FHTA 1K2I1 1TMBH 3MH7A 5T6FA 1UHBA 1L1GA 3SBKA 3LC5A 3SORA 2W3IA 4VGCC 3SV2H 2BTCE 1JRSA 2YNBA 2SGFE 2VGCC 3SGQE 4FUDA 2ULLA 1ZJKA 2XXLA 2JDID 4XRNA 2OLGA 3TNTA 1P02A 2GVFA 2PKSC 1TPPA 2HVXA 1O3HA 2VJ1A 2Z3EA 1ZSKA 1K1JA 2OC0A 1MD8A 3CENA 4AN7A 1O2TA 1KDQA 2GKVE 3M5MA 1ELCA 1FIZA 2L74A 1O3BA 3SNCA 4OM9A 5LPFA 1ZPBA 4Y8ZA 4ZKOU 1V2NT 1GBKA 3SI3H 2FOMB 4YZUA 4IMZA 8GCHF 3MWIU 1RXPA 4M9FA 1C5PA 1YLCA 5KGOA 1TBQH 1BB0B 1INCA 4B2BA 1C1NA 1O2HA 1ZHPA 1F5LA 2AYWA 2R0KA 4X6PA 3WY8A 1KIGH 1GG6C 1K1IA 2F9UA 2ZNKH 3RDZA 1OKXA 1Y3UA 2FOFA 1SLWB 1SGRE 1W0KD 3HGNA 1C2MA 4FVDA 4Q63A 4P02A 2ZP0H 2XRCA 2DUCA 3LGVA 1EPTB 5HIZA 3U69H 5DP5A 2OINA 7GCHG 1W8BH 2VIPA 1MU6B 2XBXA 4AC9A 4AZ2B 2AMQA 2J98B 3LJOA 1MTVA 1DE7H 2OXSA 3STIA 1L4ZA 3EA9A 3A84A 1SFQB 4NZQA 1KLJH 2YMSB 2RG3A 2JH6D 4AX9H 1AVXA 1GI4A 1QR3E 2BDCA 4IMQA 2VVCA 1AMHA 3LC3A 4BTTB 1W3CA 1BZXE 2AH4X 3CS7A 3RXRA 3TLOA 1CA8B 2HRVA 3KGPA 2XBVA 3RLWH 2F9PA 3AW0A 4ABBA 1AN1E 3RMLH 3F9HA 4YM9A 1ELFA 1TONA 1MTSA 3TGJE 3OTJE 3E91A 4JK5A 1BBRK 3M36A 4AFSA 1O2SA 1KLTA 2VIWA 2XWBI 1QB6A 1YCPM 1LPKB 2ZHDA 1BBRE 2AEIH 2PKAA 4ISOA 1O3LA 2BB4A 5C2ZA 4ABDA 3SUEA 2A5AA 5E2OA 1XKAC 4RKOB 1DWEH 2KCPA 2H1UA 4DOQA 2VIVA 2A2QH 1D3PB 4IS5A 1SGFA 1A61H 3AAVA 3AVZA 1O3JA 1THSH 2I6QA 2O8TA 5GPIB 2GCTB 1O36A 4BAOB 1TMUH 2ZO3H 1MKWH 2TGDA 5DPAA 4LZ4B 4ZXXH 4I8KA 1IHTH 7GCHF 3SNDA 5DP8A 3ATIA 4OGYA 1GMDG 2F9OA 4B76A 2DE8A 3UB0A 4TY6A 2CHAC 1LPZB 2A45B 4AFQA 1EJAA 1A0LA 1TNLA 3L33A 4FXGH 2ZZUH 3VB3A 1MCVA 1O5BB 1YLNA 2G81E 1C1PA 2QV1A 3B9FH 1BTWA 3RXBA 3SQEE 2ZFPH 1C5TA 4ZHAA 1BMLA 9LPRA 2BZAA 1D3DB 1OYQA 3M35A 1F0TA 1V2LT 2ZA5A 1QFKH 3A8DA 2TGAA 1DITH 2B5TB 1ZOMA 1RIWC 4FVBA 1NFUA 1C5MD 1ZGVA 3H09A 4X8UH 4WVPE 2Q6DA 1ANDA 5K7RA 3BIUH 3MQKC 4UE7H 4D76A 1AWHB 1DLKB 2P94A 1SG8B 1NPMA 2A5IA 1P06A 1BMNH 2BY8X 2XC0A 3FP7E 2C90B 3RXUA 1HAPH 4AOQA 3HKJB 2SGPE 1NO9H 3BTHE 1SFIA 5EQSA 2GD4B 3PO1B 4AG1A 5A09A 4XBBA 1AGJA 4HG6A 4I32A 4A7IB 1SI5H 4XBDA 3GY7A 3M3SA 2EA3A 4X1SU 1V2PT 1GMDF 1P12E 4RT1A 2VINA 5FX6A 2AERH 1GBCA 4KTCA 2Y5FA 1SGIB 1E0FD 3GISB 3MNCA 2VIQA 2ODYB 1C9PA 5FPTA 1A0HB 2HNTC 1N6YA 2FIRH 4CR9A 3MNSA 2QXIA 2ZECA 2F9BH 2Z9GA 2NU0E 5K0HA 1Y5AT 2BLOA 3C27B 1O2GH 2V7QD 1TBZH 3TJVA 4TYDA 2DE9A 3PLPA 3RXHA 1Z7KA 1C1WH 1GCDA 1YPLH 5BPEA 1NRNH 4JZ1A 2PW8H 1LHDH 4E7NA 2AHME 4NFEA 1Z8GA 2BD2A 2THFB 2AIQA 1V2TT 2G55A 3VGCB 4GUXA 2BQ6B 3N7EA 3PWCA 4X1QU 1VR1H 1SLXB 3T29A 3SU4A 4Y11E 3SHAH 5EGMA 5EJLA 1EP5A 1HAGE 5FBEA 5HXFA 1YBWA 6CHAB 5FAHA 3QLPH 1YPJH 4YXWD 3FN8A 3A86A 3PLBA 2C8YB 1DICA 5LH8A 2ZDMA 2QA9E 1HIAA 3SGAE 1UK2A 2BDGA 1C2EA 5EQRA 5LPRA 2A2XH 1SGDE 4B2CA 1C5NH 5G4BA 1KXAA 1O34A 1ETTH 1GI3A 1O5CB 4U01A 5E8EH 3P8NA 2RDEA 1C4V2 2K7XA 1IQGA 1EFRD 1XUHA 3GCNA 2BDHA 2Z6BD 2CK3D 1IQMA 5L30H 5CDFE 1GJ8B 1PPZA 4RT0A 4A92A 3S9BA 3I29A 4JYVH 3A85A 3ATWA 2SGDE 1Z1IA 3LGTA 1AUJA 1C1TA 1FAXA 2GMTB 4X2XA 2TRMA 1IHSH 3DT0H 4CRDA 2TPIZ 1L0ZA 3MYWA 4MPWA 1GPZA 1S6FA 1ZSLA 1F5KU 3SZEA 1LKBA 4DT7B 1BMFD 1C2JA 1FY8E 4GPGA 2Z7FE 1TNKA 1O2YA 1EPTA 1A1RA 1XVMA 3MNXA 1GHXH 5ESTE 2J98A 1Z71A 1THPB 5DP9A 2EI8A 4I8LA 5DO4H 3BTQE 2TGPZ 2FTMA 1E34B 1O3GA 1ELGA 4AYYB 1RTFB 1BMMH 4HZHA 2VVVA 1K9OE 1GI2A 1HV7A 1BQYA 5DP4A 3IITA 4F4OC 1EQ9A 1A46H 1NRPH 1S6LA 1BTZA 1HDTH 2TIOA 1N8OB 2KCYA 3ATMA 1CGIE 1XUFA 1JIRA 1AKSA 2GZ9A 4TY7A 2FS8A 2EY4C 3LGIA 2WPLS 3MU4A 1C2FA 5TJXA 1TMTH 4GLYA 5FXLA 2F83A 3A7XA 1OHHD 4OS7A 1W10U 2Q6GA 2R3YA 3TJOA 1W7GH 4NIVA 3VB6A 1PJPA 3PMJA 3RMOH 4X8VH 2FOBA 3A8BA 4O3UA 1HLTH 4BTUB 1XVOA 3URDA 3SU5A 4UONA 2ANMH 1O5FH 4I8JA 1A0JA 4F48B 5KECA 1DWDH 1RIWB 4BAHB 3P70B 1ESTA 3A88A 3FVFB 3UNRA 1O3IA 2ZU1A 3KQCA 1GI1A 4BAKB 1HAZB 4IW4E 3UR9A 2O8LA 1S81A 3BN9A 1RJXB 3MH6A 3CNRA 1SGFG 3M3TA 2FOAA 1GBBA 1O3DA 4BNRA 5GCHG 4A6LA 3KQ5A 5HIYA 2GCHG 1H8DH 1P09A 1G30B 2VH0A 1UVSH 4THNH 1W0YH 4JMYA 1TGCA 2CF8H 2GTBA 1BRAA 4K69A 4JYTA 2A4RA 2LIZA 3TH2H 2PHBA 2ZG0H 3MU5A 4XSKU 3RXVA 2OP9A 3MO9A 3CP7A 1DSTA 7LPRA 1C2HA 4E06H 3MHWU 3TNSA 4ZHMU 4DIIH 1FDPA 3GDVA 4D7GA 3WW7A 3UOPA 2FODA 1IQNA 3SV6A 2B7DH 1LPGB 5F8XA 2HNTF 3RXSA 1O5AB 1YPKH 2V6NA 4YT7H 2BXTH 1HB0B 2FO9A 1L4DA 1K1OA 4FUIA 1QBOA 4Y7AA 5DP6A 2O8MA 2CF9H 3UNSA 1LO6A 2KR7A 1FY5A 2H5CA 3VB7A 1HPGA 3P8FA 3RUOA 2AMPA 3U1IB 5GWZA 1O2XA 5AHGH 1AZ8A 3GY8A 3ZVGA 3QO6A 2PFEA 1JBUH 2OQ5A 1ANEA 1ZLRA 4FU7A 5E0GA 1P04A 5L2ZH 1JRTA 1AIXH 1XUKA 3AAUA 1NZQH 1NT1A 4K1TA 3B8JA 1E1QD 2K0QA 4R0IA 4QT8C 2QC2A 1RS0A 4FUHA 1AUTC 2GCHF 2O8UA 2YMSC 2NU4E 2WINI 2STAE 1T8OA 3KEEA 1T8LA 1VJAU 1GI9B 3P17H 2IJOB 5EXMA 3CS0A 2ZKSA 4X6MA 4UFGH 1EJNA 1Y3VA 2CJIA 3MU0A 5I46H 1KXFA 1OPHB 2ZFQH 5C5OA 2FOEA 1HAXB 2AGIX 3PTBA 1D4PB 3DSOA 2LELA 2EEKA 3W94A 3UWJH 4ABAA 3ZZ9A 3EA7A 3RU4D 1JMOH 1O2IA 3QWCH 2HPQH 3V7TA 3ZVCA 2V3HH 2BVSH 1C4Y2 3KYFA 2ZGHA 1THRH 1MBQA 2VVUA 3GY3A 5AF9H 1AB9B 5IK2D 2PGBB 1ZJDA 5AFZH 1CSOE 1NM6A 1O5GH 1J14A 1YF4A 3M7TA 2EQNA 2OC1A 1F2SE 1O35A 3RXMA 4BXWA 2HGTH 4ACAA 2ANYA 1IOEA 2FYQA 1B7XB 2QXGA 2GCTC 4TSFD 1TNHA 4ABIA 1SQOA 3FZZA 2AIPA 4GSOA 1WOFA 1BJVA 3T5FH 1B5GH 1C2IA 1CHGA 1S0QA 2J2UA 3RXCA 1JWTA 5JYIA 3MNBA 4F55A 1VCWA 1GMCG 4Q80A 4DT4A 2J94A 1ACBE 1OWIA 4TPIZ 3BEIB 2ZDLA 1O2LA 1SOZA 4CHAB 1EAWA 3ZZDA 5EU8A 1WBGB 4DJZB 2W3KA 1FPHH 2SGAA 1H8ED 4RKJB 3TK9A 2UWOA 1QBNA 3KF2A 1TGTA 2VU8E 2ZDVH 2ZGBH 2V3MA 1ARCA 1IQLA 1TOCB 3SU2A 3B23B 1LHGH 3ZYDA 2SNVA 2FYRA 1QL9A 1NESE 2FEQH 3DSPA 1L2EA 2ODPA 3BIVH 4RSPA 5C1UA 3GY2A 1H9LB 1OSSA 4DCDA 4JZDH 2ZI2H 4KKDA 2WYJA 1CU1A 1A5HA 4MPXA 1GHBG 4K8BA 4I31A 1A5GH 2H9HA 3OYPA 1SGYE 4J1YA 3S0NA 4ISNA 1BHXF 3BTFE 5F8TA 1CT2E 1EOJA 1LVOA 2A4QA 2RFKC 1TRYA 2CN0H 3BF6H 3PMHB 2OK5A 3KQBA 5H4IB 2D26C 1G3BA 5ETXA 3PO1C 3QTOH 3O8CA 1O2ZA 1O3EA 1GMCF 1WTHD 1XUJA 3UFAA 2FI4E 2PP6A 2H9EH 2BX3A 1O3KA 1NN6A 1T8NA 1Z6EA 3BG8A 1UVPA 3OEED 4X6OA 4CRAA 1YPHE 2NWNA 1G3EA 1O2MA 1IQKA 1C2LA 2XCFA 1O39A 1AVWA 4DGJA 4X6NA 2BD3A 1LKAA 1FPCH 5PTPA 5TCAA 2ZGJA 3A8AA 2ZTZA 2FOCA 1HAVB 3PYHA 3N7DA 1TABE 2WV9A 2ZFTA 1COWD 3LDXH 3PV5A 1B0FA 2PTNA 4ZKNU 2OC8A 1LHFH 4AFZA 3K6YA 4B2AA 1VCPA 1AHTH 3VGCC 3M61U 1BBRH 2UWPA 1GHVH 1TFXA 4ISHH 3GCOA 3T25A 1GHBF 1G3DA 1ZTKA 4YT6H 4K60A 3GY4A 5EODA 4MVNA 1W14U 2A32A 3E90B 2QGRA 6CHAC 3NK8A 3O8RA 5FCRA 1TYNA 2D1JA 1FNIA 1XUIA 1PQAA 2G8TA 4X2VA 2ZFSA 1GJ4H 1HXFH 1S84A 1O5EH 1DY8A 1C2GA 4FETA 3MMGA 2Z9IA 1YM0A 1HNEE 2RDLA 1GJBB 4H6SB 8LPRA 3IG6B 2Z3CA 1GBDA 1TGSZ 1KTSB 1HJ8A 1P0SH 1Y3XA 1XXFA 1W2KH 3U28C 3RM2H 4JZEH 2WPDD 4O97A 2VIOA 4MNXA 2A7CA 2WUCA 1S0RA 1O37A 3RMNH 4Z0KA 5A0BA 1LVBA 1SKYE 5A8ZA 4K2YA 2NU1E 2GMTC 1NRSH 1FN8A 3U1JB 5C3NA 2PLXA 1T4VH 3E0NB 3ZVBA 5BRRE 1SGQE 2R0LA 2J5UA 1E79D 3M5LA 4INKA 1C5ZB 4JZIA 3OE7D 1LQDB 2UUFB 3EDXB 1IQEA 4INHA 2VWMA 5B6OA 1SGPE 4B75A 1HCGA 1C5XB 1BIOA 1FV9A 5GIBA 3DD2H 1ANBA 1CGHA 2KZ4A 2ZU4A 3S7KB 1TGNA 2BX4A 3HK3B 3LU9B 5EOKA 4NWLA 4OS2A 4WXVA 3A7YA 3ZVEA 1T7CA 4HFPB 2PSXA 4XOJA 2OBOA 1DFPA 1QZ8A 1VITH 1N8OC 1V2KT 1XXDA 1Z8IB 2P3FH 5J4SA 2BQWB 1TNGA 1WQSA 3MO3A 3RC5A 1VCQA 3SI4H 1PQ8A 3GICB 3PM3A 5A8XA 3TITA 3GY6A 4SGAE 1C1VH 3ATKA 4ASHA 2W6ID 1QJ1B 3GYLB 1WCZA 1DOJA 3TGKE 1PPFE 1HGTH 1G3CA 5A2MH 2PUQH 5AFYH 2OTVA 4YTAA 1P2JA 3KQDA 1ELEE 2O8WA 1TA2A 1HAYB 2UWLA 1O3CA 2RA0A 2XNDD 2ODQA 1C1MA 1NBME 3BTGE 2J97A 2KCAA 2FTLE 1YP9A 1V2MT 2M5TA 1BDAA 3UAIC 1V2VT 1F92A 2A5KA 3SYJA 1LMWB 2GGVB 1C4U2 1T32A 2ZHWH 1CGJE 3PMBB 5T6DA 1P3CA 3VG8A 2W26A 4F49A 4CH8B 3VB5A 4LOYH 4JZFH 2ILNA 4X1NU 5J4QA 1MZDA 4R8TB 1PQ7A 3RXGA 3GCHB 1O2NA 1NFYA 1GBIA 1K1NA 1DY9A 3UY9A 5CE1A 2CMYA 4WY3A 4CRCA 4WXIA 2ZQ2A 4HTCH 3FANA 2BDYA 5FPSA 3UNQA 2OCVB 4IBLH 6ESTA 2GP9B 4ZKRU 3VB4A 1GL0E 1KTTB 1O2KA 5DGJA 1IQFA 1LQEA 1Z6JH 2HLDD 1MABB 1RTLA 1C1OA 2ZEBA 2GT8A 3VPKA 4BANB 4UDWH 2FDAA 4B1TA 1KYNA 4ACBA 2XOKD 5FBIA 5EIYA 1ETSH 2BD7A 2FX4A 4GHTA 3Q3KA 2ZGCA 5JDUB 1BRCE 3UQOA 2WZQA 1QTFA 3HPTB 3SU6A 4WMEA 3ZZBA 1GDUA 2UUKB 1UMAH 4DW2U 1SQRA 3WWFA 4AGKA 3TPIZ 1MTNB 2VH6A 3OX7U 2IOTA 3GCTG 3PWBA 4LXBH 1DWBH 1O2OA 2IPHA 3FOAA 3U98H 2BOHB 1P01A 3NKKA 5E0JA 3LJJA 4MNWA 2PTCE 2F3CE 1ZGIA 1FY4A 2BQ7B 3Q77A 1BCUH 3RU4T 2R2WU 4Y76A 4AB8A 1O3MA 1ZPZA 3EAJA 3TH4H 1E35B 1BITA 1ELVA 1GI7B 1YPHC 2WUBA 5I25A 5CMXH 3D65E 3F0PA 1TPSA 1Y59T 2YNAA 2ZTXA 3OU0A 4I7YH 4GCHG 1G2LA 4Y0ZE 1KMHB 1FLEE 1V3XA 4YESB 1IQHA 3UIRA 4FU9A 3WWBA 2VB0A 4OGXA 1FQ3A 2W5EA 1UK3A 2LPRA 1J16A 3RXAA 2WPMS 4YOIA 3KCGH 1HAVA 2Z9KA 1MMJN 3MI4A 1J9CH 1TOMH 3S7HB 5EJZA 3ZZ3A 2FOHA 4NIWA 3LT3A 3SHCH 4BXSA 3KNXA 1TX7A 1XM1A 2QCYA 1AO5A 5F53A 3ZIAD 5C1YA 4YO9A 3NUMA 1MD7A 4GAWA 1AB9C 4U32A 3LIWA 1WU1A 1ELAA 4J2YB 4CREA 2SFAA 4LK4A 2FX6A 2ZFFH 3URCA 1DT2A 1Z8JB 2P93A 1SQAA 4K1EA 3LGYA 1GCTB 1P3EA 4ISLA 2ZQ1A 1KXEA 1UVUH 1A7SA 3SUFA 1TGBA 3I77A 3GCTF 1N1LA 1C5WB 2FOGA 3GY5A 1C1SA 2FI5E 3I78A 3E3TA 2BHGA 1K1PA 6GCHG 3RXEA 1MUEB 4OS1A 4O9VA 4KTSA 3RXLA 2GX4A 1DWCH 1GBMA 3O8BA 3FKSD 4XD7D 3QZQA 2BY9X 1EB1H 3EBNA 1FZZA 1NU7B 1L1NA 4ABJA 3A7TA 2A31A 4CHAC 2Y6TA 3LKWA 4GCHF 2WHXA 1MCTA 3A81A 1AZZA 1O32A 3BV9B 3NXPA 1CT4E 4M7GA 2SGEE 1U6QA 2TGTA 5E0HA 4Y8YA 4K8YA 3TJUA 2WYGA 4FUFA 1DM4B 1UTMA 5DP3A 1AY6H 3C1KA 4YLUA 4ZAEA 1FIWA 3BG4C 4H6TA 3SW2B 4NIXA 3PLKA 1LDTT 4NCYA 1SVPA 2AMDA 1P2KA 3OEHD 1FI8A 3M37A 1DSUA 3ZZCA 4NFFA 3BEFB 1P2OA 2A4OA 1ZR0A 5DSFA 4Y10E 4DIHH 2QF5A 4ZCNA 6LPRA 3BTKE 1KDQB 1C2KA 1P57B 1P9UA 1E1RD 1PQ5A 3A80A 3BTEE 3GOVB 4UEHH 3T2NA 2A7JA 1N6XA 2FS9A 1QA7A 1ELDE 1LTOA 3E0PB 3M7QA 2OD3B 1DS2E 1QRXA 3PRDA 5EPNA 1OYTH 2BDAA 1O33A 1CBWC 5T6GA 3D62A 1GJDB 5T3HA 1HRTH 2F91A 6GCHF 3L3TA 4BAMB 1JOUB 5JB9S 1ZRKA 1UVOA 3MFJA 4D9QA 4NSYA 4B73A 1CA0B 4DVAU 4SGBE 1GDNA 1SHHB 3DA9B 2FWWA 2D2DA 1O2PA 1NROH 4U2WA 2B9LA 2HPPH 1GJ6A 5EQQA 3QTVH 3F0OA 2XWAA 1SMFE 1UJ1A 1ESAA 1TQ7B 1FY1A 3SU0A 4GVUA 3S9CA 2C3SA 1ELTA 3ITIA 3HGPA 1E38B 1J15A 2WPJS 1W0ZU 5F6MA 1J8AA 1GMHG 3NZIA 4KELA 2QE7D 3TK5A 1HAIH 4NWKA 2BXUH 4NZLA 4INLA 5C20A 5IDKA 1HAOH 2HWLB 2WPKS 2STBE 1HAHH 5GNDA 4TPYA 2PUXB 1W7XH 2ZF0H 1T4UH 2ZWLH 1QL8A 1W12U 1HJ9A 1GBJA 3A89A 2RCEA 3KIDU 4B6EA 2FXRA 1YLDA 3ZZ8A 3M3VA 5KEDA 7ESTE 1D6RA 3ZV8A 2Y5GA 2FI3E 4Y71A 1BRUP 2ALVA 1OWKA 1KLIH 5GCHF 1KXCA 1GVKB 1BRBE 3K9XB 3RXOA 1BTUA 3T27A 1QL7A 5DKMA 1Y3YA 3DHKH 4IGDA 2ZDNA 3QGNB 2FM2A 3VEQB 4HGCA 1OP8A 5DN6D 3QX5H 3E16B 1J17T 2ZU5A 1OOKB 4NIYA 4AYVB 1LHCH 5FPYA 3PV2A 1X7AC 1GI8B 3T28A 4AORA 3SOSA 1PYTC 5F8ZA 3PB1E 3A7WA 2YMSD 3A7VA 4CBOA 2WV5A 3PTNA 1GMHF 4WMDA
chains in the Genus database with same CATH topology
2AFQB 1D6WA 3H7OA 3LOXA 1P03A 4XE4A 1DPOA 3VXFH 1TAWA 2XYAA 3F9FA 2BMGB 1BTHH 5HGGA 2Z9LA 2A7HA 1GI6A 2CGAA 3E8LA 4X1PU 1GI0A 4UFEH 1Y3WA 1GBTA 1GBLA 5HMAA 1TIOA 4IC5A 1EZQA 2XNIA 1BT7A 1UTLM 3M5OA 4ESTE 1LCYA 3BTWE 2Y7ZA 4X2WA 1CT0E 2GV6A 3QGJA 1LVMA 1MQ5A 2H9TH 1D3TB 1NC6A 4A5TS 3ZZAA 1RRKA 2G4TA 3MH5A 3Q00A 2OBQA 8ESTE 2EC9H 2QF0A 1XX9A 2F9VA 3M5NA 1ZRBA 1EOLA 1IQJA 1QNJA 2XC5A 5F03A 2R2MB 3V12A 3SNAA 2R9PA 1TB6H 4MPUA 3RXFA 4A1VA 2P8OB 5EXNA 1C5VA 3OY6U 1C9TA 1QY6A 1V2ST 1ZZZA 2C4FH 1P2QA 2PSYA 4MNVA 3K6ZA 1GBFA 1YC0A 2ZHFH 3P8GA 1QCPA 3BG4B 3H7TA 3TIUA 3OSYA 2OC7A 2FZZA 2VIDA 3EA8A 4X2YA 2Y82A 1P2NA 2B8OH 3LGUA 1RD3B 1TX8A 5EG4A 2BY5X 5C67A 1UK4A 5HYOA 4ZKSU 3KL6A 3L6PA 1EZXC 5GXPA 3E1XB 1VITG 5EW1H 4WJG2 4Y79A 4MLFB 1B0EA 1QJ6B 1RFNA 1UTPA 4AG2A 4BAQB 3UTUH 1QRZA 2LNCA 5FCKA 3BSQA 1FMGA 1AFQC 1CBWB 1SR5C 2BD5A 4UFFH 3Q76A 1O0DH 1G2MA 1SPJA 2Y5HA 1TRMA 5GJ4B 1BTXA 1FXYA 3GCHC 3A7ZA 1OP0A 2PGQB 1A3EH 1QIXB 2B0FA 4MPVA 1FN6A 4UFDH 4BOHA 1S5SA 5AVDA 2ZCKP 3IWMA 1CE5A 1O2JA 1UTQA 1CQQA 3FZDA 4O3TA 2F9NA 4NA8A 3Q3YA 3V0XA 1FAKH 1S85A 2ZFRH 4Q2KA 1C5YB 1C5RA 3M7UA 1HBTH 2C8ZB 2XTTB 1UTKA 3ATLA 3OY5U 1BTPA 4PROA 1OWJA 1SHYA 1TQ0B 2XBYA 4OS5A 1WSSH 1LVYA 1SGTA 1YCPK 1MKXK 1V2QT 1EX3A 2OUAA 5JBBS 1DXWA 4H42U 3S9AA 1KXBA 1HIAB 1QQ4A 1FUJA 1ZMNA 2VNTA 2AGEX 3ZVDA 1V2JT 1Q2WA 1EASA 1MTNC 1GHAG 2BZ6H 4NGAH 1EUFA 2Q6FA 2PR3A 2AS9A 1VITF 3F9GA 1PPBH 2P3TB 4ZXYH 3A87A 1AD8H 5CHAB 1O2WA 1CO7E 1ZSJA 4Y7BA 1Y5UT 2KAIB 3LH1A 1YPEH 4XFQA 1SL3A 1T8MA 3STJA 2GV7A 2HOBA 1DLEA 1V2RT 4WH8A 1H9HE 1SB1H 1AE5A 5DK1A 2ZPRA 3ZZ6A 1P2MA 3FP6E 4K3JA 3UOUA 1SSXA 4ABHA 2BDBA 2BYAX 3TJNA 2QIQA 3RLYH 1ABJH 5DP7A 3FAOA 3UPEA 1A2CH 4WH6A 3SU3A 1AQ7A 1ZTJA 3KQEA 4RN6A 1YYY1 2BVXH 1C5SA 2WPHS 1GGDB 3A83A 3PMAB 3AASA 1O3OA 1TWXB 2G00A 2JKHA 1GBAA 4ZH8A 4XBCA 2Y81A 1GCTC 1AWFH 4IC6A 1QGFA 3F68H 1BMAA 3FP8E 4NA7A 1AKSB 1GHAF 1GJ7B 1TRNA 3U9AH 5HM9A 3K65B 4KGAA 5EXLA 1EJMA 3LGWA 1P10A 2ASUB 4YOJA 4ZMAH 2Z9JA 2SNWA 1GJ5H 3SV7A 1O3FA 9ESTA 3VXEH 1Q31A 3RMMH 4H4FA 2ZC9H 3RP2A 2H2ZA 4LZ1H 1DVAH 1G32B 1GBEA 1OP2A 2V0BA 3E6PH 2ZGXH 5L2YH 2ZCHP 2I6SA 1W13U 3SUDA 3UWIA 4D9RA 4DURA 1C1UH 2ZDAH 1BTYA 1O3NA 1KSNA 4ZUHA 2P3UB 3QK1A 1GI5A 5A0CA 2J95A 4YOGA 2G51A 3Q3XA 3DFLA 2NU2E 3ZZ7A 3V3MA 1YPGH 4FUCA 2ALPA 2GT7A 4ABFA 1SGEE 1XUGA 1L1JA 1QB9A 2C8WB 4ABGA 1P2IA 5EW2H 1A5IA 2D8WA 1F0RA 4Y6DA 1CHOG 1C5UA 5E2PA 2FP7B 2NU3E 3EE0B 4Y0YE 1TALA 3T26A 2BDIA 3TH3H 1VGCB 5JBCS 1OWHA 1E36B 1AFQB 1MKWK 2UUJB 2BY6X 2Z94A 3HATH 3SN8A 4BTIB 5LGOA 3LPRA 1CA0C 1NRQH 1TPAE 3ZZ4A 4TWWA 1NFXA 1P05A 1DANH 4A1XA 2VWNA 1CVWH 1EB2A 3DUXH 4CBNA 1ID5H 4ZROA 3BTME 1ETRH 3VFEA 1XKBC 4KTUA 3KHVA 2HALA 4VGCB 1WTGH 1DUAA 3EGKH 2VGCB 4OS6A 3U8RH 2BLQA 1MU8B 1DXPA 3RXJA 4NA9H 2BD9A 4D8NA 1C5QA 2P59A 2R3UA 4IN2A 3LH3A 2PKSB 3SJKA 4WMFA 3RU4E 1DDJA 1QQUA 1QBVH 3D49H 1RTKA 1AI8H 1O30A 4I33A 1P9SA 2W7UA 1PFXC 2YOLA 3H5CB 1EKBB 3R0FA 3P92A 1V2UT 4FUJA 2Z3DA 1CHOF 3ODFA 1GHWH 2ZCLP 1ZYOA 2JETC 1AE8H 3RC4A 4FUBA 1GDQA 4ABEA 3SO3A 2FESH 4FUGA 3SJOA 3ODDA 5A8YA 2UUYA 1WV7H 3NCLA 1O3PB 1H8IH 1PPGE 1NU9A 3EYDA 1GG6B 2J9NA 4IN1A 1ZMLA 4CRGA 1ANCA 2QXHA 1EAXA 2EI6A 3W95A 1SLUB 4AB9A 3GDSA 2CXVA 1EZSC 1G37A 2ANKH 3BTDE 1MQ6A 5ABWA 3SZNA 1C1QA 2CV3A 1QA0A 3HKIB 1ABIH 2WPIS 1GVZA 4K5ZA 5GDSH 3F1SB 4FUEA 2SGQE 1GHZA 1F7ZA 1G9IE 1Z1JA 1NRRH 2V35A 2H5DA 3SNEA 3RXIA 3SGBE 1S83A 4JYUH 2BD4A 4CH2B 3V13A 1TBRH 1TLDA 3NWUA 2C93B 2KAIA 2FMJA 2G5VA 4B71A 2ZPQA 4ISIH 5DG6A 1NTPA 1K28D 2XBWA 1QHRB 3ELAH 1YKTA 2QYIA 1FONA 1MH0A 3UQVA 3ZZ5A 2J92A 4DY7B 3P6ZB 3SJIA 2G4UA 2PV9B 1QB1A 3QZRA 4X8SH 1GVLA 2PWXA 3MU1A 1JIMA 8KME2 1ARBA 1AVGH 3U8OH 1WAYB 1NY22 2P8OC 1EAUA 2G52A 1HJAC 1UHBB 2K1QA 3P95A 2ESTE 2QN5T 2ZU3A 3F9EA 2QXJA 3ZVFA 2GDEH 4KP0A 3QDZB 4U30A 1LHEH 1O2VA 2V3OH 1OXGA 4JCNA 4MG3A 1GJ9B 5SGAE 2J4IA 1FY3A 2A4GA 1GL1A 1TX6A 7KMEH 2CHAB 4WWYA 1VJ9U 4A1TA 2A0QB 2J38A 4Q7ZA 1H1BA 1O2UA 4Q7YA 1BOQA 2JH5D 1O5DH 4FU8A 1O38A 2GZ7A 4NSVA 1MTUA 1ORFA 2BLVA 4TWYA 1HXEH 1OX1A 3N7OA 3NPSA 1QRWA 3ZV9A 1G36A 2FPZA 3TGIE 3SUGA 1TNJA 4HI3A 3SQHE 3RM0H 1H9IE 2AGGX 3ENSB 1AFEH 1BJUA 1WYKA 4X8TH 3TU7H 1OWDA 1NS3A 1O3AA 4X0WU 3UUZA 1SOTA 2XCNA 4GHQA 1P11E 2BOKA 1D9IA 1W11U 1ELBA 5C5NA 1WQVH 3DFJA 3TVJB 4WF8A 1WUNH 5JB8S 3A8CA 4CR5A 1GBHA 1UTJA 2W7SA 1NFWA 1O2RA 1SQTA 4MTBA 1SC8U 1SBWA 1UCYH 1V2WT 1DUEA 1Q3XA 1MTWA 2GZ8A 3SV9A 4XDEA 1UO6A 3AW1A 1P8VC 3F6UH 5HM2A 1OWEA 1A3BH 3QN7A 3SJ9A 3ZYEA 4DG4A 2VWOA 1DX5M 2BM2A 2JETB 1F0UA 4ZHLU 1FJSA 5CHAC 1GJCB 4K1SA 1MZAA 2BVRH 3SNBA 2XW9A 3PV4A 1M9UA 2C8XB 3SV8A 3RXTA 2Y80A 3P8OA 3MOCA 4MQAA 3A82A 2PKAB 4I8GA 5LPEA 5A0AE 3UREA 5L6NH 1T31A 1Z8RA 5IYTA 3EQ0H 1PPEE 1TPOA 2A1DB 1UCYK 1MAYA 2BD8A 2ZHEH 4X1RU 4D7FA 2ZHQH 3ESTA 1EPTC 1S6HA 2H6MA 2J34A 3O8DA 3MO6A 1ESBA 1UCYE 2XC4A 2ZIQH 1UVTH 1UTOA 2QF3A 1A4WH 2WV4A 1C2DA 1K22H 4CRBA 2OQUA 3RXQA 1KXDA 3D23A 1GGDC 1PPCE 2O9QA 1VZQH 2BLWA 3U8TH 1QJ7B 1BUIA 1YPMH 3MU8A 4CRFA 4OS4A 1V2OT 3QUMP 2P95A 3JZ2B 4NG9H 2Q1JA 1C1RA 5C1XA 1ZPCA 2G5NA 3R3GB 1K21H 4MDSA 1ZMJA 1AU8A 1PPHE 2BY7X 1C5OH 1EP6A 2VWLA 1C5LH 1MAXA 2IN2A 3MTYA 3G01A 4E7RG 1HFDA 3BEUA 4Q7XA 1PYTD 4YLQH 5TCCA 3UR6A 2ANWA 1O31A 2QAAA 2FLRH 1TA6A 3RC6A 2Y7XA 4Y8XA 1HYLA 1GWAA 3BTTE 3S69A 1QURH 3T62A 2ZPSA 4Z6AH 5JBAS 4MNYA 5EPYA 1TNIA 1RGQA 3GDUA 1EATA 1K1LA 4AFUA 2ZTYA 3FFGA 1GHYH 2TBSA 5FX5A 1Y8TA 5JBTA 1HJAB 4E05H 1EXFA 1SGCA 1SGNE 1HUTH 1TE0A 3K2UA 1O2QA 1ZTLA 1EAIA 1ZHMA 3LONA 4B74A 1XMNB 1V6DA 3GYMA 2QY0B 1SLVB 1EZUC 4JK6A 2JH0D 3RXDA 2ZU2A 1IAUA 3RXKA 5DJ7A 3SJ8A 2ZDKA 4I8HA 5ESBA 2RA3A 1F5RA 2P16A 1K1MA 1GJAB 4AGJA 8GCHG 5JPMH 1KY9A 2FLBH 3JZ1B 1Y5BT 1YGCH 2EI7A 2HLCA 1F0SA 3MH4A 1VGCC 3KN2A 1ZHRA 3TK6A 1YCPH 1E37B 1MKXH 1H4WA 3HK6B 3ZVAA 1UTNA 2HNTE 4O03A 1OS8A 3SU1A 1D3QB 3RXPA 4UD9H 1BA8B 1IQIA 1S82A 1BHXB 2GDDA 3PROA 1MBMA 1JXPA 5FHTA 1K2I1 1TMBH 3MH7A 5T6FA 1UHBA 1L1GA 3SBKA 3LC5A 3SORA 2W3IA 4VGCC 3SV2H 2BTCE 1JRSA 2YNBA 2SGFE 2VGCC 3SGQE 4FUDA 2ULLA 1ZJKA 2XXLA 2OLGA 3TNTA 1P02A 2GVFA 2PKSC 1TPPA 2HVXA 1O3HA 2VJ1A 2Z3EA 1ZSKA 1K1JA 2OC0A 1MD8A 3CENA 4AN7A 1O2TA 1KDQA 2GKVE 3M5MA 1ELCA 1FIZA 1O3BA 3SNCA 5LPFA 1ZPBA 4Y8ZA 4ZKOU 1V2NT 1GBKA 3SI3H 2FOMB 4YZUA 4IMZA 8GCHF 3MWIU 1RXPA 1C5PA 1YLCA 1TBQH 1BB0B 1INCA 4B2BA 1C1NA 1O2HA 1ZHPA 1F5LA 2AYWA 2R0KA 4X6PA 3WY8A 1KIGH 1GG6C 1K1IA 2F9UA 2ZNKH 3RDZA 1OKXA 1Y3UA 2FOFA 1SLWB 1SGRE 3HGNA 1C2MA 4FVDA 2ZP0H 2XRCA 2DUCA 3LGVA 1EPTB 3U69H 5DP5A 2OINA 7GCHG 1W8BH 2VIPA 1MU6B 2XBXA 4AZ2B 2AMQA 3LJOA 1MTVA 1DE7H 2OXSA 3STIA 1L4ZA 3EA9A 3A84A 1SFQB 4NZQA 1KLJH 2RG3A 2JH6D 4AX9H 1AVXA 1GI4A 1QR3E 2BDCA 4IMQA 2VVCA 1AMHA 3LC3A 4BTTB 1W3CA 1BZXE 2AH4X 3CS7A 3RXRA 3TLOA 1CA8B 2HRVA 3KGPA 2XBVA 3RLWH 2F9PA 3AW0A 4ABBA 1AN1E 3RMLH 3F9HA 4YM9A 1ELFA 1TONA 1MTSA 3TGJE 3OTJE 3E91A 4JK5A 1BBRK 3M36A 4AFSA 1O2SA 1KLTA 2VIWA 2XWBI 1QB6A 1YCPM 1LPKB 2ZHDA 1BBRE 2AEIH 2PKAA 4ISOA 1O3LA 2BB4A 5C2ZA 4ABDA 3SUEA 2A5AA 5E2OA 1XKAC 4RKOB 1DWEH 2H1UA 4DOQA 2VIVA 2A2QH 1D3PB 4IS5A 1SGFA 1A61H 3AAVA 3AVZA 1O3JA 1THSH 2I6QA 2O8TA 5GPIB 2GCTB 1O36A 4BAOB 1TMUH 2ZO3H 1MKWH 2TGDA 5DPAA 4LZ4B 4ZXXH 4I8KA 1IHTH 7GCHF 3SNDA 5DP8A 3ATIA 4OGYA 1GMDG 2F9OA 4B76A 2DE8A 4TY6A 2CHAC 1LPZB 2A45B 4AFQA 1EJAA 1A0LA 1TNLA 3L33A 4FXGH 2ZZUH 3VB3A 1MCVA 1O5BB 2G81E 1C1PA 2QV1A 3B9FH 1BTWA 3RXBA 3SQEE 2ZFPH 1C5TA 4ZHAA 1BMLA 9LPRA 2BZAA 1D3DB 1OYQA 3M35A 1F0TA 1V2LT 2ZA5A 1QFKH 3A8DA 2TGAA 1DITH 2B5TB 1ZOMA 1RIWC 4FVBA 1NFUA 1C5MD 1ZGVA 4X8UH 4WVPE 2Q6DA 1ANDA 5K7RA 3BIUH 4UE7H 4D76A 1AWHB 1DLKB 2P94A 1SG8B 1NPMA 2A5IA 1P06A 1BMNH 2BY8X 2XC0A 3FP7E 2C90B 3RXUA 1HAPH 4AOQA 3HKJB 2SGPE 1NO9H 3BTHE 1SFIA 5EQSA 2GD4B 3PO1B 4AG1A 5A09A 4XBBA 1AGJA 4I32A 4A7IB 1SI5H 4XBDA 3GY7A 3M3SA 2EA3A 4X1SU 1V2PT 1GMDF 1P12E 2VINA 5FX6A 2AERH 1GBCA 4KTCA 2Y5FA 1SGIB 1E0FD 3GISB 3MNCA 2VIQA 2ODYB 1C9PA 5FPTA 1A0HB