1Q2WA

X-ray crystal structure of the sars coronavirus main protease
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
295
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords nonstructural polyprotein pp1a
publication title X-Ray Crystal Structure of the SARS Coronavirus Main Protease
rcsb
source organism Sars coronavirus
total genus 88
structure length 295
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2003-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1q2wA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1q2wA02
2Z3CA 1AFQB 1MUEB 1EB1H 1TQ0B 2P3FH 1C2IA 1TX7A 1F7ZA 1KLIH 2W26A 2VNTA 2ZFSA 1QBNA 2J2UA 2ZG0H 3SBKA 4HGCA 1FDPA 1KXBA 3BG8A 4BAHB 1O39A 1V2QT 2J9NA 5K0HA 1P8VC 3A8BA 1C4Y2 1UK3A 3ZVEA 2F9OA 4YM9A 1GBDA 1TOCB 1DUAA 3RP2A 3I29A 2FX4A 2FWWA 4I8HA 3LH3A 3RXEA 2J92A 4B75A 4NWKA 4K69A 1TONA 4R8TB 5HXFA 3MU1A 4Z0KA 2NU2E 1D3DB 3E1XB 4H6TA 2P93A 2LIZA 1TE0A 5GIBA 3TJNA 1C5PA 2OBQA 4UFFH 1UTLM 2GV7A 1HAGE 3QTOH 1O5BB 3RXMA 1AUTC 1FI8A 3A7YA 1EAXA 1C1WH 1JXPA 1P2NA 2FZZA 3B8JA 1EX3A 1YPHE 1O3IA 2HOBA 4OGYA 1AN1E 3DD2H 3Q76A 1XKBC 4WVPE 1MTVA 3ELAH 1FY5A 1S81A 3HGPA 2QC2A 1VITH 2YNAA 2G52A 1SGRE 2W3IA 3ZZAA 2ALVA 1NZQH 3P8FA 1NM6A 1KLTA 3R0FA 1GBFA 1GI3A 1B7XB 4JYTA 4X2WA 4B2CA 1OYTH 1CT2E 3E91A 1Z7KA 3RXRA 2ZU3A 3FZDA 1SL3A 1ZPZA 2BLWA 5IDKA 2ANMH 1IQLA 4ZH8A 3RXSA 1OWKA 2TPIZ 1TX8A 2HRVA 1T32A 4CREA 1GBCA 4LOYH 5B6OA 4ZHLU 7GCHG 1GG6C 1FPHH 2A2QH 2XCNA 4SGBE 2BX3A 3BTWE 1NFUA 3GCTG 3L3TA 2ZU2A 1AWHB 3KQEA 2BD7A 1AD8H 3KQDA 4DG4A 2A4OA 1VCWA 2PUXB 1HAYB 4ABFA 1ANEA 4BTTB 2AMDA 2GKVE 2QAAA 2FOCA 3KCGH 1BRAA 1O2HA 4ISIH 1MD7A 1ETTH 3BTGE 4JK5A 1MQ6A 3U69H 2PTCE 3LGIA 3LKWA 3GICB 1GJBB 1LMWB 2OC1A 3F68H 5AVDA 4ABDA 3M3SA 1BCUH 2OP9A 4ASHA 1YP9A 2P8OC 5EPYA 2CJIA 3RXAA 1YCPK 2FYQA 1BZXE 1ZSKA 3ZZ7A 3BTFE 1GBJA 3ATMA 4Y76A 1J17T 1ZGVA 3A81A 1V2KT 1CU1A 1HRTH 2FIRH 5E0HA 3N7OA 1QA0A 4PROA 1U6QA 3MH7A 1FIWA 4RKJB 1W2KH 4X0WU 5EODA 1V2MT 3LC3A 1A5IA 4FUEA 4Y10E 3RXGA 1ELGA 1BB0B 1TALA 1TOMH 3ZV9A 1ELBA 1O3CA 4WH6A 2P8OB 4IS5A 2QYIA 1GJ5H 1QCPA 2PGQB 1M9UA 1DLKB 5LPRA 1ELVA 2A4QA 1KSNA 2GV6A 1SGDE 1OPHB 1BMMH 4AYVB 1AIXH 4Y71A 1P9UA 4GUXA 1HLTH 1EAIA 2ZGCA 3MOCA 2OQ5A 1GJ9B 5TJXA 3EA8A 1HNEE 1YPMH 1SGFG 3RMOH 2PTNA 2LNCA 1ZTKA 2VH0A 1HAOH 1B0FA 1O2PA 3LOXA 2Y7ZA 1OWHA 1GI8B 4OS2A 1QBOA 3MU5A 1SB1H 1G3EA 2AMPA 3FAOA 4ZXXH 4LZ4B 3A83A 4ZHMU 1G32B 1QURH 1PPBH 3D49H 1UK4A 4Y8ZA 1IQIA 4WMEA 1V3XA 2SGEE 2JETB 3BTQE 4U2WA 2FTLE 5GDSH 4NGAH 4K1TA 1P3CA 3LU9B 2XC0A 1A1RA 2XW9A 5JBAS 7ESTE 1ZTLA 4CR5A 4KKDA 2R3UA 3QN7A 1HAPH 1PJPA 4NFEA 1HJ8A 1V2JT 3RLWH 1EJNA 2BQ7B 1EZSC 1FY4A 4O3TA 1GI9B 1C2JA 1RIWB 3GCTF 5C3NA 2EI8A 2WUCA 3H5CB 3SU2A 2ODYB 1GI1A 1VR1H 1YBWA 1YPEH 4X1PU 5EXLA 2FYRA 3K9XB 1P03A 1A0HB 2TBSA 1UHBB 2ULLA 3PWCA 1V2TT 3MH4A 1SGCA 4A1XA 1MTSA 1IHSH 4D9RA 2F9PA 4AGKA 5L2ZH 1O2WA 1C2LA 1SI5H 1J15A 1K1PA 3LJJA 1TIOA 3DFLA 3SW2B 1SLUB 3H7OA 1TX6A 3P8GA 2O9QA 3W95A 4BOHA 2D8WA 4ABHA 1SGQE 2ZCLP 1P3EA 3P6ZB 3RU4T 4NWLA 1XMNB 3ZVDA 3TH4H 1F5RA 3Q3KA 1MU8B 1BJVA 3RXTA 3A7ZA 4YOGA 1KY9A 5A8XA 1S6FA 3UOUA 3V0XA 1W10U 3UTUH 4NCYA 1O38A 5DP3A 5A8ZA 1EAUA 4OS4A 3SU5A 3K6ZA 3RXCA 2BY7X 2XRCA 2VU8E 4XOJA 3E16B 2GMTC 2KAIA 2A7JA 1FN8A 2VIVA 1BUIA 2Z3EA 5DP6A 2HNTF 2H9TH 5FBIA 2JKHA 4Z6AH 1TBQH 5DP4A 2P3UB 1PPGE 4UE7H 1GJAB 5HYOA 5A0CA 2B9LA 1SGIB 1VITG 4IN1A 2FI5E 2GCTC 2BVXH 3ODFA 1P57B 2CHAC 5C2ZA 1DXWA 2GMTB 3GY3A 3V12A 3KF2A 5F8XA 3ZZ8A 1MU6B 2BD8A 2FP7B 3GYLB 1CA8B 2H5CA 1QFKH 3ENSB 1AWFH 4ZMAH 1XXFA 3A89A 2GD4B 2Z9GA 2FOHA 3SZNA 1SQTA 1W8BH 4Y8YA 1NESE 1P2QA 3ZZ3A 1O3HA 1P11E 1JOUB 2GCTB 4Y79A 3T26A 4NG9H 2GX4A 1QBVH 1ZPCA 1ANBA 4RN6A 4FUDA 2BDYA 1J16A 3RMNH 4Q80A 2Q6FA 1ZOMA 2WUBA 2SGDE 1HIAB 1T8NA 1D4PB 1EJAA 2VVCA 1P10A 4ISOA 1ZZZA 2STBE 1IQGA 2A7HA 3RXLA 1GCDA 2Q6GA 1SLXB 2VWOA 1WSSH 4TPIZ 1QJ7B 3M7UA 1C2MA 1MZDA 3RXFA 2FOFA 3PO1C 4FUIA 5CHAC 1O3LA 1THRH 4KGAA 2WYJA 1J14A 1E0FD 3L6PA 3ATIA 3HKIB 3CP7A 3SNBA 3QZRA 1V2UT 4CRDA 1KTSB 4TYDA 3GY5A 1BTXA 2XCFA 1GBEA 1C2HA 5FPSA 1GJ6A 1OKXA 1FZZA 4ZXYH 8ESTE 1EKBB 3ZVGA 1TYNA 1E37B 1TGNA 6LPRA 1BBRE 1EB2A 2VGCB 4WXVA 1BT7A 3U98H 5JYIA 4O03A 1AKSA 4NIWA 4UFDH 3UR6A 4AFSA 3PO1B 2Z9LA 2I6QA 3TITA 4TWWA 3P95A 5CHAB 2H2ZA 3EA7A 5T6GA 1O2VA 4Y7AA 1O3KA 1V2VT 1ELFA 1IHTH 1C5TA 2VWNA 3PTNA 3QX5H 3SI4H 1UCYH 4ZKOU 2K7XA 1OX1A 1IQJA 1T8MA 5DP8A 4F49A 4FU9A 3EA9A 1TPSA 1GJDB 1S83A 1C5YB 1K1NA 1F0SA 3ZVAA 2Q6DA 1DOJA 2V0BA 3MH6A 1K21H 1PPFE 2VIQA 4A5TS 2VJ1A 3OSYA 1AO5A 1F0UA 1RRKA 1NRPH 2FLBH 4I31A 2PW8H 2ZU5A 2BM2A 2F3CE 2A5KA 3LONA 3UQOA 2CXVA 8LPRA 3A8CA 2QXIA 1VITF 2ZGHA 1AVWA 2F83A 3IWMA 2QF3A 2OD3B 2RA3A 1XUJA 1KXCA 3PLKA 4A7IB 3A80A 2ZHEH 1C1SA 2FEQH 1HCGA 1DY8A 1BHXF 3UNSA 3BN9A 2ZHWH 3SU1A 2TGAA 1GBIA 4TWYA 3T62A 1IQMA 2ZHDA 5FBEA 3SNDA 2PFEA 3RMLH 3LDXH 3T2NA 2ZU4A 4X6NA 1YPGH 2AERH 2XC4A 2FS9A 1FV9A 2XYAA 2DE9A 4CH2B 3UQVA 2UUJB 5T6DA 2P94A 5FPYA 3SU3A 4GAWA 1OYQA 1QJ6B 3TU7H 3F1SB 1HFDA 1KYNA 1P2KA 1Z6JH 4X2XA 2OC0A 2P95A 1FY1A 4IMQA 4YTAA 1IQFA 1NTPA 1RXPA 3HGNA 4D9QA 2Z7FE 2C8WB 1GBHA 2A1DB 2GCHF 1Z8RA 3PLPA 2O8TA 1VGCC 1C1QA 4FUGA 2KAIB 3PTBA 3P8NA 5SGAE 2FODA 1C1UH 4WMFA 4ZHAA 5LH8A 1LVOA 4H42U 5GPIB 3M7TA 3M36A 2WPJS 1O31A 4Q7XA 1D9IA 4A92A 1OOKB 2WINI 4U30A 1DWDH 2ZQ2A 3VGCC 4DY7B 1GBMA 4CH8B 3LT3A 1HAHH 3U1JB 1K1LA 1VGCB 1H8DH 2XWBI 1O2SA 2Y7XA 2HNTE 1GI2A 4Y11E 2BDHA 3ZZBA 3V13A 1BIOA 1ZR0A 4B76A 4LK4A 3E3TA 1TFXA 2BDIA 4B73A 1PPHE 2IPHA 4X2VA 3SV7A 4FUJA 4GHTA 4LZ1H 4WH8A 2WV4A 3NUMA 1P06A 1V2OT 2VWLA 4WXIA 2BXUH 4AFQA 3HK6B 1O30A 1NROH 3VGCB 1ETRH 3RXKA 4DVAU 2BD3A 2AH4X 2V3HH 2ZGJA 2Y82A 2Z6BD 2UUFB 1BJUA 3RXQA 2Z9JA 2ZDNA 2ZP0H 2ZI2H 1WU1A 2BY5X 3I77A 2ZFTA 2CGAA 4DOQA 1T8OA 1V2ST 1O2NA 1UVTH 3GY4A 5FCRA 1A5HA 1UO6A 1YGCH 4K1EA 4KTUA 2ALPA 1A2CH 2Y80A 4UFGH 2ZCKP 2BY8X 2NU4E 3DT0H 3ZVBA 1BRBE 5K7RA 1GPZA 1EUFA 2C8YB 5CMXH 4NSVA 1FONA 5A0AE 1OP2A 1SSXA 2ZA5A 4X1NU 9ESTA 4JYUH 1WTGH 4JZDH 1C5VA 1SHYA 1NRQH 1KTTB 1GJ4H 1O5FH 4INKA 1V2RT 4TPYA 3G01A 3UREA 5DK1A 3SGBE 3A8DA 1QQUA 1J8AA 2ZFPH 1SR5C 1OWEA 1A3BH 2WYGA 1LHCH 2A32A 3WY8A 1CHGA 2A7CA 1AKSB 1T7CA 2XNIA 2XC5A 1A61H 3O8RA 3TVJB 1L4ZA 1TGSZ 1E35B 1X7AC 2FOBA 3VB7A 3FANA 3RC5A 4YT6H 1O37A 2F9BH 1O2RA 6CHAB 1GI5A 5L30H 1Y3XA 3TNTA 2VIOA 4K60A 1LQEA 1W0YH 2PKSB 3TJVA 1L1NA 4OS7A 1YCPH 3S9BA 4K5ZA 1P12E 1AFEH 1K2I1 3SJIA 3URCA 1TRMA 1YKTA 1Z8JB 1OWDA 1NU7B 1K1MA 3E8LA 2WPHS 3SI3H 5C5NA 3KIDU 5EGMA 1HXEH 1P01A 1ARBA 2THFB 2A5AA 2OXSA 2ZNKH 1ANDA 1SGYE 4H4FA 2P16A 1D3TB 1IQEA 1O2JA 4AFUA 2FX6A 3VEQB 4JCNA 3DHKH 1N6XA 2BYAX 4GLYA 4B74A 1DY9A 1BMNH 2AIPA 5I25A 1QJ1B 2HNTC 1NO9H 2BDBA 3MYWA 1XUFA 3FP8E 5E0GA 5E2OA 4D8NA 4NA9H 1DM4B 2PLXA 2EA3A 4MQAA 2VVVA 1WTHD 2F9VA 2GDEH 3C1KA 1FAXA 4RKOB 1N1LA 1SC8U 4RSPA 3I78A 3PLBA 3RDZA 1GHXH 3QK1A 1O5CB 3FVFB 3FP6E 3MU4A 4UD9H 4NSYA 2J94A 3Q3YA 1A0LA 4GVUA 1A5GH 3LGWA 1RFNA 1D6RA 1WAYB 3RU4E 3TPIZ 3B9FH 2JETC 5GCHG 3U8TH 2Y5FA 1EJMA 1S84A 1SQAA 5CE1A 2H1UA 4JMYA 1EPTC 1QB1A 3M5MA 3HK3B 3VB6A 2HLCA 3HKJB 2LPRA 3A84A 4INLA 2JH6D 1GBKA 3NWUA 1UJ1A 2BD5A 2XBYA 1QRZA 1FIZA 3SN8A 4H6SB 1E34B 3A7XA 4XBCA 1L1GA 3KNXA 1A0JA 1O3PB 1SGEE 3KHVA 4A1TA 1TA6A 4X2YA 1HAVB 1BRCE 2AGIX 5LGOA 1RIWC 1F5KU 3SU6A 2Z3DA 1C9PA 1MH0A 2ZU1A 2D1JA 1CGHA 3TGIE 1GJ7B 1OXGA 1EPTB 1DE7H 1P09A 3P8OA 4BAQB 1ZMNA 4HTCH 2GZ7A 1C2GA 1MBQA 1L2EA 3SJ8A 1IOEA 1O2TA 1PQ8A 1VJAU 3PMJA 3DA9B 3MU8A 1P2OA 6ESTA 1GHWH 1C5OH 1TNIA 1NN6A 4YZUA 1AVXA 4B1TA 4ABGA 4DW2U 5BRRE 1XM1A 5FHTA 4FUHA 1TRYA 2PSYA 2VIPA 1OWIA 4KELA 4I8KA 4AZ2B 2ESTE 2K1QA 2Z9IA 1DSUA 1O2GH 4OS6A 4K1SA 4Q7ZA 3A82A 5LPFA 1S5SA 4IN2A 2EI6A 2FMJA 4Y0ZE 1Y5BT 3RC6A 1OWJA 4TY7A 1O2IA 1G2LA 1C9TA 2ZEBA 3M5OA 3MTYA 1JBUH 1GL0E 2ASUB 1VCPA 2FPZA 1XX9A 2DE8A 2OUAA 1O2KA 3PV4A 2A2XH 2H9HA 5E8EH 3E90B 1TBRH 3RMMH 3T27A 4HI3A 2BOHB 3BTKE 1CT4E 2ZF0H 1T31A 1RGQA 1YLDA 2J4IA 1OP0A 1EQ9A 3UNRA 2GTBA 2ZZUH 2OLGA 1ZJKA 1C2KA 3A88A 1BTUA 1A7SA 1PQAA 1QA7A 3TNSA 7LPRA 1ARCA 3EGKH 4IMZA 3SORA 1F92A 3P92A 1THPB 3TK5A 3RXBA 3GDUA 2A4GA 1EZXC 3SGAE 1XVOA 3LC5A 3P17H 5GXPA 1UTNA 3ZZCA 1AI8H 4CRGA 4YOIA 1NS3A 1Z6EA 3GY2A 3TGKE 2UWPA 4CRFA 3A87A 4MNYA 2Q1JA 3BG4C 1HB0B 3S7HB 2G4UA 1EAWA 3RXJA 4CRCA 1Y3YA 2JH0D 4FVBA 1W7GH 2G55A 2WPKS 3AW1A 1CBWB 1UVPA 1INCA 4X8VH 2TGDA 8KME2 1GI6A 1H1BA 1C5RA 4WY3A 4DIHH 2AIQA 5GCHF 2HPPH 1O2UA 1CO7E 2BDAA 5JBBS 2A31A 2R9PA 1GJCB 4X8SH 1H4WA 3BG4B 3O8CA 1NFYA 1DSTA 1XKAC 2HWLB 1V2LT 3RXDA 1JRSA 1B5GH 2TGPZ 3FP7E 2BY9X 3AVZA 1BHXB 4E06H 1SQOA 1C5NH 1C5XB 1QB9A 3ITIA 5F8TA 2BVRH 5J4QA 1ABIH 1TWXB 1SVPA 1EATA 3JZ1B 2QIQA 2DUCA 1ELTA 4BTIB 4O97A 5JBCS 4XE4A 1O2LA 3O8BA 2QXGA 2ZFQH 3GCOA 2QY0B 4D76A 1AVGH 3SJ9A 4CHAB 2BDCA 2VIWA 3RM0H 4BAKB 5JDUB 3UUZA 1EASA 3STJA 2HGTH 3ZZDA 1JIRA 3PMBB 1C1NA 1KXEA 4MPXA 4AGJA 2ZWLH 3OU0A 4DJZB 1GDUA 3KN2A 1ZLRA 2GDDA 5T6FA 2R0LA 2R2WU 1O5AB 3SGQE 1KXAA 1GI7B 1WBGB 4Q2KA 4BNRA 3STIA 3VPKA 2YOLA 4O3UA 4GSOA 3GOVB 1YCPM 1MTWA 3B23B 2GCHG 4I8GA 1P05A 1BBRK 2ZDAH 1GVLA 2BMGB 1PQ5A 5TCAA 4LXBH 1O2MA 5C1UA 1RTKA 2VGCC 3SHCH 1LHEH 2UUKB 1MKWK 1XUIA 1MAYA 4AG2A 5LPEA 3LJOA 3S69A 5AFYH 1ESBA 3QUMP 2O8UA 2PR3A 2ZKSA 3U8OH 4ISNA 2G00A 3M3VA 1C1RA 2J95A 3BSQA 1O3FA 1G3CA 1Y59T 1BA8B 4X1SU 3HPTB 1EZQA 3SHAH 1V2PT 1JRTA 5EPNA 1HJ9A 1O33A 2J38A 1SLVB 1SBWA 1Y5AT 4D7GA 3ZV8A 3GY6A 2FDAA 3AW0A 2VH6A 2C90B 3F6UH 4JZFH 1XUGA 1UTMA 5DP9A 1FXYA 2SFAA 2ZTXA 3K2UA 4DGJA 3Q77A 4ABIA 5ESBA 1AGJA 2BOKA 1MMJN 1KXDA 2OQUA 1XVMA 1RTFB 1PQ7A 2QXJA 4B71A 1GGDB 2V6NA 5H4IB 3ZYDA 1FJSA 3BTTE 5A0BA 3UWJH 3SU4A 2I6SA 1TNHA 2ZGXH 1S85A 2NU3E 4X8TH 3SV9A 1NT1A 2FOEA 3CS0A 2M5TA 1YPLH 3SU0A 3BEIB 3TK6A 1GCTC 4XSKU 1ABJH 3LGTA 1UTKA 3FFGA 1MD8A 2ANYA 1O3BA 1TBZH 1HUTH 1HPGA 1HAXB 1FNIA 3GDSA 1W3CA 4MPVA 3EDXB 2ZGBH 3BIUH 2ZO3H 3V7TA 1DWBH 2ODQA 3EYDA 4NA8A 3PWBA 1GHYH 4AFZA 1GJ8B 2ZECA 4MLFB 5T3HA 3AAUA 1B0EA 5FX5A 1CGJE 1P2IA 1GCTB 1TRNA 4AX9H 5HM9A 4B2BA 1DS2E 1C2EA 1ZYOA 4YO9A 1SG8B 3M3TA 4FVDA 1TNGA 2JH5D 4BXWA 2RG3A 3UOPA 1NRRH 4ZUHA 2NWNA 1LPKB 3GCNA 4IW4E 1HYLA 2PKAA 1LHDH 1ZJDA 2FXRA 2STAE 1SGTA 4THNH 4UDWH 5GJ4B 1ZSJA 4AYYB 2QXHA 4I33A 2VINA 1P0SH 4YOJA 1AZZA 4MPUA 1UCYE 1V2NT 1ESAA 2PSXA 1GBLA 3MNCA 2VWMA 2Y5HA 2QV1A 3KQCA 1C5LH 2AEIH 3RM2H 1CSOE 2EC9H 1CA0B 3LGUA 1P2JA 1QGFA 5EQSA 2XBVA 5EOKA 5FAHA 3BTHE 3PMHB 3NCLA 2XBWA 2WPLS 1C1OA 4UONA 2A4RA 1CVWH 4ISHH 1IAUA 1BQYA 1PPZA 1TMUH 2CN0H 5F8ZA 1TGTA 1TMBH 1Y3UA 2BD9A 2FM2A 1RS0A 1ZHMA 5FCKA 3TH2H 4BAMB 5EG4A 1ELCA 1G3DA 1G37A 1V2WT 1W7XH 1HGTH 3PM3A 1HJAC 2G8TA 1A3EH 2ZDKA 1F2SE 2ZIQH 2HPQH 1DITH 1OS8A 4ZROA 1TA2A 1V6DA 1H9IE 1AE5A 2ODPA 3RXPA 1O5DH 1TNKA 4XBDA 5ABWA 1H8IH 3BTME 1FQ3A 5A8YA 1JMOH 1O2XA 1LPGB 5EXNA 2UWOA 4WWYA 3BV9B 1O3DA 1SLWB 1J9CH 3VFEA 1DUEA 1TPPA 2TIOA 1HJAB 2ZDMA 4HZHA 4WJG2 3KQBA 1T8LA 1W11U 5HM2A 1H9LB 1CHOG 2GVFA 1GMCG 1VJ9U 1O0DH 1WYKA 1YPKH 4X6MA 2ZPRA 1QNJA 1C4U2 2BB4A 2G5VA 1D3PB 3M37A 4MNVA 4YESB 1ELEE 1A46H 3BF6H 1MTUA 1W0ZU 2CMYA 1GI4A 1TNJA 1BTZA 4NIVA 1AB9B 2RCEA 3RXHA 3C27B 3E0PB 5EQQA 3U9AH 1AY6H 5DG6A 5A2MH 2ZTZA 3VB3A 1BTPA 2CF9H 3ZZ4A 1QRWA 1QIXB 3ATWA 3K65B 3ESTA 2VVUA 3NPSA 3O8DA 5F03A 1GDQA 4FU7A 1SHHB 1K22H 1HAZB 1NC6A 1ZGIA 3HATH 2GT7A 2OTVA 1S6HA 2BQ6B 3M35A 3GCHC 1O5GH 4I8LA 3KEEA 1UHBA 3F9EA 2V3OH 6CHAC 3BIVH 1QL9A 1AZ8A 2SGPE 3SJKA 3ZZ6A 1G3BA 1YPJH 1SGNE 4OS5A 3UPEA 2PKSC 3M61U 1ELAA 3RXIA 1F0TA 4A1VA 4ZAEA 2FI3E 1UVUH 3P70B 1GHBG 4AORA 2FS8A 1SFQB 1L4DA 3MFJA 1ID5H 1THSH 3GCHB 4JZIA 2FESH 3SUDA 1UTOA 3AAVA 2R2MB 4BAOB 3RXOA 4DT7B 2O8LA 3SJOA 4DCDA 4DURA 3F9FA 1PPEE 3QTVH 2Z94A 1PPCE 3MNSA 3SUEA 1BTWA 5C67A 4NIXA 1AQ7A 4B2AA 3TH3H 2UUYA 5ETXA 1K1OA 2XXLA 3TJOA 1O3OA 3T29A 3MO9A 1MKXH 4JZ1A 3RC4A 1VCQA 1WUNH 4NA7A 5TCCA 1BDAA 2ZDLA 5DP5A 1YLCA 4MNWA 5DJ7A 3EE0B 1TABE 5EXMA 1PYTC 3Q00A 2GZ9A 3TIUA 1HXFH 2SNWA 2AGEX 2FLRH 2B5TB 3NXPA 4BANB 2BZ6H 3ATKA 4I32A 1G9IE 3EQ0H 2RDLA 1O3GA 8GCHG 3MNXA 3M7QA 2QGRA 2IJOB 1NFXA 1MKXK 3H7TA 1GHAG 3GISB 4K8BA 5JPMH 4Q7YA 1W13U 1ETSH 6GCHG 3LH1A 1UMAH 1GVKB 1GG6B 4MG3A 1FN6A 1DFPA 4AOQA 3S0NA 1CGIE 1Y5UT 2V35A 2PKAB 4AB9A 2XWAA 1CE5A 2PHBA 1CHOF 1GMCF 4SGAE 3T28A 2G4TA 1C5WB 4ZKRU 1AUJA 4K2YA 4X8UH 2ZFFH 4WMDA 1DICA 1Q31A 2CV3A 1NY22 1S82A 3VB5A 2XTTB 4K3JA 3MO3A 1QL7A 1Y3WA 1T4VH 1TPOA 4ABEA 2C8ZB 3Q3XA 4JYVH 3BTEE 1HIAA 5HMAA 3S7KB 1O32A 3FZZA 1UTQA 1EP5A 3MO6A 1TLDA 2SGAA 1TMTH 1AMHA 1TNLA 1S0RA 1IQKA 1YM0A 1UVSH 1F5LA 2Z9KA 1DX5M 3MNBA 1FPCH 1FMGA 1HDTH 2OC8A 3QDZB 1DVAH 1F0RA 1LKAA 1GBAA 1O3JA 3NK8A 3F9HA 1TAWA 2W7SA 3ZZ5A 3MI4A 1LVMA 1QL8A 3SNEA 4FUBA 3OY6U 5J4SA 3VXFH 3OX7U 3EAJA 3IG6B 1Y3VA 4Y6DA 3U8RH 1FY8E 1UTPA 3ODDA 4F4OC 2BVSH 1GHBF 2BDGA 2QA9E 1DT2A 1E36B 1TGBA 3VXEH 4UFEH 1XXDA 2BTCE 1W14U 4MVNA 4UEHH 3TGJE 1LHGH 1O2QA 4U01A 1YPHC 3D23A 2BZAA 2D2DA 3V3MA 1D3QB 2P3TB 3A85A 2BXTH 4CRBA 1BRUP 1FLEE 1QTFA 1ZSLA 3GY8A 3K6YA 1RTLA 2F91A 1Q2WA 2FI4E 2Y5GA 4Y8XA 4ZKSU 2ZTYA 1C2FA 2FO9A 3UFAA 1ZMLA 1GBTA 3LPRA 3KL6A 3MHWU 4ABJA 1SOTA 3CS7A 1GL1A 1NPMA 3SV8A 5FXLA 1LO6A 1FUJA 4U32A 1GMHG 1IQHA 7GCHF 1MCTA 3L33A 1TPAE 2OCVB 3ZYEA 1MZAA 2BLVA 1BITA 2ZHQH 5EW2H 2EI7A 1G36A 2G51A 3QZQA 8GCHF 1C1TA 2HVXA 2PUQH 1SFIA 2R0KA 2FOMB 4YLUA 1XUKA 1TQ7B 1GHAF 5DP7A 1PYTD 3A8AA 3ZVCA 1EOJA 1CBWC 2BQWB 4ZKNU 6GCHF 4IC6A 5E2PA 2B0FA 5L2YH 1BMLA 3PYHA 2VB0A 4OS1A 4GCHG 1SOZA 1UK2A 9LPRA 1Q3XA 2W7UA 1O35A 2SGQE 1FAKH 5DPAA 3GDVA 3SO3A 3PROA 3QLPH 1D6WA 2QCYA 4BTUB 1DWEH 2PWXA 5JB9S 2AMQA 3OY5U 1E38B 4FUFA 4NFFA 4X6PA 3ZVFA 1SMFE 1MBMA 2XBXA 7KMEH 4J2YB 1G30B 3OTJE 4FXGH 2BD4A 4IC5A 1RJXB 1O3MA 1GMDG 4Y7BA 3MWIU 1YF4A 1C1PA 4ABBA 4J1YA 4CHAC 3AASA 1C5QA 4CRAA 1Z8IB 5ESTE 1WV7H 1KDQA 1BMAA 1NRNH 1DPOA 2ZFRH 5DO4H 2BX4A 3DFJA 2BHGA 2C93B 1H9HE 1IQNA 2AFQB 4ESTE 1KIGH 1QR3E 2ANWA 2BY6X 3SUGA 2A5IA 1L1JA 4K8YA 2FOGA 1O2OA 1C4V2 4GHQA 2W5EA 5EU8A 1DANH 4BXSA 1K28D 4VGCC 1UTJA 2B7DH 2C3SA 2OC7A 4KTSA 1EZUC 3NKKA 1C5ZB 1T4UH 4ABAA 2ANKH 1BBRH 3SV6A 1LKBA 1GWAA 1GDNA 1HBTH 1K9OE 1MKWH 1C5SA 1NRSH 1P9SA 3RLYH 2H6MA 1YYY1 3MU0A 4YT7H 3SOSA 3SQHE 3A86A 1MQ5A 1LCYA 4X1RU 4GPGA 5L6NH 2NU1E 4MTBA 4X6OA 2GT8A 1SPJA 1O3EA 3UR9A 4D7FA 1LVBA 1O5EH 2CHAB 4VGCB 3BEUA 2ZDVH 4O9VA 1O2ZA 4R0IA 1CQQA 1G2MA 1QY6A 1DDJA 1MTNC 1FY3A 1LTOA 1TB6H 1DXPA 3ZZ9A 1AHTH 1GMHF 1KXFA 3S9CA 3S9AA 2C4FH 4AB8A 2G81E 4NZQA 1A4WH 2B8OH 1XUHA 2HALA 1LVYA 2ILNA 1BTYA 5C1XA 1ELDE 2SGFE 1ZHPA 1GGDC 1AU8A 4E7RG 3MH5A 3OYPA 1QHRB 1HV7A 1Z8GA 5IYTA 1DLEA 2F9UA 2O8MA 3SNCA 5I46H 1UVOA 5E0JA 1WQVH 3BEFB 2OINA 1WQSA 5EW1H 3TK9A 2GP9B 3GY7A 2R3YA 4OGXA 1EOLA 1C2DA 1O3NA 1SGPE 1MTNB 1L0ZA 2FTMA 1ZHRA 4NZLA 3T5FH 5AHGH 2WV5A 4CR9A 4GCHF 3M5LA 4A6LA 2D26C 5HGGA 1GHZA 4CBNA 3PB1E 3UIRA 1ZTJA 1S0QA 2J34A 2ZHFH 1HAIH 1OP8A 2Y6TA 4KP0A 4HFPB 1RD3B 3KGPA 3UNQA 5C5OA 1Z1IA 4TY6A 4AN7A 5AF9H 1ZPBA 1N8OC 4FU8A 2VIDA 4XDEA 1O36A 5FX6A 1JIMA 5DGJA 3W94A 4YLQH 3E6PH 4E05H 5PTPA 3T25A 3D65E 1K1JA 1ZRKA 2BLQA 3BTDE 4E7NA 1GMDF 2AS9A 5GWZA 1C5UA 1GBBA 1LPZB 3GYMA 1O34A 4IBLH 3A7VA 4X1QU 1MCVA 4DIIH 3JZ2B 3RXVA 2ZCHP 2FOAA 2AGGX 2F9NA 1Z71A 1C1VH 2SNVA 3F9GA 4FUCA 4M7GA 4MPWA 2GGVB 2A0QB 5DKMA 1N8OB 1UCYK 4WF8A 3PMAB 3U1IB 4CBOA 3ATLA 3RU4D 2IOTA 1QB6A 1GI0A 5A09A 2ZPQA 2EEKA 4MDSA 1O2YA 2GZ8A 2PV9B 1CA0C 1BOQA 1K1IA 4Y0YE 3UWIA 1TGCA 3DUXH 1PFXC 1AE8H 2UWLA 5C20A 1N6YA 4JZEH 1WOFA 5AFZH 2QF0A 4ISLA 5BPEA 4XFQA 3UY9A 1QQ4A 2NU0E 3SNAA 1DWCH 5JB8S 1P02A 3MMGA 5FPTA 2O8WA 3CENA 2C8XB 3SUFA 2AYWA 3NZIA 3A7TA 1Z1JA 3SV2H 3VB4A 3RXUA 2RA0A 1EP6A 1LHFH 4I8JA 1OSSA 1EXFA 2QN5T 1LDTT 2BD2A 2CF8H 1LQDB 1ESTA 1KLJH 1MAXA 3QGJA 3QGNB 2W3KA 4XBBA 1NU9A 2G5NA 5G4BA 1YC0A 3URDA 1BTHH 3E0NB 1WCZA 5EQRA 1C1MA 4KTCA 5C1YA 1ACBE 2ZC9H 4MNXA 1ANCA 3D62A 1SGFA 3LGYA 1O3AA 1CT0E 2H5DA 2ZQ1A 1KDQB 1Y8TA 3SQEE 4JK6A 1ZMJA 3M5NA 2YNBA 4I7YH 3EBNA 2WPIS 1W12U 4IGDA 1AFQC 1ZRBA 3QWCH 2A45B 1AB9C 3LGVA 2WPMS 1GVZA 1ORFA 2IN2A 3A7WA 3LIWA 1HAVA 2TGTA 4AG1A 4QT8C 2PGBB 3QO6A 3IITA 1C5MD 1GHVH 1NFWA 2TRMA 1JWTA 2Y81A 3R3GB 1P2MA 3TJUA 1EPTA 3RUOA 3TLOA 2H9EH 1QRXA 1VZQH 2P59A 5F6MA 1P04A 4NIYA 2BLOA 2OBOA 2ZPSA 4INHA 5JBTA
chains in the Genus database with same CATH superfamily
2Z3CA 1AFQB 1MUEB 1EB1H 1TQ0B 2P3FH 1C2IA 1TX7A 1F7ZA 1KLIH 2W26A 2VNTA 2ZFSA 3N99A 1QBNA 2J2UA 2ZG0H 3SBKA 4HGCA 1FDPA 1KXBA 3BG8A 4BAHB 1O39A 1V2QT 2J9NA 5K0HA 1P8VC 3A8BA 1C4Y2 1UK3A 3ZVEA 2F9OA 4YM9A 1GBDA 1TOCB 1DUAA 3RP2A 3I29A 2FX4A 2FWWA 4I8HA 5KGOA 3LH3A 3RXEA 2J92A 4B75A 4NWKA 5KEDA 4K69A 1TONA 4R8TB 3SZEA 5HXFA 3MU1A 4Z0KA 2NU2E 1D3DB 3E1XB 4H6TA 2P93A 2LIZA 1TE0A 5GIBA 3TJNA 1C5PA 2OBQA 4UFFH 1UTLM 2GV7A 1HAGE 3QTOH 1O5BB 3RXMA 1AUTC 1FI8A 3A7YA 1EAXA 1C1WH 1JXPA 1P2NA 2FZZA 3B8JA 1EX3A 1YPHE 1O3IA 3VG8A 2HOBA 4OGYA 1AN1E 3DD2H 3Q76A 1XKBC 4WVPE 1MTVA 3ELAH 1FY5A 1S81A 3HGPA 2QC2A 1VITH 2YNAA 2G52A 1SGRE 2W3IA 3ZZAA 2ALVA 1NZQH 3P8FA 1NM6A 1KLTA 3R0FA 1GBFA 1GI3A 1B7XB 4JYTA 4X2WA 4B2CA 1OYTH 1CT2E 3E91A 1Z7KA 3RXRA 2ZU3A 3FZDA 1ZPZA 1SL3A 2BLWA 3PRDA 5IDKA 2ANMH 1IQLA 4ZH8A 3RXSA 1OWKA 2TPIZ 1TX8A 2HRVA 1T32A 4CREA 1GBCA 4LOYH 5B6OA 4ZHLU 7GCHG 1GG6C 1FPHH 2A2QH 2XCNA 4SGBE 2BX3A 3BTWE 1NFUA 3GCTG 3L3TA 2ZU2A 1AWHB 3KQEA 2BD7A 1AD8H 3KQDA 4DG4A 2A4OA 1VCWA 2PUXB 1HAYB 4ABFA 1ANEA 4BTTB 2AMDA 2GKVE 2QAAA 2FOCA 3KCGH 1BRAA 1O2HA 4ISIH 1MD7A 1ETTH 3BTGE 4JK5A 1MQ6A 3U69H 2PTCE 3LGIA 3LKWA 3GICB 1GJBB 1LMWB 2OC1A 3F68H 5AVDA 4ABDA 3M3SA 1BCUH 2OP9A 4ASHA 1YP9A 2P8OC 5EPYA 2CJIA 3RXAA 1YCPK 2FYQA 1BZXE 1ZSKA 3ZZ7A 3BTFE 1GBJA 3ATMA 4Y76A 1J17T 1ZGVA 3A81A 1V2KT 1CU1A 1HRTH 2FIRH 5E0HA 3N7OA 1QA0A 4PROA 2HLDD 1U6QA 3MH7A 1FIWA 4RKJB 1W2KH 4X0WU 5EODA 1V2MT 3LC3A 1A5IA 4FUEA 4Y10E 1COWD 3RXGA 1ELGA 2JJ1D 1BB0B 1TALA 1TOMH 2WSSD 3ZV9A 1ELBA 1O3CA 4WH6A 2P8OB 4IS5A 2QYIA 1GJ5H 1QCPA 1H8ED 2PGQB 1M9UA 1DLKB 5LPRA 1ELVA 2A4QA 1KSNA 2GV6A 1SGDE 1OPHB 1BMMH 4AYVB 1AIXH 4Y71A 1P9UA 4GUXA 1HLTH 1EAIA 2ZGCA 3MOCA 2OQ5A 1GJ9B 5TJXA 3EA8A 1HNEE 4ASUD 1YPMH 1SGFG 3RMOH 2PTNA 2LNCA 1ZTKA 2VH0A 1HAOH 3OEHD 1B0FA 1O2PA 3LOXA 2Y7ZA 1OWHA 1GI8B 4OS2A 1QBOA 3MU5A 1NBME 1SB1H 1G3EA 2AMPA 2JJ2D 3FAOA 4ZXXH 4LZ4B 3A83A 4ZHMU 1G32B 1QURH 1PPBH 3D49H 1UK4A 4Y8ZA 1IQIA 4WMEA 1V3XA 2SGEE 2JETB 3BTQE 4U2WA 2FTLE 5GDSH 4NGAH 4K1TA 1P3CA 3LU9B 2XC0A 1A1RA 5HIZA 2XW9A 5JBAS 7ESTE 1ZTLA 4CR5A 4KKDA 3FN8A 2R3UA 3QN7A 1HAPH 1PJPA 4NFEA 1HJ8A 1V2JT 3RLWH 1EJNA 2BQ7B 1EZSC 1FY4A 4O3TA 1GI9B 1C2JA 1RIWB 3GCTF 5C3NA 2EI8A 2WUCA 3H5CB 3SU2A 2ODYB 1GI1A 1VR1H 1YBWA 1YPEH 4X1PU 5EXLA 2FYRA 3K9XB 1P03A 1A0HB 2TBSA 1UHBB 4B6EA 2ULLA 3PWCA 1V2TT 3MH4A 1SGCA 4A1XA 1MTSA 1IHSH 4D9RA 2F9PA 4AGKA 5L2ZH 1O2WA 1C2LA 1SI5H 1J15A 1K1PA 5C0TA 3LJJA 1TIOA 3DFLA 3SW2B 1SLUB 3H7OA 1TX6A 3P8GA 2O9QA 3W95A 4BOHA 2D8WA 4ABHA 1SGQE 2ZCLP 1P3EA 3P6ZB 3RU4T 4NWLA 1XMNB 2LP6A 3TH4H 3ZVDA 1F5RA 3Q3KA 2J5UA 1MU8B 1BJVA 3RXTA 3A7ZA 4YOGA 1KY9A 5A8XA 1S6FA 3UOUA 3V0XA 3KYFA 1W10U 3UTUH 4NCYA 1O38A 5DP3A 5A8ZA 1EAUA 4OS4A 3SU5A 3K6ZA 5CHBA 3RXCA 2BY7X 2XRCA 2VU8E 4XOJA 3E16B 2GMTC 2KAIA 2A7JA 1FN8A 2VIVA 1BUIA 2Z3EA 5DP6A 2HNTF 2H9TH 5FBIA 2JKHA 4Z6AH 4ACAA 1TBQH 5DP4A 2P3UB 1PPGE 4UE7H 1GJAB 5HYOA 2KCAA 1YLNA 5A0CA 2B9LA 1SGIB 1VITG 4IN1A 2FI5E 2GCTC 2BVXH 3ODFA 1P57B 2CHAC 5C2ZA 1DXWA 2GMTB 3GY3A 3V12A 3KF2A 5F8XA 3ZZ8A 1MU6B 2BD8A 2FP7B 3GYLB 1CA8B 2H5CA 1QFKH 2L6OA 3ENSB 1AWFH 4ZMAH 1XXFA 3A89A 2GD4B 2Z9GA 3DSOA 2FOHA 3SZNA 1SQTA 1W8BH 4Y8YA 1NESE 1P2QA 3ZZ3A 1O3HA 1P11E 1JOUB 2GCTB 4Y79A 3T26A 4NG9H 2GX4A 1QBVH 1ZPCA 1ANBA 4RN6A 4FUDA 2BDYA 1J16A 3RMNH 4Q80A 2Q6FA 1ZOMA 4FETA 2WUBA 2SGDE 1HIAB 1T8NA 1D4PB 1EJAA 2VVCA 1P10A 4ISOA 1ZZZA 2STBE 1IQGA 2A7HA 3RXLA 1GCDA 2Q6GA 3F3BA 1SLXB 2VWOA 1WSSH 4TPIZ 1QJ7B 2IPQX 3M7UA 1C2MA 1MZDA 3RXFA 2FOFA 3PO1C 4FUIA 5CHAC 1O3LA 1THRH 4KGAA 2WYJA 1J14A 1E0FD 3L6PA 3ATIA 3HKIB 3CP7A 3SNBA 3QZRA 5T1VA 1V2UT 4CRDA 4F48B 1KTSB 4TYDA 3GY5A 3F0OA 1BTXA 2XCFA 1GBEA 1C2HA 5FPSA 1GJ6A 1OKXA 1FZZA 4ZXYH 8ESTE 1EKBB 3ZVGA 1TYNA 1E37B 1TGNA 6LPRA 1BBRE 1EB2A 2VGCB 4WXVA 1BT7A 3SYJA 3U98H 5JYIA 4O03A 1AKSA 4NIWA 4UFDH 3UR6A 4AFSA 3PO1B 2Z9LA 2I6QA 3TITA 4TWWA 3P95A 5CHAB 3AK5A 2H2ZA 3EA7A 5T6GA 1O2VA 4Y7AA 1O3KA 1V2VT 1ELFA 1IHTH 1C5TA 2VWNA 3PTNA 3QX5H 3SI4H 1UCYH 4ZKOU 2K7XA 1OX1A 3PV2A 1IQJA 1T8MA 5DP8A 4F49A 4FU9A 3EA9A 1TPSA 1GJDB 1UW7A 1YY3A 1S83A 1C5YB 1K1NA 1F0SA 3ZVAA 2Q6DA 1DOJA 2V0BA 3MH6A 1K21H 1PPFE 4DT4A 2VIQA 4A5TS 2VJ1A 3OSYA 1AO5A 1F0UA 1RRKA 1NRPH 2FLBH 4I31A 2PW8H 2ZU5A 2BM2A 2F3CE 2HVYB 2A5KA 3LONA 3UQOA 2CXVA 8LPRA 3A8CA 2QXIA 1VITF 2ZGHA 1AVWA 2F83A 3IWMA 2QF3A 2OD3B 2RA3A 1XUJA 1KXCA 3PLKA 4A7IB 3A80A 2ZHEH 1C1SA 2FEQH 1HCGA 1DY8A 1BHXF 3UNSA 3BN9A 4M9FA 2ZHWH 3SU1A 2TGAA 1GBIA 4TWYA 3T62A 1IQMA 2ZHDA 5FBEA 3SNDA 2PFEA 3RMLH 3LDXH 3T2NA 2ZU4A 4X6NA 1YPGH 2AERH 2XC4A 2FS9A 1FV9A 4Q4LA 2XYAA 2DE9A 4CH2B 1NBMD 5C17A 2UUJB 5T6DA 3UQVA 2P94A 5FPYA 3SU3A 4GAWA 1OYQA 1QJ6B 3TU7H 3F1SB 1HFDA 1KYNA 1QZ8A 1P2KA 1Z6JH 4X2XA 2OC0A 2P95A 1FY1A 4IMQA 4YTAA 1IQFA 1NTPA 1RXPA 3HGNA 4D9QA 2Z7FE 2C8WB 1GBHA 2A1DB 2GCHF 1Z8RA 3PLPA 5DN6D 2O8TA 1VGCC 1C1QA 4FUGA 2KAIB 3PTBA 3P8NA 5SGAE 2FODA 1C1UH 4WMFA 4ZHAA 5LH8A 1LVOA 4H42U 5GPIB 3M7TA 3M36A 2WPJS 1O31A 4Q7XA 1D9IA 4A92A 1OOKB 2WINI 4U30A 1DWDH 2XOKD 2ZQ2A 3VGCC 4DY7B 1GBMA 4CH8B 3LT3A 1HAHH 3U1JB 1K1LA 1VGCB 1H8DH 2XWBI 1O2SA 2Y7XA 2HNTE 1GI2A 4Y11E 2BDHA 3ZZBA 3V13A 1BIOA 1ZR0A 2JIZD 4B76A 4LK4A 3E3TA 1TFXA 2BDIA 4B73A 1PPHE 2IPHA 4X2VA 3SV7A 4FUJA 4GHTA 4LZ1H 4WH8A 2WV4A 3NUMA 1P06A 1V2OT 2VWLA 4WXIA 2BXUH 5B6LA 4AFQA 3HK6B 1O30A 1NROH 3VGCB 1ETRH 3RXKA 4DVAU 2BD3A 2AH4X 2V3HH 2ZGJA 2Y82A 1SQRA 2Z6BD 2UUFB 1BJUA 3RXQA 2Z9JA 2ZDNA 2ZP0H 2ZI2H 1WU1A 2BY5X 3I77A 2ZFTA 2CGAA 4DOQA 1T8OA 1V2ST 1O2NA 1UVTH 3GY4A 5FCRA 1A5HA 1UO6A 1YGCH 4K1EA 4KTUA 2ALPA 1A2CH 2Y80A 4UFGH 2ZCKP 2BY8X 2NU4E 3DT0H 3ZVBA 1BRBE 1SKYE 5K7RA 1MABB 2KCOA 5C0UA 1GPZA 1EUFA 4TSFD 2C8YB 5CMXH 4NSVA 1FONA 5A0AE 1OP2A 1SSXA 2L74A 2ZA5A 4X1NU 2KR7A 9ESTA 4JYUH 1WTGH 4JZDH 1C5VA 1SHYA 1NRQH 1KTTB 1GJ4H 4B6FA 1O5FH 4INKA 1V2RT 4TPYA 3G01A 3UREA 5DK1A 3SGBE 3A8DA 1QQUA 1J8AA 2ZFPH 1SR5C 1OWEA 1A3BH 2WYGA 1LHCH 2A32A 3WY8A 3PV5A 1CHGA 2A7CA 1AKSB 1T7CA 2V3MA 2XNIA 2F43B 2XC5A 1A61H 3O8RA 3TVJB 1L4ZA 1TGSZ 1E35B 1X7AC 2FOBA 3VB7A 3FANA 3RC5A 4YT6H 1O37A 2F9BH 1O2RA 2EQNA 4ACBA 6CHAB 1GI5A 5L30H 1Y3XA 3TNTA 2VIOA 4K60A 1LQEA 1W0YH 2PKSB 3TJVA 1L1NA 4OS7A 1YCPH 1VKYA 3S9BA 4K5ZA 1P12E 3EE7A 1AFEH 1K2I1 3SJIA 3URCA 1TRMA 1YKTA 1Z8JB 1OWDA 1NU7B 1K1MA 3E8LA 2WPHS 3SI3H 5C5NA 3KIDU 5EGMA 1HXEH 1P01A 1ARBA 2THFB 2A5AA 2OXSA 2ZNKH 1ANDA 1SGYE 4H4FA 2P16A 1D3TB 2J98A 1IQEA 1O2JA 2QF4A 4AFUA 2FX6A 3WW7A 3VEQB 4JCNA 3DHKH 1N6XA 2BYAX 4GLYA 4B74A 1DY9A 1BMNH 2AIPA 5I25A 1QJ1B 2HNTC 1NO9H 2BDBA 3MYWA 5GNDA 1XUFA 2QF5A 3FP8E 5E0GA 2V7QD 5E2OA 4D8NA 4NA9H 1DM4B 2PLXA 2EA3A 4MQAA 2VVVA 1WTHD 1BMFD 2F9VA 2GDEH 2WPDD 3C1KA 1FAXA 4RKOB 1N1LA 1SC8U 4RSPA 3I78A 3PLBA 3RDZA 1GHXH 3QK1A 1O5CB 3FVFB 3FP6E 3MU4A 4UD9H 4NSYA 2J94A 3Q3YA 1A0LA 5EJZA 4GVUA 1A5GH 2KCYA 3LGWA 1RFNA 1D6RA 1WAYB 3RU4E 3TPIZ 3B9FH 2JETC 5GCHG 3U8TH 2Y5FA 1EJMA 1S84A 1SQAA 5CE1A 2H1UA 4JMYA 1EPTC 1QB1A 3M5MA 3HK3B 3VB6A 2HLCA 3HKJB 2LPRA 3A84A 4INLA 2JH6D 1GBKA 4XD7D 3NWUA 1UJ1A 2BD5A 2XBYA 1QRZA 1FIZA 3SN8A 3OFND 4H6SB 1E34B 3A7XA 4XBCA 1L1GA 3KNXA 1A0JA 1O3PB 1SGEE 3DSPA 3KHVA 1TA6A 4A1TA 4X2YA 1HAVB 1BRCE 2AGIX 5LGOA 1RIWC 1F5KU 3SU6A 2Z3DA 1C9PA 1MH0A 2ZU1A 2D1JA 1CGHA 3TGIE 1GJ7B 3N7DA 1OXGA 1EPTB 1DE7H 1P09A 3P8OA 4BAQB 1ZMNA 4HTCH 2GZ7A 1C2GA 1MBQA 1L2EA 3SJ8A 1IOEA 1O2TA 1PQ8A 1VJAU 3PMJA 3DA9B 3MU8A 1P2OA 6ESTA 1GHWH 1C5OH 1TNIA 1NN6A 4YZUA 1AVXA 4B1TA 4ABGA 4DW2U 5BRRE 1XM1A 5FHTA 4FUHA 1TRYA 2PSYA 2VIPA 1OWIA 4KELA 4I8KA 4AZ2B 2ESTE 2K1QA 2Z9IA 1DSUA 1O2GH 4OS6A 4K1SA 4Q7ZA 3A82A 5LPFA 1S5SA 2KFWA 4IN2A 3WWFA 2EI6A 2FMJA 4Y0ZE 1Y5BT 3RC6A 1OWJA 4TY7A 1O2IA 1G2LA 1C9TA 2ZEBA 3M5OA 3MTYA 1JBUH 1GL0E 2ASUB 1VCPA 2FPZA 1XX9A 2DE8A 2OUAA 1O2KA 3PV4A 2A2XH 2H9HA 5E8EH 3E90B 1TBRH 3RMMH 3T27A 4HI3A 2BOHB 3BTKE 1CT4E 2ZF0H 1T31A 1RGQA 1YLDA 2J4IA 1OP0A 1EQ9A 3UNRA 2GTBA 2ZZUH 2OLGA 1ZJKA 1C2KA 3A88A 1BTUA 1A7SA 1PQAA 1QA7A 3TNSA 7LPRA 1ARCA 3EGKH 3UB0A 4IMZA 5C94A 3SORA 1F92A 3P92A 1THPB 3TK5A 2W6ID 3GDUA 2A4GA 3RXBA 1EZXC 3SGAE 1XVOA 3LC5A 2K0QA 3P17H 5GXPA 1UTNA 3ZZCA 1AI8H 4CRGA 4YOIA 1NS3A 1Z6EA 3GY2A 3TGKE 4HG6A 2UWPA 4CRFA 3A87A 4MNYA 2Q1JA 3BG4C 1HB0B 3S7HB 2G4UA 1EAWA 3RXJA 4CRCA 1Y3YA 2JH0D 4FVBA 1W7GH 2G55A 4OM9A 2WPKS 3AW1A 1CBWB 1UVPA 1INCA 4X8VH 2TGDA 8KME2 1GI6A 1H1BA 1C5RA 4WY3A 4DIHH 2AIQA 5GCHF 2HPPH 1O2UA 3FKSD 1CO7E 2BDAA 5JBBS 2A31A 2R9PA 1GJCB 4X8SH 1H4WA 3BG4B 3O8CA 1NFYA 1DSTA 1XKAC 2HWLB 1V2LT 3RXDA 1JRSA 1B5GH 2TGPZ 3FP7E 2BY9X 3AVZA 1BHXB 4E06H 1SQOA 1C5NH 1C5XB 1QB9A 3ITIA 5F8TA 2BVRH 5J4QA 1ABIH 1TWXB 1SVPA 1EATA 3JZ1B 2QIQA 2DUCA 1ELTA 4BTIB 4O97A 5JBCS 4XE4A 1O2LA 3O8BA 2QXGA 2ZFQH 3GCOA 2QY0B 4D76A 1AVGH 3SJ9A 4CHAB 2WHXA 2BDCA 2VIWA 3RM0H 4BAKB 3DCLA 3UUZA 5JDUB 1EASA 3STJA 2HGTH 3ZZDA 1JIRA 3PMBB 1C1NA 1KXEA 4MPXA 4AGJA 2ZWLH 3OU0A 4DJZB 1GDUA 3KN2A 1ZLRA 2GDDA 5T6FA 2R0LA 2R2WU 1O5AB 2GJGA 3SGQE 1KXAA 1GI7B 1WBGB 4Q2KA 4BNRA 3MQKC 3STIA 3VPKA 2YOLA 4O3UA 4GSOA 3GOVB 4XRNA 2VBCA 1YCPM 1MTWA 3B23B 2GCHG 4I8GA 1P05A 1BBRK 2ZDAH 1GVLA 2BMGB 1PQ5A 5TCAA 4LXBH 1O2MA 5C1UA 1RTKA 2VGCC 3SHCH 1LHEH 2UUKB 1MKWK 1XUIA 1MAYA 2YMSC 4AG2A 5LPEA 3LJOA 3S69A 5AFYH 1ESBA 3QUMP 2O8UA 2PR3A 2ZKSA 3U8OH 4ISNA 2G00A 3M3VA 1C1RA 2J95A 1FX0B 3BSQA 1O3FA 1G3CA 1Y59T 1BA8B 3OEED 4X1SU 3HPTB 1EZQA 3SHAH 1V2PT 1JRTA 5EPNA 1HJ9A 1O33A 2J38A 1SLVB 1SBWA 1Y5AT 4D7GA 3ZV8A 3GY6A 2FDAA 1WXRA 3AW0A 2VH6A 2C90B 3F6UH 4JZFH 1XUGA 1UTMA 2YMSB 1H8HD 5DP9A 1FXYA 2SFAA 2ZTXA 3K2UA 4DGJA 3Q77A 4ABIA 5ESBA 1AGJA 2BOKA 1MMJN 1KXDA 2OQUA 1XVMA 1RTFB 1PQ7A 2QXJA 4B71A 1GGDB 2V6NA 5H4IB 3ZYDA 1FJSA 3BTTE 5A0BA 3UWJH 3SU4A 2I6SA 1TNHA 5EJ1A 2ZGXH 1S85A 2NU3E 2RDEA 4X8TH 3SV9A 1NT1A 2FOEA 3CS0A 2CK3D 2M5TA 1YPLH 3SU0A 3BEIB 3TK6A 1GCTC 4XSKU 1ABJH 3LGTA 1UTKA 3FFGA 1MD8A 3UAIC 2ANYA 1O3BA 1TBZH 1HUTH 1HPGA 1HAXB 1FNIA 3GDSA 1W3CA 4MPVA 3EDXB 2ZGBH 3BIUH 2ZO3H 3V7TA 1DWBH 2ODQA 3EYDA 4NA8A 3PWBA 1GHYH 4AFZA 1GJ8B 2ZECA 4MLFB 5T3HA 3AAUA 1B0EA 5FX5A 2JDID 1CGJE 1P2IA 1GCTB 1TRNA 4AX9H 5HM9A 2W6JD 4B2BA 1DS2E 1C2EA 1ZYOA 4YO9A 1SG8B 3M3TA 4FVDA 1TNGA 2JH5D 4BXWA 2RG3A 3UOPA 1NRRH 4ZUHA 2NWNA 1LPKB 3GCNA 4IW4E 1HYLA 2PKAA 1LHDH 1ZJDA 3OAAD 2FXRA 2STAE 1W0JD 1SGTA 4THNH 4UDWH 5GJ4B 1ZSJA 4AYYB 2QXHA 4I33A 2VINA 1P0SH 4YOJA 1AZZA 4MPUA 1UCYE 1V2NT 1ESAA 2PSXA 1GBLA 3MNCA 2VWMA 2Y5HA 2QV1A 3KQCA 1C5LH 2AEIH 3WWBA 3RM2H 1CSOE 2EC9H 1CA0B 3LGUA 1P2JA 1QGFA 5EQSA 2XBVA 2PP6A 5EOKA 5FAHA 3BTHE 3PMHB 3NCLA 2XBWA 2WPLS 1C1OA 4UONA 2A4RA 1CVWH 4ISHH 1IAUA 1BQYA 1PPZA 1TMUH 2CN0H 5F8ZA 1TGTA 1TMBH 1Y3UA 2BD9A 2FM2A 1RS0A 1ZHMA 5FCKA 3TH2H 4BAMB 5EG4A 1ELCA 1G3DA 1G37A 1V2WT 1W7XH 1HGTH 3PM3A 1HJAC 2G8TA 2XNDD 1A3EH 2ZDKA 1F2SE 2ZIQH 3ZIAD 2HPQH 1DITH 1OS8A 4ZROA 1TA2A 1V6DA 2M2AA 2F4LA 1H9IE 1AE5A 2ODPA 3RXPA 1O5DH 1TNKA 4XBDA 5ABWA 1H8IH 3BTME 1FQ3A 5A8YA 1JMOH 1O2XA 1LPGB 5EXNA 1E79D 2UWOA 4WWYA 3BV9B 1O3DA 1SLWB 1J9CH 3VFEA 1DUEA 1TPPA 2TIOA 1HJAB 2ZDMA 4HZHA 4WJG2 3KQBA 1T8LA 1W11U 5HM2A 1H9LB 1CHOG 1GMCG 1VJ9U 2GVFA 1O0DH 1WYKA 1YPKH 4X6MA 2ZPRA 1QNJA 1C4U2 2BB4A 2G5VA 1D3PB 3M37A 4MNVA 4YESB 1ELEE 1A46H 3BF6H 1MTUA 1W0ZU 2CMYA 1GI4A 1TNJA 1BTZA 4NIVA 1AB9B 2RCEA 3RXHA 3C27B 3E0PB 3W1EA 5EQQA 3U9AH 1AY6H 5DG6A 5A2MH 2ZTZA 3VB3A 1BTPA 2CF9H 3ZZ4A 1QRWA 1QIXB 3ATWA 2LELA 3K65B 3ESTA 2VVUA 3NPSA 3O8DA 5F03A 1GDQA 4FU7A 1SHHB 1K22H 1HAZB 1NC6A 1ZGIA 3HATH 2GT7A 2OTVA 1S6HA 2BQ6B 3M35A 3GCHC 1O5GH 4I8LA 3KEEA 1UHBA 4RT0A 3F9EA 2V3OH 6CHAC 3BIVH 1QL9A 1AZ8A 2SGPE 3SJKA 3ZZ6A 1G3BA 1YPJH 1SGNE 4OS5A 3UPEA 2PKSC 3M61U 1ELAA 2KCPA 3RXIA 1F0TA 4A1VA 4ZAEA 2FI3E 1UVUH 3P70B 2K8IA 1GHBG 1YWUA 4AORA 2FS8A 1SFQB 1L4DA 3MFJA 1ID5H 1THSH 3GCHB 4JZIA 2FESH 3SUDA 1UTOA 3AAVA 2R2MB 4BAOB 3RXOA 4DT7B 2O8LA 3SJOA 4DCDA 4DURA 3F9FA 1PPEE 3QTVH 2Z94A 1PPCE 3MNSA 3PRBA 3SUEA 1BTWA 5C67A 4NIXA 1AQ7A 4B2AA 3TH3H 2UUYA 5ETXA 1K1OA 2XXLA 3TJOA 1O3OA 3T29A 3MO9A 1MKXH 4JZ1A 3RC4A 1VCQA 1WUNH 4NA7A 5TCCA 1BDAA 2ZDLA 5DP5A 1YLCA 4MNWA 5DJ7A 3EE0B 1TABE 5EXMA 1PYTC 3Q00A 2GZ9A 3TIUA 1HXFH 2SNWA 2AGEX 2FLRH 2B5TB 3NXPA 4BANB 2BZ6H 3ATKA 4I32A 1G9IE 3EQ0H 2RDLA 1O3GA 8GCHG 3MNXA 3M7QA 2QGRA 2IJOB 1NFXA 5HIYA 1MKXK 3H7TA 1GHAG 3GISB 4K8BA 5JPMH 4Q7YA 1W13U 1ETSH 6GCHG 3LH1A 1UMAH 3KYGA 3F2FA 1GVKB 1GG6B 4MG3A 1FN6A 1DFPA 4AOQA 3S0NA 1CGIE 1Y5UT 2V35A 2PKAB 4AB9A 2XWAA 1CE5A 5F53A 2PHBA 1CHOF 1GMCF 4SGAE 3T28A 2G4TA 1C5WB 4ZKRU 1AUJA 4K2YA 4X8UH 2ZFFH 4WMDA 1DICA 1Q31A 2CV3A 1NY22 1S82A 3VB5A 2XTTB 4K3JA 3MO3A 1QL7A 1Y3WA 1T4VH 3NRLA 1TPOA 4ABEA 2C8ZB 3Q3XA 4JYVH 3BTEE 1HIAA 3GS9A 5HMAA 2IJD1 3S7KB 1O32A 3FZZA 1UTQA 1EP5A 3MO6A 1TLDA 2SGAA 1TMTH 1AMHA 1TNLA 1S0RA 1IQKA 1YM0A 1UVSH 3F0PA 1F5LA 2Z9KA 4Z1MD 1DX5M 3MNBA 1FPCH 1FMGA 1HDTH 2OC8A 3QDZB 1DVAH 1F0RA 1LKAA 1GBAA 1O3JA 2KZ4A 3NK8A 3F9HA 1TAWA 2W7SA 3ZZ5A 3MI4A 1LVMA 1QL8A 3SNEA 4FUBA 3OY6U 5J4SA 3VXFH 3OX7U 3EAJA 3IG6B 1Y3VA 4Y6DA 3U8RH 1FY8E 1EFRD 1UTPA 3ODDA 4F4OC 2BVSH 1GHBF 2BDGA 2QA9E 1DT2A 1E36B 1TGBA 3VXEH 4UFEH 1XXDA 2BTCE 2WV9A 1W14U 4MVNA 4UEHH 3TGJE 1LHGH 1O2QA 4U01A 1YPHC 3D23A 2BZAA 2D2DA 3V3MA 1D3QB 2P3TB 3A85A 2BXTH 4CRBA 1BRUP 1FLEE 1QTFA 1ZSLA 3GY8A 3K6YA 1RTLA 2F91A 1Q2WA 2FI4E 2Y5GA 4Y8XA 4ZKSU 5FL7D 2ZTYA 1C2FA 2FO9A 3UFAA 1ZMLA 1GBTA 3LPRA 3KL6A 3MHWU 4ABJA 1SOTA 3CS7A 1K0HA 1GL1A 1NPMA 3SV8A 5FXLA 1LO6A 1FUJA 4U32A 1GMHG 1IQHA 7GCHF 1MCTA 3L33A 1TPAE 2OCVB 3ZYEA 2KX4A 1MZAA 2BLVA 1BITA 2ZHQH 5EW2H 2EI7A 1G36A 2G51A 3QZQA 8GCHF 1C1TA 2HVXA 2PUQH 1SFIA 2R0KA 3DSGA 2FOMB 4YLUA 1XUKA 1TQ7B 1GHAF 5DP7A 1PYTD 3A8AA 3ZVCA 1EOJA 4RI0A 1CBWC 2BQWB 4ZKNU 6GCHF 4IC6A 5E2PA 2B0FA 5L2YH 1BMLA 3PYHA 2VB0A 4OS1A 2OK5A 4GCHG 1SOZA 1UK2A 9LPRA 1Q3XA 2RFKC 2W7UA 1O35A 2SGQE 1FAKH 5DPAA 3GDVA 3SO3A 1OHHD 3PROA 3QLPH 1D6WA 2QCYA 5HKKD 4BTUB 1DWEH 2PWXA 4F55A 5JB9S 2AMQA 3OY5U 1E38B 4FUFA 4NFFA 4X6PA 3ZVFA 1SMFE 1MBMA 3OE7D 2XBXA 7KMEH 4J2YB 1G30B 3OTJE 4FXGH 2BD4A 4IC5A 1E1QD 1RJXB 1O3MA 1GMDG 4Y7BA 3MWIU 1YF4A 1C1PA 4ABBA 4J1YA 4CHAC 3AASA 1C5QA 4CRAA 1Z8IB 5ESTE 1WV7H 3FOAA 1KDQA 1BMAA 1NRNH 1DPOA 2ZFRH 5DO4H 3F2GA 2BX4A 3DFJA 2BHGA 2C93B 1H9HE 1IQNA 2AFQB 4ESTE 1KIGH 1QR3E 2ANWA 4AC9A 2BY6X 3SUGA 2A5IA 1L1JA 2J98B 4K8YA 1S6LA 2FOGA 1O2OA 1C4V2 4GHQA 2W5EA 5EU8A 1DANH 3F2HA 4BXSA 1K28D 4P00A 4VGCC 1UTJA 2B7DH 2C3SA 2OC7A 4KTSA 1EZUC 3NKKA 1C5ZB 1T4UH 4ABAA 2ANKH 1BBRH 3SV6A 1LKBA 1GWAA 2J97A 1GDNA 1HBTH 1K9OE 3N7EA 3FO8D 4I86A 1MKWH 1C5SA 1NRSH 1P9SA 3RLYH 2H6MA 2EY4C 1YYY1 3MU0A 4YT7H 3SOSA 3SQHE 3A86A 1MQ5A 1LCYA 4X1RU 4GPGA 5L6NH 2NU1E 4MTBA 4X6OA 2GT8A 1SPJA 1O3EA 3UR9A 4D7FA 1LVBA 1O5EH 2CHAB 4VGCB 3BEUA 5CDFE 2ZDVH 4O9VA 1O2ZA 4R0IA 1CQQA 1G2MA 1QY6A 1DDJA 1MTNC 1FY3A 1LTOA 1TB6H 1DXPA 3ZZ9A 1WDIA 1AHTH 1GMHF 1KXFA 2AHME 3S9CA 3S9AA 2C4FH 4AB8A 2G81E 4TT3D 4NZQA 1A4WH 2B8OH 1XUHA 2HALA 1LVYA 2ILNA 1BTYA 5C1XA 1ELDE 2SGFE 1ZHPA 1GGDC 1AU8A 4E7RG 3MH5A 3OYPA 1QHRB 1HV7A 1Z8GA 5IYTA 1DLEA 2F9UA 2O8MA 3SNCA 5I46H 1UVOA 5E0JA 1WQVH 3BEFB 2OINA 1WQSA 5EW1H 3TK9A 2GP9B 3GY7A 2R3YA 4OGXA 1EOLA 1C2DA 1O3NA 1SGPE 1MTNB 1L0ZA 2FTMA 1ZHRA 4NZLA 3T5FH 4Q63A 5AHGH 2WV5A 4CR9A 4GCHF 3M5LA 4A6LA 2D26C 5DSFA 5HGGA 1GHZA 4CBNA 3PB1E 3UIRA 1ZTJA 1S0QA 2J34A 2ZHFH 1HAIH 1OP8A 2Y6TA 4KP0A 4HFPB 1RD3B 3KGPA 3UNQA 5C5OA 1Z1IA 4TY6A 4AN7A 5AF9H 1ZPBA 1N8OC 4FU8A 2KM0A 2VIDA 4XDEA 1O36A 5FX6A 1JIMA 5DGJA 3W94A 4YLQH 3E6PH 4E05H 5PTPA 3T25A 4FOUC 3D65E 1K1JA 1ZRKA 2BLQA 3BTDE 1W0KD 4E7NA 1GMDF 2AS9A 5GWZA 1C5UA 1GBBA 1LPZB 3GYMA 1O34A 4IBLH 3A7VA 4X1QU 5IK2D 1MCVA 4DIIH 3JZ2B 3RXVA 2ZCHP 2FOAA 2AGGX 2F9NA 3U28C 1Z71A 1C1VH 2SNVA 3F9GA 4FUCA 4M7GA 4MPWA 2GGVB 1KMHB 2A0QB 5DKMA 1N8OB 1UCYK 4WF8A 3PMAB 3U1IB 4CBOA 3ATLA 3RU4D 2IOTA 1QB6A 1GI0A 5A09A 2ZPQA 2EEKA 4MDSA 1O2YA 2GZ8A 2PV9B 1CA0C 1BOQA 1K1IA 2WZQA 4ZCNA 3OTPA 4Y0YE 3UWIA 1TGCA 3DUXH 1PFXC 1AE8H 2UWLA 5EJLA 5C20A 1N6YA 4JZEH 1WOFA 5AFZH 2QF0A 4ISLA 5BPEA 4XFQA 3UY9A 1QQ4A 2NU0E 3SNAA 1DWCH 5JB8S 1P02A 3MMGA 5FPTA 2O8WA 3CENA 2C8XB 3SUFA 2AYWA 3CNRA 3NZIA 3A7TA 1Z1JA 3SV2H 3VB4A 3RXUA 2RA0A 1EP6A 1LHFH 4I8JA 1OSSA 1EXFA 2QN5T 1LDTT 5EIYA 2BD2A 2CF8H 1LQDB 1ESTA 1KLJH 1MAXA 3QGJA 3QGNB 2W3KA 4XBBA 1NU9A 2G5NA 5G4BA 1YC0A 3URDA 1BTHH 3E0NB 1WCZA 5EQRA 1C1MA 4KTCA 5C1YA 1ACBE 2QE7D 2ZC9H 4MNXA 1ANCA 3D62A 1SGFA 3LGYA 2YMSD 1O3AA 1CT0E 2H5DA 2ZQ1A 1KDQB 1Y8TA 1E1RD 3SQEE 4JK6A 1ZMJA 3M5NA 2YNBA 4I7YH 3EBNA 2WPIS 1W12U 4IGDA 1AFQC 1ZRBA 4YXWD 3QWCH 2A45B 1AB9C 3LGVA 2WPMS 1GVZA 1ORFA 2IN2A 3A7WA 3LIWA 4P02A 1HAVA 2TGTA 4AG1A 5KECA 4QT8C 2PGBB 3QO6A 3IITA 1C5MD 1GHVH 1NFWA 2TRMA 1JWTA 2Y81A 3R3GB 1P2MA 4RT1A 3TJUA 1EPTA 3RUOA 3TLOA 2H9EH 1QRXA 1VZQH 2P59A 3KQ5A 3H09A 5F6MA 1P04A 4NIYA 2BLOA 2OBOA 2ZPSA 4INHA 5JBTA
chains in the Genus database with same CATH topology
2Z3CA 1AFQB 1MUEB 1EB1H 1TQ0B 2P3FH 1C2IA 1TX7A 1F7ZA 1KLIH 2W26A 2VNTA 2ZFSA 1QBNA 2J2UA 2ZG0H 3SBKA 4HGCA 1FDPA 1KXBA 3BG8A 4BAHB 1O39A 1V2QT 2J9NA 5K0HA 1P8VC 3A8BA 1C4Y2 1UK3A 3ZVEA 2F9OA 4YM9A 1GBDA 1TOCB 1DUAA 3RP2A 3I29A 2FX4A 2FWWA 4I8HA 3LH3A 3RXEA 2J92A 4B75A 4NWKA 4K69A 1TONA 4R8TB 5HXFA 3MU1A 4Z0KA 2NU2E 1D3DB 3E1XB 4H6TA 2P93A 2LIZA 1TE0A 5GIBA 3TJNA 1C5PA 2OBQA 4UFFH 1UTLM 2GV7A 1HAGE 3QTOH 1O5BB 3RXMA 1AUTC 1FI8A 3A7YA 1EAXA 1C1WH 1JXPA 1P2NA 2FZZA 3B8JA 1EX3A 1YPHE 1O3IA 2HOBA 4OGYA 1AN1E 3DD2H 3Q76A 1XKBC 4WVPE 1MTVA 3ELAH 1FY5A 1S81A 3HGPA 2QC2A 1VITH 2YNAA 2G52A 1SGRE 2W3IA 3ZZAA 2ALVA 1NZQH 3P8FA 1NM6A 1KLTA 3R0FA 1GBFA 1GI3A 1B7XB 4JYTA 4X2WA 4B2CA 1OYTH 1CT2E 3E91A 1Z7KA 3RXRA 2ZU3A 3FZDA 1SL3A 1ZPZA 2BLWA 5IDKA 2ANMH 1IQLA 4ZH8A 3RXSA 1OWKA 2TPIZ 1TX8A 2HRVA 1T32A 4CREA 1GBCA 4LOYH 5B6OA 4ZHLU 7GCHG 1GG6C 1FPHH 2A2QH 2XCNA 4SGBE 2BX3A 3BTWE 1NFUA 3GCTG 3L3TA 2ZU2A 1AWHB 3KQEA 2BD7A 1AD8H 3KQDA 4DG4A 2A4OA 1VCWA 2PUXB 1HAYB 4ABFA 1ANEA 4BTTB 2AMDA 2GKVE 2QAAA 2FOCA 3KCGH 1BRAA 1O2HA 4ISIH 1MD7A 1ETTH 3BTGE 4JK5A 1MQ6A 3U69H 2PTCE 3LGIA 3LKWA 3GICB 1GJBB 1LMWB 2OC1A 3F68H 5AVDA 4ABDA 3M3SA 1BCUH 2OP9A 4ASHA 1YP9A 2P8OC 5EPYA 2CJIA 3RXAA 1YCPK 2FYQA 1BZXE 1ZSKA 3ZZ7A 3BTFE 1GBJA 3ATMA 4Y76A 1J17T 1ZGVA 3A81A 1V2KT 1CU1A 1HRTH 2FIRH 5E0HA 3N7OA 1QA0A 4PROA 1U6QA 3MH7A 1FIWA 4RKJB 1W2KH 4X0WU 5EODA 1V2MT 3LC3A 1A5IA 4FUEA 4Y10E 3RXGA 1ELGA 1BB0B 1TALA 1TOMH 3ZV9A 1ELBA 1O3CA 4WH6A 2P8OB 4IS5A 2QYIA 1GJ5H 1QCPA 2PGQB 1M9UA 1DLKB 5LPRA 1ELVA 2A4QA 1KSNA 2GV6A 1SGDE 1OPHB 1BMMH 4AYVB 1AIXH 4Y71A 1P9UA 4GUXA 1HLTH 1EAIA 2ZGCA 3MOCA 2OQ5A 1GJ9B 5TJXA 3EA8A 1HNEE 1YPMH 1SGFG 3RMOH 2PTNA 2LNCA 1ZTKA 2VH0A 1HAOH 1B0FA 1O2PA 3LOXA 2Y7ZA 1OWHA 1GI8B 4OS2A 1QBOA 3MU5A 1SB1H 1G3EA 2AMPA 3FAOA 4ZXXH 4LZ4B 3A83A 4ZHMU 1G32B 1QURH 1PPBH 3D49H 1UK4A 4Y8ZA 1IQIA 4WMEA 1V3XA 2SGEE 2JETB 3BTQE 4U2WA 2FTLE 5GDSH 4NGAH 4K1TA 1P3CA 3LU9B 2XC0A 1A1RA 2XW9A 5JBAS 7ESTE 1ZTLA 4CR5A 4KKDA 2R3UA 3QN7A 1HAPH 1PJPA 4NFEA 1HJ8A 1V2JT 3RLWH 1EJNA 2BQ7B 1EZSC 1FY4A 4O3TA 1GI9B 1C2JA 1RIWB 3GCTF 5C3NA 2EI8A 2WUCA 3H5CB 3SU2A 2ODYB 1GI1A 1VR1H 1YBWA 1YPEH 4X1PU 5EXLA 2FYRA 3K9XB 1P03A 1A0HB 2TBSA 1UHBB 2ULLA 3PWCA 1V2TT 3MH4A 1SGCA 4A1XA 1MTSA 1IHSH 4D9RA 2F9PA 4AGKA 5L2ZH 1O2WA 1C2LA 1SI5H 1J15A 1K1PA 3LJJA 1TIOA 3DFLA 3SW2B 1SLUB 3H7OA 1TX6A 3P8GA 2O9QA 3W95A 4BOHA 2D8WA 4ABHA 1SGQE 2ZCLP 1P3EA 3P6ZB 3RU4T 4NWLA 1XMNB 3ZVDA 3TH4H 1F5RA 3Q3KA 1MU8B 1BJVA 3RXTA 3A7ZA 4YOGA 1KY9A 5A8XA 1S6FA 3UOUA 3V0XA 1W10U 3UTUH 4NCYA 1O38A 5DP3A 5A8ZA 1EAUA 4OS4A 3SU5A 3K6ZA 3RXCA 2BY7X 2XRCA 2VU8E 4XOJA 3E16B 2GMTC 2KAIA 2A7JA 1FN8A 2VIVA 1BUIA 2Z3EA 5DP6A 2HNTF 2H9TH 5FBIA 2JKHA 4Z6AH 1TBQH 5DP4A 2P3UB 1PPGE 4UE7H 1GJAB 5HYOA 5A0CA 2B9LA 1SGIB 1VITG 4IN1A 2FI5E 2GCTC 2BVXH 3ODFA 1P57B 2CHAC 5C2ZA 1DXWA 2GMTB 3GY3A 3V12A 3KF2A 5F8XA 3ZZ8A 1MU6B 2BD8A 2FP7B 3GYLB 1CA8B 2H5CA 1QFKH 3ENSB 1AWFH 4ZMAH 1XXFA 3A89A 2GD4B 2Z9GA 2FOHA 3SZNA 1SQTA 1W8BH 4Y8YA 1NESE 1P2QA 3ZZ3A 1O3HA 1P11E 1JOUB 2GCTB 4Y79A 3T26A 4NG9H 2GX4A 1QBVH 1ZPCA 1ANBA 4RN6A 4FUDA 2BDYA 1J16A 3RMNH 4Q80A 2Q6FA 1ZOMA 2WUBA 2SGDE 1HIAB 1T8NA 1D4PB 1EJAA 2VVCA 1P10A 4ISOA 1ZZZA 2STBE 1IQGA 2A7HA 3RXLA 1GCDA 2Q6GA 1SLXB 2VWOA 1WSSH 4TPIZ 1QJ7B 3M7UA 1C2MA 1MZDA 3RXFA 2FOFA 3PO1C 4FUIA 5CHAC 1O3LA 1THRH 4KGAA 2WYJA 1J14A 1E0FD 3L6PA 3ATIA 3HKIB 3CP7A 3SNBA 3QZRA 1V2UT 4CRDA 1KTSB 4TYDA 3GY5A 1BTXA 2XCFA 1GBEA 1C2HA 5FPSA 1GJ6A 1OKXA 1FZZA 4ZXYH 8ESTE 1EKBB 3ZVGA 1TYNA 1E37B 1TGNA 6LPRA 1BBRE 1EB2A 2VGCB 4WXVA 1BT7A 3U98H 5JYIA 4O03A 1AKSA 4NIWA 4UFDH 3UR6A 4AFSA 3PO1B 2Z9LA 2I6QA 3TITA 4TWWA 3P95A 5CHAB 2H2ZA 3EA7A 5T6GA 1O2VA 4Y7AA 1O3KA 1V2VT 1ELFA 1IHTH 1C5TA 2VWNA 3PTNA 3QX5H 3SI4H 1UCYH 4ZKOU 2K7XA 1OX1A 1IQJA 1T8MA 5DP8A 4F49A 4FU9A 3EA9A 1TPSA 1GJDB 1S83A 1C5YB 1K1NA 1F0SA 3ZVAA 2Q6DA 1DOJA 2V0BA 3MH6A 1K21H 1PPFE 2VIQA 4A5TS 2VJ1A 3OSYA 1AO5A 1F0UA 1RRKA 1NRPH 2FLBH 4I31A 2PW8H 2ZU5A 2BM2A 2F3CE 2A5KA 3LONA 3UQOA 2CXVA 8LPRA 3A8CA 2QXIA 1VITF 2ZGHA 1AVWA 2F83A 3IWMA 2QF3A 2OD3B 2RA3A 1XUJA 1KXCA 3PLKA 4A7IB 3A80A 2ZHEH 1C1SA 2FEQH 1HCGA 1DY8A 1BHXF 3UNSA 3BN9A 2ZHWH 3SU1A 2TGAA 1GBIA 4TWYA 3T62A 1IQMA 2ZHDA 5FBEA 3SNDA 2PFEA 3RMLH 3LDXH 3T2NA 2ZU4A 4X6NA 1YPGH 2AERH 2XC4A 2FS9A 1FV9A 2XYAA 2DE9A 4CH2B 3UQVA 2UUJB 5T6DA 2P94A 5FPYA 3SU3A 4GAWA 1OYQA 1QJ6B 3TU7H 3F1SB 1HFDA 1KYNA 1P2KA 1Z6JH 4X2XA 2OC0A 2P95A 1FY1A 4IMQA 4YTAA 1IQFA 1NTPA 1RXPA 3HGNA 4D9QA 2Z7FE 2C8WB 1GBHA 2A1DB 2GCHF 1Z8RA 3PLPA 2O8TA 1VGCC 1C1QA 4FUGA 2KAIB 3PTBA 3P8NA 5SGAE 2FODA 1C1UH 4WMFA 4ZHAA 5LH8A 1LVOA 4H42U 5GPIB 3M7TA 3M36A 2WPJS 1O31A 4Q7XA 1D9IA 4A92A 1OOKB 2WINI 4U30A 1DWDH 2ZQ2A 3VGCC 4DY7B 1GBMA 4CH8B 3LT3A 1HAHH 3U1JB 1K1LA 1VGCB 1H8DH 2XWBI 1O2SA 2Y7XA 2HNTE 1GI2A 4Y11E 2BDHA 3ZZBA 3V13A 1BIOA 1ZR0A 4B76A 4LK4A 3E3TA 1TFXA 2BDIA 4B73A 1PPHE 2IPHA 4X2VA 3SV7A 4FUJA 4GHTA 4LZ1H 4WH8A 2WV4A 3NUMA 1P06A 1V2OT 2VWLA 4WXIA 2BXUH 4AFQA 3HK6B 1O30A 1NROH 3VGCB 1ETRH 3RXKA 4DVAU 2BD3A 2AH4X 2V3HH 2ZGJA 2Y82A 2Z6BD 2UUFB 1BJUA 3RXQA 2Z9JA 2ZDNA 2ZP0H 2ZI2H 1WU1A 2BY5X 3I77A 2ZFTA 2CGAA 4DOQA 1T8OA 1V2ST 1O2NA 1UVTH 3GY4A 5FCRA 1A5HA 1UO6A 1YGCH 4K1EA 4KTUA 2ALPA 1A2CH 2Y80A 4UFGH 2ZCKP 2BY8X 2NU4E 3DT0H 3ZVBA 1BRBE 5K7RA 1GPZA 1EUFA 2C8YB 5CMXH 4NSVA 1FONA 5A0AE 1OP2A 1SSXA 2ZA5A 4X1NU 9ESTA 4JYUH 1WTGH 4JZDH 1C5VA 1SHYA 1NRQH 1KTTB 1GJ4H 1O5FH 4INKA 1V2RT 4TPYA 3G01A 3UREA 5DK1A 3SGBE 3A8DA 1QQUA 1J8AA 2ZFPH 1SR5C 1OWEA 1A3BH 2WYGA 1LHCH 2A32A 3WY8A 1CHGA 2A7CA 1AKSB 1T7CA 2XNIA 2XC5A 1A61H 3O8RA 3TVJB 1L4ZA 1TGSZ 1E35B 1X7AC 2FOBA 3VB7A 3FANA 3RC5A 4YT6H 1O37A 2F9BH 1O2RA 6CHAB 1GI5A 5L30H 1Y3XA 3TNTA 2VIOA 4K60A 1LQEA 1W0YH 2PKSB 3TJVA 1L1NA 4OS7A 1YCPH 3S9BA 4K5ZA 1P12E 1AFEH 1K2I1 3SJIA 3URCA 1TRMA 1YKTA 1Z8JB 1OWDA 1NU7B 1K1MA 3E8LA 2WPHS 3SI3H 5C5NA 3KIDU 5EGMA 1HXEH 1P01A 1ARBA 2THFB 2A5AA 2OXSA 2ZNKH 1ANDA 1SGYE 4H4FA 2P16A 1D3TB 1IQEA 1O2JA 4AFUA 2FX6A 3VEQB 4JCNA 3DHKH 1N6XA 2BYAX 4GLYA 4B74A 1DY9A 1BMNH 2AIPA 5I25A 1QJ1B 2HNTC 1NO9H 2BDBA 3MYWA 1XUFA 3FP8E 5E0GA 5E2OA 4D8NA 4NA9H 1DM4B 2PLXA 2EA3A 4MQAA 2VVVA 1WTHD 2F9VA 2GDEH 3C1KA 1FAXA 4RKOB 1N1LA 1SC8U 4RSPA 3I78A 3PLBA 3RDZA 1GHXH 3QK1A 1O5CB 3FVFB 3FP6E 3MU4A 4UD9H 4NSYA 2J94A 3Q3YA 1A0LA 4GVUA 1A5GH 3LGWA 1RFNA 1D6RA 1WAYB 3RU4E 3TPIZ 3B9FH 2JETC 5GCHG 3U8TH 2Y5FA 1EJMA 1S84A 1SQAA 5CE1A 2H1UA 4JMYA 1EPTC 1QB1A 3M5MA 3HK3B 3VB6A 2HLCA 3HKJB 2LPRA 3A84A 4INLA 2JH6D 1GBKA 3NWUA 1UJ1A 2BD5A 2XBYA 1QRZA 1FIZA 3SN8A 4H6SB 1E34B 3A7XA 4XBCA 1L1GA 3KNXA 1A0JA 1O3PB 1SGEE 3KHVA 4A1TA 1TA6A 4X2YA 1HAVB 1BRCE 2AGIX 5LGOA 1RIWC 1F5KU 3SU6A 2Z3DA 1C9PA 1MH0A 2ZU1A 2D1JA 1CGHA 3TGIE 1GJ7B 1OXGA 1EPTB 1DE7H 1P09A 3P8OA 4BAQB 1ZMNA 4HTCH 2GZ7A 1C2GA 1MBQA 1L2EA 3SJ8A 1IOEA 1O2TA 1PQ8A 1VJAU 3PMJA 3DA9B 3MU8A 1P2OA 6ESTA 1GHWH 1C5OH 1TNIA 1NN6A 4YZUA 1AVXA 4B1TA 4ABGA 4DW2U 5BRRE 1XM1A 5FHTA 4FUHA 1TRYA 2PSYA 2VIPA 1OWIA 4KELA 4I8KA 4AZ2B 2ESTE 2K1QA 2Z9IA 1DSUA 1O2GH 4OS6A 4K1SA 4Q7ZA 3A82A 5LPFA 1S5SA 4IN2A 2EI6A 2FMJA 4Y0ZE 1Y5BT 3RC6A 1OWJA 4TY7A 1O2IA 1G2LA 1C9TA 2ZEBA 3M5OA 3MTYA 1JBUH 1GL0E 2ASUB 1VCPA 2FPZA 1XX9A 2DE8A 2OUAA 1O2KA 3PV4A 2A2XH 2H9HA 5E8EH 3E90B 1TBRH 3RMMH 3T27A 4HI3A 2BOHB 3BTKE 1CT4E 2ZF0H 1T31A 1RGQA 1YLDA 2J4IA 1OP0A 1EQ9A 3UNRA 2GTBA 2ZZUH 2OLGA 1ZJKA 1C2KA 3A88A 1BTUA 1A7SA 1PQAA 1QA7A 3TNSA 7LPRA 1ARCA 3EGKH 4IMZA 3SORA 1F92A 3P92A 1THPB 3TK5A 3RXBA 3GDUA 2A4GA 1EZXC 3SGAE 1XVOA 3LC5A 3P17H 5GXPA 1UTNA 3ZZCA 1AI8H 4CRGA 4YOIA 1NS3A 1Z6EA 3GY2A 3TGKE 2UWPA 4CRFA 3A87A 4MNYA 2Q1JA 3BG4C 1HB0B 3S7HB 2G4UA 1EAWA 3RXJA 4CRCA 1Y3YA 2JH0D 4FVBA 1W7GH 2G55A 2WPKS 3AW1A 1CBWB 1UVPA 1INCA 4X8VH 2TGDA 8KME2 1GI6A 1H1BA 1C5RA 4WY3A 4DIHH 2AIQA 5GCHF 2HPPH 1O2UA 1CO7E 2BDAA 5JBBS 2A31A 2R9PA 1GJCB 4X8SH 1H4WA 3BG4B 3O8CA 1NFYA 1DSTA