2Z9JA

Complex structure of sars-cov 3c-like protease with epdtc
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA02
1BJVA 4ASHA 1BTYA 1GHXH 2G51A 1RIWC 4ISNA 3H5CB 1J15A 1FPHH 3DA9B 3HK3B 3W94A 2O8WA 3I78A 2EI6A 3RXDA 4WVPE 5A09A 1VITF 1GHAG 2AGGX 1C5VA 1WCZA 3V7TA 2FZZA 2VVCA 4ABEA 4WY3A 4CBNA 4GSOA 2UWLA 3SNDA 2STBE 1Z8GA 4HI3A 2OBOA 2TGTA 3AAUA 1C2LA 1SQOA 5ABWA 5T6DA 2HPQH 4WXVA 2VU8E 1IQJA 1ELBA 2FOMB 1C2FA 1NU9A 4BAMB 1KTSB 1V2ST 3A7TA 2CXVA 1P05A 1S0RA 1UCYE 1GJ5H 3L3TA 5EXMA 2Q1JA 1QB6A 1DDJA 1GVKB 1O3MA 2B7DH 4WMDA 1C2GA 5H4IB 4NSYA 4H4FA 5JBCS 1UTJA 1DLEA 2YNAA 3U8OH 3UNSA 3SJ9A 1ACBE 3LU9B 3QK1A 1MKWK 2FOEA 1NC6A 4Y0ZE 1EJAA 1A46H 3M7QA 3MO3A 1A2CH 3BIUH 1GJ9B 2A31A 3ZZ7A 3U98H 5SGAE 2HNTF 3PTNA 3P8GA 5CMXH 4OGXA 3SU3A 1O2RA 1F0TA 2XWAA 3TK6A 1OP8A 3PB1E 1GCTB 1QA7A 2BVSH 2Q6DA 3QO6A 3OY6U 3K2UA 2QXIA 2BX4A 2F91A 5L2ZH 5EW1H 1P09A 3E6PH 2ZHWH 4Z6AH 1B5GH 4Q7YA 4DURA 3M3VA 1BBRE 3E3TA 2TBSA 4IMQA 5BPEA 2PSXA 1M9UA 2HNTC 3GCHC 1MU8B 1F5RA 4I8LA 2NU4E 4AFZA 2QV1A 3RUOA 3PMHB 2Z3EA 1VITG 2GVFA 3PMAB 1EP6A 2FX6A 1EAXA 4K8BA 2AGIX 2H5DA 2XC5A 1TQ7B 3SUGA 4AFUA 3MU8A 4X1NU 1OP2A 1ABJH 1NM6A 4GCHF 4TPIZ 1DM4B 4WXIA 1C2MA 1ESTA 1AZZA 3PMJA 3PM3A 4CH8B 4GHTA 2Z3DA 3RXTA 4ZROA 1E37B 2CMYA 3GYLB 1A7SA 2BQ6B 4XOJA 1HUTH 2HWLB 2GX4A 4CRFA 2PTNA 3TGIE 1ZSKA 4XBBA 1H1BA 1DE7H 1P01A 4MNYA 2AMQA 1C1MA 2BDGA 1QL7A 1DITH 2FOCA 3SU6A 1P2OA 3GCOA 1GJCB 4X8SH 2ZFQH 1AU8A 1YP9A 5BRRE 4BAHB 1DWDH 4CRAA 1KSNA 3ATMA 1YF4A 1Y3XA 1HDTH 3KQEA 3UNQA 5JYIA 5EXLA 4ESTE 4O03A 1P2IA 2NWNA 1JMOH 1ZTKA 4YT7H 3RU4D 2BD5A 1O5AB 1O2MA 1ZRKA 1HYLA 3FFGA 1BMNH 1GI1A 2VINA 1SB1H 1O2JA 5DP8A 1UTOA 1BRUP 4FUJA 1LO6A 1UCYH 1GDQA 1UMAH 3GDVA 3ESTA 1V2NT 1C5PA 5F8ZA 2P59A 2ZCHP 4MPWA 5TCCA 4BAQB 2IN2A 1TGCA 1O37A 1EXFA 4TPYA 1HXEH 5B6OA 1O5FH 2FMJA 1E36B 5HGGA 2OUAA 1OKXA 2JH5D 2NU1E 1OS8A 4ZXYH 1SBWA 1OYQA 1D3QB 1K1IA 1O3OA 2P8OC 3LDXH 1G36A 1DY9A 1NY22 4AOQA 3GDUA 4ISHH 1CA0B 3H7OA 1HAIH 1K1MA 4Y11E 2ZGJA 2AMDA 1AWHB 2W3KA 4LXBH 1W3CA 5PTPA 2ZNKH 4X2WA 1MAXA 1TBQH 1MQ6A 5AF9H 1SLXB 1DX5M 2P16A 1SHHB 1ZMJA 3EYDA 4F49A 3U8TH 3STJA 5EXNA 2ZU1A 1O39A 2GTBA 1G2MA 3RDZA 1Z1JA 4WH6A 2SGFE 3ZZDA 1MKXH 1WOFA 3BEFB 3OU0A 1BBRH 2O8TA 3K65B 1QBOA 2FS9A 2XC4A 1L1NA 1KLIH 8GCHG 4E7NA 1GBIA 4I8GA 1ZTLA 3VPKA 4D76A 3PLKA 2QIQA 1P3CA 1FAXA 4Q7ZA 4UONA 1O5DH 1YM0A 3TJVA 1W12U 5AFZH 2SNVA 6ESTA 2A32A 3TH2H 1LVMA 3RLYH 1LHCH 1CA8B 1P2KA 1E35B 3ZZCA 2O8MA 1YLCA 2C93B 2A4RA 2AYWA 1WU1A 2RA3A 4NA7A 1GI3A 1J9CH 2QAAA 1N8OB 1FJSA 1P04A 2PGBB 4X8VH 5GDSH 3RMNH 3SU4A 1BTUA 3O8CA 3BTWE 5E0GA 5F03A 1BMLA 2ZU2A 4Y79A 1DXPA 2GKVE 1O5GH 1TMUH 1HLTH 4O9VA 2BVRH 4Y7AA 4HFPB 4JYTA 2AS9A 1SL3A 3TH4H 1KXFA 3LJJA 1KXDA 1O38A 2ZIQH 1PPCE 2Y80A 2ZA5A 1SR5C 3ZZ4A 3A88A 1TGSZ 1TRNA 3OX7U 1AE5A 3NZIA 3M3SA 1FY8E 2VIDA 1F92A 1T8OA 4JZIA 4U30A 3TJNA 1K1NA 5EG4A 3VB4A 1KXBA 1C2IA 1BHXB 3PO1B 3Q3KA 5HM9A 1TE0A 3NKKA 4GVUA 1GL1A 1TPOA 2OLGA 1RD3B 3P70B 3A8DA 5HM2A 1NO9H 3VGCC 3RMMH 1ELEE 5JB8S 3TGJE 5T6FA 1C1PA 1K21H 1ZMNA 1GI8B 1XUFA 3SU0A 1WQVH 2KAIA 3KEEA 3P8NA 4MLFB 4JZ1A 1O2XA 1NZQH 1W11U 1O2LA 1CHGA 4XBCA 2HNTE 3ZVAA 3A89A 1O3KA 4B71A 1C5YB 1FIZA 1MQ5A 1ETTH 1S84A 1ANCA 2ZCLP 3IITA 1HNEE 2ZG0H 2V6NA 2WPJS 1V6DA 2GT7A 1SGFG 3ATKA 1GGDC 4ZH8A 5DP4A 2F9VA 1O3JA 2BY5X 1TRYA 3GY6A 5A0BA 3HK6B 1O3AA 2C8WB 3BG4C 1E0FD 1TBZH 1OX1A 1FLEE 1AB9B 1TOCB 2BOHB 1G37A 4X2YA 2BZAA 1IQMA 1DUAA 1VR1H 2HVXA 4JYUH 3GICB 1BBRK 3BTME 3GDSA 2FOHA 1AFQC 3MYWA 3UR9A 1P03A 4KTUA 3EE0B 2GZ7A 5ESBA 1A1RA 3EDXB 1ETSH 1SLUB 1NRQH 1MAYA 1O2VA 4A5TS 1GBTA 3SU2A 1TGTA 1WUNH 1IAUA 1P9SA 2FOFA 2CHAB 3F1SB 1P2JA 2WPMS 3KHVA 1CE5A 1TGBA 3KGPA 1BITA 2F9OA 1C5WB 4THNH 4ZKSU 3ZV9A 1PPGE 5FAHA 1AUJA 1TGNA 1GHVH 4BAKB 4OS6A 3T29A 1L4ZA 3MH5A 2A7HA 4X1RU 3E90B 2QXJA 3FANA 4CHAC 1V2OT 1GHWH 1D6RA 1OPHB 1S6FA 1L1GA 2ANWA 1AVGH 2J34A 2BZ6H 1C5TA 4K8YA 1GI5A 2Z9IA 1F0SA 4OS5A 4A1TA 1TX8A 3A85A 1PPEE 2OBQA 5FBIA 1AFEH 3QX5H 5JDUB 1ELAA 2PFEA 1LCYA 2PUXB 1TB6H 2FODA 3TVJB 2XNIA 3URDA 2PLXA 4Y8XA 3I77A 2Y6TA 1ZSJA 4X8TH 2WPLS 1T4VH 3B23B 5A2MH 4D7FA 3P17H 4ZKOU 1O3DA 3ZZ9A 3LOXA 1QRZA 4CRCA 3BF6H 1GHBF 1BZXE 2BMGB 1EB1H 1YGCH 2FO9A 1TWXB 3SV2H 3ENSB 3B9FH 2A7CA 1GMDG 4BANB 1YCPM 1UK2A 2IJOB 5JPMH 4AN7A 1F2SE 2TGAA 4XBDA 1TNJA 3O8RA 1LPGB 5IDKA 3SJIA 1UVUH 1MTNB 2P94A 5LPFA 1NRPH 1ZGIA 1S82A 4IW4E 3L6PA 4DIHH 2BXTH 4FUHA 2SFAA 3MMGA 3TNTA 3ZZ6A 1MBMA 2JH0D 1CHOG 1TMBH 3QTVH 3T26A 3UNRA 1SG8B 2G4TA 4OS7A 1TABE 4TY6A 2A5KA 5L30H 2GDDA 1DXWA 2A2QH 1A5GH 3SI4H 1QJ7B 4I8HA 1SSXA 1MKWH 2FIRH 2OCVB 2QA9E 3GY4A 1SMFE 1VJ9U 4AFSA 4AYVB 1OSSA 3LGUA 1VGCB 4X6OA 4DIIH 2ZI2H 4I8JA 2VIQA 1ZRBA 1SPJA 2SGQE 5JBAS 1AWFH 1IQIA 1CBWC 1UK4A 2FOAA 2G81E 1C1SA 1JBUH 3RXBA 3UPEA 1PJPA 3O8DA 2ANYA 4FU7A 1XUKA 1NTPA 1O2PA 2XCFA 2ZWLH 4BTTB 5T6GA 4Y8ZA 1GBMA 1QL8A 4NIYA 2BQ7B 2PTCE 1QBVH 2VVUA 1C1TA 1ZZZA 2Y7ZA 3EAJA 4FUEA 2FPZA 1ANEA 1DT2A 1V2QT 2SGAA 3RXOA 2R3YA 1MTVA 3C1KA 1AIXH 1GVZA 1EJMA 3EA7A 3SBKA 3F6UH 3ZYDA 2FTMA 4WMEA 2R0LA 4MPUA 1OWKA 2V0BA 1B0FA 1G30B 1BTZA 1DWCH 1EPTC 1XKBC 3UWIA 4JZFH 5HMAA 2ALPA 2P3TB 2BDIA 2Y5FA 4A7IB 2ZDVH 3AW1A 2F83A 4WWYA 1W10U 5C1XA 2F9PA 1LKBA 2QF3A 3SN8A 4B2CA 1IQLA 2EI8A 1F5KU 3TGKE 2BVXH 1G3DA 3UY9A 3MU1A 1C1UH 1C2EA 3V3MA 4JYVH 4UFDH 4X0WU 3ZVFA 1GG6B 1IHTH 2JETB 2BDBA 2PKSC 1EZUC 3QZRA 1OP0A 3BSQA 1AE8H 2RCEA 1O3FA 3RU4T 2G52A 2UUFB 3QN7A 1O3HA 4ABFA 1P06A 1P3EA 2J92A 3GY2A 1DS2E 3PV4A 3ZVBA 3P8FA 1ZYOA 2STAE 3VB6A 1HJ9A 1XXFA 1UO6A 2KAIB 5FPSA 5GIBA 1HJAB 2ODQA 3VXFH 4AGJA 3FP8E 3G01A 4DJZB 1XUJA 1CT0E 3RXHA 3A81A 1RGQA 4U32A 5L6NH 3T5FH 3FVFB 4MNVA 1OWEA 1T8NA 2GD4B 4TY7A 1LHDH 3E16B 2W7UA 1K1PA 1T7CA 3GCTF 4Y0YE 1P10A 3ATLA 4NA8A 1WV7H 1NN6A 3RXAA 4RKOB 1K28D 2GT8A 2VH0A 1ELDE 4X6PA 2O9QA 2J38A 2RDLA 2ZGXH 4X6NA 1Z8RA 2ZZUH 1CT4E 4AZ2B 4E06H 1HAGE 4PROA 1D6WA 1O2YA 2PHBA 1BRCE 1MH0A 2BM2A 3DFLA 5JB9S 2ZGCA 1ZPZA 2Z9JA 4UFGH 3IG6B 1GBDA 4XFQA 2NU2E 1QB1A 1V3XA 1BB0B 5FCKA 3UIRA 3M5LA 1MTSA 1QCPA 4NG9H 1D4PB 5EQQA 1HXFH 2BD8A 3SUFA 2JH6D 3AASA 3P6ZB 1C5NH 3UOPA 5A8XA 1LVOA 3W95A 1YYY1 5ESTE 1SC8U 1O3LA 1PQAA 4YT6H 2THFB 3TIUA 4I33A 2XYAA 1EX3A 2XWBI 3SNAA 4ZMAH 3M35A 4OGYA 1LDTT 2DE8A 3D62A 5T3HA 1RRKA 3GISB 4K1EA 1ELTA 1MU6B 3BTKE 3LH1A 3AAVA 3RM2H 1HV7A 1H9LB 1ZGVA 1Y3WA 4LK4A 1BDAA 3GCNA 2VGCB 1C9TA 3N7OA 3D23A 5TJXA 2ZFPH 3TU7H 3T28A 1XUHA 1TALA 1BHXF 4YOIA 1BA8B 3ZYEA 2FYQA 3WY8A 4BXWA 3P8OA 3CP7A 3SNCA 1RXPA 3LGYA 3ZZAA 1GJ7B 1Z8JB 3MH7A 2PUQH 1S81A 2O8UA 1EZXC 6CHAB 1W0ZU 4KTCA 2P3FH 2D8WA 1AKSB 1AMHA 1FAKH 3Q3YA 1ZJDA 3B8JA 1OWJA 3QGJA 2FLRH 2J94A 4ABDA 3MNSA 4INLA 1GJ4H 2BY9X 3NXPA 2W7SA 4KP0A 2R9PA 1TPPA 1KXCA 3TPIZ 3U1JB 4NWLA 3HATH 2J2UA 3M5MA 1T4UH 2AH4X 4ABHA 2OQUA 1O2GH 1J8AA 3LC3A 4Y71A 2Y81A 2EEKA 1SHYA 1L2EA 4FUIA 1C4Y2 2GCTC 1RIWB 1K1OA 2Z94A 1ESAA 3RXUA 1TNKA 5EODA 3I29A 4M7GA 1AI8H 1HFDA 1LPKB 1RJXB 1OWIA 2B5TB 2C8YB 2VWOA 1F0UA 3MU5A 1A5HA 1C5OH 4X2VA 4B73A 1PFXC 1CT2E 1SGFA 1YPMH 1TNGA 1ZHMA 1VCWA 2C90B 3BTTE 2ZU5A 1J17T 3VXEH 1JRSA 2ZHDA 1GI0A 4QT8C 1GHYH 4HGCA 4MNWA 4ISIH 1W8BH 1KXAA 1ZSLA 3OYPA 1KIGH 1Y5UT 1TAWA 4DOQA 3BIVH 9ESTA 3D49H 5E0JA 1O3NA 3LT3A 3A7ZA 4GCHG 2ZQ1A 4Q2KA 2FDAA 2UWPA 2FXRA 3OTJE 2GV6A 5F8XA 2CN0H 1SLWB 1F7ZA 1C5XB 1GMCF 1LQEA 4INKA 5C2ZA 2OTVA 4KTSA 1YLDA 2H2ZA 4O3TA 5GPIB 3SORA 1DWBH 1C2JA 1TIOA 1G3CA 3SJOA 1ETRH 1LHFH 1AD8H 1YPKH 1HCGA 4UEHH 1FXYA 1UTPA 3ITIA 1NPMA 2PR3A 1O32A 3S7HB 1GCDA 4CRGA 4U2WA 3SNEA 4K1TA 5EOKA 1THRH 1YC0A 1H9HE 2ZTXA 3ZZ5A 2D1JA 1O3EA 1O3PB 1QGFA 1NFWA 4B2AA 1J16A 4R0IA 4H42U 2A4OA 5C3NA 2EI7A 1O3BA 1NT1A 3JZ2B 3BTGE 3MU0A 1HAPH 1NESE 5GCHF 5K7RA 1DICA 1SGIB 2ZFSA 1KLTA 3O8BA 2BD3A 2FOBA 1WAYB 4MVNA 5E2OA 2A5AA 1A5IA 2D26C 3ZVEA 4GUXA 4A1XA 1K1LA 1ELGA 2CF9H 1FIWA 3GCHB 2ZPSA 2A4GA 3A87A 2R2MB 1FMGA 4DW2U 2ODPA 2OINA 3UTUH 4ZUHA 2ASUB 1RTKA 3BTHE 2Z9LA 2BLQA 3STIA 1GI2A 1SVPA 4VGCC 1UVSH 4JMYA 5FX5A 3M37A 4A1VA 4D9QA 4MTBA 4BTIB 1PYTC 1HAXB 3OY5U 1LPZB 1ZJKA 1GBLA 2ZF0H 4FU8A 4AG1A 3D65E 2BDYA 3ZVDA 5J4QA 4YZUA 1T8MA 2TGDA 2ALVA 4XSKU 2ZDLA 1THSH 1AUTC 2AERH 4H6SB 2OC0A 1EAWA 1P57B 1A3EH 4DCDA 3KIDU 4BAOB 1GMCG 3K6YA 1TNIA 1FZZA 7LPRA 4I32A 1EUFA 5DP5A 1ELCA 2GCHF 3FAOA 3HGNA 3MHWU 1BRAA 5GWZA 3KQDA 2PSYA 3RXRA 4X1QU 1WYKA 1QR3E 3QTOH 1QA0A 1C2KA 1W7XH 1L4DA 3T2NA 1ID5H 1GBHA 4OS1A 2VNTA 1FONA 4UDWH 5G4BA 3MI4A 1YCPK 1PPHE 2GZ8A 4NZLA 2R2WU 1ELFA 3DT0H 5AVDA 1AY6H 4DGJA 3A80A 3VB7A 2OC1A 2DUCA 3SV9A 7KMEH 4MDSA 4GAWA 2GMTC 5DGJA 1QY6A 3ZZ8A 2TRMA 3M3TA 1O2ZA 1LHGH 4NFFA 1L1JA 1HGTH 2F9UA 2BX3A 1IQHA 2K1QA 2AFQB 3LJOA 3Q76A 1O5BB 1EJNA 2ZGBH 2BD9A 1D3PB 4WMFA 2EC9H 3MNCA 1AVXA 3CS7A 1WTGH 4LZ4B 1RTFB 3RXJA 1ELVA 4K60A 4B76A 1TPAE 1LVYA 1PQ8A 3HKIB 3UQOA 5LH8A 1RFNA 1GBAA 3R0FA 3A82A 2PKAA 1GJBB 5HXFA 3QZQA 2QF0A 3A84A 3IWMA 2BTCE 1RTLA 1QIXB 1KLJH 3NCLA 5C1YA 1GBFA 3U1IB 1GJ6A 2ZTZA 1H9IE 2JKHA 4DY7B 1GJAB 2Z9GA 3NK8A 2P95A 2R3UA 2ZC9H 4K5ZA 4TWWA 3A8CA 4NFEA 2OC8A 3LONA 1GWAA 4CBOA 1A4WH 4NIVA 1LVBA 3RC6A 3NUMA 3RM0H 2AIQA 2GCHG 2UUJB 4CH2B 5C20A 1XVMA 1O2NA 1SOTA 2FI5E 3RXVA 4AX9H 1HIAA 3T62A 1XX9A 2A1DB 2WINI 3RXQA 1FI8A 1ZHPA 1FN8A 2FEQH 1V2JT 1BIOA 1FUJA 1QRXA 3BTDE 1D3TB 1FV9A 1KTTB 2C8ZB 3LH3A 1C4U2 3LGWA 2XW9A 5FCRA 1WTHD 2BXUH 1V2MT 1D9IA 1V2TT 1Y3YA 2ZGHA 1AKSA 5E8EH 1EPTA 4UD9H 3BTQE 4ZHLU 2UWOA 2CF8H 1SFIA 3DFJA 4WF8A 5A8YA 2C3SA 1GMHF 2HPPH 3LGTA 1MZAA 4FVDA 3SQHE 1O2TA 1P02A 3A7YA 5DK1A 3TK9A 5DPAA 4ZKNU 2BHGA 1C2HA 3FZDA 3BV9B 5EW2H 1FY5A 2XXLA 3UQVA 5HYOA 3RXKA 2WPIS 2VWMA 2ZDMA 2W5EA 1V2RT 1V2PT 3VGCB 2RG3A 1SGEE 5I25A 2BLOA 2ULLA 3U69H 9LPRA 1DOJA 4KGAA 4BNRA 1HAYB 3KF2A 1W0YH 6GCHF 4YESB 3GY5A 2FS8A 2SNWA 2BY7X 2Z7FE 3S9BA 5A0CA 3PLPA 2WPHS 3BG8A 3LGIA 1VCPA 5FPYA 1GCTC 4ABJA 1YPLH 1BMAA 3A8BA 1XUIA 1UVTH 3A7WA 1QB9A 1SGNE 2QN5T 1W7GH 1GI7B 5EQSA 3BN9A 5DKMA 1XKAC 2HALA 2WYJA 5CHAB 3M36A 1GGDB 1VZQH 4CR9A 4NSVA 4NCYA 2Z3CA 4A92A 2G00A 1DSUA 4HZHA 2ZHQH 1FQ3A 4YM9A 4HTCH 2K7XA 1QNJA 3BG4B 3GY7A 1WSSH 1JWTA 3VEQB 2XRCA 3SNBA 1GHBG 1KXEA 4O97A 1O5CB 1TMTH 2YOLA 2VJ1A 1TA2A 1YPHC 5DP3A 3CENA 3SV8A 1Q2WA 1CQQA 4YLUA 1AFQB 1PQ5A 1NFYA 4YLQH 2ZFFH 1FY1A 1X7AC 3PWBA 4Q80A 4X8UH 5F8TA 4JZEH 4ZHAA 1GMHG 4FUCA 1EATA 1HAVA 1SGYE 2H9EH 1A3BH 1QFKH 1H4WA 4IS5A 3F68H 1EASA 1P0SH 3GY8A 1QBNA 2F3CE 2QY0B 2SGDE 2V3HH 1WBGB 3A86A 3PROA 2OD3B 3PYHA 2A45B 3SW2B 5I46H 1HB0B 4DT7B 4CHAB 3M61U 4U01A 2FM2A 3UR6A 2A5IA 1LHEH 1W2KH 3VB5A 1P9UA 3V0XA 2DE9A 3MNBA 2BLWA 4CRBA 2VB0A 3M5NA 3U8RH 1E34B 2A7JA 1Z1IA 1K9OE 7GCHF 1RS0A 2ODYB 2ZQ2A 2ZU3A 2GP9B 1OYTH 3MWIU 1C1NA 3U9AH 3P92A 4WJG2 1EAUA 1BOQA 1NFUA 1BTWA 3V12A 1SOZA 1O31A 5ETXA 1MCVA 2TPIZ 1S83A 1FY4A 2AIPA 1TONA 2XCNA 4I31A 3JZ1B 1H8DH 3SUDA 2UUYA 3PTBA 1E38B 2BY8X 3SQEE 3RXIA 3F9EA 1HAHH 1O2SA 5DP7A 1MTUA 1QTFA 3VB3A 3A7XA 1NU7B 4MG3A 1ABIH 1CA0C 3TH3H 3KQCA 1CGHA 4F4OC 1C2DA 4OS2A 1O34A 3C27B 1UTMA 4D9RA 3E1XB 4SGBE 5K0HA 1SGPE 3E0NB 2G8TA 2VVVA 1DFPA 1Y8TA 2QXHA 4ABIA 3L33A 4AYYB 1NRSH 2ZDNA 4INHA 1CVWH 1FDPA 2ZECA 1IOEA 4LOYH 3DD2H 2FESH 4UE7H 5FHTA 4FUFA 3DHKH 2ZEBA 2PKAB 5C1UA 1GBCA 1HBTH 2H1UA 4X2XA 1XVOA 3FZZA 1IQNA 2YNBA 2V35A 2BDHA 3SV7A 2ZHFH 1S6HA 4GPGA 2I6SA 1QRWA 3BTFE 1PPZA 1CBWB 1TOMH 3RXPA 4B75A 3RXEA 1C1OA 3CS0A 3SU5A 2ANMH 1LQDB 2AGEX 4TWYA 2XBVA 1JXPA 2Q6FA 1QHRB 1D3DB 4KKDA 2ZTYA 3RC5A 4NA9H 1O3GA 1ARCA 7GCHG 1P11E 1HIAB 1IQKA 1ANBA 4D8NA 1N8OC 3SJ8A 4I7YH 1O2QA 1O33A 1TPSA 1W13U 1ZLRA 4IN2A 2H6MA 4GLYA 1A61H 1O5EH 2WUCA 4NIWA 8ESTE 1BQYA 1LKAA 1UVPA 4CR5A 1KDQA 4BTUB 1C1QA 2BLVA 1O35A 3GCTG 3ZVGA 1Z8IB 1F5LA 4RKJB 4Q7XA 1EPTB 4ISLA 4MPVA 4Y6DA 1U6QA 2PGQB 3TITA 2VIOA 3MO6A 3S7KB 1TNLA 5EPNA 4E7RG 1TLDA 1C1VH 1B7XB 1MTWA 1O3CA 1ZR0A 2Y7XA 5FXLA 3PO1C 4AFQA 4K3JA 1CGJE 3SZNA 1A0JA 2LIZA 1G2LA 1P2QA 4Z0KA 3SGBE 2HRVA 4MPXA 1C5QA 1MBQA 1MUEB 1TBRH 8GCHF 1SGCA 8LPRA 2PKSB 2GV7A 3T27A 3MNXA 3UOUA 4IBLH 2G5NA 1Z7KA 3ATIA 1O2IA 2EA3A 1VCQA 3Q3XA 1BT7A 4E05H 3QLPH 3BEUA 1QJ6B 3ZZBA 4JCNA 2ZKSA 3M5OA 4X1PU 4K2YA 3QGNB 2HGTH 1ZOMA 3EA9A 1BTXA 1YKTA 3LGVA 1C9PA 3M7TA 1NRRH 2A4QA 7ESTE 1GL0E 5AFYH 2F9BH 3OSYA 1YPHE 1OOKB 3F9GA 3SJKA 3RC4A 2V3OH 5DJ7A 4ABAA 4IC5A 1C5RA 1YCPH 4Y76A 2Y5GA 1AGJA 1GVLA 2UUKB 2AMPA 5EU8A 2W3IA 1G3EA 3K6ZA 1AB9C 1QL9A 4J1YA 5EGMA 1O2OA 2Y82A 1AN1E 1IQGA 2XBYA 1XM1A 1SGDE 3Q00A 2BD4A 3RXSA 1HAZB 5EPYA 3RXGA 3TK5A 2ESTE 4FUDA 1G32B 2OQ5A 2R0KA 2FI3E 2SGPE 2WPKS 5TCAA 1YBWA 4BOHA 5C67A 4I8KA 5LPRA 3E0PB 1UJ1A 5F6MA 4K1SA 2C8XB 4NIXA 2ILNA 1SQAA 3HKJB 2CHAC 2QC2A 1DANH 1MZDA 1UTKA 2IOTA 2FLBH 1DPOA 1HAVB 4R8TB 1DLKB 2PV9B 2HOBA 5DP9A 1SQTA 1Z6JH 2J95A 2ZFRH 3S69A 3QDZB 6LPRA 3A83A 2XBWA 4IN1A 2OP9A 2G55A 1KYNA 1SLVB 1C1RA 3AVZA 2ZP0H 1O30A 1S0QA 4JK5A 3SI3H 3ZZ3A 1P2MA 4AB9A 1JOUB 2GDEH 1SFQB 4B74A 1BUIA 3LPRA 4JZDH 1O2WA 1BCUH 1IQEA 1BRBE 3BEIB 4AORA 5LPEA 4TYDA 1Y5AT 2P3UB 2VIWA 3GOVB 4NWKA 1PPFE 1GJ8B 1UHBB 1ZMLA 1KY9A 1ANDA 1P2NA 1OXGA 2LPRA 1UTNA 3UFAA 2XC0A 1NS3A 1SGQE 2VH6A 2F9NA 1Y3VA 3KCGH 2H9TH 2WYGA 1C5LH 3SO3A 1P8VC 2GGVB 1DUEA 4MNXA 3RXFA 3SU1A 3PMBB 3Q77A 1SGRE 1C4V2 4GHQA 3RP2A 1FY3A 1O3IA 4D7GA 2VWLA 1HPGA 2A0QB 4IC6A 4YOJA 1TA6A 3TJUA 1QQUA 4AGKA 2BDCA 1DWEH 1MCTA 2M5TA 5FX6A 1N6XA 1MTNC 3F9HA 4YO9A 5DO4H 1TX6A 4XDEA 1FPCH 1DY8A 4UFEH 1S85A 3AW0A 2ZPQA 4O3UA 3RU4E 3RMLH 2I6QA 1GI9B 1AO5A 2BYAX 4WH8A 3UUZA 1O2UA 1CU1A 3LIWA 3RMOH 2GCTB 1UCYK 1WQSA 1MD8A 2O8LA 5FBEA 1JIMA 3UREA 2Z6BD 4RSPA 1VGCC 1GBEA 5GCHG 3MU4A 4RN6A 3LC5A 2NU0E 3TJOA 5GJ4B 1MD7A 5A8ZA 2RA0A 3KQBA 2ANKH 3TNSA 1GDUA 2WV5A 1TQ0B 1YPJH 2BD7A 3NPSA 3S9CA 1O36A 3SHCH 3UWJH 3F9FA 1K1JA 5E2PA 3NWUA 1AHTH 3HPTB 4FXGH 5CHAC 2P8OB 2CGAA 3SGAE 4Y7BA 1DSTA 1GI6A 1TFXA 1V2WT 3E8LA 1PPBH 5DG6A 1V2UT 4KELA 3PWCA 1TNHA 1G3BA 4YOGA 1NFXA 3A7VA 1TRMA 2ZDKA 1UVOA 4K69A 1GMDF 1EOLA 3HGPA 1PYTD 3VFEA 2SGEE 1EB2A 1UTLM 4Y10E 2D2DA 8KME2 1UTQA 1O2HA 1TYNA 2J9NA 1Q3XA 2FX4A 1MKXK 3SGQE 5C5NA 2ZU4A 4DVAU 4CREA 3EQ0H 4LZ1H 1KDQB 1ZHRA 2H5CA 1SI5H 1F0RA 1GBKA 1EKBB 1G9IE 1QURH 2XTTB 5AHGH 4OS4A 1A0LA 2B8OH 1CHOF 2PW8H 1T31A 4NZQA 1JRTA 2P93A 3FP7E 1GBJA 1GI4A 4MQAA 2FTLE 1HRTH 2W26A 1EOJA 2HLCA 2BY6X 3K9XB 2G5VA 1HAOH 1GG6C 2JETC 5IYTA 3MH4A 3GYMA 2Z9KA 3RXMA 2BQWB 5A0AE 4B1TA 3LKWA 1NROH 2H9HA 1W14U 1ZPCA 5L2YH 2VIPA 3S0NA 1PQ7A 4AB8A 1ZTJA 2QXGA 3BTEE 2BDAA 1T8LA 1XMNB 1VITH 3ODFA 2OXSA 2B0FA 1IQFA 4ABBA 4A6LA 1HJAC 4YTAA 4X1SU 4IMZA 3EGKH 4ZKRU 1AQ7A 4VGCB 1V2VT 3PLBA 2VWNA 1FNIA 1C5ZB 4JK6A 3MOCA 2CJIA 2OC7A 3SOSA 2Y5HA 1OWDA 2TIOA 3ATWA 5FPTA 1OWHA 1P12E 3V13A 3SUEA 4FU9A 2Q6GA 1NRNH 1GBBA 2FOGA 2XBXA 3EA8A 1GHZA 1XXDA 2ZHEH 3QUMP 1L0ZA 1JIRA 4NGAH 3ODDA 1MMJN 1EAIA 4CRDA 2FWWA 1K22H 3RLWH 1CO7E 1K2I1 3QWCH 3ELAH 1AVWA 2G4UA 1QJ1B 1Y3UA 1DVAH 1YPGH 5JBBS 3R3GB 1EQ9A 2IPHA 4B2BA 5CE1A 3RXLA 3GY3A 5LGOA 3H7TA 1BMMH 1GJDB 4SGAE 3EBNA 2FP7B 1XUGA 3DUXH 3ZVCA 1YPEH 3P95A 1N6YA 3SHAH 4ISOA 4ZXXH 1Q31A 2VIVA 5JBTA 1GHAF 2WUBA 3TLOA 1O0DH 4J2YB 2PWXA 2AEIH 3KL6A 4ZAEA 3MH6A 1N1LA 1C5SA 1EZQA 1C5UA 1QQ4A 3A8AA 4Y8YA 3MFJA 5J4SA 2FI4E 1BTHH 2ZCKP 5C5OA 1FN6A 1GPZA 1ARBA 2BB4A 3T25A 1INCA 1A0HB 4BXSA 1ZPBA 1IHSH 1ESBA 2GMTB 1H8IH 1B0EA 1VJAU 3SV6A 4DG4A 1S5SA 2A2XH 5DP6A 2NU3E 3KNXA 1SGTA 1O2KA 2VGCC 1BJUA 4XE4A 1UK3A 5E0HA 2BD2A 1C5MD 2B9LA 1AZ8A 1ORFA 4AG2A 1Z71A 3KN2A 4ABGA 3RXCA 5GXPA 4FUBA 4FUGA 4ZHMU 3URCA 3S9AA 1Z6EA 2CV3A 1LMWB 1T32A 1CGIE 6CHAC 2LNCA 4H6TA 1V2LT 1GDNA 1C1WH 2ZPRA 2QCYA 1CSOE 2J4IA 2C4FH 2GZ9A 1BTPA 5EQRA 4UFFH 1LTOA 1THPB 3M7UA 1Y5BT 1Y59T 1J14A 1HJ8A 1V2KT 4FVBA 4X6MA 2ZO3H 2FYRA 2QGRA 6GCHG 2TGPZ 2WV4A 3FP6E 3MO9A 3E91A 3ZV8A 4IGDA 1EP5A 3MTYA 1UHBA 2QYIA 2ZFTA 2BOKA 2ZDAH 1TX7A 1EZSC
chains in the Genus database with same CATH superfamily
1BJVA 4ASHA 1BTYA 1GHXH 2G51A 1RIWC 1YLNA 4ISNA 3H5CB 1J15A 1FPHH 3DA9B 3HK3B 5GNDA 2O8WA 3I78A 2EI6A 3W94A 3RXDA 4WVPE 5A09A 1VITF 1GHAG 2AGGX 1C5VA 1WCZA 2JDID 3V7TA 2FZZA 2VVCA 4ABEA 4WY3A 4CBNA 4GSOA 2UWLA 3SNDA 2STBE 1Z8GA 5HKKD 4HI3A 2OBOA 2TGTA 3AAUA 1C2LA 1SQOA 5ABWA 5T6DA 2HPQH 4WXVA 2VU8E 1IQJA 1ELBA 2FOMB 1C2FA 1NU9A 4BAMB 1KTSB 3F2GA 1V2ST 3A7TA 2CXVA 1P05A 1S0RA 1UCYE 1GJ5H 3L3TA 5EXMA 2Q1JA 1QB6A 1DDJA 1GVKB 1O3MA 2B7DH 4WMDA 4DT4A 1C2GA 5H4IB 4NSYA 4H4FA 5JBCS 1UTJA 1DLEA 2YNAA 3U8OH 3UNSA 3SJ9A 1ACBE 3LU9B 3QK1A 1S6LA 1MKWK 2FOEA 1NC6A 4Y0ZE 1EJAA 1A46H 3M7QA 3MO3A 1A2CH 3BIUH 1GJ9B 2A31A 3ZZ7A 3U98H 5SGAE 2HNTF 3PTNA 3P8GA 5CMXH 4OGXA 3SU3A 1O2RA 1F0TA 2XWAA 3TK6A 1OP8A 3PB1E 1GCTB 1QA7A 2BVSH 2Q6DA 3QO6A 3OY6U 3K2UA 2QXIA 2BX4A 1E1QD 2F91A 5L2ZH 5EW1H 1P09A 3E6PH 2ZHWH 4Z6AH 1B5GH 4Q7YA 4DURA 3M3VA 1BBRE 3E3TA 2TBSA 4IMQA 5BPEA 2PSXA 4ACAA 1M9UA 2HNTC 3GCHC 1MU8B 1F5RA 4XRNA 4I8LA 2NU4E 4AFZA 2QV1A 3RUOA 3PMHB 2Z3EA 1VITG 2GVFA 3PMAB 1EP6A 2FX6A 1EAXA 4K8BA 2AGIX 2H5DA 2XC5A 1TQ7B 3SUGA 4AFUA 2YMSD 3MU8A 4X1NU 1OP2A 1ABJH 1NM6A 4GCHF 4TPIZ 1DM4B 4WXIA 1C2MA 1ESTA 1AZZA 3PMJA 3PM3A 4CH8B 3DSOA 4GHTA 2Z3DA 4RT1A 3RXTA 4ZROA 1E37B 2CMYA 3GYLB 1A7SA 2BQ6B 4XOJA 1HUTH 2HWLB 2GX4A 2OK5A 4CRFA 2PTNA 3TGIE 1ZSKA 4XBBA 1H1BA 1DE7H 1P01A 4MNYA 2AMQA 1C1MA 2BDGA 1QL7A 1DITH 3OE7D 2FOCA 3SU6A 1P2OA 3GCOA 1GJCB 4X8SH 2ZFQH 1AU8A 3VG8A 1SQRA 1YP9A 2KCYA 5BRRE 4BAHB 1DWDH 4CRAA 1KSNA 3ATMA 1YF4A 1EFRD 1Y3XA 1HDTH 3KQEA 3UNQA 5JYIA 5EXLA 4ESTE 4O03A 1P2IA 3ZZ3A 2NWNA 1JMOH 1ZTKA 4YT7H 3RU4D 2BD5A 1O5AB 1O2MA 1ZRKA 1HYLA 3FFGA 1BMNH 1GI1A 2VINA 1SB1H 1O2JA 5DP8A 1UTOA 1BRUP 4FUJA 1LO6A 1UCYH 1GDQA 1UMAH 3GDVA 3ESTA 1V2NT 1C5PA 5F8ZA 2P59A 2ZCHP 4MPWA 5TCCA 4BAQB 2IN2A 1TGCA 1O37A 1EXFA 4TPYA 1HXEH 5B6OA 1O5FH 2FMJA 1E36B 5HGGA 2OUAA 1OKXA 2JH5D 2NU1E 1OS8A 4ZXYH 1SBWA 1OYQA 4RT0A 5KGOA 1D3QB 1K1IA 1O3OA 2P8OC 3LDXH 1G36A 1DY9A 1NY22 4AOQA 3GDUA 4ISHH 1CA0B 3H7OA 1HAIH 1K1MA 4Y11E 2ZGJA 2AMDA 1AWHB 2W3KA 1VKYA 1W3CA 2J98A 2ZNKH 4LXBH 5PTPA 4X2WA 1TBQH 1MAXA 1MQ6A 5AF9H 1SLXB 1DX5M 2P16A 1SHHB 1ZMJA 3EYDA 4F49A 3U8TH 3STJA 5EXNA 2ZU1A 1O39A 2GTBA 1G2MA 3RDZA 1Z1JA 4WH6A 2SGFE 3ZZDA 1MKXH 2KCPA 1WOFA 3BEFB 3OU0A 1BBRH 2O8TA 3K65B 1QBOA 2FS9A 2XC4A 1L1NA 5C17A 1YWUA 1KLIH 8GCHG 4E7NA 1GBIA 4I8GA 1ZTLA 3VPKA 4D76A 4I86A 3PLKA 2QIQA 1P3CA 1FAXA 4Q7ZA 4UONA 1O5DH 1YM0A 3TJVA 1W12U 5AFZH 2SNVA 6ESTA 2A32A 3TH2H 1LVMA 3RLYH 1LHCH 1CA8B 2V3MA 1P2KA 1E35B 3ZZCA 2O8MA 1YLCA 2C93B 2A4RA 2AYWA 1WU1A 2RA3A 4NA7A 1GI3A 2M2AA 1J9CH 2QAAA 1N8OB 1FJSA 1P04A 2PGBB 4X8VH 5GDSH 3RMNH 3SU4A 1BTUA 3O8CA 3BTWE 5E0GA 5F03A 1BMLA 2ZU2A 4Y79A 1DXPA 3F0PA 2GKVE 3OAAD 1O5GH 1TMUH 1HLTH 4O9VA 2BVRH 4Y7AA 4HFPB 4JYTA 2AS9A 1SL3A 3TH4H 1KXFA 3LJJA 1KXDA 1O38A 2ZIQH 1PPCE 2Y80A 2ZA5A 1SR5C 3ZZ4A 3A88A 1TGSZ 1TRNA 3OX7U 1AE5A 3NZIA 3M3SA 1FY8E 2VIDA 1F92A 1T8OA 4JZIA 4U30A 3TJNA 2PP6A 1K1NA 5EG4A 3VB4A 1KXBA 1C2IA 1BHXB 3PO1B 3Q3KA 5HM9A 1TE0A 3NKKA 3OFND 4GVUA 1QZ8A 1GL1A 1TPOA 2OLGA 1RD3B 3P70B 3A8DA 5HM2A 1NO9H 3VGCC 3RMMH 1ELEE 5JB8S 3TGJE 5T6FA 1C1PA 1K21H 2GJGA 1ZMNA 1GI8B 1XUFA 3SU0A 1WQVH 2KAIA 3KEEA 3P8NA 4MLFB 4JZ1A 1O2XA 1NZQH 1W11U 1O2LA 1CHGA 3OTPA 4XBCA 2HNTE 3ZVAA 3A89A 1O3KA 4B71A 1C5YB 1FIZA 1MQ5A 1ETTH 1S84A 1ANCA 2ZCLP 3IITA 5HIZA 5EIYA 1HNEE 2ZG0H 2V6NA 2WPJS 1V6DA 2GT7A 1SGFG 4F55A 3ATKA 1GGDC 4ZH8A 5DP4A 2F9VA 1O3JA 2BY5X 1TRYA 3GY6A 5A0BA 3HK6B 1NBMD 1O3AA 2C8WB 3BG4C 1E0FD 1TBZH 1OX1A 1FLEE 1AB9B 1TOCB 2BOHB 1G37A 4X2YA 2BZAA 1IQMA 1DUAA 1VR1H 2HVXA 4JYUH 3GICB 1BBRK 3BTME 3GDSA 3GS9A 2FOHA 1AFQC 3MYWA 3UR9A 1P03A 4KTUA 3EE0B 2GZ7A 5ESBA 1A1RA 3EDXB 1ETSH 1SLUB 1NRQH 1MAYA 5EJLA 1O2VA 4A5TS 1GBTA 3SU2A 1TGTA 2QF5A 1WUNH 1IAUA 1P9SA 2FOFA 2CHAB 3F1SB 1P2JA 2WPMS 3KHVA 1CE5A 1TGBA 3KGPA 1BITA 2F9OA 1C5WB 4THNH 4ZKSU 3ZV9A 1PPGE 5FAHA 1AUJA 1TGNA 1GHVH 4BAKB 4OS6A 3T29A 1L4ZA 3MH5A 2A7HA 4X1RU 3E90B 2QXJA 3FANA 4CHAC 1V2OT 1GHWH 1D6RA 1OPHB 1S6FA 1L1GA 2ANWA 1AVGH 2J34A 2BZ6H 1C5TA 4K8YA 1GI5A 2Z9IA 1F0SA 4OS5A 4A1TA 1TX8A 3A85A 1PPEE 2OBQA 5FBIA 1AFEH 3QX5H 5JDUB 1ELAA 2PFEA 1LCYA 2PUXB 1TB6H 2FODA 3TVJB 2XNIA 3URDA 2PLXA 4Y8XA 3I77A 5F53A 2Y6TA 1ZSJA 4X8TH 2WPLS 1T4VH 3B23B 5A2MH 4D7FA 3P17H 4ZKOU 1O3DA 2XNDD 3ZZ9A 3LOXA 1QRZA 4CRCA 3BF6H 1GHBF 1BZXE 2BMGB 1EB1H 1YGCH 3FN8A 2FO9A 1TWXB 3SV2H 3ENSB 3B9FH 2A7CA 2L6OA 1GMDG 4BANB 1YCPM 1UK2A 2IJOB 5JPMH 4AN7A 1F2SE 2TGAA 4XBDA 1TNJA 3O8RA 1LPGB 5IDKA 5KEDA 3SJIA 1UVUH 1MTNB 2P94A 5LPFA 1NRPH 1ZGIA 1S82A 4IW4E 3L6PA 4DIHH 2BXTH 4FUHA 2J98B 2SFAA 3MMGA 3TNTA 3ZZ6A 1MBMA 2JH0D 3F2FA 1CHOG 1TMBH 3KYFA 3QTVH 3T26A 3UNRA 1SG8B 2G4TA 4FETA 4OS7A 1TABE 4TY6A 2A5KA 5L30H 2GDDA 1DXWA 2A2QH 1A5GH 3SI4H 1QJ7B 4I8HA 2FIRH 1SSXA 1MKWH 2F43B 2OCVB 2QA9E 3GY4A 1SMFE 1VJ9U 4AFSA 4AYVB 1OSSA 3NRLA 3LGUA 1VGCB 4X6OA 4DIIH 2ZI2H 4I8JA 2VIQA 1ZRBA 4ASUD 1SPJA 2SGQE 5JBAS 1AWFH 1IQIA 1CBWC 1UK4A 2FOAA 2G81E 1C1SA 1JBUH 3RXBA 3UPEA 1PJPA 3O8DA 3U28C 2ANYA 4FU7A 1XUKA 1NTPA 1O2PA 2XCFA 2ZWLH 4BTTB 5T6GA 4Y8ZA 1GBMA 1QL8A 4NIYA 2BQ7B 2PTCE 3SYJA 1QBVH 2VVUA 1C1TA 1ZZZA 2Y7ZA 3EAJA 1E1RD 4FUEA 2FPZA 1ANEA 1DT2A 1V2QT 1E79D 2SGAA 3N99A 2R3YA 1MTVA 3RXOA 3C1KA 1AIXH 1GVZA 1EJMA 3EA7A 3SBKA 3F6UH 3ZYDA 2FTMA 4WMEA 2R0LA 4MPUA 1OWKA 2V0BA 1B0FA 1G30B 1BTZA 1DWCH 1EPTC 1XKBC 3UWIA 4JZFH 5HMAA 2ALPA 2P3TB 2QE7D 2BDIA 2Y5FA 4A7IB 2ZDVH 3AW1A 2F83A 4WWYA 1W10U 5C1XA 4Z1MD 2F9PA 1LKBA 2QF3A 3SN8A 4B2CA 1IQLA 2EI8A 1F5KU 5DSFA 3TGKE 3WW7A 2BVXH 1G3DA 3UY9A 3MU1A 1C1UH 1C2EA 3V3MA 4JYVH 4UFDH 4X0WU 3ZVFA 1GG6B 1IHTH 2JETB 2BDBA 2PKSC 1EZUC 3QZRA 1OP0A 5FL7D 3BSQA 1AE8H 2RCEA 1O3FA 3RU4T 2G52A 2UUFB 3QN7A 1O3HA 4ABFA 1P06A 1P3EA 2J92A 3GY2A 1DS2E 3PV4A 3ZVBA 3P8FA 1ZYOA 2STAE 3VB6A 1HJ9A 1XXFA 1UO6A 2KAIB 5FPSA 5GIBA 4YXWD 1HJAB 2ODQA 5CDFE 3VXFH 4AGJA 3FP8E 3G01A 4DJZB 1XUJA 1CT0E 3RXHA 3A81A 1MABB 3N7EA 1RGQA 4Q63A 4U32A 5L6NH 3T5FH 1FX0B 3FVFB 4MNVA 1OWEA 3MQKC 1T8NA 2GD4B 4TY7A 1SKYE 1LHDH 3E16B 2W7UA 1K1PA 1T7CA 3GCTF 4Y0YE 1P10A 3ATLA 4NA8A 1WV7H 1NN6A 3RXAA 4RKOB 1K28D 2GT8A 2VH0A 1ELDE 4X6PA 2O9QA 2J38A 2RDLA 2ZGXH 4X6NA 1Z8RA 2ZZUH 1CT4E 4AZ2B 4E06H 1HAGE 4PROA 1D6WA 1O2YA 2PHBA 1BRCE 1MH0A 2BM2A 3DFLA 5JB9S 2ZGCA 1ZPZA 2Z9JA 4UFGH 3IG6B 1GBDA 4XFQA 2NU2E 1QB1A 1V3XA 1BB0B 5FCKA 3UIRA 3M5LA 1MTSA 1QCPA 2WHXA 4NG9H 1D4PB 5EQQA 1HXFH 2BD8A 3SUFA 2JH6D 3AASA 3P6ZB 2HVYB 1C5NH 3UOPA 5A8XA 1LVOA 3W95A 3EE7A 1YYY1 5ESTE 1SC8U 1O3LA 1PQAA 4YT6H 3KQ5A 2THFB 3TIUA 4I33A 2XYAA 1EX3A 2XWBI 3SNAA 2AHME 3PV5A 4ZMAH 3M35A 4OGYA 3UB0A 1LDTT 2DE8A 3D62A 3KYGA 5T3HA 1RRKA 3GISB 4K1EA 1ELTA 1MU6B 3BTKE 3LH1A 3AAVA 3RM2H 1HV7A 1H9LB 1ZGVA 1Y3WA 4LK4A 1BDAA 3GCNA 2VGCB 1C9TA 3N7OA 3D23A 5TJXA 2ZFPH 3OEED 3T28A 1XUHA 3TU7H 1TALA 1BHXF 4YOIA 1BA8B 3ZYEA 2FYQA 3PV2A 3WY8A 4BXWA 3P8OA 3CP7A 3SNCA 3WWBA 1RXPA 3LGYA 3ZZAA 1GJ7B 1Z8JB 3MH7A 2PUQH 1S81A 2O8UA 1EZXC 6CHAB 1W0ZU 4KTCA 2P3FH 2D8WA 1AKSB 1AMHA 1FAKH 3Q3YA 2JJ1D 1ZJDA 2WSSD 3B8JA 1OWJA 3QGJA 2FLRH 2J94A 4ABDA 3MNSA 4INLA 1GJ4H 2BY9X 3NXPA 2W7SA 4KP0A 2R9PA 1TPPA 1KXCA 3TPIZ 3U1JB 4NWLA 3HATH 2J2UA 3M5MA 1T4UH 2AH4X 4ABHA 2OQUA 1O2GH 1J8AA 3LC3A 4Y71A 2Y81A 2EEKA 5EJZA 1SHYA 1L2EA 4FUIA 1C4Y2 2GCTC 1RIWB 1K1OA 2Z94A 4ZCNA 1ESAA 3RXUA 1TNKA 5EODA 3I29A 4M7GA 1AI8H 1HFDA 1LPKB 1RJXB 1OWIA 2B5TB 2C8YB 2VWOA 1F0UA 3MU5A 5C94A 1A5HA 1C5OH 4X2VA 4B73A 1PFXC 1CT2E 1SGFA 1YPMH 1TNGA 1ZHMA 1VCWA 2C90B 3BTTE 2ZU5A 1J17T 3VXEH 1JRSA 2ZHDA 2YMSB 1GI0A 4QT8C 1GHYH 4HGCA 4MNWA 4ISIH 1W8BH 1KXAA 1ZSLA 3OYPA 1KIGH 1Y5UT 1TAWA 4DOQA 3BIVH 9ESTA 3D49H 5E0JA 1O3NA 3LT3A 3A7ZA 4GCHG 2ZQ1A 4Q2KA 2FDAA 2UWPA 1YY3A 2FXRA 3OTJE 2GV6A 5F8XA 2CN0H 1SLWB 1F7ZA 1C5XB 1GMCF 1LQEA 4INKA 5C2ZA 2OTVA 4KTSA 1YLDA 2H2ZA 4O3TA 5GPIB 3SORA 1DWBH 1C2JA 1TIOA 1G3CA 3SJOA 1ETRH 1LHFH 4HG6A 1AD8H 1YPKH 1HCGA 4UEHH 1FXYA 1UTPA 3ITIA 1NPMA 2PR3A 1O32A 3S7HB 1GCDA 4CRGA 4U2WA 3SNEA 4K1TA 5EOKA 1THRH 1YC0A 1H9HE 2ZTXA 3ZZ5A 2D1JA 1O3EA 1O3PB 1QGFA 1NFWA 4B2AA 1J16A 4R0IA 4H42U 2A4OA 5C3NA 2EI7A 1O3BA 1NT1A 3JZ2B 3BTGE 3MU0A 1HAPH 1NESE 5GCHF 5K7RA 1DICA 1SGIB 2ZFSA 1KLTA 3O8BA 2BD3A 3F0OA 2FOBA 1WAYB 4MVNA 5E2OA 2A5AA 1A5IA 2D26C 3ZVEA 4GUXA 4A1XA 1K1LA 1ELGA 2CF9H 1FIWA 3GCHB 2ZPSA 2A4GA 2EY4C 3A87A 2R2MB 1FMGA 4DW2U 2ODPA 2OINA 4P00A 4ZUHA 2ASUB 4XD7D 1RTKA 3UTUH 3BTHE 2Z9LA 2BLQA 1KMHB 3STIA 1GI2A 1SVPA 1WDIA 4VGCC 1UVSH 4JMYA 5FX5A 2F4LA 3M37A 4A1VA 4D9QA 4MTBA 4BTIB 1PYTC 1HAXB 3OY5U 1LPZB 1ZJKA 1GBLA 2ZF0H 4FU8A 4AG1A 3D65E 2BDYA 3ZVDA 5J4QA 4YZUA 1T8MA 2TGDA 2ALVA 4XSKU 2ZDLA 1THSH 1AUTC 2AERH 4H6SB 2OC0A 1EAWA 1P57B 1A3EH 4DCDA 3KIDU 4BAOB 1GMCG 5C0TA 3K6YA 1TNIA 1FZZA 7LPRA 4I32A 1EUFA 5DP5A 1ELCA 2GCHF 3FAOA 3HGNA 3MHWU 1BRAA 5GWZA 3KQDA 2PSYA 3RXRA 4X1QU 1WYKA 1QR3E 3QTOH 1QA0A 1C2KA 1W7XH 1L4DA 3T2NA 1ID5H 1GBHA 4OS1A 2VNTA 1FONA 4UDWH 5G4BA 3MI4A 1YCPK 2HLDD 1PPHE 2GZ8A 4NZLA 2R2WU 1ELFA 3DT0H 5AVDA 1AY6H 4DGJA 3A80A 3VB7A 2OC1A 2DUCA 3SV9A 7KMEH 4MDSA 4GAWA 2GMTC 5DGJA 1QY6A 3ZZ8A 2TRMA 3M3TA 1O2ZA 1LHGH 2CK3D 4NFFA 3PRBA 5KECA 1L1JA 1HGTH 2F9UA 2BX3A 1IQHA 2K1QA 2AFQB 3FO8D 3LJOA 3Q76A 1O5BB 1EJNA 2ZGBH 2BD9A 1D3PB 4WMFA 2EC9H 3MNCA 1AVXA 3CS7A 1WTGH 4LZ4B 1RTFB 3RXJA 1ELVA 4K60A 4B76A 1TPAE 1LVYA 1PQ8A 3HKIB 3UQOA 5LH8A 1RFNA 1GBAA 3R0FA 3A82A 2PKAA 1GJBB 5HXFA 3QZQA 2QF0A 3A84A 3IWMA 2BTCE 1RTLA 1QIXB 1KLJH 2KCAA 3CNRA 3NCLA 5C1YA 1GBFA 3U1IB 1GJ6A 2ZTZA 1H9IE 2JKHA 4DY7B 1GJAB 2Z9GA 3NK8A 2P95A 2R3UA 2ZC9H 4K5ZA 4TWWA 3A8CA 1UW7A 4NFEA 2OC8A 3LONA 1GWAA 4CBOA 1A4WH 4NIVA 1LVBA 3RC6A 3NUMA 3RM0H 5EJ1A 2AIQA 2GCHG 2UUJB 4CH2B 5C20A 1XVMA 1O2NA 1SOTA 2FI5E 3RXVA 4AX9H 1HIAA 3T62A 1XX9A 2A1DB 2WINI 3RXQA 1FI8A 4F48B 1ZHPA 1FN8A 2FEQH 1V2JT 1BIOA 1FUJA 1QRXA 3BTDE 1D3TB 1FV9A 1KTTB 2C8ZB 3LH3A 1C4U2 3LGWA 4ACBA 2XW9A 5FCRA 1WTHD 2BXUH 1V2MT 1D9IA 1V2TT 1Y3YA 2ZGHA 1AKSA 5E8EH 1EPTA 4UD9H 3BTQE 4ZHLU 2UWOA 2CF8H 1SFIA 3DFJA 4WF8A 5A8YA 2C3SA 1GMHF 2HPPH 3LGTA 1MZAA 4FVDA 3SQHE 1O2TA 1P02A 3A7YA 2VBCA 5DK1A 3TK9A 5DPAA 4ZKNU 2BHGA 1C2HA 3FZDA 3BV9B 5EW2H 1FY5A 2XXLA 3UQVA 5HYOA 3RXKA 2WPIS 2VWMA 2ZDMA 2W5EA 1V2RT 1V2PT 3VGCB 2RG3A 1SGEE 5I25A 5IK2D 2BLOA 2ULLA 3U69H 9LPRA 1DOJA 4KGAA 4BNRA 1HAYB 3KF2A 1W0YH 6GCHF 4YESB 3GY5A 2FS8A 2SNWA 2BY7X 2Z7FE 3S9BA 5A0CA 3PLPA 2WPHS 3BG8A 3LGIA 1VCPA 5FPYA 1GCTC 4ABJA 1YPLH 1BMAA 3A8BA 1XUIA 1UVTH 3A7WA 1QB9A 1SGNE 1BMFD 2QN5T 1W7GH 1GI7B 5EQSA 3BN9A 5DKMA 1XKAC 2HALA 2WYJA 5CHAB 3M36A 1GGDB 1VZQH 4CR9A 1H8HD 4NSVA 4NCYA 2Z3CA 4A92A 2G00A 1DSUA 4HZHA 2ZHQH 1FQ3A 4YM9A 4HTCH 2K0QA 1NBME 2K7XA 1QNJA 3BG4B 3GY7A 1WSSH 1JWTA 3VEQB 2XRCA 3SNBA 1GHBG 1KXEA 4O97A 1O5CB 1TMTH 2YOLA 2VJ1A 1TA2A 1YPHC 5DP3A 3CENA 3SV8A 1Q2WA 1CQQA 4YLUA 1AFQB 1PQ5A 1NFYA 4YLQH 2ZFFH 1FY1A 1X7AC 3PWBA 4Q80A 4X8UH 5F8TA 4JZEH 4ZHAA 1GMHG 4FUCA 1EATA 1HAVA 1SGYE 2H9EH 1A3BH 1QFKH 1H4WA 4IS5A 3F68H 1EASA 1P0SH 3GY8A 1QBNA 2W6ID 2F3CE 2QY0B 2SGDE 2V3HH 1WBGB 3F2HA 4TSFD 3A86A 3PROA 2OD3B 3PYHA 2A45B 3SW2B 5I46H 1HB0B 4DT7B 4CHAB 3M61U 4U01A 2FM2A 3UR6A 2A5IA 4OM9A 1LHEH 1W2KH 3VB5A 1P9UA 3V0XA 2DE9A 3MNBA 2BLWA 4CRBA 2VB0A 3M5NA 3U8RH 1E34B 2A7JA 1Z1IA 1K9OE 7GCHF 1RS0A 2ODYB 2ZQ2A 2ZU3A 3DSGA 2GP9B 1OYTH 3MWIU 1C1NA 4P02A 3U9AH 3P92A 4WJG2 1EAUA 1BOQA 3SZEA 1NFUA 1BTWA 2LP6A 3V12A 1SOZA 1O31A 5ETXA 1MCVA 2TPIZ 1S83A 1FY4A 2AIPA 1TONA 2XCNA 4I31A 3JZ1B 1H8DH 3SUDA 2UUYA 3PTBA 1E38B 2BY8X 3SQEE 3RXIA 3F9EA 1HAHH 1O2SA 5DP7A 1MTUA 1QTFA 3VB3A 2YMSC 3A7XA 1NU7B 4MG3A 1ABIH 1CA0C 3TH3H 1W0JD 3KQCA 1CGHA 4F4OC 4Q4LA 1C2DA 4OS2A 1O34A 2J97A 3C27B 1UTMA 4D9RA 3E1XB 4SGBE 5K0HA 1SGPE 3E0NB 2G8TA 2VVVA 2IPQX 1DFPA 1Y8TA 2QXHA 4ABIA 3L33A 4AYYB 1NRSH 2ZDNA 4INHA 1CVWH 1FDPA 2ZECA 1IOEA 4LOYH 3DD2H 2FESH 4UE7H 5FHTA 4FUFA 3DHKH 2ZEBA 2PKAB 5C1UA 1GBCA 1HBTH 2H1UA 4X2XA 1XVOA 3FZZA 3DCLA 1IQNA 2YNBA 2V35A 2BDHA 3SV7A 2ZHFH 1S6HA 4GPGA 3WWFA 2I6SA 1QRWA 3BTFE 1PPZA 1CBWB 1TOMH 3OEHD 3RXPA 4B75A 3RXEA 1C1OA 3CS0A 3SU5A 2ANMH 1LQDB 2AGEX 4TWYA 2XBVA 1JXPA 2Q6FA 1QHRB 1D3DB 4KKDA 2ZTYA 3RC5A 4NA9H 1O3GA 1ARCA 7GCHG 1P11E 1HIAB 1IQKA 2KZ4A 1ANBA 4D8NA 1N8OC 3SJ8A 4I7YH 2V7QD 1O2QA 1O33A 1TPSA 1W13U 1ZLRA 4IN2A 2H6MA 1WXRA 4GLYA 1A61H 1O5EH 2WUCA 4NIWA 8ESTE 1BQYA 1LKAA 1UVPA 1H8ED 4CR5A 1KDQA 4BTUB 2WV9A 1C1QA 2BLVA 1W0KD 1O35A 3GCTG 3ZVGA 1Z8IB 1F5LA 4RKJB 4Q7XA 1EPTB 4ISLA 4MPVA 4Y6DA 2KFWA 1U6QA 2PGQB 3TITA 2VIOA 3MO6A 3S7KB 1TNLA 5EPNA 4E7RG 1TLDA 1C1VH 1B7XB 1MTWA 1O3CA 1ZR0A 5DN6D 2Y7XA 5FXLA 3PO1C 4AFQA 4K3JA 1CGJE 3SZNA 1A0JA 2LIZA 1G2LA 1P2QA 4Z0KA 3SGBE 4M9FA 2HRVA 4MPXA 1C5QA 1MBQA 1MUEB 1TBRH 8GCHF 1SGCA 4AC9A 2PKSB 8LPRA 2GV7A 3T27A 3MNXA 3UOUA 4IBLH 2G5NA 1Z7KA 3ATIA 1O2IA 2EA3A 1VCQA 3Q3XA 1BT7A 4E05H 3QLPH 3BEUA 1QJ6B 3ZZBA 4JCNA 2ZKSA 3M5OA 4X1PU 4K2YA 3QGNB 2HGTH 1ZOMA 3EA9A 1BTXA 1YKTA 3LGVA 1C9PA 3M7TA 1NRRH 2A4QA 7ESTE 1GL0E 5AFYH 2F9BH 2IJD1 3OSYA 1YPHE 1OOKB 3F9GA 3SJKA 3RC4A 2V3OH 5DJ7A 4ABAA 4IC5A 1C5RA 1YCPH 4Y76A 5HIYA 2Y5GA 1AGJA 1GVLA 2UUKB 2AMPA 5EU8A 2W3IA 1G3EA 3PRDA 3K6ZA 1AB9C 1QL9A 4J1YA 5EGMA 1O2OA 2Y82A 1AN1E 1IQGA 2XBYA 1XM1A 1SGDE 3Q00A 2BD4A 3RXSA 1HAZB 5EPYA 3RXGA 3TK5A 2ESTE 4FUDA 1G32B 2OQ5A 2R0KA 2FI3E 2SGPE 2WPKS 5TCAA 1YBWA 4BOHA 5C67A 4I8KA 5LPRA 3E0PB 2LELA 1UJ1A 2WZQA 5F6MA 4K1SA 2C8XB 4NIXA 2ILNA 1SQAA 3HKJB 3H09A 2CHAC 2QC2A 1DANH 1MZDA 1UTKA 2IOTA 2FLBH 1DPOA 1HAVB 4R8TB 1DLKB 2PV9B 2HOBA 5DP9A 1SQTA 1Z6JH 2J95A 2ZFRH 3S69A 3QDZB 4B6EA 6LPRA 3A83A 2XBWA 4IN1A 2OP9A 2G55A 2K8IA 1KYNA 1SLVB 1C1RA 3AVZA 2KR7A 1O30A 1S0QA 2ZP0H 4JK5A 3SI3H 1P2MA 3FKSD 1JOUB 2GDEH 4TT3D 4AB9A 1SFQB 4B74A 1K0HA 1BUIA 3LPRA 4JZDH 1O2WA 1BCUH 1IQEA 1BRBE 3BEIB 4AORA 5LPEA 4TYDA 1COWD 1Y5AT 2P3UB 2VIWA 3GOVB 4NWKA 1PPFE 3N7DA 1GJ8B 1UHBB 1ZMLA 1KY9A 1ANDA 1P2NA 1OXGA 2LPRA 1UTNA 3UFAA 2XC0A 3UAIC 1NS3A 1SGQE 2VH6A 2F9NA 1Y3VA 3KCGH 2H9TH 2WYGA 1C5LH 2J5UA 1P8VC 2GGVB 3FOAA 3SO3A 1DUEA 4MNXA 3RXFA 3SU1A 3PMBB 3Q77A 1SGRE 1C4V2 4GHQA 3RP2A 1FY3A 1O3IA 4D7GA 2VWLA 1HPGA 2A0QB 4IC6A 4YOJA 1TA6A 3TJUA 1QQUA 4AGKA 2BDCA 1DWEH 1MCTA 2M5TA 5FX6A 1N6XA 1MTNC 3F9HA 4YO9A 5DO4H 1TX6A 4XDEA 1FPCH 1DY8A 4UFEH 1S85A 3AW0A 2ZPQA 4O3UA 3RU4E 3RMLH 2I6QA 1GI9B 1AO5A 2BYAX 4WH8A 3UUZA 1O2UA 1CU1A 3LIWA 3RMOH 2GCTB 1UCYK 1WQSA 1MD8A 2O8LA 5FBEA 1JIMA 3UREA 2Z6BD 4RSPA 1VGCC 1GBEA 5GCHG 3MU4A 4RN6A 3F3BA 3LC5A 2NU0E 3TJOA 5GJ4B 1MD7A 5A8ZA 2L74A 2RA0A 3KQBA 2ANKH 3TNSA 1GDUA 2WV5A 1TQ0B 1YPJH 2BD7A 3NPSA 3S9CA 1O36A 3SHCH 3UWJH 3F9FA 1K1JA 5E2PA 3NWUA 1AHTH 3HPTB 4FXGH 5CHAC 2P8OB 2CGAA 3SGAE 4Y7BA 1DSTA 1GI6A 1TFXA 1V2WT 3E8LA 1PPBH 3AK5A 5DG6A 1V2UT 4KELA 3PWCA 1TNHA 1G3BA 4YOGA 1NFXA 3A7VA 1TRMA 2ZDKA 1UVOA 4K69A 1GMDF 1EOLA 3HGPA 1PYTD 3VFEA 2SGEE 1EB2A 1UTLM 4Y10E 2D2DA 8KME2 1UTQA 1O2HA 1TYNA 2J9NA 1Q3XA 2FX4A 1MKXK 3SGQE 5C5NA 2ZU4A 4DVAU 4CREA 3EQ0H 4LZ1H 1KDQB 1ZHRA 2H5CA 1SI5H 5C0UA 1F0RA 1GBKA 1EKBB 1G9IE 1QURH 2XTTB 5AHGH 4OS4A 1A0LA 2B8OH 1CHOF 2KX4A 2PW8H 1T31A 4NZQA 1JRTA 2P93A 3FP7E 1GBJA 1GI4A 4MQAA 2FTLE 1HRTH 2W26A 1EOJA 2HLCA 2BY6X 3K9XB 2G5VA 1HAOH 1GG6C 2JETC 5IYTA 3MH4A 3GYMA 2Z9KA 3RXMA 2BQWB 5A0AE 4B1TA 3LKWA 1NROH 2H9HA 1W14U 1ZPCA 5L2YH 2VIPA 3S0NA 1PQ7A 4AB8A 1ZTJA 2QXGA 3BTEE 2BDAA 1T8LA 1XMNB 1VITH 3ODFA 2OXSA 2B0FA 1IQFA 4ABBA 4A6LA 4RI0A 1HJAC 4YTAA 4X1SU 4IMZA 3EGKH 4ZKRU 1AQ7A 4VGCB 1V2VT 3PLBA 2VWNA 1FNIA 1C5ZB 4JK6A 3MOCA 2CJIA 2KCOA 2OC7A 3SOSA 2Y5HA 4FOUC 1OWDA 2TIOA 3ATWA 5FPTA 1OWHA 1P12E 3V13A 2JIZD 3SUEA 4FU9A 2Q6GA 1NRNH 1GBBA 2FOGA 2XBXA 3EA8A 2QF4A 1GHZA 1XXDA 2ZHEH 3QUMP 2RDEA 1L0ZA 1JIRA 5B6LA 4NGAH 2RFKC 3ODDA 1MMJN 1EAIA 4CRDA 2FWWA 1K22H 3RLWH 1CO7E 1K2I1 3QWCH 3ELAH 1AVWA 2G4UA 1QJ1B 1Y3UA 1DVAH 1YPGH 5JBBS 3R3GB 1EQ9A 2IPHA 4B2BA 5CE1A 3RXLA 3GY3A 5LGOA 3H7TA 2W6JD 1BMMH 1GJDB 4SGAE 3EBNA 2FP7B 1XUGA 3DUXH 3ZVCA 1YPEH 3P95A 1N6YA 3SHAH 4ISOA 4ZXXH 1Q31A 2VIVA 5JBTA 1GHAF 2WUBA 3TLOA 1O0DH 1OHHD 3DSPA 4J2YB 2PWXA 2AEIH 3KL6A 4ZAEA 3MH6A 1N1LA 1C5SA 1EZQA 1C5UA 1QQ4A 3A8AA 4Y8YA 3MFJA 5J4SA 2FI4E 1BTHH 2ZCKP 5C5OA 1FN6A 1GPZA 1ARBA 2BB4A 3T25A 1INCA 1A0HB 4BXSA 1ZPBA 1IHSH 1ESBA 2GMTB 1H8IH 2KM0A 1B0EA 1VJAU 3SV6A 4DG4A 1S5SA 2A2XH 5DP6A 2NU3E 3KNXA 1SGTA 1O2KA 5CHBA 2VGCC 1BJUA 4XE4A 1UK3A 2EQNA 5E0HA 2BD2A 1C5MD 2B9LA 1AZ8A 1ORFA 4AG2A 2JJ2D 1Z71A 3KN2A 4ABGA 3RXCA 5GXPA 4FUBA 4FUGA 4ZHMU 3ZIAD 3URCA 3S9AA 1Z6EA 2CV3A 1LMWB 1T32A 1CGIE 4B6FA 2LNCA 4H6TA 6CHAC 1V2LT 1GDNA 1C1WH 2ZPRA 2QCYA 1CSOE 2J4IA 2C4FH 2GZ9A 1BTPA 5T1VA 3W1EA 5EQRA 4UFFH 1LTOA 1THPB 3M7UA 1Y5BT 1Y59T 1J14A 1HJ8A 1V2KT 4FVBA 4X6MA 2ZO3H 2FYRA 2QGRA 6GCHG 2TGPZ 2WV4A 3FP6E 3MO9A 3E91A 3ZV8A 4IGDA 1EP5A 2WPDD 3MTYA 1UHBA 2QYIA 2ZFTA 2BOKA 2XOKD 2ZDAH 1TX7A 1EZSC
chains in the Genus database with same CATH topology
1BJVA 4ASHA 1BTYA 1GHXH 2G51A 1RIWC 4ISNA 3H5CB 1J15A 1FPHH 3DA9B 3HK3B 3W94A 2O8WA 3I78A 2EI6A 3RXDA 4WVPE 5A09A 1VITF 1GHAG 2AGGX 1C5VA 1WCZA 3V7TA 2FZZA 2VVCA 4ABEA 4WY3A 4CBNA 4GSOA 2UWLA 3SNDA 2STBE 1Z8GA 4HI3A 2OBOA 2TGTA 3AAUA 1C2LA 1SQOA 5ABWA 5T6DA 2HPQH 4WXVA 2VU8E 1IQJA 1ELBA 2FOMB 1C2FA 1NU9A 4BAMB 1KTSB 1V2ST 3A7TA 2CXVA 1P05A 1S0RA 1UCYE 1GJ5H 3L3TA 5EXMA 2Q1JA 1QB6A 1DDJA 1GVKB 1O3MA 2B7DH 4WMDA 1C2GA 5H4IB 4NSYA 4H4FA 5JBCS 1UTJA 1DLEA 2YNAA 3U8OH 3UNSA 3SJ9A 1ACBE 3LU9B 3QK1A 1MKWK 2FOEA 1NC6A 4Y0ZE 1EJAA 1A46H 3M7QA 3MO3A 1A2CH 3BIUH 1GJ9B 2A31A 3ZZ7A 3U98H 5SGAE 2HNTF 3PTNA 3P8GA 5CMXH 4OGXA 3SU3A 1O2RA 1F0TA 2XWAA 3TK6A 1OP8A 3PB1E 1GCTB 1QA7A 2BVSH 2Q6DA 3QO6A 3OY6U 3K2UA 2QXIA 2BX4A 2F91A 5L2ZH 5EW1H 1P09A 3E6PH 2ZHWH 4Z6AH 1B5GH 4Q7YA 4DURA 3M3VA 1BBRE 3E3TA 2TBSA 4IMQA 5BPEA 2PSXA 1M9UA 2HNTC 3GCHC 1MU8B 1F5RA 4I8LA 2NU4E 4AFZA 2QV1A 3RUOA 3PMHB 2Z3EA 1VITG 2GVFA 3PMAB 1EP6A 2FX6A 1EAXA 4K8BA 2AGIX 2H5DA 2XC5A 1TQ7B 3SUGA 4AFUA 3MU8A 4X1NU 1OP2A 1ABJH 1NM6A 4GCHF 4TPIZ 1DM4B 4WXIA 1C2MA 1ESTA 1AZZA 3PMJA 3PM3A 4CH8B 4GHTA 2Z3DA 3RXTA 4ZROA 1E37B 2CMYA 3GYLB 1A7SA 2BQ6B 4XOJA 1HUTH 2HWLB 2GX4A 4CRFA 2PTNA 3TGIE 1ZSKA 4XBBA 1H1BA 1DE7H 1P01A 4MNYA 2AMQA 1C1MA 2BDGA 1QL7A 1DITH 2FOCA 3SU6A 1P2OA 3GCOA 1GJCB 4X8SH 2ZFQH 1AU8A 1YP9A 5BRRE 4BAHB 1DWDH 4CRAA 1KSNA 3ATMA 1YF4A 1Y3XA 1HDTH 3KQEA 3UNQA 5JYIA 5EXLA 4ESTE 4O03A 1P2IA 2NWNA 1JMOH 1ZTKA 4YT7H 3RU4D 2BD5A 1O5AB 1O2MA 1ZRKA 1HYLA 3FFGA 1BMNH 1GI1A 2VINA 1SB1H 1O2JA 5DP8A 1UTOA 1BRUP 4FUJA 1LO6A 1UCYH 1GDQA 1UMAH 3GDVA 3ESTA 1V2NT 1C5PA 5F8ZA 2P59A 2ZCHP 4MPWA 5TCCA 4BAQB 2IN2A 1TGCA 1O37A 1EXFA 4TPYA 1HXEH 5B6OA 1O5FH 2FMJA 1E36B 5HGGA 2OUAA 1OKXA 2JH5D 2NU1E 1OS8A 4ZXYH 1SBWA 1OYQA 1D3QB 1K1IA 1O3OA 2P8OC 3LDXH 1G36A 1DY9A 1NY22 4AOQA 3GDUA 4ISHH 1CA0B 3H7OA 1HAIH 1K1MA 4Y11E 2ZGJA 2AMDA 1AWHB 2W3KA 4LXBH 1W3CA 5PTPA 2ZNKH 4X2WA 1MAXA 1TBQH 1MQ6A 5AF9H 1SLXB 1DX5M 2P16A 1SHHB 1ZMJA 3EYDA 4F49A 3U8TH 3STJA 5EXNA 2ZU1A 1O39A 2GTBA 1G2MA 3RDZA 1Z1JA 4WH6A 2SGFE 3ZZDA 1MKXH 1WOFA 3BEFB 3OU0A 1BBRH 2O8TA 3K65B 1QBOA 2FS9A 2XC4A 1L1NA 1KLIH 8GCHG 4E7NA 1GBIA 4I8GA 1ZTLA 3VPKA 4D76A 3PLKA 2QIQA 1P3CA 1FAXA 4Q7ZA 4UONA 1O5DH 1YM0A 3TJVA 1W12U 5AFZH 2SNVA 6ESTA 2A32A 3TH2H 1LVMA 3RLYH 1LHCH 1CA8B 1P2KA 1E35B 3ZZCA 2O8MA 1YLCA 2C93B 2A4RA 2AYWA 1WU1A 2RA3A 4NA7A 1GI3A 1J9CH 2QAAA 1N8OB 1FJSA 1P04A 2PGBB 4X8VH 5GDSH 3RMNH 3SU4A 1BTUA 3O8CA 3BTWE 5E0GA 5F03A 1BMLA 2ZU2A 4Y79A 1DXPA 2GKVE 1O5GH 1TMUH 1HLTH 4O9VA 2BVRH 4Y7AA 4HFPB 4JYTA 2AS9A 1SL3A 3TH4H 1KXFA 3LJJA 1KXDA 1O38A 2ZIQH 1PPCE 2Y80A 2ZA5A 1SR5C 3ZZ4A 3A88A 1TGSZ 1TRNA 3OX7U 1AE5A 3NZIA 3M3SA 1FY8E 2VIDA 1F92A 1T8OA 4JZIA 4U30A 3TJNA 1K1NA 5EG4A 3VB4A 1KXBA 1C2IA 1BHXB 3PO1B 3Q3KA 5HM9A 1TE0A 3NKKA 4GVUA 1GL1A 1TPOA 2OLGA 1RD3B 3P70B 3A8DA 5HM2A 1NO9H 3VGCC 3RMMH 1ELEE 5JB8S 3TGJE 5T6FA 1C1PA 1K21H 1ZMNA 1GI8B 1XUFA 3SU0A 1WQVH 2KAIA 3KEEA 3P8NA 4MLFB 4JZ1A 1O2XA 1NZQH 1W11U 1O2LA 1CHGA 4XBCA 2HNTE 3ZVAA 3A89A 1O3KA 4B71A 1C5YB 1FIZA 1MQ5A 1ETTH 1S84A 1ANCA 2ZCLP 3IITA 1HNEE 2ZG0H 2V6NA 2WPJS 1V6DA 2GT7A 1SGFG 3ATKA 1GGDC 4ZH8A 5DP4A 2F9VA 1O3JA 2BY5X 1TRYA 3GY6A 5A0BA 3HK6B 1O3AA 2C8WB 3BG4C 1E0FD 1TBZH 1OX1A 1FLEE 1AB9B 1TOCB 2BOHB 1G37A 4X2YA 2BZAA 1IQMA 1DUAA 1VR1H 2HVXA 4JYUH 3GICB 1BBRK 3BTME 3GDSA 2FOHA 1AFQC 3MYWA 3UR9A 1P03A 4KTUA 3EE0B 2GZ7A 5ESBA 1A1RA 3EDXB 1ETSH 1SLUB 1NRQH 1MAYA 1O2VA 4A5TS 1GBTA 3SU2A 1TGTA 1WUNH 1IAUA 1P9SA 2FOFA 2CHAB 3F1SB 1P2JA 2WPMS 3KHVA 1CE5A 1TGBA 3KGPA 1BITA 2F9OA 1C5WB 4THNH 4ZKSU 3ZV9A 1PPGE 5FAHA 1AUJA 1TGNA 1GHVH 4BAKB 4OS6A 3T29A 1L4ZA 3MH5A 2A7HA 4X1RU 3E90B 2QXJA 3FANA 4CHAC 1V2OT 1GHWH 1D6RA 1OPHB 1S6FA 1L1GA 2ANWA 1AVGH 2J34A 2BZ6H 1C5TA 4K8YA 1GI5A 2Z9IA 1F0SA 4OS5A 4A1TA 1TX8A 3A85A 1PPEE 2OBQA 5FBIA 1AFEH 3QX5H 5JDUB 1ELAA 2PFEA 1LCYA 2PUXB 1TB6H 2FODA 3TVJB 2XNIA 3URDA 2PLXA 4Y8XA 3I77A 2Y6TA 1ZSJA 4X8TH 2WPLS 1T4VH 3B23B 5A2MH 4D7FA 3P17H 4ZKOU 1O3DA 3ZZ9A 3LOXA 1QRZA 4CRCA 3BF6H 1GHBF 1BZXE 2BMGB 1EB1H 1YGCH 2FO9A 1TWXB 3SV2H 3ENSB 3B9FH 2A7CA 1GMDG 4BANB 1YCPM 1UK2A 2IJOB 5JPMH 4AN7A 1F2SE 2TGAA 4XBDA 1TNJA 3O8RA 1LPGB 5IDKA 3SJIA 1UVUH 1MTNB 2P94A 5LPFA 1NRPH 1ZGIA 1S82A 4IW4E 3L6PA 4DIHH 2BXTH 4FUHA 2SFAA 3MMGA 3TNTA 3ZZ6A 1MBMA 2JH0D 1CHOG 1TMBH 3QTVH 3T26A 3UNRA 1SG8B 2G4TA 4OS7A 1TABE 4TY6A 2A5KA 5L30H 2GDDA 1DXWA 2A2QH 1A5GH 3SI4H 1QJ7B 4I8HA 1SSXA 1MKWH 2FIRH 2OCVB 2QA9E 3GY4A 1SMFE 1VJ9U 4AFSA 4AYVB 1OSSA 3LGUA 1VGCB 4X6OA 4DIIH 2ZI2H 4I8JA 2VIQA 1ZRBA 1SPJA 2SGQE 5JBAS 1AWFH 1IQIA 1CBWC 1UK4A 2FOAA 2G81E 1C1SA 1JBUH 3RXBA 3UPEA 1PJPA 3O8DA 2ANYA 4FU7A 1XUKA 1NTPA 1O2PA 2XCFA 2ZWLH 4BTTB 5T6GA 4Y8ZA 1GBMA 1QL8A 4NIYA 2BQ7B 2PTCE 1QBVH 2VVUA 1C1TA 1ZZZA 2Y7ZA 3EAJA 4FUEA 2FPZA 1ANEA 1DT2A 1V2QT 2SGAA 3RXOA 2R3YA 1MTVA 3C1KA 1AIXH 1GVZA 1EJMA 3EA7A 3SBKA 3F6UH 3ZYDA 2FTMA 4WMEA 2R0LA 4MPUA 1OWKA 2V0BA 1B0FA 1G30B 1BTZA 1DWCH 1EPTC 1XKBC 3UWIA 4JZFH 5HMAA 2ALPA 2P3TB 2BDIA 2Y5FA 4A7IB 2ZDVH 3AW1A 2F83A 4WWYA 1W10U 5C1XA 2F9PA 1LKBA 2QF3A 3SN8A 4B2CA 1IQLA 2EI8A 1F5KU 3TGKE 2BVXH 1G3DA 3UY9A 3MU1A 1C1UH 1C2EA 3V3MA 4JYVH 4UFDH 4X0WU 3ZVFA 1GG6B 1IHTH 2JETB 2BDBA 2PKSC 1EZUC 3QZRA 1OP0A 3BSQA 1AE8H 2RCEA 1O3FA 3RU4T 2G52A 2UUFB 3QN7A 1O3HA 4ABFA 1P06A 1P3EA 2J92A 3GY2A 1DS2E 3PV4A 3ZVBA 3P8FA 1ZYOA 2STAE 3VB6A 1HJ9A 1XXFA 1UO6A 2KAIB 5FPSA 5GIBA 1HJAB 2ODQA 3VXFH 4AGJA 3FP8E 3G01A 4DJZB 1XUJA 1CT0E 3RXHA 3A81A 1RGQA 4U32A 5L6NH 3T5FH 3FVFB 4MNVA 1OWEA 1T8NA 2GD4B 4TY7A 1LHDH 3E16B 2W7UA 1K1PA 1T7CA 3GCTF 4Y0YE 1P10A 3ATLA 4NA8A 1WV7H 1NN6A 3RXAA 4RKOB 1K28D 2GT8A 2VH0A 1ELDE 4X6PA 2O9QA 2J38A 2RDLA 2ZGXH 4X6NA 1Z8RA 2ZZUH 1CT4E 4AZ2B 4E06H 1HAGE 4PROA 1D6WA 1O2YA 2PHBA 1BRCE 1MH0A 2BM2A 3DFLA 5JB9S 2ZGCA 1ZPZA 2Z9JA 4UFGH 3IG6B 1GBDA 4XFQA 2NU2E 1QB1A 1V3XA 1BB0B 5FCKA 3UIRA 3M5LA 1MTSA 1QCPA 4NG9H 1D4PB 5EQQA 1HXFH 2BD8A 3SUFA 2JH6D 3AASA 3P6ZB 1C5NH 3UOPA 5A8XA 1LVOA 3W95A 1YYY1 5ESTE 1SC8U 1O3LA 1PQAA 4YT6H 2THFB 3TIUA 4I33A 2XYAA 1EX3A 2XWBI 3SNAA 4ZMAH 3M35A 4OGYA 1LDTT 2DE8A 3D62A 5T3HA 1RRKA 3GISB 4K1EA 1ELTA 1MU6B 3BTKE 3LH1A 3AAVA 3RM2H 1HV7A 1H9LB 1ZGVA 1Y3WA 4LK4A 1BDAA 3GCNA 2VGCB 1C9TA 3N7OA 3D23A 5TJXA 2ZFPH 3TU7H 3T28A 1XUHA 1TALA 1BHXF 4YOIA 1BA8B 3ZYEA 2FYQA 3WY8A 4BXWA 3P8OA 3CP7A 3SNCA 1RXPA 3LGYA 3ZZAA 1GJ7B 1Z8JB 3MH7A 2PUQH 1S81A 2O8UA 1EZXC 6CHAB 1W0ZU 4KTCA 2P3FH 2D8WA 1AKSB 1AMHA 1FAKH 3Q3YA 1ZJDA 3B8JA 1OWJA 3QGJA 2FLRH 2J94A 4ABDA 3MNSA 4INLA 1GJ4H 2BY9X 3NXPA 2W7SA 4KP0A 2R9PA 1TPPA 1KXCA 3TPIZ 3U1JB 4NWLA 3HATH 2J2UA 3M5MA 1T4UH 2AH4X 4ABHA 2OQUA 1O2GH 1J8AA 3LC3A 4Y71A 2Y81A 2EEKA 1SHYA 1L2EA 4FUIA 1C4Y2 2GCTC 1RIWB 1K1OA 2Z94A 1ESAA 3RXUA 1TNKA 5EODA 3I29A 4M7GA 1AI8H 1HFDA 1LPKB 1RJXB 1OWIA 2B5TB 2C8YB 2VWOA 1F0UA 3MU5A 1A5HA 1C5OH 4X2VA 4B73A 1PFXC 1CT2E 1SGFA 1YPMH 1TNGA 1ZHMA 1VCWA 2C90B 3BTTE 2ZU5A 1J17T 3VXEH 1JRSA 2ZHDA 1GI0A 4QT8C 1GHYH 4HGCA 4MNWA 4ISIH 1W8BH 1KXAA 1ZSLA 3OYPA 1KIGH 1Y5UT 1TAWA 4DOQA 3BIVH 9ESTA 3D49H 5E0JA 1O3NA 3LT3A 3A7ZA 4GCHG 2ZQ1A 4Q2KA 2FDAA 2UWPA 2FXRA 3OTJE 2GV6A 5F8XA 2CN0H 1SLWB 1F7ZA 1C5XB 1GMCF 1LQEA 4INKA 5C2ZA 2OTVA 4KTSA 1YLDA 2H2ZA 4O3TA 5GPIB 3SORA 1DWBH 1C2JA 1TIOA 1G3CA 3SJOA 1ETRH 1LHFH 1AD8H 1YPKH 1HCGA 4UEHH 1FXYA 1UTPA 3ITIA 1NPMA 2PR3A 1O32A 3S7HB 1GCDA 4CRGA 4U2WA 3SNEA 4K1TA 5EOKA 1THRH 1YC0A 1H9HE 2ZTXA 3ZZ5A 2D1JA 1O3EA 1O3PB 1QGFA 1NFWA 4B2AA 1J16A 4R0IA 4H42U 2A4OA 5C3NA 2EI7A 1O3BA 1NT1A 3JZ2B 3BTGE 3MU0A 1HAPH 1NESE 5GCHF 5K7RA 1DICA 1SGIB 2ZFSA 1KLTA 3O8BA 2BD3A 2FOBA 1WAYB 4MVNA 5E2OA 2A5AA 1A5IA 2D26C 3ZVEA 4GUXA 4A1XA 1K1LA 1ELGA 2CF9H 1FIWA 3GCHB 2ZPSA 2A4GA 3A87A 2R2MB 1FMGA 4DW2U 2ODPA 2OINA 3UTUH 4ZUHA 2ASUB 1RTKA 3BTHE 2Z9LA 2BLQA 3STIA 1GI2A 1SVPA 4VGCC 1UVSH 4JMYA 5FX5A 3M37A 4A1VA 4D9QA 4MTBA 4BTIB 1PYTC 1HAXB 3OY5U