2Z9JA

Complex structure of sars-cov 3c-like protease with epdtc
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA02
1NROH 1V2RT 1GVZA 3P17H 3TJOA 2V3HH 1F0RA 1ZRKA 2GTBA 4JZIA 1W8BH 5IDKA 1MKWK 3M7UA 2QIQA 1F0SA 2F91A 4AGJA 4X8SH 3KGPA 1XMNB 1V2NT 3T29A 1PYTC 1BOQA 3S7HB 1PPFE 1G30B 1FXYA 1UCYK 5T6DA 1G32B 3RXFA 1MCVA 2NU4E 1EPTB 4X2VA 1EASA 3BTEE 1O3GA 5A8YA 4A92A 1K1MA 1BRAA 1NFWA 3UFAA 2WPLS 1WUNH 1NFUA 2FOFA 4XBDA 1GL1A 4A5TS 5L2ZH 1JRTA 1UTJA 1QBOA 4ISIH 2ZU4A 1HJAC 1HDTH 3RLYH 2Y80A 4QT8C 2R9PA 1O2NA 4ZAEA 5C1UA 1GG6C 1K9OE 8LPRA 5JBCS 1T8MA 1TRMA 4X0WU 4DY7B 2FOGA 4Y0YE 1O2ZA 3SJIA 5GJ4B 1C1NA 5JYIA 3D62A 1C1WH 2FXRA 1IOEA 3A85A 2G81E 1P09A 1CHGA 1C1MA 1EXFA 1O0DH 3RU4D 1QRXA 1S6HA 1O32A 3RM0H 5PTPA 2FS9A 3N7OA 1TGBA 1UVOA 4UFFH 1DOJA 1O3EA 1WAYB 3QWCH 1QB1A 4JZEH 4RKOB 4FUBA 4MNVA 4CRCA 1AE5A 4IMZA 1DWBH 2HALA 1WCZA 7ESTE 4NZLA 1KXAA 1XKBC 2STAE 3ATMA 2BD5A 2C3SA 1HYLA 1NFXA 4GAWA 3SQEE 4MPWA 2Z3EA 2FYRA 4ZHAA 3BTGE 5J4QA 2A4QA 2F9OA 1W7GH 4RKJB 2P95A 3BTWE 1GDUA 1ELVA 2ZC9H 3M3SA 3RMNH 3GCOA 1O2RA 1A0HB 3MO6A 1H4WA 2O8LA 1ARBA 6ESTA 1TPPA 1E37B 3ZZCA 1C2DA 2RCEA 3A8CA 5FHTA 2W3IA 4OS1A 4LK4A 2VJ1A 3SN8A 2FZZA 2QXJA 1C1QA 3RXKA 3LDXH 2GV6A 1Q2WA 3UQVA 3K6YA 3S7KB 1YF4A 1MTWA 3BEIB 3MI4A 1MUEB 1Y5AT 1RD3B 1C1SA 3L33A 3SBKA 2GCHG 2GGVB 4Q7XA 2M5TA 3ZV8A 3LGTA 1P9UA 2ZA5A 4UD9H 3SI3H 4CRDA 2UUJB 2I6SA 2VIOA 2A7HA 1GI8B 2PW8H 4KTSA 1C2MA 1ZHPA 3SV2H 1BMMH 1LQEA 3MTYA 3EE0B 1L4ZA 3RC4A 1JOUB 4R8TB 2BD2A 4X1RU 5EXMA 4H6TA 2FI5E 2A7CA 2ZCKP 1NFYA 3PMAB 4MNXA 1DWDH 4MTBA 4WH6A 5TJXA 4E06H 5GXPA 4X6OA 1Z7KA 1Y3VA 1XVOA 1MZAA 2TRMA 5I46H 1K1IA 1GI3A 4UE7H 2THFB 4JYTA 1KXEA 3SJKA 4DW2U 1NRNH 1DE7H 1OWEA 4XE4A 3PB1E 1RJXB 1TOMH 4DOQA 2ZGBH 2J94A 2AEIH 3A7XA 5DP3A 4NSYA 4SGBE 2HPPH 7LPRA 1Z8RA 1HAVA 1AB9B 1SFIA 1V2MT 1NRQH 7KMEH 5B6OA 1AKSB 1O5FH 3TJNA 1DT2A 4NSVA 2FI4E 1BJUA 1HAPH 1TOCB 1ORFA 3BG4C 1JMOH 3F9EA 4B74A 1C2EA 4MPVA 1G37A 3KN2A 3UNQA 1T8OA 3F9GA 3MNSA 5FPYA 4Y76A 1BDAA 4DURA 1OXGA 2P16A 1NRPH 1CA0B 4NGAH 1O3PB 2QXIA 1ZGIA 1GI7B 2FESH 4HTCH 1ZJDA 3TGJE 5EG4A 1TNHA 3UR9A 3HKJB 3RXAA 2EC9H 1LPKB 2TBSA 3U9AH 5C3NA 1QTFA 2XCFA 5TCCA 4J1YA 3U98H 1TALA 2NU1E 1IQFA 4Y7AA 2PV9B 2WV5A 5AFZH 4IC5A 1QL7A 1W10U 3BTDE 3SO3A 6CHAB 4KGAA 1O2HA 1C9PA 5E2PA 1YCPM 4FVBA 1GCTC 1HAYB 1P0SH 5A0BA 1C4U2 3NUMA 2J95A 2GDEH 5EQRA 1BA8B 2NU2E 1UVPA 4H4FA 3TK5A 4CR5A 5K7RA 1E35B 1LHEH 1TX7A 3RXPA 3PWCA 1AMHA 1YC0A 2Y7ZA 3RXQA 2GCHF 4TPYA 4AX9H 1C2IA 1K22H 2R3YA 1CO7E 3GY5A 3M5LA 1IQGA 2OLGA 1O3NA 4B75A 4IBLH 1MAYA 1GI4A 1HJ8A 5GCHF 1NN6A 2F9UA 4A1TA 1GHBG 1O2TA 3SUDA 4XBBA 1SGFA 3UWJH 1YYY1 1O2WA 1TE0A 3K65B 1O3AA 2OBOA 2Z9GA 1FNIA 4BAOB 2FOCA 2ZQ1A 2GMTC 3FP6E 2Y6TA 3NZIA 1BIOA 2C4FH 1GHAG 3LGVA 1O3FA 2JH6D 3AW0A 4I32A 1IAUA 3TNTA 1P57B 1TQ7B 1P3CA 3VXEH 5BPEA 4D76A 1K1OA 1ZSKA 3MNCA 3TH3H 3UREA 1EPTC 1Y3YA 1JXPA 4BNRA 1PPGE 5HM9A 5K0HA 4X6NA 3SQHE 4Q2KA 2BLVA 1NPMA 2W3KA 1XVMA 1YLDA 2SFAA 1LO6A 4BOHA 3MU0A 1ZMLA 1ELEE 3SZNA 1D3DB 2ZWLH 3SJ9A 2OC8A 1ANBA 2QA9E 1KLTA 3KQEA 3E16B 3KL6A 4Y8YA 1GMHF 5DGJA 1FUJA 1O2JA 1AFQC 3U8OH 7GCHF 2WPIS 1CGJE 1EQ9A 2O9QA 4FUJA 2QGRA 1C2JA 1TBZH 3C1KA 4UDWH 3GYLB 1NRSH 2A0QB 2ANYA 1V2WT 3OU0A 1CU1A 4Y8XA 4KTUA 2FMJA 5DP7A 1C1RA 1U6QA 1BTPA 5JBAS 4ABEA 3JZ2B 2G4TA 1J14A 3GCHC 1B7XB 3V13A 3B9FH 1Y5UT 3VB5A 2RG3A 1H9IE 1LVBA 4CHAB 1JIMA 2Y5FA 4AFSA 1O2LA 3BEFB 1CT2E 5LH8A 5LPEA 3A8DA 4GCHF 3ENSB 4K2YA 1E36B 2ANMH 3LC5A 3ZZ9A 1HIAB 1GWAA 1SLWB 2ZPSA 3WY8A 2PSXA 3ZZ8A 4ABHA 1XXFA 2BDBA 2ZKSA 3KHVA 1FIWA 1Z1JA 2Z3CA 4MPXA 1BJVA 1LDTT 1SR5C 3PMBB 2ZPQA 2C8YB 1FLEE 1SOZA 1G3CA 1GI0A 1XXDA 4ABAA 1SQAA 3DD2H 1C5TA 3QTOH 3ZZ6A 4MLFB 1WTGH 5HXFA 1GBEA 1O2PA 2BDCA 1HJAB 1O2GH 2CJIA 5DP5A 4LOYH 1DY8A 1DY9A 1Y8TA 4MPUA 3HATH 3PLKA 1QR3E 5FBEA 2ZNKH 3QZQA 2HNTF 5J4SA 2BXTH 2F3CE 3GDUA 1HLTH 1UK2A 1G3EA 3LONA 1TX8A 2KAIA 4AG2A 4X6MA 3A86A 4MNYA 1F0UA 5L6NH 5EXLA 4GCHG 3IWMA 1C5VA 3GY6A 1DWCH 1PQ7A 4E05H 1O36A 3G01A 2BOHB 3MNXA 2PUXB 2C8WB 1OKXA 3D49H 3OX7U 3P95A 3UUZA 1QL9A 4HZHA 1QRZA 1V2OT 1CGIE 4JK6A 4X2YA 1D3TB 1TA6A 2D26C 3LIWA 4FU7A 1LKAA 1TQ0B 4KELA 4BANB 1C1VH 1BHXB 2HRVA 4Y79A 2ZHEH 3PROA 4WWYA 3CP7A 3I77A 1MU6B 3FFGA 2O8UA 4GSOA 1TGCA 1EP6A 1DICA 3A80A 1DFPA 1SLUB 3U69H 1Z8IB 1ZRBA 4A1VA 3V3MA 4K8YA 1XUKA 3MYWA 3PO1C 2Z7FE 3MO9A 5FCRA 6GCHF 3A81A 1VGCC 5EU8A 1VR1H 1C1PA 3UR6A 4BTIB 2V6NA 3RXMA 1WYKA 4GVUA 1NRRH 5DP8A 2TGDA 1QQ4A 1ARCA 3AAUA 3RXLA 2ZDVH 2FTLE 1FONA 3MH4A 2J92A 3MH5A 4AYYB 1ELCA 2ANKH 1F5LA 3M3VA 2OUAA 3M7QA 1UHBB 3LGUA 1DWEH 1F5RA 4BTTB 4FVDA 1PPBH 1ANDA 1GBMA 1RRKA 3LKWA 3VEQB 2P3TB 1OWJA 3D65E 4I8GA 1IQNA 3ODFA 3EBNA 2XXLA 3SGAE 2GZ9A 1S0RA 6CHAC 5F6MA 3DFJA 1UJ1A 1F92A 4X2XA 2ASUB 3RLWH 2CV3A 1HXFH 3QX5H 4MQAA 5FPTA 1AE8H 1S6FA 2F9PA 3ZZ4A 1CQQA 3ZVGA 1C5XB 1TYNA 4JYUH 2IN2A 2F9VA 3MU5A 4AZ2B 1A0JA 2A5IA 1GHVH 3T5FH 1O2VA 1AUTC 1UVUH 1UVTH 3HPTB 1A46H 3GCTG 3DFLA 8GCHG 1C2HA 4NA7A 1C5LH 1EOJA 2G5NA 3FANA 3PM3A 3LGIA 1KXDA 2QXHA 1HXEH 1MTVA 1OPHB 1ELBA 1RIWB 3SU6A 4X2WA 3RXUA 3SJ8A 1C5RA 2D1JA 2F83A 3MNBA 3QTVH 5I25A 1SGCA 3S0NA 2VWMA 4ZHMU 2XWAA 1AHTH 1WTHD 1HJ9A 1VJAU 2IJOB 4X1QU 1EJNA 2QC2A 3TVJB 1PPCE 2W7SA 3ITIA 1CSOE 2EEKA 1YPMH 3RU4E 1IQJA 1QHRB 4INHA 1YLCA 3ELAH 1ETSH 1GJBB 3GY8A 2VVVA 4ZUHA 2PHBA 1TLDA 1UCYH 3S9CA 2FPZA 1HFDA 4D9RA 2H1UA 1SGEE 1EKBB 2A45B 2ZQ2A 4SGAE 4UEHH 2FX6A 2SGPE 3LU9B 4FUGA 7GCHG 2FEQH 3RC6A 1ID5H 4MG3A 2ANWA 2D2DA 2FS8A 3RXHA 4YOIA 2FTMA 1QY6A 1Z6JH 2GT8A 1MAXA 1EZQA 1TBQH 1W0YH 1V2TT 3RXCA 1F2SE 1VJ9U 1GHYH 1O33A 2FOMB 5HMAA 1SL3A 4BAKB 4OS7A 3P8GA 2BVSH 2P8OC 4RN6A 5HYOA 1O3BA 2FOAA 4NIWA 1QJ1B 3AVZA 1C9TA 1O5AB 1XUFA 3URCA 1QCPA 3PO1B 4THNH 5DG6A 1TRNA 1D9IA 4FU9A 1DM4B 1GBDA 3BTHE 1HAVB 2H5CA 2I6QA 1GPZA 1OOKB 1TB6H 5EOKA 4JZ1A 2Z94A 4ABGA 4DCDA 3RXJA 1QFKH 1GJCB 2BZAA 3SUEA 1S82A 4YTAA 1H1BA 2NU0E 4JK5A 1KYNA 2J38A 2ZTXA 1K1PA 1LKBA 2Q1JA 4O3TA 1L1GA 1W3CA 3ZZ7A 1ZSJA 3RP2A 3UOPA 1SGQE 4K1EA 3BTME 3QGNB 4GLYA 1ZPCA 1V6DA 5F8TA 1DSTA 2GCTC 1YBWA 1G3BA 2BDYA 1WBGB 4Q80A 3VB3A 1ELDE 5FXLA 1ZOMA 2VIPA 5C67A 3A89A 2F9BH 1TGSZ 1VCWA 1VITG 2XBVA 2ZDKA 2H9EH 2GZ8A 1W0ZU 3BN9A 3S9BA 5DP4A 2TGTA 3ATLA 3Q3YA 2ZFFH 1OYQA 1GJ6A 3DUXH 2QF0A 4BAQB 4Y0ZE 3MU1A 3SU4A 1SLXB 1VITH 2LIZA 4DIHH 4XBCA 2A32A 1Z1IA 3RXEA 3RXRA 1EAWA 1QJ7B 3ZV9A 1A61H 4X1SU 3F68H 1AB9C 4KTCA 1Y59T 3VXFH 4B2CA 3L3TA 1ETTH 2Z3DA 3KF2A 1GI2A 3H7TA 2PKAA 1FDPA 1EB1H 2XC4A 2ZFTA 2Z9JA 1GVKB 1TGTA 1BT7A 4U30A 2QV1A 3P8NA 1LTOA 1SMFE 2C90B 1AWFH 2BZ6H 1ELTA 2SGEE 2XC0A 2FI3E 4CREA 1J9CH 2J9NA 1A4WH 4AGKA 2C93B 2AGGX 5ESBA 1MKXH 2AIPA 1FY3A 3EA7A 1CHOF 1BTXA 1MTNB 2HWLB 1SGDE 1UK3A 1ZR0A 3M7TA 1MU8B 1MD8A 1AVWA 2O8WA 2Q6DA 5EXNA 1UCYE 4H6SB 2A5KA 3PMHB 4OS5A 3V0XA 2XW9A 2P93A 2VNTA 1D6RA 1MTUA 1IHTH 2ODQA 1GJ9B 4CRFA 3CENA 2ZPRA 1C5YB 2AYWA 3RXDA 4B73A 3A88A 3NK8A 1GHBF 3LT3A 4XDEA 3O8RA 3O8DA 1TPAE 2JETB 3KQCA 1GCTB 3SV8A 3E90B 3V12A 1YPHC 1EOLA 5JDUB 2SGAA 4LZ1H 3BEUA 1YCPH 4IN2A 2A31A 1SG8B 3TPIZ 1C5NH 3UY9A 3SUGA 2BTCE 3VFEA 4B2BA 2YNAA 1TAWA 3DA9B 1QNJA 2HLCA 1BB0B 5CE1A 1UTKA 1PJPA 3A8AA 1IQEA 1FI8A 2C8ZB 1O2YA 2J34A 2R2MB 1DPOA 2ZTZA 3MMGA 5A09A 1XX9A 3KNXA 3CS7A 2VGCB 1Z6EA 2VWLA 3BV9B 3H5CB 3SJOA 3ZVBA 1JRSA 2ZFRH 1BCUH 3SU1A 4B1TA 1L2EA 3P8FA 3PWBA 1M9UA 1C5SA 2EI8A 2BM2A 1O3LA 1THPB 1P2MA 1B5GH 2Y81A 5FX5A 4ZMAH 3ZVCA 1AU8A 4D7FA 2EA3A 1IQIA 1J8AA 4F49A 3A84A 2STBE 1UTPA 1HUTH 3T25A 1S81A 4ISHH 1P3EA 1PQAA 1GGDB 1KSNA 1FIZA 1IQHA 1PPEE 4NG9H 1FZZA 1FMGA 5C5OA 1AZZA 1VCPA 2ZGCA 1C2GA 2BVRH 1SGTA 3C27B 3NCLA 3Q3XA 3QDZB 1GBBA 3T27A 2HGTH 4FUFA 1SGPE 3SU2A 4UFDH 3SGQE 2PTNA 4OS6A 1OX1A 2OTVA 2RA3A 2ZU5A 3I78A 4E7NA 1J17T 1GVLA 2SGQE 2PKSB 1A1RA 5EW2H 1P2KA 3E8LA 4BTUB 2BY5X 4YT6H 1J15A 1NT1A 1QJ6B 2B5TB 8KME2 1H8DH 4HI3A 3ZVAA 3B23B 4TYDA 2SNVA 1ZMNA 5E2OA 4YLQH 3HKIB 3BTQE 1KTTB 1C2LA 4WF8A 1SSXA 4CBNA 1SQTA 1K1JA 3R0FA 3UTUH 2HVXA 2FWWA 2Z9IA 4ABIA 4R0IA 5CHAB 4WH8A 1CA8B 4GUXA 4X1PU 5EPNA 2A4OA 1SHYA 1C1UH 3BSQA 4NWLA 1C2KA 1OYTH 1O3HA 4Q7ZA 1TNJA 2VB0A 1BTUA 3GDVA 3QK1A 3RDZA 4AFUA 1PPZA 3LOXA 4ABFA 2ALVA 3GISB 4ISNA 1FPHH 5F8XA 1ESBA 1LHCH 1O5EH 5A0CA 1IQLA 3VB6A 1O5CB 4YESB 2NU3E 2Y82A 1FAXA 1RTFB 2ZO3H 1NC6A 1Y3UA 4NIXA 2BLWA 1UTNA 2P8OB 1BTHH 4FU8A 2H2ZA 1JIRA 2GX4A 2PUQH 3BTTE 2FODA 2ZGJA 3SGBE 1Q3XA 1RTLA 1NESE 4INKA 4NFEA 1EJMA 2VIWA 2ILNA 2PR3A 2A5AA 2BDIA 1EP5A 3UOUA 5EW1H 2ZHDA 3SUFA 5BRRE 3RXOA 3LC3A 1A7SA 2FLRH 3QZRA 4ZKRU 2CHAC 2PKSC 3M5NA 1YPJH 1YPEH 3OY6U 3SU0A 1CA0C 2ZF0H 1ZYOA 1QA7A 1DDJA 1ZLRA 1O2KA 3SNBA 4YZUA 5IYTA 1UO6A 4Y8ZA 3RMOH 1TNGA 1WQSA 1O3KA 4Y11E 5T6GA 2BOKA 2O8MA 2QAAA 3BTKE 4VGCC 5JPMH 4AFQA 1T7CA 3TGKE 1A5IA 3L6PA 3A83A 2P3FH 1VCQA 3FZZA 3BIVH 2OCVB 3ZZBA 1G2LA 4ABJA 1GI9B 2CGAA 2ZTYA 2BYAX 4LZ4B 4K1SA 3LPRA 3SV7A 4NWKA 2R3UA 1EZSC 4I8LA 3ATIA 3SNCA 2A1DB 1NS3A 2G51A 4AOQA 1VITF 1CBWC 1RGQA 4CRGA 1GBTA 4J2YB 3A7YA 1HNEE 4DT7B 1GBFA 1DUAA 3RXSA 3PLPA 1QBNA 5C1XA 3ODDA 1KIGH 2DE8A 5L2YH 2A4RA 1XUHA 5FPSA 2CHAB 3E3TA 3ZZDA 4LXBH 5T6FA 4JZDH 2BLQA 4TPIZ 1AIXH 3TJUA 3MFJA 2AMPA 2HNTC 3K9XB 2EI7A 1DVAH 4TY6A 1ELFA 4DJZB 1K1NA 3U8TH 1BUIA 4YOGA 3TH4H 2KAIB 1WOFA 2FO9A 2Q6FA 4M7GA 4MVNA 1OS8A 3A7WA 2LNCA 4NIVA 1JWTA 2FYQA 2ZP0H 3S69A 2GV7A 3LH3A 4I8HA 4X8UH 3SHCH 1Q31A 1EAXA 2RA0A 1O2SA 2R0LA 1GBHA 1ZTLA 1AVGH 2BD7A 3SNEA 1A0LA 1OP0A 5EODA 4X1NU 1GBAA 1L1JA 1O34A 4NCYA 5F03A 4YO9A 1HIAA 4A1XA 1OP2A 3MH6A 3O8CA 5FAHA 3DT0H 3GOVB 3Q76A 1GBLA 4I8JA 3VGCC 1MCTA 2OQ5A 2ZCHP 2Z9LA 1P12E 1ZTJA 3ZZ5A 1CBWB 3EA9A 3HK6B 2WINI 3T26A 1QGFA 1HPGA 2Y5GA 3MU4A 1AVXA 4AN7A 1BRCE 4ASHA 4MDSA 3GCHB 6GCHG 3TGIE 5EPYA 2CMYA 2BB4A 4NFFA 2JKHA 1NO9H 5DK1A 5DPAA 4D7GA 4ZH8A 2BXUH 1F7ZA 1EUFA 1W7XH 4PROA 1MBQA 1NM6A 1QQUA 2K1QA 3A8BA 5DP9A 1DXWA 3VPKA 1HBTH 1SGNE 1ZMJA 3SI4H 4D9QA 1V2LT 1SGIB 1THSH 1BBRE 5A2MH 3TH2H 1ANCA 1SFQB 1ZJKA 3NXPA 1LVOA 3AASA 1GJ7B 2QF3A 2TPIZ 1QB9A 1Z71A 1C4V2 1W2KH 4KKDA 1YGCH 1ESTA 1RFNA 2AFQB 2PGBB 2HOBA 4JMYA 1W14U 2AS9A 1AD8H 5HM2A 1BMNH 4GPGA 3ZZ3A 4BAHB 2P3UB 4OGXA 2UUYA 2W5EA 2Z6BD 1C5PA 1ANEA 1H9LB 4XOJA 2YNBA 3T2NA 1BRBE 2VH0A 1D3PB 2WPMS 1NTPA 2VIVA 3KQDA 1GI5A 1A3BH 2DUCA 1GJ5H 4OS2A 1O5DH 1ELAA 1UHBA 2AGIX 3VGCB 1BHXF 2BD9A 3PMJA 3U1IB 1O3CA 1BRUP 2XBWA 1IQKA 1FN8A 3AW1A 1EPTA 2FOBA 4DIIH 3SW2B 5G4BA 2FLBH 1GBKA 5CMXH 1TNLA 1YPGH 1EATA 1FAKH 1GBCA 2XTTB 1AN1E 1GJDB 1TMTH 2PKAB 1WQVH 3K2UA 1RIWC 2IOTA 4RSPA 1AGJA 2FX4A 2ZU2A 3EA8A 1PPHE 2A7JA 1AUJA 4NZQA 1GHWH 4U01A 1K1LA 1O38A 2QYIA 2BVXH 3M5MA 3A7TA 3UNRA 3EQ0H 1EX3A 2Q6GA 2HNTE 3ZZAA 1BBRH 3RM2H 3F9FA 2ZGHA 1LVYA 2Y7XA 1QURH 5E8EH 5HGGA 3GCNA 1QB6A 1LPGB 1DS2E 5GPIB 1GGDC 3QO6A 4WMDA 1QIXB 4TY7A 1AI8H 1FY5A 5FBIA 3RXIA 4AB9A 1QA0A 3EDXB 1QL8A 2XWBI 2PGQB 1O5BB 1CGHA 1NU7B 3FAOA 4XSKU 3M36A 4YLUA 2UWLA 2VH6A 1C2FA 3AAVA 1BTZA 1PYTD 1INCA 9ESTA 2BX4A 1QRWA 3VB4A 1O2IA 2GP9B 1GI6A 2XCNA 2XBYA 3GDSA 5ESTE 1EJAA 2WV4A 3UWIA 2G52A 1F5KU 4WVPE 3M37A 3GY4A 1O31A 1C1TA 5SGAE 3U8RH 3TNSA 1H8IH 4ISLA 1TBRH 2VWOA 2EI6A 1CVWH 1LHDH 3MU8A 1JBUH 3MO3A 2QCYA 2SNWA 1C5MD 2G5VA 3EYDA 4AFZA 2VINA 2OC1A 2FM2A 3P92A 1HAGE 1TMBH 1D4PB 1WU1A 5AFYH 4TWYA 1L1NA 3ZVFA 1C4Y2 1MZDA 2GMTB 3RXBA 2AMDA 5C5NA 1GMDF 1SI5H 1ZPZA 4ZKOU 3VB7A 3DHKH 1W12U 2ZECA 2J2UA 3SOSA 2R2WU 4O97A 2B0FA 3H7OA 1E38B 2BD3A 1EZUC 3W95A 1FQ3A 4BXWA 4IS5A 3LJJA 1HAHH 2ULLA 2QXGA 3TK9A 1E0FD 1T8NA 3ATWA 2K7XA 2B8OH 1P2JA 2OP9A 2ZU1A 5GCHG 1SB1H 1BTWA 4JZFH 1KDQA 3NKKA 3RXGA 1S84A 2V0BA 1RTKA 1HAOH 1GHXH 4ZHLU 1GJ4H 1UTQA 1W13U 5GIBA 1O3MA 2ZEBA 1MBMA 1FN6A 1OWKA 3ATKA 1FV9A 2XNIA 3M61U 1NY22 2PFEA 1KLJH 1PQ8A 3GY3A 1FY8E 3I29A 1C5WB 1MTSA 3SNAA 5AHGH 3U1JB 4F4OC 1UVSH 2WYJA 3MOCA 2BMGB 1CE5A 1YP9A 2ZDLA 2ZFQH 4ABDA 1SGYE 1GMDG 1TNKA 2VVCA 2UWPA 5EQSA 1V2QT 4NIYA 2NWNA 2G55A 1OWDA 1OWHA 4I31A 3ZVEA 4AB8A 5JB9S 1CHOG 1DLKB 3Q77A 1A5GH 3Q00A 1P04A 4K1TA 4A7IB 1L0ZA 2OQUA 4CHAC 3K6ZA 1G36A 5EQQA 3GICB 1G9IE 2VWNA 1TNIA 1AKSA 1TIOA 2TIOA 1W11U 3SNDA 2XYAA 2G8TA 3QUMP 2GT7A 2HPQH 1T31A 4FXGH 1T32A 3OTJE 1G3DA 4D8NA 1MQ6A 5TCAA 4Y71A 5GDSH 2ESTE 2P59A 2WYGA 3MH7A 1E34B 5DKMA 1THRH 3RMMH 3RC5A 1GHZA 1C5QA 1TABE 3LH1A 3RU4T 4KP0A 1GMHG 1P2OA 3UNSA 1RS0A 1O3IA 3FZDA 1KTSB 1GBIA 3UIRA 2BDGA 4WMEA 1XM1A 1N1LA 2O8TA 2PSYA 1WV7H 1TGNA 2JETC 3A7VA 1QBVH 1T4UH 1XUGA 2VVUA 2ALPA 1T4VH 3QGJA 4HGCA 1SHHB 1ZGVA 3GCTF 4K5ZA 1DX5M 2H6MA 3M5OA 1SGFG 2VIQA 1CT0E 1FJSA 2SGDE 3STIA 1Z8JB 4DG4A 2SGFE 2CF8H 1Y3XA 1YKTA 4K8BA 1A2CH 1C5OH 1N8OC 4I8KA 2JH0D 1V3XA 4U2WA 1SVPA 1ESAA 4INLA 1TRYA 1P9SA 2ZFPH 3BIUH 8GCHF 3HGPA 3SHAH 5LPFA 2CN0H 2QN5T 1DANH 3E0PB 4CRAA 3KQBA 3LGWA 2OC7A 3F6UH 1HAXB 4X6PA 3CS0A 1C5ZB 5T3HA 4DVAU 4A6LA 2TGAA 3GYMA 4OS4A 1K21H 3E6PH 1BMAA 2BQWB 3BG8A 1KXFA 5E0GA 1O2QA 2QY0B 5FX6A 5C2ZA 5E0HA 1O30A 2FIRH 1MH0A 4Z6AH 1P11E 1YM0A 1VGCB 1SGRE 2UWOA 2C8XB 1HRTH 3PTBA 1MKXK 3QN7A 4Z0KA 3A87A 1O2UA 4ZKSU 3F1SB 2XC5A 1K28D 2BY8X 4O03A 1IHSH 2ZIQH 1O2MA 1GI1A 3TIUA 3TLOA 1AFEH 2ZI2H 3BG4B 4ZXYH 1GCDA 1O2XA 1DLEA 1T8LA 5LGOA 5DO4H 1GDQA 1GG6B 1OWIA 1HAIH 3URDA 5AF9H 2OD3B 1MTNC 3NWUA 1KXBA 3MHWU 2BQ6B 1V2JT 2P94A 3FP8E 2FOHA 4ZROA 2AERH 1ACBE 2GKVE 1ABIH 1ZHRA 3NPSA 1P2NA 1XKAC 2BX3A 5ETXA 4WY3A 1P02A 3EGKH 1P03A 2UUKB 1GBJA 4WXIA 3STJA 3RXVA 1TFXA 5EGMA 2YOLA 2XRCA 2BY6X 4IW4E 4B76A 3T28A 1HB0B 3RXTA 2V3OH 3MWIU 4CRBA 3LGYA 4UFGH 1AFQB 1J16A 5JBBS 2OINA 1Y3WA 1DSUA 5DP6A 2FOEA 1O37A 1EAUA 1BMLA 2FP7B 2IPHA 1C5UA 4DGJA 1LCYA 1X7AC 3T62A 3IITA 4O3UA 5JB8S 1NZQH 5F8ZA 4UFEH 3JZ1B 4IC6A 1LQDB 2G00A 2GDDA 1XUJA 2XBXA 1D6WA 3UQOA 1GMCF 1A5HA 3BTFE 4WMFA 2ZDNA 1OP8A 3TU7H 3E91A 4HFPB 4AORA 3E0NB 1LHGH 4ISOA 4MNWA 3P70B 1V2PT 3R3GB 4FUEA 4ZKNU 4GHQA 1AO5A 1B0EA 2ZDAH 2BD8A 9LPRA 2PWXA 3TITA 1DUEA 1IQMA 2VU8E 3IG6B 2AIQA 3RMLH 3RUOA 2GD4B 2ZHQH 5L30H 1V2ST 4CH8B 2WPJS 2ZHFH 4VGCB 2LPRA 4K69A 4GHTA 1OSSA 4YOJA 4IN1A 4B71A 1AZ8A 2OXSA 4K3JA 4UONA 4WXVA 1UTLM 3OY5U 3S9AA 1S5SA 1ZZZA 2BHGA 2B7DH 1YPLH 1GDNA 2ZHWH 1BQYA 3SORA 4AG1A 2BDAA 2FDAA 4B2AA 1WSSH 2OBQA 2A2XH 1N6XA 2TGPZ 2ZDMA 3P6ZB 3ZVDA 1TPSA 1ZTKA 2BDHA 3SU3A 2ZCLP 4BXSA 1MD7A 1TA2A 4FUCA 2AMQA 3QLPH 1O3OA 1ZSLA 3HK3B 4Y7BA 1Z8GA 1MMJN 2WPKS 2W26A 1LPZB 1O2OA 5A0AE 2JH5D 2ODYB 2CF9H 4FUIA 3FP7E 5C1YA 2H9HA 4TWWA 1O39A 5GWZA 2WUCA 1C1OA 1DXPA 2G4UA 4JYVH 1D3QB 1P10A 1BZXE 1YCPK 1SPJA 3M3TA 3O8BA 4IGDA 3ESTA 3SU5A 3B8JA 5JBTA 4YT7H 4FUDA 1EZXC 3P8OA 2WUBA 3PLBA 4X8TH 1HAZB 4I7YH 2OC0A 2BY7X 4WJG2 1TPOA 1O35A 3FVFB 2ZG0H 1LMWB 2VIDA 1HCGA 1GMCG 2F9NA 1KY9A 1SBWA 3PTNA 3A82A 1XUIA 4CH2B 1P05A 1K2I1 2GZ7A 4U32A 4AYVB 2B9LA 1ABJH 1P8VC 1SQOA 5A8XA 2CXVA 5AVDA 1SC8U 3PV4A 2BY9X 1ZPBA 1S85A 3OYPA 4K60A 4Y6DA 1EB2A 8ESTE 3SV9A 3KEEA 1S0QA 4CBOA 3A7ZA 4X8VH 1A3EH 2R0KA 5DJ7A 5LPRA 1B0FA 3EAJA 1TX6A 6LPRA 2W7UA 3SV6A 2BQ7B 4I33A 5ABWA 2ODPA 1RXPA 1P06A 1GJAB 1V2VT 1N8OB 2V35A 4CR9A 1NU9A 5CHAC 3F9HA 2D8WA 4FUHA 4E7RG 2A2QH 2ZZUH 1G2MA 3OSYA 1PQ5A 2A4GA 1P2QA 2RDLA 4NA9H 3HGNA 2UUFB 1MQ5A 3TK6A 5FCKA 1BBRK 1GL0E 1PFXC 3KCGH 1YPHE 1HGTH 1CT4E 4H42U 1F0TA 1BTYA 3PYHA 3ZYEA 1EAIA 1SOTA 4XFQA 1AWHB 1UTMA 1LHFH 2AH4X 1SLVB 1S83A 3UPEA 1ZHMA 4ABBA 1AQ7A 1Y5BT 4Y10E 1KDQB 3LJOA 1KLIH 4ESTE 2Z9KA 2PTCE 1L4DA 3TJVA 1V2KT 3GY2A 1ETRH 2GCTB 2WPHS 4YM9A 1O3JA 3M35A 3BF6H 1H9HE 2Y5HA 1P01A 3W94A 1ELGA 1BITA 3E1XB 4NA8A 5E0JA 4ZXXH 4JCNA 3ZYDA 2GVFA 4O9VA 1V2UT 1YPKH 2ZGXH 3D23A 1HV7A 1UMAH 2ZFSA 1UK4A 2DE9A 2AGEX 1TMUH 2H5DA 5H4IB 2PLXA 1AY6H 3KIDU 2BLOA 1TONA 1N6YA 1GJ8B 1MKWH 3Q3KA 2J4IA 1GHAF 5C20A 1TWXB 2H9TH 1FY1A 5A8ZA 4BAMB 1DITH 4OGYA 4Q7YA 3V7TA 1O3DA 1LVMA 3GY7A 1P2IA 1O5GH 4IMQA 1KXCA 1FY4A 1UTOA 2ZU3A 2BD4A 2VGCC 1FPCH 1VZQH
chains in the Genus database with same CATH superfamily
1NROH 1V2RT 1GVZA 3P17H 5EJ1A 3TJOA 2V3HH 1F0RA 1ZRKA 2GTBA 4JZIA 1W8BH 5IDKA 1MKWK 3M7UA 2QIQA 1F0SA 3OAAD 2F91A 4AGJA 4X8SH 3KGPA 1XMNB 1V2NT 3T29A 1PYTC 1BOQA 3S7HB 1PPFE 1G30B 1FXYA 1UCYK 5T6DA 1G32B 3RXFA 1MCVA 2NU4E 3FN8A 1EPTB 4X2VA 1EASA 3BTEE 1O3GA 5A8YA 4A92A 1K1MA 1BRAA 1NFWA 3N99A 3UFAA 2WPLS 1WUNH 1NFUA 2FOFA 4XBDA 1GL1A 4A5TS 5L2ZH 1JRTA 4YXWD 1UTJA 1QBOA 4ISIH 2ZU4A 1HJAC 1HDTH 3RLYH 2Y80A 4QT8C 2R9PA 1O2NA 4ZAEA 3NRLA 5C1UA 1GG6C 1K9OE 8LPRA 5JBCS 1T8MA 5KECA 1TRMA 4X0WU 4DY7B 1MABB 2FOGA 3W1EA 3SYJA 4Y0YE 1O2ZA 3SJIA 5GJ4B 1C1NA 5JYIA 3D62A 1C1WH 2FXRA 1IOEA 3A85A 2G81E 1P09A 1CHGA 1C1MA 1EXFA 1O0DH 3RU4D 1QRXA 1S6HA 1O32A 3RM0H 5PTPA 2FS9A 3N7OA 1TGBA 1UVOA 4UFFH 1DOJA 1O3EA 1WAYB 3QWCH 1QB1A 4JZEH 4RKOB 4FUBA 4MNVA 2J98A 4CRCA 1AE5A 4IMZA 1DWBH 2HALA 1WCZA 7ESTE 4NZLA 1KXAA 1XKBC 2STAE 3ATMA 2BD5A 2C3SA 1HYLA 1NFXA 4GAWA 3SQEE 4MPWA 2Z3EA 2FYRA 2RFKC 2EQNA 4ZHAA 3BTGE 5J4QA 2A4QA 2F9OA 1W7GH 4RKJB 2P95A 3BTWE 1GDUA 1ELVA 2ZC9H 3M3SA 3RMNH 3GCOA 1O2RA 3WWBA 1A0HB 3MO6A 3OFND 1H4WA 2O8LA 1ARBA 6ESTA 1TPPA 1E37B 5HIYA 3ZZCA 1C2DA 2RCEA 3A8CA 5FHTA 2W3IA 4OS1A 4LK4A 2VJ1A 3SN8A 2FZZA 2QXJA 1C1QA 4ASUD 3RXKA 3LDXH 2GV6A 1Q2WA 3UQVA 3K6YA 3S7KB 1YF4A 1MTWA 3BEIB 3MI4A 1MUEB 1Y5AT 1RD3B 1C1SA 3L33A 3SBKA 2GCHG 2GGVB 4Q7XA 2M5TA 3ZV8A 3LGTA 1P9UA 2ZA5A 3DCLA 4UD9H 3SI3H 4CRDA 2UUJB 2I6SA 2VIOA 2A7HA 1GI8B 2PW8H 4KTSA 1C2MA 1ZHPA 4F55A 3SV2H 1BMMH 1LQEA 3MTYA 3EE0B 1L4ZA 3RC4A 1JOUB 2JJ2D 2BD2A 4R8TB 4X1RU 5EXMA 4H6TA 2FI5E 2A7CA 2ZCKP 1NFYA 3PMAB 4MNXA 1DWDH 4MTBA 4WH6A 5TJXA 4E06H 5GXPA 4X6OA 1Z7KA 1Y3VA 1XVOA 1MZAA 2TRMA 5I46H 1K1IA 1GI3A 5KGOA 4UE7H 3KQ5A 2THFB 4JYTA 1KXEA 3SJKA 2M2AA 4DW2U 1NRNH 1DE7H 2RDEA 1OWEA 4XE4A 3PB1E 1RJXB 1TOMH 4DOQA 2ZGBH 2J94A 2AEIH 3A7XA 5DP3A 4NSYA 4SGBE 2HPPH 7LPRA 1Z8RA 1HAVA 1AB9B 1SFIA 1V2MT 1NRQH 7KMEH 5B6OA 1AKSB 1O5FH 2J5UA 3TJNA 1DT2A 4NSVA 2FI4E 1BJUA 1HAPH 1TOCB 1ORFA 3BG4C 1JMOH 3F9EA 4B74A 1C2EA 4MPVA 1G37A 3KN2A 3UNQA 1T8OA 3F9GA 3MNSA 5FPYA 4Y76A 1BDAA 4DURA 3OEHD 1OXGA 2P16A 1NRPH 1CA0B 1NBMD 1O3PB 2QXIA 4NGAH 1ZGIA 1GI7B 2FESH 4HTCH 1EFRD 1ZJDA 3TGJE 5EG4A 2KCOA 1TNHA 3UR9A 3HKJB 3RXAA 2EC9H 1LPKB 2TBSA 3U9AH 1WXRA 5C3NA 1QTFA 2XCFA 5TCCA 4J1YA 3U98H 1TALA 2NU1E 1IQFA 4Y7AA 2PV9B 2WV5A 5AFZH 4IC5A 1QL7A 1W10U 3BTDE 3SO3A 6CHAB 4KGAA 1O2HA 1C9PA 5E2PA 1YCPM 4FVBA 1GCTC 1HAYB 1P0SH 5A0BA 1C4U2 3NUMA 2J95A 2GDEH 5EQRA 1BA8B 2NU2E 1UVPA 4TT3D 4H4FA 3TK5A 4CR5A 5K7RA 1E35B 1LHEH 1TX7A 3RXPA 3PWCA 1AMHA 4FOUC 1YC0A 2Y7ZA 3RXQA 2GCHF 4TPYA 5GNDA 4AX9H 1C2IA 1K22H 2R3YA 1CO7E 3GY5A 2QE7D 3M5LA 1IQGA 2OLGA 1O3NA 4B75A 4IBLH 1MAYA 1GI4A 1HJ8A 5GCHF 1NN6A 2F9UA 4A1TA 1GHBG 1O2TA 3SUDA 4XBBA 1SGFA 3UWJH 1YYY1 1O2WA 1TE0A 3K65B 1O3AA 2OBOA 2Z9GA 1FNIA 4BAOB 2FOCA 2ZQ1A 2GMTC 3FP6E 4B6FA 2Y6TA 3NZIA 1BIOA 2C4FH 1GHAG 3LGVA 1O3FA 2JH6D 3AW0A 4I32A 1IAUA 4ZCNA 3TNTA 1P57B 1TQ7B 1P3CA 3VXEH 5BPEA 4D76A 1K1OA 1ZSKA 3MNCA 3TH3H 1YY3A 3F2GA 3UREA 1EPTC 1Y3YA 3KYGA 1JXPA 4BNRA 1PPGE 5HM9A 5K0HA 4X6NA 3SQHE 4Q2KA 2BLVA 1NPMA 2W3KA 1XVMA 5CE1A 1YLDA 2SFAA 1LO6A 4BOHA 3MU0A 1ZMLA 1ELEE 3SZNA 1D3DB 2ZWLH 5IK2D 3SJ9A 2OC8A 1ANBA 2QA9E 1KLTA 3KQEA 3E16B 3KL6A 4Y8YA 1GMHF 5DGJA 1FUJA 1O2JA 1AFQC 3U8OH 7GCHF 2WPIS 1CGJE 1EQ9A 2O9QA 4FUJA 2QGRA 1C2JA 1TBZH 3C1KA 4UDWH 3GYLB 1NRSH 2A0QB 2ANYA 1V2WT 3OU0A 4FETA 5HKKD 1CU1A 4Y8XA 4KTUA 2FMJA 5DP7A 1C1RA 2F43B 1U6QA 1BTPA 5JBAS 4ABEA 3JZ2B 2G4TA 1J14A 3GCHC 1B7XB 5DSFA 3V13A 3B9FH 1Y5UT 3VB5A 2RG3A 1H9IE 1LVBA 4CHAB 1JIMA 1YLNA 2Y5FA 4AFSA 1O2LA 3BEFB 1CT2E 5LH8A 5LPEA 3A8DA 4GCHF 3ENSB 4K2YA 1E36B 2ANMH 3LC5A 3ZZ9A 1HIAB 1GWAA 1SLWB 2ZPSA 3WY8A 2PSXA 3ZZ8A 4ABHA 1XXFA 2BDBA 2ZKSA 3KHVA 1FIWA 1Z1JA 2Z3CA 4MPXA 1BJVA 1LDTT 1SR5C 3PMBB 2ZPQA 2C8YB 1FLEE 1SOZA 1G3CA 1GI0A 1XXDA 4ABAA 1SQAA 3DD2H 1C5TA 3QTOH 3ZZ6A 4MLFB 1WTGH 5HXFA 1GBEA 1O2PA 1KMHB 2BDCA 1HJAB 1O2GH 2CJIA 5DP5A 4LOYH 1DY8A 1DY9A 1Y8TA 4MPUA 3HATH 3PLKA 1QR3E 5FBEA 2ZNKH 3QZQA 2V7QD 2HNTF 5J4SA 2BXTH 2F3CE 3GDUA 1HLTH 1UK2A 1G3EA 3LONA 1TX8A 2KAIA 4AG2A 4X6MA 3A86A 4MNYA 1F0UA 5L6NH 5EXLA 4GCHG 3IWMA 1C5VA 2YMSD 3GY6A 1DWCH 1PQ7A 4E05H 1O36A 3G01A 2BOHB 3MNXA 2PUXB 2C8WB 1OKXA 3D49H 3OX7U 3P95A 3UUZA 1QL9A 4HZHA 1QRZA 1V2OT 1CGIE 4JK6A 4X2YA 1D3TB 1TA6A 2L6OA 2D26C 3LIWA 4FU7A 1LKAA 1TQ0B 4KELA 4BANB 1C1VH 1BHXB 2HRVA 4Y79A 2ZHEH 3PROA 4WWYA 3CP7A 3I77A 1MU6B 3FFGA 2O8UA 4GSOA 1TGCA 1EP6A 1DICA 3A80A 1DFPA 1SLUB 3U69H 1Z8IB 1ZRBA 4A1VA 3V3MA 4K8YA 1XUKA 3MYWA 2QF4A 3PO1C 2Z7FE 3MO9A 5FCRA 6GCHF 3A81A 1VGCC 5EU8A 1VR1H 2WV9A 1C1PA 3UR6A 2JDID 4BTIB 4Q63A 2V6NA 3RXMA 1WYKA 4GVUA 1NRRH 5DP8A 2TGDA 1QQ4A 1ARCA 3AAUA 3RXLA 2ZDVH 2FTLE 1FONA 3MH4A 2J92A 3MH5A 3OTPA 4AYYB 5EJLA 5CDFE 1ELCA 2ANKH 1F5LA 3M3VA 2OUAA 3M7QA 1UHBB 3LGUA 1DWEH 1F5RA 4BTTB 1H8HD 4FVDA 1PPBH 1ANDA 1GBMA 1RRKA 3LKWA 1BMFD 3VEQB 2P3TB 1OWJA 3D65E 4I8GA 1IQNA 3ODFA 3EBNA 2XXLA 3SGAE 2GZ9A 1S0RA 6CHAC 5F6MA 3DFJA 1UJ1A 1F92A 4X2XA 2ASUB 3RLWH 2CV3A 1HXFH 3QX5H 4MQAA 5FPTA 4B6EA 1AE8H 1S6FA 2F9PA 3ZZ4A 1CQQA 3ZVGA 1C5XB 1TYNA 4JYUH 2IN2A 2F9VA 3MU5A 4AZ2B 1A0JA 2A5IA 1GHVH 3T5FH 1O2VA 1AUTC 1UVUH 1UVTH 3HPTB 1A46H 3GCTG 3DFLA 2WPDD 8GCHG 2W6ID 1C2HA 4NA7A 1C5LH 1EOJA 2G5NA 3FANA 4ACBA 3PM3A 3LGIA 1KXDA 2QXHA 1HXEH 1MTVA 1OPHB 1ELBA 1RIWB 3SU6A 4X2WA 3RXUA 3SJ8A 1C5RA 2D1JA 2F83A 3MNBA 3QTVH 5I25A 1SGCA 3S0NA 2YMSB 2VWMA 4ZHMU 2XWAA 1AHTH 1WTHD 3PV5A 1HJ9A 1VJAU 2IJOB 4X1QU 1EJNA 2QC2A 3TVJB 1PPCE 2W7SA 3ITIA 1CSOE 2EEKA 1YPMH 3RU4E 1IQJA 1QHRB 4INHA 1YLCA 3ELAH 1ETSH 1GJBB 3GY8A 2VVVA 4ZUHA 2PHBA 1TLDA 1UCYH 4Q4LA 3S9CA 2FPZA 1HFDA 4D9RA 2H1UA 1SGEE 1EKBB 2A45B 2ZQ2A 4SGAE 4UEHH 2FX6A 2SGPE 3LU9B 4FUGA 7GCHG 2FEQH 3RC6A 1ID5H 4MG3A 2ANWA 2D2DA 2FS8A 3RXHA 4YOIA 4RT0A 2FTMA 1QY6A 1Z6JH 2GT8A 1MAXA 1EZQA 5B6LA 1TBQH 1W0YH 1V2TT 3RXCA 1F2SE 1VJ9U 1GHYH 1O33A 2FOMB 5HMAA 1SL3A 4BAKB 4OS7A 3P8GA 2BVSH 2P8OC 4RN6A 5HYOA 1O3BA 2FOAA 4NIWA 1QJ1B 3AVZA 1C9TA 1O5AB 1XUFA 3URCA 1QCPA 3PO1B 4THNH 5DG6A 1TRNA 1D9IA 4FU9A 2V3MA 1DM4B 1GBDA 3BTHE 1HAVB 2H5CA 2I6QA 1GPZA 1OOKB 1TB6H 5EOKA 4JZ1A 2Z94A 4ABGA 4DCDA 3RXJA 1QFKH 1GJCB 2BZAA 3SUEA 1S82A 4YTAA 2JJ1D 1H1BA 2NU0E 4JK5A 1KYNA 2J38A 2ZTXA 1K1PA 1LKBA 2Q1JA 4O3TA 1L1GA 1W3CA 3ZZ7A 1ZSJA 3RP2A 3UOPA 1SGQE 4K1EA 3BTME 3QGNB 4GLYA 1ZPCA 1V6DA 5F8TA 1DSTA 1FX0B 2GCTC 1YBWA 1G3BA 2BDYA 1WBGB 4Q80A 3VB3A 1ELDE 5KEDA 5FXLA 4Z1MD 1ZOMA 2VIPA 5C67A 3A89A 2F9BH 1TGSZ 1VCWA 1VITG 2XBVA 2ZDKA 2H9EH 2GZ8A 1W0ZU 3BN9A 3S9BA 5DP4A 2TGTA 3ATLA 3F0OA 3Q3YA 2ZFFH 1OYQA 1GJ6A 3DUXH 2QF0A 4BAQB 4Y0ZE 3MU1A 2LP6A 1SLXB 3SU4A 1VITH 2LIZA 4DIHH 4XBCA 2A32A 1Z1IA 3RXEA 3RXRA 1EAWA 1QJ7B 3ZV9A 1A61H 4X1SU 3F68H 1AB9C 4KTCA 1Y59T 3VXFH 2PP6A 4B2CA 5CHBA 3L3TA 1ETTH 2Z3DA 3KF2A 1GI2A 3H7TA 2PKAA 1FDPA 1EB1H 2XC4A 2ZFTA 2Z9JA 1GVKB 1TGTA 1BT7A 4U30A 2YMSC 2QV1A 3P8NA 1LTOA 1SMFE 2C90B 1AWFH 2BZ6H 1ELTA 2SGEE 2XC0A 2FI3E 4CREA 1J9CH 2J9NA 1A4WH 4AGKA 2C93B 2AGGX 5ESBA 1MKXH 2AIPA 1FY3A 3EA7A 1CHOF 1BTXA 1MTNB 2HWLB 1SGDE 1UK3A 1ZR0A 1S6LA 3M7TA 1MU8B 1MD8A 1AVWA 2O8WA 2Q6DA 5EXNA 1UCYE 4H6SB 2A5KA 3PMHB 4OS5A 3V0XA 2XW9A 2P93A 2VNTA 1D6RA 1MTUA 1IHTH 2ODQA 1GJ9B 4CRFA 3CENA 2ZPRA 1C5YB 2AYWA 3RXDA 4B73A 3A88A 3NK8A 1GHBF 3LT3A 4XDEA 3O8RA 3O8DA 1TPAE 2JETB 3KQCA 1GCTB 3SV8A 3E90B 3V12A 1YPHC 1EOLA 5JDUB 3FO8D 2SGAA 4LZ1H 3BEUA 1YCPH 4IN2A 2A31A 1SG8B 3TPIZ 1C5NH 3UY9A 3SUGA 2BTCE 3VFEA 4B2BA 2YNAA 1TAWA 3DA9B 1QNJA 2HLCA 1BB0B 4DT4A 1UTKA 1PJPA 3N7EA 3A8AA 1IQEA 1FI8A 2C8ZB 1O2YA 2J34A 2R2MB 1DPOA 2ZTZA 3MMGA 5A09A 1XX9A 1COWD 3KNXA 3CS7A 2VGCB 1Z6EA 2VWLA 2WHXA 3BV9B 3H5CB 3SJOA 3ZVBA 1JRSA 2ZFRH 1BCUH 3SU1A 4B1TA 1L2EA 3P8FA 3PWBA 1M9UA 1C5SA 2EI8A 2BM2A 1O3LA 1THPB 1P2MA 1B5GH 2Y81A 5FX5A 4ZMAH 3ZVCA 1AU8A 2QF5A 4D7FA 2EA3A 1IQIA 1J8AA 4F49A 3A84A 2STBE 2OK5A 1UTPA 1HUTH 3T25A 1S81A 4ISHH 1P3EA 1PQAA 1GGDB 4AC9A 1KSNA 1FIZA 1IQHA 1PPEE 4NG9H 1FZZA 1FMGA 2HLDD 5C5OA 1AZZA 1VCPA 2XOKD 2ZGCA 3AK5A 1C2GA 2BVRH 1SGTA 3C27B 3NCLA 3Q3XA 3QDZB 1GBBA 3T27A 2HGTH 4FUFA 1SGPE 3SU2A 4UFDH 3SGQE 2PTNA 3CNRA 4OS6A 1OX1A 2OTVA 2RA3A 2ZU5A 3I78A 4E7NA 1J17T 1GVLA 2SGQE 2PKSB 1A1RA 5EW2H 1P2KA 3E8LA 4BTUB 2BY5X 4YT6H 1J15A 1NT1A 1QJ6B 2B5TB 8KME2 1H8DH 4HI3A 3ZVAA 3B23B 4TYDA 2SNVA 1ZMNA 5E2OA 4YLQH 3HKIB 3BTQE 1KTTB 1C2LA 4WF8A 1SSXA 4CBNA 1SQTA 1K1JA 3R0FA 3UTUH 2HVXA 2FWWA 2Z9IA 4ABIA 4R0IA 5CHAB 4WH8A 1CA8B 5C94A 4GUXA 4X1PU 5EPNA 2A4OA 1SHYA 1C1UH 3BSQA 4NWLA 1C2KA 1OYTH 1O3HA 4Q7ZA 1TNJA 2VB0A 1BTUA 3GDVA 3QK1A 3RDZA 4AFUA 1PPZA 3LOXA 4ABFA 2ALVA 3GISB 4ISNA 4HG6A 1FPHH 5F8XA 1ESBA 1LHCH 1O5EH 5A0CA 1IQLA 3VB6A 3KYFA 1O5CB 2AHME 4YESB 2NU3E 2Y82A 1FAXA 1RTFB 2ZO3H 1NC6A 1Y3UA 4NIXA 2BLWA 1UTNA 2P8OB 1BTHH 2WSSD 2H2ZA 4FU8A 1JIRA 2GX4A 2PUQH 3BTTE 5C0TA 5DN6D 2FODA 2ZGJA 3SGBE 1Q3XA 1RTLA 1NESE 4INKA 4NFEA 1EJMA 2VIWA 2ILNA 2PR3A 2A5AA 2BDIA 1EP5A 3UOUA 5EW1H 2ZHDA 3SUFA 5BRRE 3RXOA 3LC3A 1A7SA 2FLRH 3QZRA 4ZKRU 3WWFA 2CHAC 2PKSC 3M5NA 1YPJH 1YPEH 3OY6U 3SU0A 4M9FA 1CA0C 2ZF0H 1ZYOA 1QA7A 1DDJA 1ZLRA 1O2KA 5HIZA 3SNBA 4YZUA 5IYTA 1UO6A 4Y8ZA 3FOAA 3RMOH 1TNGA 5F53A 1WQSA 1O3KA 4Y11E 5T6GA 2BOKA 2O8MA 2QAAA 3BTKE 4VGCC 5JPMH 4AFQA 1T7CA 3TGKE 1A5IA 3L6PA 3A83A 2P3FH 1VCQA 3FZZA 3UB0A 3BIVH 2OCVB 3ZZBA 1G2LA 4ABJA 1GI9B 2CGAA 2ZTYA 2BYAX 4LZ4B 4K1SA 3LPRA 3SV7A 4NWKA 2R3UA 1EZSC 4I8LA 3ATIA 3SNCA 2A1DB 1NS3A 2G51A 4AOQA 1VITF 1CBWC 3PRDA 1RGQA 4CRGA 1GBTA 1SKYE 4J2YB 3A7YA 1HNEE 4DT7B 1GBFA 1DUAA 3RXSA 3PLPA 1QBNA 5C1XA 4XD7D 2EY4C 3ODDA 1KIGH 2DE8A 5L2YH 2A4RA 1XUHA 5FPSA 2CHAB 3E3TA 3ZZDA 4LXBH 5T6FA 4JZDH 2BLQA 4TPIZ 1AIXH 3TJUA 3MFJA 2AMPA 2HNTC 3K9XB 2EI7A 1DVAH 4TY6A 1ELFA 4DJZB 1K1NA 3U8TH 1BUIA 4YOGA 3TH4H 2KAIB 1WOFA 3OEED 2FO9A 2Q6FA 4M7GA 4MVNA 1OS8A 3A7WA 2LNCA 4NIVA 1JWTA 2FYQA 2ZP0H 3S69A 2GV7A 3LH3A 4I8HA 4X8UH 3SHCH 1Q31A 1EAXA 2RA0A 1O2SA 2R0LA 1GBHA 1ZTLA 1AVGH 2BD7A 3SNEA 1A0LA 1OP0A 5EODA 4X1NU 1GBAA 1L1JA 1O34A 4NCYA 5F03A 4YO9A 2J98B 1HIAA 4A1XA 1OP2A 3MH6A 3O8CA 5FAHA 3DT0H 3GOVB 3Q76A 1GBLA 4I8JA 3VGCC 1MCTA 2OQ5A 2ZCHP 2Z9LA 1P12E 1ZTJA 3ZZ5A 1CBWB 3EA9A 3HK6B 2WINI 3T26A 1QGFA 1HPGA 2Y5GA 3MU4A 1AVXA 4AN7A 1BRCE 4ASHA 1H8ED 4MDSA 3GCHB 6GCHG 3TGIE 5EPYA 2CMYA 2BB4A 4NFFA 2JKHA 1NO9H 5DK1A 5DPAA 4D7GA 4ZH8A 2BXUH 1F7ZA 1EUFA 1W7XH 4PROA 1MBQA 1NM6A 1QQUA 2K1QA 3A8BA 5DP9A 1DXWA 3VPKA 1HBTH 1SGNE 1ZMJA 3SI4H 2L74A 4D9QA 1V2LT 1SGIB 2K8IA 1THSH 1BBRE 5A2MH 3TH2H 1ANCA 1SFQB 1ZJKA 3NXPA 1LVOA 2KCAA 1GJ7B 3AASA 2QF3A 2TPIZ 1QB9A 1Z71A 1C4V2 1W2KH 4KKDA 1YGCH 1ESTA 1RFNA 2AFQB 4RI0A 2PGBB 2HOBA 4JMYA 1W14U 2AS9A 1AD8H 5HM2A 1BMNH 4GPGA 3ZZ3A 4BAHB 2P3UB 4OGXA 2UUYA 2W5EA 2Z6BD 1C5PA 1ANEA 1H9LB 4XOJA 2YNBA 3T2NA 1BRBE 2VH0A 1D3PB 2WPMS 1NTPA 2VIVA 3KQDA 1GI5A 1A3BH 2DUCA 1GJ5H 4OS2A 1O5DH 3FKSD 1ELAA 1W0KD 1UHBA 2AGIX 3VGCB 1BHXF 2BD9A 3PMJA 3U1IB 1O3CA 4RT1A 4F48B 1BRUP 2XBWA 1IQKA 1FN8A 3AW1A 1EPTA 1SQRA 2FOBA 4DIIH 3SW2B 5G4BA 2FLBH 1GBKA 5CMXH 1TNLA 1YPGH 1EATA 1FAKH 1GBCA 2XTTB 1AN1E 4TSFD 1GJDB 1TMTH 2PKAB 1WQVH 3K2UA 1RIWC 2IOTA 4RSPA 1AGJA 2FX4A 2ZU2A 3EA8A 1PPHE 2A7JA 1AUJA 4NZQA 5C0UA 1GHWH 4U01A 1K1LA 1O38A 2QYIA 2BVXH 3M5MA 3A7TA 3UNRA 3EQ0H 1EX3A 2Q6GA 2HNTE 3ZZAA 1BBRH 3RM2H 3F2FA 3F9FA 2ZGHA 1LVYA 2Y7XA 1QURH 5E8EH 5HGGA 5FL7D 3GCNA 1E1QD 1QB6A 1LPGB 1DS2E 5GPIB 1GGDC 3QO6A 4WMDA 1QIXB 4TY7A 1AI8H 1FY5A 5FBIA 3RXIA 4AB9A 1QA0A 3EDXB 1QL8A 2XWBI 2PGQB 1O5BB 1CGHA 1NU7B 5EIYA 3FAOA 4XSKU 3M36A 4YLUA 2UWLA 2VH6A 1C2FA 3AAVA 1BTZA 1PYTD 1INCA 3DSPA 9ESTA 2BX4A 1QRWA 3VB4A 1O2IA 2GP9B 1GI6A 2XCNA 2XBYA 3GDSA 5ESTE 1EJAA 2WV4A 3UWIA 2G52A 1F5KU 4WVPE 3M37A 3GY4A 1O31A 1C1TA 5SGAE 2K0QA 3U8RH 2KX4A 3TNSA 1H8IH 4ISLA 1TBRH 2VWOA 2EI6A 1CVWH 1LHDH 3MU8A 1W0JD 4P00A 1JBUH 3MO3A 2QCYA 2SNWA 1C5MD 2G5VA 3EYDA 4AFZA 2VINA 2OC1A 2FM2A 3P92A 1HAGE 1TMBH 1D4PB 4XRNA 3UAIC 1WU1A 5AFYH 4TWYA 1L1NA 3ZVFA 2KCPA 1C4Y2 1MZDA 2GMTB 3RXBA 2AMDA 5C5NA 1GMDF 1SI5H 1ZPZA 4ZKOU 3VB7A 3DHKH 1W12U 2ZECA 2J2UA 3SOSA 2R2WU 4O97A 2B0FA 3H7OA 1E38B 2BD3A 2CK3D 1EZUC 3W95A 1FQ3A 4BXWA 4IS5A 3LJJA 1HAHH 2ULLA 2QXGA 3TK9A 1E0FD 1T8NA 3ATWA 2K7XA 2B8OH 1P2JA 2OP9A 2ZU1A 5GCHG 1SB1H 1BTWA 4JZFH 1KDQA 3NKKA 3RXGA 1S84A 2V0BA 2W6JD 3DSOA 1RTKA 1HAOH 1GHXH 4ZHLU 1GJ4H 1UTQA 1W13U 5GIBA 1O3MA 2ZEBA 1MBMA 1FN6A 1OWKA 3ATKA 1FV9A 2XNIA 3M61U 1NY22 2PFEA 1KLJH 1PQ8A 1WDIA 3GY3A 1FY8E 3I29A 3U28C 1C5WB 1MTSA 3SNAA 5AHGH 3U1JB 4P02A 4F4OC 1UVSH 2WYJA 3MOCA 2BMGB 1CE5A 1YP9A 2ZDLA 2ZFQH 4ABDA 1SGYE 1GMDG 1TNKA 2VVCA 2UWPA 2HVYB 5EQSA 1V2QT 4NIYA 2NWNA 2G55A 1OWDA 1OWHA 4I31A 3ZVEA 4AB8A 5JB9S 2KZ4A 1CHOG 1DLKB 3Q77A 1A5GH 3Q00A 1P04A 4K1TA 4A7IB 1L0ZA 2OQUA 2XNDD 4CHAC 3K6ZA 1G36A 5EQQA 3GICB 1G9IE 2VWNA 1TNIA 1AKSA 1TIOA 2TIOA 1W11U 3SNDA 2XYAA 2G8TA 3QUMP 2GT7A 2HPQH 1T31A 4FXGH 1T32A 3OTJE 1G3DA 4D8NA 1MQ6A 5EJZA 5TCAA 4Y71A 5T1VA 5GDSH 2ESTE 2P59A 2WYGA 2GJGA 3MH7A 1E34B 5DKMA 1THRH 3RMMH 3RC5A 1GHZA 1C5QA 1TABE 3LH1A 3RU4T 4KP0A 1GMHG 1P2OA 3UNSA 1RS0A 1O3IA 3FZDA 3EE7A 1K0HA 3SZEA 1KTSB 2KCYA 1GBIA 3UIRA 2BDGA 4WMEA 1XM1A 3F0PA 1N1LA 2O8TA 2PSYA 1WV7H 1TGNA 2JETC 3A7VA 1QBVH 1T4UH 1XUGA 2VVUA 2ALPA 1T4VH 3QGJA 4HGCA 1SHHB 1ZGVA 3GCTF 4K5ZA 1DX5M 2H6MA 3M5OA 1SGFG 2VIQA 1CT0E 1FJSA 2SGDE 3STIA 1Z8JB 4DG4A 2SGFE 2CF8H 1Y3XA 1YKTA 4K8BA 1A2CH 1C5OH 1N8OC 4I8KA 2JH0D 1V3XA 4U2WA 1SVPA 1ESAA 4INLA 1TRYA 1P9SA 2ZFPH 1UW7A 3BIUH 3ZIAD 8GCHF 3HGPA 3SHAH 5LPFA 2CN0H 2QN5T 1DANH 3E0PB 4CRAA 3KQBA 3LGWA 2OC7A 3F6UH 1HAXB 4X6PA 3CS0A 1C5ZB 5T3HA 4DVAU 1YWUA 4A6LA 2TGAA 3GYMA 4OS4A 1K21H 3E6PH 1BMAA 2BQWB 3BG8A 1KXFA 5E0GA 1O2QA 2QY0B 5FX6A 5C2ZA 5E0HA 1O30A 2FIRH 1MH0A 4Z6AH 1P11E 1YM0A 1VGCB 1SGRE 2UWOA 2C8XB 1HRTH 3PTBA 1MKXK 3QN7A 4Z0KA 3A87A 1O2UA 4ZKSU 3F1SB 2KR7A 2XC5A 1K28D 2BY8X 4O03A 1IHSH 2ZIQH 1O2MA 1GI1A 2J97A 3F2HA 3TIUA 3TLOA 1AFEH 2ZI2H 3BG4B 4ZXYH 1GCDA 1O2XA 1DLEA 2KM0A 1T8LA 2LELA 5LGOA 5DO4H 1GDQA 1GG6B 1OWIA 1HAIH 3URDA 5AF9H 1VKYA 2OD3B 1MTNC 3NWUA 1KXBA 3MHWU 2BQ6B 1V2JT 2P94A 3FP8E 2FOHA 4ZROA 2AERH 1ACBE 2GKVE 1ABIH 1ZHRA 3NPSA 1P2NA 1XKAC 2BX3A 1E79D 4WY3A 1P02A 3EGKH 5ETXA 1P03A 2UUKB 3PV2A 1GBJA 4WXIA 3STJA 3RXVA 1TFXA 5EGMA 2YOLA 2XRCA 2BY6X 4IW4E 4B76A 3T28A 1HB0B 3RXTA 2V3OH 3MWIU 4CRBA 3LGYA 4UFGH 1AFQB 1J16A 5JBBS 2OINA 1Y3WA 1DSUA 5DP6A 2FOEA 1O37A 1EAUA 1BMLA 2FP7B 2IPHA 1C5UA 4DGJA 1LCYA 1X7AC 3T62A 3IITA 4O3UA 5JB8S 1NZQH 5F8ZA 4UFEH 3JZ1B 4IC6A 3GS9A 1LQDB 2G00A 2GDDA 1XUJA 2XBXA 1D6WA 3UQOA 1GMCF 1A5HA 3MQKC 3BTFE 4WMFA 2ZDNA 1OHHD 1OP8A 3TU7H 3E91A 1E1RD 4HFPB 4AORA 3H09A 3E0NB 1LHGH 4ISOA 4MNWA 3P70B 1V2PT 3R3GB 4FUEA 4ZKNU 4GHQA 1AO5A 1B0EA 2JIZD 2ZDAH 2BD8A 9LPRA 2PWXA 3TITA 3N7DA 1DUEA 1IQMA 2VU8E 3IG6B 2AIQA 3RMLH 1NBME 3RUOA 2GD4B 2ZHQH 5L30H 1V2ST 4CH8B 2WPJS 2ZHFH 4VGCB 2LPRA 4K69A 4GHTA 4I86A 1OSSA 2KFWA 4YOJA 4IN1A 4B71A 1AZ8A 2OXSA 4K3JA 4UONA 4WXVA 1UTLM 3OY5U 3S9AA 1S5SA 1ZZZA 2BHGA 2B7DH 1YPLH 1GDNA 2ZHWH 1BQYA 3SORA 4AG1A 2BDAA 2FDAA 4B2AA 1WSSH 2OBQA 2A2XH 1N6XA 2TGPZ 2ZDMA 3P6ZB 3ZVDA 1TPSA 1ZTKA 2BDHA 3SU3A 2ZCLP 4BXSA 1MD7A 1TA2A 4FUCA 2AMQA 3QLPH 1O3OA 1ZSLA 3HK3B 4Y7BA 1Z8GA 1MMJN 2WPKS 2W26A 1LPZB 1QZ8A 1O2OA 5A0AE 2JH5D 2ODYB 2CF9H 4FUIA 3FP7E 5C1YA 2H9HA 4TWWA 1O39A 5GWZA 2WUCA 1C1OA 1DXPA 2G4UA 4JYVH 1D3QB 1P10A 1BZXE 1YCPK 1SPJA 3M3TA 3O8BA 4IGDA 3ESTA 3SU5A 3B8JA 5JBTA 3DSGA 4YT7H 4FUDA 1EZXC 3P8OA 2WUBA 3PLBA 4X8TH 1HAZB 4I7YH 2OC0A 2BY7X 3PRBA 1TPOA 4WJG2 1O35A 3FVFB 2ZG0H 1LMWB 3WW7A 2VIDA 1HCGA 1GMCG 2F9NA 1KY9A 1SBWA 2VBCA 3PTNA 3A82A 1XUIA 4CH2B 1P05A 1K2I1 2GZ7A 4U32A 4AYVB 2B9LA 3VG8A 4OM9A 1ABJH 1P8VC 1SQOA 5A8XA 2CXVA 2F4LA 5AVDA 1SC8U 3PV4A 2BY9X 1ZPBA 1S85A 3OYPA 4K60A 4Y6DA 1EB2A 8ESTE 3SV9A 3KEEA 1S0QA 4CBOA 3A7ZA 4X8VH 1A3EH 2R0KA 5DJ7A 5LPRA 1B0FA 3EAJA 1TX6A 6LPRA 2W7UA 3SV6A 2BQ7B 4I33A 5ABWA 2IJD1 2ODPA 1RXPA 1P06A 1GJAB 1V2VT 1N8OB 2V35A 4CR9A 1NU9A 5CHAC 3F9HA 2D8WA 4FUHA 4E7RG 2A2QH 2ZZUH 1G2MA 3OSYA 1PQ5A 2A4GA 2IPQX 1P2QA 2RDLA 4NA9H 3HGNA 2UUFB 1MQ5A 3TK6A 5FCKA 1BBRK 1GL0E 1PFXC 3KCGH 1YPHE 1HGTH 1CT4E 4H42U 1F0TA 1BTYA 3PYHA 3ZYEA 5C17A 1EAIA 4ACAA 1SOTA 4XFQA 1AWHB 1UTMA 1LHFH 2AH4X 1SLVB 1S83A 3UPEA 1ZHMA 4ABBA 1AQ7A 1Y5BT 4Y10E 1KDQB 3LJOA 1KLIH 4ESTE 2Z9KA 2PTCE 1L4DA 3TJVA 1V2KT 3GY2A 1ETRH 2GCTB 2WPHS 4YM9A 1O3JA 3M35A 3BF6H 1H9HE 2Y5HA 1P01A 3W94A 1ELGA 1BITA 3E1XB 3F3BA 4NA8A 5E0JA 4ZXXH 4JCNA 3ZYDA 2GVFA 4O9VA 1V2UT 1YPKH 2ZGXH 3D23A 1HV7A 1UMAH 2ZFSA 1UK4A 2WZQA 2DE9A 2AGEX 1TMUH 2H5DA 5H4IB 2PLXA 1AY6H 3KIDU 2BLOA 1TONA 1N6YA 1GJ8B 1MKWH 3Q3KA 2J4IA 1GHAF 5C20A 1TWXB 2H9TH 1FY1A 5A8ZA 4BAMB 1DITH 4OGYA 4Q7YA 3V7TA 1O3DA 1LVMA 3GY7A 1P2IA 1O5GH 3OE7D 4IMQA 1KXCA 1FY4A 1UTOA 2ZU3A 2BD4A 2VGCC 1FPCH 1VZQH
chains in the Genus database with same CATH topology
1NROH 1V2RT 1GVZA 3P17H 3TJOA 2V3HH 1F0RA 1ZRKA 2GTBA 4JZIA 1W8BH 5IDKA 1MKWK 3M7UA 2QIQA 1F0SA 2F91A 4AGJA 4X8SH 3KGPA 1XMNB 1V2NT 3T29A 1PYTC 1BOQA 3S7HB 1PPFE 1G30B 1FXYA 1UCYK 5T6DA 1G32B 3RXFA 1MCVA 2NU4E 1EPTB 4X2VA 1EASA 3BTEE 1O3GA 5A8YA 4A92A 1K1MA 1BRAA 1NFWA 3UFAA 2WPLS 1WUNH 1NFUA 2FOFA 4XBDA 1GL1A 4A5TS 5L2ZH 1JRTA 1UTJA 1QBOA 4ISIH 2ZU4A 1HJAC 1HDTH 3RLYH 2Y80A 4QT8C 2R9PA 1O2NA 4ZAEA 5C1UA 1GG6C 1K9OE 8LPRA 5JBCS 1T8MA 1TRMA 4X0WU 4DY7B 2FOGA 4Y0YE 1O2ZA 3SJIA 5GJ4B 1C1NA 5JYIA 3D62A 1C1WH 2FXRA 1IOEA 3A85A 2G81E 1P09A 1CHGA 1C1MA 1EXFA 1O0DH 3RU4D 1QRXA 1S6HA 1O32A 3RM0H 5PTPA 2FS9A 3N7OA 1TGBA 1UVOA 4UFFH 1DOJA 1O3EA 1WAYB 3QWCH 1QB1A 4JZEH 4RKOB 4FUBA 4MNVA 4CRCA 1AE5A 4IMZA 1DWBH 2HALA 1WCZA 7ESTE 4NZLA 1KXAA 1XKBC 2STAE 3ATMA 2BD5A 2C3SA 1HYLA 1NFXA 4GAWA 3SQEE 4MPWA 2Z3EA 2FYRA 4ZHAA 3BTGE 5J4QA 2A4QA 2F9OA 1W7GH 4RKJB 2P95A 3BTWE 1GDUA 1ELVA 2ZC9H 3M3SA 3RMNH 3GCOA 1O2RA 1A0HB 3MO6A 1H4WA 2O8LA 1ARBA 6ESTA 1TPPA 1E37B 3ZZCA 1C2DA 2RCEA 3A8CA 5FHTA 2W3IA 4OS1A 4LK4A 2VJ1A 3SN8A 2FZZA 2QXJA 1C1QA 3RXKA 3LDXH 2GV6A 1Q2WA 3UQVA 3K6YA 3S7KB 1YF4A 1MTWA 3BEIB 3MI4A 1MUEB 1Y5AT 1RD3B 1C1SA 3L33A 3SBKA 2GCHG 2GGVB 4Q7XA 2M5TA 3ZV8A 3LGTA 1P9UA 2ZA5A 4UD9H 3SI3H 4CRDA 2UUJB 2I6SA 2VIOA 2A7HA 1GI8B 2PW8H 4KTSA 1C2MA 1ZHPA 3SV2H 1BMMH 1LQEA 3MTYA 3EE0B 1L4ZA 3RC4A 1JOUB 4R8TB 2BD2A 4X1RU 5EXMA 4H6TA 2FI5E 2A7CA 2ZCKP 1NFYA 3PMAB 4MNXA 1DWDH 4MTBA 4WH6A 5TJXA 4E06H 5GXPA 4X6OA 1Z7KA 1Y3VA 1XVOA 1MZAA 2TRMA 5I46H 1K1IA 1GI3A 4UE7H 2THFB 4JYTA 1KXEA 3SJKA 4DW2U 1NRNH 1DE7H 1OWEA 4XE4A 3PB1E 1RJXB 1TOMH 4DOQA 2ZGBH 2J94A 2AEIH 3A7XA 5DP3A 4NSYA 4SGBE 2HPPH 7LPRA 1Z8RA 1HAVA 1AB9B 1SFIA 1V2MT 1NRQH 7KMEH 5B6OA 1AKSB 1O5FH 3TJNA 1DT2A 4NSVA 2FI4E 1BJUA 1HAPH 1TOCB 1ORFA 3BG4C 1JMOH 3F9EA 4B74A 1C2EA 4MPVA 1G37A 3KN2A 3UNQA 1T8OA 3F9GA 3MNSA 5FPYA 4Y76A 1BDAA 4DURA 1OXGA 2P16A 1NRPH 1CA0B 4NGAH 1O3PB 2QXIA 1ZGIA 1GI7B 2FESH 4HTCH 1ZJDA 3TGJE 5EG4A 1TNHA 3UR9A 3HKJB 3RXAA 2EC9H 1LPKB 2TBSA 3U9AH 5C3NA 1QTFA 2XCFA 5TCCA 4J1YA 3U98H 1TALA 2NU1E 1IQFA 4Y7AA 2PV9B 2WV5A 5AFZH 4IC5A 1QL7A 1W10U 3BTDE 3SO3A 6CHAB 4KGAA 1O2HA 1C9PA 5E2PA 1YCPM 4FVBA 1GCTC 1HAYB 1P0SH 5A0BA 1C4U2 3NUMA 2J95A 2GDEH 5EQRA 1BA8B 2NU2E 1UVPA 4H4FA 3TK5A 4CR5A 5K7RA 1E35B 1LHEH 1TX7A 3RXPA 3PWCA 1AMHA 1YC0A 2Y7ZA 3RXQA 2GCHF 4TPYA 4AX9H 1C2IA 1K22H 2R3YA 1CO7E 3GY5A 3M5LA 1IQGA 2OLGA 1O3NA 4B75A 4IBLH 1MAYA 1GI4A 1HJ8A 5GCHF 1NN6A 2F9UA 4A1TA 1GHBG 1O2TA 3SUDA 4XBBA 1SGFA 3UWJH 1YYY1 1O2WA 1TE0A 3K65B 1O3AA 2OBOA 2Z9GA 1FNIA 4BAOB 2FOCA 2ZQ1A 2GMTC 3FP6E 2Y6TA 3NZIA 1BIOA 2C4FH 1GHAG 3LGVA 1O3FA 2JH6D 3AW0A 4I32A 1IAUA 3TNTA 1P57B 1TQ7B 1P3CA 3VXEH 5BPEA 4D76A 1K1OA 1ZSKA 3MNCA 3TH3H 3UREA 1EPTC 1Y3YA 1JXPA 4BNRA 1PPGE 5HM9A 5K0HA 4X6NA 3SQHE 4Q2KA 2BLVA 1NPMA 2W3KA 1XVMA 1YLDA 2SFAA 1LO6A 4BOHA 3MU0A 1ZMLA 1ELEE 3SZNA 1D3DB 2ZWLH 3SJ9A 2OC8A 1ANBA 2QA9E 1KLTA 3KQEA 3E16B 3KL6A 4Y8YA 1GMHF 5DGJA 1FUJA 1O2JA 1AFQC 3U8OH 7GCHF 2WPIS 1CGJE 1EQ9A 2O9QA 4FUJA 2QGRA 1C2JA 1TBZH 3C1KA 4UDWH 3GYLB 1NRSH 2A0QB 2ANYA 1V2WT 3OU0A 1CU1A 4Y8XA 4KTUA 2FMJA 5DP7A 1C1RA 1U6QA 1BTPA 5JBAS 4ABEA 3JZ2B 2G4TA 1J14A 3GCHC 1B7XB 3V13A 3B9FH 1Y5UT 3VB5A 2RG3A 1H9IE 1LVBA 4CHAB 1JIMA 2Y5FA 4AFSA 1O2LA 3BEFB 1CT2E 5LH8A 5LPEA 3A8DA 4GCHF 3ENSB 4K2YA 1E36B 2ANMH 3LC5A 3ZZ9A 1HIAB 1GWAA 1SLWB 2ZPSA 3WY8A 2PSXA 3ZZ8A 4ABHA 1XXFA 2BDBA 2ZKSA 3KHVA 1FIWA 1Z1JA 2Z3CA 4MPXA 1BJVA 1LDTT 1SR5C 3PMBB 2ZPQA 2C8YB 1FLEE 1SOZA 1G3CA 1GI0A 1XXDA 4ABAA 1SQAA 3DD2H 1C5TA 3QTOH 3ZZ6A 4MLFB 1WTGH 5HXFA 1GBEA 1O2PA 2BDCA 1HJAB 1O2GH 2CJIA 5DP5A 4LOYH 1DY8A 1DY9A 1Y8TA 4MPUA 3HATH 3PLKA 1QR3E 5FBEA 2ZNKH 3QZQA 2HNTF 5J4SA 2BXTH 2F3CE 3GDUA 1HLTH 1UK2A 1G3EA 3LONA 1TX8A 2KAIA 4AG2A 4X6MA 3A86A 4MNYA 1F0UA 5L6NH 5EXLA 4GCHG 3IWMA 1C5VA 3GY6A 1DWCH 1PQ7A 4E05H 1O36A 3G01A 2BOHB 3MNXA 2PUXB 2C8WB 1OKXA 3D49H 3OX7U 3P95A 3UUZA 1QL9A 4HZHA 1QRZA 1V2OT 1CGIE 4JK6A 4X2YA 1D3TB 1TA6A 2D26C 3LIWA 4FU7A 1LKAA 1TQ0B 4KELA 4BANB 1C1VH 1BHXB 2HRVA 4Y79A 2ZHEH 3PROA 4WWYA 3CP7A 3I77A 1MU6B 3FFGA 2O8UA 4GSOA 1TGCA 1EP6A 1DICA 3A80A 1DFPA 1SLUB 3U69H 1Z8IB 1ZRBA 4A1VA 3V3MA 4K8YA 1XUKA 3MYWA 3PO1C 2Z7FE 3MO9A 5FCRA 6GCHF 3A81A 1VGCC 5EU8A 1VR1H 1C1PA 3UR6A 4BTIB 2V6NA 3RXMA 1WYKA 4GVUA 1NRRH 5DP8A 2TGDA 1QQ4A 1ARCA 3AAUA 3RXLA 2ZDVH 2FTLE 1FONA 3MH4A 2J92A 3MH5A 4AYYB 1ELCA 2ANKH 1F5LA 3M3VA 2OUAA 3M7QA 1UHBB 3LGUA 1DWEH 1F5RA 4BTTB 4FVDA 1PPBH 1ANDA 1GBMA 1RRKA 3LKWA 3VEQB 2P3TB 1OWJA 3D65E 4I8GA 1IQNA 3ODFA 3EBNA 2XXLA 3SGAE 2GZ9A 1S0RA 6CHAC 5F6MA 3DFJA 1UJ1A 1F92A 4X2XA 2ASUB 3RLWH 2CV3A 1HXFH 3QX5H 4MQAA 5FPTA 1AE8H 1S6FA 2F9PA 3ZZ4A 1CQQA 3ZVGA 1C5XB 1TYNA 4JYUH 2IN2A 2F9VA 3MU5A 4AZ2B 1A0JA 2A5IA 1GHVH 3T5FH 1O2VA 1AUTC 1UVUH 1UVTH 3HPTB 1A46H 3GCTG 3DFLA 8GCHG 1C2HA 4NA7A 1C5LH 1EOJA 2G5NA 3FANA 3PM3A 3LGIA 1KXDA 2QXHA 1HXEH 1MTVA 1OPHB 1ELBA 1RIWB 3SU6A 4X2WA 3RXUA 3SJ8A 1C5RA 2D1JA 2F83A 3MNBA 3QTVH 5I25A 1SGCA 3S0NA 2VWMA 4ZHMU 2XWAA 1AHTH 1WTHD 1HJ9A 1VJAU 2IJOB 4X1QU 1EJNA 2QC2A 3TVJB 1PPCE 2W7SA 3ITIA 1CSOE 2EEKA 1YPMH 3RU4E 1IQJA 1QHRB 4INHA 1YLCA 3ELAH 1ETSH 1GJBB 3GY8A 2VVVA 4ZUHA 2PHBA 1TLDA 1UCYH 3S9CA 2FPZA 1HFDA 4D9RA 2H1UA 1SGEE 1EKBB 2A45B 2ZQ2A 4SGAE 4UEHH 2FX6A 2SGPE 3LU9B 4FUGA 7GCHG 2FEQH 3RC6A 1ID5H 4MG3A 2ANWA 2D2DA 2FS8A 3RXHA 4YOIA 2FTMA 1QY6A 1Z6JH 2GT8A 1MAXA 1EZQA 1TBQH 1W0YH 1V2TT 3RXCA 1F2SE 1VJ9U 1GHYH 1O33A 2FOMB 5HMAA 1SL3A 4BAKB 4OS7A 3P8GA 2BVSH 2P8OC 4RN6A 5HYOA 1O3BA 2FOAA 4NIWA 1QJ1B 3AVZA 1C9TA 1O5AB 1XUFA 3URCA 1QCPA 3PO1B 4THNH 5DG6A 1TRNA 1D9IA 4FU9A 1DM4B 1GBDA 3BTHE 1HAVB 2H5CA 2I6QA 1GPZA 1OOKB 1TB6H 5EOKA 4JZ1A 2Z94A 4ABGA 4DCDA 3RXJA 1QFKH 1GJCB 2BZAA 3SUEA 1S82A 4YTAA 1H1BA 2NU0E 4JK5A 1KYNA 2J38A 2ZTXA 1K1PA 1LKBA 2Q1JA 4O3TA 1L1GA 1W3CA 3ZZ7A 1ZSJA 3RP2A 3UOPA 1SGQE 4K1EA 3BTME 3QGNB 4GLYA 1ZPCA 1V6DA 5F8TA 1DSTA 2GCTC 1YBWA 1G3BA 2BDYA 1WBGB 4Q80A 3VB3A 1ELDE 5FXLA 1ZOMA 2VIPA 5C67A 3A89A 2F9BH 1TGSZ 1VCWA 1VITG 2XBVA 2ZDKA 2H9EH 2GZ8A 1W0ZU 3BN9A 3S9BA 5DP4A 2TGTA 3ATLA 3Q3YA 2ZFFH 1OYQA 1GJ6A 3DUXH 2QF0A 4BAQB 4Y0ZE 3MU1A 3SU4A 1SLXB 1VITH 2LIZA 4DIHH 4XBCA 2A32A 1Z1IA 3RXEA 3RXRA 1EAWA 1QJ7B 3ZV9A 1A61H 4X1SU 3F68H 1AB9C 4KTCA 1Y59T 3VXFH 4B2CA 3L3TA 1ETTH 2Z3DA 3KF2A 1GI2A 3H7TA 2PKAA 1FDPA 1EB1H 2XC4A 2ZFTA 2Z9JA 1GVKB 1TGTA 1BT7A 4U30A 2QV1A 3P8NA 1LTOA 1SMFE 2C90B 1AWFH 2BZ6H 1ELTA 2SGEE 2XC0A 2FI3E 4CREA 1J9CH 2J9NA 1A4WH 4AGKA 2C93B 2AGGX 5ESBA 1MKXH 2AIPA 1FY3A 3EA7A 1CHOF 1BTXA 1MTNB 2HWLB 1SGDE 1UK3A 1ZR0A 3M7TA 1MU8B 1MD8A 1AVWA 2O8WA 2Q6DA 5EXNA 1UCYE 4H6SB 2A5KA 3PMHB 4OS5A 3V0XA 2XW9A 2P93A 2VNTA 1D6RA 1MTUA 1IHTH 2ODQA 1GJ9B 4CRFA 3CENA 2ZPRA 1C5YB 2AYWA 3RXDA 4B73A 3A88A 3NK8A 1GHBF 3LT3A 4XDEA 3O8RA 3O8DA 1TPAE 2JETB 3KQCA 1GCTB 3SV8A 3E90B 3V12A 1YPHC 1EOLA 5JDUB 2SGAA 4LZ1H 3BEUA 1YCPH 4IN2A 2A31A 1SG8B 3TPIZ 1C5NH 3UY9A 3SUGA 2BTCE 3VFEA 4B2BA 2YNAA 1TAWA 3DA9B 1QNJA 2HLCA 1BB0B 5CE1A 1UTKA 1PJPA 3A8AA 1IQEA 1FI8A 2C8ZB 1O2YA 2J34A 2R2MB 1DPOA 2ZTZA 3MMGA 5A09A 1XX9A 3KNXA 3CS7A 2VGCB 1Z6EA 2VWLA 3BV9B 3H5CB 3SJOA 3ZVBA 1JRSA 2ZFRH 1BCUH 3SU1A 4B1TA 1L2EA 3P8FA 3PWBA 1M9UA 1C5SA 2EI8A 2BM2A 1O3LA 1THPB 1P2MA 1B5GH 2Y81A 5FX5A 4ZMAH 3ZVCA 1AU8A 4D7FA 2EA3A 1IQIA 1J8AA 4F49A 3A84A 2STBE 1UTPA 1HUTH 3T25A 1S81A 4ISHH 1P3EA 1PQAA 1GGDB 1KSNA 1FIZA 1IQHA 1PPEE 4NG9H 1FZZA 1FMGA 5C5OA 1AZZA 1VCPA 2ZGCA 1C2GA 2BVRH 1SGTA 3C27B 3NCLA 3Q3XA 3QDZB 1GBBA 3T27A 2HGTH 4FUFA 1SGPE 3SU2A 4UFDH 3SGQE 2PTNA 4OS6A 1OX1A 2OTVA 2RA3A 2ZU5A 3I78A 4E7NA 1J17T 1GVLA 2SGQE 2PKSB 1A1RA 5EW2H 1P2KA 3E8LA 4BTUB 2BY5X 4YT6H 1J15A 1NT1A 1QJ6B 2B5TB 8KME2 1H8DH 4HI3A 3ZVAA 3B23B 4TYDA 2SNVA 1ZMNA 5E2OA 4YLQH 3HKIB 3BTQE 1KTTB 1C2LA 4WF8A 1SSXA 4CBNA 1SQTA 1K1JA 3R0FA 3UTUH 2HVXA 2FWWA 2Z9IA 4ABIA 4R0IA 5CHAB 4WH8A 1CA8B 4GUXA 4X1PU 5EPNA