2Z9JA

Complex structure of sars-cov 3c-like protease with epdtc
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
302
structure length
302
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 80
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9jA02
3S0NA 3SHCH 3LGIA 2C3SA 3SU3A 1CSOE 1THRH 1TNIA 1CT4E 4B73A 2BLOA 1O3CA 1FPCH 2A32A 1ID5H 1EPTA 1EAWA 3PM3A 4ABJA 2AGGX 3B9FH 3M61U 1DWDH 4DIIH 4I8KA 1KIGH 1QQ4A 2PKSC 2D26C 1HJ8A 1XVMA 2PHBA 2EI7A 4ISOA 2JETC 3B8JA 1F7ZA 2ZZUH 1MCTA 1DXPA 4INKA 4I32A 3SU1A 2NU2E 2ODYB 1C5VA 2Y80A 1T8MA 4HGCA 1NESE 4K2YA 2ZU2A 1ACBE 5HYOA 1SGTA 2P16A 1QFKH 1ZMJA 2GZ9A 1FI8A 3FP6E 3SGBE 1SGIB 2ZDLA 3QTVH 1G32B 1AZZA 1C4V2 1E34B 2AIPA 3U1JB 2GV6A 1P2MA 3SN8A 1YPEH 1S81A 1TRMA 2HPQH 3RU4T 4R0IA 3RM0H 2ZGXH 3RXPA 1DLEA 2UUFB 2HRVA 3SW2B 1KSNA 4JZEH 1G9IE 3SU5A 1S6HA 3EDXB 1ARBA 4D9QA 2XCNA 1P02A 1EOJA 1TAWA 1CGJE 3GDVA 1ELTA 4JZDH 1H9LB 3MH6A 1M9UA 1ZGIA 2NU0E 4AORA 1ANDA 2FOMB 1C1UH 1PPZA 3UR6A 4A7IB 5GXPA 1SB1H 3AAUA 1YPGH 3C27B 3U98H 4MG3A 3UR9A 1BUIA 3URCA 4K1SA 1JWTA 1TNJA 3T28A 3O8CA 1F5RA 2Y7XA 1HAPH 2ZHFH 3KF2A 3HKIB 4MPUA 3MYWA 5C1XA 2D8WA 2SGDE 2W7UA 2F9BH 2GKVE 2BX4A 3RXVA 1V3XA 1EP5A 5EXLA 2QC2A 1AVXA 1SOZA 3TJUA 2VWNA 1TQ0B 2ZU4A 1Y3UA 3LKWA 1CT2E 1H1BA 1FY1A 3A7WA 4VGCB 1KXCA 2OINA 1UK3A 1LVMA 1C1TA 1C2HA 1C2LA 2Z6BD 3P8FA 4BTTB 2CMYA 2GCHG 1SGYE 3SV7A 1UTMA 4X8VH 4ZHAA 2OC0A 1AKSA 1ABJH 1SFQB 1ZTKA 4NCYA 1FN6A 5DPAA 1W0YH 2J9NA 3CS0A 3ESTA 1FY8E 1IQNA 1ZYOA 2ZECA 3SBKA 1NRRH 2PV9B 4GHQA 1O2KA 5L30H 1GVZA 1NPMA 2PFEA 1FZZA 2QAAA 3ATLA 4RKOB 1MZDA 1OS8A 4TPYA 3RXAA 4THNH 1GI9B 3Q00A 3RLYH 3BTWE 1C5OH 1G3EA 4ZMAH 3K6YA 2ZF0H 3QZRA 4BXSA 3RXRA 5JB8S 1K1PA 1CGHA 1AE5A 3RUOA 6GCHG 1MD8A 1GG6B 2JH5D 1J15A 7KMEH 1P8VC 3MFJA 2QA9E 2CF9H 2UUJB 4JYVH 3UPEA 1G30B 1VCWA 1ELEE 1O3MA 3ATIA 5E2PA 2G8TA 2BDYA 4INHA 3V0XA 4ISNA 2Z9GA 1IQKA 2SNVA 4O9VA 3ZYEA 2ZU5A 4YLUA 1VGCC 1EATA 2K1QA 2JH6D 1OWJA 1V2OT 4DJZB 2ZQ1A 3TJVA 2VH0A 5J4QA 1DSTA 4NIXA 2HVXA 4JMYA 3NWUA 2ZHWH 1EX3A 3DFLA 2SGFE 5A0BA 1TIOA 2ZQ2A 1O5CB 1MTNB 1G3BA 2HWLB 4YTAA 1WQSA 4FUDA 2P93A 1PQAA 2BD2A 2WPMS 3BSQA 4GLYA 2QGRA 1H9HE 1TMBH 1O2PA 1FN8A 5FCKA 3VB5A 2XBWA 1QGFA 4ZAEA 1OP8A 3LC3A 1D3PB 3RXJA 2FI3E 1DX5M 2OC1A 1HAZB 2P3TB 3H7TA 1NRNH 3M35A 3T27A 3UQVA 1O5DH 1Y8TA 1YP9A 1SLXB 3FZZA 4BOHA 2RCEA 3OY5U 1XUHA 2HOBA 1O3OA 1BRCE 2P95A 3RXSA 4GVUA 1DT2A 4OS6A 2F83A 2SNWA 4IS5A 3BIUH 2SGEE 2FMJA 2QF0A 3SUFA 3LDXH 2WINI 1ETSH 2OCVB 1OYQA 4YLQH 1SHYA 1TMTH 5DJ7A 3UWIA 2ALVA 2BY7X 1ZR0A 2CXVA 2GMTB 1A2CH 2ZC9H 1EAUA 1SPJA 1FAKH 2BQWB 1CA8B 2OXSA 1AB9B 4B71A 2EI8A 4DVAU 3A87A 1IQGA 3GCHB 1O3JA 1QA0A 1KDQB 1AUJA 1QRWA 1P01A 1BITA 2ZDKA 1HAVA 8GCHG 2A2XH 2O8MA 1J16A 2FTLE 3SI3H 1OWDA 2A1DB 2UUYA 3ZZBA 2PWXA 4ZROA 3TLOA 1TABE 2W26A 4UEHH 1ZPBA 3E8LA 1TA6A 5JB9S 1IQJA 1HJAB 3BTME 2IJOB 2Z7FE 3KCGH 1O2YA 2VIOA 4HZHA 1AFQB 3PO1C 5E0GA 2VB0A 4XBCA 2C8YB 2Z3EA 1GPZA 2PTNA 2ZO3H 5DP5A 1O2TA 4WJG2 3M3VA 2FM2A 1LPKB 4X1QU 2GT7A 3Q76A 4IW4E 1GJ8B 1O36A 2TGAA 3V13A 1SQAA 2DE8A 4WXIA 5FPYA 1BDAA 1D3QB 1QR3E 2Y5GA 1K1JA 2FO9A 4IMZA 3EA7A 2C8XB 2LNCA 2O8WA 1ZJDA 1CGIE 2PUXB 1C1NA 2VNTA 3TK5A 2BDBA 3RXIA 1BHXB 1C5UA 7GCHG 1O31A 2A7JA 3BG8A 2BD8A 1HDTH 1N8OC 1MTSA 2AEIH 2BTCE 1ELCA 1BTHH 1C1WH 5LPFA 1F5LA 3ELAH 3A86A 2XWBI 5C3NA 4CH8B 4K1TA 3LGTA 1XUKA 1O2UA 1ZTJA 2Y7ZA 2O8UA 4PROA 3W95A 1QJ6B 1BT7A 2ANYA 5AFYH 3M36A 3T26A 1Y3WA 3M7UA 1K1IA 2QY0B 1BZXE 1MAYA 4BXWA 3A83A 3BG4C 2BDIA 3SV9A 3K6ZA 4AYVB 1C5SA 1KXEA 4FVBA 2AMQA 2STBE 1ZOMA 1UTLM 3MOCA 3UUZA 1LVOA 3A84A 1HAOH 2J92A 2P3FH 4X8UH 4IGDA 3SJOA 1S85A 2ZDVH 4DGJA 4AB8A 3GCTF 1YPLH 2GZ7A 4B2AA 2ZCHP 3Q3YA 4RKJB 3ZVGA 3MU0A 3OTJE 1ZRKA 3M37A 4I8LA 5FAHA 2RDLA 1WU1A 4CHAB 1CHOF 5A8ZA 3SO3A 2QCYA 2WUBA 3RU4D 3WY8A 2FOBA 1H9IE 1HRTH 4BAKB 5T6DA 1QHRB 1OWKA 1VITH 2CN0H 2XNIA 4Q2KA 2WPIS 3A7VA 3RXQA 2FYQA 1OWEA 2ODPA 3F68H 1RTLA 3LJJA 1B0EA 4X6NA 1VITF 1DXWA 2P8OC 1TQ7B 1GBAA 3PWCA 1P2OA 4AFQA 1O37A 3A8AA 1DWBH 3STJA 3S69A 2FLBH 3FP8E 4IMQA 3ITIA 3E1XB 3H7OA 3MNCA 4D8NA 4DOQA 5LPEA 1UCYE 1TX8A 4AG1A 1IAUA 2C4FH 4AFUA 4GCHF 5B6OA 1GVKB 1C5MD 4B1TA 3DA9B 3A7YA 1GMCG 5EODA 5HXFA 1GJ4H 1V2WT 2WUCA 2DE9A 3VB3A 2VINA 1O3FA 4NIWA 3GY6A 2Z94A 1GBFA 1LQDB 4NIVA 1GMDG 1QB9A 5EOKA 3RC5A 1GJ6A 3SJIA 1FIWA 1YCPK 4Y79A 1TBQH 2NU4E 1T8NA 1RRKA 2UWLA 3A8CA 3HATH 1MKXH 1RTKA 6LPRA 1MCVA 1C5YB 4ZH8A 1FLEE 5FPTA 3N7OA 4X8SH 1BTWA 1BJVA 3ZVCA 2ZPRA 3SJ8A 2PSXA 4D7GA 1O5FH 1GGDC 1P0SH 3SHAH 4O97A 1C4U2 3RXTA 1ARCA 1Y59T 3SJ9A 1S82A 1UHBA 3R3GB 3RMMH 3SV6A 3QWCH 1NM6A 4I8HA 4WMDA 1RIWC 1FJSA 5EPYA 1INCA 1EPTB 1VJAU 1ELAA 1HYLA 4FUHA 2BDGA 4TY7A 1S83A 1YF4A 2A4QA 2QXGA 3LGWA 1QNJA 5L2ZH 3R0FA 4UFEH 1HB0B 1SBWA 1BMNH 1EZXC 1UVSH 1MAXA 3PLBA 4INLA 1CA0B 3KQDA 4WF8A 3TJNA 2OUAA 4BNRA 1KXDA 3GY3A 5ABWA 1BRAA 4Z6AH 1GI7B 1SHHB 1A0HB 3VGCB 2SGPE 1A0JA 2ZHQH 4XFQA 1ZPZA 1O2JA 2CGAA 2J4IA 2J95A 3A8BA 3QK1A 1BBRK 4WWYA 2ZGBH 1PPCE 3E0NB 2WPKS 2ZU3A 1GBIA 1ZJKA 3RLWH 3SNCA 1O2XA 1GHBG 1QA7A 1JRSA 1A0LA 1GL0E 2PTCE 1EKBB 2PKSB 1MKWK 1DY8A 3RDZA 2QF3A 2JETB 1DS2E 5BRRE 1QB6A 2JKHA 4Y76A 3OU0A 1W7XH 1GHAF 2BY5X 1TNLA 1Q2WA 3KN2A 3PB1E 1O2NA 1PJPA 1D6RA 1FONA 1YM0A 2Y81A 1T32A 4Y7BA 2LIZA 3A85A 1GI6A 2WPHS 1UO6A 1TE0A 1GCTC 1BTZA 2Y5FA 2VIQA 3GY7A 4FUBA 1IQFA 1H8IH 2QYIA 3LPRA 1BMMH 4HTCH 5EGMA 1TGTA 4FXGH 3E6PH 3A82A 1GMHF 1YYY1 3GYMA 3NK8A 8KME2 5IYTA 3VEQB 2QXIA 3MU4A 2BLVA 1TFXA 2EI6A 3O8RA 4YOIA 3MH5A 2FWWA 1O2SA 4B74A 3LGUA 4X2YA 1AKSB 3UIRA 1CBWC 1JOUB 1O3EA 2FIRH 1LMWB 1UTQA 3M3TA 4R8TB 3SGQE 6CHAC 2ANWA 3D65E 4IBLH 1L4DA 1GDQA 5FBIA 1CO7E 2AIQA 2WV4A 1SVPA 1BHXF 4LZ4B 1OWIA 5TCAA 5AFZH 1AMHA 4WH6A 4K60A 1LHEH 1W12U 2TGPZ 5ETXA 3SQEE 3OYPA 1OXGA 1UTOA 3T2NA 1SFIA 3GICB 2ODQA 2BY6X 3OSYA 4DURA 2ZG0H 1QBVH 1LHCH 1PPBH 1C9PA 1MU8B 4CBNA 1QL9A 3U9AH 5L6NH 3K2UA 4H4FA 1PPFE 1WTGH 1ELDE 2R0KA 5FCRA 1LDTT 1O2WA 1OSSA 1D6WA 2BMGB 4CRGA 3VPKA 1AN1E 2QXHA 5DG6A 1RJXB 4OS1A 1Y5UT 2BVRH 2AMPA 1YPKH 3MU5A 1VR1H 2FOHA 1L2EA 1S0QA 1OP2A 3UOUA 3A7TA 2OBQA 4UDWH 3KIDU 1ANEA 2ILNA 1ELBA 1WAYB 4Y6DA 4ZXXH 2KAIA 2FX6A 1GI1A 2A7HA 5CE1A 1PPEE 3P92A 3ZVAA 5JBCS 2BD7A 4X1SU 1AE8H 1J17T 2RA0A 4XBDA 3SOSA 1EJAA 4IC5A 1GI5A 4X0WU 2P3UB 3NCLA 2A5KA 4XOJA 2RG3A 3FP7E 2W3IA 1DICA 3M5OA 4K8YA 1ESAA 3GCTG 2BD4A 2VGCC 1O34A 2YOLA 2B0FA 1JBUH 5A8XA 1XM1A 2IN2A 5LGOA 4ABDA 4NWKA 3BTTE 5C20A 1TMUH 4TWYA 3FFGA 1PQ7A 1AFEH 1FY3A 1NRSH 2ZCKP 3O8DA 3UREA 1KLTA 1C1MA 1G36A 4FU8A 1FAXA 5IDKA 4YOJA 3ZYDA 4Z0KA 1Z7KA 4J2YB 3SJKA 1GBLA 1HJ9A 2PR3A 1GCDA 1ZSLA 5FX6A 2P94A 3VXEH 4XBBA 1VGCB 1ZLRA 4OGYA 3NZIA 4MNYA 2FOGA 1NN6A 1HV7A 1L1JA 4OS5A 1TRYA 1F5KU 1GJBB 5JDUB 3E90B 3UWJH 3GDUA 3ZZAA 2ZPQA 2WPLS 2ZFQH 2ZHEH 1A46H 1P57B 4UFFH 1C1RA 3TNSA 1C2GA 1QBOA 4LZ1H 1ESBA 1TONA 2GT8A 1UK2A 2ASUB 1O2LA 1D3TB 1Y3XA 3SUEA 5A09A 1YGCH 1HAVB 3FVFB 4MTBA 1MMJN 1O3LA 1SL3A 5DP9A 1ELGA 1T7CA 3V12A 3LU9B 1TGNA 4NGAH 1CQQA 1NFUA 1KLIH 1VJ9U 1RS0A 1HBTH 2ZKSA 2BD9A 2VVCA 4MLFB 2I6QA 3E0PB 1SGPE 4YESB 2V3OH 4VGCC 1A5HA 1C1SA 5DGJA 1X7AC 2QIQA 3URDA 3TGJE 2Z9KA 2V0BA 2WV5A 2ZFFH 4FU7A 5DP3A 2A5AA 2BD5A 9ESTA 1V2NT 1JRTA 4NIYA 3PMBB 2J2UA 3K65B 1BTUA 2FTMA 1P05A 3LJOA 4ABEA 3P17H 5T3HA 4YT6H 1NFWA 5LPRA 1DPOA 5DO4H 3RXDA 5C67A 4Q7XA 1EXFA 1C2JA 1AZ8A 3UNQA 4ABGA 1NU9A 2R0LA 2G51A 3ZZCA 1TX6A 3BTDE 3UNSA 1UCYK 4AG2A 1HLTH 5ESTE 3P8OA 4A6LA 3TGIE 4NFEA 4MQAA 5FX5A 2FDAA 1LHDH 2ZTZA 1UTKA 3F9HA 1GBBA 1GG6C 5PTPA 1QJ1B 3QUMP 1YC0A 2HNTF 4YO9A 2XWAA 4MPVA 1GDUA 5EW1H 2A31A 4UFGH 3A80A 4IN1A 3TU7H 5GDSH 3S9CA 2VWOA 2VWLA 1JIMA 1YPMH 1L1NA 3IG6B 3E3TA 1GI2A 7LPRA 4LXBH 1UVPA 3S9AA 1Y5AT 1SOTA 2ANMH 1BRUP 2Z9JA 3GY5A 4H6TA 1UMAH 3S7KB 5A0CA 2FLRH 2D2DA 4O03A 1DUAA 1IOEA 4RSPA 1THPB 3GCOA 1O5AB 1NY22 1GI8B 1IQIA 1IQHA 1O2GH 1YLDA 1DLKB 3U8RH 3U8TH 1V2UT 4NSYA 2VIDA 1A1RA 1C5TA 1TOMH 1G3DA 3GISB 4Y8XA 2Q6DA 2FESH 1ELFA 3F6UH 4X6MA 1GJ9B 1WUNH 4OS2A 3RXMA 4ABBA 2XW9A 1P3CA 3EE0B 1LKBA 2W3KA 4FUIA 1ESTA 1MU6B 1EJNA 2FS9A 3SU2A 2C8WB 4X6OA 1QB1A 1F2SE 4YT7H 3AASA 3P70B 4JK6A 1S5SA 3BTFE 1V2PT 3KGPA 3CS7A 1ZHPA 3UFAA 4GAWA 2FOAA 4ABIA 3PWBA 1PYTC 1T4UH 4SGBE 3ZVDA 4ZUHA 2LPRA 3BN9A 4Y7AA 1IQMA 5AHGH 5C2ZA 3AVZA 3ENSB 3PYHA 4AOQA 4E05H 1BB0B 2H5CA 4MPXA 1EUFA 2XC0A 4JZ1A 1FMGA 1TBZH 3ZV9A 2UWPA 3GCHC 1AQ7A 1LKAA 1TWXB 3VB4A 2Y82A 1FPHH 1HFDA 3OX7U 1OP0A 1LPZB 5EQSA 8LPRA 2Z9LA 4JK5A 3RXEA 1IHSH 1E38B 2GV7A 1T4VH 1SLWB 4DT7B 1SGFG 3UQOA 1UVTH 2G52A 3F1SB 2BQ7B 4AFZA 3LT3A 3TVJB 5DP4A 2AERH 1GBCA 2FX4A 1UHBB 1XUGA 1WTHD 2CHAC 4NWLA 1QTFA 3SUGA 5C1YA 2AH4X 1KXBA 2QV1A 1D4PB 1IHTH 4AYYB 1SMFE 2BLWA 4O3UA 1XKAC 5A0AE 3CENA 3CP7A 2XTTB 4NA8A 1O35A 4I33A 4J1YA 3RC6A 2GCTC 1D3DB 2PGBB 7ESTE 3ODFA 4ZKNU 1YPHE 2AFQB 2B8OH 4ESTE 2AS9A 3RMOH 3HGNA 1RFNA 3RXBA 2CJIA 3M5NA 1PPHE 2BD3A 2BHGA 3M5MA 3SNAA 1D9IA 1TYNA 1EB1H 1FUJA 4I8JA 1ELVA 1ETRH 1O2IA 4MVNA 1SGDE 4UD9H 4ASHA 3BTQE 3ZZDA 1AI8H 1J9CH 1YCPH 1S0RA 1S84A 3H5CB 1BRBE 1KY9A 1S6FA 1V2MT 5FHTA 2HGTH 4IN2A 1P2QA 1C5QA 1V2TT 2ZWLH 1U6QA 4MPWA 1PYTD 3FANA 3NKKA 1W11U 1RIWB 1AY6H 1O3KA 1O39A 3GDSA 3MU8A 5F6MA 1SGFA 1WYKA 2WYGA 3DUXH 1O3DA 1SR5C 4NZLA 6GCHF 5E2OA 3EQ0H 4KELA 1ZMLA 4U32A 3SV8A 4H6SB 1K1OA 1P12E 1ABIH 3F9GA 4ZKRU 1E35B 2VIPA 4ABAA 1NRPH 2FODA 3M3SA 3DT0H 3JZ1B 4A1VA 1P9UA 1J14A 1C1PA 4A1XA 2XBYA 1O3BA 2YNBA 1GBTA 1ETTH 4F49A 4AZ2B 3ZZ7A 1G2LA 3QDZB 5CHAB 2GP9B 4YM9A 1UTJA 3PTNA 2BZ6H 1F0RA 2HNTE 3ZVBA 1DDJA 1O5BB 1DFPA 4D7FA 4GSOA 2THFB 3BEIB 1P09A 2HLCA 5EPNA 2C90B 1K21H 1V2ST 2FYRA 2ZFRH 5EQQA 4AFSA 4B2BA 3LC5A 1P04A 2R3YA 1G3CA 4O3TA 2PKAA 3IITA 2ZP0H 2EA3A 2FZZA 2OBOA 1BA8B 4ISIH 4X1PU 5BPEA 1QURH 3MNBA 1LPGB 3FAOA 2W5EA 2HPPH 3T25A 3ZVEA 1BBRH 4X8TH 1YPHC 4DW2U 4LK4A 3NXPA 4ZHLU 2BVSH 2HALA 2ZU1A 3STIA 2GGVB 5EXNA 1GJDB 2ZI2H 5JBTA 3ZZ6A 3TGKE 5AVDA 1NRQH 4A5TS 1FIZA 1EB2A 3SQHE 1ZPCA 1LHFH 4K5ZA 4CH2B 3QN7A 1TPPA 4XDEA 3BTHE 3I29A 1OKXA 4Y10E 2R3UA 3PLKA 3ODDA 3RM2H 2TGDA 1LVBA 3GY4A 1Z6JH 4UE7H 2FI5E 1G2MA 1TRNA 1MUEB 3VB6A 1TPSA 1TALA 1K2I1 1P2KA 1Z1JA 2ZA5A 3MU1A 4Y8ZA 1SC8U 2G55A 4CRCA 5HM9A 2BX3A 4KKDA 3MNSA 3S9BA 1GHZA 2Z3CA 4KTCA 2BVXH 3UOPA 4YZUA 3VFEA 3M5LA 1VCPA 1Z8IB 3SNEA 2K7XA 2KAIB 2J38A 1MBMA 2XXLA 1T8LA 6CHAB 4K1EA 2WYJA 1Q3XA 3V7TA 1BTXA 3ATKA 1TGCA 4Q7ZA 3V3MA 3SNDA 3TNTA 4X2WA 4NFFA 5GCHF 2A0QB 1W7GH 1SGCA 2ZFPH 4JCNA 1PQ8A 1MH0A 1W0ZU 3KQCA 3UY9A 2TGTA 1MQ6A 3VGCC 4I7YH 1GHXH 4NA9H 2HNTC 1MBQA 1YCPM 1DANH 1QCPA 1DSUA 1EAXA 1UVOA 3F9FA 1F0SA 1HXEH 1WBGB 2SGQE 4FVDA 2ZGJA 3KQEA 2PUQH 4BANB 1V2LT 1O2RA 7GCHF 4B2CA 2TBSA 2H9TH 1HIAA 4E7NA 1O30A 3TH3H 1AWFH 5A2MH 2H9EH 4UONA 2BDCA 3MO6A 2ZCLP 2B7DH 1OWHA 1BMAA 1L1GA 1GBMA 3B23B 4TYDA 1O3NA 2ANKH 2A5IA 1Q31A 3SU0A 4ZKOU 1YKTA 1N1LA 3QGNB 4GUXA 4CRFA 2F91A 2J34A 2Z9IA 2ZEBA 2V3HH 3C1KA 4KTSA 5DKMA 2ESTE 4BAMB 3EBNA 4DIHH 3W94A 1B7XB 5JYIA 1JXPA 5GPIB 1EZUC 1E0FD 1ANCA 2ALPA 2Q6GA 1AO5A 1OPHB 1FDPA 1V2RT 2VGCB 2AYWA 3A7ZA 1T8OA 4X2VA 3QX5H 1C2EA 1P03A 2BY9X 5E8EH 4NG9H 4ISLA 1W2KH 1UTPA 5ESBA 4JZFH 2XC4A 3Q77A 4FUCA 4D9RA 3M7TA 1LCYA 5F03A 3KL6A 5C5OA 1ZHRA 1H8DH 2SFAA 1O2ZA 1B5GH 4JYUH 4FUGA 3BTEE 4IC6A 2ZTXA 3U8OH 1CHGA 2BYAX 1G37A 1FY4A 3IWMA 4XE4A 3PV4A 1AIXH 3HK6B 4TWWA 1LO6A 3L33A 1O2QA 4Y71A 1LVYA 2F9PA 1HAXB 1DOJA 5EG4A 5SGAE 4WMFA 3SV2H 4GPGA 1WSSH 2V6NA 1GBJA 1QRZA 2OTVA 3BTGE 1AUTC 3A89A 4Q7YA 3FZDA 2ZPSA 5E0HA 1WV7H 3MH4A 4XSKU 2GD4B 1F0TA 3PTBA 1CHOG 1GBDA 1CU1A 1BTYA 1XKBC 5I46H 1GMCF 3ZZ5A 1TX7A 4BTUB 3P8NA 1XVOA 1ANBA 2B9LA 3SZNA 4WXVA 1GMDF 5LH8A 3BEUA 1C9TA 1SQOA 3L3TA 5JBBS 1ZMNA 2UWOA 3MTYA 1HAYB 4NZQA 1H4WA 2FOFA 1C5NH 2C93B 2G5VA 2BM2A 1AD8H 2BQ6B 1O3PB 4OGXA 3P8GA 1RD3B 2FI4E 2W7SA 1VITG 1ZZZA 3LH3A 2IOTA 3Q3XA 5C5NA 5F8TA 4I8GA 1MTVA 2UUKB 3DFJA 2A4RA 1GHYH 1EZSC 3BTKE 1P2IA 2OC8A 2NU3E 3PMHB 1PFXC 4QT8C 3RP2A 4A92A 2OP9A 4GCHG 2F9UA 3U1IB 2SGAA 1HAIH 4HFPB 1BBRE 3A88A 4FUEA 1DM4B 1SGEE 2VH6A 2OQ5A 3SI4H 3BF6H 4DG4A 1LTOA 1O3HA 1O3AA 2GZ8A 1O3GA 2VVUA 4Y0YE 4AGKA 2XYAA 3JZ2B 3BV9B 3P6ZB 3RU4E 1ZTLA 2FXRA 3E16B 3MNXA 2P59A 5AF9H 3BIVH 4KTUA 1GHWH 1SI5H 4Y0ZE 2G00A 2FEQH 3S7HB 1ZSJA 1UCYH 1DE7H 3T62A 3ZVFA 4B75A 2R2WU 1C5RA 1EAIA 5DP6A 3TJOA 3K9XB 1GJ7B 1FNIA 1EZQA 3GYLB 1KXAA 1XXDA 1IQEA 1K1NA 2R2MB 1TOCB 3ZZ8A 4E06H 3E91A 3RMNH 1O2VA 3RMLH 1BIOA 5K0HA 4X6PA 1GI0A 3GOVB 1SLVB 3A81A 1AVWA 1O38A 1QIXB 1UJ1A 2CV3A 1HCGA 1RXPA 1O2MA 3D62A 1V2JT 5F8XA 1KXFA 1TB6H 3MMGA 3AW1A 1BQYA 4K69A 4E7RG 1T31A 2YNAA 1Y3VA 1EJMA 1C5PA 2TPIZ 5K7RA 4U01A 2FS8A 4CREA 3PMJA 1FV9A 1BJUA 2F9VA 1GHBF 5GWZA 1MD7A 2H1UA 4MNXA 9LPRA 1QY6A 4CRAA 1P2JA 2CF8H 5DK1A 1MQ5A 1TNGA 3PO1B 4FU9A 1F0UA 3O8BA 4HI3A 2GDEH 2C8ZB 4B76A 1TNKA 2H6MA 1V2VT 1Y3YA 1Z6EA 1FY5A 2ULLA 2Y6TA 3SGAE 5EQRA 1W3CA 1GI3A 1GVLA 3P95A 2ZFTA 2XBXA 2Q1JA 8ESTE 1WQVH 1AGJA 4UFDH 3QGJA 1QL7A 3GY2A 3VB7A 1MZAA 2M5TA 1JMOH 1MTNC 1CVWH 1TPOA 1O5EH 3PROA 1DVAH 1RTFB 3ZV8A 2BB4A 1XUIA 2F9OA 2AGIX 1N8OB 1GL1A 1Z8JB 2BZAA 3M7QA 4K8BA 1YLCA 5GJ4B 3TH2H 3A7XA 4BTIB 3T29A 4RN6A 3MO9A 5E0JA 4GHTA 3LH1A 3HGPA 1NO9H 2PGQB 5EXMA 2BDAA 4BAOB 1A7SA 1MTWA 5H4IB 1E36B 1GHAG 1C5WB 3BG4B 1QL8A 4ABHA 1V2QT 1SGRE 3RXUA 2AGEX 4D76A 2FPZA 4U30A 1QBNA 2BXUH 1AHTH 1QQUA 3LGVA 4X1RU 3U69H 2PW8H 1DY9A 1QRXA 4WY3A 1VCQA 1JIRA 5T6FA 1HPGA 3HKJB 5DP8A 1CE5A 3KNXA 3OY6U 3HK3B 1Z8GA 3EGKH 4CBOA 5GCHG 3QZQA 1O5GH 3SU6A 2CHAB 2EEKA 2GMTC 4KP0A 4X1NU 2G4UA 1FQ3A 1K28D 3RC4A 1NFXA 3LONA 1AB9C 3RXLA 4AX9H 4BAQB 5JPMH 1C2DA 1W10U 2EC9H 3ZZ4A 1GMHG 4DY7B 1NZQH 5GIBA 1TGSZ 3D23A 4JZIA 3DHKH 1YBWA 2F9NA 3NUMA 5HGGA 1HAGE 4H42U 2GCTB 2VJ1A 4ZHMU 1J8AA 1DWCH 1HAHH 1L0ZA 3ZZ9A 1O2HA 3PLPA 1P2NA 3EA8A 2TIOA 2ZDAH 3MO3A 3I77A 1HJAC 2RA3A 4MDSA 1KYNA 1C2KA 1AFQC 2O9QA 2P8OB 1WOFA 1Z1IA 2FOEA 4A1TA 5G4BA 2ZGHA 1P11E 1TPAE 1A61H 2I6SA 3DD2H 2H2ZA 1DITH 3VXFH 3RXOA 2IPHA 1EASA 4FUJA 2XRCA 2GX4A 2H5DA 1A5GH 1A5IA 5C1UA 1LHGH 1ZSKA 1HGTH 1GBHA 1NTPA 2FOCA 3TPIZ 1DWEH 2PKAB 3T5FH 3MHWU 1A4WH 1C2FA 2O8LA 1OX1A 1SGQE 2OQUA 2BY8X 1GJCB 3AW0A 2Y5HA 1N6XA 1HNEE 6ESTA 2F3CE 2VVVA 1O0DH 2G4TA 2VIVA 2A7CA 3EA9A 1KDQA 1K22H 1W8BH 3BEFB 2H9HA 1AVGH 1THSH 4CRBA 5J4SA 4YOGA 1K9OE 2GCHF 1AU8A 4ISHH 2O8TA 1NFYA 3RXKA 1TLDA 1W13U 1IQLA 2TRMA 2WPJS 1LQEA 3PMAB 4Y11E 3MI4A 2NU1E 1A3BH 2Q6FA 1C2IA 1GHVH 1RGQA 1GGDB 3D49H 1ZHMA 2V35A 1O33A 4CRDA 5HMAA 1O32A 1KTTB 2B5TB 2XC5A 3G01A 2GDDA 3RXHA 5DP7A 4NA7A 4TPIZ 3SUDA 3AAVA 1L4ZA 2A2QH 2A4OA 1TBRH 1SSXA 3LOXA 1WCZA 5F8ZA 1MTUA 2FP7B 2G81E 3RXCA 4WH8A 3KHVA 4TY6A 4M7GA 1E37B 3QO6A 3UTUH 1Y5BT 1XUFA 1C1QA 4CHAC 2JH0D 4FUFA 2BOHB 4SGAE 2DUCA 4OS7A 1GBEA 3NPSA 4ZKSU 1C5XB 4U2WA 2PSYA 2ZHDA 3A8DA 1XMNB 2D1JA 3TK9A 1GDNA 5FXLA 1UVUH 4JYTA 1K1LA 4CR5A 2ZDNA 1BTPA 1SQTA 1O3IA 3EYDA 3KQBA 3TITA 1NC6A 1TA2A 1XX9A 5TJXA 3RXFA 2ZIQH 4OS4A 2G5NA 5A8YA 4MNVA 1K1MA 4K3JA 3SU4A 5T6GA 4AGJA 3GY8A 1XUJA 2VWMA 5L2YH 2NWNA 2R9PA 1C5ZB 1HUTH 1UK4A 4X2XA 1VZQH 2ZGCA 1F92A 1PPGE 3EAJA 3SNBA 1EP6A 1NU7B 3ZZ3A 1SGNE 2XCFA 1MKXK 2J94A 1GJAB 2QXJA 1TNHA 1HIAB 3QTOH 3TIUA 1C5LH 2VIWA 1V6DA 3F9EA 1OYTH 1BOQA 4ABFA 1C1OA 4MNWA 3I78A 4NSVA 2GVFA 2GTBA 2ZTYA 1C1VH 1P06A 4AB9A 1B0FA 1OOKB 1N6YA 2PLXA 1YPJH 5JBAS 2ZDMA 1MKWH 1W14U 1GWAA 2OLGA 1GI4A 5HM2A 1GJ5H 4DCDA 1FXYA 1KLJH 4LOYH 3TH4H 1NROH 3RXGA 1ORFA 1CT0E 1GBKA 1GCTB 3HPTB 1P10A 3SORA 1P3EA 3GCNA 1SLUB 1A3EH 4ZXYH 2AMDA 1P9SA 3KEEA 1O2OA 1AWHB 1C4Y2 2BLQA 5CHAC 4Q80A 4AN7A 1BCUH 2QN5T 2A45B 2BXTH 3ATMA 5FBEA 5EU8A 1NS3A 2OD3B 5I25A 1EPTC 4KGAA 3LIWA 2BOKA 8GCHF 1KTSB 3MH7A 1UTNA 1QJ7B 1Z71A 1NT1A 3L6PA 3MWIU 1XXFA 1CBWB 1V2KT 4Y8YA 1ZGVA 2A4GA 1HXFH 2OC7A 1ZRBA 2ZFSA 1BMLA 3Q3KA 3TK6A 4BAHB 3ATWA 1DUEA 4CR9A 4I31A 2STAE 1CA0C 2BDHA 4WMEA 1EQ9A 5EW2H 2ZNKH 1Z8RA 2VU8E 3LGYA 1SG8B 1TGBA 1EOLA 4F4OC 4WVPE 5TCCA 2XBVA 5CMXH 2Z3DA 5FPSA 3UNRA 1PQ5A 1C2MA 3QLPH
chains in the Genus database with same CATH superfamily
3S0NA 3SHCH 3LGIA 2C3SA 3SU3A 1CSOE 1THRH 1TNIA 1CT4E 4B73A 2BLOA 1O3CA 1FPCH 1SKYE 2A32A 1ID5H 1EPTA 1EAWA 3PM3A 4ABJA 2AGGX 3B9FH 3M61U 1DWDH 4DIIH 4I8KA 1KIGH 1QQ4A 2PKSC 2D26C 1HJ8A 1XVMA 2PHBA 2EI7A 4ISOA 2JETC 3B8JA 3WW7A 1F7ZA 2ZZUH 1MCTA 1DXPA 4INKA 4I32A 3SU1A 2NU2E 2ODYB 1C5VA 2Y80A 1WXRA 1T8MA 4HGCA 1NESE 4K2YA 2ZU2A 1ACBE 5HYOA 1SGTA 2P16A 1QFKH 1ZMJA 2GZ9A 1FI8A 3FP6E 3SGBE 1SGIB 2ZDLA 4F48B 3QTVH 1G32B 1AZZA 1C4V2 1E34B 2AIPA 3U1JB 2GV6A 1P2MA 3SN8A 1YPEH 1S81A 1TRMA 2HPQH 3RU4T 4R0IA 3RM0H 2ZGXH 3RXPA 1DLEA 2UUFB 2HRVA 3SW2B 1KSNA 4JZEH 1G9IE 3SU5A 1S6HA 3EDXB 1ARBA 1E79D 4D9QA 2XCNA 1P02A 1EOJA 1TAWA 1CGJE 3GDVA 1ELTA 4JZDH 1H9LB 3MH6A 1M9UA 1ZGIA 2NU0E 4AORA 1ANDA 2FOMB 1C1UH 1PPZA 3UR6A 4A7IB 5GXPA 1SB1H 3AAUA 1YPGH 3C27B 2M2AA 3U98H 4MG3A 3UR9A 1BUIA 3URCA 4K1SA 1JWTA 1TNJA 3T28A 3O8CA 1F5RA 2Y7XA 1HAPH 2ZHFH 3KF2A 3HKIB 4MPUA 3MYWA 5C1XA 2D8WA 2SGDE 5HIZA 2W7UA 2F9BH 2GKVE 2BX4A 3RXVA 1V3XA 1EP5A 5EXLA 2IJD1 2QC2A 1AVXA 1SOZA 3TJUA 2VWNA 1TQ0B 2ZU4A 1Y3UA 3LKWA 1CT2E 2KCYA 1H1BA 1FY1A 3A7WA 4VGCB 1KXCA 2OINA 1UK3A 1LVMA 1C1TA 1C2HA 1C2LA 2Z6BD 3P8FA 4BTTB 2CMYA 2GCHG 1SGYE 3SV7A 1UTMA 4X8VH 4ZHAA 2OC0A 1AKSA 1ABJH 1SFQB 1ZTKA 4NCYA 1FN6A 5DPAA 1W0YH 2J9NA 3CS0A 3ESTA 1FY8E 1IQNA 1ZYOA 2ZECA 3SBKA 1NRRH 2PV9B 4GHQA 1O2KA 5L30H 1GVZA 1NPMA 2PFEA 1FZZA 2QAAA 3ATLA 4RKOB 1MZDA 1OS8A 4TPYA 3RXAA 4THNH 1GI9B 3Q00A 3RLYH 3BTWE 1C5OH 1G3EA 4ZMAH 3K6YA 2ZF0H 3QZRA 4BXSA 3RXRA 5JB8S 1K1PA 1CGHA 1AE5A 3RUOA 6GCHG 1MD8A 1GG6B 2JH5D 1J15A 3DSOA 7KMEH 1P8VC 3MFJA 2QA9E 2CF9H 2UUJB 4JYVH 3UPEA 1G30B 1VCWA 1ELEE 4M9FA 1O3MA 3DCLA 3ATIA 5E2PA 2G8TA 2BDYA 4INHA 3V0XA 4ISNA 2Z9GA 1IQKA 2SNVA 4O9VA 3ZYEA 2ZU5A 3OAAD 4YLUA 1VGCC 1EATA 2K1QA 2JH6D 1OWJA 1V2OT 4DJZB 2ZQ1A 3F3BA 3TJVA 1MABB 2VH0A 5J4QA 1DSTA 4NIXA 5GNDA 2HVXA 4JMYA 3NWUA 2ZHWH 1EX3A 3DFLA 2SGFE 5A0BA 1TIOA 4FOUC 2ZQ2A 1O5CB 4RI0A 1MTNB 1G3BA 2HWLB 4YTAA 1WQSA 4FUDA 2P93A 1PQAA 2BD2A 2WPMS 3BSQA 4GLYA 2QGRA 1H9HE 1TMBH 1O2PA 1FN8A 5FCKA 3VB5A 2XBWA 1QGFA 4ZAEA 1OP8A 1WDIA 3LC3A 1D3PB 3RXJA 2FI3E 1DX5M 2OC1A 1HAZB 2P3TB 3H7TA 1NRNH 3M35A 3T27A 3UQVA 1O5DH 1Y8TA 1YP9A 1SLXB 3FZZA 4BOHA 2RCEA 3OY5U 1XUHA 2HOBA 4XD7D 1O3OA 1BRCE 2P95A 3RXSA 4GVUA 1DT2A 4OS6A 2F83A 1KMHB 2KM0A 2SNWA 4IS5A 3BIUH 2SGEE 2FMJA 2QF0A 3EE7A 3SUFA 3LDXH 2WINI 1ETSH 2OCVB 1OYQA 4YLQH 1SHYA 1TMTH 5DJ7A 1QZ8A 3UWIA 2ALVA 2BY7X 1ZR0A 2CXVA 2GMTB 1A2CH 2ZC9H 1EAUA 1SPJA 1FAKH 2BQWB 1CA8B 2OXSA 1AB9B 4B71A 2EI8A 4DVAU 3A87A 1IQGA 3GCHB 1O3JA 1QA0A 1KDQB 1AUJA 1QRWA 1P01A 5KECA 1BITA 2ZDKA 1HAVA 8GCHG 2A2XH 2O8MA 1J16A 2FTLE 3SI3H 1OWDA 2A1DB 2UUYA 3ZZBA 2PWXA 4ZROA 3TLOA 5EIYA 1TABE 2W26A 2RFKC 4UEHH 1ZPBA 3E8LA 1TA6A 5JB9S 1IQJA 1HJAB 3BTME 2IJOB 2Z7FE 3KCGH 1O2YA 2VIOA 4HZHA 1AFQB 3PO1C 5E0GA 2VB0A 4XBCA 2C8YB 2Z3EA 1GPZA 2PTNA 2ZO3H 1SQRA 5DP5A 1O2TA 4WJG2 3M3VA 2FM2A 1LPKB 4X1QU 2GT7A 3Q76A 4IW4E 1GJ8B 1O36A 2TGAA 3V13A 1SQAA 2DE8A 4WXIA 2XOKD 5FPYA 1BDAA 1D3QB 1QR3E 2Y5GA 1K1JA 2FO9A 4IMZA 3EA7A 2C8XB 2LNCA 3ZIAD 2O8WA 1ZJDA 1CGIE 2PUXB 1C1NA 2VNTA 3TK5A 2BDBA 3RXIA 1BHXB 1C5UA 7GCHG 1O31A 2A7JA 3BG8A 2BD8A 1HDTH 1N8OC 1MTSA 2AEIH 2BTCE 1ELCA 1BTHH 1C1WH 5LPFA 1F5LA 3ELAH 3A86A 2XWBI 5C3NA 4CH8B 4K1TA 3LGTA 1XUKA 1O2UA 1ZTJA 2Y7ZA 2O8UA 4PROA 3W95A 1QJ6B 1BT7A 2ANYA 5AFYH 3M36A 3T26A 1Y3WA 3M7UA 1K1IA 2QY0B 1BZXE 1MAYA 4BXWA 3A83A 3BG4C 5C17A 2BDIA 3SV9A 3K6ZA 4AYVB 1C5SA 1KXEA 4FVBA 2AMQA 2STBE 1ZOMA 1UTLM 3MOCA 3UUZA 1LVOA 3A84A 1HAOH 2J92A 2P3FH 4X8UH 4IGDA 3SJOA 1S85A 2ZDVH 4DGJA 4AB8A 3GCTF 1YPLH 2GZ7A 4B2AA 3N7DA 2ZCHP 3Q3YA 4RKJB 3ZVGA 3MU0A 3OTJE 1ZRKA 3M37A 4I8LA 5FAHA 2RDLA 4HG6A 1WU1A 4CHAB 5F53A 1CHOF 5A8ZA 3SO3A 2QCYA 2WUBA 3RU4D 3WY8A 2FOBA 1H9IE 1HRTH 4BAKB 5T6DA 1QHRB 1OWKA 1VITH 2CN0H 2XNIA 4Q2KA 2WPIS 5IK2D 3A7VA 3RXQA 2FYQA 1OWEA 4TSFD 2ODPA 3F68H 1RTLA 3LJJA 1B0EA 4X6NA 1VITF 1DXWA 2P8OC 1TQ7B 1GBAA 3PWCA 1P2OA 4AFQA 1O37A 3A8AA 1DWBH 3STJA 3S69A 2FLBH 3FP8E 4IMQA 3ITIA 4B6EA 3E1XB 3H7OA 3MNCA 4D8NA 4DOQA 5LPEA 1UCYE 1TX8A 4AG1A 1IAUA 2C4FH 4AFUA 4GCHF 5B6OA 1GVKB 1C5MD 4B1TA 3DA9B 3A7YA 3W1EA 1GMCG 5EODA 5HXFA 1GJ4H 1V2WT 2WUCA 2DE9A 3VB3A 2VINA 1O3FA 4NIWA 3GY6A 2Z94A 1GBFA 1LQDB 4NIVA 1GMDG 1QB9A 5EOKA 3RC5A 1W0KD 1GJ6A 3SJIA 1FIWA 1YCPK 4Y79A 1TBQH 2NU4E 1T8NA 1RRKA 2UWLA 5EJZA 3A8CA 3HATH 1MKXH 1RTKA 6LPRA 1MCVA 1C5YB 4ZH8A 1FLEE 5FPTA 3N7OA 4X8SH 1BTWA 1BJVA 3ZVCA 2ZPRA 3SJ8A 2PSXA 4D7GA 1O5FH 1GGDC 1P0SH 3SHAH 4O97A 1C4U2 3RXTA 1ARCA 1Y59T 3SJ9A 1S82A 1UHBA 3R3GB 3RMMH 3SV6A 3QWCH 1NM6A 2JDID 4I8HA 4WMDA 1RIWC 1FJSA 5EPYA 1INCA 1EPTB 1VJAU 1ELAA 1HYLA 4FUHA 2YMSC 2BDGA 4TY7A 1S83A 1YF4A 2A4QA 2QXGA 3LGWA 1QNJA 5L2ZH 3R0FA 4UFEH 1HB0B 1SBWA 1BMNH 1EZXC 2J5UA 1UVSH 1MAXA 3PLBA 4INLA 1CA0B 3KQDA 4WF8A 3TJNA 2OUAA 4BNRA 1KXDA 3GY3A 5ABWA 1BRAA 4Z6AH 1GI7B 1SHHB 1A0HB 3VGCB 2SGPE 1A0JA 2ZHQH 4XFQA 1ZPZA 1O2JA 2CGAA 2J4IA 2J95A 3A8BA 3QK1A 1BBRK 4WWYA 2ZGBH 1PPCE 3E0NB 2WPKS 2ZU3A 1GBIA 1ZJKA 3RLWH 3SNCA 2WSSD 5B6LA 1O2XA 2LP6A 1GHBG 2K0QA 1QA7A 1JRSA 1A0LA 1GL0E 2F43B 2PTCE 1EKBB 2PKSB 1MKWK 1DY8A 3RDZA 2QF3A 2JETB 1DS2E 5BRRE 1QB6A 2JKHA 1YLNA 4Y76A 3OU0A 1W7XH 1GHAF 2BY5X 1TNLA 1Q2WA 3KN2A 3PB1E 3DSPA 1O2NA 1PJPA 1D6RA 1FONA 1YM0A 2Y81A 1T32A 4Y7BA 2LIZA 3A85A 1GI6A 2WPHS 1UO6A 1TE0A 1GCTC 1BTZA 2Y5FA 2VIQA 3GY7A 4FUBA 1IQFA 1H8IH 2QYIA 3LPRA 1BMMH 4HTCH 5EGMA 5CDFE 1TGTA 4FXGH 3E6PH 3A82A 1GMHF 1YYY1 3GYMA 1UW7A 3NK8A 8KME2 5IYTA 3VEQB 2QXIA 3MU4A 2YMSD 2BLVA 1TFXA 2XNDD 2EI6A 3O8RA 4TT3D 4YOIA 3MH5A 2FWWA 1O2SA 4B74A 3LGUA 4X2YA 1AKSB 3UIRA 1OHHD 1CBWC 1JOUB 1O3EA 2FIRH 1LMWB 1UTQA 3M3TA 4R8TB 3SGQE 6CHAC 2ANWA 3D65E 3OTPA 4IBLH 1L4DA 1GDQA 5FBIA 1CO7E 2AIQA 3KYGA 4XRNA 2WV4A 1SVPA 1BHXF 4LZ4B 1OWIA 5TCAA 5AFZH 1AMHA 4WH6A 4K60A 1LHEH 1W12U 2TGPZ 3VG8A 5ETXA 3SQEE 3OYPA 1OXGA 1UTOA 3T2NA 1SFIA 3GICB 2ODQA 2BY6X 2GJGA 3OSYA 4DURA 2ZG0H 1QBVH 1LHCH 1PPBH 1C9PA 1MU8B 4CBNA 1QL9A 3U9AH 2WHXA 5L6NH 3K2UA 2KZ4A 4H4FA 1PPFE 1WTGH 1ELDE 2R0KA 5FCRA 1LDTT 1O2WA 1OSSA 1D6WA 2BMGB 4CRGA 5DN6D 3VPKA 1AN1E 1E1QD 2QXHA 1RJXB 5DG6A 4OS1A 2QF4A 1Y5UT 2BVRH 2AMPA 1YPKH 2JIZD 3MU5A 1VR1H 2FOHA 1L2EA 1S0QA 1OP2A 3UOUA 3A7TA 2OBQA 4UDWH 3KIDU 1ANEA 2ILNA 1ELBA 1WAYB 4Y6DA 4ZXXH 2KAIA 2FX6A 1GI1A 2A7HA 5CE1A 1PPEE 3P92A 3ZVAA 5JBCS 2BD7A 4OM9A 4X1SU 1AE8H 1J17T 2RA0A 4XBDA 3SOSA 1EJAA 4IC5A 1GI5A 4X0WU 2P3UB 3NCLA 2A5KA 4XOJA 2RG3A 3FP7E 2W3IA 1DICA 3M5OA 4K8YA 1ESAA 3GCTG 2BD4A 2VGCC 1O34A 2YOLA 2B0FA 1JBUH 5A8XA 1XM1A 2IN2A 5LGOA 4ABDA 4NWKA 3BTTE 5C20A 2HVYB 1TMUH 4TWYA 1S6LA 3FFGA 1PQ7A 1AFEH 1FY3A 1NRSH 2ZCKP 3O8DA 3UREA 1KLTA 2KR7A 1C1MA 1G36A 1YWUA 4FU8A 1FAXA 5IDKA 4YOJA 3ZYDA 4Z0KA 1Z7KA 5KGOA 4J2YB 3SJKA 1GBLA 1HJ9A 2PR3A 1GCDA 1ZSLA 1COWD 5FX6A 2P94A 3VXEH 4XBBA 1VGCB 1ZLRA 4OGYA 3NZIA 4MNYA 2FOGA 1NN6A 1HV7A 1L1JA 4OS5A 1TRYA 1F5KU 3OE7D 1GJBB 5JDUB 3E90B 3UWJH 3FOAA 3GDUA 2ZPQA 2WPLS 3ZZAA 2ZFQH 2ZHEH 1A46H 1P57B 4UFFH 1C1RA 3TNSA 1C2GA 1QBOA 4LZ1H 1ESBA 1TONA 2GT8A 1UK2A 2ASUB 3FO8D 1O2LA 1D3TB 1Y3XA 3SUEA 5A09A 1YGCH 1HAVB 3FVFB 4MTBA 3H09A 1MMJN 1O3LA 1SL3A 5DP9A 1ELGA 1T7CA 3V12A 3LU9B 1TGNA 4NGAH 1CQQA 1NFUA 1KLIH 3SYJA 1VJ9U 2L74A 1RS0A 1HBTH 2ZKSA 2BD9A 2VVCA 4MLFB 2I6QA 3E0PB 1SGPE 4YESB 2V3OH 4VGCC 1A5HA 2QF5A 1C1SA 5DGJA 3OFND 1X7AC 2QIQA 3URDA 3TGJE 2Z9KA 2V0BA 2WV5A 2ZFFH 4FU7A 5DP3A 2A5AA 2BD5A 9ESTA 1V2NT 1JRTA 4NIYA 3PMBB 2J2UA 3K65B 1BTUA 2FTMA 1P05A 3LJOA 4ABEA 3P17H 5T3HA 4YT6H 1NFWA 5LPRA 1DPOA 5DO4H 3NRLA 3RXDA 5C67A 4Q7XA 1EXFA 1C2JA 1AZ8A 3UNQA 4ABGA 1NU9A 4RT1A 2R0LA 2G51A 3ZZCA 1TX6A 3BTDE 3UNSA 1UCYK 4AG2A 1HLTH 5ESTE 3P8OA 4A6LA 3TGIE 4NFEA 4MQAA 5FX5A 2FDAA 1LHDH 2ZTZA 1UTKA 3F9HA 1GBBA 1GG6C 5PTPA 1QJ1B 3QUMP 1YC0A 2HNTF 4YO9A 2XWAA 4MPVA 1GDUA 5EW1H 2A31A 4UFGH 3A80A 4IN1A 3TU7H 5GDSH 3S9CA 2VWOA 2VWLA 1JIMA 1YPMH 1L1NA 3IG6B 3E3TA 1GI2A 7LPRA 4LXBH 1UVPA 3S9AA 1Y5AT 1SOTA 2ANMH 1BRUP 2Z9JA 3GY5A 4H6TA 1UMAH 3S7KB 5A0CA 2FLRH 2D2DA 4O03A 1DUAA 1IOEA 3N7EA 4RSPA 1THPB 3GCOA 1O5AB 1NY22 1GI8B 1IQIA 1IQHA 1O2GH 1YLDA 1DLKB 3U8RH 3U8TH 1V2UT 4NSYA 2VIDA 1A1RA 1C5TA 1TOMH 1G3DA 3GISB 4Y8XA 2CK3D 2Q6DA 2FESH 1ELFA 3F6UH 4X6MA 1GJ9B 1WUNH 4OS2A 3RXMA 4ABBA 2XW9A 1P3CA 3EE0B 1LKBA 2W3KA 4FUIA 1ESTA 1MU6B 1EJNA 2FS9A 3SU2A 2C8WB 4X6OA 1QB1A 1F2SE 4YT7H 3AASA 3P70B 4JK6A 1S5SA 3BTFE 1V2PT 3KGPA 3CS7A 1ZHPA 3UFAA 4GAWA 2FOAA 4ABIA 3PWBA 1PYTC 1T4UH 4SGBE 3ZVDA 4ZUHA 2LPRA 3BN9A 4Y7AA 1IQMA 5AHGH 5C2ZA 1E1RD 3AVZA 3ENSB 3PYHA 4AOQA 4E05H 1BB0B 2H5CA 4MPXA 1EUFA 2XC0A 4JZ1A 1FMGA 1TBZH 3ZV9A 2UWPA 3GCHC 1AQ7A 1LKAA 1TWXB 4YXWD 3VB4A 5EJ1A 2Y82A 1FPHH 1HFDA 3OX7U 1OP0A 4RT0A 1LPZB 5EQSA 8LPRA 2Z9LA 4JK5A 3RXEA 1IHSH 4ASUD 1E38B 2GV7A 1T4VH 1SLWB 4DT7B 3DSGA 1SGFG 3UQOA 1UVTH 2G52A 3F1SB 2BQ7B 5C94A 4AFZA 3LT3A 3TVJB 2WZQA 5DP4A 2AERH 1GBCA 2FX4A 3F2HA 1UHBB 1XUGA 1WTHD 2CHAC 4NWLA 2F4LA 1QTFA 3SUGA 5C1YA 2AH4X 1KXBA 2QV1A 1D4PB 1IHTH 4AYYB 1SMFE 2BLWA 2PP6A 1XKAC 4O3UA 5A0AE 3CENA 3CP7A 2XTTB 4NA8A 1O35A 4I33A 4J1YA 3RC6A 2GCTC 1D3DB 2PGBB 7ESTE 3ODFA 4ZKNU 1YPHE 2AFQB 2B8OH 4ESTE 2AS9A 3RMOH 3HGNA 1RFNA 3RXBA 2CJIA 3M5NA 1PPHE 2BD3A 2BHGA 3M5MA 3SNAA 1D9IA 1TYNA 2V3MA 1EB1H 1FUJA 4I8JA 1ELVA 1ETRH 1O2IA 4MVNA 1SGDE 4UD9H 4ASHA 2HLDD 3BTQE 3ZZDA 1AI8H 1J9CH 1YCPH 1S0RA 1S84A 3H5CB 1BRBE 1KY9A 1S6FA 1V2MT 5FHTA 2HGTH 4IN2A 1P2QA 1C5QA 1V2TT 2ZWLH 1U6QA 4MPWA 1PYTD 3FANA 3NKKA 5EJLA 1W11U 1RIWB 1AY6H 1O3KA 1O39A 3GDSA 2EY4C 3MU8A 5F6MA 1SGFA 1WYKA 2WYGA 2YMSB 3DUXH 1O3DA 1SR5C 4NZLA 6GCHF 1K0HA 5E2OA 3EQ0H 4KELA 1ZMLA 4U32A 3SV8A 4H6SB 1K1OA 1P12E 1ABIH 2KCOA 3F9GA 4ZKRU 1E35B 2VIPA 4ABAA 1NRPH 5C0TA 2FODA 3SZEA 3M3SA 3DT0H 3JZ1B 4A1VA 1P9UA 1J14A 1C1PA 4A1XA 2XBYA 1O3BA 2YNBA 1GBTA 1ETTH 4F49A 4AZ2B 2KX4A 3ZZ7A 1G2LA 3QDZB 3KYFA 5CHAB 2GP9B 4YM9A 1UTJA 3PTNA 2BZ6H 1F0RA 2HNTE 3ZVBA 1DDJA 1O5BB 1DFPA 4D7FA 4GSOA 2THFB 3BEIB 1P09A 2HLCA 5EPNA 2C90B 1K21H 1V2ST 2FYRA 2ZFRH 5EQQA 4AFSA 4B2BA 3LC5A 1P04A 2R3YA 1G3CA 4O3TA 2PKAA 3IITA 2ZP0H 2EA3A 2FZZA 2OBOA 1BA8B 4ISIH 4X1PU 5BPEA 1QURH 3MNBA 1LPGB 3FAOA 2W5EA 2KCPA 2HPPH 3T25A 3ZVEA 1BBRH 4AC9A 4X8TH 1YPHC 4DW2U 4LK4A 2V7QD 3NXPA 4ZHLU 2BVSH 2HALA 2ZU1A 3STIA 2GGVB 5EXNA 1GJDB 2ZI2H 5JBTA 3ZZ6A 3TGKE 5AVDA 1NRQH 4A5TS 1FIZA 1VKYA 1EB2A 3SQHE 1ZPCA 1LHFH 4K5ZA 4CH2B 3QN7A 1TPPA 4XDEA 3BTHE 3I29A 1OKXA 4Y10E 2R3UA 3PLKA 3ODDA 3RM2H 2TGDA 1LVBA 3GY4A 1Z6JH 4UE7H 2FI5E 1G2MA 1TRNA 1MUEB 3VB6A 1TPSA 1TALA 1K2I1 1P2KA 1Z1JA 2ZA5A 3MU1A 5HIYA 4Y8ZA 1SC8U 2G55A 4CRCA 5HM9A 2BX3A 4KKDA 3MNSA 3S9BA 1GHZA 2Z3CA 4KTCA 2BVXH 3UOPA 4YZUA 3VFEA 3M5LA 1VCPA 1Z8IB 2W6JD 3SNEA 2K7XA 2KAIB 2J38A 1MBMA 2XXLA 1T8LA 6CHAB 4K1EA 2WYJA 1Q3XA 3V7TA 1BTXA 3ATKA 1TGCA 3UB0A 4B6FA 4Q7ZA 3V3MA 2WV9A 3SNDA 3TNTA 4X2WA 4NFFA 5GCHF 2A0QB 1W7GH 1SGCA 2ZFPH 4JCNA 1PQ8A 1MH0A 1W0ZU 3KQCA 3UY9A 2TGTA 4F55A 1MQ6A 3VGCC 4I7YH 1GHXH 4NA9H 2HNTC 1MBQA 1YCPM 1DANH 3FKSD 4FETA 1QCPA 1DSUA 1EAXA 1UVOA 3F9FA 1F0SA 1HXEH 1WBGB 2SGQE 4FVDA 2ZGJA 3KQEA 2PUQH 4BANB 1V2LT 1O2RA 7GCHF 4B2CA 2TBSA 2H9TH 1HIAA 4E7NA 1O30A 3F2GA 3TH3H 1AWFH 5A2MH 2H9EH 2LELA 4UONA 2BDCA 3MO6A 3MQKC 2ZCLP 2B7DH 1EFRD 2J98B 1OWHA 1BMAA 1L1GA 1GBMA 3B23B 4TYDA 1O3NA 2ANKH 2A5IA 1Q31A 3SU0A 4ZKOU 1YKTA 1N1LA 3PV2A 2OK5A 3QGNB 4GUXA 4ZCNA 4CRFA 2F91A 2J34A 2Z9IA 2ZEBA 2V3HH 3C1KA 4KTSA 5DKMA 2ESTE 4BAMB 3EBNA 4DIHH 3W94A 1B7XB 5JYIA 1JXPA 5GPIB 1EZUC 1E0FD 1ANCA 2ALPA 2Q6GA 1AO5A 1OPHB 1FDPA 1V2RT 2VGCB 2AYWA 3A7ZA 1T8OA 4X2VA 3QX5H 1C2EA 1P03A 2BY9X 5E8EH 1FX0B 2EQNA 3OEHD 4NG9H 4ISLA 1W2KH 1UTPA 1H8HD 5ESBA 4JZFH 2XC4A 3Q77A 4FUCA 4D9RA 3M7TA 1LCYA 5F03A 5C0UA 3KL6A 5C5OA 1ZHRA 1H8DH 2SFAA 1O2ZA 1B5GH 4JYUH 4FUGA 3BTEE 4IC6A 2ZTXA 3U8OH 1CHGA 2BYAX 1G37A 1FY4A 3IWMA 4XE4A 3PV4A 1AIXH 3HK6B 3WWBA 4TWWA 1LO6A 3L33A 1O2QA 4Y71A 1LVYA 2F9PA 5CHBA 1HAXB 1DOJA 5EG4A 5SGAE 4WMFA 3SV2H 4GPGA 1WSSH 2V6NA 1GBJA 1QRZA 2QE7D 2OTVA 3BTGE 1AUTC 3A89A 4Q7YA 3FZDA 2ZPSA 5E0HA 1WV7H 3MH4A 4XSKU 2GD4B 1F0TA 3PTBA 1CHOG 1GBDA 1CU1A 1BTYA 1XKBC 5I46H 1GMCF 3ZZ5A 1TX7A 4BTUB 3P8NA 1XVOA 1BMFD 1ANBA 2B9LA 3SZNA 4WXVA 1GMDF 5LH8A 3BEUA 1C9TA 1SQOA 3L3TA 3OEED 1ZMNA 5JBBS 2UWOA 3MTYA 2J98A 1HAYB 4NZQA 1H4WA 2FOFA 1C5NH 2C93B 2G5VA 2BM2A 1AD8H 2BQ6B 1O3PB 4OGXA 3P8GA 1RD3B 2FI4E 2W7SA 1VITG 1ZZZA 3LH3A 2IOTA 3Q3XA 5C5NA 5F8TA 2KFWA 3GS9A 4I8GA 1MTVA 2UUKB 3DFJA 2A4RA 1GHYH 1EZSC 3BTKE 1P2IA 2OC8A 2NU3E 3PMHB 1PFXC 4QT8C 3RP2A 4A92A 2OP9A 4GCHG 2F9UA 3U1IB 2SGAA 1HAIH 4HFPB 1BBRE 3A88A 4FUEA 1DM4B 1SGEE 2VH6A 2OQ5A 3SI4H 3BF6H 4DG4A 1LTOA 1O3HA 1O3AA 2GZ8A 1O3GA 2VVUA 4Y0YE 4AGKA 2XYAA 3JZ2B 3BV9B 3P6ZB 3RU4E 1ZTLA 2FXRA 3E16B 3MNXA 2P59A 5AF9H 3BIVH 4KTUA 1GHWH 1SI5H 4Q4LA 4Y0ZE 2G00A 2FEQH 3S7HB 1ZSJA 1UCYH 2WPDD 1DE7H 3T62A 3ZVFA 4B75A 2R2WU 1C5RA 1EAIA 5DP6A 3TJOA 3K9XB 1GJ7B 1FNIA 1EZQA 3GYLB 1KXAA 1XXDA 1IQEA 1K1NA 2R2MB 1TOCB 3ZZ8A 1H8ED 4E06H 3E91A 3RMNH 1O2VA 3RMLH 1BIOA 5K0HA 4X6PA 1GI0A 3GOVB 1SLVB 3A81A 1AVWA 1O38A 1QIXB 1UJ1A 2CV3A 1HCGA 1RXPA 4I86A 1O2MA 3D62A 1V2JT 5F8XA 1KXFA 1TB6H 3MMGA 3AW1A 1BQYA 4K69A 4E7RG 1T31A 4ACAA 2YNAA 1Y3VA 1EJMA 1C5PA 2TPIZ 5K7RA 4U01A 2JJ1D 2FS8A 4CREA 3PMJA 1FV9A 1BJUA 2F9VA 1GHBF 5GWZA 1MD7A 2H1UA 4MNXA 9LPRA 1QY6A 4CRAA 1P2JA 2CF8H 5DK1A 1MQ5A 3F0OA 4ACBA 1TNGA 3PO1B 4FU9A 1F0UA 3O8BA 4HI3A 5HKKD 2GDEH 2C8ZB 4B76A 4P02A 1TNKA 2H6MA 1V2VT 1Y3YA 1Z6EA 1FY5A 2ULLA 2Y6TA 3SGAE 5EQRA 1W3CA 1GI3A 1GVLA 5KEDA 3P95A 2ZFTA 2XBXA 2Q1JA 8ESTE 1WQVH 1AGJA 4UFDH 3QGJA 1QL7A 3GY2A 3VB7A 1MZAA 2M5TA 1JMOH 1MTNC 1CVWH 1TPOA 1O5EH 3PROA 1DVAH 1RTFB 3ZV8A 2BB4A 1XUIA 2F9OA 2AGIX 1N8OB 1GL1A 1Z8JB 2BZAA 3M7QA 4K8BA 1YLCA 5GJ4B 3TH2H 3A7XA 4BTIB 3T29A 4RN6A 3MO9A 5E0JA 4GHTA 3LH1A 3HGPA 1NO9H 2PGQB 1YY3A 5EXMA 3N99A 2BDAA 4BAOB 1A7SA 1MTWA 5H4IB 1E36B 1GHAG 1C5WB 3BG4B 1QL8A 4ABHA 1V2QT 1SGRE 3RXUA 2AGEX 4D76A 2FPZA 4U30A 1QBNA 2BXUH 1AHTH 5T1VA 1QQUA 3LGVA 4X1RU 3U69H 2PW8H 4Z1MD 1DY9A 1QRXA 4WY3A 1VCQA 1JIRA 3F0PA 3KQ5A 5T6FA 1HPGA 3HKJB 5DP8A 1CE5A 3KNXA 3OY6U 3HK3B 1Z8GA 3EGKH 4CBOA 5GCHG 3QZQA 1O5GH 3SU6A 2CHAB 2EEKA 2GMTC 4KP0A 2IPQX 4X1NU 2G4UA 1FQ3A 1K28D 3RC4A 1NFXA 3LONA 1AB9C 3RXLA 4AX9H 4BAQB 5JPMH 1C2DA 1W10U 2EC9H 3ZZ4A 1GMHG 4DY7B 1NZQH 5GIBA 1TGSZ 3D23A 4JZIA 3DHKH 1YBWA 2F9NA 3NUMA 5HGGA 1HAGE 4H42U 2GCTB 2VJ1A 3PRDA 4Q63A 4ZHMU 1J8AA 1DWCH 1HAHH 1L0ZA 3ZZ9A 1O2HA 3PLPA 1P2NA 3EA8A 2TIOA 2ZDAH 3MO3A 3I77A 1HJAC 2RA3A 4MDSA 1KYNA 2L6OA 1C2KA 1AFQC 2O9QA 2P8OB 1WOFA 1Z1IA 2FOEA 4A1TA 5G4BA 2ZGHA 1P11E 1NBME 1TPAE 1A61H 2I6SA 3DD2H 2H2ZA 1DITH 3VXFH 3RXOA 2IPHA 1EASA 4FUJA 2XRCA 2GX4A 2H5DA 1A5GH 1A5IA 5C1UA 1LHGH 1ZSKA 1HGTH 1GBHA 1NTPA 2FOCA 3TPIZ 1DWEH 2PKAB 3T5FH 3MHWU 1A4WH 1C2FA 2O8LA 1OX1A 1SGQE 2OQUA 2BY8X 1GJCB 3AW0A 2Y5HA 1N6XA 1HNEE 6ESTA 2F3CE 2VVVA 1O0DH 2G4TA 2VIVA 2A7CA 3EA9A 1KDQA 1K22H 1W8BH 3BEFB 3PV5A 3WWFA 2H9HA 1AVGH 1THSH 4CRBA 5J4SA 4YOGA 1K9OE 2GCHF 1AU8A 4ISHH 2O8TA 1NFYA 3RXKA 1TLDA 1W13U 1IQLA 2TRMA 2WPJS 1LQEA 3PMAB 4Y11E 3MI4A 2NU1E 1A3BH 2Q6FA 1C2IA 1GHVH 2J97A 1RGQA 1GGDB 3D49H 1ZHMA 2V35A 1O33A 4CRDA 5HMAA 3PRBA 1O32A 1KTTB 2B5TB 2XC5A 3G01A 2GDDA 3RXHA 5DP7A 4NA7A 4TPIZ 3SUDA 3AAVA 1L4ZA 2A2QH 2A4OA 1TBRH 1SSXA 3LOXA 1WCZA 5F8ZA 1MTUA 2FP7B 2G81E 3RXCA 4WH8A 3KHVA 2W6ID 4TY6A 4M7GA 1E37B 3QO6A 3UTUH 1Y5BT 1XUFA 1C1QA 4CHAC 2JH0D 4FUFA 2BOHB 4SGAE 2DUCA 4OS7A 1GBEA 1W0JD 3NPSA 4ZKSU 2K8IA 1C5XB 4U2WA 2PSYA 2ZHDA 3A8DA 1XMNB 2D1JA 3TK9A 1GDNA 5FXLA 1UVUH 4JYTA 5DSFA 1K1LA 4CR5A 2ZDNA 1BTPA 1SQTA 1O3IA 3EYDA 3KQBA 3TITA 1NC6A 1TA2A 1XX9A 2JJ2D 5TJXA 3RXFA 5FL7D 2ZIQH 4OS4A 2G5NA 4DT4A 5A8YA 4MNVA 1K1MA 4K3JA 3SU4A 5T6GA 4AGJA 3GY8A 1XUJA 2VWMA 3UAIC 5L2YH 2NWNA 2R9PA 1C5ZB 1HUTH 1UK4A 4X2XA 1VZQH 2ZGCA 1F92A 1PPGE 3EAJA 3SNBA 1EP6A 1NU7B 3ZZ3A 1SGNE 2XCFA 3AK5A 1MKXK 2J94A 1GJAB 2KCAA 2QXJA 1TNHA 1HIAB 3QTOH 3TIUA 1C5LH 2VIWA 1V6DA 3F9EA 3FN8A 1OYTH 1BOQA 4ABFA 1C1OA 4MNWA 3I78A 2AHME 4NSVA 2GVFA 2GTBA 2ZTYA 1C1VH 1P06A 4AB9A 1B0FA 1OOKB 1N6YA 2PLXA 3F2FA 1YPJH 5JBAS 2ZDMA 1MKWH 1W14U 1GWAA 2OLGA 1GI4A 5HM2A 1GJ5H 4DCDA 1FXYA 1KLJH 4LOYH 3TH4H 1NROH 3RXGA 1ORFA 1CT0E 1GBKA 1GCTB 3HPTB 1P10A 3SORA 1P3EA 3GCNA 1SLUB 1A3EH 4ZXYH 2AMDA 1P9SA 3KEEA 1O2OA 2VBCA 1AWHB 1C4Y2 2BLQA 5CHAC 4Q80A 4AN7A 1BCUH 2QN5T 2A45B 2BXTH 3ATMA 5FBEA 5EU8A 1NS3A 2OD3B 5I25A 1EPTC 4KGAA 3U28C 3LIWA 2BOKA 8GCHF 3CNRA 1KTSB 3MH7A 1UTNA 1QJ7B 1Z71A 1NT1A 3L6PA 3MWIU 1XXFA 1CBWB 1V2KT 4Y8YA 1ZGVA 2A4GA 4P00A 1HXFH 2OC7A 2RDEA 1ZRBA 2ZFSA 1BMLA 3Q3KA 3TK6A 4BAHB 3ATWA 1DUEA 4CR9A 4I31A 2STAE 1CA0C 2BDHA 4WMEA 1EQ9A 5EW2H 2ZNKH 1Z8RA 2VU8E 3LGYA 1SG8B 1TGBA 1EOLA 4F4OC 4WVPE 5TCCA 2XBVA 5CMXH 2Z3DA 5FPSA 3UNRA 1PQ5A 1NBMD 1C2MA 3QLPH
chains in the Genus database with same CATH topology
3S0NA 3SHCH 3LGIA 2C3SA 3SU3A 1CSOE 1THRH 1TNIA 1CT4E 4B73A 2BLOA 1O3CA 1FPCH 2A32A 1ID5H 1EPTA 1EAWA 3PM3A 4ABJA 2AGGX 3B9FH 3M61U 1DWDH 4DIIH 4I8KA 1KIGH 1QQ4A 2PKSC 2D26C 1HJ8A 1XVMA 2PHBA 2EI7A 4ISOA 2JETC 3B8JA 1F7ZA 2ZZUH 1MCTA 1DXPA 4INKA 4I32A 3SU1A 2NU2E 2ODYB 1C5VA 2Y80A 1T8MA 4HGCA 1NESE 4K2YA 2ZU2A 1ACBE 5HYOA 1SGTA 2P16A 1QFKH 1ZMJA 2GZ9A 1FI8A 3FP6E 3SGBE 1SGIB 2ZDLA 3QTVH 1G32B 1AZZA 1C4V2 1E34B 2AIPA 3U1JB 2GV6A 1P2MA 3SN8A 1YPEH 1S81A 1TRMA 2HPQH 3RU4T 4R0IA 3RM0H 2ZGXH 3RXPA 1DLEA 2UUFB 2HRVA 3SW2B 1KSNA 4JZEH 1G9IE 3SU5A 1S6HA 3EDXB 1ARBA 4D9QA 2XCNA 1P02A 1EOJA 1TAWA 1CGJE 3GDVA 1ELTA 4JZDH 1H9LB 3MH6A 1M9UA 1ZGIA 2NU0E 4AORA 1ANDA 2FOMB 1C1UH 1PPZA 3UR6A 4A7IB 5GXPA 1SB1H 3AAUA 1YPGH 3C27B 3U98H 4MG3A 3UR9A 1BUIA 3URCA 4K1SA 1JWTA 1TNJA 3T28A 3O8CA 1F5RA 2Y7XA 1HAPH 2ZHFH 3KF2A 3HKIB 4MPUA 3MYWA 5C1XA 2D8WA 2SGDE 2W7UA 2F9BH 2GKVE 2BX4A 3RXVA 1V3XA 1EP5A 5EXLA 2QC2A 1AVXA 1SOZA 3TJUA 2VWNA 1TQ0B 2ZU4A 1Y3UA 3LKWA 1CT2E 1H1BA 1FY1A 3A7WA 4VGCB 1KXCA 2OINA 1UK3A 1LVMA 1C1TA 1C2HA 1C2LA 2Z6BD 3P8FA 4BTTB 2CMYA 2GCHG 1SGYE 3SV7A 1UTMA 4X8VH 4ZHAA 2OC0A 1AKSA 1ABJH 1SFQB 1ZTKA 4NCYA 1FN6A 5DPAA 1W0YH 2J9NA 3CS0A 3ESTA 1FY8E 1IQNA 1ZYOA 2ZECA 3SBKA 1NRRH 2PV9B 4GHQA 1O2KA 5L30H 1GVZA 1NPMA 2PFEA 1FZZA 2QAAA 3ATLA 4RKOB 1MZDA 1OS8A 4TPYA 3RXAA 4THNH 1GI9B 3Q00A 3RLYH 3BTWE 1C5OH 1G3EA 4ZMAH 3K6YA 2ZF0H 3QZRA 4BXSA 3RXRA 5JB8S 1K1PA 1CGHA 1AE5A 3RUOA 6GCHG 1MD8A 1GG6B 2JH5D 1J15A 7KMEH 1P8VC 3MFJA 2QA9E 2CF9H 2UUJB 4JYVH 3UPEA 1G30B 1VCWA 1ELEE 1O3MA 3ATIA 5E2PA 2G8TA 2BDYA 4INHA 3V0XA 4ISNA 2Z9GA 1IQKA 2SNVA 4O9VA 3ZYEA 2ZU5A 4YLUA 1VGCC 1EATA 2K1QA 2JH6D 1OWJA 1V2OT 4DJZB 2ZQ1A 3TJVA 2VH0A 5J4QA 1DSTA 4NIXA 2HVXA 4JMYA 3NWUA 2ZHWH 1EX3A 3DFLA 2SGFE 5A0BA 1TIOA 2ZQ2A 1O5CB 1MTNB 1G3BA 2HWLB 4YTAA 1WQSA 4FUDA 2P93A 1PQAA 2BD2A 2WPMS 3BSQA 4GLYA 2QGRA 1H9HE 1TMBH 1O2PA 1FN8A 5FCKA 3VB5A 2XBWA 1QGFA 4ZAEA 1OP8A 3LC3A 1D3PB 3RXJA 2FI3E 1DX5M 2OC1A 1HAZB 2P3TB 3H7TA 1NRNH 3M35A 3T27A 3UQVA 1O5DH 1Y8TA 1YP9A 1SLXB 3FZZA 4BOHA 2RCEA 3OY5U 1XUHA 2HOBA 1O3OA 1BRCE 2P95A 3RXSA 4GVUA 1DT2A 4OS6A 2F83A 2SNWA 4IS5A 3BIUH 2SGEE 2FMJA 2QF0A 3SUFA 3LDXH 2WINI 1ETSH 2OCVB 1OYQA 4YLQH 1SHYA 1TMTH 5DJ7A 3UWIA 2ALVA 2BY7X 1ZR0A 2CXVA 2GMTB 1A2CH 2ZC9H 1EAUA 1SPJA 1FAKH 2BQWB 1CA8B 2OXSA 1AB9B 4B71A 2EI8A 4DVAU 3A87A 1IQGA 3GCHB 1O3JA 1QA0A 1KDQB 1AUJA 1QRWA 1P01A 1BITA 2ZDKA 1HAVA 8GCHG 2A2XH 2O8MA 1J16A 2FTLE 3SI3H 1OWDA 2A1DB 2UUYA 3ZZBA 2PWXA 4ZROA 3TLOA 1TABE 2W26A 4UEHH 1ZPBA 3E8LA 1TA6A 5JB9S 1IQJA 1HJAB 3BTME 2IJOB 2Z7FE 3KCGH 1O2YA 2VIOA 4HZHA 1AFQB 3PO1C 5E0GA 2VB0A 4XBCA 2C8YB 2Z3EA 1GPZA 2PTNA 2ZO3H 5DP5A 1O2TA 4WJG2 3M3VA 2FM2A 1LPKB 4X1QU 2GT7A 3Q76A 4IW4E 1GJ8B 1O36A 2TGAA 3V13A 1SQAA 2DE8A 4WXIA 5FPYA 1BDAA 1D3QB 1QR3E 2Y5GA 1K1JA 2FO9A 4IMZA 3EA7A 2C8XB 2LNCA 2O8WA 1ZJDA 1CGIE 2PUXB 1C1NA 2VNTA 3TK5A 2BDBA 3RXIA 1BHXB 1C5UA 7GCHG 1O31A 2A7JA 3BG8A 2BD8A 1HDTH 1N8OC 1MTSA 2AEIH 2BTCE 1ELCA 1BTHH 1C1WH 5LPFA 1F5LA 3ELAH 3A86A 2XWBI 5C3NA 4CH8B 4K1TA 3LGTA 1XUKA 1O2UA 1ZTJA 2Y7ZA 2O8UA 4PROA 3W95A 1QJ6B 1BT7A 2ANYA 5AFYH 3M36A 3T26A 1Y3WA 3M7UA 1K1IA 2QY0B 1BZXE 1MAYA 4BXWA 3A83A 3BG4C 2BDIA 3SV9A 3K6ZA 4AYVB 1C5SA 1KXEA 4FVBA 2AMQA 2STBE 1ZOMA 1UTLM 3MOCA 3UUZA 1LVOA 3A84A 1HAOH 2J92A 2P3FH 4X8UH 4IGDA 3SJOA 1S85A 2ZDVH 4DGJA 4AB8A 3GCTF 1YPLH 2GZ7A 4B2AA 2ZCHP 3Q3YA 4RKJB 3ZVGA 3MU0A 3OTJE 1ZRKA 3M37A 4I8LA 5FAHA 2RDLA 1WU1A 4CHAB 1CHOF 5A8ZA 3SO3A 2QCYA 2WUBA 3RU4D 3WY8A 2FOBA 1H9IE 1HRTH 4BAKB 5T6DA 1QHRB 1OWKA 1VITH 2CN0H 2XNIA 4Q2KA 2WPIS 3A7VA 3RXQA 2FYQA 1OWEA 2ODPA 3F68H 1RTLA 3LJJA 1B0EA 4X6NA 1VITF 1DXWA 2P8OC 1TQ7B 1GBAA 3PWCA 1P2OA 4AFQA 1O37A 3A8AA 1DWBH 3STJA 3S69A 2FLBH 3FP8E 4IMQA 3ITIA 3E1XB 3H7OA 3MNCA 4D8NA 4DOQA 5LPEA 1UCYE 1TX8A 4AG1A 1IAUA 2C4FH 4AFUA 4GCHF 5B6OA 1GVKB 1C5MD 4B1TA 3DA9B 3A7YA 1GMCG 5EODA 5HXFA 1GJ4H 1V2WT 2WUCA 2DE9A 3VB3A 2VINA 1O3FA 4NIWA 3GY6A 2Z94A 1GBFA 1LQDB 4NIVA 1GMDG 1QB9A 5EOKA 3RC5A 1GJ6A 3SJIA 1FIWA 1YCPK 4Y79A 1TBQH 2NU4E 1T8NA 1RRKA 2UWLA 3A8CA 3HATH 1MKXH 1RTKA 6LPRA 1MCVA 1C5YB 4ZH8A 1FLEE 5FPTA 3N7OA 4X8SH 1BTWA 1BJVA 3ZVCA 2ZPRA 3SJ8A 2PSXA 4D7GA 1O5FH 1GGDC 1P0SH 3SHAH 4O97A 1C4U2 3RXTA 1ARCA 1Y59T 3SJ9A 1S82A 1UHBA 3R3GB 3RMMH 3SV6A 3QWCH 1NM6A 4I8HA 4WMDA 1RIWC 1FJSA 5EPYA 1INCA 1EPTB 1VJAU 1ELAA 1HYLA 4FUHA 2BDGA 4TY7A 1S83A 1YF4A 2A4QA 2QXGA 3LGWA 1QNJA 5L2ZH 3R0FA 4UFEH 1HB0B 1SBWA 1BMNH 1EZXC 1UVSH 1MAXA 3PLBA 4INLA 1CA0B 3KQDA 4WF8A 3TJNA 2OUAA 4BNRA 1KXDA 3GY3A 5ABWA 1BRAA 4Z6AH 1GI7B 1SHHB 1A0HB 3VGCB 2SGPE 1A0JA 2ZHQH 4XFQA 1ZPZA 1O2JA 2CGAA 2J4IA 2J95A 3A8BA 3QK1A 1BBRK 4WWYA 2ZGBH 1PPCE 3E0NB 2WPKS 2ZU3A 1GBIA 1ZJKA 3RLWH 3SNCA 1O2XA 1GHBG 1QA7A 1JRSA 1A0LA 1GL0E 2PTCE 1EKBB 2PKSB 1MKWK 1DY8A 3RDZA 2QF3A 2JETB 1DS2E 5BRRE 1QB6A 2JKHA 4Y76A 3OU0A 1W7XH 1GHAF 2BY5X 1TNLA 1Q2WA 3KN2A 3PB1E 1O2NA 1PJPA 1D6RA 1FONA 1YM0A 2Y81A 1T32A 4Y7BA 2LIZA 3A85A 1GI6A 2WPHS 1UO6A 1TE0A 1GCTC 1BTZA 2Y5FA 2VIQA 3GY7A 4FUBA 1IQFA 1H8IH 2QYIA 3LPRA 1BMMH 4HTCH 5EGMA 1TGTA 4FXGH 3E6PH 3A82A 1GMHF 1YYY1 3GYMA 3NK8A 8KME2 5IYTA 3VEQB 2QXIA 3MU4A 2BLVA 1TFXA 2EI6A 3O8RA 4YOIA 3MH5A 2FWWA 1O2SA 4B74A 3LGUA 4X2YA 1AKSB 3UIRA 1CBWC 1JOUB 1O3EA 2FIRH 1LMWB 1UTQA 3M3TA 4R8TB 3SGQE 6CHAC 2ANWA 3D65E 4IBLH 1L4DA 1GDQA 5FBIA 1CO7E 2AIQA 2WV4A 1SVPA 1BHXF 4LZ4B 1OWIA 5TCAA 5AFZH 1AMHA 4WH6A 4K60A 1LHEH 1W12U 2TGPZ 5ETXA 3SQEE 3OYPA 1OXGA 1UTOA 3T2NA 1SFIA 3GICB 2ODQA 2BY6X 3OSYA 4DURA 2ZG0H 1QBVH 1LHCH 1PPBH 1C9PA 1MU8B 4CBNA 1QL9A 3U9AH 5L6NH 3K2UA 4H4FA 1PPFE 1WTGH 1ELDE 2R0KA 5FCRA 1LDTT 1O2WA 1OSSA 1D6WA 2BMGB 4CRGA 3VPKA 1AN1E 2QXHA 5DG6A 1RJXB 4OS1A 1Y5UT 2BVRH 2AMPA 1YPKH 3MU5A 1VR1H 2FOHA 1L2EA 1S0QA 1OP2A 3UOUA 3A7TA 2OBQA 4UDWH 3KIDU 1ANEA 2ILNA 1ELBA 1WAYB 4Y6DA 4ZXXH 2KAIA 2FX6A 1GI1A 2A7HA 5CE1A 1PPEE 3P92A 3ZVAA 5JBCS 2BD7A 4X1SU 1AE8H 1J17T 2RA0A 4XBDA 3SOSA 1EJAA 4IC5A 1GI5A 4X0WU 2P3UB 3NCLA 2A5KA 4XOJA 2RG3A 3FP7E 2W3IA 1DICA 3M5OA 4K8YA 1ESAA 3GCTG 2BD4A 2VGCC 1O34A 2YOLA 2B0FA 1JBUH 5A8XA 1XM1A 2IN2A 5LGOA 4ABDA 4NWKA 3BTTE 5C20A 1TMUH 4TWYA 3FFGA 1PQ7A 1AFEH 1FY3A 1NRSH 2ZCKP 3O8DA 3UREA 1KLTA 1C1MA 1G36A 4FU8A 1FAXA 5IDKA 4YOJA 3ZYDA 4Z0KA 1Z7KA 4J2YB 3SJKA 1GBLA 1HJ9A 2PR3A 1GCDA 1ZSLA 5FX6A 2P94A 3VXEH 4XBBA 1VGCB 1ZLRA 4OGYA 3NZIA 4MNYA 2FOGA 1NN6A 1HV7A 1L1JA 4OS5A 1TRYA 1F5KU 1GJBB 5JDUB 3E90B 3UWJH 3GDUA 3ZZAA 2ZPQA 2WPLS 2ZFQH 2ZHEH 1A46H 1P57B 4UFFH 1C1RA 3TNSA 1C2GA 1QBOA 4LZ1H 1ESBA 1TONA 2GT8A 1UK2A 2ASUB 1O2LA 1D3TB 1Y3XA 3SUEA 5A09A 1YGCH 1HAVB 3FVFB 4MTBA 1MMJN 1O3LA 1SL3A 5DP9A 1ELGA 1T7CA 3V12A 3LU9B 1TGNA 4NGAH 1CQQA 1NFUA 1KLIH 1VJ9U 1RS0A 1HBTH 2ZKSA 2BD9A 2VVCA 4MLFB 2I6QA 3E0PB 1SGPE 4YESB 2V3OH 4VGCC 1A5HA 1C1SA 5DGJA 1X7AC 2QIQA 3URDA 3TGJE 2Z9KA 2V0BA 2WV5A 2ZFFH 4FU7A 5DP3A 2A5AA 2BD5A 9ESTA 1V2NT 1JRTA 4NIYA 3PMBB 2J2UA 3K65B 1BTUA 2FTMA 1P05A 3LJOA 4ABEA 3P17H 5T3HA 4YT6H 1NFWA 5LPRA 1DPOA 5DO4H 3RXDA 5C67A 4Q7XA 1EXFA 1C2JA 1AZ8A 3UNQA 4ABGA 1NU9A 2R0LA 2G51A 3ZZCA 1TX6A 3BTDE 3UNSA 1UCYK 4AG2A 1HLTH 5ESTE 3P8OA 4A6LA 3TGIE 4NFEA 4MQAA 5FX5A 2FDAA 1LHDH 2ZTZA 1UTKA 3F9HA 1GBBA 1GG6C 5PTPA 1QJ1B 3QUMP 1YC0A 2HNTF 4YO9A 2XWAA 4MPVA 1GDUA 5EW1H 2A31A 4UFGH 3A80A 4IN1A 3TU7H 5GDSH 3S9CA 2VWOA 2VWLA 1JIMA 1YPMH 1L1NA 3IG6B 3E3TA 1GI2A 7LPRA 4LXBH 1UVPA 3S9AA 1Y5AT 1SOTA 2ANMH 1BRUP 2Z9JA 3GY5A 4H6TA 1UMAH 3S7KB 5A0CA 2FLRH 2D2DA 4O03A 1DUAA 1IOEA 4RSPA 1THPB 3GCOA 1O5AB 1NY22 1GI8B 1IQIA 1IQHA 1O2GH 1YLDA 1DLKB 3U8RH 3U8TH 1V2UT 4NSYA 2VIDA 1A1RA 1C5TA 1TOMH 1G3DA 3GISB 4Y8XA 2Q6DA 2FESH 1ELFA 3F6UH 4X6MA 1GJ9B 1WUNH 4OS2A 3RXMA 4ABBA 2XW9A 1P3CA 3EE0B 1LKBA 2W3KA 4FUIA 1ESTA 1MU6B 1EJNA 2FS9A 3SU2A 2C8WB 4X6OA 1QB1A 1F2SE 4YT7H 3AASA 3P70B 4JK6A 1S5SA 3BTFE 1V2PT 3KGPA 3CS7A 1ZHPA 3UFAA 4GAWA 2FOAA 4ABIA 3PWBA