1EXFA

Exfoliative toxin a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
VSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXFOLIATVE TOXIN A
publication title The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
total genus 51
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA01
1TBZH 2EEKA 3SJ8A 4ABBA 3PMBB 3VB7A 2Y82A 1KDQB 3UR9A 1QTFA 8ESTE 1BRUP 3GCHC 3MNBA 5HXFA 4Y7BA 1GI2A 3AAUA 1QHRB 4AFUA 4I33A 1UMAH 1SOZA 1CT4E 2WPLS 2KAIA 4NGAH 3E0PB 1IQHA 1V6DA 1CO7E 4I8GA 1OWIA 3SGAE 4B2CA 3S9CA 2Z3DA 3BTME 1Y5BT 4RKOB 2BDCA 5FAHA 1O39A 2WUBA 2BY8X 1YPKH 2QGRA 3BTKE 1D4PB 2XWBI 2ZCKP 1BRAA 1GHAF 5LPFA 4U30A 1V2QT 1QJ6B 4K1EA 1B5GH 3Q77A 1ZOMA 5HMAA 4B71A 1L1NA 2TBSA 1LQDB 1W11U 2FESH 2BX3A 2SGEE 1QL8A 5T6FA 3V3MA 4U2WA 1TNGA 2HNTF 1H8IH 1SLUB 1P2MA 2XC5A 1CHGA 2YNAA 3OTJE 3LH3A 2P16A 4O9VA 3EA7A 1EP6A 1TPAE 1Z1JA 4AG2A 1MU6B 2RDLA 2QA9E 4E05H 5C1YA 1L0ZA 1AN1E 1C2JA 2ZPQA 1CU1A 1AB9B 3RXIA 4A7IB 2A5IA 3PMHB 1ZJKA 3RXPA 2F9NA 3T5FH 1UCYK 2FM2A 4J2YB 4FUEA 4ZHMU 4NZLA 1PQ8A 2PHBA 2CF8H 1OS8A 2BD5A 1EPTC 1V2RT 3GY3A 6GCHF 2OP9A 1UO6A 3DFJA 3VB5A 4UE7H 3JZ1B 3GYLB 4RKJB 3PWBA 1O33A 3BTGE 1A3EH 5JB9S 1AVGH 3RMNH 5HYOA 1HJ8A 4R8TB 1ACBE 3G01A 4IC6A 6LPRA 1NFYA 2PLXA 3BSQA 2P94A 3OU0A 1C5ZB 3BG4B 4GSOA 2Y5FA 4JZIA 3TGKE 1TRNA 1VJAU 2OQ5A 2STBE 1T7CA 2Y5GA 1QRWA 2FTMA 2D26C 1IQNA 1S0RA 2PUXB 4AORA 2PTCE 1K1NA 1ZRBA 4ABDA 2ZA5A 1CQQA 3Q76A 4VGCC 2W7SA 2C8XB 1HJAB 1XVMA 2G81E 4I31A 3M5MA 4KTSA 4CRCA 5FCKA 3O8CA 4X1PU 2IJOB 4BTTB 2UWPA 5AF9H 4X8TH 1G2LA 5FPSA 3SU6A 3VPKA 1WCZA 1GG6B 1LHCH 3FANA 1LMWB 2ZDMA 4WMFA 3RMMH 1ELTA 4ISLA 5LPEA 1MAXA 5E8EH 1TBQH 4ABIA 2EI8A 3MU1A 4HTCH 2A5AA 3P95A 4BTIB 3ZVBA 4K2YA 3MH5A 1HAPH 1DY8A 2BQ7B 1DVAH 1MTWA 1F5LA 1JMOH 1JWTA 5DG6A 1W7XH 4Y6DA 5A8YA 2P93A 2Q6FA 2FP7B 3A84A 1LPGB 3GCTG 1MZDA 1QL7A 1AFQB 1LDTT 2ZU4A 3KQDA 1AVXA 2J9NA 4JYTA 1GI1A 3D65E 4TWYA 1PPEE 4X1SU 4ZKSU 1FIWA 4CBOA 1YPHE 4CRDA 5GXPA 5JDUB 2BTCE 3HKIB 1BRCE 3L33A 1ELAA 4ZH8A 1J14A 3GICB 5ETXA 3SOSA 3RXJA 4GVUA 4CHAC 1O3EA 3SO3A 1DLEA 5TJXA 1KLTA 2WV5A 3TU7H 2G55A 1WU1A 4K8YA 4WH8A 3LJJA 1C2MA 3FP6E 1O5CB 1O2HA 1GGDB 1ZYOA 1D3DB 1N8OB 4YT6H 4JZFH 7LPRA 2J92A 1GHWH 3PO1B 1PQAA 5CMXH 1C5QA 2HALA 1ZTJA 4IMZA 1AFEH 4TYDA 3SUGA 1C4U2 1HUTH 3SNEA 1K22H 1XVOA 4XDEA 1AVWA 2ASUB 3A85A 4XOJA 5DKMA 4X0WU 1BTXA 5EODA 4AFQA 1G36A 1GBMA 1LHDH 1NFXA 2ZGXH 1AZZA 2ZFTA 4MTBA 3RXDA 1UJ1A 4D8NA 1GPZA 3FZDA 4K60A 2PUQH 3RLYH 3ZZBA 1BBRH 3EA8A 1P2OA 5EOKA 1THSH 2THFB 4WXVA 4PROA 3SGBE 2WPIS 3AVZA 1G3EA 3L3TA 1O3KA 4AGJA 1TABE 1WYKA 3L6PA 2WYJA 4KP0A 4U01A 1KLIH 2R2WU 3TK5A 1SR5C 2Z9GA 1YM0A 2V0BA 4JCNA 1C5TA 5J4QA 1L1JA 1SG8B 3A88A 1JBUH 3OYPA 4X2XA 3T29A 1W0YH 1OYTH 5C5OA 3MU0A 3BTHE 4LOYH 4AB8A 4HZHA 3P8FA 3GOVB 5DJ7A 1AHTH 1GI5A 3GCTF 1FPHH 1O3GA 1QBOA 2ZGCA 1F92A 3KL6A 1EP5A 3UQOA 2LPRA 2BD2A 1AZ8A 3EQ0H 1YLCA 1O2XA 3RM2H 3BG8A 3GY5A 1KLJH 4I8JA 1HJ9A 3GY4A 4MNYA 1NT1A 2SNWA 1MKWK 1P57B 1FLEE 3NKKA 3U98H 3BTQE 4NFFA 1GJ5H 1CE5A 5DP8A 1TLDA 2ZI2H 2GVFA 2JETB 5EXNA 2A2QH 4LZ4B 2C90B 4Z6AH 1JRTA 1GHZA 4BNRA 3KHVA 1NROH 3W95A 5JBTA 1O3JA 2IPHA 1PQ5A 1O2ZA 2QY0B 2GD4B 4O97A 3O8BA 2AMDA 4I7YH 4JK5A 3SV2H 5EG4A 1C5MD 1IOEA 4GAWA 3PROA 1OKXA 5E2PA 7KMEH 1AB9C 3MU5A 4WMEA 3LIWA 3MO3A 4BTUB 4D7GA 4AB9A 3QK1A 2RCEA 5JPMH 1G9IE 3UNRA 2BLWA 2FX4A 2H5DA 4ISHH 2R2MB 1T4UH 1W2KH 2WPKS 3RM0H 3M36A 4XBDA 4AN7A 3A7WA 1L1GA 3TPIZ 4BAQB 3U1JB 1F0TA 3UTUH 2QF0A 1BUIA 2FODA 3S7KB 1DOJA 3AAVA 2QAAA 3SGQE 1IQIA 3LJOA 1BMNH 1GDUA 2ZHDA 3QUMP 1AIXH 3UFAA 5EU8A 3TJOA 1GJ9B 2XTTB 2GMTB 1TGNA 1O3HA 1D6RA 1P03A 2GKVE 1NU7B 1JIMA 1Y8TA 3M7UA 1N1LA 2PWXA 4RN6A 1C5PA 1QA7A 2Q1JA 1TOMH 4B1TA 2XCNA 2VIPA 3PLPA 4B75A 1SGIB 3VGCB 2FXRA 1GL0E 2VWMA 4YO9A 2ZHFH 1QQUA 4UFGH 5A8ZA 2J94A 3QGJA 2R9PA 3P8NA 1HJAC 2BM2A 1HGTH 3TH3H 2CV3A 1JRSA 3TK6A 1AU8A 5L6NH 1K1JA 3R0FA 4FUBA 5A09A 2ZFQH 2QF3A 1O2NA 1A61H 3ATIA 1FUJA 1GG6C 3PM3A 1T8NA 3VB3A 4NIWA 2BYAX 3DD2H 2FLBH 1TNLA 1DS2E 2J95A 3ZZ4A 1RRKA 1O2LA 1OWDA 1V2JT 3UR6A 2Q6DA 3GDVA 3TH2H 2Z9IA 1SGNE 3EGKH 3ZYDA 2ZFRH 2A7HA 4IMQA 1UTMA 3MI4A 2XRCA 1O2IA 3JZ2B 2OLGA 2BY9X 1DWBH 1WQSA 1G3BA 1VGCC 4I8HA 4KTUA 1K28D 1GBBA 3MO6A 3CP7A 3MH7A 5K7RA 1PPHE 1AFQC 4GUXA 1TBRH 3GYMA 4X2WA 1GJ7B 3F9GA 2PW8H 1IQMA 3SZNA 3UPEA 3RXOA 4WXIA 1P09A 3M3VA 2V35A 1FN6A 3U9AH 3MHWU 2O8LA 3T26A 1AWHB 1SGYE 3F9HA 4NSVA 5EXMA 1SGRE 3M35A 2GV6A 2ZGHA 2ZDKA 2QYIA 1F0RA 2VIVA 3UNQA 1BIOA 3PO1C 4AZ2B 2PSXA 5T6GA 2H6MA 3A7YA 4UFEH 5F8XA 3MU4A 1TYNA 5DP4A 3A82A 2O9QA 1S6HA 2F9VA 2F9OA 3RXCA 4IBLH 1C5RA 1A0JA 2XWAA 2Z6BD 4XE4A 1GBDA 1ELGA 3NWUA 2NWNA 1C2LA 2H9HA 1W13U 2B8OH 4CH2B 1EX3A 1K1IA 2BQ6B 3UREA 1P3EA 1P2JA 5FXLA 4TPIZ 1TPOA 3PTBA 1A0HB 4ABJA 1MMJN 1KXCA 5L2ZH 1ELFA 2ZDLA 3U1IB 1EZUC 1NRSH 2FOEA 1V2WT 1P9UA 1UK3A 2EC9H 2GDDA 3RXHA 3D23A 1DFPA 1XUGA 1MAYA 1ZRKA 2IOTA 2IN2A 1YPJH 3ELAH 2ZFPH 1WTGH 3VXFH 2TGDA 3P70B 1DWEH 4DIIH 4ISIH 2FZZA 4YESB 1HNEE 2PTNA 1EZSC 1TGSZ 1BHXF 1SOTA 2PGBB 5EQQA 1O5BB 2FIRH 2OCVB 1Y5UT 2HRVA 1DUAA 1O36A 1G3CA 1HAYB 3BF6H 1FONA 1L4ZA 1DT2A 1TALA 1UVSH 1T8OA 3KCGH 1MQ6A 4CH8B 4MPWA 2A4GA 3SU4A 3K6YA 2A32A 4HFPB 4NA9H 1ZMLA 2Z3EA 1QY6A 1PPFE 4ABEA 1Y3YA 2QV1A 3ZVFA 4A1XA 1AY6H 4DT7B 5AFYH 5GDSH 1OP0A 4ZKNU 3SJ9A 4NCYA 8GCHF 1S84A 2R3YA 3HPTB 2AGGX 3IG6B 2W26A 1C1TA 1ZSKA 4D9RA 3WY8A 3U69H 4X6OA 3W94A 1FI8A 2J2UA 5LPRA 2XBVA 2OBOA 3TJNA 1O2PA 3TGIE 6GCHG 3MNSA 4B2AA 2ZIQH 3ZZCA 4ABGA 3EDXB 1GBAA 1C2FA 1LHFH 1Z1IA 1GI7B 3BTTE 1A5GH 3IWMA 4OS2A 2V6NA 1C1QA 3SBKA 1UK2A 1LPKB 1GMCG 3NXPA 3M61U 1T8MA 1C2EA 1OP8A 1GDQA 1O31A 4IC5A 4A6LA 4MVNA 2H2ZA 1ZTKA 2HLCA 1F5KU 2LNCA 3TIUA 2BD9A 4XFQA 2A4QA 5HM2A 1SGTA 1ID5H 1NN6A 2BD4A 2Y5HA 3KIDU 2AERH 2DE9A 1F0UA 1Y3VA 1O2VA 1ZZZA 1A7SA 3P8OA 3TNSA 1CA0B 1O34A 4DVAU 4YLUA 1A4WH 4WF8A 1GBCA 3B8JA 3P8GA 3HKJB 5FHTA 2C4FH 2ZQ1A 1FQ3A 4Y7AA 2QN5T 5IDKA 1HAOH 1QL9A 2GZ9A 1AO5A 3RUOA 1GJAB 1Z6EA 1WOFA 2OXSA 1FXYA 1YC0A 2RA3A 3Q00A 4K1SA 1PYTD 1GVKB 1QR3E 2F9PA 4NIVA 1O3FA 5CHAB 4MNWA 2VH6A 2TGPZ 1GJCB 1D3TB 5C1XA 2GZ7A 2BD7A 3VGCC 2ANKH 4FU8A 1C2IA 4X1QU 2CJIA 1HAIH 2C8WB 2BVSH 1KIGH 1EAWA 3ZV9A 2VH0A 2VB0A 3QTOH 4HI3A 3E1XB 2FO9A 5IYTA 1LCYA 1LO6A 1YCPH 1NRQH 4E7RG 1SGDE 1Z8GA 1O2QA 2W3IA 1YBWA 4TY7A 1A2CH 4GHQA 3A83A 3QLPH 5CE1A 1SLVB 4MNVA 1DANH 3E16B 3MTYA 2RG3A 4UDWH 1XUIA 1RJXB 1GBIA 2SGAA 1W3CA 1ABJH 2XYAA 1CGHA 3UQVA 3PMAB 1D3QB 1HAVB 4WWYA 3DHKH 3KF2A 1BDAA 3UIRA 3KQCA 1G3DA 3E3TA 3HGNA 4QT8C 1GMCF 1H9IE 1O2KA 1XUKA 2BLQA 3LOXA 4FXGH 1P8VC 2WV4A 5EW2H 1BTYA 2HPQH 1NTPA 1S82A 1YPLH 4BAKB 2VVUA 3C27B 1P2NA 5L2YH 3ZZ8A 4ZHLU 3FFGA 2NU1E 2ANMH 3M3TA 1NRRH 1O5DH 2A4OA 3A7VA 3F68H 4DW2U 1EOLA 1K1PA 1E34B 2GDEH 2VVCA 2XC0A 1P2QA 1EAUA 3ZV8A 2Z3CA 4CRGA 2HOBA 1HCGA 3SORA 2GCTB 3A87A 3F9EA 2I6QA 1V2VT 1LVBA 4Y11E 3LGWA 1B0EA 4NIYA 3SI3H 1O2OA 3SV8A 1ESBA 4INKA 4Q2KA 4ZXYH 1FY3A 5E0JA 2ZECA 1O3BA 1SGFG 4XSKU 1GWAA 2WUCA 1Z7KA 1IHSH 1BB0B 1PPBH 2ZDNA 1AD8H 4OGYA 3SW2B 1C2HA 2AGIX 1SB1H 1L2EA 3QN7A 2QXGA 3MO9A 3ATLA 1H8DH 2SGDE 3BTEE 1ZPZA 1BHXB 2FYRA 1FJSA 2JH0D 4FUHA 3SI4H 3BTWE 1ESAA 1V2PT 3MMGA 2JKHA 2GX4A 1AKSA 1NZQH 2I6SA 1C1WH 1BCUH 1O3LA 3SUEA 2O8WA 4Y8XA 2GV7A 1MKWH 1RIWB 1TMUH 3H7TA 1SPJA 1C1UH 2XBWA 1WAYB 4KGAA 5T3HA 1TB6H 3LGYA 1TX7A 2NU3E 3DT0H 4NSYA 4U32A 3UUZA 3TGJE 2B7DH 4OS4A 1DDJA 2Z94A 1UHBA 1GHYH 1SHHB 2OD3B 1C5UA 3GY7A 2SGQE 2C93B 1P3CA 2QIQA 2G51A 1MD8A 1ZHRA 1XMNB 5HM9A 1DITH 1ELCA 3GDUA 4ISOA 2VWOA 1CA8B 3STIA 1C2KA 4MDSA 2PGQB 1J15A 1QIXB 3RU4E 2BLVA 4ASHA 1NS3A 2QXJA 1U6QA 2XCFA 2OBQA 1KY9A 4XBBA 1XUHA 1HYLA 1UK4A 1GCTC 2BDYA 3AW1A 8KME2 2C8ZB 3OY6U 2FWWA 4AYVB 1G37A 1SMFE 3FZZA 2ZHQH 4I8LA 1T8LA 3LT3A 1EAIA 2A5KA 2BHGA 2EI7A 1DE7H 1LVOA 1F0SA 3SJIA 1GJDB 1TPSA 3TLOA 3TH4H 4O3UA 1V2KT 5F8ZA 5T6DA 3Q3YA 3RMOH 5DP5A 1QCPA 3IITA 1MCVA 2SNVA 1BTHH 3SU1A 1PPCE 1NC6A 3PMJA 4CR9A 3U8TH 1C9PA 3MNCA 4SGAE 1LPZB 2P8OB 2ALVA 3ZVEA 3RXAA 3M7QA 1ORFA 1UCYE 3RU4D 2DE8A 2ZHWH 3KGPA 1TRMA 1HRTH 1K1LA 3BEUA 1DY9A 2H5CA 1P06A 5DGJA 2PFEA 5H4IB 3A8DA 3MNXA 1ZHMA 3ZZ9A 1CA0C 4IN1A 2ZO3H 1P2KA 3ATMA 1SC8U 3RC6A 1FAXA 1V2NT 1BTWA 4NIXA 2FOMB 4OS1A 1LTOA 3LC5A 1EAXA 3TITA 2OC7A 4INLA 3PWCA 1GBHA 2ZEBA 1Z8RA 1OXGA 3S69A 1W14U 2ULLA 2OINA 1XXFA 2VIWA 1SSXA 4D76A 4WVPE 2CN0H 1ELVA 3ODDA 5EGMA 1HFDA 1GL1A 1AE5A 1O3DA 1FIZA 3BEFB 1O3OA 1Z6JH 2K1QA 5BPEA 3RMLH 2GGVB 3LKWA 2ZWLH 4UD9H 1FZZA 3RXTA 4AFSA 3ITIA 2J38A 2ZFFH 4X8UH 1TQ7B 4A1VA 1MTUA 2PV9B 3TJUA 3RXVA 2EA3A 3A89A 2ODPA 1T4VH 2FTLE 4A1TA 1OYQA 2BDIA 2FEQH 5JBCS 2XW9A 4IN2A 3O8RA 1MH0A 4ZAEA 2WPMS 2P59A 3BTDE 2QCYA 2UUYA 1QB6A 2WINI 1HAHH 3SUFA 4ZKOU 3P17H 1NO9H 3NUMA 1TA2A 1TA6A 4KELA 1XUJA 5C1UA 2GTBA 4DY7B 1RS0A 1C1OA 4FU9A 1HAVA 1IQFA 3VEQB 2C3SA 4X1NU 4AG1A 4K3JA 3SU0A 1O5AB 2UUFB 3FVFB 4NFEA 3T2NA 2F3CE 1RTFB 2VJ1A 4DG4A 3ZZAA 1V2ST 1SLWB 3D49H 3BG4C 3GCHB 4BOHA 1DX5M 5DP7A 1P12E 5A0CA 2A7CA 1YPMH 2ANYA 2HVXA 2CXVA 1H9LB 2VWLA 2BQWB 4UONA 1MTSA 4DURA 3DFLA 1YGCH 1BTZA 2B0FA 1AUJA 5HGGA 1GHVH 1UTLM 3RXGA 1S83A 2H9EH 5C5NA 5GJ4B 4K1TA 1M9UA 1GBLA 1SVPA 5C3NA 3ZZ7A 3SN8A 1DWCH 3LDXH 1ZPBA 4IGDA 2VWNA 1PJPA 1ANCA 3SJKA 2EI6A 4X6MA 4Y76A 2SFAA 5A8XA 1E0FD 2ZF0H 5EXLA 1IHTH 3RXBA 3S9BA 2BB4A 5AFZH 1Q3XA 1K1MA 2AS9A 1UTPA 2FOBA 5FCRA 1H1BA 1EB2A 5AVDA 1RIWC 3GISB 1PQ7A 2BX4A 8GCHG 3B9FH 2BVXH 1B7XB 1LKAA 3M5LA 1PPGE 1GBEA 1IAUA 3T28A 4R0IA 1DLKB 4JMYA 4X2YA 5GPIB 1ABIH 1WBGB 3LH1A 1DSTA 3V7TA 3ZVCA 3STJA 1D9IA 5G4BA 2ZHEH 1GBKA 1GGDC 1W12U 1SHYA 4H6TA 2GCHG 5DO4H 5F6MA 1N8OC 5ESTE 1EJMA 1YPGH 3RU4T 3TK9A 3KNXA 2HWLB 1H9HE 2FPZA 3RXSA 4H4FA 4YT7H 1IQKA 4AYYB 2CMYA 1NRNH 1A46H 1GI3A 1ZSLA 1YPHC 3A7XA 2ZU3A 3K6ZA 5A2MH 2O8TA 1P0SH 3EAJA 3CS0A 1AQ7A 1P11E 1ZMJA 1HB0B 5DPAA 1O3IA 8LPRA 1LHEH 1GMDG 2PSYA 2PKAB 1E37B 2Z9KA 1ZTLA 1H4WA 1TGTA 1J8AA 1C5SA 1YYY1 2YNBA 1ESTA 3Q3KA 1AKSB 5B6OA 4I32A 4CR5A 4F4OC 1GHBG 3VFEA 2H1UA 3A8CA 2FOHA 3PLKA 4JK6A 4THNH 1K1OA 1UHBB 1MQ5A 1C5NH 1TPPA 1MBQA 1ZJDA 3RXUA 3T62A 4H42U 3LGUA 1O5GH 4TY6A 1SGQE 5I46H 1DXWA 4ZHAA 4Q80A 1YKTA 3K2UA 5C20A 1E35B 4OS6A 1ETTH 3ZVDA 2FOFA 4D7FA 4M7GA 4Y8YA 3I29A 1FPCH 1UCYH 4DGJA 1W8BH 4CHAB 2B5TB 4Q7YA 4ZMAH 4Y0ZE 1NFWA 1C5VA 1EB1H 1XXDA 4FVBA 4JYUH 2HNTC 2FYQA 5E0GA 3U8OH 1RTKA 1VJ9U 2ZQ2A 1N6YA 4ZROA 1P02A 1CBWB 1Y3XA 1OPHB 3Q3XA 1SGEE 4GLYA 1MBMA 3V13A 1ETSH 2JETC 2BD8A 3B23B 3MH4A 2GCHF 4Y0YE 4AX9H 5K0HA 1MCTA 2ZCLP 5JYIA 1C4Y2 3MU8A 3M5NA 4Q7ZA 3PV4A 1QA0A 2D1JA 1JXPA 1FAKH 2BMGB 1LVYA 1RTLA 2AMQA 1Z8JB 1O35A 1W7GH 2ZGBH 3LGTA 1K9OE 2SGPE 5EW1H 1PPZA 3UNSA 1NM6A 1PFXC 2G8TA 1P10A 6CHAB 1GMDF 2RA0A 2DUCA 1TNIA 2VIDA 1WUNH 3O8DA 1GBJA 3M7TA 1EJNA 4INHA 1MZAA 1G30B 1QJ7B 1GHBF 3LU9B 2GMTC 3SQHE 4TWWA 2FLRH 3UWIA 3A8AA 3SU3A 1SFQB 2GT8A 4X8SH 2ZTZA 1ETRH 4ABHA 2C8YB 4CRFA 1O2UA 4IS5A 1HIAB 2G5VA 2GZ8A 5FBEA 1F2SE 3BIUH 1GJ4H 1VZQH 2FMJA 3R3GB 1DM4B 1UTOA 5LGOA 3A8BA 4MPXA 1O3MA 4KTCA 4ZKRU 1MKXK 3HK3B 1MU8B 4DOQA 3K65B 2BXTH 1K2I1 2R0LA 1TX8A 2OC8A 1GI6A 2WPJS 2HGTH 1HDTH 1SL3A 3TNTA 3DA9B 1YP9A 1MTNB 4CRBA 1HAGE 3P92A 4Y79A 2R0KA 1ZHPA 1BQYA 1WSSH 3GCOA 4X1RU 2W3KA 2GT7A 1Y3UA 1O2WA 1TX6A 2AIQA 3SNAA 1ZLRA 2VIQA 2M5TA 4Y10E 1ZSJA 4HGCA 4YOJA 2CHAB 4JZEH 4KKDA 5DP3A 1TOCB 1KXAA 1SBWA 2VINA 2P95A 2G5NA 1P04A 2Y6TA 1FY5A 4IW4E 2OC1A 1C5OH 1IQJA 1C9TA 3SV7A 4LK4A 1GCDA 1EOJA 1GVLA 1EJAA 1O3AA 1BMAA 1UTJA 2ZG0H 3I78A 1TNHA 1UVOA 2F9BH 1C5LH 1V2UT 1FNIA 3QWCH 1ZGVA 3SHCH 2A31A 4CREA 2ZTXA 1NESE 2G00A 4B74A 1EPTA 1C5YB 1ZGIA 3I77A 5F03A 3MOCA 1QBVH 1KXDA 1WQVH 2YOLA 1TNKA 1O3CA 2XC4A 1DICA 1SI5H 4I8KA 1QB9A 1DXPA 1HAXB 2BXUH 4YM9A 5C67A 2BDHA 4AFZA 3QZRA 3GDSA 2VVVA 1C1VH 4GHTA 2ZNKH 2ODQA 7ESTE 1KTTB 4NWKA 2BDGA 3HATH 5DK1A 1OP2A 1UTQA 2AEIH 3ZYEA 1BOQA 4X6PA 1D3PB 1FN8A 3ZZ5A 3CENA 2ALPA 4FU7A 4DIHH 1UTNA 2TGAA 2A1DB 2STAE 1TWXB 2PKSB 2PKAA 1BJUA 3S0NA 1T31A 3KN2A 3GCNA 2ZTYA 3T27A 1IQLA 2BY5X 4FUDA 2ZZUH 3UY9A 2BY7X 1CGIE 3BN9A 3URCA 5F8TA 4ESTE 1CVWH 5FX5A 2ZGJA 3A81A 1O3PB 1SGFA 1QURH 1RXPA 4YTAA 3VB6A 1KXFA 1SLXB 2AGEX 1THPB 2FS8A 1L4DA 4XBCA 3RLWH 3S9AA 1CSOE 4ZUHA 1VGCB 2A2XH 3A86A 3F6UH 2A45B 1SGPE 3SV9A 2VGCB 1Z71A 3GY8A 2Y7ZA 4NG9H 1OX1A 1S85A 1YCPK 2F83A 2ZU1A 1AE8H 3OY5U 4LXBH 3SU5A 1LKBA 3H7OA 4WJG2 1TONA 1V2TT 1J16A 2Y80A 1HBTH 3VB4A 2ZU5A 3QO6A 3MYWA 2PR3A 4H6SB 1VITG 1P01A 2BOHB 1GMHG 2OQUA 2Z9JA 1XUFA 2BD3A 1FY8E 5JBAS 1SQTA 1E36B 3E8LA 2Q6GA 4CBNA 2FOAA 1CBWC 4NA8A 1TFXA 5BRRE 2XBYA 2QC2A 4E06H 4A5TS 3RXQA 1YF4A 4X8VH 5I25A 1VITH 2TIOA 4BXSA 2NU2E 5FPTA 1Z8IB 4WH6A 1NU9A 1HPGA 3ATWA 2OC0A 1TGCA 1UVPA 1ANEA 5TCAA 2XXLA 4OS5A 1CT2E 5FPYA 1ARBA 2ZC9H 2AH4X 3BIVH 4BAHB 1X7AC 3AW0A 2ILNA 1Q31A 5JBBS 5ABWA 2FDAA 1THRH 2FI5E 3ODFA 9LPRA 1RGQA 3E6PH 6CHAC 1YCPM 1W0ZU 1CGJE 4FUGA 1PYTC 4JZDH 1V2LT 1ZPCA 1QRZA 5J4SA 2ODYB 1FY1A 1RD3B 2BZ6H 4FUJA 1VCPA 2HNTE 1DUEA 3ZZ6A 3C1KA 4K5ZA 2W7UA 4NA7A 2VNTA 4BXWA 5E0HA 1GBFA 3ENSB 3BTFE 4B2BA 2ESTE 2FI4E 2P3UB 2QXIA 1FV9A 1KDQA 1TRYA 2BDAA 5CHAC 5C2ZA 1JOUB 2JH5D 4Q7XA 2V3OH 1EXFA 1GHXH 1HIAA 3GY6A 2UWLA 1TMTH 3HK6B 1Q2WA 4YOGA 1BMMH 5A0BA 1SQOA 2AYWA 5GCHG 1O2RA 2CGAA 4FVDA 1QGFA 1O5FH 1QNJA 1HLTH 2O8MA 4O3TA 3OSYA 3QTVH 4J1YA 3MFJA 1C1SA 2UWOA 3PYHA 1ANBA 5AHGH 2G52A 3SV6A 1D6WA 1EUFA 1TAWA 1MTNC 1O30A 1SFIA 3E91A 1C1PA 1C2GA 1UVTH 2W5EA 1GI9B 4FUFA 3SUDA 1F5RA 2ZFSA 3QDZB 3RXRA 1VITF 1BITA 2XNIA 2O8UA 3UOUA 1AUTC 1GMHF 2SGFE 1INCA 1NY22 5JB8S 3N7OA 2H9TH 1J9CH 5L30H 1JIRA 3P6ZB 1A1RA 5EPNA 1P9SA 3KQBA 3EYDA 2CHAC 4FUIA 1HAZB 1NFUA 3QGNB 2GP9B 1VR1H 5EQRA 5FBIA 1GJ8B 1EQ9A 4BAOB 1XKAC 2BZAA 2FOGA 2ZKSA 3OX7U 3D62A 5TCCA 3U8RH 1C5XB 1BTUA 3FP7E 3SQEE 2A7JA 1CHOG 1A3BH 1QBNA 1NRPH 3MH6A 1GBTA 3E0NB 1GVZA 3BEIB 5E2OA 1J17T 2G4TA 3SU2A 2BOKA 4ZXXH 1ARCA 2A4RA 2KAIB 1QRXA 2OUAA 3ZVAA 3T25A 1QFKH 3M3SA 3E90B 1BBRK 3SNBA 1MTVA 1XM1A 1RFNA 6ESTA 4BAMB 4SGBE 1QJ1B 1YPEH 2GCTC 5LH8A 1BRBE 1Y59T 1TQ0B 3FP8E 2BY6X 1O2SA 2OTVA 2ZPRA 1T32A 2V3HH 4UFDH 1G32B 1O3NA 3RXMA 1Y3WA 1XKBC 1LQEA 4DCDA 1VCWA 3HGPA 1AGJA 3F9FA 1DSUA 1IQGA 1OWHA 1BT7A 7GCHG 2JH6D 3RXLA 4X6NA 3S7HB 1LVMA 1ZR0A 1A5HA 4MQAA 2D2DA 1C5WB 1UTKA 2TRMA 1O2GH 3RXKA 2PKSC 3LPRA 2ANWA 2AMPA 4F49A 4B73A 4DJZB 2A0QB 1WTHD 1UVUH 1V2OT 1DWDH 1F7ZA 4GCHG 3PLBA 5GCHF 1VCQA 3A7TA 2J4IA 3KEEA 1KYNA 2ZDAH 1O2YA 4CRAA 1O2TA 2AFQB 3SNCA 5A0AE 4ABFA 1KXEA 2R3UA 3TJVA 1SQAA 1S81A 3LGVA 1V3XA 1EPTB 9ESTA 2TPIZ 2Z7FE 4NZQA 3SNDA 4MLFB 3UOPA 3ZZDA 1C4V2 2VGCC 3RP2A 2Z9LA 4A92A 2F91A 3V12A 4YOIA 2ZPSA 4OGXA 5DP9A 1C1MA 4E7NA 4K69A 5FX6A 3QZQA 4ISNA 2F9UA 3UWJH 1C1RA 3RXEA 1HXEH 4UFFH 1OWEA 3SJOA 2AIPA 1CHOF 2VU8E 4MPUA 3VXEH 4VGCB 1WV7H 1EKBB 1MUEB 1P05A 1LHGH 1W10U 4NWLA 1ZMNA 1YLDA 1ELBA 4JZ1A 1EZQA 3RDZA 4K8BA 5EPYA 1S6FA 1OWKA 4UEHH 1KSNA 3NPSA 3LC3A 2B9LA 2UUJB 1ELDE 3V0XA 5GIBA 3FAOA 1AWFH 3DUXH 5DP6A 5EQSA 2FI3E 2BVRH 4WMDA 4GPGA 3MWIU 2P8OC 1CT0E 3GY2A 3AASA 1DPOA 1AI8H 1MD7A 1S5SA 3RC4A 3PTNA 3EA9A 3PB1E 1O2JA 1S0QA 1GJ6A 3ESTA 1TE0A 3CS7A 1GDNA 1KXBA 3RC5A 1MKXH 1OSSA 3ZVGA 3NCLA 7GCHF 2WPHS 2TGTA 5GWZA 3KQEA 1FY4A 1O32A 3EE0B 3RXFA 4YLQH 2QXHA 4O03A 4BANB 1C1NA 1GHAG 3ATKA 4GCHF 2VIOA 2P3TB 1O2MA 4YZUA 5ESBA 4B76A 1BTPA 4X2VA 1Y5AT 1SGCA 2XBXA 3NK8A 3K9XB 4ABAA 1P2IA 1IQEA 1QB1A 2FS9A 3H5CB 4TPYA 1EASA 1OOKB 2CF9H 3URDA 2P3FH 1HXFH 3M5OA 4Y71A 1E38B 2J34A 1XX9A 1A5IA 1C2DA 4RSPA 1GI4A 1TNJA 1OWJA 4OS7A 3LONA 5PTPA 2ZU2A 2BDBA 1GJBB 1ANDA 1NPMA 1O38A 1K21H 2NU4E 1BBRE 1EATA 1AMHA 4MG3A 3QX5H 2ZP0H 4MPVA 1A0LA 4Z0KA 1FMGA 1HV7A 1GI0A 4LZ1H 1FDPA 1GCTB 3LGIA 3BV9B 2BLOA 3NZIA 1V2MT 1O5EH 3SHAH 1BJVA 2G4UA 1TGBA 1B0FA 2Y81A 5SGAE 2ZDVH 2D8WA 4FUCA 4D9QA 1TMBH 1ELEE 2WYGA 2FX6A 4Y8ZA 3ZZ3A 3A7ZA 4AGKA 4AOQA 2HPPH 1QQ4A 1BZXE 2ZCHP 1BA8B 1O37A 4MNXA 1TIOA 2UUKB 2FOCA 1G2MA 4JYVH 3F1SB 1N6XA 3A80A 1EZXC 4WY3A 1BMLA 1KTSB 2NU0E 1O0DH 3TVJB 1GI8B 2Y7XA 3M37A
chains in the Genus database with same CATH superfamily
1TBZH 2EEKA 3SJ8A 4ABBA 3PMBB 3VB7A 2Y82A 1KDQB 3UR9A 1QTFA 8ESTE 1BRUP 3GCHC 3MNBA 5HXFA 4Y7BA 1GI2A 3AAUA 3DSOA 1QHRB 4AFUA 5EJLA 4I33A 1UMAH 1SOZA 1CT4E 2WPLS 2KAIA 4NGAH 3E0PB 1IQHA 1V6DA 1CO7E 4I8GA 1OWIA 3DCLA 3SGAE 4B2CA 3S9CA 2Z3DA 3BTME 1Y5BT 4RKOB 2BDCA 5FAHA 1O39A 2WUBA 2BY8X 1YPKH 2QGRA 3BTKE 1D4PB 2XWBI 2ZCKP 1BRAA 1GHAF 5LPFA 4U30A 1V2QT 1QJ6B 4K1EA 1B5GH 3Q77A 1ZOMA 5HMAA 4B71A 1L1NA 2TBSA 1LQDB 2J98B 1W11U 2FESH 2BX3A 2SGEE 1QL8A 5T6FA 3V3MA 4U2WA 1TNGA 2HNTF 1H8IH 1SLUB 1P2MA 2XC5A 1CHGA 2YNAA 3OTJE 3LH3A 2P16A 4O9VA 3EA7A 1EP6A 1TPAE 1Z1JA 4AG2A 1MU6B 2RDLA 2QA9E 4E05H 5C1YA 1L0ZA 1AN1E 1C2JA 2ZPQA 1CU1A 1AB9B 3RXIA 4A7IB 2A5IA 3PMHB 1ZJKA 3RXPA 2F9NA 3T5FH 1UCYK 5HKKD 2FM2A 4J2YB 2YMSB 4FUEA 4ZHMU 4NZLA 1PQ8A 2PHBA 2CF8H 1OS8A 4TT3D 2BD5A 1EPTC 1V2RT 3GY3A 6GCHF 2OP9A 1UO6A 3DFJA 3VB5A 4UE7H 3JZ1B 3GYLB 4RKJB 3PWBA 1O33A 3BTGE 1A3EH 5JB9S 1AVGH 3RMNH 5HYOA 1HJ8A 4R8TB 1KMHB 1ACBE 3G01A 4IC6A 6LPRA 1NFYA 2PLXA 3BSQA 2P94A 3OU0A 1C5ZB 3BG4B 4GSOA 2Y5FA 4JZIA 3TGKE 1TRNA 1VJAU 2OQ5A 2STBE 1T7CA 2Y5GA 1QRWA 2FTMA 2D26C 1IQNA 1S0RA 2PUXB 4AORA 2PTCE 1K1NA 1ZRBA 4ABDA 5KEDA 2ZA5A 1CQQA 3Q76A 4VGCC 2W7SA 2C8XB 1HJAB 1XVMA 2G81E 4I31A 3M5MA 4KTSA 4CRCA 5FCKA 3O8CA 4X1PU 2IJOB 4BTTB 3PV5A 2UWPA 5AF9H 4X8TH 1G2LA 5FPSA 4RT1A 3SU6A 3VPKA 1WCZA 1GG6B 1LHCH 3FANA 1LMWB 2ZDMA 4WMFA 3RMMH 5KECA 1ELTA 4ISLA 5LPEA 1MAXA 5E8EH 1TBQH 4ABIA 2EI8A 3MU1A 4HTCH 2A5AA 3P95A 4BTIB 3ZVBA 4K2YA 3MH5A 1HAPH 1DY8A 2BQ7B 1DVAH 1MTWA 1F5LA 1JMOH 1JWTA 5DG6A 2KZ4A 1W7XH 4Y6DA 5A8YA 2P93A 2Q6FA 2FP7B 3A84A 1LPGB 3GCTG 1MZDA 1QL7A 1AFQB 1LDTT 2ZU4A 3KQDA 1AVXA 2J9NA 4JYTA 1GI1A 3D65E 4TWYA 1PPEE 4X1SU 4ZKSU 1FIWA 4ZCNA 4CBOA 1YPHE 4CRDA 5GXPA 5JDUB 2BTCE 3HKIB 1BRCE 3L33A 1ELAA 4ZH8A 1J14A 3GICB 5ETXA 3SOSA 3RXJA 4GVUA 4CHAC 4ACBA 1O3EA 3SO3A 1DLEA 5TJXA 1KLTA 2WV5A 3TU7H 2G55A 1WU1A 4K8YA 4WH8A 3LJJA 1C2MA 3FP6E 1O5CB 1O2HA 1GGDB 1ZYOA 1D3DB 1N8OB 4YT6H 4JZFH 7LPRA 2J92A 1GHWH 3PO1B 1PQAA 3OE7D 5CMXH 1YLNA 1C5QA 2HALA 1ZTJA 4IMZA 1AFEH 4TYDA 3SUGA 1C4U2 1HUTH 3SNEA 1K22H 1XVOA 4XDEA 1AVWA 3EE7A 2ASUB 3A85A 4XOJA 5DKMA 4X0WU 1BTXA 5EODA 4AFQA 1G36A 1GBMA 1LHDH 1NFXA 2ZGXH 1AZZA 2ZFTA 4MTBA 3RXDA 1UJ1A 4D8NA 1GPZA 3FZDA 4K60A 2PUQH 3RLYH 3ZZBA 1BBRH 3EA8A 1P2OA 5EOKA 1THSH 2THFB 4WXVA 4PROA 3SGBE 2WPIS 3AVZA 1G3EA 3L3TA 1O3KA 4AGJA 1TABE 1WYKA 3L6PA 2WYJA 4KP0A 4U01A 1KLIH 2R2WU 3TK5A 1SR5C 2Z9GA 1YM0A 2V0BA 4JCNA 1C5TA 5J4QA 1L1JA 1SG8B 3A88A 1JBUH 3OYPA 4X2XA 3T29A 1W0YH 1OYTH 5C5OA 3MU0A 3BTHE 4LOYH 4AB8A 4HZHA 3P8FA 3GOVB 5DJ7A 1AHTH 1GI5A 3GCTF 1E79D 1FPHH 1O3GA 1QBOA 2ZGCA 1F92A 3KL6A 1EP5A 3UQOA 2LPRA 2BD2A 1AZ8A 3EQ0H 4ACAA 1YLCA 1O2XA 3RM2H 3BG8A 3GY5A 1KLJH 4I8JA 1HJ9A 3GY4A 4MNYA 1NT1A 2SNWA 1MKWK 1P57B 1FLEE 3NKKA 3U98H 3BTQE 4NFFA 1GJ5H 1CE5A 5DP8A 1TLDA 2ZI2H 2GVFA 2JETB 5EXNA 2A2QH 4LZ4B 2C90B 4Z6AH 1JRTA 1GHZA 4BNRA 3KHVA 1NROH 3W95A 2J5UA 5JBTA 1O3JA 4Q4LA 2IPHA 1PQ5A 1O2ZA 2QY0B 2GD4B 4O97A 3O8BA 2AMDA 4I7YH 4JK5A 3SV2H 5EG4A 1C5MD 1IOEA 4GAWA 3PROA 1OKXA 5E2PA 7KMEH 1AB9C 3MU5A 4WMEA 3LIWA 3MO3A 4BTUB 4D7GA 4AB9A 3QK1A 2RCEA 5JPMH 1G9IE 3UNRA 2BLWA 2FX4A 2H5DA 2KCAA 4ISHH 2QF5A 2R2MB 1T4UH 2YMSC 1W2KH 2WPKS 3RM0H 3M36A 4XBDA 4AN7A 3A7WA 1L1GA 3TPIZ 4BAQB 3U1JB 1F0TA 3UTUH 2QF0A 1BUIA 2FODA 3S7KB 1DOJA 3AAVA 2QAAA 3SGQE 1IQIA 3LJOA 1BMNH 1GDUA 1H8ED 2ZHDA 3QUMP 1AIXH 3UFAA 3F2FA 5EU8A 3TJOA 1GJ9B 2XTTB 2GMTB 1TGNA 3KYFA 3OFND 1O3HA 1D6RA 1P03A 2GKVE 1NU7B 1JIMA 1Y8TA 3M7UA 1N1LA 2PWXA 4RN6A 1C5PA 1QA7A 2Q1JA 1TOMH 4B1TA 3WWFA 2XCNA 2VIPA 3PLPA 1YY3A 2L74A 4B75A 1SGIB 3VGCB 2FXRA 1GL0E 2VWMA 4YO9A 2ZHFH 1QQUA 4UFGH 5T1VA 5A8ZA 2J94A 3QGJA 2R9PA 3P8NA 1HJAC 2BM2A 1HGTH 3TH3H 2CV3A 1JRSA 3TK6A 1AU8A 5L6NH 1K1JA 3R0FA 4FUBA 5A09A 2ZFQH 2QF3A 1O2NA 1A61H 2RFKC 3ATIA 2QE7D 1FUJA 1GG6C 3PM3A 1T8NA 3VB3A 4NIWA 2BYAX 3DD2H 2FLBH 1TNLA 1DS2E 2J95A 3ZZ4A 1RRKA 1O2LA 1OWDA 1V2JT 3UR6A 2Q6DA 3GDVA 3TH2H 2Z9IA 1SGNE 3EGKH 3ZYDA 2ZFRH 2A7HA 4IMQA 1UTMA 3MI4A 2XRCA 1O2IA 3JZ2B 2OLGA 2BY9X 1DWBH 2WHXA 1WQSA 1G3BA 1VGCC 4I8HA 4KTUA 1K28D 1VKYA 1GBBA 3MO6A 3CP7A 3MH7A 5K7RA 1PPHE 1AFQC 4GUXA 1TBRH 3GYMA 4X2WA 1UW7A 1GJ7B 3F9GA 2PW8H 3FKSD 1IQMA 3SZNA 3UPEA 3RXOA 4P00A 4WXIA 1P09A 3M3VA 2V35A 1FN6A 3U9AH 3MHWU 2O8LA 3T26A 1AWHB 1SGYE 3F9HA 4NSVA 5EXMA 1SGRE 3M35A 2GV6A 1E1QD 2ZDKA 2ZGHA 2QYIA 1F0RA 2VIVA 3UNQA 1BIOA 2LELA 3PO1C 4AZ2B 2PSXA 5T6GA 1W0JD 2H6MA 3A7YA 4UFEH 5F8XA 3MU4A 1TYNA 5DP4A 3A82A 2O9QA 1S6HA 5EIYA 2F9VA 2F9OA 3RXCA 4IBLH 1C5RA 1A0JA 2XWAA 2Z6BD 4XE4A 1GBDA 1ELGA 3NWUA 2NWNA 1C2LA 5B6LA 2H9HA 1W13U 2B8OH 4CH2B 1EX3A 1K1IA 3F0PA 2BQ6B 3UREA 1P3EA 1P2JA 5FXLA 4TPIZ 4XD7D 1TPOA 3PTBA 1A0HB 4ABJA 1MMJN 1KXCA 5L2ZH 1ELFA 2ZDLA 4P02A 3U1IB 1EZUC 1NRSH 2FOEA 1V2WT 1P9UA 1UK3A 2EC9H 2GDDA 3RXHA 3D23A 1DFPA 1XUGA 1MAYA 1ZRKA 2IOTA 2IN2A 1YPJH 3ELAH 4XRNA 2ZFPH 1WTGH 3VXFH 2TGDA 3P70B 1DWEH 4DIIH 4ISIH 2FZZA 4YESB 3N7EA 1HNEE 2PTNA 1EZSC 1TGSZ 1BHXF 1SOTA 2PGBB 5EQQA 1O5BB 2FIRH 2OCVB 1Y5UT 2HRVA 1DUAA 1O36A 2EY4C 1G3CA 2AHME 1HAYB 3BF6H 1FONA 1L4ZA 1DT2A 1TALA 1UVSH 1T8OA 3ZIAD 3KCGH 1MQ6A 4CH8B 4MPWA 2A4GA 3SU4A 3K6YA 2A32A 4HFPB 4NA9H 1ZMLA 2Z3EA 1QY6A 1PPFE 4ABEA 1Y3YA 2QV1A 4YXWD 3ZVFA 4A1XA 1AY6H 4DT7B 5AFYH 5GDSH 1OP0A 4ZKNU 3SJ9A 4NCYA 8GCHF 1S84A 2R3YA 3HPTB 2AGGX 3IG6B 2W26A 1C1TA 1ZSKA 4D9RA 3WY8A 3U69H 4X6OA 3W94A 1FI8A 2J2UA 5LPRA 2XBVA 2OBOA 3TJNA 1O2PA 3TGIE 5C17A 6GCHG 3MNSA 4B2AA 2ZIQH 3ZZCA 4ABGA 3EDXB 1GBAA 1C2FA 1LHFH 1Z1IA 1GI7B 3BTTE 1A5GH 3IWMA 4OS2A 2V6NA 1C1QA 3SBKA 1UK2A 1LPKB 2KCOA 1GMCG 3NXPA 3M61U 1T8MA 1C2EA 1OP8A 2JDID 1GDQA 1O31A 3WW7A 2LP6A 4IC5A 4A6LA 4MVNA 2H2ZA 1ZTKA 2HLCA 1F5KU 2LNCA 3TIUA 2BD9A 4XFQA 2A4QA 5HM2A 1SGTA 1ID5H 1NN6A 2BD4A 2Y5HA 3KIDU 2AERH 2DE9A 1F0UA 1Y3VA 1O2VA 1ZZZA 1A7SA 3P8OA 3TNSA 1CA0B 1O34A 4DVAU 1WXRA 4YLUA 1A4WH 4WF8A 1GBCA 3B8JA 3P8GA 3HKJB 5FHTA 2C4FH 2ZQ1A 1FQ3A 4Y7AA 4Z1MD 2QN5T 5IDKA 1HAOH 1BMFD 1QL9A 2GZ9A 1AO5A 3RUOA 1GJAB 1Z6EA 1WOFA 2OXSA 1FXYA 1YC0A 2RA3A 3Q00A 4K1SA 1PYTD 1GVKB 1QR3E 2F9PA 4NIVA 1O3FA 5CHAB 4MNWA 2VH6A 2TGPZ 1GJCB 1D3TB 5C1XA 2GZ7A 2BD7A 3VGCC 2ANKH 4FU8A 1C2IA 4X1QU 2CJIA 1HAIH 2C8WB 2BVSH 1KIGH 1EAWA 3ZV9A 2VH0A 2VB0A 3QTOH 4HI3A 3E1XB 3F0OA 2FO9A 5IYTA 3MQKC 1LCYA 1LO6A 1YCPH 1NRQH 4E7RG 1SGDE 1Z8GA 1O2QA 2W3IA 1YBWA 4TY7A 1A2CH 4GHQA 3A83A 3QLPH 5CE1A 1SLVB 4MNVA 1DANH 3E16B 3MTYA 2KX4A 2RG3A 4UDWH 1XUIA 1RJXB 1GBIA 2SGAA 1W3CA 1ABJH 2XYAA 1CGHA 3UQVA 3PMAB 1D3QB 1HAVB 4WWYA 3DHKH 3KF2A 1BDAA 3UIRA 3KQCA 1G3DA 3E3TA 3HGNA 4QT8C 1GMCF 1H9IE 1O2KA 1XUKA 2BLQA 3LOXA 4FXGH 3W1EA 1P8VC 2WV4A 5EW2H 1BTYA 2HPQH 1NTPA 1S82A 1YPLH 4BAKB 2VVUA 2GJGA 3C27B 1P2NA 5L2YH 3ZZ8A 2KFWA 2YMSD 4ZHLU 3FFGA 2NU1E 2ANMH 3M3TA 1NRRH 1O5DH 2A4OA 3A7VA 3F68H 4DW2U 1EOLA 1K1PA 1E34B 2GDEH 2VVCA 5FL7D 5IK2D 2XC0A 1P2QA 1EAUA 3ZV8A 2Z3CA 5CHBA 4CRGA 2HOBA 1HCGA 3SORA 2GCTB 3A87A 3KYGA 3F9EA 2I6QA 1V2VT 1LVBA 4Y11E 3LGWA 1B0EA 4NIYA 3SI3H 1O2OA 3SV8A 1ESBA 4INKA 3N7DA 4Q2KA 4ZXYH 1FY3A 5E0JA 2ZECA 1O3BA 2KM0A 1SGFG 4XSKU 1GWAA 2WUCA 1Z7KA 1IHSH 4B6EA 1BB0B 1PPBH 2ZDNA 1AD8H 4OGYA 3SW2B 1C2HA 2AGIX 1SB1H 1L2EA 3QN7A 2QXGA 3MO9A 3ATLA 1H8DH 2SGDE 3BTEE 1ZPZA 1BHXB 2FYRA 1FJSA 2JH0D 4FUHA 3SI4H 3BTWE 1ESAA 1V2PT 3MMGA 2JKHA 2GX4A 1AKSA 1NZQH 2I6SA 1C1WH 1BCUH 1O3LA 3SUEA 2O8WA 4Y8XA 2GV7A 1MKWH 1RIWB 1TMUH 3H7TA 4OM9A 1SPJA 1C1UH 2WV9A 2XBWA 1WAYB 4KGAA 5T3HA 1TB6H 3LGYA 1TX7A 2NU3E 3DT0H 4NSYA 4U32A 3UUZA 3TGJE 2B7DH 4OS4A 2QF4A 1DDJA 2Z94A 1UHBA 1GHYH 1SHHB 2OD3B 1C5UA 3GY7A 2SGQE 2C93B 1P3CA 2QIQA 2G51A 1MD8A 1ZHRA 1XMNB 5HM9A 1DITH 1ELCA 3GDUA 4ISOA 2VWOA 1CA8B 2EQNA 3STIA 1C2KA 4MDSA 2PGQB 1J15A 1QIXB 3RU4E 2BLVA 4ASHA 1NS3A 2QXJA 1U6QA 2RDEA 2XCFA 2OBQA 1KY9A 4XBBA 1XUHA 1HYLA 2VBCA 1UK4A 1GCTC 2BDYA 3AW1A 8KME2 2C8ZB 1YWUA 2FWWA 3OY6U 4AYVB 1G37A 1SMFE 3FZZA 2ZHQH 4I8LA 1T8LA 3LT3A 1EAIA 5EJ1A 2A5KA 2BHGA 2EI7A 1DE7H 1LVOA 1F0SA 3SJIA 1GJDB 1TPSA 2OK5A 3TH4H 3TLOA 4O3UA 1V2KT 5F8ZA 5T6DA 3Q3YA 3RMOH 5DP5A 1QCPA 3IITA 1MCVA 1EFRD 2SNVA 1BTHH 3SU1A 1PPCE 1NC6A 3PMJA 4CR9A 3U8TH 1C9PA 3MNCA 4SGAE 4F55A 1LPZB 2P8OB 2ALVA 3ZVEA 3OAAD 3RXAA 3M7QA 1ORFA 1UCYE 3RU4D 2DE8A 2ZHWH 3KGPA 1TRMA 1HRTH 1K1LA 3BEUA 1DY9A 2H5CA 1P06A 5DGJA 2PFEA 5H4IB 3A8DA 3MNXA 1ZHMA 3ZZ9A 1CA0C 4IN1A 2ZO3H 1P2KA 3ATMA 1SC8U 3RC6A 1FAXA 1V2NT 1BTWA 4NIXA 2FOMB 4OS1A 1LTOA 3LC5A 1EAXA 3TITA 2OC7A 4INLA 3PWCA 1GBHA 2ZEBA 1Z8RA 1OXGA 3S69A 1W14U 2ULLA 2OINA 1XXFA 2VIWA 1SSXA 4D76A 4WVPE 2CN0H 1ELVA 3ODDA 5EGMA 1HFDA 1GL1A 1AE5A 1O3DA 1FIZA 3BEFB 1O3OA 2K8IA 1Z6JH 2K1QA 4FOUC 5BPEA 2GGVB 3RMLH 3LKWA 2ZWLH 4UD9H 3VG8A 1FZZA 3RXTA 5EJZA 4AFSA 3ITIA 2J38A 2ZFFH 3N99A 1TQ7B 4X8UH 4A1VA 1MTUA 2PV9B 3TJUA 3RXVA 2EA3A 3A89A 2ODPA 1T4VH 2FTLE 4A1TA 1OYQA 2BDIA 2FEQH 5JBCS 2XW9A 4IN2A 3O8RA 1MH0A 5HIZA 4ZAEA 2WPMS 2P59A 3BTDE 2QCYA 2UUYA 1QB6A 2WINI 1HAHH 3SUFA 4ZKOU 3P17H 1NO9H 3NUMA 1TA2A 1TA6A 4KELA 1XUJA 5C1UA 1SKYE 2GTBA 4DY7B 2W6JD 1RS0A 1C1OA 4FU9A 1HAVA 1IQFA 3VEQB 2C3SA 4X1NU 4AG1A 4K3JA 3SU0A 1O5AB 2UUFB 3FVFB 4NFEA 3T2NA 2F3CE 1RTFB 2VJ1A 4DG4A 3ZZAA 1V2ST 1SLWB 3D49H 3BG4C 2KR7A 3GCHB 4BOHA 1DX5M 5DP7A 1P12E 5A0CA 2A7CA 1YPMH 2ANYA 2HVXA 2CXVA 1H9LB 4B6FA 2VWLA 2BQWB 4UONA 1MTSA 4DURA 3DFLA 1YGCH 1BTZA 2B0FA 1AUJA 5CDFE 5HGGA 1GHVH 1UTLM 3RXGA 1S83A 2H9EH 5C5NA 5GJ4B 4K1TA 1M9UA 1GBLA 1SVPA 5C3NA 3ZZ7A 3SN8A 1DWCH 3LDXH 1ZPBA 4FETA 4IGDA 2VWNA 4HG6A 1PJPA 1ANCA 3SJKA 2EI6A 4X6MA 4Y76A 1E1RD 2SFAA 5A8XA 1E0FD 2ZF0H 5EXLA 1IHTH 3RXBA 3S9BA 2BB4A 5AFZH 1Q3XA 1K1MA 2AS9A 5C0TA 1UTPA 2FOBA 5FCRA 1H1BA 1EB2A 5AVDA 1RIWC 3GISB 1PQ7A 2BX4A 8GCHG 3B9FH 2BVXH 1B7XB 1LKAA 3M5LA 2WZQA 2L6OA 1PPGE 1GBEA 1IAUA 3T28A 4R0IA 1DLKB 4JMYA 4X2YA 5GPIB 1ABIH 1WBGB 3LH1A 1DSTA 3V7TA 3ZVCA 3STJA 1D9IA 5G4BA 2ZHEH 1GBKA 1GGDC 1W12U 1SHYA 4H6TA 2GCHG 5DO4H 5F6MA 1N8OC 5ESTE 1EJMA 1YPGH 3RU4T 3TK9A 3KNXA 2HWLB 1FX0B 1H9HE 2FPZA 3RXSA 4H4FA 4YT7H 1IQKA 4AYYB 2CMYA 1NRNH 1A46H 1GI3A 1ZSLA 1YPHC 3A7XA 2ZU3A 3K6ZA 5A2MH 2O8TA 1P0SH 3EAJA 3CS0A 1AQ7A 1P11E 1ZMJA 1HB0B 5DPAA 1O3IA 8LPRA 1LHEH 1GMDG 2PSYA 2PKAB 1E37B 2Z9KA 1ZTLA 1H4WA 1TGTA 1J8AA 1C5SA 1YYY1 2YNBA 1ESTA 3Q3KA 1AKSB 5B6OA 4I32A 4CR5A 4F4OC 1GHBG 2IPQX 3VFEA 2H1UA 4RI0A 3A8CA 2FOHA 3PLKA 4JK6A 4THNH 1K1OA 1UHBB 1MQ5A 1C5NH 1TPPA 1MBQA 1ZJDA 3RXUA 3T62A 4H42U 3LGUA 3KQ5A 1O5GH 4TY6A 1SGQE 5I46H 1DXWA 4ZHAA 4Q80A 1YKTA 3K2UA 5C20A 3UAIC 1E35B 4OS6A 3CNRA 1ETTH 3ZVDA 2FOFA 4D7FA 4M7GA 4Y8YA 3I29A 1FPCH 1UCYH 4DGJA 1W8BH 2JIZD 4CHAB 2B5TB 4Q7YA 4ZMAH 4Y0ZE 1NFWA 1C5VA 1EB1H 1XXDA 4FVBA 4JYUH 2HNTC 2FYQA 5E0GA 3U8OH 1RTKA 1VJ9U 2ZQ2A 1N6YA 4ZROA 1P02A 1CBWB 1Y3XA 1OPHB 3F2HA 3Q3XA 1SGEE 1QZ8A 4GLYA 1MBMA 3V13A 1ETSH 2JETC 5C94A 2BD8A 3B23B 3MH4A 2GCHF 4Y0YE 4AX9H 5K0HA 1MCTA 2ZCLP 5JYIA 1C4Y2 3MU8A 3M5NA 4Q7ZA 3PV4A 1QA0A 2D1JA 1JXPA 1FAKH 2BMGB 1LVYA 1RTLA 2AMQA 1Z8JB 1O35A 1W7GH 2ZGBH 3LGTA 1K9OE 2SGPE 3DSPA 5EW1H 1PPZA 3UNSA 1NM6A 1PFXC 2G8TA 3F2GA 1P10A 6CHAB 1GMDF 2RA0A 2DUCA 1TNIA 2VIDA 1WUNH 3O8DA 1GBJA 3M7TA 1EJNA 4INHA 1MZAA 1G30B 2IJD1 1QJ7B 1GHBF 3LU9B 2GMTC 3SQHE 4TWWA 2FLRH 3UWIA 3A8AA 3SU3A 1SFQB 2GT8A 4X8SH 2ZTZA 3OTPA 1ETRH 4ABHA 2C8YB 4CRFA 1O2UA 4IS5A 1HIAB 2G5VA 2GZ8A 5FBEA 1F2SE 3BIUH 1GJ4H 1VZQH 2FMJA 3R3GB 1DM4B 1UTOA 5LGOA 3A8BA 4MPXA 1O3MA 4KTCA 4ZKRU 1MKXK 3HK3B 1SQRA 1MU8B 4DOQA 3K65B 2BXTH 1K2I1 2R0LA 1TX8A 2OC8A 1GI6A 2WPJS 2HGTH 1HDTH 1SL3A 2KCYA 3TNTA 3DA9B 1YP9A 1MTNB 4CRBA 1HAGE 1W0KD 3P92A 4Y79A 2R0KA 1ZHPA 1BQYA 1WSSH 3GCOA 4X1RU 2W3KA 2GT7A 1Y3UA 1O2WA 1TX6A 2AIQA 3SNAA 1ZLRA 2VIQA 2M5TA 4Y10E 1ZSJA 4HGCA 4YOJA 2CHAB 4JZEH 4KKDA 5DP3A 1TOCB 2KCPA 1KXAA 1SBWA 2VINA 2P95A 2G5NA 1P04A 2Y6TA 1FY5A 4IW4E 2OC1A 1C5OH 1IQJA 1C9TA 3SV7A 4LK4A 1GCDA 1EOJA 1GVLA 1EJAA 1O3AA 1BMAA 1UTJA 2ZG0H 3I78A 1TNHA 1UVOA 2F9BH 2XOKD 1C5LH 1V2UT 1FNIA 3QWCH 1ZGVA 3SHCH 2A31A 4CREA 2ZTXA 1NESE 2G00A 4B74A 1EPTA 1C5YB 1ZGIA 3I77A 5F03A 2HLDD 3MOCA 1QBVH 1KXDA 1WQVH 2YOLA 1TNKA 1O3CA 2XC4A 1DICA 1SI5H 4I8KA 1QB9A 1DXPA 1HAXB 2BXUH 2JJ2D 3PRDA 4YM9A 5C67A 2BDHA 4AFZA 3QZRA 3GDSA 2VVVA 1C1VH 4GHTA 2ZNKH 2ODQA 7ESTE 1KTTB 4NWKA 2BDGA 3HATH 5DK1A 1OP2A 1UTQA 2AEIH 3ZYEA 1BOQA 4X6PA 1D3PB 1FN8A 3ZZ5A 3CENA 2ALPA 4FU7A 4DIHH 1UTNA 2TGAA 2A1DB 2STAE 2XNDD 1TWXB 2PKSB 2PKAA 1BJUA 3S0NA 1T31A 3KN2A 3GCNA 2ZTYA 3T27A 1IQLA 2BY5X 4FUDA 2ZZUH 3UY9A 2BY7X 1CGIE 3BN9A 3URCA 5F8TA 4ESTE 1CVWH 3F3BA 5FX5A 2ZGJA 3A81A 1O3PB 1SGFA 1QURH 1RXPA 4YTAA 3VB6A 1KXFA 1SLXB 2AGEX 1THPB 2F4LA 2FS8A 1L4DA 5KGOA 1WDIA 3NRLA 4XBCA 3RLWH 4Q63A 3S9AA 1CSOE 4ZUHA 1VGCB 2A2XH 3A86A 5GNDA 3F6UH 2A45B 1SGPE 3SV9A 2VGCB 3FOAA 1Z71A 3GY8A 2Y7ZA 4NG9H 1OX1A 1S85A 1YCPK 2F83A 2ZU1A 1AE8H 3OY5U 4LXBH 3SU5A 1LKBA 3H7OA 4WJG2 4AC9A 3PRBA 1TONA 1V2TT 1J16A 2Y80A 1HBTH 3VB4A 2ZU5A 3QO6A 3MYWA 2PR3A 4H6SB 1VITG 1P01A 2BOHB 1GMHG 2OQUA 2Z9JA 1XUFA 2BD3A 1FY8E 5JBAS 4F48B 1SQTA 1E36B 3E8LA 2Q6GA 4CBNA 3DSGA 3GS9A 2FOAA 1CBWC 4NA8A 2WPDD 3U28C 1TFXA 5BRRE 2XBYA 2HVYB 3H09A 2QC2A 4E06H 4A5TS 3RXQA 1YF4A 4X8VH 5I25A 1VITH 2TIOA 4BXSA 2PP6A 2NU2E 5FPTA 1Z8IB 4WH6A 1NU9A 1HPGA 3ATWA 2OC0A 1TGCA 1UVPA 1ANEA 5TCAA 2XXLA 4OS5A 1CT2E 5FPYA 1ARBA 2ZC9H 2AH4X 3BIVH 4BAHB 1X7AC 2M2AA 3AW0A 2ILNA 1Q31A 5JBBS 5ABWA 2FDAA 1THRH 2FI5E 3ODFA 9LPRA 1RGQA 4ASUD 3E6PH 6CHAC 1YCPM 1W0ZU 1CGJE 4FUGA 1PYTC 4JZDH 1V2LT 1K0HA 1ZPCA 1QRZA 5J4SA 2ODYB 1FY1A 1RD3B 2BZ6H 4FUJA 1VCPA 3PV2A 2HNTE 1DUEA 3ZZ6A 3C1KA 4K5ZA 2W7UA 1MABB 4NA7A 2VNTA 4BXWA 5E0HA 1GBFA 3ENSB 3BTFE 4B2BA 2ESTE 2FI4E 2P3UB 2QXIA 2V7QD 1FV9A 1KDQA 1TRYA 2BDAA 5CHAC 5C2ZA 1JOUB 2JH5D 4Q7XA 2V3OH 1EXFA 1GHXH 1HIAA 3GY6A 2UWLA 1TMTH 3HK6B 1Q2WA 4YOGA 1BMMH 5A0BA 1SQOA 2AYWA 4M9FA 1O2RA 2CGAA 5GCHG 4FVDA 1QGFA 1O5FH 1QNJA 1HLTH 2O8MA 4O3TA 3OSYA 3QTVH 3FN8A 4J1YA 3MFJA 1C1SA 2UWOA 3PYHA 1ANBA 5AHGH 2G52A 3SV6A 1D6WA 1EUFA 1TAWA 2W6ID 1MTNC 1O30A 1SFIA 3E91A 1C1PA 5DSFA 2JJ1D 1C2GA 1UVTH 2W5EA 1GI9B 4FUFA 3SUDA 1COWD 1F5RA 2ZFSA 3QDZB 2J98A 3RXRA 1VITF 1BITA 2XNIA 2O8UA 3UOUA 1AUTC 1GMHF 2SGFE 1INCA 1NY22 5JB8S 3N7OA 2H9TH 1J9CH 5L30H 1JIRA 3P6ZB 1A1RA 5EPNA 1P9SA 3KQBA 3EYDA 2CHAC 4FUIA 1HAZB 1NFUA 3QGNB 2GP9B 1VR1H 5EQRA 5FBIA 1GJ8B 1EQ9A 4BAOB 1XKAC 2BZAA 2FOGA 2ZKSA 3OX7U 3D62A 5TCCA 3U8RH 1C5XB 1BTUA 3FP7E 3SQEE 2A7JA 1CHOG 1A3BH 1QBNA 4DT4A 3AK5A 1NRPH 3MH6A 1GBTA 3E0NB 1GVZA 3BEIB 5E2OA 1J17T 2G4TA 3SU2A 2BOKA 4ZXXH 1ARCA 2A4RA 2KAIB 1QRXA 2OUAA 3ZVAA 1OHHD 3T25A 1QFKH 3M3SA 3SZEA 3E90B 1BBRK 3SNBA 1MTVA 1XM1A 1RFNA 6ESTA 4BAMB 4SGBE 1QJ1B 1YPEH 2GCTC 5LH8A 1BRBE 1Y59T 1TQ0B 3FP8E 2BY6X 1O2SA 2OTVA 2ZPRA 1T32A 2V3HH 4UFDH 1G32B 1O3NA 3RXMA 1Y3WA 1XKBC 1LQEA 4DCDA 1VCWA 3HGPA 1AGJA 3F9FA 1DSUA 1IQGA 1OWHA 1BT7A 7GCHG 2F43B 2JH6D 3RXLA 4X6NA 3S7HB 1LVMA 1ZR0A 5C0UA 1A5HA 4MQAA 2D2DA 1C5WB 1UTKA 2TRMA 1O2GH 3RXKA 2PKSC 3LPRA 2ANWA 2AMPA 4F49A 4B73A 4DJZB 2A0QB 1WTHD 1UVUH 1V2OT 1DWDH 1F7ZA 4GCHG 3PLBA 5GCHF 1VCQA 2V3MA 3A7TA 2J4IA 3KEEA 4I86A 1KYNA 2ZDAH 1O2YA 4CRAA 1O2TA 2AFQB 3SNCA 5A0AE 4ABFA 1KXEA 2R3UA 3TJVA 1SQAA 1S81A 3LGVA 1V3XA 1EPTB 9ESTA 2TPIZ 2Z7FE 4NZQA 3SNDA 4MLFB 3UOPA 3ZZDA 1C4V2 2J97A 2VGCC 3RP2A 2Z9LA 4A92A 2F91A 3V12A 4YOIA 2ZPSA 4OGXA 5DP9A 1C1MA 4E7NA 4K69A 1S6LA 5FX6A 3QZQA 4ISNA 2F9UA 3UWJH 1C1RA 3RXEA 1HXEH 1H8HD 1OWEA 4UFFH 2AIPA 3SJOA 1CHOF 2VU8E 4MPUA 3VXEH 4VGCB 5HIYA 1WV7H 1EKBB 1MUEB 1P05A 1LHGH 1W10U 4NWLA 1ZMNA 1YLDA 1ELBA 4JZ1A 1EZQA 3RDZA 4K8BA 5EPYA 1S6FA 1OWKA 4UEHH 1KSNA 3NPSA 3UB0A 3WWBA 3LC3A 2B9LA 2UUJB 1ELDE 3V0XA 5GIBA 3FAOA 1AWFH 3DUXH 5DP6A 5EQSA 2FI3E 2BVRH 4WMDA 4GPGA 3MWIU 2P8OC 1CT0E 3GY2A 3AASA 1DPOA 1AI8H 1MD7A 1S5SA 3RC4A 3PTNA 3EA9A 3PB1E 1O2JA 1S0QA 1GJ6A 3ESTA 1TE0A 3CS7A 1GDNA 1KXBA 3RC5A 1MKXH 1OSSA 3ZVGA 3NCLA 7GCHF 2WPHS 2TGTA 5GWZA 3KQEA 1FY4A 1O32A 3EE0B 3RXFA 2CK3D 4YLQH 2QXHA 4O03A 4BANB 1C1NA 1GHAG 3ATKA 4GCHF 2VIOA 2P3TB 1O2MA 4YZUA 5ESBA 4B76A 1BTPA 4X2VA 1Y5AT 1SGCA 2XBXA 1NBME 3NK8A 3K9XB 4ABAA 1P2IA 1IQEA 1QB1A 2FS9A 3H5CB 4TPYA 3SYJA 1EASA 1OOKB 2CF9H 3URDA 2P3FH 1HXFH 3M5OA 4Y71A 1E38B 2J34A 1XX9A 1A5IA 1C2DA 4RSPA 1GI4A 1TNJA 2K0QA 1OWJA 4OS7A 3LONA 5PTPA 2ZU2A 2BDBA 1GJBB 1ANDA 1NPMA 1O38A 1K21H 2NU4E 1BBRE 1EATA 1AMHA 4MG3A 3QX5H 2WSSD 4TSFD 2ZP0H 4MPVA 1A0LA 4Z0KA 1FMGA 4RT0A 1HV7A 1GI0A 4LZ1H 5DN6D 1FDPA 1GCTB 3LGIA 3BV9B 2BLOA 3NZIA 3FO8D 1V2MT 1O5EH 3SHAH 1BJVA 2G4UA 1TGBA 1B0FA 2Y81A 5SGAE 2ZDVH 2D8WA 4FUCA 4D9QA 1TMBH 5F53A 1ELEE 2WYGA 2FX6A 4Y8ZA 1NBMD 3ZZ3A 3A7ZA 4AGKA 4AOQA 2HPPH 1QQ4A 1BZXE 2ZCHP 1BA8B 3OEHD 1O37A 4MNXA 1TIOA 2UUKB 2FOCA 1G2MA 4JYVH 3F1SB 1N6XA 3A80A 1EZXC 4WY3A 1BMLA 1KTSB 2NU0E 1O0DH 3OEED 3TVJB 1GI8B 2Y7XA 3M37A
chains in the Genus database with same CATH topology
1TBZH 2EEKA 3SJ8A 4ABBA 3PMBB 3VB7A 2Y82A 1KDQB 3UR9A 1QTFA 8ESTE 1BRUP 3GCHC 3MNBA 5HXFA 4Y7BA 1GI2A 3AAUA 1QHRB 4AFUA 4I33A 1UMAH 1SOZA 1CT4E 2WPLS 2KAIA 4NGAH 3E0PB 1IQHA 1V6DA 1CO7E 4I8GA 1OWIA 3SGAE 4B2CA 3S9CA 2Z3DA 3BTME 1Y5BT 4RKOB 2BDCA 5FAHA 1O39A 2WUBA 2BY8X 1YPKH 2QGRA 3BTKE 1D4PB 2XWBI 2ZCKP 1BRAA 1GHAF 5LPFA 4U30A 1V2QT 1QJ6B 4K1EA 1B5GH 3Q77A 1ZOMA 5HMAA 4B71A 1L1NA 2TBSA 1LQDB 1W11U 2FESH 2BX3A 2SGEE 1QL8A 5T6FA 3V3MA 4U2WA 1TNGA 2HNTF 1H8IH 1SLUB 1P2MA 2XC5A 1CHGA 2YNAA 3OTJE 3LH3A 2P16A 4O9VA 3EA7A 1EP6A 1TPAE 1Z1JA 4AG2A 1MU6B 2RDLA 2QA9E 4E05H 5C1YA 1L0ZA 1AN1E 1C2JA 2ZPQA 1CU1A 1AB9B 3RXIA 4A7IB 2A5IA 3PMHB 1ZJKA 3RXPA 2F9NA 3T5FH 1UCYK 2FM2A 4J2YB 4FUEA 4ZHMU 4NZLA 1PQ8A 2PHBA 2CF8H 1OS8A 2BD5A 1EPTC 1V2RT 3GY3A 6GCHF 2OP9A 1UO6A 3DFJA 3VB5A 4UE7H 3JZ1B 3GYLB 4RKJB 3PWBA 1O33A 3BTGE 1A3EH 5JB9S 1AVGH 3RMNH 5HYOA 1HJ8A 4R8TB 1ACBE 3G01A 4IC6A 6LPRA 1NFYA 2PLXA 3BSQA 2P94A 3OU0A 1C5ZB 3BG4B 4GSOA 2Y5FA 4JZIA 3TGKE 1TRNA 1VJAU 2OQ5A 2STBE 1T7CA 2Y5GA 1QRWA 2FTMA 2D26C 1IQNA 1S0RA 2PUXB 4AORA 2PTCE 1K1NA 1ZRBA 4ABDA 2ZA5A 1CQQA 3Q76A 4VGCC 2W7SA 2C8XB 1HJAB 1XVMA 2G81E 4I31A 3M5MA 4KTSA 4CRCA 5FCKA 3O8CA 4X1PU 2IJOB 4BTTB 2UWPA 5AF9H 4X8TH 1G2LA 5FPSA 3SU6A 3VPKA 1WCZA 1GG6B 1LHCH 3FANA 1LMWB 2ZDMA 4WMFA 3RMMH 1ELTA 4ISLA 5LPEA 1MAXA 5E8EH 1TBQH 4ABIA 2EI8A 3MU1A 4HTCH 2A5AA 3P95A 4BTIB 3ZVBA 4K2YA 3MH5A 1HAPH 1DY8A 2BQ7B 1DVAH 1MTWA 1F5LA 1JMOH 1JWTA 5DG6A 1W7XH 4Y6DA 5A8YA 2P93A 2Q6FA 2FP7B 3A84A 1LPGB 3GCTG 1MZDA 1QL7A 1AFQB 1LDTT 2ZU4A 3KQDA 1AVXA 2J9NA 4JYTA 1GI1A 3D65E 4TWYA 1PPEE 4X1SU 4ZKSU 1FIWA 4CBOA 1YPHE 4CRDA 5GXPA 5JDUB 2BTCE 3HKIB 1BRCE 3L33A 1ELAA 4ZH8A 1J14A 3GICB 5ETXA 3SOSA 3RXJA 4GVUA 4CHAC 1O3EA 3SO3A 1DLEA 5TJXA 1KLTA 2WV5A 3TU7H 2G55A 1WU1A 4K8YA 4WH8A 3LJJA 1C2MA 3FP6E 1O5CB 1O2HA 1GGDB 1ZYOA 1D3DB 1N8OB 4YT6H 4JZFH 7LPRA 2J92A 1GHWH 3PO1B 1PQAA 5CMXH 1C5QA 2HALA 1ZTJA 4IMZA 1AFEH 4TYDA 3SUGA 1C4U2 1HUTH 3SNEA 1K22H 1XVOA 4XDEA 1AVWA 2ASUB 3A85A 4XOJA 5DKMA 4X0WU 1BTXA 5EODA 4AFQA 1G36A 1GBMA 1LHDH 1NFXA 2ZGXH 1AZZA 2ZFTA 4MTBA 3RXDA 1UJ1A 4D8NA 1GPZA 3FZDA 4K60A 2PUQH 3RLYH 3ZZBA 1BBRH 3EA8A 1P2OA 5EOKA 1THSH 2THFB 4WXVA 4PROA 3SGBE 2WPIS 3AVZA 1G3EA 3L3TA 1O3KA 4AGJA 1TABE 1WYKA 3L6PA 2WYJA 4KP0A 4U01A 1KLIH 2R2WU 3TK5A 1SR5C 2Z9GA 1YM0A 2V0BA 4JCNA 1C5TA 5J4QA 1L1JA 1SG8B 3A88A 1JBUH 3OYPA 4X2XA 3T29A 1W0YH 1OYTH 5C5OA 3MU0A 3BTHE 4LOYH 4AB8A 4HZHA 3P8FA 3GOVB 5DJ7A 1AHTH 1GI5A 3GCTF 1FPHH 1O3GA 1QBOA 2ZGCA 1F92A 3KL6A 1EP5A 3UQOA 2LPRA 2BD2A 1AZ8A 3EQ0H 1YLCA 1O2XA 3RM2H 3BG8A 3GY5A 1KLJH 4I8JA 1HJ9A 3GY4A 4MNYA 1NT1A 2SNWA 1MKWK 1P57B 1FLEE 3NKKA 3U98H 3BTQE 4NFFA 1GJ5H 1CE5A 5DP8A 1TLDA 2ZI2H 2GVFA 2JETB 5EXNA 2A2QH 4LZ4B 2C90B 4Z6AH 1JRTA 1GHZA 4BNRA 3KHVA 1NROH 3W95A 5JBTA 1O3JA 2IPHA 1PQ5A 1O2ZA 2QY0B 2GD4B 4O97A 3O8BA 2AMDA 4I7YH 4JK5A 3SV2H 5EG4A 1C5MD 1IOEA 4GAWA 3PROA 1OKXA 5E2PA 7KMEH 1AB9C 3MU5A 4WMEA 3LIWA 3MO3A 4BTUB 4D7GA 4AB9A 3QK1A 2RCEA 5JPMH 1G9IE 3UNRA 2BLWA 2FX4A 2H5DA 4ISHH 2R2MB 1T4UH 1W2KH 2WPKS 3RM0H 3M36A 4XBDA 4AN7A 3A7WA 1L1GA 3TPIZ 4BAQB 3U1JB 1F0TA 3UTUH 2QF0A 1BUIA 2FODA 3S7KB 1DOJA 3AAVA 2QAAA 3SGQE 1IQIA 3LJOA 1BMNH 1GDUA 2ZHDA 3QUMP 1AIXH 3UFAA 5EU8A 3TJOA 1GJ9B 2XTTB 2GMTB 1TGNA 1O3HA 1D6RA 1P03A 2GKVE 1NU7B 1JIMA 1Y8TA 3M7UA 1N1LA 2PWXA 4RN6A 1C5PA 1QA7A 2Q1JA 1TOMH 4B1TA 2XCNA 2VIPA 3PLPA 4B75A 1SGIB 3VGCB 2FXRA 1GL0E 2VWMA 4YO9A 2ZHFH 1QQUA 4UFGH 5A8ZA 2J94A 3QGJA 2R9PA 3P8NA 1HJAC 2BM2A 1HGTH 3TH3H 2CV3A 1JRSA 3TK6A 1AU8A 5L6NH 1K1JA 3R0FA 4FUBA 5A09A 2ZFQH 2QF3A 1O2NA 1A61H 3ATIA 1FUJA 1GG6C 3PM3A 1T8NA 3VB3A 4NIWA 2BYAX 3DD2H 2FLBH 1TNLA 1DS2E 2J95A 3ZZ4A 1RRKA 1O2LA 1OWDA 1V2JT 3UR6A 2Q6DA 3GDVA 3TH2H 2Z9IA 1SGNE 3EGKH 3ZYDA 2ZFRH 2A7HA 4IMQA 1UTMA 3MI4A 2XRCA 1O2IA 3JZ2B 2OLGA 2BY9X 1DWBH 1WQSA 1G3BA 1VGCC 4I8HA 4KTUA 1K28D 1GBBA 3MO6A 3CP7A 3MH7A 5K7RA 1PPHE 1AFQC 4GUXA 1TBRH 3GYMA 4X2WA 1GJ7B 3F9GA 2PW8H 1IQMA 3SZNA 3UPEA 3RXOA 4WXIA 1P09A 3M3VA 2V35A 1FN6A 3U9AH 3MHWU 2O8LA 3T26A 1AWHB 1SGYE 3F9HA 4NSVA 5EXMA 1SGRE 3M35A 2GV6A 2ZGHA 2ZDKA 2QYIA 1F0RA 2VIVA 3UNQA 1BIOA 3PO1C 4AZ2B 2PSXA 5T6GA 2H6MA 3A7YA 4UFEH 5F8XA 3MU4A 1TYNA 5DP4A 3A82A 2O9QA 1S6HA 2F9VA 2F9OA 3RXCA 4IBLH 1C5RA 1A0JA 2XWAA 2Z6BD 4XE4A 1GBDA 1ELGA 3NWUA 2NWNA 1C2LA 2H9HA 1W13U 2B8OH 4CH2B 1EX3A 1K1IA 2BQ6B 3UREA 1P3EA 1P2JA 5FXLA 4TPIZ 1TPOA 3PTBA 1A0HB 4ABJA 1MMJN 1KXCA 5L2ZH 1ELFA 2ZDLA 3U1IB 1EZUC 1NRSH 2FOEA 1V2WT 1P9UA 1UK3A 2EC9H 2GDDA 3RXHA 3D23A 1DFPA 1XUGA 1MAYA 1ZRKA 2IOTA 2IN2A 1YPJH 3ELAH 2ZFPH 1WTGH 3VXFH 2TGDA 3P70B 1DWEH 4DIIH 4ISIH 2FZZA 4YESB 1HNEE 2PTNA 1EZSC 1TGSZ 1BHXF 1SOTA 2PGBB 5EQQA 1O5BB 2FIRH 2OCVB 1Y5UT 2HRVA 1DUAA 1O36A 1G3CA 1HAYB 3BF6H 1FONA 1L4ZA 1DT2A 1TALA 1UVSH 1T8OA 3KCGH 1MQ6A 4CH8B 4MPWA 2A4GA 3SU4A 3K6YA 2A32A 4HFPB 4NA9H 1ZMLA 2Z3EA 1QY6A 1PPFE 4ABEA 1Y3YA 2QV1A 3ZVFA 4A1XA 1AY6H 4DT7B 5AFYH 5GDSH 1OP0A 4ZKNU 3SJ9A 4NCYA 8GCHF 1S84A 2R3YA 3HPTB 2AGGX 3IG6B 2W26A 1C1TA 1ZSKA 4D9RA 3WY8A 3U69H 4X6OA 3W94A 1FI8A 2J2UA 5LPRA 2XBVA 2OBOA 3TJNA 1O2PA 3TGIE 6GCHG 3MNSA 4B2AA 2ZIQH 3ZZCA 4ABGA 3EDXB 1GBAA 1C2FA 1LHFH 1Z1IA 1GI7B 3BTTE 1A5GH 3IWMA 4OS2A 2V6NA 1C1QA 3SBKA 1UK2A 1LPKB 1GMCG 3NXPA 3M61U 1T8MA 1C2EA 1OP8A 1GDQA 1O31A 4IC5A 4A6LA 4MVNA 2H2ZA 1ZTKA 2HLCA 1F5KU 2LNCA 3TIUA 2BD9A 4XFQA 2A4QA 5HM2A 1SGTA 1ID5H 1NN6A 2BD4A 2Y5HA 3KIDU 2AERH 2DE9A 1F0UA 1Y3VA 1O2VA 1ZZZA 1A7SA 3P8OA 3TNSA 1CA0B 1O34A 4DVAU 4YLUA 1A4WH 4WF8A 1GBCA 3B8JA 3P8GA 3HKJB 5FHTA 2C4FH 2ZQ1A 1FQ3A 4Y7AA 2QN5T 5IDKA 1HAOH 1QL9A 2GZ9A 1AO5A 3RUOA 1GJAB 1Z6EA 1WOFA 2OXSA 1FXYA 1YC0A 2RA3A 3Q00A 4K1SA 1PYTD 1GVKB 1QR3E 2F9PA 4NIVA 1O3FA 5CHAB 4MNWA 2VH6A 2TGPZ 1GJCB 1D3TB 5C1XA 2GZ7A 2BD7A 3VGCC 2ANKH 4FU8A 1C2IA 4X1QU 2CJIA 1HAIH 2C8WB 2BVSH 1KIGH 1EAWA 3ZV9A 2VH0A 2VB0A 3QTOH 4HI3A 3E1XB 2FO9A 5IYTA 1LCYA 1LO6A 1YCPH 1NRQH 4E7RG 1SGDE 1Z8GA 1O2QA 2W3IA 1YBWA 4TY7A 1A2CH 4GHQA 3A83A 3QLPH 5CE1A 1SLVB 4MNVA 1DANH 3E16B 3MTYA 2RG3A 4UDWH 1XUIA 1RJXB 1GBIA 2SGAA 1W3CA 1ABJH 2XYAA 1CGHA 3UQVA 3PMAB 1D3QB 1HAVB 4WWYA 3DHKH 3KF2A 1BDAA 3UIRA 3KQCA 1G3DA 3E3TA 3HGNA 4QT8C 1GMCF 1H9IE 1O2KA 1XUKA 2BLQA 3LOXA 4FXGH 1P8VC 2WV4A 5EW2H 1BTYA 2HPQH 1NTPA 1S82A 1YPLH 4BAKB 2VVUA 3C27B 1P2NA 5L2YH 3ZZ8A 4ZHLU 3FFGA 2NU1E 2ANMH 3M3TA 1NRRH 1O5DH 2A4OA 3A7VA 3F68H 4DW2U 1EOLA 1K1PA 1E34B 2GDEH 2VVCA 2XC0A 1P2QA 1EAUA 3ZV8A 2Z3CA 4CRGA 2HOBA 1HCGA 3SORA 2GCTB 3A87A 3F9EA 2I6QA 1V2VT 1LVBA 4Y11E 3LGWA 1B0EA 4NIYA 3SI3H 1O2OA 3SV8A 1ESBA 4INKA 4Q2KA 4ZXYH 1FY3A 5E0JA 2ZECA 1O3BA 1SGFG 4XSKU 1GWAA 2WUCA 1Z7KA 1IHSH 1BB0B 1PPBH 2ZDNA 1AD8H 4OGYA 3SW2B 1C2HA 2AGIX 1SB1H 1L2EA 3QN7A 2QXGA 3MO9A 3ATLA 1H8DH 2SGDE 3BTEE 1ZPZA 1BHXB 2FYRA 1FJSA 2JH0D 4FUHA 3SI4H 3BTWE 1ESAA 1V2PT 3MMGA 2JKHA 2GX4A 1AKSA 1NZQH 2I6SA 1C1WH 1BCUH 1O3LA 3SUEA 2O8WA 4Y8XA 2GV7A 1MKWH 1RIWB 1TMUH 3H7TA 1SPJA 1C1UH 2XBWA 1WAYB 4KGAA 5T3HA 1TB6H 3LGYA 1TX7A 2NU3E 3DT0H 4NSYA 4U32A 3UUZA 3TGJE 2B7DH 4OS4A 1DDJA 2Z94A 1UHBA 1GHYH 1SHHB 2OD3B 1C5UA 3GY7A 2SGQE 2C93B 1P3CA 2QIQA 2G51A 1MD8A 1ZHRA 1XMNB 5HM9A 1DITH 1ELCA 3GDUA 4ISOA 2VWOA 1CA8B 3STIA 1C2KA 4MDSA 2PGQB 1J15A 1QIXB 3RU4E 2BLVA 4ASHA 1NS3A 2QXJA 1U6QA 2XCFA 2OBQA 1KY9A 4XBBA 1XUHA 1HYLA 1UK4A 1GCTC 2BDYA 3AW1A 8KME2 2C8ZB 3OY6U 2FWWA 4AYVB 1G37A 1SMFE 3FZZA 2ZHQH 4I8LA 1T8LA 3LT3A 1EAIA 2A5KA 2BHGA 2EI7A 1DE7H 1LVOA 1F0SA 3SJIA 1GJDB 1TPSA 3TLOA 3TH4H 4O3UA 1V2KT 5F8ZA 5T6DA 3Q3YA 3RMOH 5DP5A 1QCPA 3IITA 1MCVA 2SNVA 1BTHH 3SU1A 1PPCE 1NC6A 3PMJA 4CR9A 3U8TH 1C9PA 3MNCA 4SGAE 1LPZB 2P8OB 2ALVA 3ZVEA 3RXAA 3M7QA 1ORFA 1UCYE 3RU4D 2DE8A 2ZHWH 3KGPA 1TRMA 1HRTH 1K1LA 3BEUA 1DY9A 2H5CA 1P06A 5DGJA 2PFEA 5H4IB 3A8DA 3MNXA 1ZHMA 3ZZ9A 1CA0C 4IN1A 2ZO3H 1P2KA 3ATMA 1SC8U 3RC6A 1FAXA 1V2NT 1BTWA 4NIXA 2FOMB 4OS1A 1LTOA 3LC5A 1EAXA 3TITA 2OC7A 4INLA 3PWCA 1GBHA 2ZEBA 1Z8RA 1OXGA 3S69A 1W14U 2ULLA 2OINA