1EXFA

Exfoliative toxin a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
VSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
molecule keywords EXFOLIATVE TOXIN A
total genus 51
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA01
1FN6A 3D49H 1W12U 3E0NB 2FX6A 1ZSKA 1LDTT 1O3BA 2QXGA 3S69A 4NIVA 5EW1H 1FN8A 1W0YH 3SNEA 1FPCH 1O5BB 2BVXH 4ABDA 2BDGA 2XYAA 1ZSJA 1Q3XA 1DSTA 2GDDA 1YCPK 4UD9H 1C5TA 4FXGH 2O8LA 1BBRK 2CMYA 2F9BH 1NY22 3T25A 1O3EA 2Z3DA 2Q6FA 1AMHA 1BMNH 2BDIA 1ZRKA 1T8MA 1W11U 2H5CA 2LPRA 1G2LA 4YLUA 3RC5A 1UK3A 1A0LA 2P95A 1P01A 1AU8A 1QL8A 3MNCA 2VWLA 3GICB 3FP7E 3HGNA 1CSOE 1ABJH 2FLRH 2FWWA 1C2KA 2QC2A 2WINI 4FUEA 3BG4B 1GJ7B 3ZVEA 4D8NA 1IQHA 1H8IH 3A82A 5J4SA 1A5IA 1BTXA 4KKDA 2G5VA 2O9QA 1J9CH 1IQMA 1BQYA 1OWKA 2UUJB 2RA3A 4A7IB 2FMJA 4IMZA 3QK1A 1V2VT 3PLKA 1OP0A 2ZHEH 2STBE 1SGNE 1HB0B 2HNTF 3RXBA 3GCHB 1O2WA 1QRXA 1F2SE 2A2QH 2WYJA 1O3NA 4AFSA 1TMTH 4AN7A 2J4IA 1H4WA 2AERH 1AUJA 2ZHDA 3TH4H 4DGJA 2AIPA 3Q3YA 3TJOA 3SJKA 1MKWH 1MQ5A 5DG6A 3RXLA 6ESTA 1AKSA 1GVLA 1BUIA 1GDNA 1JMOH 4UONA 1S85A 2J9NA 3RXIA 2XC4A 5JB8S 1H9IE 9LPRA 3P8NA 2F9UA 1PPCE 2QA9E 4MNXA 3TK9A 1SLWB 1O2PA 2GP9B 1THRH 1YCPM 4IBLH 2BZ6H 3RXPA 1DFPA 1UVPA 3NZIA 3ZZBA 3AASA 1GMHG 1O2ZA 1RTKA 2JKHA 2FI5E 4ZKRU 1ANBA 2VVCA 4ZKSU 2BXTH 4TWYA 1VITG 2FM2A 2Z94A 2BVSH 1O3OA 2VIQA 1P06A 2WV5A 2BDCA 2SGQE 3GDUA 4AYVB 1GHZA 1QQUA 5JBTA 3S9CA 4R8TB 2OQ5A 2STAE 1D6RA 4NIYA 4BAMB 1SHYA 2J92A 2D26C 1LPGB 1MZAA 3UQVA 1BTPA 3RC4A 3BIVH 5HMAA 3PLPA 4Y8XA 1AFEH 1VITF 1YPEH 4B1TA 1ZMLA 2H9TH 1RD3B 3MOCA 4UFEH 1SQTA 2ZTZA 3UOPA 1YPLH 3NPSA 5TJXA 1MKXH 1P2NA 1O5FH 1C5LH 1NPMA 1WV7H 1WQVH 1CHOF 1QL7A 4Z6AH 1DLKB 1CGJE 4LK4A 1ZPCA 3LH1A 3MO3A 3STIA 1W14U 3GY7A 1KXEA 5H4IB 4GCHF 1K2I1 3EE0B 4Y8ZA 2CF9H 4MNYA 4I8JA 1XUKA 1RIWB 1FXYA 1AB9B 2GT8A 3A84A 1Q2WA 3MNBA 4IN1A 2O8MA 2GGVB 1DWBH 5DP3A 1FY4A 2Y5HA 2PHBA 1O2XA 1C9TA 1LTOA 2P59A 1UCYH 1E34B 1F7ZA 2DE9A 3SNCA 1OPHB 3BTDE 2EEKA 3I77A 2P3TB 1FIWA 1QJ6B 1MBQA 4H6SB 2AGEX 3RXTA 3TK6A 2A7CA 2QGRA 2FIRH 1DE7H 3DHKH 3V7TA 2WYGA 1K1NA 1EAIA 1FQ3A 2H9EH 4Q7YA 1P9SA 1IOEA 1YGCH 5L2YH 1GI9B 2EI8A 3UPEA 3KGPA 1P2JA 2ZHWH 4X2VA 4O97A 1TAWA 1C1PA 2HPQH 2BLVA 1DICA 1QBNA 3A8CA 4ESTE 1O3DA 2A31A 3FZZA 5EU8A 2BYAX 2JH5D 4U2WA 1GI7B 1SHHB 3URCA 2BTCE 1N6YA 1BTWA 1QRWA 1O3KA 2FTMA 7GCHG 3EQ0H 1UK2A 2GZ8A 1Y5BT 3CS7A 1RIWC 2QXJA 3VEQB 5C20A 1SLVB 1O38A 3F9GA 2BY7X 3M3TA 1M9UA 2VH6A 4K60A 2PGBB 1GHXH 1ZR0A 4JZFH 1FAXA 1NC6A 1VZQH 1RFNA 3P92A 1DITH 1C2GA 1V2ST 5FXLA 5AHGH 2V0BA 5FX5A 3SI4H 2M5TA 1SGRE 1O34A 3A89A 2ZDKA 2GKVE 3GY3A 1B7XB 3E3TA 1K1PA 4MPWA 1YKTA 5EODA 1QBOA 2OLGA 3M36A 3SU1A 3LU9B 4K8YA 1IQJA 2PLXA 1YF4A 5PTPA 1GI0A 3CENA 1LO6A 2CHAC 1ABIH 8KME2 1V2LT 5EXLA 4MDSA 3ZZ6A 1SGEE 9ESTA 1V2UT 5F8ZA 5GIBA 1O2IA 1CGHA 1LPKB 2ZDLA 1BHXF 3G01A 4WY3A 1YM0A 2CV3A 5I46H 3TGKE 1RGQA 3E8LA 2JETB 2PGQB 1HV7A 2AS9A 4MLFB 3LKWA 1C2DA 1GBHA 4FUHA 1CT2E 1ELFA 4X1RU 2UWOA 3SJIA 1FY3A 1K1IA 4SGBE 2QF3A 4GSOA 1GBDA 3B9FH 3M3SA 2A45B 3TGJE 4YM9A 3LJOA 2ANYA 2EA3A 2LNCA 4YOIA 2Q6DA 1GHYH 1XUJA 5ESBA 3OSYA 4Y8YA 3M61U 3W94A 4AG1A 3E0PB 1VJAU 2P8OC 3ZZ8A 4J2YB 5IYTA 1TPOA 3SHCH 2OP9A 1O5CB 5JB9S 2C8YB 3N7OA 1GJ5H 4Y7AA 2TGTA 4B71A 4OS5A 2PSYA 2B8OH 4CRAA 2VU8E 4I33A 4ABIA 2XC0A 4B73A 4X1NU 3UREA 1O3GA 2ZIQH 2A4OA 3CP7A 2VWMA 1C1TA 3D62A 5A0AE 1GMDF 2IN2A 4UDWH 4CBNA 2UUYA 2OQUA 3ZZ4A 3Q3KA 2Z7FE 4GCHG 2ZGJA 1HPGA 1A3EH 5A8YA 4K3JA 1AN1E 2AGIX 4JK5A 1GJ6A 1W8BH 3Q77A 2ZA5A 1KIGH 1A46H 1KDQA 1RRKA 4OGXA 4Y71A 2GV6A 2XW9A 1PJPA 2J95A 3QX5H 5E8EH 2VJ1A 2Q1JA 2P3FH 1D3QB 4X8SH 3NKKA 1C5RA 4B2BA 1D3TB 4ZHLU 2F9VA 3QZQA 2RDLA 2ZO3H 4ABEA 4WXIA 3QGJA 1Z6JH 5GCHG 3V3MA 3NUMA 1G3DA 1RTFB 2FOCA 2NU1E 1QA7A 4GVUA 2VWNA 1PQ8A 1IHTH 2WPHS 4CR5A 3RP2A 2WUBA 3VGCB 4X2XA 2HRVA 2A5IA 3ENSB 2C8ZB 5LGOA 3UUZA 1KXBA 3ESTA 2AMQA 2BZAA 2VIPA 2BD8A 4I31A 1J14A 5HYOA 1H1BA 2PW8H 2R3YA 1O2NA 1GI6A 3LGUA 3GCHC 3PMBB 2ZQ1A 1K1JA 1PYTC 5A0BA 1CBWC 1O33A 2C8WB 1GMHF 1L0ZA 1MTNC 3E16B 3IG6B 3MH4A 1YPHE 3UR6A 3U98H 4XBDA 2BD2A 3KQBA 4FUBA 3D65E 1V2PT 1NRRH 5AFZH 2TIOA 5A0CA 5A2MH 5SGAE 1YPHC 4LZ4B 3DT0H 5JBBS 1N6XA 1GJAB 1G9IE 2F91A 1FPHH 4DW2U 1UTQA 3MU1A 1CA0B 1EATA 1AIXH 3A8DA 5JYIA 1O3HA 3GCTF 3M3VA 4FUGA 4WMDA 2BY5X 3PO1B 4XOJA 2AYWA 4BOHA 1AWFH 4CBOA 3PMHB 5HM9A 4TPIZ 3ZZ7A 1SFQB 5IDKA 1Y5UT 1ANDA 1H9LB 1HIAA 2Y7ZA 2ZHFH 5LPFA 5EG4A 3LC3A 2PKSC 3LGIA 3TJVA 3MO6A 2TGAA 3PLBA 3SW2B 3B8JA 2XBYA 2ALPA 1FY5A 2XNIA 3BTQE 3SQHE 1ZPZA 1A0HB 2KAIB 1KLIH 1GBLA 2Z9IA 3UIRA 3ZZ3A 2G00A 3SORA 2ZFFH 1O2OA 3MU5A 2ZI2H 1EAWA 1HAXB 2FP7B 1GJ9B 2G4UA 1OXGA 4AZ2B 1MMJN 3BEFB 1O2GH 3EYDA 3HPTB 1P11E 2WPLS 1DX5M 2VNTA 4RKJB 2O8TA 2ZKSA 1RXPA 3NCLA 3P70B 4YT6H 2TRMA 1T8NA 4BTUB 1CO7E 3OX7U 1G3BA 4ABJA 3O8CA 1L4ZA 2XRCA 2ODPA 1TOCB 3FANA 1FMGA 1EJNA 4Y0YE 6GCHG 1A1RA 3VB3A 1C1VH 4E7NA 1W0ZU 2J38A 1PFXC 4BNRA 1TX7A 1XUGA 4TYDA 1DM4B 1G32B 1TNHA 2YNAA 1TBZH 3GCNA 4WMFA 3RLYH 1JWTA 1G30B 1O3IA 3QUMP 3ZZ9A 2W3KA 1Q31A 1W2KH 1GCTC 5DJ7A 3SGAE 3M7QA 3O8DA 2PKAB 5A8ZA 1AVXA 2BQ7B 1GJDB 3LGYA 1XVOA 4X6PA 7GCHF 1C5QA 1O5GH 2OINA 1V2QT 1C2EA 1QY6A 1QCPA 1T4VH 2HNTC 3RUOA 1O2HA 3TLOA 4MTBA 3RXOA 3HATH 3PROA 1BBRH 1C1OA 4I8LA 4D7FA 4AGJA 3NK8A 1ZLRA 3VB4A 4K1SA 1TNGA 1CA0C 2A4GA 3K2UA 1ANCA 3T28A 2TGDA 1GJ8B 2DE8A 2VINA 1C4V2 1SGDE 2ZG0H 2SNWA 4JZDH 1HFDA 1NESE 1P10A 4X8TH 1BDAA 2Z3CA 1AE8H 1ZZZA 3H7OA 1GI2A 3CS0A 1O0DH 1LVBA 2ZGCA 1E0FD 4THNH 5EPNA 3QZRA 2FX4A 4OS4A 3NWUA 2F83A 3SJ9A 1Y5AT 2GCHF 2BM2A 1KTTB 2PV9B 2P16A 4UFFH 2BD5A 4X6MA 1AD8H 4M7GA 4ABFA 5C5NA 3ATLA 1QB9A 1K9OE 2H9HA 2V35A 1AFQC 1C1WH 4B74A 1ARCA 5GWZA 3TNSA 8ESTE 1SOZA 1FY8E 2AGGX 4F4OC 1AUTC 2Y5GA 3ATKA 1VCWA 2BD7A 1GG6B 1V2WT 3P8GA 1MAXA 1MTUA 3JZ2B 1DWDH 2V3OH 1LKBA 1P0SH 1C1MA 4HI3A 3A7XA 3OY6U 1C4Y2 1QB1A 3SUFA 4BXSA 1PPZA 1TGBA 2SFAA 5EQSA 4INLA 3ZVGA 1WQSA 2BLOA 2NU0E 1SB1H 2UWLA 5T6GA 1DOJA 4WVPE 5ABWA 2ZTYA 5FAHA 2ZDMA 4XDEA 3A7TA 1INCA 3RXVA 4DJZB 6CHAB 1ZSLA 1NT1A 2ESTE 2O8WA 1ARBA 2BVRH 3PYHA 2KAIA 1SSXA 3BTWE 3ZV9A 3PB1E 2BB4A 1NO9H 4KP0A 4BTTB 2GMTC 2QAAA 1SGTA 1C5VA 1W13U 2FI3E 2GDEH 3ODFA 4NSYA 4BAQB 1PQ5A 2ZU1A 1D3PB 1RJXB 2XBWA 2Y81A 4GUXA 1LKAA 4K1TA 1KYNA 1PYTD 2ZU2A 2ANWA 3SV7A 3F68H 4WH8A 2ZHQH 1OWHA 5CE1A 2ZTXA 1NU9A 4ZKNU 2ZFSA 1J8AA 1PPGE 1EZQA 1QL9A 1VJ9U 3HK3B 1UHBB 1Z8GA 4K5ZA 1P05A 4DURA 3IWMA 4K69A 1Z8JB 2FOAA 1CGIE 3L6PA 3A81A 3SUDA 1S0RA 1O30A 2ZPRA 3VFEA 2QIQA 2B5TB 1IQGA 2ZGHA 3FP6E 1P2IA 4OS2A 4NWLA 1O3FA 1L1GA 1QA0A 1P2KA 1ELDE 2AFQB 1K21H 1XUIA 1GBEA 3FP8E 1O2KA 1WYKA 3RXSA 2FPZA 4OS6A 2ZP0H 1GI5A 4Y11E 1S6FA 3SOSA 3ZYDA 2C3SA 3RXRA 1XXDA 4NA7A 1SGFA 5FPYA 3URDA 1V2OT 1N8OB 1UHBA 1MKXK 3O8BA 1EKBB 2PR3A 1HAYB 4INHA 1T4UH 3UFAA 2SGFE 1UK4A 2ZFPH 1JRTA 1ZTKA 3P95A 1RS0A 1C2LA 1HXFH 3GYLB 4FVBA 1GBKA 1JOUB 1E35B 1Y8TA 2F9NA 3P17H 2A4QA 4ZROA 1P2OA 4B75A 3SNAA 2XWBI 3RXCA 5C67A 1Y3UA 5E0HA 2HGTH 3MU8A 1GDUA 1ZTJA 1UTPA 3AAUA 3M37A 1IQKA 2A0QB 2FOHA 3U8TH 2ZCLP 1ZGVA 1OYTH 4K2YA 3KCGH 2W5EA 1FV9A 1C2HA 2ZFQH 1FLEE 1WU1A 1E38B 4LXBH 2ZCKP 5L30H 3RXQA 3LPRA 1BA8B 1OSSA 4CH8B 2J34A 4LZ1H 1FUJA 3MFJA 2ZDVH 1O2SA 1GJ4H 2NU2E 4Y10E 3LT3A 3FVFB 3RM0H 3A7VA 1WBGB 4MNWA 4WWYA 3TNTA 4X6NA 3UWIA 3C1KA 1HCGA 1GVZA 1XUFA 2BLQA 1GI4A 1SVPA 3DUXH 3RXMA 3E90B 2NU4E 8GCHG 2GVFA 1C5XB 3U69H 4UEHH 5LPRA 1JXPA 1YP9A 3RM2H 1ZJKA 3M5MA 4LOYH 5CHAC 3JZ1B 3RU4T 2XCFA 4A1TA 2EI7A 3T26A 5C2ZA 1O2JA 3SNDA 3OTJE 4A92A 3A87A 3UY9A 3F1SB 3SUGA 2BXUH 1O37A 1TONA 3D23A 1ETTH 4UFGH 2ALVA 2A2XH 2Z9LA 2XXLA 2BD9A 1PPFE 2ZNKH 4IN2A 2CJIA 1KXFA 2QXHA 1Z1IA 1P09A 4Q7ZA 1RTLA 3L33A 3LONA 1GBJA 1MU6B 2BY8X 2B7DH 5JPMH 4BAKB 3U8OH 3MTYA 2ZDNA 5GJ4B 6GCHF 1OX1A 3IITA 1H9HE 3GY5A 2OBOA 1BRAA 3PO1C 4AORA 4DOQA 1O5DH 4WMEA 1S83A 3TH2H 3HGPA 1EX3A 3SBKA 3EA8A 1TLDA 3AVZA 5FBIA 3ZZDA 2XCNA 3TIUA 1W10U 3E6PH 3RXHA 2WPIS 4AGKA 1P03A 1XX9A 1VCPA 3RXEA 2VIOA 1ZJDA 2QY0B 4MPUA 3SGBE 4ZH8A 2HVXA 2HNTE 4WF8A 5EGMA 1THPB 2BD4A 1GBBA 1K1LA 4IC6A 5ETXA 1CBWB 1QIXB 2BDYA 5BRRE 4HFPB 3UNQA 2Y82A 3MH7A 4U30A 2GCTC 3A83A 5DP7A 1BCUH 2BOKA 1G36A 3SO3A 3LJJA 3T62A 1CHOG 2IPHA 3F9HA 3GY6A 4TY7A 2YOLA 4Y6DA 2R0KA 3DD2H 1KDQB 1T8LA 3UNRA 1AVGH 2VH0A 3ZV8A 4NIXA 1UTNA 2BLWA 1XMNB 2R3UA 1GHBG 1TPSA 1B0FA 2VVVA 1ZOMA 1GBFA 1P12E 3ATIA 1TQ0B 2QN5T 2V3HH 1QGFA 3SJ8A 2VVUA 1AVWA 3RXGA 1V2JT 3LIWA 1J17T 1NRPH 2FOFA 4JYVH 2ODYB 1TBQH 4ISHH 1NRQH 5EXNA 1EB2A 3W95A 1SGQE 3GY8A 1W7GH 1LMWB 1OKXA 3BTHE 3DFJA 3BTME 3PMAB 1FDPA 4GHQA 1O2LA 1UVUH 3PTBA 4XE4A 1NFXA 4NCYA 4FU8A 1P9UA 3BTTE 4CRBA 3SUEA 4XBCA 4JZEH 1DDJA 2OC1A 1GI3A 1BIOA 1AHTH 3RC6A 3ODDA 1BTYA 1GHBF 1OWJA 2YNBA 1TIOA 1EP6A 1WTGH 2G52A 2BX3A 1TOMH 3HKIB 5LPEA 1MCTA 1NZQH 1XKBC 2FYQA 4WXVA 3VB7A 4D9QA 2VIDA 2THFB 1GPZA 1SQOA 1UTJA 3MU4A 1GMCG 1WSSH 3OYPA 1P3EA 3PV4A 3TJNA 4DCDA 1KXAA 2BOHB 2G5NA 4J1YA 4AX9H 1GJBB 1AGJA 2R0LA 1JIMA 4FU7A 3VPKA 3QO6A 1HLTH 3UNSA 4AFUA 3HKJB 2OUAA 3BTGE 1TRNA 1BBRE 1TX8A 2VGCC 4Y79A 1EAUA 3L3TA 1HIAB 4FU9A 1SGCA 2XC5A 1G2MA 3SNBA 1MCVA 1LHFH 1GG6C 4DIIH 3OY5U 2OXSA 2CXVA 5DKMA 4JCNA 1BTZA 2QF0A 2FDAA 4E05H 1CHGA 4X1PU 2VB0A 4JZIA 1CT4E 1AE5A 1IQNA 5DO4H 7ESTE 2H6MA 2OTVA 1EXFA 2XTTB 3ZVCA 3ZZAA 3B23B 4O3UA 4ZXYH 1UTKA 3E91A 1K22H 1LVOA 1O35A 1GHAG 3KL6A 1FI8A 1CT0E 3QLPH 2FESH 2FOMB 5DP4A 1BHXB 1YPKH 1V2MT 1J16A 1AI8H 3TGIE 1A5HA 3QTOH 2Z3EA 3KQDA 1NN6A 3F6UH 1O3JA 4OS7A 3SU5A 3T27A 3M5LA 4Y7BA 5T6DA 4AFQA 4Q2KA 4ASHA 1B5GH 5DP6A 1MD8A 1EZSC 1O2TA 2ODQA 4GLYA 2W3IA 4NFEA 3H7TA 4BAHB 1BOQA 3P6ZB 1K1OA 4ABGA 3A85A 4DIHH 1VR1H 1PPEE 4TY6A 2XBVA 1KLJH 1C5UA 4X8VH 1SLUB 1P2MA 1SGFG 1SGIB 1BT7A 4FUDA 2SNVA 1U6QA 3S0NA 2HALA 4X0WU 2HWLB 3RXAA 3V0XA 1QFKH 1IQIA 4H6TA 1DPOA 1LHGH 3R3GB 5I25A 4ABAA 2WPMS 2W7SA 2RG3A 1WAYB 4RKOB 4WH6A 5E2PA 1UJ1A 4YO9A 1HRTH 4FUFA 3SU2A 1O2MA 1DANH 1Y3VA 1EJMA 2R9PA 1X7AC 4RN6A 4D9RA 3AW1A 1C1NA 1ZPBA 2ZU5A 4XSKU 4MG3A 4YOGA 1CE5A 3A8AA 4A5TS 1O2UA 3RMMH 3ITIA 2A1DB 2A5KA 2BY6X 1ETRH 3BV9B 1NFUA 2UUKB 4ZUHA 1ZYOA 1DVAH 1A7SA 1QQ4A 5TCAA 4ISIH 1T31A 5JBAS 1B0EA 1G3CA 3GY4A 3P8FA 3VB6A 1FZZA 1L4DA 5AF9H 1NS3A 1F92A 1QB6A 1C1SA 1OWDA 5AVDA 3LOXA 1C5YB 2HPPH 1MTWA 4SGAE 2AEIH 6LPRA 1SI5H 4A1VA 5E2OA 4X6OA 5C1XA 1SL3A 1F5RA 1HBTH 1ELCA 2BD3A 1HYLA 1O36A 3UTUH 4X2WA 5DPAA 1HUTH 5BPEA 3STJA 1GI8B 1UVOA 4MPXA 1ELBA 4MVNA 1S81A 1YYY1 1O3CA 1IQFA 4NFFA 4AOQA 3K9XB 1ELVA 2IJOB 4IC5A 5HGGA 1ETSH 2SGDE 1GBTA 4ISLA 1QNJA 3BIUH 1AQ7A 5E0GA 3ELAH 3DFLA 4AFZA 1V2TT 4B2AA 1GBAA 1QTFA 1DXPA 1ZHMA 1AFQB 1C2FA 4NG9H 1YPMH 1GWAA 1DUAA 2XBXA 4TPYA 3S7KB 3KQCA 2C93B 3GDSA 3QTVH 4Y0ZE 3O8RA 3RU4E 1T32A 2ZECA 2OBQA 1XVMA 2VWOA 1UCYK 1N8OC 1YLCA 1IQLA 1F0RA 3H5CB 2WPKS 3BG8A 2ZEBA 3RU4D 3PTNA 4KTSA 3SQEE 4VGCB 1EOJA 1TMBH 2EI6A 1LPZB 3A86A 1OP8A 2Z9GA 5J4QA 1C2JA 1QJ7B 2FYRA 3KHVA 2D8WA 2ZFRH 4H42U 5GDSH 3RLWH 5F03A 3VXEH 2GV7A 1TYNA 1MBMA 4NGAH 5F6MA 3EA9A 1QJ1B 2I6QA 5F8XA 4E7RG 1UVSH 1MTNB 1Y3WA 2GT7A 2ZZUH 5FPTA 3M35A 3LH3A 1O2QA 2R2WU 2ZF0H 1AZ8A 4GPGA 1MU8B 1C5PA 2WPJS 1HAVB 1SMFE 2C4FH 3E1XB 2A32A 1TGTA 4CRCA 3VGCC 1HAPH 5C3NA 1BZXE 4KTUA 5EW2H 1O2YA 1YC0A 4U32A 3QGNB 1TE0A 5C1UA 1AB9C 1NROH 3BTKE 1ESBA 5GXPA 4JZ1A 2BDBA 4NA8A 2FZZA 5A09A 1LQEA 2QCYA 1GGDC 5CHAB 8LPRA 2C90B 5DK1A 4ZMAH 4JK6A 5DGJA 4AYYB 3ZVAA 1HXEH 1EPTB 3RMLH 1T8OA 3RMNH 1C4U2 1EPTC 4BXWA 1S84A 1SOTA 2J2UA 3P8OA 1OWEA 2H1UA 2FI4E 4Z0KA 1GHAF 1BTUA 1O2RA 1V2RT 1KXDA 1EZXC 2GZ9A 2ILNA 1FJSA 2JETC 2A5AA 2W26A 4IW4E 2G55A 1G37A 2ZQ2A 1TALA 1FAKH 1C5SA 2F9OA 1C1QA 1QHRB 4FUJA 1C5WB 1TNJA 3M7TA 1GGDB 2ZGBH 1F0UA 1S0QA 1WCZA 1MAYA 4OGYA 1ZMJA 4CR9A 1VGCC 2PSXA 5B6OA 2PWXA 3Q00A 2ANKH 3A7WA 1IHSH 3KQEA 1OP2A 2AMPA 1Z6EA 2D1JA 1GBMA 3ZYEA 2FEQH 3LGTA 2VGCB 3KIDU 2JH6D 5CMXH 4KTCA 1BITA 3GISB 3Q3XA 2NWNA 3GY2A 2ZCHP 1WOFA 1MTVA 1MKWK 1PPBH 1DY8A 3BEIB 3MO9A 3SGQE 1E36B 4NWKA 1A5GH 4YESB 1HAHH 1LHDH 1KSNA 4GHTA 1L2EA 1P04A 1XXFA 4IGDA 1DXWA 1TRYA 4E06H 2BDHA 4ZAEA 1ELEE 1TNLA 2Y80A 2V6NA 1VGCB 1Z7KA 4VGCC 4AB8A 3AW0A 4OS1A 1Z8RA 3S7HB 3SZNA 1S5SA 1TGNA 1MZDA 3ZZCA 1OWIA 3BF6H 1HJ8A 4H4FA 2B9LA 4B76A 1PQAA 1O31A 1BRCE 4AB9A 4AG2A 3A8BA 5T3HA 2A7HA 4ZHMU 5FHTA 2C8XB 1GCTB 4MQAA 1Z8IB 4JYTA 3U1IB 4DVAU 1JIRA 4DG4A 1CVWH 1HDTH 2BQ6B 4GAWA 2BDAA 1O3PB 4CHAC 1BRUP 1GL1A 2OCVB 1GBIA 1YBWA 2QYIA 4Q7XA 4A1XA 1NTPA 3A7ZA 1O3LA 2B0FA 1LQDB 3TPIZ 4BAOB 2G4TA 2OC0A 1W7XH 1SBWA 1HAOH 4FUIA 1TABE 1HAGE 1TPPA 3C27B 3LC5A 1L1NA 3GDVA 4F49A 3UQOA 1HAVA 2FOEA 1V2NT 1KY9A 1ZTLA 2WUCA 1HGTH 5HXFA 3RXKA 4NZLA 5EPYA 1A4WH 3GCTG 5FCRA 1O2VA 1P2QA 1UTLM 2G81E 3TJUA 3ZVFA 1V3XA 3ZVDA 2FTLE 1D6WA 3SHAH 1BTHH 1F0SA 1KLTA 2UUFB 4K8BA 4HZHA 3TU7H 1DWCH 4WJG2 3R0FA 3U8RH 5EXMA 2JH0D 1HJAB 3AAVA 4ZHAA 1Y59T 1TA6A 1FONA 1WTHD 4YOJA 1EP5A 2FLBH 2GCTB 2ZU4A 5FBEA 2PKAA 1PQ7A 3SV8A 3VXFH 2TPIZ 4D76A 1SG8B 4K1EA 3SU0A 1D3DB 3TITA 3BN9A 1O3AA 2P93A 1TNIA 1SFIA 3GOVB 4X1SU 1L1JA 1G3EA 1GCDA 1EB1H 1C5OH 1MQ6A 2ZC9H 1JRSA 3DA9B 2Y5FA 4UFDH 5EOKA 1NU7B 5ESTE 2AIQA 1N1LA 1GI1A 1CA8B 2OC8A 3MI4A 4B2CA 2PFEA 1SGPE 1K28D 1GHVH 5JBCS 1ZRBA 5AFYH 3MMGA 3PWCA 5JDUB 1A0JA 3QWCH 2H5DA 3BSQA 1KXCA 2UWPA 1YCPH 2AMDA 5FX6A 3KEEA 1GL0E 2WV4A 1TQ7B 3I29A 1NRNH 1D9IA 1LHEH 4HTCH 1S82A 1AY6H 4CHAB 4YZUA 1D4PB 3VB5A 1ZHPA 3HK6B 2BMGB 2CGAA 1A2CH 1Z71A 1CQQA 1HAZB 4JYUH 3ZZ5A 1H8DH 1S6HA 1TNKA 3RDZA 3NXPA 5EQRA 1AWHB 3OU0A 4BANB 1SQAA 1OYQA 1EUFA 2AH4X 2ULLA 1BMLA 2FXRA 1ESAA 2PKSB 2TGPZ 3EAJA 1MD7A 3MYWA 1F5LA 3TVJB 2Z9KA 1MH0A 1IQEA 1AZZA 5FPSA 1DLEA 3T29A 2BY9X 4Y76A 3MNSA 1AKSB 3I78A 1HNEE 4NIWA 3RXDA 1YLDA 4R0IA 1SC8U 2RCEA 4IS5A 3SU3A 2GCHG 2ZGXH 1TWXB 2Y7XA 3ATMA 4O03A 3K6YA 2FOGA 3KN2A 3FAOA 2ASUB 3UWJH 5FCKA 2EC9H 4XBBA 1SPJA 2HLCA 2ZWLH 1TA2A 1XKAC 1MTSA 1V2KT 1W3CA 1HJ9A 4I8HA 3EDXB 5G4BA 5L6NH 1P57B 3T5FH 2Z9JA 3K65B 3QDZB 5F8TA 1OS8A 3V13A 3S9BA 2ZPSA 4ZXXH 2PUQH 4D7GA 2Z6BD 2QV1A 3S9AA 1XM1A 4ISOA 1Z1JA 3T2NA 1MUEB 2W7UA 1DSUA 4I32A 1GMCF 1IAUA 3UR9A 1GBCA 1TB6H 3LGVA 4QT8C 2SGPE 3BEUA 4DY7B 1A3BH 2Q6GA 1DWEH 3SN8A 3M5OA 1K1MA 1P8VC 1QURH 5LH8A 2QXIA 1ELAA 3K6ZA 2H2ZA 2G8TA 2XWAA 1JBUH 1UTOA 1XUHA 2SGAA 3QN7A 1NFYA 5C1YA 2CF8H 1C5MD 4CRFA 2RA0A 1BRBE 5TCCA 1O39A 2R2MB 2VIVA 5GPIB 4A6LA 3RXUA 4UE7H 1C9PA 2GD4B 2D2DA 4DT7B 1BJVA 4PROA 2G51A 1YPGH 4ABBA 1EQ9A 3GYMA 1QR3E 5T6FA 2ZDAH 1BMMH 1UVTH 2GZ7A 3MH6A 4ISNA 2GX4A 1ID5H 3F9EA 1LHCH 1UCYE 1NM6A 1ZMNA 4IMQA 3RXFA 1C1UH 3ATWA 1KTSB 4XFQA 2PUXB 5DP9A 4NZQA 1O32A 3PM3A 2FS8A 2BQWB 1ZHRA 3LDXH 3SU4A 4MNVA 1GJCB 1C2IA 3MWIU 2HOBA 2ZFTA 3EGKH 1TBRH 2P3UB 2NU3E 1SR5C 2F9PA 1HAIH 3KNXA 2GMTB 5GCHF 1A61H 1GDQA 1E37B 3MHWU 1EOLA 2P8OB 1VITH 5L2ZH 1TMUH 1TRMA 1P3CA 4YT7H 1O5EH 3TK5A 3SJOA 3M5NA 1WUNH 1THSH 1V6DA 3RMOH 4TWWA 5K0HA 2CN0H 3SU6A 2BHGA 3F9FA 3GCOA 1J15A 1C1RA 3FFGA 2ZPQA 3KF2A 1EJAA 3V12A 1LVYA 2A4RA 4Q80A 1TFXA 1P02A 2DUCA 4X1QU 3WY8A 3U9AH 4ABHA 2F3CE 1QBVH 3Q76A 4CRDA 3BTFE 1ELGA 4JMYA 5EQQA 2Y6TA 1C5NH 1F5KU 1ACBE 4MPVA 4NA9H 3SV6A 4KELA 1UO6A 1VCQA 4CH2B 3A88A 1SLXB 2FODA 2O8UA 1NRSH 1EAXA 1LVMA 4FVDA 1Y3XA 1FIZA 4O9VA 2CHAB 3PWBA 1LCYA 1PPHE 4RSPA 2OD3B 3BTEE 1DT2A 1ESTA 4FUCA 4INKA 3SV2H 3PMJA 1TGSZ 1BJUA 4YTAA 5HM2A 2FOBA 3A80A 1SGYE 4X2YA 2ZU3A 1C2MA 3UOUA 1UMAH 1ANEA 3BG4C 7KMEH 1C5ZB 4U01A 1HJAC 1UTMA 1EASA 4I7YH 1DUEA 1O3MA 4I8KA 2TBSA 4HGCA 4CREA 1Y3YA 2SGEE 3MNXA 2ANMH 4YLQH 3M7UA 1FY1A 1DY9A 1TPAE 4X8UH 2J94A 4O3TA 4I8GA 5E0JA 1TGCA 2IOTA 1DS2E 1CU1A 1GHWH 2GTBA 2PTCE 1NFWA 1ZGIA 4BTIB 2A7JA 1ELTA 2PTNA 1GVKB 4CRGA 1QRZA 8GCHF 2OC7A 3MH5A 1BB0B 6CHAC 2VIWA 4ZKOU 3A7YA 2K1QA 1F0TA 1EPTA 2BX4A 3FZDA 1OOKB 3SV9A 1FNIA 3TH3H 3EA7A 2FS9A 4NSVA 1BMAA 3MU0A 1EZUC 1AO5A 2FO9A 7LPRA 5A8XA 3ZVBA 2P94A 1YPJH 3U1JB 5DP5A 5C5OA 4KGAA 1T7CA 3RXJA 2I6SA 1ORFA 5K7RA 3LGWA 1TX6A 3SI3H 5DP8A 1O5AB 1GMDG
chains in the Genus database with same CATH superfamily
1FN6A 3D49H 1W12U 3E0NB 2FX6A 1ZSKA 1LDTT 1O3BA 2QXGA 3S69A 4NIVA 5EW1H 1FN8A 1W0YH 3SNEA 1FPCH 1O5BB 2BVXH 4ABDA 2BDGA 2XYAA 1ZSJA 1Q3XA 1DSTA 2GDDA 1YCPK 4UD9H 1C5TA 4FXGH 2O8LA 1BBRK 2CMYA 3CNRA 2F9BH 1NY22 3T25A 1O3EA 2Z3DA 2Q6FA 1AMHA 3F2HA 1BMNH 2BDIA 1ZRKA 1T8MA 1W11U 2H5CA 2LPRA 1G2LA 4YLUA 3RC5A 1UK3A 1A0LA 2P95A 1P01A 1AU8A 1QL8A 3MNCA 2VWLA 3GICB 3FP7E 3HGNA 1CSOE 4TT3D 1ABJH 2FLRH 2FWWA 1C2KA 2QC2A 2WINI 4FUEA 3BG4B 1GJ7B 3ZVEA 4D8NA 1IQHA 1H8IH 3A82A 5J4SA 1A5IA 1BTXA 4KKDA 2G5VA 2O9QA 1J9CH 1IQMA 1BQYA 1OWKA 2UUJB 3PV5A 2RA3A 4A7IB 2FMJA 4IMZA 2RDEA 1V2VT 3PLKA 1OP0A 3QK1A 2ZHEH 2STBE 1SGNE 1HB0B 2HNTF 3RXBA 3GCHB 1O2WA 1QRXA 1F2SE 2A2QH 2WYJA 1O3NA 4AFSA 1TMTH 4AN7A 2J4IA 1H4WA 2AERH 1AUJA 2ZHDA 3TH4H 4DGJA 2AIPA 3Q3YA 3TJOA 3SJKA 1MKWH 1MQ5A 5DG6A 3RXLA 6ESTA 1AKSA 1GVLA 1BUIA 1GDNA 1JMOH 4UONA 1S85A 2J9NA 3RXIA 2XC4A 5JB8S 1H9IE 9LPRA 3P8NA 2F9UA 1PPCE 2QA9E 4MNXA 3TK9A 1SLWB 1O2PA 2GP9B 1THRH 1YCPM 4IBLH 2BZ6H 3RXPA 1DFPA 1UVPA 3VG8A 3NZIA 3ZZBA 3AASA 1GMHG 1O2ZA 1RTKA 2JKHA 2FI5E 2J98A 4ZKRU 1ANBA 2VVCA 3WWBA 4ZKSU 2BXTH 4TWYA 1VITG 2HVYB 2FM2A 2Z94A 2KCPA 2BVSH 1O3OA 2VIQA 1P06A 2WV5A 4YXWD 2BDCA 2SGQE 3GDUA 4AYVB 1GHZA 1QQUA 4ACAA 5JBTA 3S9CA 4R8TB 2OQ5A 2STAE 1D6RA 4NIYA 4BAMB 1SHYA 3N7EA 2J92A 2D26C 1LPGB 4I86A 1MZAA 3UQVA 1BTPA 3RC4A 3BIVH 5HMAA 3PLPA 4Y8XA 1AFEH 1VITF 1YPEH 4B1TA 1ZMLA 2H9TH 1RD3B 3MOCA 4UFEH 1SQTA 2ZTZA 3UOPA 1YPLH 3NPSA 1QZ8A 5TJXA 1MKXH 1P2NA 1O5FH 1C5LH 1NPMA 1WV7H 1WQVH 1CHOF 1QL7A 4Z6AH 1DLKB 1CGJE 4LK4A 1ZPCA 3LH1A 3MO3A 3STIA 1W14U 3GY7A 1KXEA 5H4IB 4GCHF 1K2I1 3EE0B 4Y8ZA 2CF9H 4MNYA 4I8JA 1XUKA 1RIWB 1FXYA 5FL7D 2KR7A 1AB9B 2GT8A 3A84A 3OAAD 1Q2WA 3MNBA 4IN1A 2O8MA 2GGVB 1DWBH 5DP3A 1FY4A 2Y5HA 2KCAA 2PHBA 1O2XA 1C9TA 1LTOA 2P59A 1UCYH 1E34B 1F7ZA 2DE9A 3SNCA 1OPHB 2LP6A 2EEKA 3BTDE 3I77A 2P3TB 1FIWA 1QJ6B 1MBQA 4H6SB 2AGEX 3RXTA 3TK6A 2A7CA 2JJ1D 2QGRA 2FIRH 1DE7H 3DHKH 3V7TA 2WYGA 1K1NA 1EAIA 1FQ3A 2H9EH 4Q7YA 1P9SA 1IOEA 1YGCH 5L2YH 1GI9B 2EI8A 3UPEA 3KGPA 1P2JA 2ZHWH 4X2VA 4O97A 1TAWA 1C1PA 2HPQH 2BLVA 1DICA 1QBNA 3A8CA 4ESTE 1O3DA 2A31A 3FZZA 5EU8A 2BYAX 2JH5D 4U2WA 1GI7B 1SHHB 3URCA 2BTCE 1N6YA 1BTWA 1QRWA 1O3KA 2FTMA 7GCHG 3EQ0H 1UK2A 2GZ8A 1Y5BT 3CS7A 1RIWC 2QXJA 3VEQB 5C20A 1SLVB 1O38A 3F9GA 2BY7X 3M3TA 1M9UA 2VH6A 4K60A 2PGBB 3OE7D 1GHXH 1ZR0A 4JZFH 1FAXA 1NC6A 1VZQH 1RFNA 3P92A 1DITH 1C2GA 1V2ST 5FXLA 5AHGH 2V0BA 5FX5A 3SI4H 2M5TA 1SGRE 1O34A 3A89A 2ZDKA 2GKVE 3GY3A 1B7XB 3E3TA 1K1PA 4MPWA 1YKTA 5EODA 1QBOA 2OLGA 3M36A 3SU1A 3DSOA 3LU9B 4K8YA 2QE7D 2W6JD 1IQJA 2PLXA 4XD7D 1YF4A 5PTPA 1GI0A 3CENA 1LO6A 2CHAC 1ABIH 8KME2 1V2LT 5EXLA 4MDSA 3ZZ6A 1SGEE 9ESTA 1V2UT 3H09A 5F8ZA 5GIBA 1O2IA 1CGHA 1LPKB 2ZDLA 1BHXF 3G01A 4WY3A 1YM0A 2CV3A 5I46H 3TGKE 1RGQA 3E8LA 2JETB 1YLNA 2PGQB 1HV7A 2AS9A 4MLFB 3LKWA 1C2DA 2KZ4A 1GBHA 4FUHA 1CT2E 1ELFA 4X1RU 2UWOA 3SJIA 3WWFA 1FY3A 1K1IA 4SGBE 2QF3A 4GSOA 1GBDA 3B9FH 3M3SA 2A45B 3TGJE 4YM9A 3LJOA 2ANYA 2EA3A 2LNCA 4YOIA 2Q6DA 1GHYH 1XUJA 5ESBA 2V7QD 3OSYA 4Y8YA 3M61U 3W94A 4AG1A 3E0PB 1VJAU 2P8OC 3ZZ8A 2J97A 4J2YB 5IYTA 1TPOA 3SHCH 2OP9A 1O5CB 2QF5A 5JB9S 2C8YB 3N7OA 1GJ5H 4Y7AA 2TGTA 4B71A 4OS5A 2PSYA 2B8OH 4CRAA 2VU8E 4I33A 4ABIA 2XC0A 4B73A 3ZIAD 4X1NU 3UB0A 1O3GA 3UREA 2ZIQH 2A4OA 3CP7A 2VWMA 1C1TA 3D62A 5A0AE 1GMDF 2IN2A 4UDWH 4CBNA 2UUYA 2OQUA 3ZZ4A 3Q3KA 2Z7FE 4GCHG 2ZGJA 1HPGA 1A3EH 2K8IA 5A8YA 4K3JA 1AN1E 2AGIX 4JK5A 1GJ6A 1W8BH 3Q77A 2M2AA 2ZA5A 1KIGH 1A46H 1KDQA 1RRKA 4OGXA 4Y71A 4Q4LA 2GV6A 2XW9A 1PJPA 2J95A 3QX5H 5E8EH 2VJ1A 2Q1JA 2P3FH 1D3QB 4X8SH 3NKKA 1C5RA 4B2BA 1D3TB 4ZHLU 2F9VA 3QZQA 2RDLA 2ZO3H 1VKYA 4ABEA 4WXIA 3QGJA 1Z6JH 5GCHG 3V3MA 5C0UA 3NUMA 1G3DA 1RTFB 2FOCA 2NU1E 1QA7A 4GVUA 3DSGA 2VWNA 1PQ8A 1IHTH 2WPHS 4CR5A 3RP2A 2WUBA 3VGCB 4X2XA 2HRVA 2A5IA 3ENSB 2C8ZB 5LGOA 3UUZA 1KXBA 3ESTA 2AMQA 2BZAA 3DSPA 2VIPA 2BD8A 4I31A 1J14A 5HYOA 1H1BA 2PW8H 2R3YA 1O2NA 1GI6A 3LGUA 3GCHC 3PMBB 2ZQ1A 1K1JA 5T1VA 1PYTC 5A0BA 1CBWC 2C8WB 1O33A 1GMHF 1L0ZA 1MTNC 3E16B 3IG6B 3MH4A 1YPHE 3UR6A 3U98H 4XBDA 2BD2A 3KQBA 4FUBA 3D65E 1V2PT 1NRRH 5AFZH 5IK2D 2TIOA 5EIYA 5A0CA 5A2MH 5SGAE 1YPHC 4LZ4B 4RI0A 3DT0H 5JBBS 1N6XA 1GJAB 1G9IE 2F91A 1FPHH 4DW2U 1UTQA 3MU1A 1CA0B 1EATA 1AIXH 3A8DA 5JYIA 1O3HA 3GCTF 3M3VA 4FUGA 4WMDA 2BY5X 3PO1B 4XOJA 2AYWA 4BOHA 1AWFH 4CBOA 3PMHB 2OK5A 5HM9A 4TPIZ 3ZZ7A 1SFQB 5IDKA 1Y5UT 1ANDA 1H9LB 1HIAA 2Y7ZA 2ZHFH 5LPFA 5EG4A 3LC3A 3PRBA 2PKSC 3LGIA 3TJVA 3MO6A 2TGAA 3PLBA 3SW2B 3B8JA 2XBYA 2ALPA 1FY5A 2XNIA 3BTQE 3SQHE 1ZPZA 1A0HB 2KAIB 1KLIH 1GBLA 2Z9IA 3UIRA 3ZZ3A 2G00A 3SORA 2ZFFH 1O2OA 3MU5A 2ZI2H 1EAWA 1HAXB 2FP7B 5EJLA 1GJ9B 2G4UA 1OXGA 4AZ2B 1MMJN 3BEFB 1O2GH 3EYDA 3HPTB 1P11E 2WPLS 1DX5M 2VNTA 4RKJB 2O8TA 2ZKSA 1RXPA 4FOUC 3NCLA 3P70B 4YT6H 1MABB 1T8NA 2TRMA 4BTUB 1CO7E 3OX7U 1G3BA 4ABJA 3O8CA 1L4ZA 2XRCA 2ODPA 1TOCB 3FANA 1FMGA 1EJNA 4Y0YE 6GCHG 1A1RA 4P02A 3VB3A 1C1VH 4E7NA 1W0ZU 2J38A 1PFXC 4BNRA 1TX7A 1XUGA 4TYDA 1DM4B 1G32B 1TNHA 2YNAA 3OEHD 1TBZH 3UAIC 3GCNA 4WMFA 3RLYH 1JWTA 1G30B 1O3IA 3QUMP 3ZZ9A 2W3KA 1Q31A 1W2KH 1GCTC 5DJ7A 3SGAE 3M7QA 3O8DA 3NRLA 2PKAB 5A8ZA 1AVXA 2BQ7B 1GJDB 3LGYA 1XVOA 4X6PA 7GCHF 1C5QA 1O5GH 2OINA 1V2QT 1C2EA 1QY6A 1QCPA 1T4VH 2HNTC 3RUOA 4M9FA 1O2HA 3TLOA 4MTBA 1YY3A 3RXOA 3HATH 4ZCNA 3PROA 1BBRH 1C1OA 4I8LA 4D7FA 4AGJA 3NK8A 1ZLRA 2JIZD 3PV2A 3VB4A 4K1SA 1TNGA 1CA0C 2A4GA 3K2UA 1ANCA 3T28A 2TGDA 1GJ8B 2DE8A 2VINA 1C4V2 1SGDE 2JDID 2ZG0H 2SNWA 4JZDH 1HFDA 1NESE 1P10A 4X8TH 1BDAA 2Z3CA 1AE8H 1ZZZA 3H7OA 1GI2A 3CS0A 1O0DH 1LVBA 2ZGCA 1E0FD 4THNH 5EPNA 3QZRA 2FX4A 4OS4A 3NWUA 2F83A 3SJ9A 1Y5AT 2GCHF 2BM2A 1KTTB 2PV9B 2P16A 4UFFH 2BD5A 4X6MA 1AD8H 4M7GA 4ABFA 5C5NA 3ATLA 1QB9A 1UW7A 1K9OE 2H9HA 2V35A 1AFQC 1C1WH 2KM0A 4B74A 1ARCA 5GWZA 3TNSA 8ESTE 1SOZA 1FY8E 2AGGX 4F4OC 1AUTC 2Y5GA 3ATKA 1VCWA 5HKKD 2BD7A 1GG6B 1V2WT 3P8GA 1MAXA 1MTUA 3JZ2B 1DWDH 2V3OH 1LKBA 1P0SH 1K0HA 1C1MA 4HI3A 3A7XA 3OY6U 1C4Y2 1QB1A 5HIZA 3SUFA 1PPZA 4BXSA 1TGBA 2SFAA 5EQSA 4INLA 3ZVGA 1WQSA 2BLOA 2NU0E 1SB1H 2UWLA 5T6GA 1DOJA 4WVPE 5ABWA 5EJ1A 2ZTYA 5FAHA 2ZDMA 4XDEA 3A7TA 1INCA 3RXVA 4DJZB 3FN8A 1ZSLA 6CHAB 1NT1A 2ESTE 3EE7A 2O8WA 1ARBA 5KECA 2BVRH 3PYHA 2WV9A 2KAIA 1SSXA 3BTWE 3ZV9A 3PB1E 2BB4A 1NO9H 4KP0A 1WXRA 4BTTB 2GMTC 2QAAA 2WHXA 1SGTA 1C5VA 1W13U 2FI3E 2GDEH 3ODFA 4NSYA 4BAQB 1PQ5A 2ZU1A 1D3PB 1RJXB 2XBWA 2Y81A 4GUXA 1LKAA 4K1TA 1KYNA 1PYTD 2ZU2A 2ANWA 3SV7A 3F68H 4WH8A 2ZHQH 1OWHA 5CE1A 2ZTXA 1NU9A 4ZKNU 2ZFSA 1J8AA 1PPGE 1EZQA 1QL9A 1VJ9U 3HK3B 1UHBB 1Z8GA 4K5ZA 1P05A 4DURA 3IWMA 4K69A 1Z8JB 2FOAA 1CGIE 3L6PA 3A81A 3SUDA 1S0RA 1O30A 2ZPRA 3VFEA 2QIQA 2B5TB 1IQGA 2ZGHA 3FP6E 1P2IA 4OS2A 4ACBA 4NWLA 1O3FA 1L1GA 1QA0A 1P2KA 1ELDE 2AFQB 1K21H 1XUIA 1GBEA 3FP8E 1O2KA 1WYKA 3RXSA 2FPZA 4OS6A 2ZP0H 2LELA 2KX4A 1GI5A 4Y11E 1S6FA 3SOSA 3ZYDA 2C3SA 2F4LA 1XXDA 4NA7A 1SGFA 5FPYA 3RXRA 3URDA 4OM9A 1V2OT 1N8OB 1UHBA 1MKXK 3O8BA 1EKBB 2PR3A 1HAYB 4INHA 1T4UH 5CHBA 3UFAA 2SGFE 5C94A 1UK4A 2ZFPH 1JRTA 1ZTKA 3P95A 1RS0A 1C2LA 1HXFH 3GYLB 4FVBA 1GBKA 1JOUB 1E35B 1Y8TA 2F9NA 3P17H 2A4QA 4ZROA 1P2OA 4B75A 3SNAA 2XWBI 3RXCA 5C67A 1Y3UA 5E0HA 2HGTH 3MU8A 1GDUA 1ZTJA 1UTPA 3AAUA 3M37A 1IQKA 2A0QB 2FOHA 3U8TH 2ZCLP 1ZGVA 1OYTH 4K2YA 3KCGH 2W5EA 2GJGA 1FV9A 1C2HA 2ZFQH 1FLEE 1WU1A 1E38B 4LXBH 2ZCKP 5L30H 3SZEA 3RXQA 3LPRA 1BA8B 1OSSA 4CH8B 1E1QD 2J34A 4LZ1H 1FUJA 3MFJA 2ZDVH 1O2SA 1GJ4H 2NU2E 4Y10E 3LT3A 3FVFB 3RM0H 3A7VA 1WBGB 4MNWA 4WWYA 3TNTA 4X6NA 3UWIA 3C1KA 1HCGA 1GVZA 1XUFA 2BLQA 1GI4A 1SVPA 3DUXH 3RXMA 3E90B 2NU4E 8GCHG 2GVFA 1C5XB 3U69H 4UEHH 5LPRA 1JXPA 1YP9A 3RM2H 1ZJKA 3M5MA 4LOYH 5CHAC 3JZ1B 3RU4T 2XCFA 4A1TA 2EI7A 3T26A 5C2ZA 1O2JA 3SNDA 3OTJE 4A92A 3A87A 3UY9A 3F1SB 3SUGA 2BXUH 1O37A 1TONA 3D23A 1ETTH 4UFGH 2ALVA 2A2XH 3OFND 2Z9LA 2XXLA 2BD9A 1PPFE 2ZNKH 4IN2A 2CJIA 1KXFA 2QXHA 5C0TA 1Z1IA 1P09A 4Q7ZA 1RTLA 3L33A 3LONA 1GBJA 1MU6B 2BY8X 2B7DH 5JPMH 4BAKB 3U8OH 3MTYA 2ZDNA 5GJ4B 6GCHF 1OX1A 3IITA 1H9HE 3GY5A 2OBOA 1BRAA 3PO1C 4AORA 4DOQA 1O5DH 4WMEA 1S83A 3TH2H 3HGPA 1EX3A 3SBKA 3EA8A 1TLDA 3AVZA 5FBIA 3ZZDA 2XCNA 3TIUA 1W10U 3E6PH 3RXHA 2WPIS 4AGKA 1P03A 1XX9A 1VCPA 3RXEA 2VIOA 1ZJDA 2QY0B 4MPUA 3SGBE 4ZH8A 2HVXA 2HNTE 4WF8A 5EGMA 1THPB 2BD4A 1GBBA 1K1LA 4IC6A 5ETXA 1CBWB 1QIXB 2BDYA 5BRRE 3N7DA 4HFPB 3UNQA 2Y82A 3MH7A 4U30A 2GCTC 3A83A 5DP7A 1BCUH 2BOKA 1G36A 4F48B 3SO3A 3LJJA 3T62A 1CHOG 2IPHA 2YMSD 3F9HA 3GY6A 4TY7A 2YOLA 4Y6DA 2R0KA 3DD2H 1KDQB 1T8LA 3UNRA 4XRNA 1AVGH 2VH0A 3ZV8A 4NIXA 1UTNA 2BLWA 1XMNB 2R3UA 1GHBG 1TPSA 1B0FA 2VVVA 1ZOMA 1GBFA 1P12E 3ATIA 1TQ0B 2QN5T 2V3HH 1QGFA 3SJ8A 2VVUA 1AVWA 2J5UA 3RXGA 1V2JT 3LIWA 1J17T 3PRDA 1NRPH 2FOFA 4JYVH 2ODYB 1TBQH 4ISHH 1NRQH 5EXNA 1EB2A 2WZQA 3W95A 1SGQE 3GY8A 3FOAA 1W7GH 1LMWB 1OKXA 3BTHE 3DFJA 1NBMD 3BTME 3PMAB 1FDPA 4GHQA 1E1RD 1O2LA 1UVUH 3PTBA 4XE4A 1NFXA 4NCYA 4FU8A 1P9UA 3BTTE 4B6FA 4CRBA 3SUEA 4XBCA 1H8HD 1W0KD 4JZEH 1DDJA 2OC1A 1GI3A 2KCOA 1BIOA 1AHTH 5DN6D 3RC6A 3ODDA 1BTYA 1GHBF 1OWJA 2YNBA 1TIOA 1EP6A 1WTGH 2G52A 2BX3A 1TOMH 3HKIB 5LPEA 1MCTA 1NZQH 1XKBC 2FYQA 4WXVA 3VB7A 4D9QA 2VIDA 2THFB 1GPZA 1SQOA 1UTJA 3MU4A 1GMCG 1WSSH 3OYPA 1P3EA 3PV4A 3TJNA 4DCDA 1KXAA 2BOHB 2G5NA 4J1YA 4AX9H 1GJBB 1AGJA 2R0LA 1JIMA 2WPDD 4FU7A 3VPKA 3QO6A 1HLTH 3UNSA 4AFUA 3HKJB 2OUAA 3BTGE 1TRNA 1BBRE 1TX8A 2VGCC 4Y79A 1EAUA 3L3TA 1HIAB 4FU9A 1SGCA 2XC5A 1G2MA 3SNBA 1MCVA 1LHFH 1GG6C 4DIIH 2XOKD 3OY5U 2OXSA 2CXVA 5DKMA 4JCNA 1BTZA 2QF0A 2FDAA 4E05H 1CHGA 4X1PU 2VB0A 4JZIA 1CT4E 1AE5A 1IQNA 5DO4H 7ESTE 2H6MA 2OTVA 1EXFA 2XTTB 3ZVCA 3ZZAA 5B6LA 3B23B 4O3UA 2AHME 4ZXYH 1UTKA 3E91A 1K22H 1LVOA 1O35A 1GHAG 3KL6A 1FI8A 1YWUA 1CT0E 3QLPH 2FESH 2FOMB 5DP4A 1BHXB 1YPKH 1V2MT 1J16A 1AI8H 3TGIE 1A5HA 3QTOH 2Z3EA 3KQDA 1NN6A 3F6UH 1O3JA 4OS7A 3SU5A 3T27A 3M5LA 4Y7BA 5T6DA 4AFQA 4Q2KA 4ASHA 1B5GH 5DP6A 1MD8A 1EZSC 1O2TA 2ODQA 4GLYA 2W3IA 4NFEA 3H7TA 4BAHB 1BOQA 3P6ZB 1K1OA 4ABGA 3A85A 4DIHH 4F55A 5HIYA 1VR1H 1PPEE 4TY6A 5EJZA 2XBVA 1KLJH 1C5UA 4X8VH 1SLUB 1P2MA 1SGFG 1SGIB 1BT7A 4FUDA 2SNVA 1U6QA 3S0NA 2HALA 4X0WU 2HWLB 3RXAA 3F0PA 1QFKH 3V0XA 1IQIA 4H6TA 1DPOA 1LHGH 3R3GB 4Q63A 5I25A 4ABAA 2WPMS 2W7SA 2RG3A 1WAYB 4RKOB 4WH6A 5E2PA 1UJ1A 4YO9A 1HRTH 3F2GA 4FUFA 3SU2A 1O2MA 2F43B 1DANH 1Y3VA 1EJMA 2R9PA 1X7AC 4RN6A 4D9RA 3AW1A 1C1NA 1ZPBA 2ZU5A 4XSKU 4MG3A 4YOGA 1CE5A 3A8AA 4A5TS 1O2UA 3RMMH 3ITIA 2A1DB 5GNDA 2A5KA 2BY6X 1ETRH 3BV9B 1NFUA 2UUKB 4ZUHA 1ZYOA 1DVAH 1A7SA 1QQ4A 5TCAA 4ISIH 4HG6A 1T31A 5JBAS 1B0EA 1G3CA 3GY4A 3P8FA 3VB6A 1FZZA 1L4DA 5AF9H 1NS3A 1F92A 1QB6A 1C1SA 1OWDA 5AVDA 3LOXA 1C5YB 2HPPH 1MTWA 3U28C 4SGAE 2AEIH 6LPRA 1SI5H 4A1VA 5E2OA 4X6OA 5C1XA 1SL3A 1F5RA 1HBTH 1ELCA 2WSSD 2BD3A 1HYLA 1O36A 3UTUH 4X2WA 5DPAA 1HUTH 5BPEA 3STJA 1GI8B 1UVOA 4MPXA 1ELBA 4MVNA 1S81A 1YYY1 1O3CA 1IQFA 4NFFA 4AOQA 3K9XB 1ELVA 2IJOB 4IC5A 5HGGA 1ETSH 2SGDE 1GBTA 1NBME 4ISLA 1QNJA 3BIUH 1AQ7A 3WW7A 5E0GA 3ELAH 3DFLA 4AFZA 1V2TT 4B2AA 1GBAA 1QTFA 5KGOA 2QF4A 2PP6A 1DXPA 1ZHMA 1AFQB 1C2FA 4NG9H 1YPMH 1GWAA 3GS9A 1DUAA 2XBXA 4TPYA 3S7KB 3KQCA 2C93B 3GDSA 3QTVH 4Y0ZE 3O8RA 3RU4E 1T32A 2ZECA 2OBQA 1XVMA 2VWOA 1UCYK 1N8OC 1YLCA 1IQLA 1F0RA 3H5CB 2WPKS 3BG8A 2ZEBA 3RU4D 3PTNA 4KTSA 3SQEE 4VGCB 1EOJA 1TMBH 2EI6A 1LPZB 3A86A 1OP8A 2Z9GA 5J4QA 2KCYA 1C2JA 1QJ7B 2FYRA 3KHVA 2D8WA 2ZFRH 4H42U 5GDSH 3RLWH 5F03A 2J98B 3VXEH 2GV7A 4AC9A 1TYNA 1MBMA 4NGAH 5F6MA 4P00A 3EA9A 1QJ1B 2I6QA 4TSFD 5F8XA 4E7RG 1UVSH 1MTNB 1Y3WA 2GT7A 2ZZUH 5FPTA 3M35A 3LH3A 1O2QA 2R2WU 2ZF0H 1AZ8A 4GPGA 1MU8B 1BMFD 1C5PA 2WPJS 1HAVB 1SMFE 2C4FH 3E1XB 2A32A 1TGTA 4CRCA 3VGCC 1HAPH 5CDFE 5C3NA 1BZXE 4KTUA 5EW2H 1O2YA 1YC0A 4U32A 3QGNB 1TE0A 5C1UA 3DCLA 1AB9C 1NROH 3BTKE 1ESBA 5GXPA 2RFKC 4JZ1A 2BDBA 4NA8A 2FZZA 5A09A 1LQEA 2QCYA 1GGDC 5CHAB 8LPRA 2C90B 5DK1A 4ZMAH 2HLDD 4JK6A 5DGJA 4AYYB 3ZVAA 1H8ED 1HXEH 1EPTB 3FKSD 3RMLH 1SQRA 1T8OA 3RMNH 1C4U2 1EPTC 4BXWA 1S84A 1SOTA 5F53A 2J2UA 3P8OA 1OWEA 2H1UA 2FI4E 4Z0KA 1GHAF 1BTUA 1O2RA 1V2RT 1KXDA 1EZXC 2GZ9A 2ILNA 1FJSA 2JETC 2A5AA 2W26A 4IW4E 2G55A 1G37A 2ZQ2A 1TALA 1FAKH 3OTPA 1C5SA 2F9OA 1C1QA 1QHRB 4FUJA 1C5WB 1TNJA 3M7TA 1GGDB 2ZGBH 1F0UA 1S0QA 1WCZA 1MAYA 4OGYA 1ZMJA 4CR9A 1VGCC 2PSXA 2YMSC 2PWXA 5B6OA 3Q00A 2ANKH 3A7WA 1OHHD 1IHSH 3KQEA 1OP2A 2AMPA 1Z6EA 2D1JA 1GBMA 3ZYEA 2FEQH 3LGTA 2VGCB 3KIDU 2JH6D 5CMXH 4KTCA 1BITA 3GISB 3Q3XA 2NWNA 3GY2A 2ZCHP 1WOFA 1MTVA 1MKWK 1PPBH 1DY8A 3BEIB 3MO9A 3SGQE 1E36B 4NWKA 1A5GH 4YESB 1HAHH 1LHDH 4ASUD 1KSNA 4GHTA 1L2EA 1P04A 1XXFA 4IGDA 1DXWA 1TRYA 4E06H 2BDHA 4ZAEA 1ELEE 1TNLA 2Y80A 4RT0A 2V6NA 1VGCB 1Z7KA 4VGCC 4AB8A 3AW0A 4OS1A 1Z8RA 2JJ2D 3S7HB 1COWD 3SZNA 1S5SA 1TGNA 1MZDA 3ZZCA 1OWIA 3BF6H 1HJ8A 4H4FA 2B9LA 4B76A 1PQAA 1O31A 1BRCE 4AB9A 4AG2A 3A8BA 3W1EA 5T3HA 2A7HA 4ZHMU 5FHTA 2C8XB 1GCTB 4MQAA 1Z8IB 4JYTA 3U1IB 4DVAU 1JIRA 4DG4A 1CVWH 1HDTH 2BQ6B 4GAWA 2BDAA 1O3PB 4CHAC 1BRUP 1GL1A 2OCVB 1GBIA 1YBWA 2QYIA 4Q7XA 4A1XA 1NTPA 3A7ZA 1KMHB 1E79D 1O3LA 2B0FA 1LQDB 3TPIZ 4BAOB 2G4TA 2OC0A 1W7XH 1SBWA 1HAOH 4FUIA 1TABE 3OEED 1HAGE 1TPPA 3C27B 3LC5A 1L1NA 3GDVA 4F49A 3UQOA 1HAVA 2FOEA 1V2NT 1KY9A 1ZTLA 2WUCA 1HGTH 5HXFA 4Z1MD 3RXKA 4NZLA 5EPYA 1A4WH 1W0JD 3GCTG 5FCRA 1O2VA 1P2QA 1UTLM 2G81E 3TJUA 3ZVFA 1V3XA 3KYGA 3ZVDA 2FTLE 1D6WA 3SHAH 1BTHH 1F0SA 1KLTA 2UUFB 4K8BA 4HZHA 3N99A 3SYJA 3TU7H 1DWCH 4WJG2 3R0FA 3U8RH 5EXMA 2JH0D 1HJAB 3AAVA 4ZHAA 2YMSB 1Y59T 1TA6A 2K0QA 1FONA 5KEDA 1WTHD 4YOJA 1EP5A 2FLBH 2L74A 2V3MA 2GCTB 2ZU4A 5FBEA 2PKAA 1PQ7A 3SV8A 3VXFH 2TPIZ 4D76A 1SG8B 4K1EA 3SU0A 1D3DB 3TITA 3BN9A 2XNDD 4RT1A 1O3AA 2P93A 1TNIA 1SFIA 3GOVB 4X1SU 1L1JA 1G3EA 1GCDA 1EB1H 1C5OH 1MQ6A 2ZC9H 1JRSA 3DA9B 2Y5FA 4UFDH 5EOKA 1NU7B 5ESTE 2AIQA 1N1LA 1GI1A 1CA8B 2OC8A 3MI4A 4B2CA 2PFEA 1SGPE 1K28D 1GHVH 5JBCS 1ZRBA 5AFYH 3MMGA 3PWCA 1SKYE 5JDUB 1A0JA 2IJD1 3QWCH 2H5DA 3BSQA 1KXCA 2UWPA 1YCPH 2AMDA 5FX6A 1EFRD 3KEEA 1GL0E 2WV4A 1TQ7B 3I29A 1NRNH 1D9IA 1LHEH 4HTCH 1S82A 1AY6H 3F3BA 4CHAB 4YZUA 1D4PB 3VB5A 1ZHPA 3HK6B 2BMGB 2CGAA 1A2CH 1Z71A 1CQQA 1HAZB 4JYUH 3ZZ5A 1H8DH 1S6HA 1TNKA 3RDZA 3NXPA 3FO8D 5EQRA 1AWHB 3OU0A 4BANB 1SQAA 1OYQA 1EUFA 2AH4X 2ULLA 1BMLA 2FXRA 1ESAA 2PKSB 2TGPZ 3EAJA 1MD7A 3MYWA 1F5LA 3TVJB 2Z9KA 1MH0A 1IQEA 1AZZA 5FPSA 1DLEA 3T29A 2BY9X 4Y76A 4B6EA 3MNSA 1AKSB 2EY4C 3I78A 1HNEE 4NIWA 3RXDA 1YLDA 4R0IA 1SC8U 2RCEA 4IS5A 3SU3A 2GCHG 2ZGXH 1TWXB 2Y7XA 3ATMA 4O03A 3K6YA 2FOGA 3KN2A 3FAOA 2VBCA 2ASUB 3UWJH 5FCKA 2CK3D 2EC9H 4XBBA 1SPJA 2HLCA 2ZWLH 1TA2A 1XKAC 1MTSA 1V2KT 1W3CA 1HJ9A 3MQKC 4I8HA 3EDXB 5G4BA 5L6NH 1P57B 3T5FH 2Z9JA 3K65B 2IPQX 3QDZB 5F8TA 1OS8A 3V13A 3S9BA 2ZPSA 4ZXXH 2PUQH 4D7GA 2Z6BD 2QV1A 3S9AA 1XM1A 4ISOA 1Z1JA 3T2NA 1MUEB 2W7UA 1DSUA 4I32A 1GMCF 1IAUA 3UR9A 1GBCA 1TB6H 3LGVA 4QT8C 2SGPE 3BEUA 4DY7B 1A3BH 2Q6GA 1DWEH 3SN8A 3M5OA 1K1MA 1P8VC 1QURH 5LH8A 3F2FA 2QXIA 1ELAA 3K6ZA 2H2ZA 2G8TA 2XWAA 1JBUH 1UTOA 1XUHA 2SGAA 3QN7A 1NFYA 4FETA 5C1YA 2CF8H 1C5MD 4CRFA 2RA0A 1BRBE 5TCCA 3AK5A 1O39A 2R2MB 2VIVA 5GPIB 4A6LA 3RXUA 4UE7H 1C9PA 2GD4B 2D2DA 4DT7B 1BJVA 4PROA 2G51A 1YPGH 4ABBA 1EQ9A 3GYMA 1QR3E 5T6FA 2ZDAH 1BMMH 1UVTH 2GZ7A 3MH6A 4ISNA 2GX4A 1ID5H 3F9EA 1LHCH 1UCYE 1NM6A 3KQ5A 1ZMNA 4IMQA 3RXFA 1C1UH 3ATWA 1KTSB 4XFQA 2PUXB 5DP9A 4NZQA 1O32A 3PM3A 2FS8A 2BQWB 1ZHRA 3LDXH 3SU4A 4MNVA 1GJCB 1C2IA 3MWIU 2HOBA 2ZFTA 3EGKH 1TBRH 2P3UB 2NU3E 1SR5C 2F9PA 1HAIH 3KNXA 2GMTB 5GCHF 1A61H 1GDQA 1E37B 3MHWU 1EOLA 2P8OB 1VITH 5L2ZH 1TMUH 1TRMA 1P3CA 4YT7H 1O5EH 3TK5A 3SJOA 3M5NA 1WUNH 1THSH 1V6DA 3RMOH 4TWWA 5K0HA 2CN0H 3SU6A 2BHGA 3F9FA 3GCOA 1J15A 1C1RA 3FFGA 2ZPQA 3KF2A 1EJAA 3V12A 1LVYA 2A4RA 4Q80A 1TFXA 1P02A 2DUCA 4X1QU 3WY8A 3U9AH 4ABHA 2F3CE 2KFWA 1QBVH 3Q76A 4CRDA 1FX0B 3BTFE 1ELGA 4JMYA 5EQQA 2Y6TA 3KYFA 1C5NH 1F5KU 5C17A 1ACBE 4MPVA 4NA9H 3SV6A 4KELA 1UO6A 1VCQA 4CH2B 3A88A 1SLXB 2FODA 2O8UA 1NRSH 1EAXA 1LVMA 4FVDA 1Y3XA 1FIZA 4O9VA 2CHAB 3PWBA 1LCYA 1PPHE 4RSPA 2OD3B 3BTEE 1DT2A 1ESTA 4FUCA 4INKA 3SV2H 3PMJA 1TGSZ 1BJUA 4YTAA 5HM2A 2FOBA 3A80A 1SGYE 4X2YA 3F0OA 2ZU3A 1C2MA 3UOUA 1UMAH 1ANEA 2EQNA 3BG4C 1C5ZB 7KMEH 4U01A 1HJAC 1UTMA 1EASA 4I7YH 1DUEA 1O3MA 4I8KA 2TBSA 4HGCA 4CREA 1S6LA 1Y3YA 2SGEE 3MNXA 2ANMH 4YLQH 3M7UA 1FY1A 1DY9A 1TPAE 4X8UH 2J94A 4O3TA 4I8GA 5E0JA 1TGCA 2IOTA 1DS2E 1CU1A 1GHWH 2GTBA 2PTCE 1NFWA 1ZGIA 5DSFA 4BTIB 2A7JA 1ELTA 2PTNA 1GVKB 4CRGA 1QRZA 8GCHF 2OC7A 3MH5A 1BB0B 6CHAC 1WDIA 2VIWA 4ZKOU 3A7YA 2K1QA 1F0TA 1EPTA 2BX4A 2L6OA 3FZDA 1OOKB 3SV9A 1FNIA 3TH3H 3EA7A 2FS9A 4NSVA 1BMAA 4DT4A 3MU0A 1EZUC 1AO5A 2FO9A 7LPRA 5A8XA 3ZVBA 2P94A 1YPJH 3U1JB 5DP5A 5C5OA 4KGAA 1T7CA 3RXJA 2I6SA 1ORFA 5K7RA 3LGWA 1TX6A 3SI3H 2W6ID 5DP8A 1O5AB 1GMDG
chains in the Genus database with same CATH topology
1FN6A 3D49H 1W12U 3E0NB 2FX6A 1ZSKA 1LDTT 1O3BA 2QXGA 3S69A 4NIVA 5EW1H 1FN8A 1W0YH 3SNEA 1FPCH 1O5BB 2BVXH 4ABDA 2BDGA 2XYAA 1ZSJA 1Q3XA 1DSTA 2GDDA 1YCPK 4UD9H 1C5TA 4FXGH 2O8LA 1BBRK 2CMYA 2F9BH 1NY22 3T25A 1O3EA 2Z3DA 2Q6FA 1AMHA 1BMNH 2BDIA 1ZRKA 1T8MA 1W11U 2H5CA 2LPRA 1G2LA 4YLUA 3RC5A 1UK3A 1A0LA 2P95A 1P01A 1AU8A 1QL8A 3MNCA 2VWLA 3GICB 3FP7E 3HGNA 1CSOE 1ABJH 2FLRH 2FWWA 1C2KA 2QC2A 2WINI 4FUEA 3BG4B 1GJ7B 3ZVEA 4D8NA 1IQHA 1H8IH 3A82A 5J4SA 1A5IA 1BTXA 4KKDA 2G5VA 2O9QA 1J9CH 1IQMA 1BQYA 1OWKA 2UUJB 2RA3A 4A7IB 2FMJA 4IMZA 3QK1A 1V2VT 3PLKA 1OP0A 2ZHEH 2STBE 1SGNE 1HB0B 2HNTF 3RXBA 3GCHB 1O2WA 1QRXA 1F2SE 2A2QH 2WYJA 1O3NA 4AFSA 1TMTH 4AN7A 2J4IA 1H4WA 2AERH 1AUJA 2ZHDA 3TH4H 4DGJA 2AIPA 3Q3YA 3TJOA 3SJKA 1MKWH 1MQ5A 5DG6A 3RXLA 6ESTA 1AKSA 1GVLA 1BUIA 1GDNA 1JMOH 4UONA 1S85A 2J9NA 3RXIA 2XC4A 5JB8S 1H9IE 9LPRA 3P8NA 2F9UA 1PPCE 2QA9E 4MNXA 3TK9A 1SLWB 1O2PA 2GP9B 1THRH 1YCPM 4IBLH 2BZ6H 3RXPA 1DFPA 1UVPA 3NZIA 3ZZBA 3AASA 1GMHG 1O2ZA 1RTKA 2JKHA 2FI5E 4ZKRU 1ANBA 2VVCA 4ZKSU 2BXTH 4TWYA 1VITG 2FM2A 2Z94A 2BVSH 1O3OA 2VIQA 1P06A 2WV5A 2BDCA 2SGQE 3GDUA 4AYVB 1GHZA 1QQUA 5JBTA 3S9CA 4R8TB 2OQ5A 2STAE 1D6RA 4NIYA 4BAMB 1SHYA 2J92A 2D26C 1LPGB 1MZAA 3UQVA 1BTPA 3RC4A 3BIVH 5HMAA 3PLPA 4Y8XA 1AFEH 1VITF 1YPEH 4B1TA 1ZMLA 2H9TH 1RD3B 3MOCA 4UFEH 1SQTA 2ZTZA 3UOPA 1YPLH 3NPSA 5TJXA 1MKXH 1P2NA 1O5FH 1C5LH 1NPMA 1WV7H 1WQVH 1CHOF 1QL7A 4Z6AH 1DLKB 1CGJE 4LK4A 1ZPCA 3LH1A 3MO3A 3STIA 1W14U 3GY7A 1KXEA 5H4IB 4GCHF 1K2I1 3EE0B 4Y8ZA 2CF9H 4MNYA 4I8JA 1XUKA 1RIWB 1FXYA 1AB9B 2GT8A 3A84A 1Q2WA 3MNBA 4IN1A 2O8MA 2GGVB 1DWBH 5DP3A 1FY4A 2Y5HA 2PHBA 1O2XA 1C9TA 1LTOA 2P59A 1UCYH 1E34B 1F7ZA 2DE9A 3SNCA 1OPHB 3BTDE 2EEKA 3I77A 2P3TB 1FIWA 1QJ6B 1MBQA 4H6SB 2AGEX 3RXTA 3TK6A 2A7CA 2QGRA 2FIRH 1DE7H 3DHKH 3V7TA 2WYGA 1K1NA 1EAIA 1FQ3A 2H9EH 4Q7YA 1P9SA 1IOEA 1YGCH 5L2YH 1GI9B 2EI8A 3UPEA 3KGPA 1P2JA 2ZHWH 4X2VA 4O97A 1TAWA 1C1PA 2HPQH 2BLVA 1DICA 1QBNA 3A8CA 4ESTE 1O3DA 2A31A 3FZZA 5EU8A 2BYAX 2JH5D 4U2WA 1GI7B 1SHHB 3URCA 2BTCE 1N6YA 1BTWA 1QRWA 1O3KA 2FTMA 7GCHG 3EQ0H 1UK2A 2GZ8A 1Y5BT 3CS7A 1RIWC 2QXJA 3VEQB 5C20A 1SLVB 1O38A 3F9GA 2BY7X 3M3TA 1M9UA 2VH6A 4K60A 2PGBB 1GHXH 1ZR0A 4JZFH 1FAXA 1NC6A 1VZQH 1RFNA 3P92A 1DITH 1C2GA 1V2ST 5FXLA 5AHGH 2V0BA 5FX5A 3SI4H 2M5TA 1SGRE 1O34A 3A89A 2ZDKA 2GKVE 3GY3A 1B7XB 3E3TA 1K1PA 4MPWA 1YKTA 5EODA 1QBOA 2OLGA 3M36A 3SU1A 3LU9B 4K8YA 1IQJA 2PLXA 1YF4A 5PTPA 1GI0A 3CENA 1LO6A 2CHAC 1ABIH 8KME2 1V2LT 5EXLA 4MDSA 3ZZ6A 1SGEE 9ESTA 1V2UT 5F8ZA 5GIBA 1O2IA 1CGHA 1LPKB 2ZDLA 1BHXF 3G01A 4WY3A 1YM0A 2CV3A 5I46H 3TGKE 1RGQA 3E8LA 2JETB 2PGQB 1HV7A 2AS9A 4MLFB 3LKWA 1C2DA 1GBHA 4FUHA 1CT2E 1ELFA 4X1RU 2UWOA 3SJIA 1FY3A 1K1IA 4SGBE 2QF3A 4GSOA 1GBDA 3B9FH 3M3SA 2A45B 3TGJE 4YM9A 3LJOA 2ANYA 2EA3A 2LNCA 4YOIA 2Q6DA 1GHYH 1XUJA 5ESBA 3OSYA 4Y8YA 3M61U 3W94A 4AG1A 3E0PB 1VJAU 2P8OC 3ZZ8A 4J2YB 5IYTA 1TPOA 3SHCH 2OP9A 1O5CB 5JB9S 2C8YB 3N7OA 1GJ5H 4Y7AA 2TGTA 4B71A 4OS5A 2PSYA 2B8OH 4CRAA 2VU8E 4I33A 4ABIA 2XC0A 4B73A 4X1NU 3UREA 1O3GA 2ZIQH 2A4OA 3CP7A 2VWMA 1C1TA 3D62A 5A0AE 1GMDF 2IN2A 4UDWH 4CBNA 2UUYA 2OQUA 3ZZ4A 3Q3KA 2Z7FE 4GCHG 2ZGJA 1HPGA 1A3EH 5A8YA 4K3JA 1AN1E 2AGIX 4JK5A 1GJ6A 1W8BH 3Q77A 2ZA5A 1KIGH 1A46H 1KDQA 1RRKA 4OGXA 4Y71A 2GV6A 2XW9A 1PJPA 2J95A 3QX5H 5E8EH 2VJ1A 2Q1JA 2P3FH 1D3QB 4X8SH 3NKKA 1C5RA 4B2BA 1D3TB 4ZHLU 2F9VA 3QZQA 2RDLA 2ZO3H 4ABEA 4WXIA 3QGJA 1Z6JH 5GCHG 3V3MA 3NUMA 1G3DA 1RTFB 2FOCA 2NU1E 1QA7A 4GVUA 2VWNA 1PQ8A 1IHTH 2WPHS 4CR5A 3RP2A 2WUBA 3VGCB 4X2XA 2HRVA 2A5IA 3ENSB 2C8ZB 5LGOA 3UUZA 1KXBA 3ESTA 2AMQA 2BZAA 2VIPA 2BD8A 4I31A 1J14A 5HYOA 1H1BA 2PW8H 2R3YA 1O2NA 1GI6A 3LGUA 3GCHC 3PMBB 2ZQ1A 1K1JA 1PYTC 5A0BA 1CBWC 1O33A 2C8WB 1GMHF 1L0ZA 1MTNC 3E16B 3IG6B 3MH4A 1YPHE 3UR6A 3U98H 4XBDA 2BD2A 3KQBA 4FUBA 3D65E 1V2PT 1NRRH 5AFZH 2TIOA 5A0CA 5A2MH 5SGAE 1YPHC 4LZ4B 3DT0H 5JBBS 1N6XA 1GJAB 1G9IE 2F91A 1FPHH 4DW2U 1UTQA 3MU1A 1CA0B 1EATA 1AIXH 3A8DA 5JYIA 1O3HA 3GCTF 3M3VA 4FUGA 4WMDA 2BY5X 3PO1B 4XOJA 2AYWA 4BOHA 1AWFH 4CBOA 3PMHB 5HM9A 4TPIZ 3ZZ7A 1SFQB 5IDKA 1Y5UT 1ANDA 1H9LB 1HIAA 2Y7ZA 2ZHFH 5LPFA 5EG4A 3LC3A 2PKSC 3LGIA 3TJVA 3MO6A 2TGAA 3PLBA 3SW2B 3B8JA 2XBYA 2ALPA 1FY5A 2XNIA 3BTQE 3SQHE 1ZPZA 1A0HB 2KAIB 1KLIH 1GBLA 2Z9IA 3UIRA 3ZZ3A 2G00A 3SORA 2ZFFH 1O2OA 3MU5A 2ZI2H 1EAWA 1HAXB 2FP7B 1GJ9B 2G4UA 1OXGA 4AZ2B 1MMJN 3BEFB 1O2GH 3EYDA 3HPTB 1P11E 2WPLS 1DX5M 2VNTA 4RKJB 2O8TA 2ZKSA 1RXPA 3NCLA 3P70B 4YT6H 2TRMA 1T8NA 4BTUB 1CO7E 3OX7U 1G3BA 4ABJA 3O8CA 1L4ZA 2XRCA 2ODPA 1TOCB 3FANA 1FMGA 1EJNA 4Y0YE 6GCHG 1A1RA 3VB3A 1C1VH 4E7NA 1W0ZU 2J38A 1PFXC 4BNRA 1TX7A 1XUGA 4TYDA 1DM4B 1G32B 1TNHA 2YNAA 1TBZH 3GCNA 4WMFA 3RLYH 1JWTA 1G30B 1O3IA 3QUMP 3ZZ9A 2W3KA 1Q31A 1W2KH 1GCTC 5DJ7A 3SGAE 3M7QA 3O8DA 2PKAB 5A8ZA 1AVXA 2BQ7B 1GJDB 3LGYA 1XVOA 4X6PA 7GCHF 1C5QA 1O5GH 2OINA 1V2QT 1C2EA 1QY6A 1QCPA 1T4VH 2HNTC 3RUOA 1O2HA 3TLOA 4MTBA 3RXOA 3HATH 3PROA 1BBRH 1C1OA 4I8LA 4D7FA 4AGJA 3NK8A 1ZLRA 3VB4A 4K1SA 1TNGA 1CA0C 2A4GA 3K2UA 1ANCA 3T28A 2TGDA 1GJ8B 2DE8A 2VINA 1C4V2 1SGDE 2ZG0H 2SNWA 4JZDH 1HFDA 1NESE 1P10A 4X8TH 1BDAA 2Z3CA 1AE8H 1ZZZA 3H7OA 1GI2A 3CS0A 1O0DH 1LVBA 2ZGCA 1E0FD 4THNH 5EPNA 3QZRA 2FX4A 4OS4A 3NWUA 2F83A 3SJ9A 1Y5AT 2GCHF 2BM2A 1KTTB 2PV9B 2P16A 4UFFH 2BD5A 4X6MA 1AD8H 4M7GA 4ABFA 5C5NA 3ATLA 1QB9A 1K9OE 2H9HA 2V35A 1AFQC 1C1WH 4B74A 1ARCA 5GWZA 3TNSA 8ESTE 1SOZA 1FY8E 2AGGX 4F4OC 1AUTC 2Y5GA 3ATKA 1VCWA 2BD7A 1GG6B 1V2WT 3P8GA 1MAXA 1MTUA 3JZ2B 1DWDH 2V3OH 1LKBA 1P0SH 1C1MA 4HI3A 3A7XA 3OY6U 1C4Y2 1QB1A 3SUFA 4BXSA 1PPZA 1TGBA 2SFAA 5EQSA 4INLA 3ZVGA 1WQSA 2BLOA 2NU0E 1SB1H 2UWLA 5T6GA 1DOJA 4WVPE 5ABWA 2ZTYA 5FAHA 2ZDMA 4XDEA 3A7TA 1INCA 3RXVA 4DJZB 6CHAB 1ZSLA 1NT1A 2ESTE 2O8WA 1ARBA 2BVRH 3PYHA 2KAIA 1SSXA 3BTWE 3ZV9A 3PB1E 2BB4A 1NO9H 4KP0A 4BTTB 2GMTC 2QAAA 1SGTA 1C5VA 1W13U 2FI3E 2GDEH 3ODFA 4NSYA 4BAQB 1PQ5A 2ZU1A 1D3PB 1RJXB 2XBWA 2Y81A 4GUXA 1LKAA 4K1TA 1KYNA 1PYTD 2ZU2A 2ANWA 3SV7A 3F68H 4WH8A 2ZHQH 1OWHA 5CE1A 2ZTXA 1NU9A 4ZKNU 2ZFSA 1J8AA 1PPGE 1EZQA 1QL9A 1VJ9U 3HK3B 1UHBB 1Z8GA 4K5ZA 1P05A 4DURA 3IWMA 4K69A 1Z8JB 2FOAA 1CGIE 3L6PA 3A81A 3SUDA 1S0RA 1O30A 2ZPRA 3VFEA 2QIQA 2B5TB 1IQGA 2ZGHA 3FP6E 1P2IA 4OS2A 4NWLA 1O3FA 1L1GA 1QA0A 1P2KA 1ELDE 2AFQB 1K21H 1XUIA 1GBEA 3FP8E 1O2KA 1WYKA 3RXSA 2FPZA 4OS6A 2ZP0H 1GI5A 4Y11E 1S6FA 3SOSA 3ZYDA 2C3SA 3RXRA 1XXDA 4NA7A 1SGFA 5FPYA 3URDA 1V2OT 1N8OB 1UHBA 1MKXK 3O8BA 1EKBB 2PR3A 1HAYB 4INHA 1T4UH 3UFAA 2SGFE 1UK4A 2ZFPH 1JRTA 1ZTKA 3P95A 1RS0A 1C2LA 1HXFH 3GYLB 4FVBA 1GBKA 1JOUB 1E35B 1Y8TA 2F9NA 3P17H 2A4QA 4ZROA 1P2OA 4B75A 3SNAA 2XWBI 3RXCA 5C67A 1Y3UA 5E0HA 2HGTH 3MU8A 1GDUA 1ZTJA 1UTPA 3AAUA 3M37A 1IQKA 2A0QB 2FOHA 3U8TH 2ZCLP 1ZGVA 1OYTH 4K2YA 3KCGH 2W5EA 1FV9A 1C2HA 2ZFQH 1FLEE 1WU1A 1E38B 4LXBH 2ZCKP 5L30H 3RXQA 3LPRA 1BA8B 1OSSA 4CH8B 2J34A 4LZ1H 1FUJA 3MFJA 2ZDVH 1O2SA 1GJ4H 2NU2E 4Y10E 3LT3A 3FVFB 3RM0H 3A7VA 1WBGB 4MNWA 4WWYA 3TNTA 4X6NA 3UWIA 3C1KA 1HCGA 1GVZA 1XUFA 2BLQA 1GI4A 1SVPA 3DUXH 3RXMA 3E90B 2NU4E 8GCHG 2GVFA 1C5XB 3U69H 4UEHH 5LPRA 1JXPA 1YP9A 3RM2H 1ZJKA 3M5MA 4LOYH 5CHAC 3JZ1B 3RU4T 2XCFA 4A1TA 2EI7A 3T26A 5C2ZA 1O2JA 3SNDA 3OTJE 4A92A 3A87A 3UY9A 3F1SB 3SUGA 2BXUH 1O37A 1TONA 3D23A 1ETTH 4UFGH 2ALVA 2A2XH 2Z9LA 2XXLA 2BD9A 1PPFE 2ZNKH 4IN2A 2CJIA 1KXFA 2QXHA 1Z1IA 1P09A 4Q7ZA 1RTLA 3L33A 3LONA 1GBJA 1MU6B 2BY8X 2B7DH 5JPMH 4BAKB 3U8OH 3MTYA 2ZDNA 5GJ4B 6GCHF 1OX1A 3IITA 1H9HE 3GY5A 2OBOA 1BRAA 3PO1C 4AORA 4DOQA 1O5DH 4WMEA 1S83A 3TH2H 3HGPA 1EX3A 3SBKA 3EA8A 1TLDA 3AVZA 5FBIA 3ZZDA 2XCNA 3TIUA 1W10U 3E6PH 3RXHA 2WPIS 4AGKA 1P03A 1XX9A 1VCPA 3RXEA 2VIOA 1ZJDA 2QY0B 4MPUA 3SGBE 4ZH8A 2HVXA 2HNTE 4WF8A 5EGMA 1THPB 2BD4A 1GBBA 1K1LA 4IC6A 5ETXA 1CBWB 1QIXB 2BDYA 5BRRE 4HFPB 3UNQA 2Y82A 3MH7A 4U30A 2GCTC 3A83A 5DP7A 1BCUH 2BOKA 1G36A 3SO3A 3LJJA 3T62A 1CHOG 2IPHA 3F9HA 3GY6A 4TY7A 2YOLA 4Y6DA 2R0KA 3DD2H 1KDQB 1T8LA