1EXFA

Exfoliative toxin a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
VSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXFOLIATVE TOXIN A
publication title The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
total genus 51
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA01
1ESTA 3BEFB 5C2ZA 2HRVA 3N7OA 3L3TA 1JBUH 3TNSA 1NFWA 4IBLH 1V2WT 1ZGIA 4DJZB 5AFYH 1C1QA 1IAUA 2FZZA 3SNAA 4GHTA 2AMPA 2JETB 2GDDA 2VH6A 3P17H 5SGAE 3GCHB 3LJOA 3PLPA 2ODPA 3PTNA 5HM9A 2C90B 4TY7A 4JZ1A 1YBWA 5JBCS 2OBOA 4Y8XA 3UR9A 4ABHA 2CV3A 4NIYA 2ZHEH 1TNGA 3HK3B 1HJAC 5AHGH 1PPFE 1FPCH 1PPEE 2VVVA 2OXSA 1MU6B 4ZKRU 1P2OA 4GPGA 2ODQA 1AZZA 1QB1A 2BVSH 3RXHA 2ZHDA 1SI5H 4ZUHA 4DURA 1O3CA 2AERH 1DDJA 1D6WA 3ATMA 1GG6C 2ZGHA 4Y6DA 2NU4E 1IQHA 2CHAB 1EQ9A 1ZMLA 1C5VA 2PGBB 3QX5H 2W7SA 3SNCA 4H4FA 2D8WA 2WPHS 3TJNA 3P8GA 3RMOH 3LH1A 3UTUH 3TGJE 3GICB 1L4DA 1WTHD 2A4GA 3ZZ8A 1TRMA 7LPRA 2VWLA 3GYMA 4NIXA 1HAZB 2EC9H 1A1RA 1HIAA 2Z7FE 3MYWA 2OP9A 2PKAA 4RN6A 1BBRK 4H6TA 4X2WA 5ABWA 2XW9A 3ZZDA 2AMQA 4U30A 1G3DA 4HI3A 4ISOA 3H5CB 5C20A 1OXGA 1W3CA 1N6YA 1KLJH 1X7AC 2XC4A 1F5RA 1WOFA 1CGIE 2V3HH 3RXCA 3ZZ3A 2RCEA 4ESTE 3V13A 2H6MA 4D9QA 1N8OB 1MU8B 2LNCA 1LKAA 2HNTC 3ZZBA 2A32A 1J9CH 1O2VA 3MO3A 1ZSJA 4JYUH 3RXPA 1TNJA 3R0FA 2ZTZA 2Y7XA 1HV7A 1Y3WA 2R3UA 5BPEA 1LPKB 1TGBA 3KQCA 4ZKSU 4X1RU 2BXUH 1EZXC 2GZ8A 3TK5A 2QYIA 4X2YA 4X8VH 1TABE 2H5CA 1IQGA 2J92A 3M3VA 1ESBA 1K1OA 1O5BB 1EJNA 1YCPH 3H7TA 4WY3A 4RKJB 1SHHB 4LK4A 1EOLA 3EE0B 4IMZA 4AGKA 1QA0A 7GCHF 1C4V2 2I6QA 1GDQA 3RU4T 1ZMJA 1SQTA 2P8OC 1W13U 3A7TA 3GYLB 1CBWC 1O3FA 2SNVA 2Q6GA 1OKXA 1MH0A 2FI3E 1UVUH 1DPOA 1GI7B 3A8BA 2ZDNA 3PV4A 4UFGH 1GJ5H 1AB9C 5AF9H 3SBKA 3HGNA 1SB1H 1L2EA 3M7QA 1AIXH 3SUEA 2HGTH 3SJKA 1K21H 2FPZA 3TU7H 1XKBC 1TLDA 2PUXB 3JZ2B 4GHQA 2VGCB 1A0JA 4MPVA 4AORA 5F8XA 3OX7U 1XX9A 1PYTC 1TGNA 4ZH8A 1FLEE 4ISIH 1NC6A 3TITA 2AS9A 3RXIA 3VB3A 1MAXA 3TH2H 2OD3B 1TRNA 2NU1E 4K1SA 2G81E 5L2ZH 1T4UH 2C8YB 1QHRB 3RUOA 1GBAA 2ZHWH 1KLTA 2ZCLP 2AH4X 3BF6H 2AGGX 4XOJA 2FEQH 3IG6B 1LKBA 1C2MA 4AYVB 4D7GA 1KXEA 1PPCE 1S81A 2Z9IA 3M5MA 4BAMB 4CH2B 1J8AA 1EUFA 3QO6A 3RXMA 3GDVA 2KAIB 1C5NH 1C5WB 1DT2A 2UUJB 1ACBE 1C1MA 1O0DH 3LKWA 1PQAA 1HRTH 1UK4A 3KQBA 1NT1A 5CHAC 4AOQA 4NCYA 3ZZAA 2O8TA 3QZRA 1W7GH 1HNEE 1MKXK 4CHAB 2ANMH 2ZFQH 2ZU2A 3A89A 2BHGA 5E8EH 5J4SA 1EXFA 2TGDA 3PB1E 1O2PA 4IW4E 2PSYA 5EOKA 1GI3A 4X1PU 1GJAB 2A45B 1QB6A 2HNTF 2ANYA 4WMDA 3O8BA 2C8WB 2C3SA 2F9BH 2VIVA 1CQQA 4J1YA 5HM2A 4J2YB 3T28A 1C2IA 4CRGA 1TNHA 2UWOA 3BG8A 3F68H 3ZZ7A 3RXGA 2RG3A 3T29A 1YPEH 3GY4A 1Z1IA 1C5XB 1MKWK 1AGJA 4O97A 4Y0YE 1V2LT 5JBAS 1XUGA 3PMAB 2G55A 4K1EA 2GDEH 2ASUB 1EAWA 1N6XA 3ZVAA 5K7RA 1WYKA 1ZTKA 4ABIA 2XBWA 4ZKNU 3A83A 3P8FA 3RP2A 2P59A 3S9BA 1NRSH 3A7ZA 1Q2WA 2BQWB 1C1TA 3VPKA 4K69A 1GMHG 1AKSB 3UY9A 1ETTH 1F0TA 2FOMB 2P94A 2YNBA 1BRBE 2WPLS 4GLYA 3MNBA 5DP3A 3MO9A 4INHA 5DP6A 1LTOA 4ZAEA 5JBBS 1Z8GA 5TJXA 3P92A 2CF8H 3KL6A 2H1UA 1QL7A 2BX4A 1QCPA 3LGTA 1IQMA 3TJUA 3P70B 1O34A 3NK8A 1S6FA 1VCQA 1H4WA 4OS5A 1LQDB 4MPUA 5C5NA 2P3TB 1GVKB 1T8OA 1UO6A 4BXWA 1C1RA 5T6FA 2VIQA 3MH7A 1DWDH 1O3OA 1DFPA 2WINI 5E2PA 3OTJE 3ODDA 4ABFA 2BOHB 1AE5A 3FP8E 5DP7A 2Q6FA 3GY5A 1JRTA 1XUIA 4X2VA 3CS7A 2GZ7A 2BXTH 3A84A 4WF8A 4BTIB 1SHYA 2A2XH 3SZNA 4ZHLU 1GPZA 3FZDA 2A4QA 2WV5A 1K28D 1LVMA 2GCTB 3QLPH 1BMMH 1CSOE 3RC5A 2ZFRH 4JZEH 1G2MA 1JXPA 5T6GA 2EI7A 3OU0A 1YPLH 3BTME 4R0IA 5DGJA 1AVXA 3M5NA 3RXVA 1EPTA 3P95A 1UVSH 1C4U2 4JYTA 1DICA 1H1BA 1ANEA 1SFIA 3B23B 1Y5BT 1WBGB 1UTLM 4TWWA 2PR3A 3D65E 3FANA 1EOJA 2P8OB 2JETC 1TNKA 2TGPZ 3GCHC 3JZ1B 5CMXH 2XC0A 2WYJA 2F3CE 3LJJA 2PLXA 4KGAA 2ZHFH 1F0UA 1BRUP 3LOXA 1LHCH 2VINA 3T5FH 2UWLA 2FIRH 1CO7E 1HLTH 1O30A 3RXAA 1EJAA 3RM0H 4MPXA 4YOGA 2FLRH 4MG3A 4PROA 4OGXA 5FPTA 4MLFB 2BB4A 3IITA 2BD4A 1SL3A 2HALA 2JH0D 3ZVGA 3SJ8A 2VIPA 1O3NA 3DD2H 3M5OA 1K2I1 2FODA 4Y71A 2XXLA 3SN8A 2C93B 3PMJA 2FS8A 3EDXB 2QCYA 4B74A 4NSVA 3SW2B 1GJ6A 3S7HB 1KXFA 4AG1A 2WV4A 2LPRA 2STAE 1NPMA 4H6SB 3W94A 1XUHA 2ZPQA 4GAWA 3RU4E 4FUHA 1SG8B 4KKDA 4JZFH 1YLCA 3T2NA 2GV6A 3SO3A 1YPJH 4JMYA 3G01A 1ZMNA 3SU6A 4B76A 1GBMA 1GJCB 1ZHPA 1EP5A 1GJDB 1V2VT 1Z6JH 3A8CA 3FP6E 2B0FA 3M35A 1MQ6A 4TY6A 3MNCA 2ZG0H 1HAGE 4DVAU 1GVLA 2ZDMA 4X8SH 3RM2H 2VIDA 5DJ7A 1FNIA 1B5GH 1O3HA 1CT0E 1VGCC 2W3KA 3EA8A 2M5TA 1P01A 3SUFA 5EU8A 4JCNA 2F9VA 1BQYA 1E34B 1O2KA 1YYY1 3UWIA 3MNXA 3MO6A 4NGAH 1O2HA 1UVOA 3Q76A 1BMLA 3A8DA 2UUYA 1WU1A 2Z9GA 1FDPA 1N8OC 2J34A 2HNTE 2GT7A 1SLUB 1WTGH 2FO9A 4MNVA 1MBMA 1WQVH 4ZROA 1OWJA 2GD4B 3VB4A 1THRH 1ZJKA 1JOUB 2J38A 4X6OA 3DT0H 1YPMH 4IN1A 3TPIZ 6LPRA 1ZHRA 1ZTLA 2Z9JA 1UHBA 1W0YH 4HTCH 4X1SU 3VXFH 2VWOA 4FUCA 8KME2 3U8OH 1MUEB 1NRRH 1FY5A 4ZXYH 2BD2A 2UWPA 3KHVA 3H7OA 4FUFA 4UD9H 3CP7A 4INLA 4RKOB 1IQFA 1O38A 1UTOA 3RMMH 4GUXA 1ABIH 3RXRA 1QRWA 1P2NA 2ZGBH 3A87A 1ANCA 1DS2E 3BTHE 2J2UA 2BDGA 3BTWE 3QTVH 5E0GA 2FOEA 4WH6A 3A88A 1C5LH 3EA7A 4A1VA 2GCHG 1BIOA 1O31A 1YCPK 1QFKH 5T3HA 1BTHH 1LDTT 2F9PA 3RXKA 1GGDB 1HAIH 2SGEE 1G3EA 4BANB 1FQ3A 2G00A 1JRSA 2RA0A 4E7NA 1W0ZU 1CHOF 1D4PB 1O2OA 4XSKU 1O2RA 1TX7A 2VGCC 3ZVDA 3ODFA 3STJA 1ZPBA 5EXLA 4AFQA 1GHXH 3UPEA 2FLBH 1VCWA 2BLQA 4Y7AA 3BTQE 5G4BA 1AO5A 3TJVA 4X6PA 4AFSA 1PYTD 1GJ7B 1SGPE 4XBBA 3ZVFA 1V2MT 1AFQC 1SLXB 2D2DA 1Y3XA 1Q31A 1P05A 2AMDA 1NU7B 4FUJA 2ZU3A 1O3KA 1T7CA 3E16B 1OWHA 5A2MH 1FY4A 1TAWA 2HPPH 1WUNH 1O36A 2QIQA 2Q6DA 1H9IE 1NN6A 1GJ4H 5PTPA 3EGKH 3GY7A 1Z8RA 1TPPA 2ZCKP 4CHAC 1TGTA 2SGDE 2XWAA 1AMHA 2FOHA 1MQ5A 2CMYA 2OC1A 4GVUA 3U1JB 1MTSA 2PGQB 3DFLA 1HDTH 1AD8H 2R2WU 1VCPA 1A2CH 4Q2KA 1SFQB 3O8DA 1VITG 1DWCH 1V2RT 3K9XB 3KQDA 3RXOA 3CS0A 2V0BA 2TGTA 4ASHA 1TRYA 5A8XA 1YP9A 2ZDLA 3KGPA 1DSUA 1FY3A 1OS8A 1CU1A 1NRQH 4FUEA 2GMTB 3GCTG 1P2QA 1UTQA 1WV7H 2OQUA 1HXFH 3RXDA 2BY5X 1GCTB 3R3GB 3ZVCA 5B6OA 2H2ZA 5DKMA 3ITIA 3PO1C 2OQ5A 2BYAX 4Y8ZA 3SV7A 2BDIA 3SHCH 2HPQH 1TOCB 3EQ0H 3EAJA 2VIWA 4UONA 1BRCE 1YF4A 1ZJDA 4KTUA 1C2FA 1C5PA 2FXRA 3BTFE 3RLWH 3OYPA 4CRCA 1NO9H 1GBTA 1P2KA 1XUJA 1HIAB 2Y81A 5H4IB 3RDZA 1YGCH 1C2LA 4TPYA 2PKAB 1ZLRA 3W95A 1QJ7B 4ABJA 4IGDA 1CVWH 2XTTB 1G2LA 2QC2A 4B2BA 3BIVH 1YC0A 1TYNA 1VGCB 2BZ6H 3URCA 2Z9KA 3LGYA 1EX3A 3K65B 4F49A 1J17T 3BV9B 3F6UH 3MOCA 3UQVA 1HBTH 1PQ5A 1N1LA 1G9IE 3LPRA 1G30B 4GCHG 4SGBE 1C2KA 1QJ1B 2D26C 2PFEA 5CE1A 2OBQA 1NRNH 1P9UA 4D76A 3QN7A 1KXCA 1SGCA 5F8ZA 1FIWA 1HAHH 2A1DB 1RGQA 2GCTC 3SQEE 2F9OA 3STIA 1B0FA 5I25A 4DW2U 3M7UA 4BAKB 3BEUA 1ELAA 1CT4E 2THFB 5FCKA 3TLOA 2SGAA 1S0QA 1EPTC 3SNBA 3AVZA 4A1XA 4OS4A 2H9EH 1EB2A 1F92A 4Z0KA 1IHTH 1RFNA 2O8UA 4CRBA 1ID5H 4NZQA 4NWLA 5T6DA 1AU8A 2IPHA 2VVUA 1A5HA 1QJ6B 3A7YA 3A7WA 3MWIU 3SI3H 1UVPA 2WYGA 3LIWA 4Y76A 2O8WA 1TA2A 4TPIZ 4WXVA 1MTVA 1BTYA 4ABBA 1O2WA 2B9LA 1SGTA 1MCVA 1MD8A 3PMBB 5IYTA 4A5TS 1AWHB 1DWEH 4ZHMU 3QDZB 1O32A 4XBCA 3E91A 1T8NA 2XBXA 1IQLA 4BAQB 1HAXB 1LCYA 1P3EA 2EI8A 1V2PT 4Q7YA 2QF3A 4WH8A 1G32B 2FWWA 3E3TA 2BD8A 5TCCA 1K1MA 2HWLB 1HAPH 3TJOA 1NU9A 1SR5C 2Z9LA 3E0PB 1Z8JB 4LXBH 2AIPA 3LDXH 5C67A 2W5EA 4IC5A 4AYYB 1O2UA 5GXPA 1Y5UT 5LH8A 1HAVB 3RMLH 2Q1JA 1FZZA 2WPKS 2ANKH 1UTPA 1AFQB 5AVDA 1W7XH 2ESTE 4K1TA 1BB0B 1A3EH 3OSYA 3A82A 1TB6H 3GISB 3E6PH 3PMHB 4ABEA 4HZHA 2F83A 3AAVA 3F9EA 3ZZ5A 1UTJA 1Z8IB 4X8TH 5A0BA 1ZZZA 2BLOA 4NG9H 1BUIA 3M3SA 1O2JA 1T4VH 3MI4A 2DUCA 1SQAA 3GOVB 3TNTA 1H9LB 2BMGB 2OCVB 1DX5M 1SGNE 1UTMA 3WY8A 1O3AA 1PPGE 1TBRH 1V2KT 1TQ0B 4NFFA 1DY9A 2P3UB 1GVZA 2GZ9A 2AIQA 1K1JA 3UOPA 1EATA 4VGCC 1W8BH 3TK9A 2GV7A 2O9QA 5EW2H 3DHKH 3ZZ9A 3B8JA 2V35A 4B1TA 2OC8A 1V2UT 1Z1JA 3MNSA 3PWCA 4U2WA 5GCHG 2ZU1A 1QQUA 1A5IA 5E2OA 2ZFPH 4B73A 2BQ7B 1UK3A 2V3OH 3ZZCA 3DFJA 1AVWA 1TE0A 2J95A 5EODA 1HUTH 2ZGCA 3P6ZB 5EXMA 1D3PB 1DE7H 1TIOA 1TBZH 1C1OA 3KCGH 2ZC9H 3TH3H 1SLWB 1BRAA 2R0LA 2SGFE 1P03A 2A7JA 1DITH 1DWBH 3PO1B 1MBQA 4A7IB 3ELAH 1OP8A 4NA9H 1O2ZA 2ZQ2A 4F4OC 1CT2E 1W11U 3FP7E 3T62A 4I7YH 4ISNA 1SSXA 2ZO3H 2EEKA 2DE8A 4BAHB 1RIWC 4K3JA 4AB9A 1YCPM 4LZ4B 1GDNA 1K1NA 1AUTC 3UUZA 3TK6A 2ZEBA 1BDAA 5EQRA 1ELVA 1O2NA 4IN2A 1GGDC 5BRRE 1CE5A 4FU8A 4AGJA 2ZGJA 1XVMA 1BBRH 2J4IA 3LGVA 1NS3A 2BVXH 3GDSA 2PUQH 5GJ4B 2VJ1A 1TBQH 3NPSA 3GCTF 4CBOA 1QGFA 1W12U 1HGTH 4Q80A 1TOMH 1GL1A 1VJ9U 1O2LA 4LOYH 1LHFH 2FTMA 1E36B 1NM6A 3VGCC 2BQ6B 3B9FH 4CH8B 1TNIA 3MH5A 1C1UH 3E0NB 4FXGH 4AG2A 1A4WH 1FIZA 2A2QH 4CR5A 1TQ7B 4FU7A 4H42U 5EXNA 4O03A 3IWMA 4WMEA 3PLBA 1ELDE 2OUAA 1ELGA 1O3DA 2R9PA 3BG4C 3LGUA 3RC4A 2BY8X 5FBEA 1ZOMA 1GHYH 2YNAA 2BOKA 1J14A 1PQ7A 5C1UA 2PSXA 3P8OA 3SU0A 1C5TA 5DP8A 1CGJE 3BTGE 1PPBH 1GJ8B 2Y5FA 4CREA 2AGEX 1CA8B 3L6PA 3M36A 4NA7A 3RC6A 2P95A 1EPTB 1EJMA 1GBIA 1LVYA 5EPNA 1LPGB 3EYDA 2J9NA 1ZR0A 5DPAA 2FI4E 3QZQA 3HK6B 4MDSA 2VH0A 1S84A 3URDA 1RTKA 2NWNA 1E0FD 4UEHH 3ENSB 4KELA 4X1NU 3LGWA 1TX6A 1EB1H 4CRAA 3MU8A 2FM2A 1GBDA 4U32A 1TPSA 1KY9A 3EA9A 3SGAE 1FUJA 5EG4A 2XCNA 1OX1A 4XBDA 2NU3E 2I6SA 2ZF0H 4GCHF 2FMJA 1TMUH 1VJAU 4KTCA 2IN2A 8LPRA 1GBJA 2HOBA 2FX4A 1QRZA 1W14U 4B71A 3D49H 2BD3A 1AY6H 3PROA 3RXQA 2GMTC 4YZUA 3MH4A 1QB9A 2H5DA 1L1NA 4JZDH 1AWFH 3A80A 3MHWU 1D3QB 4D8NA 1A0LA 1GCTC 2VWNA 1K1PA 2BY9X 4I8HA 5DG6A 2HVXA 1KTTB 1D3TB 6GCHG 4YOJA 4E05H 4B2CA 1OYQA 1ZRBA 4D9RA 4DG4A 4XE4A 1SOTA 2VB0A 5EQQA 3VFEA 1GI0A 4YTAA 1OWDA 4AFUA 1C5ZB 1FXYA 1NRPH 3S69A 2CN0H 1BHXF 4OS1A 3SUDA 1LVBA 2SFAA 4NZLA 5LGOA 1HXEH 1H9HE 5C1YA 1O2SA 1NTPA 1YPHC 4SGAE 3GCOA 1ANDA 3LT3A 4O3UA 2GX4A 9LPRA 1V3XA 3RXSA 2SGQE 1C5OH 1RXPA 1KDQA 3PM3A 1AHTH 3Q3XA 1RTLA 4R8TB 1NFUA 3U8RH 1MTWA 4ABDA 3TIUA 5A09A 1K9OE 4VGCB 2C8ZB 1TFXA 3L33A 2ZECA 2YOLA 4NIWA 1Y3YA 1Z71A 1MTUA 1O35A 3BN9A 7ESTE 3M3TA 4FU9A 4X6MA 5J4QA 1GI8B 2O8LA 1CHGA 1NROH 2ANWA 1GHZA 3F9GA 4Q7ZA 4THNH 5L6NH 3UQOA 2BM2A 3A81A 5HGGA 3ATIA 4BTUB 1AFEH 9ESTA 1UHBB 1A0HB 3ATLA 1O2YA 2H9TH 1T31A 3BTKE 4YLQH 5FHTA 1KXAA 1DVAH 3SV2H 1O2TA 3AAUA 2W3IA 1F7ZA 2BD5A 2RDLA 1BOQA 1ZYOA 3SNDA 3UR6A 2FX6A 2QA9E 1IHSH 5A8YA 2ZA5A 4B75A 1RIWB 2ZIQH 1GBHA 1CA0C 4U01A 4IMQA 1VITH 1P10A 2V6NA 1NY22 1KLIH 2P93A 1EZUC 4ZHAA 1QQ4A 5A0CA 2VNTA 2STBE 4Y11E 1QRXA 1KTSB 5E0HA 5GCHF 2QXHA 5TCAA 1BHXB 3MU5A 2OTVA 1ZHMA 1NESE 1C5YB 4GSOA 1A5GH 1AI8H 1RJXB 1LO6A 1GI2A 3F9HA 3M37A 1UTKA 2OC7A 1P12E 1OWIA 2BDHA 2TPIZ 2ZI2H 4YT7H 2BDBA 1UVTH 3FZZA 3K2UA 4BNRA 3SHAH 3E1XB 1J15A 3HATH 3T25A 4WMFA 4XFQA 3K6ZA 1E35B 4ABGA 1FV9A 3VGCB 1ELTA 1XKAC 1WQSA 3D23A 3MH6A 1F2SE 4BXSA 1B0EA 2Y6TA 2BZAA 2XBVA 2ZDKA 4JK5A 1MZAA 2ZFSA 2QY0B 1SGEE 4K8BA 1DOJA 1P2IA 3VXEH 2K1QA 1GMHF 5DK1A 3BG4B 3BSQA 3QUMP 3E90B 4INKA 4E06H 1GI5A 2ZU5A 3QGNB 1ORFA 3OY6U 1E37B 5GWZA 2ZCHP 3ATKA 4BTTB 1GDUA 1V2ST 5E0JA 2TGAA 4I31A 1GMCG 2QXIA 3TVJB 2ZKSA 1BJUA 1BTXA 1INCA 3A86A 2QF0A 3RXUA 3QWCH 3V12A 1O3IA 3DUXH 1H8DH 1QNJA 5ETXA 4I32A 2GVFA 1IQIA 3T26A 4OGYA 1AN1E 1KXBA 1ZTJA 4AX9H 5EPYA 1GHWH 2SNWA 3ZVEA 1PQ8A 2D1JA 1LHDH 3SV8A 5FX5A 1S5SA 2OINA 1P2JA 1L4ZA 3BTDE 2GKVE 4MNWA 5JPMH 4MNXA 2Y5GA 1SGFA 3RXBA 2ZDAH 4K2YA 3KNXA 4JK6A 4X2XA 1PJPA 3SGBE 1VR1H 2XNIA 3Q77A 2BTCE 1GI4A 5JB9S 4Y10E 2ILNA 1GBLA 2EA3A 1H8IH 1GBFA 2A5AA 1AE8H 1CGHA 1FN6A 1O5GH 1EZQA 3F1SB 1GHBG 6CHAB 1T8LA 4K5ZA 1SMFE 2GP9B 1C5RA 1VZQH 1LMWB 1QY6A 3FVFB 1QBVH 4UE7H 2Y7ZA 1GBKA 3BIUH 2CGAA 2QN5T 5FPSA 1G36A 5L30H 3SORA 3GY2A 1KSNA 1XXDA 2ZGXH 1TPOA 1BTPA 3TGKE 1C1NA 3LONA 1SOZA 3SUGA 1P3CA 4CR9A 1GBEA 1YPGH 1BMAA 3SV6A 1DM4B 1B7XB 4I8KA 1C1PA 1JIRA 2BDCA 1TNLA 3GY8A 4NWKA 8GCHG 3PYHA 1JMOH 2BLVA 5C5OA 1D3DB 1IQNA 1EAXA 1MD7A 1ZRKA 1C2GA 3GY3A 3HKIB 1DLEA 2WPIS 1PPHE 3C27B 4Y0ZE 1O3EA 2CJIA 1O3JA 1KXDA 2SGPE 3SU3A 2R2MB 2B5TB 1OSSA 1L1GA 4FUGA 4ZKOU 1Y8TA 5HXFA 2ZPSA 4WVPE 5JDUB 2Z3DA 6GCHF 1V6DA 4HGCA 4MPWA 2B7DH 3MU0A 5F6MA 5EW1H 1SVPA 2XWBI 3NKKA 4Y7BA 1TX8A 3S9AA 1GBBA 2QGRA 3ZV9A 4A6LA 1UMAH 4OS2A 4JYVH 4BOHA 5FBIA 1O2QA 3SI4H 3NWUA 4Q7XA 1A61H 1ARCA 3MMGA 1V2JT 4FVDA 3ZYEA 2PWXA 5C1XA 3I29A 3OY5U 1HYLA 1UTNA 4FVBA 2BY6X 1TMTH 1P57B 1C4Y2 2WUBA 1S6HA 5HMAA 5DP4A 1FY1A 1ZPZA 1ZGVA 1SLVB 1C5SA 1O2XA 1SQOA 1CA0B 1W10U 2TIOA 4JZIA 4NA8A 1THSH 1P9SA 3SJOA 3T27A 3LGIA 4DGJA 4B2AA 3SGQE 2PKSC 2P16A 4I8GA 5FAHA 3GCNA 2R0KA 4UDWH 3TGIE 2O8MA 1AUJA 1G37A 2W26A 1THPB 3S7KB 1YPKH 1GWAA 2GT8A 3HPTB 3NZIA 1LVOA 3ZV8A 2ZNKH 1FJSA 1UCYH 2IJOB 1SGRE 1LHGH 3ZZ6A 1D9IA 2J94A 1A3BH 2ALPA 3SJ9A 1UCYE 1O3GA 1O5AB 2HLCA 4ZXXH 1K1IA 2BVRH 1C1WH 1OOKB 1AVGH 2FS9A 2G8TA 1O3BA 3LH3A 3HKJB 1SGQE 4UFFH 2XBYA 1K1LA 1C5UA 2VVCA 1TGSZ 2FYQA 1GHAG 3A7XA 3MU1A 4DIHH 1IOEA 2UUFB 1MZDA 1LQEA 3M7TA 1D6RA 1GI9B 1YPHE 2ZFFH 4YLUA 1P0SH 4UFDH 2PV9B 5F8TA 2GCHF 1XM1A 3NXPA 3SJIA 3GDUA 1HAVA 3E8LA 4ABAA 1SGFG 2ZU4A 4QT8C 4ZMAH 2UUKB 1O3PB 5GDSH 2AFQB 1O2IA 3U8TH 3FAOA 4AZ2B 1NFXA 2GGVB 1DUEA 1OPHB 3ZVBA 3UNSA 2RA3A 4E7RG 2BY7X 1EP6A 5FXLA 1SGYE 2NU2E 1U6QA 4X8UH 1ANBA 1QA7A 1FAKH 2KAIA 2XRCA 3DA9B 3K6YA 2QXGA 1P04A 5DP5A 1DXPA 1EAUA 7KMEH 4NFEA 4ISLA 2F9NA 1O39A 2ZHQH 3ATWA 1GL0E 1V2QT 1TPAE 1OYTH 2AGIX 2DE9A 2ZP0H 3FFGA 4Y8YA 5JB8S 1HPGA 3U98H 3QGJA 4DT7B 4LZ1H 1BCUH 1O5EH 2JH5D 1GMCF 3A8AA 4MNYA 2TBSA 4IC6A 1EKBB 2BDAA 2FOGA 3BTEE 3M61U 5A8ZA 1Y5AT 2AYWA 4O3TA 1SGIB 4M7GA 1ABJH 1HJAB 4K60A 1GMDG 1CHOG 4AN7A 5HYOA 3SV9A 1MMJN 4MQAA 1QURH 2A0QB 2CXVA 3GY6A 1BTWA 1OWKA 1O33A 2G4UA 3KEEA 1DSTA 1VITF 1O37A 2Z3EA 1G3CA 4DOQA 2PTNA 1GG6B 3O8RA 1C9PA 1V2NT 3LC3A 5IDKA 2XC5A 2ZPRA 3SU5A 1YLDA 2BX3A 1P11E 1AKSA 1GJ9B 2Y80A 1XMNB 1RTFB 1ELFA 2WUCA 4I33A 4WJG2 2BDYA 4A92A 3RLYH 1BBRE 5JBTA 1BTUA 1C1VH 1NZQH 1W2KH 4X0WU 3SU2A 1BMNH 1GHBF 3Q3KA 1S85A 2A7CA 1BT7A 2Y82A 2EI6A 2WPMS 1GBCA 1TMBH 3I78A 5FCRA 1SGDE 1ETSH 1PPZA 1ESAA 1OP2A 4WWYA 1M9UA 1Y3VA 2ZDVH 4NIVA 1FMGA 4D7FA 1RRKA 1TWXB 1KIGH 1S0RA 1LPZB 2QXJA 4KTSA 4FUBA 2FP7B 1HCGA 3VB5A 2Z3CA 3QTOH 8GCHF 2QV1A 1HJ8A 1ZSLA 1FI8A 8ESTE 1MTNC 3RXTA 1C1SA 1XXFA 3PTBA 4I8JA 2IOTA 2FOFA 2VWMA 5GPIB 3NCLA 3UREA 1C2DA 2ZZUH 1SPJA 3LU9B 2PKSB 3U69H 5L2YH 5LPRA 1MAYA 4KP0A 5FX6A 2VIOA 4I8LA 5C3NA 3ZYDA 2OLGA 2W7UA 3U1IB 1O5FH 4K8YA 4UFEH 5F03A 4A1TA 1SBWA 5LPEA 1ELBA 1P2MA 1QL8A 1ELEE 5AFZH 5ESBA 4CRFA 4YM9A 1GI6A 1P09A 1KYNA 1CBWB 1S82A 2F9UA 2FOBA 4NSYA 1Z6EA 3V3MA 4AB8A 4CRDA 5A0AE 1JWTA 2C4FH 2GTBA 1AB9B 2G5NA 3AW1A 1QBNA 6CHAC 1IQKA 3LC5A 4Z6AH 2ZFTA 5JYIA 1QBOA 3C1KA 1S83A 1O3MA 2WPJS 2FTLE 3RXLA 1DXWA 2ZTYA 1ZPCA 3ZZ4A 4XDEA 2BD9A 4YOIA 3RXFA 1Q3XA 4RSPA 3UOUA 3BTTE 5DP9A 4BAOB 2G51A 1O3LA 4TWYA 1K22H 1A7SA 2A7HA 4TYDA 1ZSKA 3P8NA 1SC8U 1O2GH 1P8VC 1GI1A 2ZWLH 2BLWA 1TA6A 1FAXA 1MKXH 1HB0B 1KDQB 1T8MA 2FI5E 1F5LA 1O2MA 1DANH 3AW0A 1BZXE 1ETRH 3NUMA 3F9FA 3O8CA 1AZ8A 2CHAC 3SU4A 1DY8A 1IQJA 2B8OH 1FPHH 4DY7B 3AASA 1HAYB 1DUAA 3UWJH 3PWBA 3CENA 1F0SA 3VB6A 1C5QA 3A85A 2Z6BD 5DO4H 2PW8H 3Q00A 4MVNA 2CF9H 2F91A 3I77A 1C5MD 1WAYB 1TALA 4O9VA 2Z94A 5CHAB 1YM0A 3RU4D 4OS7A 1GHVH 1Y3UA 1QR3E 7GCHG 2FOAA 2G4TA 2A4OA 5EQSA 1MKWH 2TRMA 2Y5HA 4FUDA 1GHAF 4FUIA 1Z7KA 2BD7A 1UJ1A 2A5KA 2A5IA 1RS0A 4HFPB 1NFYA 2XYAA 1C2JA 1P06A 1YKTA 1C9TA 2FOCA 3KN2A 3SU1A 3UNQA 1A46H 4OS6A 1XVOA 1WSSH 1F5KU 3V0XA 3PLKA 1T32A 4CBNA 1EASA 3SQHE 4IS5A 2FDAA 4YT6H 1G3BA 1TGCA 3VB7A 1L1JA 3S0NA 1IQEA 1OWEA 2ZQ1A 4DIIH 1E38B 5FPYA 1BJVA 1L0ZA 4Y79A 1P02A 3RXEA 2AEIH 2PTCE 6ESTA 5GIBA 5K0HA 3UNRA 1UK2A 2A31A 2OC0A 3TH4H 1GCDA 1QTFA 3KF2A 1AQ7A 1PFXC 1V2TT 3V7TA 5ESTE 2FYRA 5I46H 2G5VA 1ARBA 5EGMA 1QL9A 2ZTXA 4WXIA 1O5DH 3QK1A 4ISHH 5LPFA 3M5LA 3SOSA 1WCZA 3S9CA 3ESTA 1O5CB 2G52A 4X1QU 2ALVA 3MTYA 2JKHA 3UIRA 2QAAA 1XUFA 1XUKA 2ULLA 1HAOH 1EAIA 3VEQB 1FY8E 4YO9A 3RXJA 1BA8B 1GMDF 2C8XB 1EZSC 4AFZA 1UCYK 3Q3YA 3KIDU 1BTZA 1J16A 2ODYB 1FN8A 1OP0A 1C2HA 3BEIB 2JH6D 3UFAA 3D62A 1QIXB 4DCDA 2R3YA 1DLKB 3U9AH 1BITA 1MCTA 1Y59T 1LHEH 1TONA 2NU0E 3KQEA 3RMNH 2PHBA 1GJBB 1HFDA 2H9HA 2VU8E 2XCFA 3MFJA 1C2EA 3A7VA 2FESH 1MTNB 2A4RA 1ELCA 1FONA 1HJ9A 1F0RA 2P3FH 4X6NA 1JIMA 1V2OT 4MTBA 1RD3B 3SNEA 4YESB 3MU4A 3HGPA
chains in the Genus database with same CATH superfamily
1ESTA 3BEFB 5C2ZA 2HRVA 3N7OA 3L3TA 1JBUH 3TNSA 1NFWA 4IBLH 1V2WT 1ZGIA 4DJZB 5AFYH 1C1QA 1IAUA 2FZZA 3SNAA 4GHTA 2AMPA 2JETB 2GDDA 2VH6A 3P17H 5SGAE 3GCHB 3LJOA 3PLPA 2ODPA 3PTNA 5HM9A 2C90B 4TY7A 4JZ1A 1YBWA 5JBCS 2OBOA 4Y8XA 3UR9A 4ABHA 2CV3A 4NIYA 2ZHEH 1TNGA 3HK3B 1HJAC 5AHGH 1PPFE 1FPCH 1PPEE 2VVVA 2OXSA 1MU6B 4ZKRU 1P2OA 4GPGA 4F48B 2ODQA 1AZZA 1QB1A 2BVSH 3RXHA 2ZHDA 1SI5H 3WWFA 4ZUHA 4DURA 5HIYA 1O3CA 2AERH 1DDJA 1D6WA 3ATMA 1GG6C 2ZGHA 4Y6DA 2NU4E 1IQHA 2CHAB 1EQ9A 1ZMLA 1C5VA 1H8ED 2PGBB 3QX5H 2W7SA 3SNCA 4H4FA 2D8WA 2WPHS 3TJNA 3P8GA 3RMOH 3LH1A 3UTUH 3TGJE 3GICB 1L4DA 1WTHD 2A4GA 3ZZ8A 1TRMA 7LPRA 2VWLA 3GYMA 4NIXA 1HAZB 2EC9H 1A1RA 1HIAA 2Z7FE 3MYWA 2OP9A 2PKAA 4RN6A 1BBRK 4H6TA 4X2WA 3N7DA 5ABWA 2XW9A 3ZZDA 2AMQA 4U30A 1G3DA 4HI3A 4ISOA 3H5CB 5C20A 1OXGA 1W3CA 1N6YA 1KLJH 1X7AC 2XC4A 1F5RA 1WOFA 1CGIE 2V3HH 3RXCA 3ZZ3A 2RCEA 4ESTE 3V13A 2H6MA 4D9QA 1N8OB 1E1QD 1MU8B 3DSOA 2LNCA 1LKAA 2HNTC 3ZZBA 2A32A 1J9CH 1O2VA 3MO3A 1ZSJA 4JYUH 3RXPA 1TNJA 3R0FA 2ZTZA 2Y7XA 1HV7A 1Y3WA 2R3UA 5BPEA 1LPKB 1TGBA 3KQCA 4ZKSU 4X1RU 2BXUH 1EZXC 2GZ8A 3TK5A 2QYIA 4X2YA 4X8VH 1TABE 2H5CA 1YY3A 1IQGA 2J92A 3M3VA 1ESBA 1K1OA 1O5BB 1EJNA 1YCPH 3H7TA 4WY3A 4RKJB 1SHHB 4LK4A 1EOLA 3EE0B 4IMZA 4AGKA 1QA0A 7GCHF 1C4V2 2I6QA 1GDQA 3RU4T 1ZMJA 1SQTA 2P8OC 1W13U 3A7TA 3GYLB 1CBWC 1O3FA 2HVYB 2SNVA 2Q6GA 1OKXA 1MH0A 4FOUC 2FI3E 1UVUH 1DPOA 3N99A 1GI7B 3A8BA 2ZDNA 3PV4A 4UFGH 1GJ5H 1AB9C 5AF9H 3SBKA 3HGNA 1SB1H 1L2EA 3M7QA 1AIXH 3OAAD 3SUEA 4OM9A 2HGTH 3SJKA 1K21H 2FPZA 3TU7H 2KCYA 1XKBC 1TLDA 2PUXB 3JZ2B 4GHQA 2VGCB 1A0JA 4MPVA 4AORA 5F8XA 3OX7U 1XX9A 1PYTC 1TGNA 4ZH8A 1FLEE 4ISIH 1NC6A 3TITA 2AS9A 3RXIA 2XNDD 3VB3A 4RI0A 1MAXA 3TH2H 2OD3B 1TRNA 2NU1E 4K1SA 2G81E 5L2ZH 1T4UH 2C8YB 1QHRB 3RUOA 1GBAA 2ZHWH 1KLTA 2ZCLP 2AH4X 3BF6H 2AGGX 4XOJA 2FEQH 3IG6B 1LKBA 1C2MA 4AYVB 4D7GA 1KXEA 1PPCE 1S81A 2Z9IA 3M5MA 4BAMB 4CH2B 1J8AA 1EUFA 3QO6A 4FETA 3RXMA 3GDVA 2KAIB 1C5NH 1C5WB 1DT2A 2UUJB 1ACBE 1C1MA 1O0DH 3LKWA 2KZ4A 1PQAA 1HRTH 1UK4A 3KQBA 1NT1A 5CHAC 4AOQA 4NCYA 5DN6D 3ZZAA 2O8TA 3QZRA 1W7GH 1HNEE 1MKXK 4CHAB 2ANMH 2ZFQH 2ZU2A 3A89A 2BHGA 5E8EH 5J4SA 1EXFA 2TGDA 3PB1E 1O2PA 4IW4E 2PSYA 5EOKA 1GI3A 4X1PU 1GJAB 2A45B 1QB6A 2HNTF 2ANYA 4WMDA 3O8BA 3WWBA 2C8WB 2C3SA 2F9BH 2VIVA 1CQQA 4J1YA 4DT4A 5HM2A 4J2YB 3T28A 1C2IA 3OE7D 4CRGA 1TNHA 2UWOA 3BG8A 3F68H 3ZZ7A 3RXGA 2RG3A 3T29A 1YPEH 3GY4A 1Z1IA 1C5XB 1MKWK 1AGJA 4O97A 4Y0YE 1V2LT 5JBAS 1XUGA 3PMAB 2G55A 4K1EA 2GDEH 2ASUB 1EAWA 1N6XA 3ZVAA 5K7RA 1WYKA 1ZTKA 4ABIA 2XBWA 4ZKNU 3A83A 3P8FA 3RP2A 2P59A 3S9BA 1FX0B 1NRSH 3A7ZA 1Q2WA 2BQWB 1C1TA 3VPKA 4K69A 1GMHG 1AKSB 3UY9A 1ETTH 1F0TA 2FOMB 2P94A 2YNBA 1BRBE 2WPLS 4GLYA 2JIZD 3MNBA 5DP3A 3MQKC 3MO9A 4INHA 5DP6A 1LTOA 2KCPA 4ZAEA 5JBBS 1Z8GA 5TJXA 3P92A 2CF8H 3KL6A 2H1UA 1QL7A 2BX4A 1QCPA 3LGTA 1IQMA 2PP6A 3TJUA 3P70B 1O34A 3NK8A 1S6FA 1VCQA 1H4WA 4OS5A 1LQDB 4MPUA 5C5NA 2P3TB 1GVKB 1T8OA 1UO6A 4BXWA 1C1RA 5T6FA 2VIQA 3MH7A 1DWDH 1O3OA 1DFPA 2WINI 5E2PA 3OTJE 3ODDA 4ABFA 2BOHB 1AE5A 3FP8E 5DP7A 2Q6FA 3GY5A 1JRTA 1XUIA 4X2VA 3CS7A 2GZ7A 2BXTH 3A84A 4WF8A 1K0HA 4BTIB 1SHYA 2A2XH 3SZNA 4ZHLU 1GPZA 3FZDA 2A4QA 2WV5A 1K28D 1LVMA 2GCTB 3QLPH 1BMMH 1CSOE 3RC5A 2ZFRH 4JZEH 1G2MA 1JXPA 5T6GA 2EI7A 3OU0A 1YPLH 3BTME 4ASUD 4R0IA 3DSGA 5DGJA 1AVXA 3M5NA 3RXVA 4XRNA 1EPTA 3P95A 1UVSH 1C4U2 4JYTA 1DICA 1H1BA 1ANEA 1SFIA 3B23B 1Y5BT 1WBGB 1UTLM 4TWWA 2PR3A 3D65E 3FANA 1EOJA 2P8OB 2JETC 1TNKA 2TGPZ 3GCHC 3JZ1B 5CMXH 2XC0A 2WYJA 2F3CE 3LJJA 2PLXA 4KGAA 2ZHFH 1F0UA 1BRUP 3LOXA 1LHCH 2VINA 3T5FH 2UWLA 2FIRH 1CO7E 1HLTH 1O30A 3RXAA 1EJAA 3RM0H 4MPXA 4YOGA 2FLRH 4MG3A 4PROA 4OGXA 5FPTA 4MLFB 2BB4A 3IITA 2BD4A 1SL3A 2HALA 2JH0D 3ZVGA 3SJ8A 2VIPA 1O3NA 3DD2H 3M5OA 1K2I1 2FODA 4Y71A 2XXLA 3SN8A 2C93B 3PMJA 2FS8A 2HLDD 3EDXB 2QCYA 4B74A 4NSVA 3SW2B 1GJ6A 3S7HB 1KXFA 4AG1A 2WV4A 2LPRA 2STAE 1NPMA 4H6SB 3W94A 1XUHA 2ZPQA 4GAWA 3RU4E 4FUHA 1SG8B 4KKDA 4JZFH 1YLCA 1H8HD 4HG6A 3T2NA 2GV6A 3SO3A 1YPJH 4JMYA 3G01A 1ZMNA 3SU6A 4B76A 1GBMA 1GJCB 1ZHPA 1EP5A 1GJDB 4ACAA 2YMSB 3EE7A 1V2VT 1Z6JH 3A8CA 3FP6E 2B0FA 3M35A 1MQ6A 3F2FA 4TY6A 3MNCA 2ZG0H 1HAGE 4DVAU 1GVLA 2ZDMA 4X8SH 3RM2H 5C17A 2VIDA 5DJ7A 1FNIA 1B5GH 1O3HA 1CT0E 1VGCC 2W3KA 3EA8A 2M5TA 4F55A 1P01A 3SUFA 5EU8A 4JCNA 2F9VA 1BQYA 1E34B 1O2KA 1YYY1 3UWIA 3MNXA 3MO6A 4NGAH 1O2HA 1UVOA 3Q76A 1BMLA 3A8DA 2UUYA 1WU1A 2Z9GA 1FDPA 2KCOA 1N8OC 2J34A 2HNTE 2GT7A 2KX4A 1SLUB 1WTGH 2FO9A 4MNVA 1MBMA 1WQVH 4ZROA 1OWJA 2GD4B 3VB4A 1THRH 1ZJKA 1JOUB 2J38A 4X6OA 3DT0H 1YPMH 4IN1A 3TPIZ 6LPRA 1ZHRA 1ZTLA 2Z9JA 1UHBA 1W0YH 4HTCH 4X1SU 3VXFH 2VWOA 4FUCA 8KME2 3U8OH 1MUEB 1NRRH 1FY5A 1YWUA 4ZXYH 2BD2A 2UWPA 3KHVA 3H7OA 4FUFA 4UD9H 3CP7A 4INLA 4RKOB 1IQFA 1O38A 1UTOA 3RMMH 4GUXA 1ABIH 3RXRA 1QRWA 1P2NA 2ZGBH 3A87A 1ANCA 1DS2E 3BTHE 2J2UA 2BDGA 3BTWE 3QTVH 5E0GA 2FOEA 4WH6A 2F4LA 3A88A 1C5LH 3EA7A 4A1VA 2GCHG 3F0OA 1BIOA 1O31A 1YCPK 1QFKH 5T3HA 1BTHH 1LDTT 3VG8A 2F9PA 3RXKA 1GGDB 1HAIH 2SGEE 1G3EA 4BANB 1FQ3A 2G00A 1JRSA 2RA0A 4E7NA 1W0ZU 1CHOF 1D4PB 1O2OA 2IJD1 4XSKU 1O2RA 1TX7A 2VGCC 3ZVDA 3ODFA 3STJA 1ZPBA 5EXLA 4AFQA 5EIYA 1GHXH 2QF5A 3UPEA 2FLBH 1VCWA 2BLQA 4Y7AA 3BTQE 5G4BA 1AO5A 3TJVA 4X6PA 2JDID 4AFSA 1PYTD 1GJ7B 1SGPE 4XBBA 3ZVFA 1V2MT 1AFQC 1SLXB 2D2DA 1Y3XA 1Q31A 2EY4C 1P05A 5KEDA 2AMDA 1NU7B 4FUJA 2ZU3A 1O3KA 1T7CA 3E16B 1OWHA 5A2MH 1FY4A 1TAWA 2HPPH 2WZQA 1WUNH 1O36A 2QIQA 2Q6DA 1H9IE 1NN6A 1GJ4H 5PTPA 3EGKH 3GY7A 3SYJA 3UAIC 1Z8RA 1TPPA 2ZCKP 4CHAC 1TGTA 2SGDE 2XWAA 1AMHA 2FOHA 1MQ5A 2CMYA 2OC1A 2YMSD 4GVUA 3U1JB 1MTSA 2PGQB 3DFLA 1HDTH 1AD8H 2R2WU 1VCPA 1A2CH 4Q2KA 1SFQB 3O8DA 1VITG 1DWCH 1V2RT 2GJGA 3K9XB 3KQDA 3RXOA 3CS0A 2V0BA 2TGTA 3H09A 4ASHA 1TRYA 5A8XA 1YP9A 2ZDLA 3KGPA 1DSUA 1FY3A 1OS8A 1CU1A 1NRQH 4FUEA 2GMTB 3GCTG 1P2QA 1UTQA 1WV7H 2OQUA 1HXFH 1E1RD 3RXDA 2BY5X 1GCTB 3R3GB 3ZVCA 5B6OA 2H2ZA 5DKMA 3ITIA 3PO1C 2OQ5A 2BYAX 4Y8ZA 3SV7A 2BDIA 2WSSD 3SHCH 2HPQH 1TOCB 3EQ0H 3EAJA 2VIWA 4UONA 1BRCE 1YF4A 1ZJDA 4I86A 4KTUA 1C2FA 1C5PA 2FXRA 3BTFE 3PV2A 3RLWH 3OYPA 4CRCA 1NO9H 1GBTA 2J98A 1P2KA 2W6ID 1XUJA 1HIAB 2Y81A 5H4IB 3RDZA 1YGCH 1C2LA 4TPYA 2PKAB 1ZLRA 3W95A 1QJ7B 4ABJA 4IGDA 1CVWH 2XTTB 1G2LA 2QC2A 4B2BA 3BIVH 1YC0A 1TYNA 1VGCB 2BZ6H 3URCA 2Z9KA 3LGYA 1EX3A 3K65B 4F49A 1J17T 3BV9B 3F6UH 3MOCA 3UQVA 1HBTH 1PQ5A 1N1LA 1G9IE 3LPRA 1G30B 3OEHD 2V7QD 4GCHG 4SGBE 1C2KA 1QJ1B 2D26C 2PFEA 5CE1A 2OBQA 1NRNH 1P9UA 4D76A 3QN7A 1KXCA 5EJLA 1SGCA 5F8ZA 1FIWA 1HAHH 2A1DB 1RGQA 2GCTC 3SQEE 3WW7A 2F9OA 4ACBA 3STIA 1B0FA 5I25A 4DW2U 3M7UA 4BAKB 3BEUA 1ELAA 1CT4E 2THFB 5FCKA 3TLOA 2SGAA 1QZ8A 1S0QA 1EPTC 3SNBA 3AVZA 4A1XA 4OS4A 2H9EH 1EB2A 1F92A 4Z0KA 1IHTH 1RFNA 2O8UA 4CRBA 1ID5H 4NZQA 4NWLA 5T6DA 1AU8A 2IPHA 3FO8D 2VVUA 1A5HA 1QJ6B 3A7YA 4YXWD 1BMFD 3A7WA 3MWIU 3SI3H 1UVPA 2WYGA 3LIWA 4Y76A 2O8WA 1TA2A 4TPIZ 4WXVA 1MTVA 1BTYA 4ABBA 1O2WA 2B9LA 1SGTA 1MCVA 1MD8A 1W0KD 2KFWA 3PMBB 1AWHB 1DWEH 5IYTA 4ZHMU 4A5TS 3QDZB 1O32A 4XBCA 3E91A 1T8NA 2XBXA 1IQLA 4BAQB 1HAXB 1LCYA 1P3EA 2EI8A 1V2PT 4Q7YA 2QF3A 4WH8A 5EJZA 1G32B 2FWWA 3E3TA 5GNDA 2BD8A 5TCCA 1K1MA 2HWLB 1HAPH 3TJOA 1NU9A 1SR5C 2Z9LA 3E0PB 1Z8JB 3DCLA 4LXBH 2QF4A 2AIPA 3LDXH 5C67A 2W5EA 4IC5A 4AYYB 1O2UA 4TSFD 5GXPA 1Y5UT 2L6OA 3GS9A 5LH8A 1HAVB 3RMLH 2Q1JA 1FZZA 2WPKS 2ANKH 1UTPA 1AFQB 5AVDA 1W7XH 2ESTE 4K1TA 3F2HA 1BB0B 3FKSD 1A3EH 3OSYA 2J5UA 3A82A 1TB6H 3GISB 3E6PH 3PMHB 4ABEA 4HZHA 2F83A 3AAVA 3F9EA 3ZZ5A 1UTJA 1Z8IB 4X8TH 5A0BA 1ZZZA 2BLOA 4NG9H 1BUIA 3M3SA 1O2JA 1T4VH 2YMSC 3MI4A 4B6EA 2DUCA 1SQAA 3GOVB 3FOAA 1H9LB 3TNTA 5DSFA 2BMGB 2OCVB 2LELA 1DX5M 1SGNE 1UTMA 3WY8A 1O3AA 1PPGE 1TBRH 1V2KT 1TQ0B 4NFFA 1DY9A 2P3UB 1GVZA 2GZ9A 2AIQA 1K1JA 3UOPA 1EATA 4VGCC 1W8BH 3TK9A 2GV7A 2O9QA 5EW2H 3DHKH 3ZZ9A 3B8JA 2V35A 4B1TA 2OC8A 1V2UT 1Z1JA 3MNSA 3PWCA 4U2WA 5GCHG 2ZU1A 1QQUA 1A5IA 5E2OA 2ZFPH 4B73A 1WDIA 2BQ7B 1UK3A 2V3OH 3ZZCA 3DFJA 3F2GA 1AVWA 1TE0A 2J95A 5EODA 1HUTH 2ZGCA 3P6ZB 5EXMA 1D3PB 1DE7H 1TIOA 1TBZH 1C1OA 3KCGH 2ZC9H 3TH3H 1SLWB 1BRAA 2R0LA 2SGFE 1P03A 2A7JA 1DITH 1DWBH 3PO1B 1MBQA 4A7IB 3ELAH 1OP8A 4NA9H 1O2ZA 2ZQ2A 4F4OC 1CT2E 1W11U 3FP7E 3T62A 4I7YH 4ISNA 1SSXA 2ZO3H 2EEKA 2DE8A 4BAHB 1RIWC 4K3JA 4AB9A 1YCPM 4LZ4B 1GDNA 1K1NA 1AUTC 3UUZA 1W0JD 3TK6A 2ZEBA 1BDAA 1NBMD 5EQRA 1ELVA 1O2NA 4IN2A 1GGDC 5BRRE 1CE5A 4FU8A 4AGJA 2ZGJA 1XVMA 4XD7D 1BBRH 2J4IA 3LGVA 1NS3A 2BVXH 3GDSA 2PUQH 5GJ4B 2VJ1A 1TBQH 3NPSA 3GCTF 4CBOA 1QGFA 1W12U 1HGTH 4Q80A 1TOMH 1GL1A 1VJ9U 1O2LA 4LOYH 1LHFH 2FTMA 1E36B 1NM6A 3VGCC 2BQ6B 3B9FH 4CH8B 1TNIA 3MH5A 1C1UH 3E0NB 4FXGH 4AG2A 1A4WH 1FIZA 2A2QH 4CR5A 1TQ7B 4FU7A 4H42U 5EXNA 4O03A 3IWMA 4WMEA 3PLBA 1ELDE 2OUAA 1ELGA 1O3DA 2R9PA 3BG4C 3LGUA 3RC4A 2BY8X 5FBEA 1ZOMA 1GHYH 2YNAA 2BOKA 4B6FA 1J14A 1PQ7A 5C1UA 2PSXA 3P8OA 3SU0A 1C5TA 5DP8A 1CGJE 3BTGE 1PPBH 1GJ8B 2Y5FA 4CREA 2AGEX 1CA8B 3L6PA 3M36A 4NA7A 4Q4LA 5HIZA 3RC6A 2P95A 5B6LA 1EPTB 1EJMA 1GBIA 2W6JD 1LVYA 1VKYA 5EPNA 1LPGB 3U28C 2AHME 3EYDA 2J9NA 1ZR0A 5DPAA 2FI4E 3QZQA 1OHHD 3HK6B 4MDSA 1EFRD 2VH0A 1S84A 2QE7D 3URDA 1RTKA 2NWNA 1E0FD 4UEHH 3ENSB 4KELA 4X1NU 3LGWA 1TX6A 1EB1H 4CRAA 3MU8A 2FM2A 1GBDA 4U32A 1TPSA 1KY9A 3EA9A 3SGAE 1FUJA 5EG4A 2XCNA 1OX1A 4XBDA 4Z1MD 2NU3E 2I6SA 2F43B 2ZF0H 4GCHF 2FMJA 1TMUH 1VJAU 4KTCA 2IN2A 8LPRA 1GBJA 2HOBA 2FX4A 1QRZA 1W14U 4B71A 3D49H 2BD3A 1AY6H 3PROA 3RXQA 2GMTC 4YZUA 3MH4A 1QB9A 2H5DA 1L1NA 4JZDH 1AWFH 3A80A 3MHWU 1D3QB 4D8NA 1A0LA 1GCTC 2VWNA 1K1PA 2BY9X 4I8HA 5DG6A 2HVXA 1KTTB 2KR7A 1D3TB 6GCHG 4YOJA 4E05H 4B2CA 1OYQA 1ZRBA 4D9RA 4DG4A 4XE4A 1SOTA 2VB0A 5EQQA 3VFEA 1GI0A 4YTAA 4AC9A 1E79D 1OWDA 4AFUA 1C5ZB 1FXYA 1NRPH 3S69A 2CN0H 1BHXF 4OS1A 3SUDA 1LVBA 2SFAA 4NZLA 5LGOA 1HXEH 1H9HE 5C94A 5C1YA 1O2SA 1COWD 1NTPA 1YPHC 4SGAE 3GCOA 1ANDA 2RDEA 3LT3A 4O3UA 2GX4A 9LPRA 1V3XA 3RXSA 5FL7D 2SGQE 1C5OH 1RXPA 3FN8A 1KDQA 3PM3A 1AHTH 3Q3XA 1RTLA 2V3MA 1NFUA 4R8TB 4TT3D 3U8RH 1MTWA 4ABDA 3TIUA 5A09A 1K9OE 4VGCB 2C8ZB 1TFXA 3L33A 2ZECA 2YOLA 4NIWA 1Y3YA 1Z71A 1MTUA 1O35A 3BN9A 7ESTE 3M3TA 4FU9A 4X6MA 5J4QA 1GI8B 2O8LA 1CHGA 5KGOA 1NROH 2JJ1D 2ANWA 1GHZA 3F9GA 4Q7ZA 4THNH 5L6NH 3UQOA 2BM2A 3A81A 5HGGA 3ATIA 4BTUB 1AFEH 9ESTA 1UHBB 1A0HB 3ATLA 1O2YA 2H9TH 1T31A 3BTKE 4YLQH 5FHTA 3CNRA 1KXAA 1DVAH 3SV2H 1O2TA 3AAUA 2W3IA 1F7ZA 2BD5A 2RDLA 1BOQA 1ZYOA 3SNDA 3UR6A 2WHXA 2FX6A 2QA9E 3AK5A 1IHSH 5CDFE 5A8YA 2ZA5A 4B75A 1RIWB 2ZIQH 1GBHA 1CA0C 4U01A 4IMQA 1VITH 1P10A 2V6NA 1NY22 1KLIH 2P93A 1EZUC 4ZHAA 1QQ4A 5A0CA 2VNTA 2STBE 4Y11E 1QRXA 1KTSB 5E0HA 5GCHF 2QXHA 5TCAA 1BHXB 3MU5A 2OTVA 1ZHMA 1NESE 1C5YB 4GSOA 1A5GH 1AI8H 1RJXB 3KYGA 1LO6A 1GI2A 3F9HA 3M37A 1UTKA 2OC7A 1P12E 1OWIA 2BDHA 2TPIZ 2ZI2H 4YT7H 2BDBA 1UVTH 3FZZA 3K2UA 2K0QA 4BNRA 3SHAH 3E1XB 1J15A 3HATH 3T25A 4WMFA 4XFQA 3K6ZA 1E35B 4ABGA 1FV9A 3VGCB 1ELTA 1XKAC 1WQSA 3D23A 3MH6A 1F2SE 4BXSA 1B0EA 2Y6TA 2BZAA 2XBVA 2ZDKA 4JK5A 1MZAA 2ZFSA 2QY0B 1SGEE 4K8BA 1DOJA 1P2IA 3VXEH 2K1QA 1GMHF 5DK1A 3BG4B 3BSQA 3QUMP 3E90B 4INKA 4E06H 1GI5A 2ZU5A 3QGNB 1ORFA 3OY6U 1E37B 5GWZA 2ZCHP 3ATKA 4BTTB 1GDUA 1V2ST 5E0JA 2TGAA 4I31A 1GMCG 2QXIA 3TVJB 2ZKSA 1BJUA 1BTXA 1INCA 1UW7A 3A86A 2QF0A 3RXUA 3QWCH 5HKKD 3V12A 1O3IA 3DUXH 1H8DH 1QNJA 5ETXA 4I32A 2GVFA 1IQIA 3T26A 4OGYA 1AN1E 1KXBA 1ZTJA 4AX9H 5EPYA 1GHWH 2SNWA 3ZVEA 1PQ8A 2D1JA 1LHDH 3SV8A 5FX5A 1S5SA 2OINA 1P2JA 1L4ZA 3BTDE 2GKVE 4MNWA 5JPMH 4MNXA 2Y5GA 1SGFA 3RXBA 3PRBA 2ZDAH 4K2YA 3F3BA 3KNXA 4JK6A 4X2XA 1PJPA 3SGBE 1VR1H 2XNIA 3Q77A 2BTCE 1GI4A 3SZEA 5JB9S 4M9FA 4Y10E 2ILNA 1GBLA 2EA3A 1H8IH 1GBFA 2A5AA 1AE8H 1CGHA 1FN6A 1O5GH 2WV9A 1EZQA 3F1SB 1GHBG 6CHAB 1T8LA 4K5ZA 1SMFE 2GP9B 1C5RA 1VZQH 1LMWB 1QY6A 3FVFB 2J97A 1QBVH 4UE7H 2Y7ZA 1GBKA 3BIUH 3PV5A 2CGAA 2QN5T 5FPSA 1G36A 5L30H 3SORA 3GY2A 1KSNA 1XXDA 2ZGXH 1TPOA 1SQRA 1BTPA 2J98B 3TGKE 1C1NA 3LONA 1SOZA 5CHBA 3SUGA 1P3CA 4CR9A 1GBEA 1YPGH 1BMAA 3SV6A 1DM4B 1B7XB 4I8KA 4P00A 1C1PA 1JIRA 2BDCA 1TNLA 3GY8A 4NWKA 8GCHG 3PYHA 1JMOH 2BLVA 5C5OA 1D3DB 1IQNA 1EAXA 1MD7A 1ZRKA 1C2GA 3GY3A 3HKIB 1DLEA 2WPIS 1PPHE 3C27B 4Y0ZE 1O3EA 2CJIA 1O3JA 1KXDA 2SGPE 3SU3A 2R2MB 2B5TB 1OSSA 1L1GA 4FUGA 4ZKOU 1Y8TA 5HXFA 2ZPSA 4WVPE 5JDUB 2Z3DA 6GCHF 1V6DA 4HGCA 4MPWA 2B7DH 2LP6A 3MU0A 5F6MA 1SVPA 2XWBI 3NKKA 4Y7BA 5EW1H 1TX8A 3S9AA 1GBBA 2QGRA 3ZV9A 4A6LA 1UMAH 4OS2A 4JYVH 4BOHA 5FBIA 1O2QA 3SI4H 3NWUA 4Q7XA 2JJ2D 1A61H 1ARCA 3MMGA 1V2JT 4FVDA 3ZYEA 2PWXA 5C1XA 3I29A 3OY5U 5T1VA 1HYLA 1UTNA 4FVBA 2BY6X 1TMTH 1P57B 1C4Y2 2WUBA 1S6HA 5HMAA 5DP4A 3NRLA 1FY1A 1ZPZA 1ZGVA 1SLVB 1C5SA 1O2XA 1SQOA 1CA0B 1W10U 2TIOA 4JZIA 4NA8A 1THSH 1P9SA 3SJOA 3T27A 3LGIA 4DGJA 4B2AA 3SGQE 5EJ1A 2PKSC 2P16A 4I8GA 5FAHA 3GCNA 2R0KA 4UDWH 1WXRA 3TGIE 2O8MA 1AUJA 1G37A 2W26A 1THPB 3S7KB 1YPKH 1GWAA 2GT8A 3HPTB 3NZIA 1LVOA 3ZV8A 2ZNKH 1FJSA 1UCYH 3PRDA 2IJOB 1SGRE 1LHGH 3ZZ6A 1D9IA 2J94A 1A3BH 2ALPA 3SJ9A 1UCYE 1O3GA 1O5AB 2HLCA 4ZXXH 1K1IA 2BVRH 1C1WH 1OOKB 1AVGH 2FS9A 2G8TA 1O3BA 3LH3A 3HKJB 1SGQE 4UFFH 2XBYA 1K1LA 1C5UA 2VVCA 1TGSZ 2FYQA 1GHAG 3A7XA 3MU1A 4DIHH 1IOEA 2UUFB 1MZDA 1LQEA 3ZIAD 3M7TA 1D6RA 1GI9B 1YPHE 2ZFFH 4YLUA 1MABB 1P0SH 4UFDH 1SKYE 2PV9B 5F8TA 2GCHF 1XM1A 3NXPA 3SJIA 3GDUA 1HAVA 3E8LA 4ABAA 1SGFG 2ZU4A 4QT8C 4ZMAH 5KECA 2WPDD 2UUKB 1O3PB 5GDSH 2AFQB 1O2IA 3U8TH 3FAOA 4AZ2B 1NFXA 2GGVB 1DUEA 1OPHB 3ZVBA 3UNSA 2RA3A 4P02A 4E7RG 2BY7X 1EP6A 5FXLA 1SGYE 2NU2E 1U6QA 4X8UH 1ANBA 1QA7A 1FAKH 2KAIA 2XRCA 3DA9B 3K6YA 2QXGA 1P04A 5DP5A 1DXPA 1EAUA 7KMEH 4NFEA 4ISLA 2F9NA 1O39A 2ZHQH 3ATWA 1GL0E 3F0PA 1V2QT 1TPAE 1OYTH 2AGIX 2DE9A 2ZP0H 3FFGA 4Y8YA 5JB8S 1HPGA 3U98H 3QGJA 4DT7B 4LZ1H 1BCUH 1O5EH 2JH5D 1GMCF 3A8AA 4MNYA 2TBSA 4IC6A 1EKBB 2BDAA 2FOGA 3BTEE 3M61U 5A8ZA 1Y5AT 2AYWA 4O3TA 1SGIB 4M7GA 1ABJH 1HJAB 4K60A 1GMDG 1CHOG 4AN7A 5HYOA 1NBME 3SV9A 1MMJN 4MQAA 3KQ5A 1QURH 2A0QB 2CXVA 3GY6A 1BTWA 1OWKA 1O33A 2G4UA 2KM0A 1DSTA 3KEEA 1VITF 1O37A 2Z3EA 1G3CA 4DOQA 2PTNA 1GG6B 3O8RA 1C9PA 1V2NT 3LC3A 5IDKA 3UB0A 2XC5A 2ZPRA 3SU5A 1YLDA 2BX3A 1P11E 1AKSA 1GJ9B 2Y80A 1XMNB 1RTFB 1ELFA 2WUCA 4I33A 4WJG2 2BDYA 4A92A 3RLYH 1BBRE 5JBTA 1BTUA 1C1VH 1NZQH 1W2KH 4X0WU 3SU2A 1BMNH 2KCAA 1GHBF 2OK5A 3Q3KA 1S85A 2A7CA 1BT7A 2Y82A 2EI6A 2WPMS 1GBCA 1TMBH 3I78A 5FCRA 1SGDE 1ETSH 1PPZA 1ESAA 1OP2A 4WWYA 1M9UA 1Y3VA 2ZDVH 4NIVA 1FMGA 4D7FA 2EQNA 1RRKA 1TWXB 1KIGH 1S0RA 1LPZB 2QXJA 4KTSA 4FUBA 2FP7B 1HCGA 3VB5A 2Z3CA 3QTOH 5C0TA 8GCHF 2QV1A 1HJ8A 1ZSLA 1FI8A 8ESTE 1MTNC 3RXTA 1C1SA 1XXFA 3PTBA 4I8JA 2IOTA 2FOFA 2VWMA 5GPIB 3NCLA 3UREA 1C2DA 2ZZUH 1SPJA 3LU9B 2PKSB 3U69H 5L2YH 5LPRA 1MAYA 4KP0A 5FX6A 2VIOA 4I8LA 1S6LA 5C3NA 3ZYDA 2OLGA 2W7UA 3U1IB 1O5FH 4K8YA 4UFEH 5F03A 4A1TA 1SBWA 5LPEA 1ELBA 1P2MA 1QL8A 1ELEE 5AFZH 5ESBA 4CRFA 4YM9A 4RT1A 5IK2D 1GI6A 1P09A 1KYNA 1CBWB 1S82A 2F9UA 2FOBA 4NSYA 1Z6EA 3V3MA 4AB8A 4CRDA 5A0AE 1JWTA 3N7EA 2C4FH 2GTBA 1AB9B 2G5NA 3AW1A 1QBNA 6CHAC 1IQKA 3LC5A 4Z6AH 2ZFTA 5JYIA 1QBOA 3C1KA 1S83A 1O3MA 2WPJS 2FTLE 3RXLA 1DXWA 2ZTYA 1ZPCA 3ZZ4A 3KYFA 4XDEA 2BD9A 3OEED 4YOIA 3RXFA 1Q3XA 4RSPA 3UOUA 3BTTE 5DP9A 4BAOB 2G51A 1O3LA 4TWYA 1K22H 1A7SA 2A7HA 4TYDA 1ZSKA 3P8NA 1SC8U 1O2GH 1P8VC 1GI1A 2ZWLH 2BLWA 1TA6A 1FAXA 1MKXH 1HB0B 5C0UA 1KDQB 1T8MA 2FI5E 1F5LA 1O2MA 1DANH 1YLNA 1BZXE 1ETRH 3AW0A 1KMHB 3F9FA 3NUMA 3O8CA 1AZ8A 2CHAC 3SU4A 1DY8A 1IQJA 2B8OH 1FPHH 4DY7B 3AASA 2IPQX 1HAYB 1DUAA 3UWJH 3PWBA 3CENA 1F0SA 3VB6A 1C5QA 3A85A 2Z6BD 5DO4H 2PW8H 3Q00A 4MVNA 2CF9H 2F91A 3I77A 1C5MD 1WAYB 1TALA 4O9VA 2Z94A 5CHAB 1YM0A 3RU4D 4OS7A 1GHVH 1Y3UA 1QR3E 7GCHG 2FOAA 2G4TA 2A4OA 5EQSA 1MKWH 2TRMA 3W1EA 2Y5HA 4FUDA 4RT0A 1GHAF 4FUIA 1Z7KA 3OFND 2BD7A 1UJ1A 3OTPA 2A5KA 2A5IA 1RS0A 4HFPB 2CK3D 1NFYA 2XYAA 1C2JA 1P06A 1YKTA 1C9TA 2FOCA 3DSPA 3KN2A 3SU1A 1A46H 3UNQA 4OS6A 1XVOA 1WSSH 1F5KU 3V0XA 3PLKA 1T32A 2M2AA 4CBNA 1EASA 3SQHE 4IS5A 4Q63A 2FDAA 4YT6H 1G3BA 1TGCA 3VB7A 1L1JA 2XOKD 3S0NA 1IQEA 1OWEA 2ZQ1A 4DIIH 1E38B 5FPYA 2K8IA 1BJVA 5F53A 1L0ZA 2VBCA 4Y79A 1P02A 3RXEA 2AEIH 2PTCE 6ESTA 5GIBA 5K0HA 3UNRA 1UK2A 2A31A 2OC0A 3TH4H 1GCDA 1QTFA 3KF2A 1AQ7A 1PFXC 1V2TT 3V7TA 5ESTE 2FYRA 5I46H 2L74A 2G5VA 1ARBA 5EGMA 1QL9A 2ZTXA 4WXIA 2RFKC 1O5DH 3QK1A 4ISHH 5LPFA 3M5LA 3SOSA 1WCZA 3S9CA 3ESTA 1O5CB 2G52A 4X1QU 2ALVA 3MTYA 2JKHA 3UIRA 2QAAA 1XUFA 1XUKA 2ULLA 1HAOH 1EAIA 3VEQB 1FY8E 4YO9A 3RXJA 1BA8B 1GMDF 2C8XB 1EZSC 4AFZA 1UCYK 3Q3YA 3KIDU 1BTZA 1J16A 2ODYB 1FN8A 1OP0A 1C2HA 3BEIB 2JH6D 3UFAA 3D62A 1QIXB 4DCDA 2R3YA 1DLKB 3U9AH 1BITA 1MCTA 1Y59T 1LHEH 1TONA 2NU0E 3KQEA 3RMNH 2PHBA 1GJBB 1HFDA 2H9HA 2VU8E 2XCFA 3MFJA 1C2EA 3A7VA 2FESH 2A4RA 1MTNB 1ELCA 1FONA 1HJ9A 1F0RA 2P3FH 4X6NA 1JIMA 1V2OT 4MTBA 4ZCNA 1RD3B 3SNEA 4YESB 3MU4A 3HGPA
chains in the Genus database with same CATH topology
1ESTA 3BEFB 5C2ZA 2HRVA 3N7OA 3L3TA 1JBUH 3TNSA 1NFWA 4IBLH 1V2WT 1ZGIA 4DJZB 5AFYH 1C1QA 1IAUA 2FZZA 3SNAA 4GHTA 2AMPA 2JETB 2GDDA 2VH6A 3P17H 5SGAE 3GCHB 3LJOA 3PLPA 2ODPA 3PTNA 5HM9A 2C90B 4TY7A 4JZ1A 1YBWA 5JBCS 2OBOA 4Y8XA 3UR9A 4ABHA 2CV3A 4NIYA 2ZHEH 1TNGA 3HK3B 1HJAC 5AHGH 1PPFE 1FPCH 1PPEE 2VVVA 2OXSA 1MU6B 4ZKRU 1P2OA 4GPGA 2ODQA 1AZZA 1QB1A 2BVSH 3RXHA 2ZHDA 1SI5H 4ZUHA 4DURA 1O3CA 2AERH 1DDJA 1D6WA 3ATMA 1GG6C 2ZGHA 4Y6DA 2NU4E 1IQHA 2CHAB 1EQ9A 1ZMLA 1C5VA 2PGBB 3QX5H 2W7SA 3SNCA 4H4FA 2D8WA 2WPHS 3TJNA 3P8GA 3RMOH 3LH1A 3UTUH 3TGJE 3GICB 1L4DA 1WTHD 2A4GA 3ZZ8A 1TRMA 7LPRA 2VWLA 3GYMA 4NIXA 1HAZB 2EC9H 1A1RA 1HIAA 2Z7FE 3MYWA 2OP9A 2PKAA 4RN6A 1BBRK 4H6TA 4X2WA 5ABWA 2XW9A 3ZZDA 2AMQA 4U30A 1G3DA 4HI3A 4ISOA 3H5CB 5C20A 1OXGA 1W3CA 1N6YA 1KLJH 1X7AC 2XC4A 1F5RA 1WOFA 1CGIE 2V3HH 3RXCA 3ZZ3A 2RCEA 4ESTE 3V13A 2H6MA 4D9QA 1N8OB 1MU8B 2LNCA 1LKAA 2HNTC 3ZZBA 2A32A 1J9CH 1O2VA 3MO3A 1ZSJA 4JYUH 3RXPA 1TNJA 3R0FA 2ZTZA 2Y7XA 1HV7A 1Y3WA 2R3UA 5BPEA 1LPKB 1TGBA 3KQCA 4ZKSU 4X1RU 2BXUH 1EZXC 2GZ8A 3TK5A 2QYIA 4X2YA 4X8VH 1TABE 2H5CA 1IQGA 2J92A 3M3VA 1ESBA 1K1OA 1O5BB 1EJNA 1YCPH 3H7TA 4WY3A 4RKJB 1SHHB 4LK4A 1EOLA 3EE0B 4IMZA 4AGKA 1QA0A 7GCHF 1C4V2 2I6QA 1GDQA 3RU4T 1ZMJA 1SQTA 2P8OC 1W13U 3A7TA 3GYLB 1CBWC 1O3FA 2SNVA 2Q6GA 1OKXA 1MH0A 2FI3E 1UVUH 1DPOA 1GI7B 3A8BA 2ZDNA 3PV4A 4UFGH 1GJ5H 1AB9C 5AF9H 3SBKA 3HGNA 1SB1H 1L2EA 3M7QA 1AIXH 3SUEA 2HGTH 3SJKA 1K21H 2FPZA 3TU7H 1XKBC 1TLDA 2PUXB 3JZ2B 4GHQA 2VGCB 1A0JA 4MPVA 4AORA 5F8XA 3OX7U 1XX9A 1PYTC 1TGNA 4ZH8A 1FLEE 4ISIH 1NC6A 3TITA 2AS9A 3RXIA 3VB3A 1MAXA 3TH2H 2OD3B 1TRNA 2NU1E 4K1SA 2G81E 5L2ZH 1T4UH 2C8YB 1QHRB 3RUOA 1GBAA 2ZHWH 1KLTA 2ZCLP 2AH4X 3BF6H 2AGGX 4XOJA 2FEQH 3IG6B 1LKBA 1C2MA 4AYVB 4D7GA 1KXEA 1PPCE 1S81A 2Z9IA 3M5MA 4BAMB 4CH2B 1J8AA 1EUFA 3QO6A 3RXMA 3GDVA 2KAIB 1C5NH 1C5WB 1DT2A 2UUJB 1ACBE 1C1MA 1O0DH 3LKWA 1PQAA 1HRTH 1UK4A 3KQBA 1NT1A 5CHAC 4AOQA 4NCYA 3ZZAA 2O8TA 3QZRA 1W7GH 1HNEE 1MKXK 4CHAB 2ANMH 2ZFQH 2ZU2A 3A89A 2BHGA 5E8EH 5J4SA 1EXFA 2TGDA 3PB1E 1O2PA 4IW4E 2PSYA 5EOKA 1GI3A 4X1PU 1GJAB 2A45B 1QB6A 2HNTF 2ANYA 4WMDA 3O8BA 2C8WB 2C3SA 2F9BH 2VIVA 1CQQA 4J1YA 5HM2A 4J2YB 3T28A 1C2IA 4CRGA 1TNHA 2UWOA 3BG8A 3F68H 3ZZ7A 3RXGA 2RG3A 3T29A 1YPEH 3GY4A 1Z1IA 1C5XB 1MKWK 1AGJA 4O97A 4Y0YE 1V2LT 5JBAS 1XUGA 3PMAB 2G55A 4K1EA 2GDEH 2ASUB 1EAWA 1N6XA 3ZVAA 5K7RA 1WYKA 1ZTKA 4ABIA 2XBWA 4ZKNU 3A83A 3P8FA 3RP2A 2P59A 3S9BA 1NRSH 3A7ZA 1Q2WA 2BQWB 1C1TA 3VPKA 4K69A 1GMHG 1AKSB 3UY9A 1ETTH 1F0TA 2FOMB 2P94A 2YNBA 1BRBE 2WPLS 4GLYA 3MNBA 5DP3A 3MO9A 4INHA 5DP6A 1LTOA 4ZAEA 5JBBS 1Z8GA 5TJXA 3P92A 2CF8H 3KL6A 2H1UA 1QL7A 2BX4A 1QCPA 3LGTA 1IQMA 3TJUA 3P70B 1O34A 3NK8A 1S6FA 1VCQA 1H4WA 4OS5A 1LQDB 4MPUA 5C5NA 2P3TB 1GVKB 1T8OA 1UO6A 4BXWA 1C1RA 5T6FA 2VIQA 3MH7A 1DWDH 1O3OA 1DFPA 2WINI 5E2PA 3OTJE 3ODDA 4ABFA 2BOHB 1AE5A 3FP8E 5DP7A 2Q6FA 3GY5A 1JRTA 1XUIA 4X2VA 3CS7A 2GZ7A 2BXTH 3A84A 4WF8A 4BTIB 1SHYA 2A2XH 3SZNA 4ZHLU 1GPZA 3FZDA 2A4QA 2WV5A 1K28D 1LVMA 2GCTB 3QLPH 1BMMH 1CSOE 3RC5A 2ZFRH 4JZEH 1G2MA 1JXPA 5T6GA 2EI7A 3OU0A 1YPLH 3BTME 4R0IA 5DGJA 1AVXA 3M5NA 3RXVA 1EPTA 3P95A 1UVSH 1C4U2 4JYTA 1DICA 1H1BA 1ANEA 1SFIA 3B23B 1Y5BT 1WBGB 1UTLM 4TWWA 2PR3A 3D65E 3FANA 1EOJA 2P8OB 2JETC 1TNKA 2TGPZ 3GCHC 3JZ1B 5CMXH 2XC0A 2WYJA 2F3CE 3LJJA 2PLXA 4KGAA 2ZHFH 1F0UA 1BRUP 3LOXA 1LHCH 2VINA 3T5FH 2UWLA 2FIRH 1CO7E 1HLTH 1O30A 3RXAA 1EJAA 3RM0H 4MPXA 4YOGA 2FLRH 4MG3A 4PROA 4OGXA 5FPTA 4MLFB 2BB4A 3IITA 2BD4A 1SL3A 2HALA 2JH0D 3ZVGA 3SJ8A 2VIPA 1O3NA 3DD2H 3M5OA 1K2I1 2FODA 4Y71A 2XXLA 3SN8A 2C93B 3PMJA 2FS8A 3EDXB 2QCYA 4B74A 4NSVA 3SW2B 1GJ6A 3S7HB 1KXFA 4AG1A 2WV4A 2LPRA 2STAE 1NPMA 4H6SB 3W94A 1XUHA 2ZPQA 4GAWA 3RU4E 4FUHA 1SG8B 4KKDA 4JZFH 1YLCA 3T2NA 2GV6A 3SO3A 1YPJH 4JMYA 3G01A 1ZMNA 3SU6A 4B76A 1GBMA 1GJCB 1ZHPA 1EP5A 1GJDB 1V2VT 1Z6JH 3A8CA 3FP6E 2B0FA 3M35A 1MQ6A 4TY6A 3MNCA 2ZG0H 1HAGE 4DVAU 1GVLA 2ZDMA 4X8SH 3RM2H 2VIDA 5DJ7A 1FNIA 1B5GH 1O3HA 1CT0E 1VGCC 2W3KA 3EA8A 2M5TA 1P01A 3SUFA 5EU8A 4JCNA 2F9VA 1BQYA 1E34B 1O2KA 1YYY1 3UWIA 3MNXA 3MO6A 4NGAH 1O2HA 1UVOA 3Q76A 1BMLA 3A8DA 2UUYA 1WU1A 2Z9GA 1FDPA 1N8OC 2J34A 2HNTE 2GT7A 1SLUB 1WTGH 2FO9A 4MNVA 1MBMA 1WQVH 4ZROA 1OWJA 2GD4B 3VB4A 1THRH 1ZJKA 1JOUB 2J38A 4X6OA 3DT0H 1YPMH 4IN1A 3TPIZ 6LPRA 1ZHRA 1ZTLA 2Z9JA 1UHBA 1W0YH 4HTCH 4X1SU 3VXFH 2VWOA 4FUCA 8KME2 3U8OH 1MUEB 1NRRH 1FY5A 4ZXYH 2BD2A 2UWPA 3KHVA 3H7OA 4FUFA 4UD9H 3CP7A 4INLA 4RKOB 1IQFA 1O38A 1UTOA 3RMMH 4GUXA 1ABIH 3RXRA 1QRWA 1P2NA 2ZGBH 3A87A 1ANCA 1DS2E 3BTHE 2J2UA 2BDGA 3BTWE 3QTVH 5E0GA 2FOEA 4WH6A 3A88A 1C5LH 3EA7A 4A1VA 2GCHG 1BIOA 1O31A 1YCPK 1QFKH 5T3HA 1BTHH 1LDTT 2F9PA 3RXKA 1GGDB 1HAIH 2SGEE 1G3EA 4BANB 1FQ3A 2G00A 1JRSA 2RA0A 4E7NA 1W0ZU 1CHOF 1D4PB 1O2OA 4XSKU 1O2RA 1TX7A 2VGCC 3ZVDA 3ODFA 3STJA 1ZPBA 5EXLA 4AFQA 1GHXH 3UPEA 2FLBH 1VCWA 2BLQA 4Y7AA 3BTQE 5G4BA 1AO5A 3TJVA 4X6PA 4AFSA 1PYTD 1GJ7B 1SGPE 4XBBA 3ZVFA 1V2MT 1AFQC 1SLXB 2D2DA 1Y3XA 1Q31A 1P05A 2AMDA 1NU7B 4FUJA 2ZU3A 1O3KA 1T7CA 3E16B 1OWHA 5A2MH 1FY4A 1TAWA 2HPPH 1WUNH 1O36A 2QIQA 2Q6DA 1H9IE 1NN6A 1GJ4H 5PTPA 3EGKH 3GY7A 1Z8RA 1TPPA 2ZCKP 4CHAC 1TGTA 2SGDE 2XWAA 1AMHA 2FOHA 1MQ5A 2CMYA 2OC1A 4GVUA 3U1JB 1MTSA 2PGQB 3DFLA 1HDTH 1AD8H 2R2WU 1VCPA 1A2CH 4Q2KA 1SFQB 3O8DA 1VITG 1DWCH 1V2RT 3K9XB 3KQDA 3RXOA 3CS0A 2V0BA 2TGTA 4ASHA 1TRYA 5A8XA 1YP9A 2ZDLA 3KGPA 1DSUA 1FY3A 1OS8A 1CU1A 1NRQH 4FUEA 2GMTB 3GCTG 1P2QA 1UTQA 1WV7H 2OQUA 1HXFH 3RXDA 2BY5X 1GCTB 3R3GB 3ZVCA 5B6OA 2H2ZA 5DKMA 3ITIA 3PO1C 2OQ5A 2BYAX 4Y8ZA 3SV7A 2BDIA 3SHCH 2HPQH 1TOCB 3EQ0H 3EAJA 2VIWA 4UONA 1BRCE 1YF4A 1ZJDA 4KTUA 1C2FA 1C5PA 2FXRA 3BTFE 3RLWH 3OYPA 4CRCA 1NO9H 1GBTA 1P2KA 1XUJA 1HIAB 2Y81A 5H4IB 3RDZA 1YGCH 1C2LA 4TPYA 2PKAB 1ZLRA 3W95A 1QJ7B 4ABJA 4IGDA 1CVWH 2XTTB 1G2LA 2QC2A 4B2BA 3BIVH 1YC0A 1TYNA 1VGCB 2BZ6H 3URCA 2Z9KA 3LGYA 1EX3A 3K65B 4F49A 1J17T 3BV9B 3F6UH 3MOCA 3UQVA 1HBTH 1PQ5A 1N1LA 1G9IE 3LPRA 1G30B 4GCHG 4SGBE 1C2KA 1QJ1B 2D26C 2PFEA 5CE1A 2OBQA 1NRNH 1P9UA 4D76A 3QN7A 1KXCA 1SGCA 5F8ZA 1FIWA 1HAHH 2A1DB 1RGQA 2GCTC 3SQEE 2F9OA 3STIA 1B0FA 5I25A 4DW2U 3M7UA 4BAKB 3BEUA 1ELAA 1CT4E 2THFB 5FCKA 3TLOA 2SGAA 1S0QA 1EPTC 3SNBA 3AVZA 4A1XA 4OS4A 2H9EH 1EB2A 1F92A 4Z0KA 1IHTH 1RFNA 2O8UA 4CRBA 1ID5H 4NZQA 4NWLA 5T6DA 1AU8A 2IPHA 2VVUA 1A5HA 1QJ6B 3A7YA 3A7WA 3MWIU 3SI3H 1UVPA 2WYGA 3LIWA 4Y76A 2O8WA 1TA2A 4TPIZ 4WXVA 1MTVA 1BTYA 4ABBA 1O2WA 2B9LA 1SGTA 1MCVA 1MD8A 3PMBB 5IYTA 4A5TS 1AWHB 1DWEH 4ZHMU 3QDZB 1O32A 4XBCA 3E91A 1T8NA 2XBXA 1IQLA 4BAQB 1HAXB 1LCYA 1P3EA 2EI8A 1V2PT 4Q7YA 2QF3A 4WH8A 1G32B 2FWWA 3E3TA 2BD8A 5TCCA 1K1MA 2HWLB 1HAPH 3TJOA 1NU9A 1SR5C 2Z9LA 3E0PB 1Z8JB 4LXBH 2AIPA 3LDXH 5C67A 2W5EA 4IC5A 4AYYB 1O2UA 5GXPA 1Y5UT 5LH8A 1HAVB 3RMLH 2Q1JA 1FZZA 2WPKS 2ANKH 1UTPA 1AFQB 5AVDA 1W7XH 2ESTE 4K1TA 1BB0B 1A3EH 3OSYA 3A82A 1TB6H 3GISB 3E6PH 3PMHB 4ABEA 4HZHA 2F83A 3AAVA 3F9EA 3ZZ5A 1UTJA 1Z8IB 4X8TH 5A0BA 1ZZZA 2BLOA 4NG9H 1BUIA 3M3SA 1O2JA 1T4VH 3MI4A 2DUCA 1SQAA 3GOVB 3TNTA 1H9LB 2BMGB 2OCVB 1DX5M 1SGNE 1UTMA 3WY8A 1O3AA 1PPGE 1TBRH 1V2KT 1TQ0B 4NFFA 1DY9A 2P3UB 1GVZA 2GZ9A 2AIQA 1K1JA 3UOPA 1EATA 4VGCC 1W8BH 3TK9A 2GV7A 2O9QA 5EW2H 3DHKH 3ZZ9A 3B8JA 2V35A 4B1TA 2OC8A 1V2UT 1Z1JA 3MNSA 3PWCA 4U2WA 5GCHG 2ZU1A 1QQUA 1A5IA 5E2OA 2ZFPH 4B73A 2BQ7B 1UK3A 2V3OH 3ZZCA 3DFJA 1AVWA 1TE0A 2J95A 5EODA 1HUTH 2ZGCA 3P6ZB 5EXMA 1D3PB 1DE7H 1TIOA 1TBZH 1C1OA 3KCGH 2ZC9H 3TH3H 1SLWB 1BRAA 2R0LA 2SGFE 1P03A 2A7JA 1DITH 1DWBH 3PO1B 1MBQA 4A7IB 3ELAH 1OP8A 4NA9H 1O2ZA 2ZQ2A 4F4OC 1CT2E 1W11U 3FP7E 3T62A 4I7YH 4ISNA 1SSXA 2ZO3H 2EEKA 2DE8A 4BAHB 1RIWC 4K3JA 4AB9A 1YCPM 4LZ4B 1GDNA 1K1NA 1AUTC 3UUZA 3TK6A 2ZEBA 1BDAA 5EQRA 1ELVA 1O2NA 4IN2A 1GGDC 5BRRE 1CE5A 4FU8A 4AGJA 2ZGJA 1XVMA 1BBRH 2J4IA 3LGVA 1NS3A 2BVXH 3GDSA 2PUQH 5GJ4B 2VJ1A 1TBQH 3NPSA 3GCTF 4CBOA 1QGFA 1W12U 1HGTH 4Q80A 1TOMH 1GL1A 1VJ9U 1O2LA 4LOYH 1LHFH 2FTMA