1EXFA

Exfoliative toxin a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
VSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (toxin/peptide)
molecule keywords EXFOLIATVE TOXIN A
publication title The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.
pubmed doi rcsb
total genus 51
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA01
3HK3B 2BDHA 3DFLA 1UTLM 1TGBA 2FIRH 1O2MA 1O32A 1NPMA 1TOCB 4FUFA 3SORA 1P02A 1OSSA 1D3DB 3BTDE 2VWMA 3QZRA 3BTEE 1NS3A 3RXGA 1FAXA 4OS1A 2WPJS 4MG3A 1PJPA 1Z1JA 2A4QA 2O8MA 4NSYA 1AWFH 3MNXA 2P95A 2R9PA 1ARBA 2HOBA 1LMWB 3PV4A 4AZ2B 4DURA 1YYY1 3TJOA 5LPRA 1SG8B 1BOQA 1DSUA 2C8XB 3U69H 2BM2A 1OWHA 1F0RA 4A7IB 3LU9B 2BB4A 3BTKE 4LXBH 2WV5A 4Z6AH 1ELCA 5C67A 1SQAA 1ZOMA 1SGFA 3G01A 2WYGA 2NU4E 3RXSA 4X8TH 1P2JA 1RFNA 2A5AA 1Y3WA 3BIVH 3KQCA 4FU8A 3T2NA 2XC5A 1LHGH 1BITA 3CS7A 2BLOA 3ZVEA 4FU7A 2A4RA 4I8LA 2R3YA 3D23A 1ZPZA 3M36A 1GJ6A 3FFGA 1MZAA 2ZWLH 1GVKB 2VVCA 4RKJB 2ZU4A 1ZHMA 3MU1A 3EE0B 5TCCA 1KTSB 1L2EA 1RIWB 3M35A 2BXUH 3UREA 3A8BA 2G51A 2CXVA 3GCTG 3RXPA 3UR9A 1WTHD 1NT1A 1SLVB 2P8OB 3NK8A 2XBVA 5EXMA 1H1BA 1TRNA 2A2XH 4XE4A 5FPTA 1AY6H 2SGEE 3STIA 1LHCH 3ATIA 1VGCB 1S83A 1NROH 5A8XA 3LGWA 5GIBA 1GDQA 3GY8A 5E0GA 1NN6A 5I25A 4O9VA 5F6MA 4ABDA 1WYKA 3Q76A 4I8GA 1TMUH 4TWWA 3LIWA 2BVXH 4ABHA 3SI4H 2ZGJA 3SU5A 4MNVA 1UK2A 1Y5UT 1YM0A 2ZDKA 1V2MT 2Z9GA 1C1NA 1O36A 3KQBA 3RXOA 1C5SA 1TYNA 1GJDB 2PKSB 4WMDA 4OGYA 1BRAA 5JBAS 3TIUA 1ELBA 3ZVGA 1Y3XA 1MUEB 1GMHF 1P04A 4E05H 3RUOA 5AFZH 1NFWA 4LK4A 1BTZA 3TNTA 1O2IA 2PV9B 2ZA5A 5HM9A 4H42U 4XBDA 1QRXA 1IQEA 4DT7B 1YPMH 3QGJA 1HJAB 1LQDB 8LPRA 2ZFTA 3B9FH 1T4VH 3PMAB 5ESTE 1ZJDA 1OPHB 3A82A 4MQAA 1UTQA 1DWCH 3GISB 1AIXH 1YLDA 3A85A 3MU0A 1DLEA 1GVZA 4DY7B 2OINA 2TGTA 1MAXA 1Y3UA 4FUJA 3U1JB 3U9AH 2BD7A 3TK5A 2PSYA 4MNWA 1LVYA 5G4BA 3A7VA 1EOJA 1FNIA 4WWYA 3D49H 2PHBA 2WPKS 1FY3A 5K0HA 1VZQH 2ZO3H 1O2XA 1GDUA 4I31A 1CGJE 1H9IE 3UFAA 3P17H 3ZZ3A 1W13U 1TPOA 3PO1B 4X6NA 1O3GA 2OLGA 2BDCA 1CSOE 3TJNA 4X6OA 3DHKH 1TPAE 5HYOA 5L30H 5LGOA 3D62A 4INLA 3VB4A 1MQ5A 1P05A 1YPKH 4CR5A 1HRTH 2A5KA 1ZHRA 1KXDA 3ZVDA 2WUCA 3LJJA 6CHAC 1V2ST 9ESTA 1C5ZB 4AFQA 3D65E 1O33A 3MMGA 4UFGH 1MU6B 2UUYA 3K6ZA 5C5NA 2Y7ZA 1QY6A 1GMCF 2C4FH 1O2RA 2BZ6H 3ZVBA 4ZXXH 2Z9LA 1MKXK 4X2VA 3S7KB 3KEEA 1BIOA 4VGCB 4O3TA 2EI8A 2RA0A 1P3CA 3SJOA 4Y79A 1C2HA 2HLCA 5A8ZA 3RU4T 7GCHG 2P16A 1DE7H 3RXFA 2ZTZA 1YCPK 1O2YA 1EAUA 1ZPBA 5DP4A 1GCTC 3WY8A 5FX5A 1C1WH 1NTPA 1H8DH 1X7AC 3VFEA 2WPMS 1DITH 4HZHA 4D7GA 4WY3A 1ZRBA 3PB1E 2GCTC 4NIXA 2IJOB 5AFYH 1F0SA 2W3KA 3E90B 1N6YA 2G00A 3KGPA 1C5OH 1W3CA 1UCYK 1EPTC 1RTFB 1D4PB 2C8ZB 1AD8H 1SGRE 1RTLA 2G8TA 5GCHG 2B5TB 1OOKB 4Y11E 4QT8C 8GCHG 1HAPH 1O2KA 1W8BH 1TX6A 1MAYA 1ZYOA 1FUJA 1HXEH 3L6PA 1P0SH 5DP6A 4JZEH 3RC6A 1BDAA 3RXTA 2OQ5A 2F9UA 3K9XB 1IQNA 1C2KA 1V2WT 2SGAA 3SV2H 3GCTF 1SFQB 4JK6A 3KNXA 5FXLA 3PROA 2IPHA 3EAJA 2UUJB 5F8ZA 1C5XB 1A46H 2ZP0H 4OS6A 3RMLH 1DFPA 2NU2E 2FDAA 2ZFPH 2PTNA 3S9BA 2JH5D 2PFEA 3O8CA 3ELAH 2ZFSA 4IMQA 4GLYA 2ZDMA 3SJ9A 3RXLA 4K8BA 5E8EH 4GUXA 1MBMA 4ABGA 2AMQA 1LO6A 2P3FH 2Y82A 3BN9A 1DPOA 3H7TA 1AB9B 3URDA 1P11E 3MTYA 1YF4A 2PR3A 2QF3A 1O30A 4B2BA 4MVNA 2XC0A 3CS0A 1GBTA 1JWTA 1GI6A 1ZSJA 3M5NA 4BAQB 2AMDA 1GBFA 2NU1E 3V7TA 2BY6X 4AG2A 1EZXC 1MTUA 3AAVA 1VCQA 4NCYA 4ZKOU 4J1YA 2LPRA 4KGAA 1F92A 2ZIQH 4UD9H 3BEUA 1C5UA 1RJXB 1K1MA 1DLKB 2FODA 2ZU5A 4MPUA 1ZGIA 3MH5A 1CHOG 2ZQ1A 1YPEH 2F3CE 3ZVCA 2ZHDA 1YCPH 4MDSA 3QWCH 2Y7XA 3LGUA 3SO3A 1G37A 2ZECA 2H5DA 2SGPE 3M7QA 4WH8A 3ZZCA 2J95A 4Q2KA 2AERH 2AIPA 3W95A 1K2I1 2QCYA 4ZKSU 2G4TA 4NWKA 1O3EA 3AVZA 1O3DA 1BA8B 4GCHG 4ABEA 2FI4E 1IQFA 1ZTLA 2TGPZ 1TQ0B 4LOYH 2CGAA 5HXFA 1C2JA 1GCDA 4FXGH 4AORA 3V12A 1WUNH 4HTCH 1FI8A 2EI6A 3KCGH 1B7XB 3BTME 1UCYH 3ATKA 1W11U 1G9IE 2VU8E 4R8TB 3HPTB 4NG9H 5EXNA 4DVAU 1BMNH 3PM3A 4AOQA 1LHDH 3SU4A 1P9UA 4JYVH 4AGJA 4INKA 3RU4D 1GI3A 4BNRA 1ID5H 1V2TT 1P12E 1PQ7A 1Z8IB 3RXQA 3P95A 1BTPA 3F9GA 1GDNA 4U01A 1CT0E 5GJ4B 2Q6GA 1GJCB 1GPZA 5L2ZH 3EA7A 9LPRA 1V2PT 2ALPA 2TGAA 1P2NA 1WTGH 1TGSZ 3CP7A 1LVBA 3MHWU 1MTNB 3RXAA 3S69A 2J34A 4TPIZ 5DK1A 1NO9H 1PQAA 1SGFG 3LC3A 1O3NA 2IN2A 3ZZ7A 4LZ1H 1UTPA 2OP9A 1TBRH 3A88A 2ZGBH 3T62A 1ACBE 2BDYA 3LT3A 3V3MA 1J14A 2V6NA 3MO3A 1O35A 1QRZA 4MPWA 4H4FA 4RSPA 1YPHC 4Y76A 1AWHB 1W12U 3GCHC 1S6HA 4SGAE 4A1VA 1O2HA 2F9BH 1H9HE 3MWIU 1TE0A 1MH0A 2BTCE 1PQ8A 2FS8A 3UNSA 1BCUH 2XC4A 2AGGX 3RXCA 4WXIA 1HCGA 3FANA 4INHA 2C90B 5CHAB 3R0FA 1HAOH 1P01A 3O8DA 5JBTA 4U2WA 1C9TA 2G4UA 3K65B 1DVAH 1DANH 3H7OA 2P3TB 4CBOA 1MCVA 1WV7H 1DUEA 3OU0A 1SGCA 4ZKRU 3Q77A 1SPJA 2BDIA 3FVFB 5A0AE 4GVUA 5GCHF 4IS5A 4Q7XA 1GBBA 5FCRA 1LPGB 1MKWK 3ZV8A 1QTFA 1EAXA 1C5PA 1GG6B 1MMJN 3ATMA 4O3UA 1TALA 1BJUA 1QIXB 1YKTA 1ANCA 1EKBB 4CHAC 2FS9A 4X2WA 3RU4E 1BZXE 2GV7A 3BG4B 1NU7B 3A8CA 5EQSA 1MTVA 1C5VA 1NRRH 3RM2H 2GT8A 3QX5H 4THNH 1EP5A 3SN8A 2ZPRA 1HUTH 2FOEA 4X0WU 2DE9A 3NWUA 3DUXH 2Z6BD 2BZAA 1W0ZU 1ELVA 2UWLA 3BTTE 3BIUH 4DJZB 1C4Y2 3SGBE 3RP2A 4CH2B 1FQ3A 2XBXA 4IMZA 3PMJA 3MH7A 1QFKH 4YT7H 4YLUA 3Q00A 3GYLB 1O2NA 1DWBH 2QGRA 5T6DA 1RRKA 1O2VA 1IQGA 1TPPA 2ZC9H 2JKHA 4X2XA 4BAKB 3IWMA 1EXFA 1XKAC 1A5IA 1KIGH 1DOJA 4D76A 2ODYB 1CGIE 1SGEE 2OXSA 1C1PA 2FOCA 2H5CA 1UVPA 3ZVFA 2BLVA 1W0YH 4BAOB 3QZQA 1GGDC 1K9OE 4BXWA 4D9RA 1TMBH 4WMFA 2B9LA 2FX4A 1PYTC 1HBTH 2VIQA 2J38A 1O5AB 1L4ZA 3MU8A 1K1OA 5T6FA 3SUEA 3ZZ6A 1RGQA 5BPEA 3VGCC 4FUEA 1GJ7B 3UTUH 1QA0A 2UUFB 1QB9A 2FM2A 1SGIB 1XUIA 3U8RH 1SOTA 1JOUB 2VWLA 1QA7A 1P2MA 2R2WU 1B5GH 2OCVB 6GCHF 1FY1A 4Q7ZA 4X1QU 1HJAC 2ZDNA 1GHXH 2ZNKH 3FP6E 5JBCS 1A2CH 3GYMA 1FY4A 1N6XA 3A80A 1CA0B 3A7WA 4U32A 1J15A 1TPSA 2ZGXH 1IQKA 3M7UA 4B2AA 1TOMH 2HPQH 3P8FA 3PTNA 4Q80A 5F8TA 1S0QA 1JIMA 1EZUC 1HAZB 3SUDA 1O3IA 1MKWH 1UHBB 2IOTA 2Y5GA 4AFSA 2J4IA 3SV8A 7LPRA 1D3TB 1GHVH 2A7JA 2A5IA 2XBYA 1GI5A 4KTCA 1BMAA 3SNEA 3T28A 1UVUH 4Y8ZA 3LGVA 1AUTC 1S5SA 2RCEA 2RA3A 1GI0A 2ZDLA 1J9CH 2CJIA 2FOHA 2PUQH 1EJNA 3A83A 4JYUH 2I6SA 5GWZA 2HNTC 2ZPSA 3M7TA 4ASHA 1TLDA 2PGBB 2ZU1A 3ESTA 2A7CA 3P6ZB 3ZVAA 4SGBE 3GDUA 4XDEA 1YGCH 3RMNH 5GXPA 3E16B 1E0FD 2PGQB 1OWKA 4NIWA 2ZDVH 2VIWA 1VR1H 2JETC 5FPSA 2VIPA 2VH0A 1GBCA 1TMTH 3F9FA 2XCNA 1OYTH 2GCHG 1AVXA 2QIQA 2TIOA 4E06H 1O3KA 5SGAE 4NIVA 3AAUA 4DG4A 5EW2H 2W5EA 3SU2A 4VGCC 1O5FH 1Z6EA 1LTOA 3SUFA 1OX1A 2I6QA 1C2LA 3ZZ9A 1DWDH 5DG6A 4K5ZA 8ESTE 1V2NT 1GHBF 3BTQE 1A1RA 2BD9A 1DS2E 1G32B 1QB6A 1XUGA 1SC8U 2XYAA 3UWIA 2CHAB 1O38A 3S9AA 3TGJE 1QURH 3HATH 2J9NA 2ZGHA 4CRCA 3KF2A 4CR9A 1C5QA 1TWXB 3LKWA 3ODFA 2HVXA 3ZYDA 2FX6A 1PPZA 1QHRB 2GZ8A 2A45B 1GMDG 2YNAA 3OYPA 3BTFE 1EATA 3E3TA 1KSNA 2WINI 4FUHA 1YP9A 3A7YA 1EAIA 1UVOA 1EASA 1FLEE 3SU6A 1FIWA 5HM2A 1A7SA 1A4WH 5T6GA 1HIAA 2PWXA 2BD2A 1W7XH 4WVPE 2GMTB 2ANYA 3M5OA 1WCZA 2Z9KA 1O39A 1TNGA 2GP9B 3KN2A 1YPJH 2NU0E 1XUHA 4NA7A 1SLXB 1XM1A 3FAOA 1QL7A 3CENA 1H4WA 2YOLA 1VITF 2VGCB 3A8DA 4UEHH 3BF6H 3TK6A 1C1TA 2TRMA 3M3SA 3FP8E 1O2PA 1HJ9A 3QTVH 1O34A 1SLUB 3MH6A 1QB1A 4IC5A 4Y7AA 2R2MB 1CE5A 2W7SA 1L0ZA 1S84A 2F91A 4X8SH 5EQQA 1G3DA 2P59A 1KXEA 3ZZAA 3VB5A 3A7TA 3GICB 3RXDA 1C2EA 2G52A 2ZFFH 4YM9A 3TK9A 2D1JA 1ESAA 2CN0H 1OP0A 2BD4A 5I46H 2Z9IA 2FMJA 4O03A 2W3IA 4FUDA 1TBZH 4BANB 3OY6U 1V2QT 2AGEX 4AFUA 2FOAA 3M61U 3U8OH 2DUCA 4UE7H 3KQDA 4K1SA 3VXEH 1E35B 4Y0ZE 1V3XA 1B0FA 1INCA 1OWJA 2QYIA 1WQSA 1QBOA 5JDUB 3DD2H 2KAIB 4LZ4B 1O3BA 2BVRH 3GCOA 2EEKA 1J17T 1HJ8A 1CBWC 3I78A 4ZHAA 2ZCLP 1EPTA 4ISNA 3PTBA 1XMNB 1CA8B 3VEQB 4NGAH 3QUMP 1UTOA 1VJ9U 3HK6B 1RD3B 2Z3EA 3VB6A 1O2TA 1P8VC 4K69A 4CBNA 3E1XB 5AVDA 3PMBB 5DP3A 2BX3A 2VJ1A 3ATLA 3BG8A 4Y8XA 2ZHEH 5CE1A 1KLJH 2C8YB 1CT2E 1BMMH 3OX7U 1TNKA 4CRFA 1Y3VA 1YPGH 1C5YB 4YOJA 1GI7B 1GBKA 3MNCA 1A61H 1BRBE 4GPGA 1MQ6A 2BHGA 2ULLA 1QCPA 1QGFA 4UDWH 2WUBA 1QR3E 2AEIH 3UOPA 4OGXA 1C2IA 7ESTE 2C3SA 3TH3H 5LPEA 1N8OC 4CH8B 3RC4A 1Y5BT 2QA9E 4JK5A 1SGDE 1V2KT 3MNBA 1ESBA 2WYJA 1NRQH 4HI3A 1OXGA 1BBRK 1O0DH 2FO9A 3HGNA 4D9QA 3TLOA 2GCHF 1UTJA 2Z3DA 3MO9A 2LNCA 1O5GH 1OP8A 1Z8GA 2G55A 2VIVA 2CF9H 3TH2H 5ESBA 2Q1JA 4NFFA 1BHXF 1SMFE 2Q6DA 4NSVA 5E0JA 3SJ8A 5C1XA 1E36B 5DPAA 3RLWH 1ZGVA 4X2YA 1C2GA 4JYTA 5HMAA 1ZRKA 4CRDA 1OP2A 3LJOA 5FPYA 3FP7E 3QGNB 1EQ9A 3RLYH 3HKJB 1JRTA 2BQ7B 2GZ9A 2QF0A 3TITA 4DOQA 2GGVB 2FXRA 3T27A 2M5TA 2FOFA 2UWOA 2BY8X 3SNBA 3U1IB 1G3EA 1ELFA 1O3AA 2ZU3A 3EA8A 5A2MH 3V0XA 2Y5FA 1FAKH 1O2OA 3UQVA 1P10A 1Y3YA 3MI4A 1F5KU 1C5RA 1UTKA 4NFEA 1ELDE 4A1XA 1MKXH 4ZH8A 4I8JA 1PPEE 1DM4B 1GBIA 3UOUA 1P9SA 1O2JA 4CRGA 1GL0E 3V13A 2FLBH 2EA3A 2BD3A 3LGYA 1ZZZA 2OC0A 4AX9H 5A8YA 1ETSH 1HIAB 4CRAA 4I8KA 1GJ9B 1O2ZA 1C5WB 4ABAA 2O8UA 3SI3H 4JZIA 4DIHH 5T3HA 1UHBA 2ZTYA 2ZZUH 1NY22 1W14U 1RTKA 4D8NA 1TQ7B 3BV9B 1WU1A 1ZSKA 1QQ4A 1MTSA 1QRWA 4WXVA 1O5EH 3UY9A 6CHAB 1P57B 3ATWA 1A5HA 1BBRH 1CQQA 1MD8A 1ZTKA 3SQHE 3N7OA 3SNCA 1T8LA 3PMHB 1P03A 5J4SA 1ELGA 1GHAG 3KHVA 2TPIZ 3A7ZA 2FLRH 1F7ZA 3AASA 1T8OA 2VVUA 1A3EH 1K1LA 5E2OA 1L1NA 3SU3A 1GHYH 3STJA 3LGIA 4I33A 1EB2A 4X6MA 3MU4A 4XFQA 1GI4A 2XBWA 3RM0H 5GPIB 4D7FA 1V6DA 3ODDA 1ELTA 1UTNA 5L2YH 1GCTB 2GVFA 3VB3A 4A92A 1DUAA 1Y59T 1UK3A 1C1OA 5DP5A 2Z94A 3URCA 4BTTB 1K1JA 1O5DH 2D26C 4HFPB 2PKAA 4BAMB 2ZFRH 4BXSA 4DIIH 2GCTB 1A0HB 1CA0C 5C3NA 1HDTH 3TH4H 1AO5A 4JZ1A 1OKXA 4YOGA 1IQIA 4MLFB 4Y7BA 1NESE 4K1EA 1ELAA 7GCHF 3RXIA 1ZMLA 1EPTB 5A0CA 2PUXB 4DCDA 4TY7A 4AGKA 1C5NH 1S81A 4NZQA 1AE5A 3PLKA 1SHYA 1ZLRA 2F83A 3A8AA 1GVLA 2AIQA 3RDZA 1DX5M 3F9EA 4WF8A 3S7HB 1GI2A 4DW2U 3UWJH 3E8LA 1YLCA 2BY7X 3T5FH 1E38B 3KL6A 1NRSH 5EPNA 1DT2A 4NA8A 3L3TA 1TX8A 1UCYE 3B8JA 1V2OT 4YOIA 5JB8S 4ESTE 3MU5A 2ZEBA 3M5MA 1F0TA 1BUIA 1TFXA 1GHZA 1TABE 2JH6D 1THRH 8GCHF 2V3OH 1Z8RA 2H9TH 1RXPA 1KXBA 3RXKA 1XVOA 2F9OA 2PTCE 3P8GA 2VVVA 3FZDA 2J92A 1HXFH 1QJ1B 3SV7A 1HAGE 2ESTE 1Y8TA 4GHQA 5ETXA 3P8OA 2QY0B 1IQMA 2BD5A 1THPB 2PW8H 3SZNA 1PFXC 3SGAE 2P3UB 3AW0A 1RIWC 2D8WA 2O8WA 1AFQB 1K1PA 1K28D 4DGJA 4AB8A 2ODPA 3O8RA 1UVTH 5F8XA 3RXJA 2P8OC 5EG4A 2ZKSA 3C27B 1AZ8A 1E34B 2JH0D 1O2QA 2A2QH 1VGCC 3MO6A 5IYTA 2G81E 1GMHG 3SHCH 3GCNA 1UTMA 1QNJA 3KIDU 2EC9H 2F9PA 1WBGB 2V0BA 3NKKA 4TYDA 2HNTF 2XCFA 6ESTA 3Q3XA 2FYRA 2XNIA 1BHXB 4I8HA 2KAIA 3JZ1B 3BEIB 5HGGA 1QJ7B 1G2MA 1HGTH 1GI1A 1ORFA 4B71A 1L1JA 4PROA 1THSH 2PKSC 3T29A 3P70B 2BDGA 4GAWA 3LH3A 1CHOF 1C1UH 1O31A 1S82A 2EI7A 2B0FA 1W10U 1FZZA 5EPYA 5E0HA 3TU7H 1TIOA 2G5NA 1SR5C 3UR6A 1NFUA 1GHWH 4JCNA 1ETTH 4BOHA 2UWPA 4AYYB 1DY8A 4GCHF 2CV3A 4FU9A 2DE8A 5C20A 5LH8A 1DDJA 1NU9A 3GY3A 2Q6FA 1XVMA 3IG6B 1AVGH 4OS7A 1FPCH 2VWOA 1O5CB 2SNVA 1NRNH 1O3CA 5ABWA 3UNRA 1P3EA 1C1QA 1J16A 1SGYE 2V3HH 2FOGA 4K2YA 3EQ0H 1ANDA 1SGPE 1V2LT 2SNWA 5EQRA 2F9VA 2FYQA 1CVWH 1SQOA 3SU1A 3ENSB 4XBCA 4F49A 1TNHA 4ZKNU 2AGIX 2HRVA 1TRMA 5DP7A 3PLPA 3GCHB 1T4UH 3ZZBA 1ELEE 4IN1A 1ZJKA 1GMCG 3PO1C 4Y10E 2TGDA 3MYWA 1V2RT 1Z71A 4Z0KA 1DSTA 1GBLA 3R3GB 3UPEA 3RMMH 3VXFH 2C8WB 2VB0A 2J2UA 4X6PA 4Q7YA 5A09A 7KMEH 4KELA 1LCYA 1TRYA 3KQEA 3NXPA 1ABIH 1LKBA 1HAVB 1AFEH 2NU3E 2AFQB 1VITH 1FY8E 1JIRA 4ZHLU 4RKOB 3LDXH 1KDQA 2FESH 2ANMH 1H8IH 4Y6DA 5DKMA 5H4IB 2O8TA 2OBOA 2VIOA 4K3JA 3DFJA 1OWEA 3B23B 4YTAA 1Z7KA 1GJAB 2Y81A 2ASUB 3BTWE 5LPFA 1MCTA 1SGNE 1UO6A 1IQLA 1ZMJA 4AYVB 2OC8A 1G2LA 3C1KA 3ZZDA 3SNDA 3AW1A 2PKAB 5DO4H 1UJ1A 3QK1A 1HAYB 2ZCKP 2ZG0H 1ARCA 1D6WA 3A87A 4BTUB 4E7RG 1A0LA 3SHAH 1DY9A 4I7YH 4CHAB 2Z7FE 4A5TS 1M9UA 3E0PB 3SV6A 1AE8H 1T7CA 5EU8A 1L1GA 1BMLA 3SUGA 1KLIH 3A7XA 3SJKA 1HAHH 1C9PA 3U8TH 1EUFA 3VPKA 1BTWA 1C4V2 2ALVA 1P2KA 1DWEH 3SBKA 1B0EA 4YZUA 1D9IA 1NRPH 1O3FA 1MBQA 3TPIZ 2Y5HA 4WH6A 3QLPH 4ISOA 3NZIA 1BRCE 4JZFH 4OS5A 3RXMA 2GTBA 1AGJA 3GDVA 4TPYA 2OTVA 2NWNA 4O97A 2H9EH 1O3HA 3LGTA 1OYQA 1NZQH 3PWCA 4XBBA 4UONA 3K2UA 4B2CA 5L6NH 1GGDB 2Y6TA 1BQYA 5TCAA 1G3BA 1VCWA 1EOLA 2B8OH 2PSXA 3MFJA 3SU0A 3TJUA 1NM6A 4U30A 1HFDA 1SL3A 1G30B 5C5OA 4UFDH 3VGCB 2FPZA 1LQEA 1TGCA 1V2JT 3F9HA 1WSSH 2ODQA 2PLXA 4H6SB 1WAYB 2STBE 2ZI2H 1AUJA 3JZ2B 1AU8A 4OS2A 1O3PB 3I77A 3UIRA 1GJ5H 3RXBA 2SGDE 1C5TA 4KKDA 1SSXA 1IHTH 1PPGE 5JBBS 1QL8A 1YC0A 1BB0B 1BTHH 3ZV9A 1Q3XA 1EZQA 3Q3YA 3K6YA 1CHGA 1AB9C 4A1TA 2W26A 3NCLA 3E91A 1T32A 3LPRA 4CREA 5FBIA 1GWAA 1O37A 2BVSH 3TVJB 1U6QA 2WPHS 2GX4A 1C4U2 1CU1A 2QV1A 1TA2A 5FHTA 3L33A 2BMGB 1Z8JB 1GJBB 2WPLS 1SLWB 1N1LA 1BTUA 1FN8A 4ABBA 2BOKA 4K60A 4MNXA 1AKSB 4Y71A 2XRCA 1NFXA 4GHTA 2HWLB 2BDBA 1IQJA 4IC6A 3ZZ8A 1W7GH 4XOJA 3OTJE 3H5CB 1SBWA 2ZQ2A 3NUMA 3ZZ4A 1SHHB 1HYLA 3ITIA 3A86A 4FVDA 2A7HA 8KME2 4KTSA 4NIYA 1C2MA 1JXPA 4ABJA 5K7RA 3UNQA 1S0RA 4K8YA 4MTBA 3M3VA 2OBQA 1ZSLA 5E2PA 3LC5A 5AHGH 2B7DH 2WV4A 5DP9A 3NPSA 2BX4A 2ZPQA 1GBHA 2BD8A 3BTGE 1ABJH 4IW4E 1UVSH 1O3LA 2JETB 1EB1H 2SGQE 6LPRA 2BYAX 3GY2A 1AZZA 2BXTH 4YO9A 5CMXH 2GD4B 2Y80A 1UK4A 1SI5H 2ZU2A 2R3UA 1TGTA 1XX9A 1O2WA 1KYNA 1K22H 3GY7A 3P8NA 4OS4A 3E6PH 1GI8B 1V2UT 1K21H 4ZROA 3BTHE 2CF8H 2BLQA 1G36A 5JYIA 4YLQH 1ETRH 3U98H 1BT7A 1ANEA 3I29A 5C1YA 3F68H 3T26A 1JMOH 4NWLA 1LVOA 3A89A 1SFIA 4X1RU 1LVMA 2ZGCA 1SOZA 2XW9A 1LPKB 1MTNC 1YCPM 3TNSA 1ZR0A 3M37A 1A0JA 2J94A 5GDSH 1FY5A 3UQOA 1AMHA 5EOKA 1PPCE 1Q2WA 3Q3KA 5BRRE 1HPGA 3E0NB 3GY5A 1FJSA 1FPHH 1BRUP 1T8NA 1KTTB 4MNYA 1S6FA 1IQHA 1C2DA 1KDQB 1AN1E 2ZHQH 3GDSA 2BDAA 3MH4A 1YBWA 2ANWA 3QN7A 4ZMAH 3RXUA 3BSQA 4YESB 1AVWA 1OWDA 1FMGA 1IHSH 1IAUA 1EJMA 1XUJA 1WOFA 4R0IA 5JB9S 1GMDF 5CHAC 2A4OA 1G3CA 2R0KA 3F6UH 5F03A 2A32A 3ZYEA 4BTIB 4ZUHA 1HB0B 2P93A 4H6TA 3RXHA 2K1QA 3HGPA 3RMOH 3S9CA 5DP8A 1O2GH 3RXRA 1C1SA 1LDTT 1O3JA 2FEQH 3PLBA 4BAHB 3QO6A 4ABFA 1DXPA 1P2IA 3OSYA 2FWWA 2OC1A 3DT0H 1UMAH 2ZCHP 1JRSA 1VCPA 2BQWB 1Y5AT 2FTMA 2OQUA 1TNJA 1GG6C 1JBUH 1NC6A 2OD3B 2BQ6B 1W2KH 3T25A 3EGKH 4FUBA 1YPHE 3BG4C 2QXIA 1DICA 1FV9A 1MTWA 2F9NA 3HKIB 1C1MA 2QAAA 5FCKA 2VH6A 4I32A 2O8LA 4IBLH 4AG1A 1AFQC 5EW1H 1PYTD 2FP7B 1Z1IA 3FZZA 1FDPA 3O8BA 4KTUA 2ZF0H 2AH4X 1TONA 4GSOA 2THFB 1D6RA 1ZPCA 1QL9A 2HALA 1TB6H 5JPMH 1NFYA 1PQ5A 1Z6JH 1KXAA 1HAIH 3TGKE 4A6LA 4X8UH 1CBWB 6GCHG 4IGDA 1PPFE 1TAWA 3M5LA 4XSKU 5EXLA 1K1IA 3QDZB 4MPVA 1EAWA 1EP6A 4ABIA 2VIDA 2Z9JA 1L4DA 1TNIA 4YT6H 1J8AA 4RN6A 2A4GA 4ZXYH 1XXDA 1QBVH 1HAVA 1A5GH 2XWBI 4B74A 4KP0A 2V35A 4TY6A 1A3BH 2UUKB 1PPHE 3MOCA 1LPZB 2D2DA 2A1DB 2VWNA 2ZDAH 4B1TA 1CT4E 2H9HA 1CGHA 1XUKA 4NA9H 3SQEE 2GZ7A 2HGTH 3UUZA 2Z3CA 2FOMB 1C5LH 1O3OA 2XWAA 4FVBA 3RXVA 3QTOH 1E37B 2QXGA 2FZZA 1SB1H 1RS0A 2WPIS 4ISIH 1BTXA 1F0UA 4NZLA 1BJVA 3SW2B 1F2SE 1ZMNA 2SFAA 3EDXB 2QN5T 3S0NA 1GL1A 1DXWA 4X1NU 1N8OB 5EGMA 3DA9B 2RDLA 3M3TA 2ZTXA 1OWIA 1XXFA 2GDDA 5C1UA 5FBEA 1FXYA 2C93B 3P92A 4X8VH 4ZHMU 1ANBA 1PPBH 1GBAA 4FUCA 3TJVA 1GJ8B 1K1NA 4WMEA 2O9QA 3OY5U 1D3QB 4E7NA 1HNEE 1TA6A 1QQUA 1VJAU 1CO7E 1FN6A 2CMYA 2GT7A 1KXFA 1P09A 4ISLA 4TWYA 1MD7A 1SQTA 1P06A 1SGTA 1TX7A 1C1RA 5IDKA 1BBRE 3A84A 4F4OC 2H6MA 4UFEH 2SGFE 2QXJA 1QJ6B 1EX3A 3LOXA 4Y8YA 1S85A 1EJAA 2OC7A 2YNBA 4UFFH 1GHBG 4ZAEA 2GDEH 3PYHA 1BTYA 1AI8H 3SV9A 3F1SB 3SOSA 1T31A 1V2VT 3RXEA 5C2ZA 1OS8A 2AS9A 1GI9B 2ZHFH 5PTPA 1D3PB 2ANKH 2A0QB 1YPLH 1TGNA 2FI5E 2OUAA 1HV7A 1SGQE 1ESTA 2XXLA 1QBNA 4Y0YE 1GJ4H 1TBQH 3SNAA 3LONA 1GBJA 3PWBA 5EODA 3GOVB 1O2SA 2CHAC 2FTLE 1LKAA 3IITA 3EYDA 1C2FA 2AYWA 4JZDH 3VB7A 2ZHWH 3TGIE 5B6OA 2A31A 4IN2A 2GKVE 2ZFQH 3LH1A 1LHEH 1MZDA 1KY9A 1WQVH 2BY5X 1C1VH 1P2OA 2HNTE 2BOHB 1ZTJA 1C5MD 2FOBA 4ISHH 2VNTA 2QC2A 1AQ7A 4WJG2 5AF9H 4X1PU 1VITG 1AKSA 3BEFB 4CRBA 4B73A 4JMYA 5DJ7A 3SGQE 1SVPA 4HGCA 1HAXB 2FI3E 2GMTC 4J2YB 2QXHA 3A81A 1O5BB 2STAE 3W94A 5FX6A 3ZZ5A 1KLTA 3GY4A 1TNLA 4B75A 1O3MA 2P94A 1GBDA 3RC5A 5A0BA 2XTTB 3SJIA 1MU8B 1XKBC 1AHTH 1LHFH 1T8MA 1H9LB 2VGCC 2VINA 5DGJA 4X1SU 4FUIA 1GBEA 1GBMA 1P2QA 1O2UA 4FUGA 4AB9A 2AMPA 4B76A 1KXCA 3MNSA 2GV6A 1O2LA 5FAHA 2ILNA 1F5LA 2R0LA 3GY6A 4AN7A 5TJXA 1XUFA 2W7UA 2BY9X 2HPPH 1EZSC 2G5VA 5J4QA 1GHAF 1ZHPA 1F5RA 2BLWA 3EA9A 1IOEA 2RG3A 2H1UA 1FIZA 4AFZA 4K1TA 2TBSA 1HLTH 1Q31A 2H2ZA 4M7GA 4MPXA 1FONA
chains in the Genus database with same CATH superfamily
3HK3B 2BDHA 2RDEA 3DFLA 1UTLM 1TGBA 2FIRH 5HIZA 1O2MA 1O32A 2F43B 1NPMA 3DCLA 1TOCB 4FUFA 3SORA 1P02A 1OSSA 1D3DB 3BTDE 2VWMA 3QZRA 3BTEE 1NS3A 3RXGA 1FAXA 4OS1A 2WPJS 4ACAA 4MG3A 1PJPA 1Z1JA 2A4QA 1VKYA 2O8MA 4NSYA 5FL7D 1AWFH 3MNXA 2P95A 2R9PA 1ARBA 2HOBA 1LMWB 3PV4A 4AZ2B 4DURA 1YYY1 3TJOA 5LPRA 1SG8B 1BOQA 1DSUA 2C8XB 3U69H 2BM2A 1OWHA 1F0RA 4A7IB 3LU9B 2BB4A 3BTKE 4LXBH 2WV5A 4Z6AH 1ELCA 5C67A 1SQAA 1ZOMA 1SGFA 3G01A 2WYGA 2NU4E 3RXSA 4X8TH 1P2JA 1RFNA 2A5AA 1Y3WA 3BIVH 3KQCA 4FU8A 3T2NA 2XC5A 1LHGH 1BITA 3CS7A 2BLOA 3ZVEA 4FU7A 2A4RA 4I8LA 2R3YA 3D23A 1ZPZA 3M36A 1GJ6A 1W0JD 3FFGA 1MZAA 2ZWLH 3KYFA 1GVKB 2VVCA 4RKJB 2ZU4A 1ZHMA 3MU1A 3EE0B 5TCCA 1KTSB 1L2EA 1RIWB 3M35A 2BXUH 2K8IA 3UREA 3A8BA 2G51A 2CXVA 3GCTG 3RXPA 3UR9A 3UB0A 1WTHD 2M2AA 1NT1A 1SLVB 2P8OB 3NK8A 2XBVA 5EXMA 1H1BA 3OE7D 1TRNA 2A2XH 4XE4A 5FPTA 1AY6H 2SGEE 3STIA 1LHCH 3ATIA 1VGCB 1S83A 1NROH 5A8XA 3LGWA 5GIBA 1GDQA 3GY8A 5E0GA 1NN6A 5I25A 4O9VA 5F6MA 4ABDA 1WYKA 3Q76A 4I8GA 1TMUH 4TWWA 3LIWA 2BVXH 4ABHA 3SI4H 2ZGJA 3SU5A 4MNVA 1UK2A 1Y5UT 1YM0A 2ZDKA 1V2MT 2Z9GA 1C1NA 1O36A 3KQBA 3RXOA 1C5SA 1TYNA 1GJDB 2PKSB 4WMDA 4OGYA 1BRAA 4XRNA 5JBAS 3TIUA 1ELBA 3ZVGA 1Y3XA 1MUEB 1GMHF 1P04A 4E05H 3RUOA 5AFZH 1NFWA 4LK4A 1BTZA 3TNTA 1O2IA 2PV9B 2ZA5A 3SZEA 5HM9A 4H42U 4XBDA 1QRXA 1IQEA 4DT7B 1YPMH 3QGJA 1HJAB 1LQDB 8LPRA 2ZFTA 3B9FH 1T4VH 3PMAB 5ESTE 1ZJDA 1OPHB 3A82A 4MQAA 1UTQA 1DWCH 3GISB 1AIXH 1YLDA 3A85A 3MU0A 3H09A 1DLEA 1GVZA 4DY7B 2OINA 2TGTA 1MAXA 1Y3UA 4FUJA 4Q63A 3U1JB 3U9AH 2BD7A 3TK5A 2PSYA 4MNWA 1LVYA 5G4BA 3A7VA 1EOJA 4ACBA 1FNIA 2KCAA 3D49H 4WWYA 1WDIA 2PHBA 2WPKS 1FY3A 5K0HA 4HG6A 1VZQH 2ZO3H 1O2XA 1GDUA 4I31A 1CGJE 1H9IE 3UFAA 3P17H 3ZZ3A 1W13U 1TPOA 3PO1B 4X6NA 1O3GA 2OLGA 2BDCA 1CSOE 3TJNA 4X6OA 3DHKH 2EQNA 1TPAE 5HYOA 5L30H 5LGOA 3D62A 4INLA 3VB4A 1MQ5A 4ZCNA 1P05A 1YPKH 4CR5A 1HRTH 2A5KA 1ZHRA 1KXDA 3ZVDA 2WUCA 3LJJA 1NBMD 6CHAC 5T1VA 1V2ST 9ESTA 1C5ZB 4AFQA 3D65E 1O33A 3MMGA 4UFGH 1MU6B 2UUYA 3K6ZA 5C5NA 2Y7ZA 1QY6A 5C0TA 1GMCF 2C4FH 1QZ8A 1O2RA 2BZ6H 3ZVBA 4ZXXH 2Z9LA 1MKXK 4X2VA 3S7KB 3KEEA 1BIOA 4VGCB 4O3TA 2EI8A 2RA0A 1P3CA 3SJOA 4Y79A 1C2HA 2HLCA 5A8ZA 3RU4T 4RT1A 2P16A 1DE7H 3RXFA 7GCHG 2WSSD 1YCPK 2ZTZA 1O2YA 1EAUA 5C0UA 1ZPBA 5DP4A 1GCTC 3WY8A 5FX5A 1C1WH 1NTPA 1H8DH 1X7AC 3VFEA 2WPMS 1DITH 4HZHA 4D7GA 4WY3A 1ZRBA 3PB1E 2GCTC 4NIXA 2IJOB 5AFYH 5F53A 1F0SA 2W3KA 3E90B 1N6YA 2G00A 3KGPA 1C5OH 1W3CA 1UCYK 1EPTC 3DSGA 1RTFB 1D4PB 2C8ZB 1AD8H 1SGRE 1RTLA 2G8TA 5GCHG 2B5TB 1OOKB 4Y11E 4QT8C 8GCHG 1HAPH 1O2KA 2KCOA 1W8BH 1TX6A 1MAYA 1ZYOA 1FUJA 1HXEH 3L6PA 1P0SH 5DP6A 4JZEH 3RC6A 1BDAA 3RXTA 2OQ5A 2F9UA 3K9XB 1IQNA 1C2KA 1V2WT 2SGAA 3SV2H 3GCTF 1SFQB 4JK6A 3KNXA 5FXLA 3PROA 2IPHA 1MABB 3EAJA 2UUJB 5F8ZA 1C5XB 1A46H 2ZP0H 4OS6A 3RMLH 1DFPA 2NU2E 2FDAA 2ZFPH 2PTNA 3S9BA 2JH5D 2PFEA 3O8CA 3ELAH 2ZFSA 4IMQA 4GLYA 2ZDMA 3SJ9A 3RXLA 4K8BA 5E8EH 4GUXA 1MBMA 4ABGA 2AMQA 1LO6A 2P3FH 2Y82A 3BN9A 1DPOA 3H7TA 1AB9B 3URDA 1P11E 3MTYA 1YF4A 3OFND 2PR3A 2QF3A 1O30A 4B2BA 4MVNA 2XC0A 3CS0A 1GBTA 1JWTA 1GI6A 1ZSJA 3M5NA 4BAQB 2AMDA 1GBFA 2NU1E 3V7TA 2BY6X 4AG2A 1EZXC 1MTUA 3AAVA 1VCQA 4NCYA 4ZKOU 4J1YA 2LPRA 4KGAA 1F92A 3DSOA 2ZIQH 4UD9H 3BEUA 1C5UA 1RJXB 1K1MA 1DLKB 2FODA 2ZU5A 4MPUA 1ZGIA 3MH5A 1CHOG 2ZQ1A 1YPEH 2F3CE 3ZVCA 2ZHDA 1YCPH 4MDSA 3QWCH 2Y7XA 4P00A 3LGUA 3SO3A 1G37A 2ZECA 2H5DA 2SGPE 3M7QA 4WH8A 3ZZCA 2J95A 4Q2KA 2AERH 2AIPA 3W95A 1K2I1 2QCYA 4ZKSU 4FETA 2G4TA 4NWKA 1O3EA 3AVZA 3WWFA 1O3DA 1BA8B 4GCHG 5CHBA 4ABEA 2FI4E 1IQFA 1ZTLA 2TGPZ 1TQ0B 4LOYH 2CGAA 5HXFA 1C2JA 1GCDA 4FXGH 4AORA 3V12A 1WUNH 4HTCH 1FI8A 2EI6A 3KCGH 2RFKC 1B7XB 3BTME 1UCYH 3ATKA 1W11U 1G9IE 2VU8E 4R8TB 2KCYA 3HPTB 4NG9H 5EXNA 4DVAU 2IPQX 1BMNH 3PM3A 4AOQA 1LHDH 3SU4A 1P9UA 4JYVH 4AGJA 2JDID 4INKA 3RU4D 1GI3A 4BNRA 1ID5H 1V2TT 1P12E 1PQ7A 1Z8IB 3RXQA 3P95A 2J5UA 1BTPA 3F9GA 1GDNA 4U01A 2V3MA 1CT0E 5GJ4B 2Q6GA 1GJCB 1GPZA 5L2ZH 3EA7A 9LPRA 1V2PT 2ALPA 2TGAA 3MQKC 2HLDD 1P2NA 1WTGH 1TGSZ 3CP7A 1LVBA 3MHWU 1MTNB 3RXAA 3S69A 2J34A 4TPIZ 5DK1A 1NO9H 1PQAA 1SGFG 3LC3A 1O3NA 2IN2A 3ZZ7A 4LZ1H 1UTPA 2OP9A 1TBRH 3A88A 2ZGBH 3T62A 1ACBE 2BDYA 3LT3A 3V3MA 1J14A 2V6NA 3MO3A 1O35A 4B6EA 1QRZA 4MPWA 4H4FA 4RSPA 1YPHC 4Y76A 1AWHB 1W12U 3GCHC 1S6HA 4SGAE 4A1VA 1O2HA 2F9BH 1H9HE 3MWIU 1TE0A 1MH0A 2BTCE 1PQ8A 2FS8A 3UNSA 1BCUH 2XC4A 2AGGX 3RXCA 4FOUC 4WXIA 3F2FA 1HCGA 3FANA 4INHA 2C90B 5CHAB 3R0FA 1HAOH 1P01A 3O8DA 5JBTA 4U2WA 1C9TA 2G4UA 3K65B 1DVAH 1DANH 3H7OA 2P3TB 4CBOA 1MCVA 1WV7H 1DUEA 3OU0A 1SGCA 4ZKRU 3Q77A 1SPJA 2BDIA 3FVFB 5A0AE 4GVUA 5GCHF 4IS5A 4Q7XA 3N7EA 1GBBA 3F3BA 5FCRA 1LPGB 1MKWK 3ZV8A 2YMSC 1QTFA 1EAXA 1C5PA 1GG6B 1MMJN 3ATMA 4O3UA 1TALA 1BJUA 1QIXB 1YKTA 1ANCA 1EKBB 4CHAC 2FS9A 4X2WA 3RU4E 1BZXE 2GV7A 3BG4B 1NU7B 3A8CA 5EQSA 1MTVA 1C5VA 1NRRH 3RM2H 2GT8A 3QX5H 4THNH 1EP5A 3SN8A 2ZPRA 1HUTH 2FOEA 4X0WU 2DE9A 3NWUA 2KX4A 3DUXH 2Z6BD 2BZAA 1W0ZU 1ELVA 3OAAD 2UWLA 3BTTE 3BIUH 4DJZB 1C4Y2 3SGBE 3RP2A 4CH2B 1FQ3A 2XBXA 4IMZA 3PMJA 3MH7A 1QFKH 4YT7H 4YLUA 3Q00A 3GYLB 1O2NA 1DWBH 2QGRA 5T6DA 1RRKA 1O2VA 1IQGA 1TPPA 2ZC9H 2JKHA 4X2XA 4BAKB 3IWMA 1EXFA 1XKAC 1A5IA 1KIGH 1DOJA 4D76A 2ODYB 1CGIE 1SGEE 2OXSA 2XNDD 1C1PA 2FOCA 2H5CA 1UVPA 3ZVFA 2BLVA 1W0YH 4BAOB 3QZQA 1GGDC 1K9OE 4BXWA 4D9RA 1TMBH 4WMFA 2B9LA 2FX4A 1PYTC 1HBTH 2VIQA 2J38A 1O5AB 1L4ZA 3MU8A 1K1OA 5T6FA 3SUEA 1K0HA 3ZZ6A 1RGQA 2WPDD 5BPEA 3VGCC 4FUEA 1GJ7B 3UTUH 1QA0A 2UUFB 1QB9A 2FM2A 1SGIB 1XUIA 3U8RH 1SOTA 1JOUB 2VWLA 1QA7A 1P2MA 1YWUA 2R2WU 1B5GH 2OCVB 6GCHF 1FY1A 4Q7ZA 4X1QU 1HJAC 3AK5A 2ZDNA 1GHXH 2ZNKH 3FP6E 5JBCS 1A2CH 3GYMA 1FY4A 1N6XA 3A80A 1CA0B 3A7WA 4U32A 1J15A 1TPSA 2ZGXH 1IQKA 3M7UA 4B2AA 1TOMH 2HPQH 3P8FA 3PTNA 4Q80A 5F8TA 1S0QA 1JIMA 1EZUC 1HAZB 2WZQA 3F2GA 3SUDA 1O3IA 1MKWH 1UHBB 2IOTA 2Y5GA 4AFSA 2J4IA 3SV8A 7LPRA 1D3TB 1GHVH 2A7JA 2A5IA 2XBYA 1GI5A 4KTCA 1BMAA 3SNEA 3T28A 1UVUH 4Y8ZA 3LGVA 1AUTC 1S5SA 2RCEA 4P02A 2RA3A 1GI0A 2ZDLA 1J9CH 2CJIA 2FOHA 2PUQH 2XOKD 1EJNA 3A83A 4JYUH 2I6SA 5GWZA 2L6OA 2HNTC 2ZPSA 3M7TA 4ASHA 1TLDA 2PGBB 2ZU1A 3ESTA 2A7CA 3P6ZB 3ZVAA 4SGBE 3GDUA 4XDEA 1YGCH 3RMNH 2J97A 5GXPA 3E16B 1E0FD 4I86A 2PGQB 1OWKA 4NIWA 2ZDVH 2VIWA 1VR1H 2JETC 5FPSA 2VIPA 2VH0A 1GBCA 1TMTH 4ASUD 3F9FA 2XCNA 1OYTH 2GCHG 1AVXA 2QIQA 2TIOA 4E06H 1O3KA 3N7DA 5SGAE 4NIVA 3AAUA 4DG4A 5EW2H 2W5EA 3SU2A 4VGCC 1O5FH 1Z6EA 1LTOA 3SUFA 1OX1A 2I6QA 1C2LA 3ZZ9A 1DWDH 5DG6A 4K5ZA 8ESTE 1V2NT 1GHBF 3BTQE 1A1RA 2BD9A 1DS2E 1G32B 1QB6A 1XUGA 1SC8U 2XYAA 3UWIA 2CHAB 1O38A 3S9AA 3N99A 3TGJE 1QURH 3HATH 2J9NA 2ZGHA 4CRCA 3KF2A 4CR9A 1C5QA 1TWXB 3LKWA 3ODFA 2HVXA 3ZYDA 2FX6A 1PPZA 1QHRB 2GZ8A 2LELA 2A45B 1GMDG 2YNAA 3OYPA 3BTFE 5GNDA 1EATA 3E3TA 3W1EA 1KSNA 2WINI 4FUHA 1YP9A 3A7YA 2OK5A 1EAIA 1UVOA 1EASA 1FLEE 5EJZA 3SU6A 1FIWA 5HM2A 1A7SA 2V7QD 1A4WH 5T6GA 1E79D 1HIAA 2PWXA 2BD2A 1W7XH 4DT4A 4WVPE 2GMTB 2ANYA 3M5OA 1WCZA 2Z9KA 1H8HD 1O39A 1TNGA 2GP9B 3KN2A 1YPJH 2NU0E 1XUHA 4NA7A 1SLXB 1XM1A 3FAOA 1QL7A 3CENA 1H4WA 2YOLA 1E1QD 1VITF 2VGCB 3A8DA 4UEHH 3BF6H 3TK6A 1C1TA 2TRMA 3M3SA 3FP8E 1O2PA 1HJ9A 3QTVH 1SQRA 2IJD1 1O34A 1SLUB 3MH6A 1QB1A 4IC5A 4Y7AA 2R2MB 1CE5A 2W7SA 1L0ZA 1S84A 1E1RD 2F91A 4X8SH 5EQQA 1G3DA 2P59A 3FKSD 1KXEA 1W0KD 3ZZAA 2VBCA 3VB5A 3A7TA 3GICB 3RXDA 1C2EA 2G52A 2ZFFH 4RT0A 4YM9A 3TK9A 2D1JA 1ESAA 2CN0H 1OP0A 2BD4A 5I46H 2Z9IA 2FMJA 4O03A 2W3IA 4FUDA 3SYJA 1TBZH 4BANB 3OY6U 1V2QT 2AGEX 4AFUA 2FOAA 2KR7A 3M61U 3U8OH 2DUCA 5C94A 4UE7H 3KQDA 4K1SA 3VXEH 1E35B 4Y0ZE 1V3XA 1B0FA 1INCA 1OWJA 2QYIA 1WQSA 1QBOA 5JDUB 3DD2H 2KAIB 4LZ4B 1O3BA 2BVRH 3GCOA 2EEKA 1J17T 1HJ8A 1CBWC 3I78A 4ZHAA 2ZCLP 1EPTA 4ISNA 3PTBA 1XMNB 1CA8B 3VEQB 4NGAH 3QUMP 1UTOA 1VJ9U 2J98B 3HK6B 1RD3B 2Z3EA 3VB6A 1O2TA 1P8VC 4K69A 4CBNA 3E1XB 5AVDA 3PMBB 5DP3A 2BX3A 2VJ1A 3KYGA 3EE7A 3ATLA 3BG8A 4Y8XA 2ZHEH 5CE1A 1KLJH 2C8YB 1CT2E 1BMMH 3OX7U 1TNKA 4CRFA 1Y3VA 1YPGH 1C5YB 4YOJA 1GI7B 1GBKA 3MNCA 1A61H 1BRBE 4GPGA 1MQ6A 1UW7A 2BHGA 2ULLA 1QCPA 1QGFA 4UDWH 2WUBA 1QR3E 2AEIH 3UOPA 4OGXA 1C2IA 7ESTE 2C3SA 3TH3H 5LPEA 1N8OC 4CH8B 3RC4A 1Y5BT 2QA9E 4JK5A 5IK2D 1SGDE 1V2KT 3MNBA 1ESBA 2WYJA 1NRQH 4HI3A 1OXGA 1BBRK 1O0DH 2FO9A 3HGNA 4D9QA 3TLOA 1EFRD 5B6LA 2GCHF 1UTJA 2Z3DA 3MO9A 2LNCA 1O5GH 1OP8A 1Z8GA 2G55A 2VIVA 2CF9H 3OTPA 5ESBA 3TH2H 2Q1JA 4NFFA 1BHXF 1SMFE 2Q6DA 4NSVA 5E0JA 3SJ8A 5C1XA 1E36B 5DPAA 1KMHB 3RLWH 1ZGVA 4X2YA 1C2GA 4JYTA 5HMAA 1ZRKA 5C17A 4CRDA 1OP2A 3LJOA 2YMSD 5FPYA 3FP7E 1NBME 3QGNB 1EQ9A 3RLYH 3HKJB 4F48B 1JRTA 2BQ7B 2GZ9A 2QF0A 3TITA 4DOQA 2GGVB 2FXRA 3T27A 2M5TA 2FOFA 2UWOA 2BY8X 3SNBA 3WW7A 3U1IB 1G3EA 1ELFA 1O3AA 2ZU3A 3EA8A 5A2MH 3V0XA 2Y5FA 1FAKH 1O2OA 3UQVA 1P10A 1Y3YA 3MI4A 1F5KU 1C5RA 1UTKA 4NFEA 1ELDE 4A1XA 1MKXH 4ZH8A 4I8JA 1PPEE 1DM4B 1GBIA 3UOUA 1P9SA 1O2JA 4CRGA 1GL0E 4M9FA 3V13A 2FLBH 2EA3A 2BD3A 3LGYA 1ZZZA 2OC0A 4AX9H 5A8YA 1ETSH 1HIAB 4CRAA 4I8KA 1GJ9B 1O2ZA 1C5WB 4ABAA 2O8UA 3SI3H 4JZIA 4DIHH 5T3HA 1UHBA 2ZTYA 2ZZUH 1NY22 1W14U 1RTKA 4D8NA 1TQ7B 3BV9B 1WU1A 2JJ1D 1ZSKA 1QQ4A 1MTSA 1QRWA 4WXVA 1O5EH 3UY9A 6CHAB 1P57B 3ATWA 1A5HA 1BBRH 1CQQA 1MD8A 1ZTKA 3SQHE 3N7OA 3SNCA 1T8LA 3PMHB 1P03A 5J4SA 1ELGA 1GHAG 3KHVA 2TPIZ 3A7ZA 2FLRH 1F7ZA 3AASA 1T8OA 2EY4C 2VVUA 1A3EH 1K1LA 5E2OA 1L1NA 3SU3A 1GHYH 3STJA 3LGIA 4I33A 1EB2A 4X6MA 3MU4A 4XFQA 1GI4A 2XBWA 3RM0H 5GPIB 4D7FA 3F0OA 1V6DA 3ODDA 3PRDA 1ELTA 1UTNA 5HKKD 5L2YH 1GCTB 2GVFA 3VB3A 4A92A 1DUAA 1Y59T 1UK3A 4YXWD 1C1OA 5DP5A 2Z94A 3URCA 4BTTB 1K1JA 1O5DH 2D26C 4HFPB 2PKAA 4BAMB 2ZFRH 4BXSA 4DIIH 2GCTB 1A0HB 1CA0C 5C3NA 1HDTH 3TH4H 1AO5A 4JZ1A 1OKXA 4YOGA 1IQIA 4MLFB 4Z1MD 4Y7BA 1NESE 4K1EA 1ELAA 7GCHF 3RXIA 1ZMLA 1EPTB 5A0CA 2PUXB 4DCDA 4TY7A 4AGKA 1C5NH 1S81A 4NZQA 1AE5A 3PLKA 1SHYA 1ZLRA 2F83A 3A8AA 1GVLA 2AIQA 3RDZA 1DX5M 3F9EA 4WF8A 3S7HB 1GI2A 4DW2U 3UWJH 3E8LA 1YLCA 2BY7X 3T5FH 1E38B 3KL6A 1NRSH 5EPNA 1DT2A 4NA8A 3L3TA 1TX8A 1UCYE 3B8JA 1V2OT 4YOIA 5JB8S 4ESTE 3MU5A 2ZEBA 3M5MA 1F0TA 1BUIA 1TFXA 1GHZA 1TABE 2JH6D 4TT3D 1THRH 8GCHF 2V3OH 1Z8RA 2H9TH 1RXPA 1KXBA 3RXKA 1XVOA 2F9OA 2PTCE 3P8GA 2VVVA 3FZDA 2J92A 1HXFH 1QJ1B 3SV7A 1HAGE 2ESTE 1Y8TA 4GHQA 5ETXA 3P8OA 2QY0B 1IQMA 2BD5A 1THPB 2PW8H 3SZNA 1PFXC 3SGAE 1WXRA 2P3UB 3KQ5A 3AW0A 1RIWC 2D8WA 2O8WA 3PV5A 1AFQB 1K1PA 1K28D 4DGJA 4AB8A 2ODPA 3O8RA 1UVTH 5F8XA 3RXJA 2P8OC 5EG4A 2ZKSA 3C27B 1AZ8A 1E34B 2JH0D 1O2QA 2A2QH 1VGCC 3MO6A 5IYTA 2G81E 1GMHG 2QE7D 3SHCH 3GCNA 1UTMA 1QNJA 3KIDU 2EC9H 2F4LA 2F9PA 1WBGB 2V0BA 3NKKA 4TYDA 2HNTF 2XCFA 6ESTA 3Q3XA 2FYRA 2XNIA 1BHXB 4I8HA 2KAIA 3JZ1B 3BEIB 5HGGA 1QJ7B 1G2MA 1HGTH 1GI1A 1ORFA 4B71A 1L1JA 4PROA 1THSH 2PKSC 3T29A 3P70B 2BDGA 4GAWA 3LH3A 1CHOF 1C1UH 1O31A 1S82A 2EI7A 2B0FA 1W10U 4AC9A 1FZZA 5EPYA 5E0HA 3TU7H 1TIOA 2G5NA 2J98A 1SR5C 2PP6A 3UR6A 1NFUA 1GHWH 4JCNA 1ETTH 4BOHA 2UWPA 4AYYB 1DY8A 4GCHF 2CV3A 3FOAA 4FU9A 2DE8A 4XD7D 5C20A 5LH8A 4OM9A 1DDJA 1NU9A 2K0QA 3GY3A 2Q6FA 1XVMA 3IG6B 1AVGH 4OS7A 5CDFE 1FPCH 2VWOA 1O5CB 2SNVA 1NRNH 1O3CA 5ABWA 3UNRA 1P3EA 1C1QA 1J16A 1SGYE 2V3HH 2FOGA 4K2YA 3EQ0H 1ANDA 1SGPE 1V2LT 2SNWA 5EQRA 2F9VA 2FYQA 1CVWH 1SQOA 3SU1A 3ENSB 4XBCA 4F49A 1TNHA 4ZKNU 2AGIX 2HRVA 1TRMA 5DP7A 3PLPA 3GCHB 1T4UH 3ZZBA 1ELEE 4IN1A 1ZJKA 1GMCG 3PO1C 4Y10E 2TGDA 3MYWA 1V2RT 1Z71A 4Z0KA 1DSTA 1GBLA 3R3GB 3UPEA 3RMMH 3VXFH 2C8WB 2VB0A 2J2UA 4X6PA 4Q7YA 5A09A 7KMEH 4KELA 1LCYA 1TRYA 3KQEA 3NXPA 1ABIH 1LKBA 1HAVB 1AFEH 2NU3E 2AFQB 1VITH 1FY8E 1JIRA 4ZHLU 4RKOB 3LDXH 1KDQA 2FESH 2ANMH 1H8IH 3F0PA 4Y6DA 5DKMA 5H4IB 5DSFA 2O8TA 2OBOA 2VIOA 4K3JA 3DFJA 1OWEA 3B23B 4YTAA 1Z7KA 1GJAB 2Y81A 2ASUB 3BTWE 1YLNA 3PV2A 5LPFA 1MCTA 1SGNE 1UO6A 1IQLA 1ZMJA 4AYVB 2OC8A 1G2LA 3C1KA 3ZZDA 3SNDA 3AW1A 2PKAB 1COWD 2YMSB 5DO4H 1UJ1A 3QK1A 1HAYB 2ZCKP 2ZG0H 1ARCA 1D6WA 3A87A 4BTUB 4E7RG 1A0LA 3SHAH 1DY9A 4I7YH 4CHAB 2Z7FE 4A5TS 1M9UA 3E0PB 3SV6A 1AE8H 1T7CA 5EU8A 1L1GA 1BMLA 3SUGA 1KLIH 3A7XA 3SJKA 1HAHH 1C9PA 3U8TH 1EUFA 3VPKA 1BTWA 1C4V2 2ALVA 1P2KA 1DWEH 3SBKA 1B0EA 4YZUA 1D9IA 2QF4A 1NRPH 1O3FA 1MBQA 3TPIZ 2Y5HA 4WH6A 3QLPH 4ISOA 3NZIA 1BRCE 4JZFH 4OS5A 3RXMA 2GTBA 1AGJA 3GDVA 4TPYA 2OTVA 2NWNA 4O97A 2H9EH 1O3HA 3LGTA 1OYQA 1NZQH 3PWCA 4XBBA 4UONA 3K2UA 4B2CA 5L6NH 1GGDB 2Y6TA 1BQYA 5TCAA 1G3BA 1VCWA 1EOLA 2B8OH 2PSXA 3MFJA 3SU0A 3TJUA 1NM6A 4U30A 1HFDA 1SL3A 1G30B 5C5OA 4UFDH 3VGCB 2FPZA 1LQEA 1TGCA 1V2JT 3F9HA 1WSSH 2ODQA 2PLXA 4H6SB 1WAYB 2STBE 2ZI2H 1AUJA 3JZ2B 1AU8A 4OS2A 1O3PB 3I77A 3UIRA 1GJ5H 3RXBA 2SGDE 1C5TA 4KKDA 1SSXA 1IHTH 1PPGE 5JBBS 2GJGA 1QL8A 1YC0A 1BB0B 1BTHH 3ZV9A 1Q3XA 1EZQA 3Q3YA 3K6YA 1CHGA 1AB9C 4A1TA 2W26A 3NCLA 3E91A 1T32A 3LPRA 4CREA 5FBIA 1GWAA 1O37A 2BVSH 3TVJB 3VG8A 1U6QA 2WPHS 2GX4A 1C4U2 2WV9A 1CU1A 2QV1A 1TA2A 5FHTA 3L33A 2BMGB 1Z8JB 1GJBB 2WPLS 1SLWB 1N1LA 1BTUA 1FN8A 4ABBA 2BOKA 4K60A 4MNXA 1AKSB 4Y71A 2XRCA 1NFXA 4GHTA 2HWLB 2BDBA 1IQJA 4IC6A 3ZZ8A 1W7GH 3ZIAD 4XOJA 3OTJE 3H5CB 1SBWA 2ZQ2A 3NUMA 3ZZ4A 1SHHB 1HYLA 3ITIA 3A86A 3FO8D 4FVDA 2A7HA 8KME2 4KTSA 4NIYA 1C2MA 1JXPA 4ABJA 5K7RA 3UNQA 1S0RA 4K8YA 4MTBA 3M3VA 2OBQA 1ZSLA 5E2PA 1H8ED 2QF5A 3LC5A 5AHGH 2B7DH 2WV4A 5DP9A 3NPSA 2BX4A 2ZPQA 1GBHA 2BD8A 3BTGE 1ABJH 4IW4E 1UVSH 1O3LA 2JETB 1EB1H 2SGQE 6LPRA 2BYAX 3GY2A 1AZZA 2BXTH 4YO9A 5CMXH 2GD4B 2Y80A 1UK4A 1SI5H 2ZU2A 2R3UA 1TGTA 1XX9A 1O2WA 1KYNA 1K22H 3GY7A 3P8NA 4OS4A 3E6PH 1GI8B 1V2UT 3FN8A 1K21H 4ZROA 3BTHE 2CF8H 2BLQA 1G36A 5JYIA 4YLQH 1ETRH 3U98H 1BT7A 1ANEA 3I29A 5C1YA 3F68H 3T26A 1JMOH 4NWLA 1LVOA 3A89A 1SFIA 4X1RU 1BMFD 1LVMA 2ZGCA 1SOZA 2XW9A 1LPKB 1MTNC 1YCPM 3TNSA 1ZR0A 2WHXA 3M37A 1A0JA 2J94A 5GDSH 1FY5A 3UQOA 1AMHA 5EOKA 1PPCE 1S6LA 1Q2WA 3Q3KA 5BRRE 1HPGA 3E0NB 2JJ2D 2KM0A 1FJSA 3GY5A 1FPHH 1BRUP 1T8NA 1KTTB 4MNYA 1OHHD 1S6FA 1IQHA 1C2DA 1KDQB 1AN1E 2ZHQH 3GDSA 2BDAA 3MH4A 1YBWA 2ANWA 3QN7A 4ZMAH 3RXUA 3BSQA 2W6JD 3WWBA 4YESB 1AVWA 1OWDA 1FMGA 3PRBA 1IHSH 1IAUA 1EJMA 1XUJA 1WOFA 4R0IA 5JB9S 1GMDF 5CHAC 2A4OA 1G3CA 2R0KA 2W6ID 3F6UH 5F03A 2A32A 3ZYEA 4BTIB 4ZUHA 1HB0B 2P93A 4H6TA 3RXHA 2K1QA 3HGPA 3RMOH 3S9CA 5DP8A 1O2GH 3RXRA 1C1SA 1LDTT 1O3JA 2FEQH 3PLBA 2AHME 4BAHB 3QO6A 4ABFA 1DXPA 1P2IA 1SKYE 3OSYA 2FWWA 5EIYA 2OC1A 3DT0H 1UMAH 2ZCHP 1JRSA 1VCPA 2BQWB 1Y5AT 2FTMA 2OQUA 1TNJA 1GG6C 1JBUH 1NC6A 2CK3D 2OD3B 2BQ6B 1YY3A 1W2KH 3T25A 3EGKH 4FUBA 1YPHE 3BG4C 2QXIA 1DICA 1FV9A 1MTWA 2F9NA 3HKIB 1C1MA 2QAAA 5FCKA 2VH6A 4I32A 2O8LA 4IBLH 4AG1A 1AFQC 5EW1H 1PYTD 2HVYB 5EJ1A 2FP7B 1Z1IA 3FZZA 1FDPA 3O8BA 4KTUA 2ZF0H 2AH4X 3GS9A 1TONA 4GSOA 2THFB 1D6RA 1ZPCA 1QL9A 2HALA 1TB6H 5JPMH 1NFYA 5KECA 1PQ5A 1Z6JH 1KXAA 1HAIH 3TGKE 4A6LA 4X8UH 1CBWB 6GCHG 4IGDA 1PPFE 1TAWA 3M5LA 4XSKU 5EXLA 1K1IA 3QDZB 4MPVA 1EAWA 1EP6A 4ABIA 2VIDA 2Z9JA 1L4DA 3UAIC 1TNIA 4YT6H 1J8AA 4RN6A 2A4GA 4ZXYH 1XXDA 1QBVH 1HAVA 1A5GH 2XWBI 4B74A 4KP0A 2V35A 4TY6A 1A3BH 2UUKB 1PPHE 3MOCA 1LPZB 2D2DA 2A1DB 2VWNA 2ZDAH 4B1TA 1CT4E 2H9HA 1CGHA 1XUKA 4NA9H 5DN6D 3SQEE 3F2HA 2GZ7A 2HGTH 3UUZA 2Z3CA 2FOMB 1C5LH 1O3OA 2XWAA 4FVBA 3RXVA 3QTOH 1E37B 2QXGA 2FZZA 1SB1H 1RS0A 2WPIS 4ISIH 1BTXA 4TSFD 1F0UA 4NZLA 1BJVA 3SW2B 1F2SE 1ZMNA 2SFAA 3EDXB 2QN5T 3S0NA 1GL1A 1DXWA 4X1NU 1N8OB 5EGMA 3DA9B 2RDLA 3M3TA 2ZTXA 1OWIA 2JIZD 1XXFA 2GDDA 5C1UA 5FBEA 1FXYA 2C93B 3P92A 4X8VH 4ZHMU 1ANBA 1PPBH 1GBAA 4FUCA 3TJVA 1GJ8B 1K1NA 4WMEA 2O9QA 4Q4LA 3OY5U 1D3QB 4E7NA 1HNEE 1TA6A 1QQUA 1VJAU 1CO7E 1FN6A 2CMYA 2GT7A 1KXFA 1P09A 4ISLA 4TWYA 1MD7A 1SQTA 1P06A 4F55A 1SGTA 1TX7A 1C1RA 5IDKA 1BBRE 3A84A 4F4OC 2H6MA 4UFEH 2SGFE 2QXJA 1QJ6B 1EX3A 3LOXA 4Y8YA 1S85A 5HIYA 2L74A 1EJAA 2OC7A 2YNBA 4UFFH 1GHBG 4ZAEA 2GDEH 3PYHA 1BTYA 1AI8H 3DSPA 3SV9A 3F1SB 3SOSA 2KZ4A 3OEED 1T31A 1V2VT 3RXEA 5C2ZA 1OS8A 2AS9A 3NRLA 1GI9B 2ZHFH 5PTPA 1D3PB 2ANKH 2A0QB 1YPLH 1TGNA 2FI5E 2OUAA 1HV7A 1SGQE 1ESTA 2XXLA 1QBNA 4Y0YE 1GJ4H 1TBQH 3SNAA 3LONA 1GBJA 3PWBA 5EODA 3GOVB 1O2SA 2CHAC 2FTLE 1LKAA 3IITA 3EYDA 1C2FA 2AYWA 4JZDH 3VB7A 2ZHWH 3TGIE 5KGOA 5B6OA 2A31A 4IN2A 2GKVE 2ZFQH 3LH1A 1LHEH 1MZDA 1KY9A 1WQVH 2BY5X 1C1VH 1P2OA 2HNTE 2BOHB 1ZTJA 1C5MD 2FOBA 4ISHH 2VNTA 2QC2A 1AQ7A 4WJG2 5AF9H 4X1PU 1VITG 1AKSA 3BEFB 3CNRA 4CRBA 4B73A 4JMYA 5KEDA 2KFWA 5DJ7A 4B6FA 3SGQE 1SVPA 4HGCA 1HAXB 2FI3E 2GMTC 4J2YB 2QXHA 3A81A 1O5BB 2LP6A 2STAE 3W94A 5FX6A 3ZZ5A 1KLTA 3GY4A 1TNLA 4B75A 1O3MA 2P94A 1GBDA 3RC5A 5A0BA 2XTTB 3SJIA 1MU8B 1XKBC 1AHTH 1LHFH 1T8MA 1FX0B 1H9LB 2VGCC 3OEHD 2VINA 5DGJA 4X1SU 4FUIA 1GBEA 1GBMA 1P2QA 1O2UA 4FUGA 4AB9A 2AMPA 4B76A 1KXCA 3MNSA 2GV6A 1O2LA 5FAHA 2ILNA 1F5LA 2R0LA 3GY6A 4AN7A 5TJXA 1XUFA 2W7UA 2BY9X 2HPPH 1EZSC 2G5VA 5J4QA 1GHAF 1ZHPA 1F5RA 4RI0A 2BLWA 3EA9A 5EJLA 1IOEA 2RG3A 2H1UA 1FIZA 3U28C 4AFZA 2KCPA 4K1TA 2TBSA 1HLTH 1Q31A 2H2ZA 4M7GA 4MPXA 1FONA
chains in the Genus database with same CATH topology
3HK3B 2BDHA 3DFLA 1UTLM 1TGBA 2FIRH 1O2MA 1O32A 1NPMA 1TOCB 4FUFA 3SORA 1P02A 1OSSA 1D3DB 3BTDE 2VWMA 3QZRA 3BTEE 1NS3A 3RXGA 1FAXA 4OS1A 2WPJS 4MG3A 1PJPA 1Z1JA 2A4QA 2O8MA 4NSYA 1AWFH 3MNXA 2P95A 2R9PA 1ARBA 2HOBA 1LMWB 3PV4A 4AZ2B 4DURA 1YYY1 3TJOA 5LPRA 1SG8B 1BOQA 1DSUA 2C8XB 3U69H 2BM2A 1OWHA 1F0RA 4A7IB 3LU9B 2BB4A 3BTKE 4LXBH 2WV5A 4Z6AH 1ELCA 5C67A 1SQAA 1ZOMA 1SGFA 3G01A 2WYGA 2NU4E 3RXSA 4X8TH 1P2JA 1RFNA 2A5AA 1Y3WA 3BIVH 3KQCA 4FU8A 3T2NA 2XC5A 1LHGH 1BITA 3CS7A 2BLOA 3ZVEA 4FU7A 2A4RA 4I8LA 2R3YA 3D23A 1ZPZA 3M36A 1GJ6A 3FFGA 1MZAA 2ZWLH 1GVKB 2VVCA 4RKJB 2ZU4A 1ZHMA 3MU1A 3EE0B 5TCCA 1KTSB 1L2EA 1RIWB 3M35A 2BXUH 3UREA 3A8BA 2G51A 2CXVA 3GCTG 3RXPA 3UR9A 1WTHD 1NT1A 1SLVB 2P8OB 3NK8A 2XBVA 5EXMA 1H1BA 1TRNA 2A2XH 4XE4A 5FPTA 1AY6H 2SGEE 3STIA 1LHCH 3ATIA 1VGCB 1S83A 1NROH 5A8XA 3LGWA 5GIBA 1GDQA 3GY8A 5E0GA 1NN6A 5I25A 4O9VA 5F6MA 4ABDA 1WYKA 3Q76A 4I8GA 1TMUH 4TWWA 3LIWA 2BVXH 4ABHA 3SI4H 2ZGJA 3SU5A 4MNVA 1UK2A 1Y5UT 1YM0A 2ZDKA 1V2MT 2Z9GA 1C1NA 1O36A 3KQBA 3RXOA 1C5SA 1TYNA 1GJDB 2PKSB 4WMDA 4OGYA 1BRAA 5JBAS 3TIUA 1ELBA 3ZVGA 1Y3XA 1MUEB 1GMHF 1P04A 4E05H 3RUOA 5AFZH 1NFWA 4LK4A 1BTZA 3TNTA 1O2IA 2PV9B 2ZA5A 5HM9A 4H42U 4XBDA 1QRXA 1IQEA 4DT7B 1YPMH 3QGJA 1HJAB 1LQDB 8LPRA 2ZFTA 3B9FH 1T4VH 3PMAB 5ESTE 1ZJDA 1OPHB 3A82A 4MQAA 1UTQA 1DWCH 3GISB 1AIXH 1YLDA 3A85A 3MU0A 1DLEA 1GVZA 4DY7B 2OINA 2TGTA 1MAXA 1Y3UA 4FUJA 3U1JB 3U9AH 2BD7A 3TK5A 2PSYA 4MNWA 1LVYA 5G4BA 3A7VA 1EOJA 1FNIA 4WWYA 3D49H 2PHBA 2WPKS 1FY3A 5K0HA 1VZQH 2ZO3H 1O2XA 1GDUA 4I31A 1CGJE 1H9IE 3UFAA 3P17H 3ZZ3A 1W13U 1TPOA 3PO1B 4X6NA 1O3GA 2OLGA 2BDCA 1CSOE 3TJNA 4X6OA 3DHKH 1TPAE 5HYOA 5L30H 5LGOA 3D62A 4INLA 3VB4A 1MQ5A 1P05A 1YPKH 4CR5A 1HRTH 2A5KA 1ZHRA 1KXDA 3ZVDA 2WUCA 3LJJA 6CHAC 1V2ST 9ESTA 1C5ZB 4AFQA 3D65E 1O33A 3MMGA 4UFGH 1MU6B 2UUYA 3K6ZA 5C5NA 2Y7ZA 1QY6A 1GMCF 2C4FH 1O2RA 2BZ6H 3ZVBA 4ZXXH 2Z9LA 1MKXK 4X2VA 3S7KB 3KEEA 1BIOA 4VGCB 4O3TA 2EI8A 2RA0A 1P3CA 3SJOA 4Y79A 1C2HA 2HLCA 5A8ZA 3RU4T 7GCHG 2P16A 1DE7H 3RXFA 2ZTZA 1YCPK 1O2YA 1EAUA 1ZPBA 5DP4A 1GCTC 3WY8A 5FX5A 1C1WH 1NTPA 1H8DH 1X7AC 3VFEA 2WPMS 1DITH 4HZHA 4D7GA 4WY3A 1ZRBA 3PB1E 2GCTC 4NIXA 2IJOB 5AFYH 1F0SA 2W3KA 3E90B 1N6YA 2G00A 3KGPA 1C5OH 1W3CA 1UCYK 1EPTC 1RTFB 1D4PB 2C8ZB 1AD8H 1SGRE 1RTLA 2G8TA 5GCHG 2B5TB 1OOKB 4Y11E 4QT8C 8GCHG 1HAPH 1O2KA 1W8BH 1TX6A 1MAYA 1ZYOA 1FUJA 1HXEH 3L6PA 1P0SH 5DP6A 4JZEH 3RC6A 1BDAA 3RXTA 2OQ5A 2F9UA 3K9XB 1IQNA 1C2KA 1V2WT 2SGAA 3SV2H 3GCTF 1SFQB 4JK6A 3KNXA 5FXLA 3PROA 2IPHA 3EAJA 2UUJB 5F8ZA 1C5XB 1A46H 2ZP0H 4OS6A 3RMLH 1DFPA 2NU2E 2FDAA 2ZFPH 2PTNA 3S9BA 2JH5D 2PFEA 3O8CA 3ELAH 2ZFSA 4IMQA 4GLYA 2ZDMA 3SJ9A 3RXLA 4K8BA 5E8EH 4GUXA 1MBMA 4ABGA 2AMQA 1LO6A 2P3FH 2Y82A 3BN9A 1DPOA 3H7TA 1AB9B 3URDA 1P11E 3MTYA 1YF4A 2PR3A 2QF3A 1O30A 4B2BA 4MVNA 2XC0A 3CS0A 1GBTA 1JWTA 1GI6A 1ZSJA 3M5NA 4BAQB 2AMDA 1GBFA 2NU1E 3V7TA 2BY6X 4AG2A 1EZXC 1MTUA 3AAVA 1VCQA 4NCYA 4ZKOU 4J1YA 2LPRA 4KGAA 1F92A 2ZIQH 4UD9H 3BEUA 1C5UA 1RJXB 1K1MA 1DLKB 2FODA 2ZU5A 4MPUA 1ZGIA 3MH5A 1CHOG 2ZQ1A 1YPEH 2F3CE 3ZVCA 2ZHDA 1YCPH 4MDSA 3QWCH 2Y7XA 3LGUA 3SO3A 1G37A 2ZECA 2H5DA 2SGPE 3M7QA 4WH8A 3ZZCA 2J95A 4Q2KA 2AERH 2AIPA 3W95A 1K2I1 2QCYA 4ZKSU 2G4TA 4NWKA 1O3EA 3AVZA 1O3DA 1BA8B 4GCHG 4ABEA 2FI4E 1IQFA 1ZTLA 2TGPZ 1TQ0B 4LOYH 2CGAA 5HXFA 1C2JA 1GCDA 4FXGH 4AORA 3V12A 1WUNH 4HTCH 1FI8A 2EI6A 3KCGH 1B7XB 3BTME 1UCYH 3ATKA 1W11U 1G9IE 2VU8E 4R8TB 3HPTB 4NG9H 5EXNA 4DVAU 1BMNH 3PM3A 4AOQA 1LHDH 3SU4A 1P9UA 4JYVH 4AGJA 4INKA 3RU4D 1GI3A 4BNRA 1ID5H 1V2TT 1P12E 1PQ7A 1Z8IB 3RXQA 3P95A 1BTPA 3F9GA 1GDNA 4U01A 1CT0E 5GJ4B 2Q6GA 1GJCB 1GPZA 5L2ZH 3EA7A 9LPRA 1V2PT 2ALPA 2TGAA 1P2NA 1WTGH 1TGSZ 3CP7A 1LVBA 3MHWU 1MTNB 3RXAA 3S69A 2J34A 4TPIZ 5DK1A 1NO9H 1PQAA 1SGFG 3LC3A 1O3NA 2IN2A 3ZZ7A 4LZ1H 1UTPA 2OP9A 1TBRH 3A88A 2ZGBH 3T62A 1ACBE 2BDYA 3LT3A 3V3MA 1J14A 2V6NA 3MO3A 1O35A 1QRZA 4MPWA 4H4FA 4RSPA 1YPHC 4Y76A 1AWHB 1W12U 3GCHC 1S6HA 4SGAE 4A1VA 1O2HA 2F9BH 1H9HE 3MWIU 1TE0A 1MH0A 2BTCE 1PQ8A 2FS8A 3UNSA 1BCUH 2XC4A 2AGGX 3RXCA 4WXIA 1HCGA 3FANA 4INHA 2C90B 5CHAB 3R0FA 1HAOH 1P01A 3O8DA 5JBTA 4U2WA 1C9TA 2G4UA 3K65B 1DVAH 1DANH 3H7OA 2P3TB 4CBOA 1MCVA 1WV7H 1DUEA 3OU0A 1SGCA 4ZKRU 3Q77A 1SPJA 2BDIA 3FVFB 5A0AE 4GVUA 5GCHF 4IS5A 4Q7XA 1GBBA 5FCRA 1LPGB 1MKWK 3ZV8A 1QTFA 1EAXA 1C5PA 1GG6B 1MMJN 3ATMA 4O3UA 1TALA 1BJUA 1QIXB 1YKTA 1ANCA 1EKBB 4CHAC 2FS9A 4X2WA 3RU4E 1BZXE 2GV7A 3BG4B 1NU7B 3A8CA 5EQSA 1MTVA 1C5VA 1NRRH 3RM2H 2GT8A 3QX5H 4THNH 1EP5A 3SN8A 2ZPRA 1HUTH 2FOEA 4X0WU 2DE9A 3NWUA 3DUXH 2Z6BD 2BZAA 1W0ZU 1ELVA 2UWLA 3BTTE 3BIUH 4DJZB 1C4Y2 3SGBE 3RP2A 4CH2B 1FQ3A 2XBXA 4IMZA 3PMJA 3MH7A 1QFKH 4YT7H 4YLUA 3Q00A 3GYLB 1O2NA 1DWBH 2QGRA 5T6DA 1RRKA 1O2VA 1IQGA 1TPPA 2ZC9H 2JKHA 4X2XA 4BAKB 3IWMA 1EXFA 1XKAC 1A5IA 1KIGH 1DOJA 4D76A 2ODYB 1CGIE 1SGEE 2OXSA 1C1PA 2FOCA 2H5CA 1UVPA 3ZVFA 2BLVA 1W0YH 4BAOB 3QZQA 1GGDC 1K9OE 4BXWA 4D9RA 1TMBH 4WMFA 2B9LA 2FX4A 1PYTC 1HBTH 2VIQA 2J38A 1O5AB 1L4ZA 3MU8A 1K1OA 5T6FA 3SUEA 3ZZ6A 1RGQA 5BPEA 3VGCC 4FUEA 1GJ7B 3UTUH 1QA0A 2UUFB 1QB9A 2FM2A 1SGIB 1XUIA 3U8RH 1SOTA 1JOUB 2VWLA 1QA7A 1P2MA 2R2WU 1B5GH 2OCVB 6GCHF 1FY1A 4Q7ZA 4X1QU 1HJAC 2ZDNA 1GHXH 2ZNKH 3FP6E 5JBCS 1A2CH 3GYMA 1FY4A 1N6XA 3A80A 1CA0B 3A7WA 4U32A 1J15A 1TPSA 2ZGXH 1IQKA 3M7UA 4B2AA 1TOMH 2HPQH 3P8FA 3PTNA 4Q80A 5F8TA 1S0QA 1JIMA 1EZUC 1HAZB 3SUDA 1O3IA 1MKWH 1UHBB 2IOTA 2Y5GA 4AFSA 2J4IA 3SV8A 7LPRA 1D3TB 1GHVH 2A7JA 2A5IA 2XBYA 1GI5A 4KTCA 1BMAA 3SNEA 3T28A 1UVUH 4Y8ZA 3LGVA 1AUTC 1S5SA 2RCEA 2RA3A 1GI0A 2ZDLA 1J9CH 2CJIA 2FOHA 2PUQH 1EJNA 3A83A 4JYUH 2I6SA 5GWZA 2HNTC 2ZPSA 3M7TA 4ASHA 1TLDA 2PGBB 2ZU1A 3ESTA 2A7CA 3P6ZB 3ZVAA 4SGBE 3GDUA 4XDEA 1YGCH 3RMNH 5GXPA 3E16B 1E0FD 2PGQB 1OWKA 4NIWA 2ZDVH 2VIWA 1VR1H 2JETC 5FPSA 2VIPA 2VH0A 1GBCA 1TMTH 3F9FA 2XCNA 1OYTH 2GCHG 1AVXA 2QIQA 2TIOA 4E06H 1O3KA 5SGAE 4NIVA 3AAUA 4DG4A 5EW2H 2W5EA 3SU2A 4VGCC 1O5FH 1Z6EA 1LTOA 3SUFA 1OX1A 2I6QA 1C2LA 3ZZ9A 1DWDH 5DG6A 4K5ZA 8ESTE 1V2NT 1GHBF 3BTQE 1A1RA 2BD9A 1DS2E 1G32B 1QB6A 1XUGA 1SC8U 2XYAA 3UWIA 2CHAB 1O38A 3S9AA 3TGJE 1QURH 3HATH 2J9NA 2ZGHA 4CRCA 3KF2A 4CR9A 1C5QA 1TWXB 3LKWA 3ODFA 2HVXA 3ZYDA 2FX6A 1PPZA 1QHRB 2GZ8A 2A45B 1GMDG 2YNAA 3OYPA 3BTFE 1EATA 3E3TA 1KSNA 2WINI 4FUHA 1YP9A 3A7YA 1EAIA 1UVOA 1EASA 1FLEE 3SU6A 1FIWA 5HM2A 1A7SA 1A4WH 5T6GA 1HIAA 2PWXA 2BD2A 1W7XH 4WVPE 2GMTB 2ANYA 3M5OA 1WCZA 2Z9KA 1O39A 1TNGA 2GP9B 3KN2A 1YPJH 2NU0E 1XUHA 4NA7A 1SLXB 1XM1A 3FAOA 1QL7A 3CENA 1H4WA 2YOLA 1VITF 2VGCB 3A8DA 4UEHH 3BF6H 3TK6A 1C1TA 2TRMA 3M3SA 3FP8E 1O2PA 1HJ9A 3QTVH 1O34A 1SLUB 3MH6A 1QB1A 4IC5A 4Y7AA 2R2MB 1CE5A 2W7SA 1L0ZA 1S84A 2F91A 4X8SH 5EQQA 1G3DA 2P59A 1KXEA 3ZZAA 3VB5A 3A7TA 3GICB 3RXDA 1C2EA 2G52A 2ZFFH 4YM9A 3TK9A 2D1JA 1ESAA 2CN0H 1OP0A 2BD4A 5I46H 2Z9IA 2FMJA 4O03A 2W3IA 4FUDA 1TBZH 4BANB 3OY6U 1V2QT 2AGEX 4AFUA 2FOAA 3M61U 3U8OH 2DUCA 4UE7H 3KQDA 4K1SA 3VXEH 1E35B 4Y0ZE 1V3XA 1B0FA 1INCA 1OWJA 2QYIA 1WQSA 1QBOA 5JDUB 3DD2H 2KAIB 4LZ4B 1O3BA 2BVRH 3GCOA 2EEKA 1J17T 1HJ8A 1CBWC 3I78A 4ZHAA 2ZCLP 1EPTA 4ISNA 3PTBA 1XMNB 1CA8B 3VEQB 4NGAH 3QUMP 1UTOA 1VJ9U 3HK6B 1RD3B 2Z3EA 3VB6A 1O2TA 1P8VC 4K69A 4CBNA 3E1XB 5AVDA 3PMBB 5DP3A 2BX3A 2VJ1A 3ATLA 3BG8A 4Y8XA 2ZHEH 5CE1A 1KLJH 2C8YB 1CT2E 1BMMH 3OX7U 1TNKA 4CRFA 1Y3VA 1YPGH 1C5YB 4YOJA 1GI7B 1GBKA 3MNCA 1A61H 1BRBE 4GPGA 1MQ6A 2BHGA 2ULLA 1QCPA 1QGFA 4UDWH 2WUBA 1QR3E 2AEIH 3UOPA 4OGXA 1C2IA 7ESTE 2C3SA 3TH3H 5LPEA 1N8OC 4CH8B 3RC4A 1Y5BT 2QA9E 4JK5A 1SGDE 1V2KT 3MNBA 1ESBA 2WYJA 1NRQH 4HI3A 1OXGA 1BBRK 1O0DH 2FO9A 3HGNA 4D9QA 3TLOA 2GCHF 1UTJA 2Z3DA 3MO9A 2LNCA 1O5GH 1OP8A 1Z8GA 2G55A 2VIVA 2CF9H 3TH2H 5ESBA 2Q1JA 4NFFA 1BHXF 1SMFE 2Q6DA 4NSVA 5E0JA 3SJ8A 5C1XA 1E36B 5DPAA 3RLWH 1ZGVA 4X2YA 1C2GA 4JYTA 5HMAA 1ZRKA 4CRDA 1OP2A 3LJOA 5FPYA 3FP7E 3QGNB 1EQ9A 3RLYH 3HKJB 1JRTA 2BQ7B 2GZ9A 2QF0A 3TITA 4DOQA 2GGVB 2FXRA 3T27A 2M5TA 2FOFA 2UWOA 2BY8X