1EXFA

Exfoliative toxin a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
b'VSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXFOLIATVE TOXIN A
publication title The structure of the superantigen exfoliative toxin A suggests a novel regulation as a serine protease.
pubmed doi rcsb
molecule tags Complex (toxin/peptide)
total genus 51
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1exfA01
2ZHWH 2GV6A 3PV4A 2QV1A 1K22H 5JDUB 1C5OH 1OKXA 1UCYK 2H2ZA 4DGJA 1FQ3A 1KDQB 1BRAA 3M5NA 1ESTA 3T5FH 1GMHF 3BIUH 3MMGA 1VITF 1RRKA 4K8YA 1UTPA 4X2WA 1EATA 2WYJA 4FUDA 5JBBS 2GZ8A 2H9HA 1GI7B 1QA0A 1QB1A 2CV3A 4I31A 2F3CE 3GY2A 4XBDA 4CR9A 1S0QA 4CRGA 3M7UA 4XFQA 3QGNB 5C5OA 1GHVH 1N6YA 2BD7A 2FODA 5DKMA 5DP9A 2HPPH 4B73A 1JOUB 2R0LA 5ABWA 4D7GA 5DP3A 4DURA 3MH7A 3TVJB 2B0FA 1XXDA 4CBNA 1N1LA 2O9QA 1NU9A 1HAZB 3RXHA 4XDEA 4AYVB 1O2WA 2DE9A 1H8IH 3VXEH 3EDXB 1SGQE 1UTQA 3VXFH 4KTUA 3MH5A 1Y8TA 4K8BA 1GHBF 1IQIA 1P04A 4NZLA 4TWWA 1SGEE 1FV9A 1HNEE 4K1SA 2A4RA 3AASA 4AFSA 1ARCA 3A82A 1O3CA 1E37B 2QF3A 1WBGB 3O8DA 4H6SB 2NWNA 2C3SA 2A7CA 1Y5UT 1ELAA 3KL6A 4BNRA 2FPZA 3P6ZB 1F92A 1GL1A 4ISNA 4AFZA 1E36B 3AVZA 3TIUA 2V0BA 2Z3EA 2BXTH 2ALPA 1ZYOA 2FX6A 1MCVA 4ABFA 2FZZA 5LPRA 3EA8A 5FPYA 5FX5A 2C8XB 1MD7A 1O39A 3QK1A 1ACBE 1RGQA 2ZO3H 2ZU3A 2NU2E 2TRMA 8LPRA 1Z8RA 3RXCA 2TGAA 1BTWA 2ZDMA 5FBEA 1SGFA 2ZDKA 3PROA 2HWLB 1QBVH 1DE7H 5JPMH 1O2NA 3MH4A 3W94A 1N8OC 1GI0A 5E8EH 2ZTZA 4TPIZ 3VEQB 3MNBA 4NIVA 3LGTA 1A5IA 1IQNA 3MNXA 1F5LA 2SFAA 1C9TA 1BRCE 5BPEA 1A7SA 6GCHF 1KLIH 1GCDA 3SNBA 3SU1A 1Y3VA 2WPLS 4YOIA 3K6YA 1V2NT 4AG1A 1XKAC 3RP2A 1F2SE 1O5DH 4RN6A 3JZ1B 2ZGHA 5DP5A 1ESAA 4Y71A 4IBLH 2FM2A 2UUFB 4A1VA 1J17T 1NO9H 1SGIB 1GBTA 1GI4A 1O3OA 3A88A 1RXPA 1EZXC 3LGWA 1QIXB 3U98H 3T27A 4D8NA 3RMNH 2A0QB 2UUYA 1FONA 2ZPQA 5T6DA 5JB9S 1TABE 1HAIH 3L3TA 3UOPA 1VCPA 4Q80A 4HFPB 4AYYB 3F9GA 1XKBC 3UOUA 1K2I1 1AFEH 4UFEH 1P3CA 2J38A 1AWHB 3M5OA 4ISHH 2STAE 1TA6A 2OQUA 3SU2A 3MNCA 3SGBE 1EOLA 1P10A 2J92A 1UVSH 1IQKA 4WXIA 2VGCB 3P8GA 1GI2A 3HK3B 2VIQA 1NTPA 1WQSA 1KTSB 4ZXXH 1EAXA 1S6HA 4AB8A 1C5SA 1P9UA 1MZDA 3AAUA 3TK9A 1FIWA 1C1SA 3PM3A 1LHEH 1DITH 1LPZB 3F9HA 2EI8A 1SGTA 3UR6A 1B5GH 1AE8H 4YOGA 1BMNH 1TIOA 1TX6A 1D3DB 1ZJKA 1SPJA 2AYWA 1P3EA 1AVWA 3I77A 4BXWA 3V3MA 1BMMH 1L4ZA 1QGFA 1C5YB 2WYGA 2RA3A 2PGQB 1KSNA 3Q3YA 5BRRE 5T6GA 4X8SH 1VJ9U 1P2IA 3A7VA 1V3XA 1BHXF 2SGFE 4B74A 3V7TA 2G81E 1DS2E 2FOAA 3C27B 3S9BA 1C1NA 2AMQA 1ZGIA 2BY8X 1GJAB 1DM4B 3R0FA 5EPYA 4CRAA 3ZVFA 2JH0D 3SOSA 1GBKA 1DICA 1HLTH 2STBE 2XC5A 1NY22 2G4UA 3KGPA 1XVOA 1K1NA 1HDTH 1JRSA 1LHDH 1GHWH 1J9CH 1NRSH 2QXIA 4FVDA 3A89A 2D1JA 1OWKA 2ZTYA 4MNXA 5F8XA 3RU4E 3Q3KA 1HAGE 1SVPA 1VCQA 2G5NA 3A8AA 1PQAA 1A61H 5JB8S 1P2JA 1GBMA 2Z94A 5TCAA 1ZMLA 4ZAEA 2QN5T 3LPRA 2FI3E 3D49H 1GGDC 1O2KA 3T25A 3TK5A 5A0CA 1VGCC 1XVMA 2OP9A 3A85A 2OXSA 1TWXB 3H7OA 5JBTA 1S5SA 1V2KT 1CVWH 1G3CA 1CHOF 3VB4A 3FAOA 1MD8A 2WUCA 4K1TA 5C3NA 2VJ1A 6CHAB 3HATH 2NU0E 1GJBB 2XXLA 3GDSA 4OS7A 2WPMS 5I46H 1EP5A 1C2LA 5GJ4B 1TFXA 1TNGA 1KYNA 1UVTH 2ANKH 1C1PA 1CA8B 1G30B 3PO1B 3STIA 3TPIZ 1C5XB 1C2GA 1LDTT 3A86A 4JYVH 1C1RA 4X6NA 1TRNA 4NIXA 1P12E 1HV7A 1O3EA 1V2VT 1C2IA 1CO7E 1AQ7A 5DP6A 2BQWB 5EU8A 1UCYE 1MAXA 3ATIA 3RXLA 3RXUA 5A0AE 2QIQA 2SGPE 3KQBA 5T3HA 3SUGA 4E06H 2JKHA 2P95A 1GMCF 1QL7A 1SQTA 1B0FA 4AOQA 4U01A 5HGGA 2XWBI 2F83A 4O97A 2HRVA 1BTUA 1UTJA 1TBZH 3M7TA 4B2CA 1DY9A 1YP9A 1NC6A 1BMAA 1V2UT 1DLEA 1S0RA 1NROH 2J94A 2PFEA 1MAYA 1SHHB 1YPHC 1F7ZA 4NIWA 2H9TH 1GDUA 1CQQA 1L4DA 3VB3A 2WPJS 1YCPK 3Q00A 1MKWH 1WU1A 2PKSC 3M3VA 2FLBH 1ZRKA 1T7CA 1O5GH 1K1IA 4I8JA 1HAVA 2FESH 1ESBA 4DCDA 1AUJA 2AIQA 1O2PA 1P0SH 2BDHA 1BBRH 2BZ6H 2ODQA 1P03A 3ZZCA 5FAHA 2A1DB 4INKA 4Y10E 4IN1A 1QL9A 2GDEH 1FY3A 2ZCLP 3A8DA 1UTOA 7GCHG 8KME2 2Z7FE 1JBUH 5F8TA 4UD9H 2Z9IA 4BXSA 1RD3B 1GHXH 1YPLH 3BTFE 2GGVB 1S81A 1SOTA 1T8MA 1C4U2 2XCNA 3MH6A 1ZLRA 4NSYA 2XTTB 1Q3XA 1YM0A 4RKJB 1T8NA 4CRBA 3SI4H 1HUTH 1UK4A 3ATLA 4ISIH 3SV2H 3SQEE 2CF8H 3PWCA 1OP8A 3OSYA 1D9IA 1BA8B 1IHTH 3BTHE 1TNHA 1FJSA 1ZPBA 4Q7YA 5E0GA 5C5NA 2XBVA 2CHAC 3LJJA 1DXPA 2OUAA 7ESTE 1F0UA 2CJIA 3RMLH 1EKBB 3RXPA 3SV9A 1O2ZA 1AB9C 1IQLA 2JETB 1W7GH 2ZU5A 7KMEH 3VB5A 1LKAA 1O3KA 1MTNB 2H5CA 2A7JA 1C5UA 4U32A 2XRCA 1AZZA 2GP9B 3RXRA 1LO6A 3NKKA 3SN8A 2P8OB 1AO5A 2GCTC 2G5VA 1W11U 2FOBA 4UONA 2BVRH 2ZIQH 2HNTE 4Y0ZE 1THPB 1KLJH 1U6QA 4IS5A 1PYTC 5TCCA 3WY8A 1P8VC 3RXFA 4DY7B 1O5FH 1YC0A 1FIZA 2PSXA 1KXBA 3A80A 4ZHMU 1H1BA 3BN9A 1S83A 1ANBA 2FP7B 5FBIA 3T26A 1MH0A 1NZQH 4BTUB 3B23B 4X1PU 1BB0B 4K3JA 3BV9B 1V2MT 2VH0A 2BOHB 2F9OA 3BEFB 3NXPA 3RDZA 1WTHD 2O8LA 1P09A 3T28A 1K1LA 2J95A 4JZFH 1QJ1B 3A7XA 2FO9A 3M3SA 1G9IE 1ZTKA 2OC1A 1W13U 2VWNA 2GVFA 5HMAA 1O2TA 3SNAA 3KIDU 1TMTH 5DPAA 1BIOA 2XBYA 4WY3A 1O5AB 1X7AC 1ZPCA 1GBLA 2UUJB 1EJMA 1AVXA 1BBRK 3SU5A 1GHAG 4NCYA 3N7OA 5AVDA 2W3IA 1C5MD 4X8UH 2AGIX 2BOKA 3QGJA 1EPTB 3GCTF 2XYAA 1QR3E 1QA7A 4FUGA 3S0NA 2GV7A 1W12U 4YLQH 3P8FA 1P05A 1NM6A 1E34B 5GWZA 4Y8ZA 3SZNA 2RA0A 3ZVDA 1QJ7B 1UHBB 4UFDH 1W0ZU 2THFB 2YOLA 1KDQA 3R3GB 1O2JA 2Z9LA 4OS6A 5C1UA 1WV7H 4JK5A 2A5KA 3BTEE 1ZMNA 1D3QB 2ZU2A 4MDSA 3TNTA 2AEIH 3RXMA 1W2KH 1SFIA 1HJ9A 3M35A 4ZHLU 4MPWA 1QRXA 3A7TA 1HAYB 3U1IB 2WPKS 3BSQA 4B2BA 2Y5HA 3FP6E 1KXDA 1KXFA 3SO3A 1O36A 5L30H 1BZXE 1LKBA 4THNH 9ESTA 1O3IA 2ZPSA 3E1XB 4KTCA 4XOJA 3ENSB 1AGJA 4YO9A 4R0IA 3E90B 3SHAH 1AU8A 1YYY1 3S9CA 3BG4C 1ANEA 1P57B 1C1MA 1H9LB 2B7DH 3ESTA 4NFEA 4M7GA 1ELCA 4JYUH 2BLOA 1EAWA 1CHGA 1LPKB 2F9UA 1AMHA 4FUJA 5E2PA 2JH6D 4JK6A 5CMXH 5F8ZA 1IQFA 5HYOA 1OXGA 1SOZA 4F49A 3VGCB 2CGAA 3SGQE 2BY7X 2KAIB 1O3LA 1DVAH 4OS1A 1T8OA 2FTMA 4FUCA 8GCHG 4BAQB 1FN6A 1DWEH 2B9LA 1O2HA 1SGCA 1UO6A 1VR1H 2GKVE 1PQ7A 3SNEA 2QF0A 1IHSH 1TMBH 4NFFA 1MTVA 1Z8GA 1LVBA 2AGGX 2XWAA 2WPHS 5F03A 3LDXH 5CE1A 1G3EA 1K21H 2EI6A 3GCHC 3RXJA 1AHTH 1HAOH 1RTKA 1V2OT 3GY3A 4ZHAA 1C2JA 1GMHG 1VITG 2ZDAH 4YLUA 3GCHB 4Y8YA 4JCNA 3OY5U 1G32B 1Y59T 1O3FA 1EXFA 3QO6A 3A7YA 2RG3A 2V35A 1XXFA 3M5LA 4I7YH 3SW2B 1W3CA 3F6UH 4I8GA 1M9UA 4IC5A 4X1QU 1J15A 3PLKA 3S7KB 4TYDA 2Q6GA 4ABGA 3RU4D 2BZAA 4Q7XA 2ZGXH 2ZFRH 3QLPH 1HRTH 1PFXC 2V6NA 3LH1A 3TNSA 2QYIA 3VFEA 1W0YH 5EPNA 4ZKRU 4MNWA 5A8XA 2Q1JA 2A5AA 3AW0A 2GMTC 2Y7ZA 3F68H 1Y3XA 1DFPA 2SGDE 3HGPA 2ZECA 2BHGA 2OCVB 2Z3CA 1BCUH 1YLCA 2BY9X 2AMPA 1JXPA 2GMTB 3O8BA 4H4FA 4WWYA 4WH6A 2A45B 2ZFPH 1PPHE 1T8LA 4CH8B 3F9EA 1C5QA 3OU0A 1A0HB 4CRDA 3ATWA 2XCFA 2PKAB 1VJAU 1Z7KA 3Q77A 1GHBG 2WINI 3SQHE 1HXEH 1O2RA 1ANCA 1TNJA 1ZSLA 2XC0A 3MOCA 4JZDH 5K7RA 2FS8A 1S6FA 1O2LA 1AI8H 5IYTA 1C9PA 2A7HA 4UDWH 1BMLA 2ZZUH 1GVZA 4SGBE 3RC4A 1O3BA 1NT1A 3MFJA 1UTKA 3SJIA 5HM2A 1C5ZB 4GHQA 2ZCKP 2EC9H 1BTYA 3A7WA 1BTHH 4O03A 4A6LA 4X8VH 3SU4A 1SSXA 2BDYA 2NU3E 2FDAA 2GT8A 5A2MH 4CHAC 4BAHB 1NFYA 4AORA 1KIGH 2BTCE 1QBNA 1ZPZA 1CT0E 3MO3A 1N8OB 1TRYA 4CHAB 2BLWA 2FEQH 3TGKE 4Y8XA 3KHVA 1GI8B 1CU1A 1EZQA 3EGKH 2QXGA 3E16B 2GCHF 2QCYA 2A4QA 3MU5A 3QUMP 1CGIE 2Y80A 5EQRA 2BLQA 1GMDF 2HLCA 1C1QA 9LPRA 2PW8H 3UNQA 3OY6U 1C1TA 2YNAA 3RXAA 6GCHG 3GDVA 4DW2U 4QT8C 2CF9H 5E0HA 1XM1A 3PB1E 1GVLA 2G8TA 1S84A 3E6PH 3RMMH 4KKDA 3MYWA 4YZUA 1CE5A 1VZQH 3L33A 1ZZZA 3KCGH 1OWHA 1MKXH 2Y82A 1ELFA 1KXEA 2BY6X 1OS8A 4X1SU 1SR5C 1QRZA 3SNDA 1BJVA 1SQOA 4ZKSU 4FUIA 2BYAX 1GBEA 1C5VA 2A31A 1ZHMA 4OS5A 3UY9A 1O2MA 1KXAA 2WUBA 4D76A 3DUXH 1MBQA 2R3YA 5GIBA 4ABDA 3RMOH 1MU6B 3S9AA 1C2KA 5EXLA 3ODDA 4INHA 2ZQ2A 2GX4A 1GBBA 2R0KA 4JZIA 1BBRE 4KTSA 1CGHA 4XBCA 1Q31A 1DY8A 1D3TB 1ABJH 2ANYA 1GJ7B 4GVUA 3SBKA 3GY7A 2FS9A 3M7QA 2ALVA 1V6DA 1EB1H 1BTPA 1AVGH 4X2XA 1YBWA 1O3HA 4O9VA 1Z71A 3TU7H 1FNIA 2VIOA 5SGAE 2FMJA 2O8TA 2Q6DA 1P11E 1H4WA 1O37A 1TE0A 4Z0KA 1O2XA 2VWMA 1FY8E 1BHXB 3RU4T 3ZYEA 1V2PT 2ZFFH 1V2LT 3UPEA 4BTIB 3UNRA 1GJ8B 1AFQC 4O3UA 1QURH 4CBOA 4X0WU 1IOEA 1GDNA 3CS0A 1LQEA 5J4QA 4R8TB 3MWIU 1NFXA 4GLYA 1TPPA 1ZTJA 3MU8A 1FMGA 3DT0H 2AERH 3PMHB 4D9QA 2SGEE 3RXGA 1P2OA 1LHFH 2ZHDA 1UJ1A 1O5CB 3M61U 3ZZ6A 1DUAA 1A1RA 1TBRH 4MNYA 2LPRA 2XNIA 1EOJA 1FI8A 1NRPH 3PWBA 4Y7BA 3UWJH 3EA7A 1H9IE 1CBWC 4B2AA 1A46H 1CT4E 1AY6H 4NSVA 4BAMB 1ELBA 1GGDB 4UEHH 3LH3A 1VGCB 3UQVA 1YGCH 4VGCC 3ZZ7A 4YM9A 1FDPA 5C20A 1C2FA 1YPJH 3M37A 3NK8A 2QAAA 4Q2KA 3SUFA 4FUHA 2FXRA 3K2UA 1O31A 1CT2E 1PQ8A 3MU4A 2H1UA 4AFUA 1UVUH 1CHOG 1SGDE 3OX7U 4YTAA 4ZROA 1W10U 3LOXA 5A09A 1XUKA 1TOMH 4AGJA 2BD8A 3LC5A 4NWLA 1L1GA 2BVXH 4WMDA 1BJUA 4A5TS 3A8CA 3D65E 3M5MA 2Z9GA 3V0XA 2CMYA 1KXCA 1HCGA 4WH8A 1L2EA 2EEKA 2ODYB 1TAWA 1TRMA 2R2MB 1S82A 1SI5H 3U8TH 3UR9A 1GMCG 1TYNA 3ZZ3A 1TNKA 2PUXB 1ELTA 1WUNH 2BD2A 3ZZBA 3NCLA 3DD2H 3TGJE 5DJ7A 1OWDA 1J8AA 1EZSC 1G2MA 1IQMA 2O8MA 2P3FH 1GWAA 1P2QA 2A4GA 2W5EA 2BDBA 1H9HE 3UTUH 3SV7A 1LCYA 1WCZA 2IJOB 2PKSB 1HJAC 3SHCH 4YOJA 1IQGA 2H6MA 1ABIH 1JRTA 4X6MA 2J34A 1LVMA 1TQ7B 3HK6B 2Z9JA 2FOHA 1UVPA 1OSSA 2OINA 2C4FH 4BAOB 3BTTE 1GCTC 5JYIA 3FZZA 4FVBA 1FN8A 2P3UB 1QCPA 1O5EH 1K1OA 1LVYA 5DK1A 3RUOA 4BTTB 1MZAA 2Y7XA 2FX4A 4ABAA 1ELDE 1DPOA 2ZDLA 1MTSA 5C1XA 1G3BA 3E0PB 1WAYB 2VWLA 3NUMA 1O3DA 1ZMJA 3DFLA 3LJOA 1NFWA 2A4OA 1NESE 1MTUA 2BD9A 2IN2A 4HTCH 4FU9A 1GG6C 1OPHB 2AH4X 1LHGH 1QBOA 1EPTA 1HJ8A 1T4UH 2HPQH 1ETTH 3P92A 5HXFA 4GPGA 2CHAB 2F9PA 1UK2A 2AIPA 4JMYA 5EQSA 1GG6B 4K5ZA 1TA2A 3GYLB 1QNJA 1SB1H 1UHBA 2PTCE 3BTDE 4DVAU 2ANWA 1AKSB 1PJPA 1AB9B 2UWLA 2Z3DA 1CA0C 1P02A 3AW1A 1IQJA 1XUHA 1A4WH 3SV8A 3PLBA 1RTFB 5L2YH 1G2LA 2EI7A 1DX5M 4XSKU 3V12A 4X6OA 2GCTB 4WXVA 1GJDB 4MNVA 4ZXYH 1YPKH 1UTLM 3QX5H 1OP0A 2FWWA 2J9NA 1GBHA 3KQEA 1Y5BT 4GCHF 4MPVA 5EODA 2IOTA 1KY9A 2I6SA 2OC7A 2SNWA 3KQDA 1Z1JA 1Z8JB 2OLGA 1WYKA 1GBCA 4NA7A 1XUFA 1MKWK 4FU7A 2O8UA 3ZVGA 1OX1A 5TJXA 3VPKA 4AZ2B 4NG9H 3H5CB 5LPFA 2PV9B 2ZC9H 2ZI2H 3P95A 4IGDA 3TH3H 3BIVH 3NZIA 1QB6A 1PPFE 1GJ6A 2ZEBA 4JYTA 1P2KA 1A5HA 3TH4H 2K1QA 1Y3UA 2PGBB 1SLWB 1O35A 1UCYH 3SV6A 3RXKA 1SMFE 1TLDA 3SORA 4Y7AA 3ZZ9A 3UUZA 5ETXA 2KAIA 3URCA 1NU7B 5I25A 2BMGB 2D8WA 2GZ9A 4FU8A 4TWYA 3ZVCA 1JWTA 3FP7E 3OYPA 3GCTG 2TGDA 1C5PA 1NFUA 3BF6H 3BTGE 1TPOA 1E38B 1GI9B 1AIXH 1QRWA 2VIPA 3MU0A 1FY5A 3OTJE 2UUKB 4ZKNU 3MI4A 3PYHA 4LOYH 3TJNA 1EAIA 2PLXA 1GVKB 5GCHF 1HGTH 3TJVA 1PQ5A 1SBWA 3LKWA 1SGYE 3ATKA 4WF8A 3SU6A 2BD3A 4AG2A 1GHZA 2OBQA 2G4TA 3B8JA 1MQ5A 3P8OA 4Y6DA 3BTME 4RKOB 1DWBH 3SU0A 2F9BH 1PYTD 1O3NA 2HGTH 2QY0B 3QTVH 1O5BB 3BTWE 5E0JA 5EW2H 2BDIA 4WMFA 1P9SA 1XMNB 4GHTA 4WJG2 2FOCA 1A2CH 2OC8A 1HIAB 2BXUH 1O2GH 1ORFA 1DWDH 1F0TA 1WQVH 2G00A 1D6WA 3W95A 4CR5A 1Y3WA 3P8NA 1O32A 1T4VH 1QB9A 2EA3A 3QTOH 3CENA 5LGOA 2BDGA 1V2ST 2C8ZB 2W7SA 4AFQA 2ZDVH 1C5LH 1L1JA 2ZF0H 3A7ZA 1QY6A 4A1XA 1FLEE 3BG4B 5FPTA 2W26A 1BT7A 2OD3B 3SUDA 1TNIA 1C4V2 4JZ1A 1AUTC 7LPRA 2QC2A 1P06A 2R3UA 2BB4A 1MQ6A 2VH6A 5DO4H 2JH5D 4O3TA 4NGAH 5A0BA 2PKAA 1ZTLA 4ZMAH 1O2OA 2QA9E 5L2ZH 3V13A 1FPCH 1TPAE 2ZFSA 2ZA5A 4IW4E 1OWIA 1O3PB 1QQUA 1TGNA 3KQCA 1OP2A 5JBAS 2UWPA 2HOBA 4DIHH 2D26C 3MHWU 3LU9B 1BRBE 4AX9H 1UTNA 3SNCA 3RLWH 1EX3A 1HB0B 1TQ0B 2A32A 3LGIA 3P17H 4WVPE 2UWOA 3E8LA 1QFKH 1E35B 1W14U 1YCPM 1O3MA 1C5NH 2NU1E 1SLUB 5G4BA 3STJA 1P2MA 1SFQB 1ZOMA 1NS3A 3AAVA 3RXOA 1TNLA 2Y5FA 3PTNA 5H4IB 3DHKH 4YT6H 2ULLA 2BLVA 1BQYA 5FCRA 1GI3A 2ZPRA 2BX4A 4ZUHA 3UWIA 4U2WA 1TX7A 1GI1A 2B5TB 2G55A 4ISLA 4MVNA 1W7XH 2WPIS 3PMJA 1YPHE 6ESTA 3SJ8A 5EG4A 1RJXB 4UFGH 1A0LA 1ARBA 5CHAC 1YF4A 1KTTB 1THSH 1O3GA 3ITIA 1ETSH 1K1MA 5EXNA 3TLOA 2NU4E 4I8HA 5CHAB 4OS2A 2AS9A 4I33A 1HFDA 2BD4A 3KF2A 1ZSKA 3GY5A 2H5DA 1XX9A 4NIYA 3TITA 2J4IA 2ZFQH 3B9FH 2ZHQH 4RSPA 5AFZH 1O2QA 1JIMA 1EP6A 1TPSA 1ETRH 3UREA 3U8OH 3PMAB 1T31A 4IN2A 3QWCH 1BOQA 4CH2B 2GTBA 6LPRA 1A5GH 2GT7A 3SU3A 5LPEA 5FCKA 1C2EA 4B71A 3E0NB 4LZ4B 2HALA 3TJUA 1TGTA 2I6QA 3HKJB 4MLFB 5ESBA 3ZZ8A 4DIIH 1BRUP 1QJ6B 4GUXA 2ZFTA 3GY4A 3GY6A 3PTBA 4CRFA 5T6FA 4BANB 2W7UA 1IQEA 1C2DA 3IWMA 1YPMH 5DP7A 2Q6FA 1QTFA 2VB0A 4Y11E 1OWEA 1TGCA 4FUFA 5GXPA 4KP0A 1P01A 1ELVA 4Y0YE 2VINA 1Z6JH 4PROA 3RLYH 2FOGA 4BAKB 1D3PB 3PMBB 1UVOA 3E91A 1SGPE 4E05H 2DE8A 2VU8E 2PWXA 2HNTC 3QN7A 3SGAE 1C1UH 1UMAH 2HNTF 2F91A 3FP8E 3EAJA 2LNCA 5FX6A 2GCHG 3EQ0H 1YKTA 1GMDG 4UE7H 1ZSJA 3K65B 3VB7A 5DG6A 1EAUA 4MTBA 5A8ZA 4DOQA 1AE5A 1O2VA 1SGRE 2BVSH 4LK4A 3A8BA 3FZDA 1ZGVA 2F9VA 2BD5A 3EYDA 1G37A 3MO6A 2HVXA 2C8WB 1SHYA 3F9FA 2OBOA 1GHYH 3RXVA 3HPTB 2H9EH 2QGRA 1L1NA 2BDCA 1V2WT 1V2RT 2VVUA 1QQ4A 1Z8IB 1F0SA 4AB9A 5FXLA 1BTXA 2O8WA 1O2SA 4HI3A 1ELGA 1SG8B 3S7HB 1HPGA 3SJKA 3KN2A 3GDUA 3K6ZA 1RIWC 1SLXB 2TGTA 4NZQA 2VGCC 1PPGE 3ZZAA 3QDZB 3U1JB 1OYQA 1HYLA 3GY8A 1RIWB 3UIRA 3ELAH 2ZU1A 3Q76A 1GL0E 2XBXA 1O2YA 5EW1H 2GZ7A 2ZU4A 3M36A 5DP4A 5GPIB 4LZ1H 1SL3A 1EJAA 3G01A 3U69H 4X2YA 3DA9B 3LGUA 3BEUA 3BEIB 3O8RA 1SGFG 1TALA 4NWKA 1NN6A 3RXBA 5EOKA 4MPXA 1DOJA 4K69A 2VIDA 1DSUA 3HKIB 3KEEA 4H6TA 5FHTA 3E3TA 1THRH 4SGAE 4FXGH 1V2TT 1GJCB 3EA9A 3RXDA 3F1SB 1YCPH 4TPYA 1Z6EA 3P70B 2V3OH 1AFQB 4JZEH 2P16A 4D7FA 3D62A 3GOVB 2BY5X 2FYQA 3RM0H 4A92A 1GBDA 2WV5A 2GDDA 1NRNH 2BX3A 1BDAA 3MO9A 1FZZA 1Q2WA 3GCOA 1EQ9A 1GJ5H 3C1KA 1DLKB 4KELA 1CSOE 2RCEA 4ABBA 3RXIA 2SNVA 4Z6AH 5FPSA 1E0FD 4MG3A 2G52A 1G3DA 3GCNA 2ZG0H 1EZUC 2RDLA 3JZ2B 3ATMA 1BUIA 3SJ9A 2BQ6B 4I8LA 1CBWB 8ESTE 4KGAA 1ZRBA 2R2WU 5DGJA 5IDKA 3GISB 4MQAA 5GDSH 1N6XA 3DFJA 1FY1A 3T29A 1FAXA 3RXEA 2FI4E 1GBIA 2F9NA 2ZGCA 4VGCB 2PR3A 2ZCHP 1H8DH 4K2YA 6CHAC 3K9XB 1GBJA 4NA8A 1MKXK 5K0HA 1Y5AT 1V2JT 2QXHA 2ZP0H 3LIWA 3L6PA 4HZHA 1AWFH 1O0DH 3PO1C 1LTOA 2AFQB 1LHCH 4E7RG 4IMZA 1C5RA 3ZVAA 4B1TA 1HXFH 3RXQA 2C8YB 1PPZA 2VVVA 1HAHH 3SI3H 3ZYDA 1O3JA 1O2UA 3RC6A 4DG4A 1EUFA 2Z6BD 1MUEB 5ESTE 4J1YA 1ANDA 4B75A 1Y3YA 3LC3A 1AZ8A 2FI5E 2P3TB 1O34A 1LMWB 2PHBA 2ZWLH 5F6MA 1AKSA 1TGSZ 1G36A 1DSTA 4K1EA 2FOFA 1C5WB 1GDQA 1FUJA 2TBSA 1OYTH 1UK3A 2ZHEH 1DUEA 2OQ5A 1EB2A 1DANH 1TX8A 3ZZDA 2PTNA 1YPEH 1C1WH 1O38A 2ESTE 3S69A 2VIWA 4ZH8A 1KLTA 2AMDA 1SQAA 1PPCE 4ZKOU 1LVOA 1HJAB 4INLA 3M3TA 2SGQE 1FPHH 3GICB 2BDAA 2FOEA 1A3EH 5J4SA 2ILNA 4DJZB 1LPGB 1S85A 1OWJA 1SLVB 4FUBA 1MMJN 1P2NA 1SC8U 2ZGJA 4TY6A 4X2VA 2ZNKH 7GCHF 2CXVA 3UQOA 4XBBA 2XC4A 4CRCA 1EASA 1WSSH 1JMOH 3QZRA 1GCTB 1FAKH 3CS7A 5AFYH 3SUEA 2B8OH 2FOMB 1GJ9B 3NWUA 1D6RA 1YPGH 3NPSA 1HAPH 4B76A 4OGXA 5B6OA 3H7TA 1TBQH 1V2QT 3ODFA 5JBCS 4IC6A 4AGKA 2PSYA 2DUCA 1NPMA 2ZQ1A 4TY7A 5EXMA 1A3BH 1NRRH 5C67A 2AGEX 2CN0H 4IMQA 1NRQH 3RXSA 3ZV9A 3A84A 5E2OA 3A81A 1IAUA 3I78A 5DP8A 1W8BH 1O3AA 2A5IA 3UNSA 4XE4A 1ZHRA 1C2HA 4I32A 2JETC 2ZKSA 4ABEA 2P59A 4K60A 4X6PA 1MTNC 1CA0B 1J16A 3RXTA 1DDJA 1C2MA 4ASHA 1GI6A 4X1RU 3RC5A 1C5TA 3BG8A 4ISOA 4A1TA 1DT2A 2P8OC 2VNTA 3ZZ5A 2D2DA 2V3HH 1LQDB 4ABHA 1WOFA 3BTKE 3MTYA 2PUQH 4J2YB 4UFFH 2P93A 1C1OA 3TGIE 3MU1A 1HAVB 4YT7H 3LONA 4GSOA 4NA9H 1TOCB 2A2QH 3FANA 1HIAA 1OOKB 4LXBH 1SGNE 3I29A 4ESTE 4GCHG 1XUIA 3T2NA 2FYRA 1ZR0A 1F5KU 1JIRA 1FY4A 3FFGA 2ZHFH 1B0EA 1DWCH 1HAXB 2A2XH 2W3KA 4I8KA 1YLDA 3BTQE 2ZDNA 3IITA 3A87A 3EE0B 3QZQA 1B7XB 3U8RH 2OC0A 2P94A 2ASUB 2TIOA 2Y5GA 3PLPA 4Y79A 1ZJDA 1GHAF 1VITH 4F4OC 2IPHA 3SJOA 1O2IA 4X1NU 5AF9H 2YNBA 3GYMA 1AD8H 2XBWA 2WV4A 2Z9KA 1DXWA 3RM2H 4YESB 1K9OE 4HGCA 4D9RA 1TB6H 2SGAA 1J14A 1WTGH 1EPTC 3ZZ4A 1L0ZA 2GD4B 4WMEA 1XUJA 1XUGA 1K1JA 2QXJA 2C90B 5LH8A 3CP7A 4Y76A 1MCTA 2VVCA 3D23A 1HBTH 1T32A 2ANMH 3KNXA 4U30A 1FXYA 1Z1IA 1QHRB 4AN7A 5EGMA 2BM2A 3TH2H 1TMUH 1TONA 5L6NH 3O8CA 1VCWA 1CGJE 2FIRH 3LGYA 5EQQA 3HGNA 1IQHA 5GCHG 2R9PA 3ZVEA 3MNSA 3IG6B 1AN1E 1MBMA 5HM9A 1TGBA 1BITA 2Y81A 4E7NA 1RTLA 4ABJA 2OTVA 5C2ZA 1GI5A 4H42U 1GBAA 1RFNA 3LGVA 2M5TA 5C1YA 2VIVA 3T62A 1MTWA 2G51A 1F0RA 1UTMA 1ELEE 2VWOA 1MU8B 2FLRH 1O30A 3ZV8A 3U9AH 3FVFB 3URDA 4ABIA 4BOHA 5PTPA 2ZTXA 2J2UA 1A0JA 4GAWA 4MPUA 2ZGBH 1EJNA 1ID5H 1INCA 1K1PA 5AHGH 2FTLE 2BQ7B 2C93B 1QL8A 2ODPA 3LT3A 1GPZA 1ZHPA 2Y6TA 1PPBH 1K28D 4OS4A 3TK6A 1PPEE 2XW9A 4OGYA 4DT7B 5A8YA 1RS0A 8GCHF 2TGPZ 4X8TH 3VB6A 3VGCC 1GJ4H 1GBFA 1BTZA 3TJOA 1D4PB 1C1VH 4CREA 1C4Y2 4Q7ZA 3UFAA 4A7IB 3A83A 1F5RA 3ZVBA 1O33A 4FUEA 3Q3XA 2TPIZ
chains in the Genus database with same CATH superfamily
2ZHWH 2GV6A 3PV5A 3PV4A 2QV1A 1K22H 5JDUB 1C5OH 1OKXA 1UCYK 2H2ZA 4DGJA 1FQ3A 1KDQB 1BRAA 3M5NA 1ESTA 3T5FH 1GMHF 3BIUH 3MMGA 1VITF 1RRKA 4K8YA 1UTPA 4X2WA 1EATA 2WYJA 4FUDA 5JBBS 2GZ8A 2H9HA 1GI7B 1QA0A 2KCYA 1QB1A 2CV3A 4I31A 2F3CE 3GY2A 4XBDA 4CR9A 1S0QA 4CRGA 3M7UA 4XFQA 3QGNB 5C5OA 1GHVH 5C0TA 1N6YA 2BD7A 2FODA 5DKMA 5T1VA 5DP9A 2HPPH 4B73A 1JOUB 2R0LA 5ABWA 4D7GA 5DP3A 4DURA 3MH7A 3TVJB 2B0FA 1XXDA 4CBNA 1EFRD 1N1LA 2O9QA 1NU9A 2K8IA 1HAZB 1YWUA 3RXHA 4XDEA 4AYVB 1O2WA 2DE9A 1H8IH 3VXEH 5KECA 3EDXB 1SGQE 1UTQA 3VXFH 4KTUA 3MH5A 1Y8TA 4K8BA 1GHBF 1IQIA 1P04A 4NZLA 4TWWA 1SGEE 1FV9A 1HNEE 4K1SA 2A4RA 3AASA 4AFSA 1ARCA 3A82A 1O3CA 3FKSD 1E37B 2QF3A 1WBGB 3O8DA 4H6SB 2NWNA 2C3SA 2A7CA 1Y5UT 1ELAA 3KL6A 2YMSC 4BNRA 4P02A 2FPZA 3P6ZB 1F92A 1GL1A 4ISNA 4AFZA 1E36B 3AVZA 3TIUA 2V0BA 2Z3EA 2BXTH 2ALPA 1ZYOA 2FX6A 1MCVA 4ABFA 2FZZA 5LPRA 3F0PA 3EA8A 5FPYA 5FX5A 2C8XB 1MD7A 1O39A 3QK1A 1ACBE 1RGQA 2ZO3H 2ZU3A 2NU2E 2TRMA 8LPRA 1Z8RA 3RXCA 2TGAA 1BTWA 2ZDMA 5FBEA 1SGFA 2ZDKA 3PROA 2HWLB 1QBVH 1DE7H 5JPMH 1O2NA 3MH4A 3W94A 1N8OC 1FX0B 1GI0A 5E8EH 2ZTZA 4TPIZ 3VEQB 3MNBA 4NIVA 3LGTA 1A5IA 1IQNA 3MNXA 1F5LA 2SFAA 1C9TA 1BRCE 5BPEA 1A7SA 6GCHF 5IK2D 1KLIH 1GCDA 3SNBA 3SU1A 1Y3VA 1COWD 2WPLS 4YOIA 3K6YA 1V2NT 4AG1A 1XKAC 3RP2A 1F2SE 1O5DH 4RN6A 3JZ1B 2ZGHA 5DP5A 1ESAA 4Y71A 4IBLH 2FM2A 2UUFB 4A1VA 1J17T 1NO9H 1SGIB 1GBTA 1GI4A 1O3OA 3A88A 1KMHB 1RXPA 1EZXC 3LGWA 2KCAA 1QIXB 3U98H 3T27A 4D8NA 3RMNH 2A0QB 2UUYA 1FONA 2ZPQA 5T6DA 5JB9S 1TABE 1HAIH 3L3TA 2WZQA 1VCPA 3UOPA 4Q80A 4HFPB 4AYYB 3F9GA 1XKBC 3UOUA 1K2I1 1AFEH 4UFEH 1P3CA 2J38A 1AWHB 3M5OA 4ISHH 2STAE 1TA6A 2OQUA 3SU2A 3MNCA 3SGBE 1EOLA 1P10A 2J92A 1UVSH 1IQKA 4WXIA 2VGCB 3P8GA 1GI2A 3HK3B 2VIQA 1NTPA 1WQSA 1KTSB 4Q4LA 4ZXXH 1EAXA 1S6HA 4AB8A 1C5SA 1P9UA 1MZDA 3AAUA 3TK9A 1FIWA 1C1SA 3PM3A 1LHEH 1DITH 1LPZB 3F9HA 2EI8A 1SGTA 3UR6A 1B5GH 1AE8H 4YOGA 1BMNH 1TIOA 1TX6A 1D3DB 3KQ5A 1ZJKA 1SPJA 2AYWA 1P3EA 1AVWA 3I77A 4BXWA 3V3MA 1BMMH 1L4ZA 1QGFA 1C5YB 2WYGA 2RA3A 2PGQB 1KSNA 3Q3YA 5BRRE 5T6GA 4X8SH 1VJ9U 1P2IA 3A7VA 1V3XA 1BHXF 2SGFE 4B74A 3V7TA 2G81E 1DS2E 2FOAA 3C27B 3S9BA 1C1NA 2AMQA 2IJD1 1ZGIA 2BY8X 1GJAB 1DM4B 2WSSD 3R0FA 5EPYA 4CRAA 3ZVFA 2JH0D 5EJZA 3SOSA 1GBKA 1DICA 1HLTH 2STBE 2XC5A 1NY22 2G4UA 3KGPA 1XVOA 1K1NA 1HDTH 1JRSA 1LHDH 3SZEA 1GHWH 1J9CH 1NRSH 2QXIA 4FVDA 3A89A 2D1JA 1OWKA 2ZTYA 4MNXA 5F8XA 3RU4E 3Q3KA 1HAGE 1SVPA 1VCQA 2G5NA 3A8AA 1PQAA 1A61H 5JB8S 1P2JA 1GBMA 2Z94A 5TCAA 1ZMLA 4ZAEA 4F48B 2QN5T 3LPRA 2FI3E 3D49H 1GGDC 1O2KA 3T25A 3TK5A 5A0CA 3FN8A 1VGCC 1XVMA 2OP9A 3A85A 2OXSA 1TWXB 3H7OA 5JBTA 1S5SA 1V2KT 1CVWH 1G3CA 1CHOF 3VB4A 3FAOA 1MD8A 2WUCA 4K1TA 5C3NA 2VJ1A 6CHAB 2L74A 2NU0E 1GJBB 2XXLA 3GDSA 3HATH 4OS7A 2WPMS 5I46H 1EP5A 1C2LA 5GJ4B 1TFXA 1WXRA 1TNGA 1KYNA 1UVTH 2ANKH 1C1PA 1CA8B 1G30B 3PO1B 2J5UA 3STIA 3TPIZ 1C5XB 1C2GA 1LDTT 3A86A 4JYVH 1C1RA 4X6NA 1TRNA 4NIXA 1P12E 1HV7A 1BMFD 1O3EA 1V2VT 2QE7D 1C2IA 1CO7E 1AQ7A 5DP6A 2GJGA 2BQWB 5EU8A 1UCYE 1MAXA 3ATIA 3RXLA 3RXUA 5A0AE 2EQNA 2QIQA 2SGPE 3KQBA 5T3HA 3SUGA 4E06H 2JKHA 2P95A 1GMCF 1QL7A 1NBMD 1SQTA 1B0FA 4AOQA 4U01A 5HGGA 2XWBI 2F83A 4O97A 2HRVA 4ACBA 1BTUA 1UTJA 1TBZH 3M7TA 4B2CA 2RFKC 1DY9A 1YP9A 1NC6A 1BMAA 1V2UT 1DLEA 1E1RD 1S0RA 1NROH 2J94A 3PRBA 2PFEA 1MAYA 1SHHB 1YPHC 1F7ZA 4NIWA 2H9TH 1GDUA 1CQQA 1L4DA 3VB3A 2WPJS 1YCPK 3Q00A 1MKWH 1WU1A 2PKSC 3M3VA 5KEDA 2WV9A 2FLBH 1ZRKA 1T7CA 1O5GH 1K1IA 4I8JA 1HAVA 2FESH 1ESBA 4DCDA 1AUJA 2AIQA 1O2PA 1P0SH 2BDHA 1BBRH 2BZ6H 2ODQA 1P03A 4ZCNA 3ZZCA 5FAHA 2A1DB 4INKA 4Y10E 4IN1A 1QL9A 2OK5A 2RDEA 2GDEH 1FY3A 2ZCLP 3A8DA 1UTOA 7GCHG 8KME2 2Z7FE 1JBUH 5F8TA 4UD9H 2Z9IA 4BXSA 1RD3B 1GHXH 1YPLH 3BTFE 2GGVB 1S81A 1SOTA 1T8MA 1C4U2 2XCNA 3MH6A 2JDID 1ZLRA 4NSYA 2XTTB 1Q3XA 1YM0A 4RKJB 1T8NA 4CRBA 3SI4H 1HUTH 1UK4A 3ATLA 4ISIH 3SV2H 3SQEE 2CF8H 3PWCA 1OP8A 3OSYA 1D9IA 1BA8B 1IHTH 3BTHE 5B6LA 1TNHA 1FJSA 1ZPBA 4Q7YA 4ACAA 5E0GA 5C5NA 2XBVA 2CHAC 2XNDD 3LJJA 1DXPA 2OUAA 7ESTE 1F0UA 2CJIA 3RMLH 1EKBB 3RXPA 3SV9A 1O2ZA 1AB9C 1IQLA 2JETB 1W7GH 2ZU5A 7KMEH 3VB5A 1LKAA 1O3KA 1MTNB 2H5CA 2A7JA 1C5UA 4U32A 2XRCA 1AZZA 2GP9B 3RXRA 1LO6A 3NKKA 3SN8A 2P8OB 1AO5A 2GCTC 2G5VA 1W11U 2FOBA 4UONA 2BVRH 2ZIQH 2HNTE 4Y0ZE 1THPB 1KLJH 1U6QA 4IS5A 1PYTC 5TCCA 3WY8A 1P8VC 3RXFA 4DY7B 1O5FH 1YC0A 1FIZA 2PSXA 2LELA 1KXBA 3A80A 4ZHMU 1H1BA 3BN9A 1S83A 1ANBA 2FP7B 5FBIA 3T26A 1MH0A 1NZQH 4BTUB 3B23B 4X1PU 1BB0B 4K3JA 3BV9B 2M2AA 5HIZA 1V2MT 2VH0A 2BOHB 2F9OA 3BEFB 3NXPA 3RDZA 1WTHD 2O8LA 1P09A 3T28A 1K1LA 2J95A 4JZFH 1QJ1B 3A7XA 2FO9A 3M3SA 1G9IE 1ZTKA 2OC1A 1W13U 2VWNA 2F4LA 2GVFA 1O2TA 3SNAA 3KIDU 1TMTH 5DPAA 1BIOA 2XBYA 4WY3A 1O5AB 1X7AC 1ZPCA 1GBLA 2UUJB 1EJMA 1AVXA 1BBRK 3SU5A 1GHAG 4NCYA 3N7OA 5AVDA 2W3IA 1C5MD 4X8UH 2AGIX 2BOKA 2J98A 3QGJA 1EPTB 3GCTF 4F55A 2XYAA 1QR3E 1QA7A 3OTPA 4FUGA 3S0NA 2GV7A 1W12U 4YLQH 3P8FA 1P05A 1NM6A 1E34B 5GWZA 4Y8ZA 3SZNA 2RA0A 3ZVDA 1QJ7B 1UHBB 4UFDH 1W0ZU 2THFB 2YOLA 1KDQA 3R3GB 1O2JA 2Z9LA 4OS6A 5C1UA 1WV7H 4JK5A 2A5KA 3BTEE 1ZMNA 1D3QB 2ZU2A 4MDSA 3TNTA 2AEIH 3RXMA 1W2KH 3WWBA 1SFIA 1HJ9A 3M35A 4ZHLU 4MPWA 1QRXA 3A7TA 1HAYB 3U1IB 2WPKS 3BSQA 4B2BA 2Y5HA 3FP6E 1KXDA 1KXFA 3SO3A 1O36A 5L30H 1BZXE 1LKBA 4THNH 9ESTA 1O3IA 2ZPSA 1QZ8A 3E1XB 4KTCA 4XOJA 3ENSB 1AGJA 4YO9A 4R0IA 3E90B 3SHAH 1AU8A 1YYY1 3S9CA 3BG4C 1ANEA 1P57B 1C1MA 1H9LB 2B7DH 3ESTA 4NFEA 4M7GA 1ELCA 4JYUH 2BLOA 1EAWA 1CHGA 1LPKB 3PRDA 2F9UA 1AMHA 3F3BA 4FUJA 5E2PA 2JH6D 4JK6A 5CMXH 5F8ZA 1IQFA 5HYOA 1OXGA 1SOZA 4F49A 3VGCB 2KCOA 2CGAA 3SGQE 2BY7X 2KAIB 1O3LA 1DVAH 4OS1A 1T8OA 2FTMA 4FUCA 8GCHG 5CHBA 1FN6A 4BAQB 1DWEH 2B9LA 1O2HA 1SGCA 1UO6A 1VR1H 2GKVE 1PQ7A 3SNEA 2QF0A 1IHSH 1TMBH 4NFFA 1MTVA 1Z8GA 3EE7A 1LVBA 2AGGX 2XWAA 2WPHS 5F03A 3LDXH 5CE1A 1G3EA 1K21H 4FETA 2EI6A 3F0OA 3GCHC 3RXJA 1AHTH 1HAOH 1E79D 1RTKA 1V2OT 3GY3A 4ZHAA 1C2JA 1GMHG 1VITG 2ZDAH 4YLUA 3GCHB 4Y8YA 4JCNA 3OY5U 1G32B 1Y59T 1O3FA 1EXFA 4OM9A 3QO6A 3OEED 3A7YA 2RG3A 2V35A 1XXFA 3M5LA 4I7YH 3SW2B 1W3CA 3F6UH 4I8GA 1M9UA 4IC5A 4X1QU 1J15A 3PLKA 3S7KB 4TYDA 2Q6GA 4ABGA 3RU4D 2BZAA 4Q7XA 2ZGXH 2ZFRH 3QLPH 1HRTH 1PFXC 2V6NA 3LH1A 3TNSA 2QYIA 3VFEA 1W0YH 5EPNA 4ZKRU 4MNWA 5A8XA 2Q1JA 2A5AA 3AW0A 2GMTC 2Y7ZA 3F68H 1Y3XA 1DFPA 2SGDE 3HGPA 2ZECA 1E1QD 2BHGA 2OCVB 2Z3CA 1BCUH 1YLCA 2BY9X 2AMPA 1JXPA 2GMTB 3O8BA 4H4FA 4WWYA 4WH6A 2A45B 2ZFPH 3DCLA 1PPHE 1T8LA 4CH8B 3F9EA 1C5QA 3OU0A 1A0HB 4CRDA 3ATWA 2XCFA 2PKAB 1VJAU 2F43B 1Z7KA 3Q77A 1GHBG 2WINI 3SQHE 1HXEH 1O2RA 1ANCA 1TNJA 1ZSLA 2XC0A 3MOCA 4JZDH 5K7RA 1YY3A 5KGOA 2FS8A 2YMSB 1S6FA 1O2LA 1AI8H 5IYTA 1C9PA 2A7HA 4UDWH 1BMLA 2EY4C 2ZZUH 1GVZA 4SGBE 3RC4A 1O3BA 1NT1A 3MFJA 1UTKA 3SJIA 5HM2A 1C5ZB 4GHQA 2ZCKP 2EC9H 1BTYA 3A7WA 1BTHH 4O03A 2JJ2D 4A6LA 4X8VH 3SU4A 1SSXA 2BDYA 2NU3E 2FDAA 2GT8A 5A2MH 4CHAC 4BAHB 1NFYA 4AORA 1KIGH 2BTCE 1QBNA 1ZPZA 1CT0E 5F53A 3MO3A 1N8OB 1TRYA 4CHAB 2BLWA 2FEQH 3TGKE 4Y8XA 3KHVA 1GI8B 1CU1A 1EZQA 3EGKH 2QXGA 3E16B 2GCHF 2QCYA 3F2GA 2A4QA 3MU5A 3QUMP 1CGIE 2Y80A 5EQRA 2BLQA 1GMDF 2HLCA 1C1QA 9LPRA 2PW8H 3UNQA 2QF5A 3OY6U 1C1TA 2YNAA 3RXAA 6GCHG 3GDVA 4DW2U 4QT8C 2CF9H 5E0HA 1XM1A 3PB1E 1GVLA 2G8TA 2AHME 1S84A 3E6PH 3RMMH 2PP6A 4KKDA 3MYWA 4YZUA 1CE5A 1VZQH 3L33A 1ZZZA 3KCGH 1OWHA 1MKXH 2Y82A 1ELFA 1KXEA 2BY6X 1OS8A 4X1SU 1SR5C 1QRZA 3SNDA 1BJVA 1SQOA 4ZKSU 4FUIA 2BYAX 2A31A 1C5VA 1GBEA 1ZHMA 4OS5A 3UY9A 1O2MA 1KXAA 2WUBA 4D76A 3DUXH 1MBQA 2R3YA 5GIBA 4ABDA 3RMOH 1MU6B 3S9AA 1C2KA 5EXLA 3ODDA 4INHA 2ZQ2A 4M9FA 4YXWD 2GX4A 1GBBA 2R0KA 4JZIA 1BBRE 4KTSA 1CGHA 4XBCA 1Q31A 1DY8A 1D3TB 1ABJH 2ANYA 1GJ7B 4GVUA 3SBKA 3GY7A 2FS9A 3M7QA 2ALVA 3PV2A 1V6DA 1EB1H 1BTPA 1AVGH 4X2XA 1YBWA 1O3HA 4O9VA 1Z71A 3TU7H 1FNIA 2VIOA 5SGAE 2FMJA 2KM0A 2O8TA 2Q6DA 1P11E 1H4WA 1O37A 1TE0A 4Z0KA 1O2XA 2VWMA 1FY8E 1BHXB 3RU4T 3ZYEA 1V2PT 2ZFFH 1V2LT 3UPEA 4BTIB 3UNRA 1GJ8B 1AFQC 1UW7A 2QF4A 4O3UA 1QURH 4CBOA 4X0WU 1IOEA 1GDNA 3CS0A 1LQEA 5J4QA 4R8TB 3MWIU 1NFXA 4GLYA 1TPPA 1ZTJA 3MU8A 1FMGA 3DT0H 2AERH 3PMHB 4D9QA 2SGEE 3RXGA 1P2OA 5GNDA 1LHFH 2ZHDA 1UJ1A 1O5CB 3M61U 3ZZ6A 1DUAA 1A1RA 1TBRH 4MNYA 2LPRA 2K0QA 2XNIA 1EOJA 1FI8A 1NRPH 3PWBA 4Y7BA 3UWJH 3EA7A 1H9IE 5HIYA 1CBWC 4B2AA 1A46H 1CT4E 1AY6H 4NSVA 4BAMB 3FOAA 1ELBA 1GGDB 4UEHH 3LH3A 1VGCB 3UQVA 1YGCH 4VGCC 3ZZ7A 4YM9A 1FDPA 2JIZD 1C2FA 1YPJH 2W6JD 3M37A 2QAAA 3NK8A 4Q2KA 4FUHA 2FXRA 3K2UA 3SUFA 1O31A 1CT2E 1PQ8A 3MU4A 1OHHD 2H1UA 4AFUA 1UVUH 1CHOG 3OEHD 1SGDE 3OX7U 4YTAA 4ZROA 1W10U 3LOXA 5A09A 1XUKA 1TOMH 4AGJA 2BD8A 3LC5A 4NWLA 1L1GA 2BVXH 4WMDA 1BJUA 4A5TS 3A8CA 3D65E 2KX4A 3M5MA 2Z9GA 3V0XA 2CMYA 3WW7A 1KXCA 1HCGA 4WH8A 1L2EA 2EEKA 2ODYB 1TAWA 3DSOA 1TRMA 2R2MB 1S82A 1SI5H 3U8TH 3UR9A 1GMCG 1TYNA 3ZZ3A 1TNKA 2PUXB 1ELTA 1WUNH 2BD2A 3ZZBA 3NCLA 3DD2H 3TGJE 5DJ7A 1OWDA 1J8AA 1EZSC 1G2MA 1IQMA 2O8MA 2P3FH 1GWAA 1P2QA 2A4GA 2W5EA 2BDBA 1H9HE 3UTUH 3SV7A 1LCYA 1WCZA 2IJOB 2PKSB 1HJAC 3SHCH 4YOJA 1IQGA 2H6MA 1ABIH 1JRTA 4X6MA 2J34A 1LVMA 1TQ7B 3HK6B 2Z9JA 3UAIC 2FOHA 1UVPA 1OSSA 4P00A 2OINA 2C4FH 4BAOB 3BTTE 1GCTC 5JYIA 3FZZA 4FVBA 1FN8A 2P3UB 1QCPA 1O5EH 1K1OA 1LVYA 5DK1A 3RUOA 4BTTB 3AK5A 1MZAA 2Y7XA 2FX4A 4ABAA 3F2FA 1ELDE 1DPOA 2ZDLA 1MTSA 5C1XA 1G3BA 3E0PB 1WAYB 2VWLA 3NUMA 1O3DA 1ZMJA 3DFLA 3LJOA 1NFWA 2A4OA 1NESE 1MTUA 2BD9A 2IN2A 4HTCH 4FU9A 1GG6C 1OPHB 2AH4X 1LHGH 1QBOA 1EPTA 1HJ8A 1T4UH 2HPQH 1ETTH 3P92A 5HXFA 4GPGA 2CHAB 2F9PA 1UK2A 2AIPA 4JMYA 5EQSA 1GG6B 4K5ZA 1TA2A 3GYLB 1QNJA 1SB1H 1UHBA 2PTCE 3BTDE 3H09A 4DVAU 2ANWA 1AKSB 1PJPA 1AB9B 2UWLA 2Z3DA 1CA0C 1P02A 3AW1A 1IQJA 1XUHA 1A4WH 5C17A 3SV8A 3PLBA 1RTFB 5L2YH 1G2LA 2EI7A 1DX5M 4XSKU 3V12A 4X6OA 2GCTB 4WXVA 1GJDB 4MNVA 4ZXYH 1YPKH 3ZIAD 1WDIA 2WPDD 1UTLM 3QX5H 2L6OA 1OP0A 2FWWA 2J9NA 2J97A 3N7DA 1GBHA 3KQEA 1Y5BT 4GCHF 4MPVA 5EODA 2IOTA 1KY9A 5C94A 2I6SA 2OC7A 2SNWA 4HG6A 3KQDA 1Z1JA 1Z8JB 2OLGA 1WYKA 1GBCA 4NA7A 1XUFA 1MKWK 4FU7A 2O8UA 3ZVGA 1OX1A 5TJXA 3VPKA 4AZ2B 4NG9H 3H5CB 5LPFA 2PV9B 2ZC9H 2ZI2H 3P95A 4IGDA 3TH3H 3BIVH 3NZIA 1QB6A 1PPFE 5C20A 1GJ6A 2ZEBA 4JYTA 1P2KA 1A5HA 3TH4H 2K1QA 4RT1A 1Y3UA 2PGBB 1SLWB 2KCPA 1O35A 1UCYH 3SV6A 3RXKA 1SMFE 1TLDA 3SORA 4Y7AA 3ZZ9A 3UUZA 5ETXA 2KAIA 3URCA 1NU7B 5I25A 2BMGB 2D8WA 2GZ9A 4FU8A 4TWYA 3ZVCA 1JWTA 3OFND 3FP7E 3OYPA 3GCTG 2TGDA 1C5PA 1NFUA 3BF6H 3BTGE 1TPOA 1E38B 1GI9B 1AIXH 1QRWA 4I86A 2VIPA 3MU0A 1FY5A 3OTJE 2UUKB 5DSFA 3MI4A 4ZKNU 3PYHA 4LOYH 3TJNA 1EAIA 2PLXA 1GVKB 5GCHF 1HGTH 3TJVA 1PQ5A 1SBWA 3LKWA 1SGYE 3ATKA 4WF8A 3SU6A 2BD3A 4AG2A 1GHZA 2OBQA 2G4TA 3B8JA 1MQ5A 4FOUC 3P8OA 4Y6DA 2IPQX 3BTME 4RKOB 1DWBH 3SU0A 2F9BH 4DT4A 1PYTD 1O3NA 2HGTH 2QY0B 3QTVH 1O5BB 3BTWE 5E0JA 5EW2H 3N7EA 2BDIA 4WMFA 1P9SA 1XMNB 4GHTA 4WJG2 2FOCA 1A2CH 1HIAB 2OC8A 2BXUH 1O2GH 1ORFA 1DWDH 1F0TA 1WQVH 2G00A 1D6WA 3W95A 4CR5A 1Y3WA 3P8NA 1O32A 1T4VH 1QB9A 2EA3A 3QTOH 3SYJA 3CENA 5LGOA 2BDGA 1V2ST 2C8ZB 2W7SA 4AFQA 2ZDVH 1C5LH 1L1JA 2ZF0H 3A7ZA 1QY6A 4A1XA 1FLEE 3BG4B 5FPTA 2W26A 1BT7A 2OD3B 3SUDA 1TNIA 1C4V2 4JZ1A 1AUTC 7LPRA 1H8ED 2QC2A 1P06A 2R3UA 3N99A 2BB4A 1MQ6A 2VH6A 5DO4H 5EIYA 2JH5D 4O3TA 4NGAH 5A0BA 2PKAA 1ZTLA 4ZMAH 1O2OA 2QA9E 5L2ZH 3V13A 1FPCH 1TPAE 2ZFSA 2ZA5A 4IW4E 3F2HA 1OWIA 1O3PB 3OE7D 1QQUA 1TGNA 3KQCA 1OP2A 5JBAS 2UWPA 2HOBA 4DIHH 2D26C 1YLNA 2LP6A 3LU9B 3MHWU 3UB0A 1BRBE 4AX9H 1UTNA 2KFWA 3SNCA 3RLWH 1EX3A 1HB0B 1TQ0B 2A32A 3LGIA 3P17H 4WVPE 2UWOA 3E8LA 1QFKH 1E35B 1W14U 1YCPM 1O3MA 1C5NH 2NU1E 1SLUB 5G4BA 3STJA 1P2MA 1SFQB 1ZOMA 1NS3A 3AAVA 3RXOA 1TNLA 2Y5FA 3PTNA 5H4IB 3DHKH 4YT6H 2ULLA 2BLVA 1BQYA 5FCRA 1GI3A 2ZPRA 2BX4A 4ZUHA 3UWIA 4U2WA 1TX7A 1GI1A 2B5TB 2G55A 2KR7A 4ISLA 4MVNA 1W7XH 2WPIS 3PMJA 1YPHE 6ESTA 3SJ8A 5EG4A 1RJXB 4UFGH 1A0LA 1ARBA 5CHAC 1YF4A 1KTTB 1THSH 1O3GA 3ITIA 1ETSH 1K1MA 5EXNA 3TLOA 2NU4E 4I8HA 5CHAB 4OS2A 2AS9A 4I33A 1HFDA 2BD4A 3KF2A 1ZSKA 3GY5A 2H5DA 1XX9A 4NIYA 3TITA 2J4IA 2ZFQH 3B9FH 2ZHQH 4RSPA 5AFZH 1O2QA 1JIMA 1EP6A 1TPSA 1ETRH 3UREA 3U8OH 2W6ID 3PMAB 1T31A 4IN2A 3QWCH 1BOQA 4CH2B 2GTBA 6LPRA 5FL7D 1A5GH 5C0UA 2GT7A 3SU3A 5LPEA 5FCKA 1C2EA 4B71A 3E0NB 4LZ4B 2HALA 3TJUA 1SKYE 1TGTA 2I6QA 3HKJB 4MLFB 5ESBA 3ZZ8A 4DIIH 1BRUP 1QJ6B 4GUXA 2ZFTA 3GY4A 3GY6A 3PTBA 4CRFA 5T6FA 4BANB 2W7UA 1IQEA 1C2DA 3IWMA 1YPMH 3NRLA 5DP7A 2Q6FA 1QTFA 2VB0A 4Y11E 1OWEA 1S6LA 1TGCA 4FUFA 5GXPA 4KP0A 1P01A 1ELVA 4Y0YE 2VINA 1Z6JH 4PROA 3RLYH 2FOGA 4BAKB 1D3PB 3PMBB 1UVOA 3E91A 1SGPE 4E05H 2DE8A 2VU8E 2PWXA 2HNTC 3QN7A 3SGAE 1C1UH 1UMAH 2HNTF 2F91A 3FP8E 3EAJA 2LNCA 4TT3D 5FX6A 2GCHG 3EQ0H 4B6FA 1YKTA 1GMDG 4UE7H 1ZSJA 3K65B 3VB7A 5DG6A 1EAUA 2YMSD 4MTBA 5A8ZA 4DOQA 1AE5A 1O2VA 1SGRE 2BVSH 4LK4A 3A8BA 3FZDA 1ZGVA 2F9VA 2BD5A 3EYDA 1G37A 3MO6A 2HVXA 2C8WB 1SQRA 1SHYA 3F9FA 2OBOA 1GHYH 3RXVA 4Z1MD 3HPTB 2H9EH 2CK3D 2QGRA 1L1NA 2BDCA 1V2WT 1V2RT 2VVUA 1QQ4A 1Z8IB 1F0SA 4AB9A 5FXLA 1BTXA 2O8WA 1O2SA 4HI3A 1ELGA 1SG8B 3S7HB 1HPGA 3SJKA 3KN2A 3GDUA 3K6ZA 1RIWC 1SLXB 2TGTA 4NZQA 2VGCC 1PPGE 3ZZAA 4RT0A 3QDZB 3CNRA 3U1JB 1OYQA 1HYLA 3GY8A 1RIWB 3UIRA 3ELAH 2ZU1A 3Q76A 1GL0E 2XBXA 1O2YA 5EW1H 2GZ7A 2ZU4A 3M36A 5DP4A 5GPIB 4LZ1H 1SL3A 1EJAA 3G01A 3U69H 3KYGA 4X2YA 3OAAD 3DA9B 3DSPA 3LGUA 3BEUA 3BEIB 3O8RA 1SGFG 1TALA 4NWKA 1NN6A 3RXBA 5EOKA 4MPXA 1DOJA 4K69A 2VIDA 2V3MA 1DSUA 3HKIB 3KEEA 4H6TA 5FHTA 3E3TA 1THRH 4SGAE 4FXGH 1V2TT 1GJCB 3EA9A 3RXDA 3F1SB 1YCPH 4TPYA 1Z6EA 3P70B 2V3OH 1AFQB 4JZEH 2P16A 4D7FA 3D62A 3GOVB 2BY5X 2FYQA 3RM0H 4A92A 1GBDA 2WV5A 2GDDA 1NRNH 2BX3A 1BDAA 3MO9A 1FZZA 1Q2WA 3GCOA 2HLDD 1EQ9A 1GJ5H 3C1KA 1DLKB 4KELA 1CSOE 2RCEA 4ABBA 3RXIA 2SNVA 4Z6AH 5FPSA 1E0FD 4MG3A 5HKKD 2G52A 1G3DA 3GCNA 2ZG0H 1EZUC 2RDLA 3JZ2B 3ATMA 1BUIA 3SJ9A 2BQ6B 4I8LA 1CBWB 8ESTE 4KGAA 1ZRBA 2R2WU 5DGJA 5IDKA 4RI0A 3GISB 4MQAA 5HMAA 5GDSH 1N6XA 5EJLA 3DFJA 1FY1A 3T29A 1FAXA 3RXEA 2FI4E 1GBIA 3VG8A 2F9NA 2ZGCA 3WWFA 4VGCB 2PR3A 2ZCHP 1H8DH 4K2YA 6CHAC 3K9XB 1GBJA 4NA8A 1MKXK 5K0HA 1Y5AT 1V2JT 2QXHA 2ZP0H 3LIWA 3L6PA 2XOKD 4HZHA 1AWFH 1O0DH 3PO1C 1LTOA 2AFQB 1LHCH 4E7RG 4IMZA 1C5RA 3ZVAA 4B1TA 1HXFH 3RXQA 2C8YB 1PPZA 2VVVA 1HAHH 3SI3H 3ZYDA 1O3JA 1O2UA 3RC6A 4DG4A 1EUFA 2Z6BD 1MUEB 5ESTE 4J1YA 1ANDA 4Q63A 4B75A 1Y3YA 3LC3A 1AZ8A 2FI5E 2P3TB 1O34A 1LMWB 2PHBA 2ZWLH 5F6MA 1AKSA 1TGSZ 1G36A 1DSTA 4K1EA 2FOFA 1C5WB 1GDQA 1FUJA 2TBSA 4TSFD 1OYTH 1UK3A 2ZHEH 1DUEA 2OQ5A 1EB2A 1DANH 1TX8A 3ZZDA 2PTNA 3W1EA 1YPEH 1C1WH 1O38A 2ESTE 3S69A 2VIWA 4ZH8A 1KLTA 2AMDA 1SQAA 1PPCE 4ZKOU 1LVOA 1HJAB 4INLA 3M3TA 2SGQE 1FPHH 3GICB 2BDAA 2FOEA 5DN6D 1A3EH 5J4SA 2ILNA 4DJZB 1LPGB 1S85A 1OWJA 1SLVB 4FUBA 1MMJN 1P2NA 1SC8U 2ZGJA 4TY6A 4X2VA 2ZNKH 7GCHF 2CXVA 3UQOA 4XBBA 2XC4A 2V7QD 4CRCA 1EASA 1WSSH 1JMOH 3QZRA 1GCTB 1FAKH 3CS7A 5AFYH 3SUEA 2B8OH 2FOMB 1GJ9B 3NWUA 1D6RA 3GS9A 1YPGH 3NPSA 1HAPH 4B76A 4OGXA 5B6OA 3H7TA 1TBQH 1V2QT 3ODFA 5JBCS 4IC6A 4AGKA 2PSYA 2DUCA 1NPMA 2ZQ1A 4TY7A 5EXMA 1A3BH 1NRRH 5C67A 2AGEX 2CN0H 4IMQA 1NRQH 3RXSA 3ZV9A 3A84A 5E2OA 3A81A 1IAUA 3I78A 5DP8A 1W8BH 1O3AA 2A5IA 3UNSA 4XE4A 1ZHRA 2HVYB 1C2HA 4I32A 2JETC 2ZKSA 4ABEA 2P59A 4K60A 4X6PA 1MTNC 1CA0B 2KZ4A 1J16A 3RXTA 1DDJA 1C2MA 4ASHA 1GI6A 4X1RU 3RC5A 1C5TA 3BG8A 4ISOA 4A1TA 1DT2A 2P8OC 2VNTA 3ZZ5A 2D2DA 2V3HH 1LQDB 4ABHA 1WOFA 3BTKE 3MTYA 2PUQH 4J2YB 4ASUD 4UFFH 2P93A 1C1OA 3TGIE 3MU1A 3MQKC 1HAVB 4YT7H 3LONA 4GSOA 4NA9H 1TOCB 2A2QH 3FANA 1HIAA 1OOKB 4LXBH 1SGNE 3I29A 4ESTE 4GCHG 1XUIA 3T2NA 2FYRA 1ZR0A 1F5KU 1FY4A 1JIRA 3FFGA 2ZHFH 1B0EA 3U28C 1DWCH 1HAXB 2A2XH 2W3KA 4I8KA 1YLDA 3BTQE 2ZDNA 3IITA 3A87A 3EE0B 3QZQA 1B7XB 3U8RH 1VKYA 2OC0A 2P94A 2ASUB 2TIOA 2Y5GA 3PLPA 4Y79A 1ZJDA 1GHAF 1VITH 4F4OC 2IPHA 3SJOA 1O2IA 4X1NU 5AF9H 1K0HA 2YNBA 3GYMA 1AD8H 2XBWA 2WV4A 2Z9KA 1DXWA 3RM2H 4YESB 1K9OE 5EJ1A 4HGCA 4D9RA 1TB6H 2SGAA 1J14A 1WTGH 1EPTC 3ZZ4A 1L0ZA 2GD4B 1H8HD 4WMEA 2JJ1D 1XUJA 1XUGA 1K1JA 2QXJA 2C90B 1MABB 5LH8A 3CP7A 4Y76A 1MCTA 2VVCA 3D23A 1HBTH 1T32A 2ANMH 3KNXA 4U30A 1FXYA 1Z1IA 1QHRB 4AN7A 5EGMA 4AC9A 2BM2A 3TH2H 1TMUH 1TONA 5L6NH 3O8CA 1VCWA 1CGJE 4XRNA 2FIRH 3LGYA 5EQQA 3HGNA 1IQHA 5GCHG 2R9PA 3ZVEA 3MNSA 3IG6B 1AN1E 1MBMA 5HM9A 1TGBA 1BITA 2Y81A 4E7NA 1RTLA 4ABJA 2OTVA 5C2ZA 1GI5A 4H42U 1GBAA 1RFNA 3LGVA 3KYFA 2M5TA 5C1YA 2VIVA 3T62A 1MTWA 2G51A 2WHXA 1F0RA 1UTMA 1ELEE 2VWOA 1MU8B 2FLRH 1O30A 1NBME 3ZV8A 5CDFE 3U9AH 3FVFB 3URDA 4ABIA 4BOHA 5PTPA 2ZTXA 2J2UA 1A0JA 4GAWA 4MPUA 2ZGBH 1EJNA 1ID5H 1INCA 3DSGA 1K1PA 5AHGH 2FTLE 2BQ7B 2C93B 1QL8A 2ODPA 3LT3A 1GPZA 4XD7D 1ZHPA 2Y6TA 1PPBH 1K28D 4OS4A 3TK6A 1W0KD 1PPEE 2XW9A 4OGYA 4DT7B 3FO8D 5A8YA 1RS0A 8GCHF 2TGPZ 4X8TH 3VB6A 3VGCC 1GJ4H 1GBFA 1BTZA 3TJOA 1D4PB 1C1VH 2VBCA 4B6EA 2J98B 4CREA 1C4Y2 4Q7ZA 3UFAA 4A7IB 1W0JD 3A83A 1F5RA 3ZVBA 1O33A 4FUEA 3Q3XA 2TPIZ
chains in the Genus database with same CATH topology
2ZHWH 2GV6A 3PV4A 2QV1A 1K22H 5JDUB 1C5OH 1OKXA 1UCYK 2H2ZA 4DGJA 1FQ3A 1KDQB 1BRAA 3M5NA 1ESTA 3T5FH 1GMHF 3BIUH 3MMGA 1VITF 1RRKA 4K8YA 1UTPA 4X2WA 1EATA 2WYJA 4FUDA 5JBBS 2GZ8A 2H9HA 1GI7B 1QA0A 1QB1A 2CV3A 4I31A 2F3CE 3GY2A 4XBDA 4CR9A 1S0QA 4CRGA 3M7UA 4XFQA 3QGNB 5C5OA 1GHVH 1N6YA 2BD7A 2FODA 5DKMA 5DP9A 2HPPH 4B73A 1JOUB 2R0LA 5ABWA 4D7GA 5DP3A 4DURA 3MH7A 3TVJB 2B0FA 1XXDA 4CBNA 1N1LA 2O9QA 1NU9A 1HAZB 3RXHA 4XDEA 4AYVB 1O2WA 2DE9A 1H8IH 3VXEH 3EDXB 1SGQE 1UTQA 3VXFH 4KTUA 3MH5A 1Y8TA 4K8BA 1GHBF 1IQIA 1P04A 4NZLA 4TWWA 1SGEE 1FV9A 1HNEE 4K1SA 2A4RA 3AASA 4AFSA 1ARCA 3A82A 1O3CA 1E37B 2QF3A 1WBGB 3O8DA 4H6SB 2NWNA 2C3SA 2A7CA 1Y5UT 1ELAA 3KL6A 4BNRA 2FPZA 3P6ZB 1F92A 1GL1A 4ISNA 4AFZA 1E36B 3AVZA 3TIUA 2V0BA 2Z3EA 2BXTH 2ALPA 1ZYOA 2FX6A 1MCVA 4ABFA 2FZZA 5LPRA 3EA8A 5FPYA 5FX5A 2C8XB 1MD7A 1O39A 3QK1A 1ACBE 1RGQA 2ZO3H 2ZU3A 2NU2E 2TRMA 8LPRA 1Z8RA 3RXCA 2TGAA 1BTWA 2ZDMA 5FBEA 1SGFA 2ZDKA 3PROA 2HWLB 1QBVH 1DE7H 5JPMH 1O2NA 3MH4A 3W94A 1N8OC 1GI0A 5E8EH 2ZTZA 4TPIZ 3VEQB 3MNBA 4NIVA 3LGTA 1A5IA 1IQNA 3MNXA 1F5LA 2SFAA 1C9TA 1BRCE 5BPEA 1A7SA 6GCHF 1KLIH 1GCDA 3SNBA 3SU1A 1Y3VA 2WPLS 4YOIA 3K6YA 1V2NT 4AG1A 1XKAC 3RP2A 1F2SE 1O5DH 4RN6A 3JZ1B 2ZGHA 5DP5A 1ESAA 4Y71A 4IBLH 2FM2A 2UUFB 4A1VA 1J17T 1NO9H 1SGIB 1GBTA 1GI4A 1O3OA 3A88A 1RXPA 1EZXC 3LGWA 1QIXB 3U98H 3T27A 4D8NA 3RMNH 2A0QB 2UUYA 1FONA 2ZPQA 5T6DA 5JB9S 1TABE 1HAIH 3L3TA 3UOPA 1VCPA 4Q80A 4HFPB 4AYYB 3F9GA 1XKBC 3UOUA 1K2I1 1AFEH 4UFEH 1P3CA 2J38A 1AWHB 3M5OA 4ISHH 2STAE 1TA6A 2OQUA 3SU2A 3MNCA 3SGBE 1EOLA 1P10A 2J92A 1UVSH 1IQKA 4WXIA 2VGCB 3P8GA 1GI2A 3HK3B 2VIQA 1NTPA 1WQSA 1KTSB 4ZXXH 1EAXA 1S6HA 4AB8A 1C5SA 1P9UA 1MZDA 3AAUA 3TK9A 1FIWA 1C1SA 3PM3A 1LHEH 1DITH 1LPZB 3F9HA 2EI8A 1SGTA 3UR6A 1B5GH 1AE8H 4YOGA 1BMNH 1TIOA 1TX6A 1D3DB 1ZJKA 1SPJA 2AYWA 1P3EA 1AVWA 3I77A 4BXWA 3V3MA 1BMMH 1L4ZA 1QGFA 1C5YB 2WYGA 2RA3A 2PGQB 1KSNA 3Q3YA 5BRRE 5T6GA 4X8SH 1VJ9U 1P2IA 3A7VA 1V3XA 1BHXF 2SGFE 4B74A 3V7TA 2G81E 1DS2E 2FOAA 3C27B 3S9BA 1C1NA 2AMQA 1ZGIA 2BY8X 1GJAB 1DM4B 3R0FA 5EPYA 4CRAA 3ZVFA 2JH0D 3SOSA 1GBKA 1DICA 1HLTH 2STBE 2XC5A 1NY22 2G4UA 3KGPA 1XVOA 1K1NA 1HDTH 1JRSA 1LHDH 1GHWH 1J9CH 1NRSH 2QXIA 4FVDA 3A89A 2D1JA 1OWKA 2ZTYA 4MNXA 5F8XA 3RU4E 3Q3KA 1HAGE 1SVPA 1VCQA 2G5NA 3A8AA 1PQAA 1A61H 5JB8S 1P2JA 1GBMA 2Z94A 5TCAA 1ZMLA 4ZAEA 2QN5T 3LPRA 2FI3E 3D49H 1GGDC 1O2KA 3T25A 3TK5A 5A0CA 1VGCC 1XVMA 2OP9A 3A85A 2OXSA 1TWXB 3H7OA 5JBTA 1S5SA 1V2KT 1CVWH 1G3CA 1CHOF 3VB4A 3FAOA 1MD8A 2WUCA 4K1TA 5C3NA 2VJ1A 6CHAB 3HATH 2NU0E 1GJBB 2XXLA 3GDSA 4OS7A 2WPMS 5I46H 1EP5A 1C2LA 5GJ4B 1TFXA 1TNGA 1KYNA 1UVTH 2ANKH 1C1PA 1CA8B 1G30B 3PO1B 3STIA 3TPIZ 1C5XB 1C2GA 1LDTT 3A86A 4JYVH 1C1RA 4X6NA 1TRNA 4NIXA 1P12E 1HV7A 1O3EA 1V2VT 1C2IA 1CO7E 1AQ7A 5DP6A 2BQWB 5EU8A 1UCYE 1MAXA 3ATIA 3RXLA 3RXUA 5A0AE 2QIQA 2SGPE 3KQBA 5T3HA 3SUGA 4E06H 2JKHA 2P95A 1GMCF 1QL7A 1SQTA 1B0FA 4AOQA 4U01A 5HGGA 2XWBI 2F83A 4O97A 2HRVA 1BTUA 1UTJA 1TBZH 3M7TA 4B2CA 1DY9A 1YP9A 1NC6A 1BMAA 1V2UT 1DLEA 1S0RA 1NROH 2J94A 2PFEA 1MAYA 1SHHB 1YPHC 1F7ZA 4NIWA 2H9TH 1GDUA 1CQQA 1L4DA 3VB3A 2WPJS 1YCPK 3Q00A 1MKWH 1WU1A 2PKSC 3M3VA 2FLBH 1ZRKA 1T7CA 1O5GH 1K1IA 4I8JA 1HAVA 2FESH 1ESBA 4DCDA 1AUJA 2AIQA 1O2PA 1P0SH 2BDHA 1BBRH 2BZ6H 2ODQA 1P03A 3ZZCA 5FAHA 2A1DB 4INKA 4Y10E 4IN1A 1QL9A 2GDEH 1FY3A 2ZCLP 3A8DA 1UTOA 7GCHG 8KME2 2Z7FE 1JBUH 5F8TA 4UD9H 2Z9IA 4BXSA 1RD3B 1GHXH 1YPLH 3BTFE 2GGVB 1S81A 1SOTA 1T8MA 1C4U2 2XCNA 3MH6A 1ZLRA 4NSYA 2XTTB 1Q3XA 1YM0A 4RKJB 1T8NA 4CRBA 3SI4H 1HUTH 1UK4A 3ATLA 4ISIH 3SV2H 3SQEE 2CF8H 3PWCA 1OP8A 3OSYA 1D9IA 1BA8B 1IHTH 3BTHE 1TNHA 1FJSA 1ZPBA 4Q7YA 5E0GA 5C5NA 2XBVA 2CHAC 3LJJA 1DXPA 2OUAA 7ESTE 1F0UA 2CJIA 3RMLH 1EKBB 3RXPA 3SV9A 1O2ZA 1AB9C 1IQLA 2JETB 1W7GH 2ZU5A 7KMEH 3VB5A 1LKAA 1O3KA 1MTNB 2H5CA 2A7JA 1C5UA 4U32A 2XRCA 1AZZA 2GP9B 3RXRA 1LO6A 3NKKA 3SN8A 2P8OB 1AO5A 2GCTC 2G5VA 1W11U 2FOBA 4UONA 2BVRH 2ZIQH 2HNTE 4Y0ZE 1THPB 1KLJH 1U6QA 4IS5A 1PYTC 5TCCA 3WY8A 1P8VC 3RXFA 4DY7B 1O5FH 1YC0A 1FIZA 2PSXA 1KXBA 3A80A 4ZHMU 1H1BA 3BN9A 1S83A 1ANBA 2FP7B 5FBIA 3T26A 1MH0A 1NZQH 4BTUB 3B23B 4X1PU 1BB0B 4K3JA 3BV9B 1V2MT 2VH0A 2BOHB 2F9OA 3BEFB 3NXPA 3RDZA 1WTHD 2O8LA 1P09A 3T28A 1K1LA 2J95A 4JZFH 1QJ1B 3A7XA 2FO9A 3M3SA 1G9IE 1ZTKA 2OC1A 1W13U 2VWNA 2GVFA 5HMAA 1O2TA 3SNAA 3KIDU 1TMTH 5DPAA 1BIOA 2XBYA 4WY3A 1O5AB 1X7AC 1ZPCA 1GBLA 2UUJB 1EJMA 1AVXA 1BBRK 3SU5A 1GHAG 4NCYA 3N7OA 5AVDA 2W3IA 1C5MD 4X8UH 2AGIX 2BOKA 3QGJA 1EPTB 3GCTF 2XYAA 1QR3E 1QA7A 4FUGA 3S0NA 2GV7A 1W12U 4YLQH 3P8FA 1P05A 1NM6A 1E34B 5GWZA 4Y8ZA 3SZNA 2RA0A 3ZVDA 1QJ7B 1UHBB 4UFDH 1W0ZU 2THFB 2YOLA 1KDQA 3R3GB 1O2JA 2Z9LA 4OS6A 5C1UA 1WV7H 4JK5A 2A5KA 3BTEE 1ZMNA 1D3QB 2ZU2A 4MDSA 3TNTA 2AEIH 3RXMA 1W2KH 1SFIA 1HJ9A 3M35A 4ZHLU 4MPWA 1QRXA 3A7TA 1HAYB 3U1IB 2WPKS 3BSQA 4B2BA 2Y5HA 3FP6E 1KXDA 1KXFA 3SO3A 1O36A 5L30H 1BZXE 1LKBA 4THNH 9ESTA 1O3IA 2ZPSA 3E1XB 4KTCA 4XOJA 3ENSB 1AGJA 4YO9A 4R0IA 3E90B 3SHAH 1AU8A 1YYY1 3S9CA 3BG4C 1ANEA 1P57B 1C1MA 1H9LB 2B7DH 3ESTA 4NFEA 4M7GA 1ELCA 4JYUH 2BLOA 1EAWA 1CHGA 1LPKB 2F9UA 1AMHA 4FUJA 5E2PA 2JH6D 4JK6A 5CMXH 5F8ZA 1IQFA 5HYOA 1OXGA 1SOZA 4F49A 3VGCB 2CGAA 3SGQE 2BY7X 2KAIB 1O3LA 1DVAH 4OS1A 1T8OA 2FTMA 4FUCA 8GCHG 4BAQB 1FN6A 1DWEH 2B9LA 1O2HA 1SGCA 1UO6A 1VR1H 2GKVE 1PQ7A 3SNEA 2QF0A 1IHSH 1TMBH 4NFFA 1MTVA 1Z8GA 1LVBA 2AGGX 2XWAA 2WPHS 5F03A 3LDXH 5CE1A 1G3EA 1K21H 2EI6A 3GCHC 3RXJA 1AHTH 1HAOH 1RTKA 1V2OT 3GY3A 4ZHAA 1C2JA 1GMHG 1VITG 2ZDAH 4YLUA 3GCHB 4Y8YA 4JCNA 3OY5U 1G32B 1Y59T 1O3FA 1EXFA 3QO6A 3A7YA 2RG3A 2V35A 1XXFA 3M5LA 4I7YH 3SW2B 1W3CA 3F6UH 4I8GA 1M9UA 4IC5A 4X1QU 1J15A 3PLKA 3S7KB 4TYDA 2Q6GA 4ABGA 3RU4D 2BZAA 4Q7XA 2ZGXH 2ZFRH 3QLPH 1HRTH 1PFXC 2V6NA 3LH1A 3TNSA 2QYIA 3VFEA 1W0YH 5EPNA 4ZKRU 4MNWA 5A8XA 2Q1JA 2A5AA 3AW0A 2GMTC 2Y7ZA 3F68H 1Y3XA 1DFPA 2SGDE 3HGPA 2ZECA 2BHGA 2OCVB 2Z3CA 1BCUH 1YLCA 2BY9X 2AMPA 1JXPA 2GMTB 3O8BA 4H4FA 4WWYA 4WH6A 2A45B 2ZFPH 1PPHE 1T8LA 4CH8B 3F9EA 1C5QA 3OU0A 1A0HB 4CRDA 3ATWA 2XCFA 2PKAB 1VJAU 1Z7KA 3Q77A 1GHBG 2WINI 3SQHE 1HXEH 1O2RA 1ANCA 1TNJA 1ZSLA 2XC0A 3MOCA 4JZDH 5K7RA 2FS8A 1S6FA 1O2LA 1AI8H 5IYTA 1C9PA 2A7HA 4UDWH 1BMLA 2ZZUH 1GVZA 4SGBE 3RC4A 1O3BA 1NT1A 3MFJA 1UTKA 3SJIA 5HM2A 1C5ZB 4GHQA 2ZCKP 2EC9H 1BTYA 3A7WA 1BTHH 4O03A 4A6LA 4X8VH 3SU4A 1SSXA 2BDYA 2NU3E 2FDAA 2GT8A 5A2MH 4CHAC 4BAHB 1NFYA 4AORA 1KIGH 2BTCE 1QBNA 1ZPZA 1CT0E 3MO3A 1N8OB 1TRYA 4CHAB 2BLWA 2FEQH 3TGKE 4Y8XA 3KHVA 1GI8B 1CU1A 1EZQA 3EGKH 2QXGA 3E16B 2GCHF 2QCYA 2A4QA 3MU5A 3QUMP 1CGIE 2Y80A 5EQRA 2BLQA 1GMDF 2HLCA 1C1QA 9LPRA 2PW8H 3UNQA 3OY6U 1C1TA 2YNAA 3RXAA 6GCHG 3GDVA 4DW2U 4QT8C 2CF9H 5E0HA 1XM1A 3PB1E 1GVLA 2G8TA 1S84A 3E6PH 3RMMH 4KKDA 3MYWA 4YZUA 1CE5A 1VZQH 3L33A 1ZZZA 3KCGH 1OWHA 1MKXH 2Y82A 1ELFA 1KXEA 2BY6X 1OS8A 4X1SU 1SR5C 1QRZA 3SNDA 1BJVA 1SQOA 4ZKSU 4FUIA 2BYAX 1GBEA 1C5VA 2A31A 1ZHMA 4OS5A 3UY9A 1O2MA 1KXAA 2WUBA 4D76A 3DUXH 1MBQA 2R3YA 5GIBA 4ABDA 3RMOH 1MU6B 3S9AA 1C2KA 5EXLA 3ODDA 4INHA 2ZQ2A 2GX4A 1GBBA 2R0KA 4JZIA 1BBRE 4KTSA 1CGHA 4XBCA 1Q31A 1DY8A 1D3TB 1ABJH 2ANYA 1GJ7B 4GVUA 3SBKA 3GY7A 2FS9A 3M7QA 2ALVA 1V6DA 1EB1H 1BTPA 1AVGH 4X2XA 1YBWA 1O3HA 4O9VA 1Z71A 3TU7H 1FNIA 2VIOA 5SGAE 2FMJA 2O8TA 2Q6DA 1P11E 1H4WA 1O37A 1TE0A 4Z0KA 1O2XA 2VWMA 1FY8E 1BHXB 3RU4T 3ZYEA 1V2PT 2ZFFH 1V2LT 3UPEA 4BTIB 3UNRA 1GJ8B 1AFQC 4O3UA 1QURH 4CBOA 4X0WU 1IOEA 1GDNA 3CS0A 1LQEA 5J4QA 4R8TB 3MWIU 1NFXA 4GLYA 1TPPA 1ZTJA 3MU8A 1FMGA 3DT0H 2AERH 3PMHB 4D9QA 2SGEE 3RXGA 1P2OA 1LHFH 2ZHDA 1UJ1A 1O5CB 3M61U 3ZZ6A 1DUAA 1A1RA 1TBRH 4MNYA 2LPRA 2XNIA 1EOJA 1FI8A 1NRPH 3PWBA 4Y7BA 3UWJH 3EA7A 1H9IE 1CBWC 4B2AA 1A46H 1CT4E 1AY6H 4NSVA 4BAMB 1ELBA 1GGDB 4UEHH 3LH3A 1VGCB 3UQVA 1YGCH 4VGCC 3ZZ7A 4YM9A 1FDPA 5C20A 1C2FA 1YPJH 3M37A 3NK8A 2QAAA 4Q2KA 3SUFA 4FUHA 2FXRA 3K2UA 1O31A 1CT2E 1PQ8A 3MU4A 2H1UA 4AFUA 1UVUH 1CHOG 1SGDE 3OX7U 4YTAA 4ZROA 1W10U 3LOXA 5A09A 1XUKA