3UR6A

1.5a resolution structure of apo norwalk virus protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
164
Chain Sequence
MAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase
molecule keywords 3C-like protease
total genus 37
structure length 164
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A01
2HNTF 5L30H 2BD2A 4GHTA 5EGMA 1DANH 2PUXB 3BSQA 2PTNA 4GVUA 1UO6A 1GBEA 3PLPA 1SG8B 1LVMA 2RA0A 3QGNB 1SBWA 1S0RA 1AN1E 2BY7X 1NTPA 2DE8A 2H5DA 3BTHE 2FPZA 1GG6B 1C2MA 4X8TH 2GVFA 4MVNA 1TNHA 3UWIA 1BJVA 1TAWA 2JETC 2BD7A 2PHBA 3RMOH 4R0IA 1SOZA 4A1VA 3SHAH 3ZVEA 1GDNA 1GCTB 3ZZ7A 1OWHA 2ZFPH 2OUAA 1K1IA 1GI9B 2BLVA 5IYTA 4JK5A 1HIAB 3A8DA 2TGDA 1P04A 2BLOA 2Y7XA 8ESTE 2FOBA 3AW1A 3M36A 2ZPQA 2G51A 5GCHG 4I31A 4D7FA 3Q77A 4ZROA 3VFEA 3NUMA 4X8SH 1TPOA 1H8DH 1UMAH 2VH0A 1C1TA 3UNRA 3A8AA 2BDGA 2J2UA 4MPXA 3JZ2B 1OWJA 2ZQ1A 3AAVA 1GJ4H 3M5NA 1CQQA 5C3NA 1NY22 1IQEA 1HAGE 3SNEA 1GHBF 2GT7A 5GWZA 1ZYOA 1OP8A 1RFNA 1GJDB 1BIOA 3AVZA 4YESB 1J17T 4R8TB 1GDUA 4CRAA 4X8VH 2OINA 5DP7A 4X2XA 1SGTA 2C90B 3U98H 4FXGH 2ZC9H 1LKAA 3RC6A 6CHAB 2RA3A 3Q3KA 3F9GA 4WF8A 2FOFA 2ZI2H 2A4OA 1F5RA 4NFFA 1EPTA 3ZZCA 1H8IH 2R3YA 1WUNH 3GISB 1OWDA 1D3TB 9LPRA 5FXLA 1GHZA 1SGFA 1O3KA 3PMBB 3O8RA 5JYIA 1TGTA 1QGFA 5TCAA 2OP9A 1CBWB 1LO6A 2GV7A 4D9QA 1EPTC 1TQ0B 2ZDAH 5A2MH 2GGVB 2ZCLP 2WPMS 3CS0A 5HYOA 4NWLA 4WH8A 4JZ1A 1SGNE 1V2MT 5JB9S 5DP8A 1DLEA 2PLXA 2SNWA 2J95A 1HNEE 5E0JA 3SQEE 2Y82A 2O8MA 3RXQA 3FZDA 4AORA 3PLKA 1FPCH 2H5CA 4D76A 1C1WH 2ZGXH 3TIUA 1F7ZA 3SU1A 1UTMA 1JBUH 1MAYA 6CHAC 5FPYA 3RP2A 2V0BA 4A1TA 1D6RA 2J4IA 4NG9H 5GJ4B 3LPRA 1TGCA 3JZ1B 3VPKA 3UTUH 4DURA 1W13U 1INCA 1MKWK 2Z3EA 4X6PA 1LHEH 3GDSA 4TPIZ 1K1LA 1MQ5A 3RXIA 1TWXB 3FP6E 1UCYK 3RLWH 3SO3A 4CREA 2ZEBA 3EA7A 1EXFA 1Y3UA 1CO7E 1S83A 1BQYA 1YM0A 4OS5A 1OSSA 1TBZH 4NIVA 1BTUA 2ZFRH 2WPJS 1O3NA 2FIRH 2XBWA 4A6LA 1GPZA 2ODQA 2ZZUH 3UNQA 2KAIA 3K2UA 3SI4H 1RRKA 1YBWA 1OYQA 4AG2A 1ZPBA 1A0LA 1RTLA 3F9EA 1TMUH 7LPRA 2QAAA 2A32A 3A88A 2BY6X 1BZXE 1O2WA 1OWEA 1XUKA 4XBCA 3EYDA 2Y81A 3STIA 4XE4A 2A7CA 4NWKA 4DOQA 3CS7A 2IOTA 3VXFH 4NSYA 3BTGE 4OS7A 4ABEA 1P9SA 2VVCA 3AASA 4DJZB 1S6HA 3P6ZB 4MTBA 3GY2A 3UPEA 4AN7A 2AIQA 2O8TA 3PMAB 1OWKA 2J9NA 2PWXA 3RMNH 3R3GB 1EZQA 3U9AH 1TOMH 1XUJA 1TGNA 3SGAE 1VCWA 2ZTYA 4UFGH 1ZHRA 3KEEA 3O8DA 4I8KA 2F3CE 2PGBB 1HRTH 1GHAF 1FIWA 1C5OH 2VU8E 3DA9B 4ABJA 1TRYA 9ESTA 2VJ1A 3C27B 4K3JA 1YC0A 2GP9B 3SU0A 2A7JA 2WPIS 3RXHA 1ETRH 1GVZA 1O5EH 5GIBA 1D3QB 1Y3VA 1OS8A 3E8LA 1SLUB 5F8ZA 1QTFA 2BOHB 4B2CA 1O35A 4CHAB 2CJIA 3M7UA 2CHAC 1FMGA 2GX4A 4FUGA 2FOGA 4UD9H 1GMCG 2GDEH 1BRCE 3TK5A 1A4WH 4Q2KA 1QCPA 2VVUA 5EOKA 3LC5A 1QB6A 1BUIA 2NWNA 2WPLS 4K1SA 3RXOA 1E35B 2WUBA 3S7KB 3TH4H 5FX5A 4K2YA 1A46H 1SQTA 1C5TA 1BRAA 1ORFA 4MG3A 3UY9A 1UHBB 3ZZ4A 2ZGCA 1BCUH 3KGPA 3PO1B 4D8NA 1N6YA 1CVWH 2EA3A 3P8FA 4CRGA 2F91A 3BTFE 1ELBA 3PWBA 3BG4C 5EXLA 1OOKB 2BD9A 4GSOA 1PPEE 5C1YA 4YT6H 1UTLM 3GCOA 2QYIA 1JIRA 1HLTH 4I8GA 1SSXA 1S82A 2J94A 1KXFA 2F9UA 5BPEA 1DX5M 1NFYA 1THSH 3W95A 1V2NT 1ANBA 3ZZ9A 3LJOA 1QQUA 1SPJA 1O31A 4MNWA 2ZHFH 2FX4A 4BTTB 2AH4X 4A1XA 3F9HA 2Z7FE 3GCHC 2FOAA 1KLJH 4B73A 1O37A 1KTTB 1IHSH 4IMZA 1CGJE 5E8EH 2ZTZA 5EQSA 3SV7A 2B7DH 2EEKA 4HI3A 1K1NA 5EPNA 2ZA5A 1WSSH 1CU1A 4H6TA 2P3FH 1K21H 2PKAB 2J34A 3Q76A 2TGTA 3M7TA 2A4GA 4AFZA 3F68H 1NT1A 3BTKE 1AB9C 1ID5H 4AB9A 3D62A 5JPMH 5FBIA 3BEIB 1N8OC 2FMJA 1WYKA 4Y8XA 4A7IB 1NO9H 1SC8U 2AGIX 3URDA 5L2ZH 1EOJA 1HJ9A 1QJ6B 2J38A 1BJUA 1CA0B 2P93A 3V3MA 2BD8A 1NRSH 3SHCH 2Q1JA 4ZAEA 2HGTH 1XUHA 2A45B 2ASUB 3UOPA 1A5GH 2XW9A 1H9LB 1F0SA 1ZGIA 1H9IE 3H7TA 1DWDH 2BD4A 3M35A 4Y71A 3GCTG 1RIWB 2AFQB 1SOTA 2OQ5A 1V2QT 3PLBA 1O5DH 4JYTA 1FZZA 4RSPA 1P2OA 4BTIB 1HFDA 4RKJB 3BV9B 3MO9A 4GCHG 1GI6A 2EI8A 1EAXA 1HYLA 3PMJA 3RUOA 1ZRKA 1XX9A 1YP9A 2YOLA 3RXKA 3V13A 2THFB 3L6PA 3NWUA 1P12E 5EODA 1RTKA 4LXBH 4TWWA 3E16B 5GXPA 1FAXA 4KGAA 1RIWC 1SGCA 4LZ4B 1ZJDA 1CA8B 1DDJA 1E36B 5EW2H 1GHVH 5JBBS 2QGRA 3ZZ6A 1ZSLA 3K9XB 4OGYA 2ZHQH 1C2IA 3T5FH 4CH2B 4OGXA 2ZCKP 4Z0KA 2YNBA 1JRTA 2ZDKA 1EB1H 4KKDA 4ABGA 4B71A 3TK6A 1DVAH 4AYYB 4E06H 1EPTB 5B6OA 4PROA 3IWMA 4ISNA 1ARCA 1A5HA 4WVPE 2OCVB 1AIXH 1DS2E 2ZU3A 1O2XA 1GI0A 2ZTXA 1ARBA 2Q6FA 4DT7B 1QIXB 3RXCA 1TFXA 1ZPZA 4X0WU 1QY6A 4WXIA 1O3JA 2TGAA 5DK1A 1GGDC 3RU4D 5E0HA 2HLCA 1O2JA 4WXVA 2BY5X 2B5TB 1MTVA 1EZXC 1LKBA 2Y5GA 2H9EH 1TX8A 1Z71A 3BTDE 3MO3A 4AFQA 4DIHH 1LVYA 1TRMA 2BQWB 2JETB 3FFGA 2VWOA 4Y7BA 3GY5A 1THPB 3HPTB 1PPFE 1C9PA 4JMYA 1AY6H 1PPHE 1OX1A 1ANEA 3TGJE 3Q00A 5DO4H 3PO1C 1ABIH 2ZGHA 3BIVH 3QN7A 1O2LA 4BNRA 1C5UA 3VB7A 4K1TA 2SNVA 2PUQH 3GYMA 2FTLE 1L1JA 2O8LA 4ZXYH 2DE9A 4TY6A 4U01A 3F9FA 1KXEA 1TALA 2F9OA 1A2CH 2R0LA 4M7GA 4JK6A 4ABDA 5FHTA 1K1MA 5FCRA 1XKAC 1D9IA 1FPHH 4FVDA 5F6MA 1PJPA 1WAYB 1A1RA 4O9VA 1C5MD 2HRVA 3ZZAA 4WY3A 1IAUA 2IJOB 1DOJA 1KDQA 3PYHA 5E2PA 1DUAA 1C4Y2 1TRNA 4B2AA 3PTNA 1DT2A 1P2IA 1LPKB 2ESTE 2ODYB 3P8NA 3FP8E 2UUKB 2C8ZB 2Y5FA 2ZF0H 2W7SA 1KIGH 4Q7YA 3OY6U 1MD7A 1W14U 4YZUA 2CF9H 1O2YA 1FN8A 1CGHA 2GMTC 3U69H 1ZMJA 4AFUA 1D3DB 1AU8A 1K28D 1AMHA 1Z6JH 2K1QA 4O3TA 3MH5A 3RXAA 2D26C 1TMTH 7ESTE 2B9LA 2UUYA 4B76A 1NESE 3S9BA 2UUJB 1OXGA 1EJMA 4Y79A 2P3UB 1QB9A 1KSNA 1DITH 2Y80A 1VCPA 2BVRH 2CMYA 3AW0A 1J15A 1OWIA 5T3HA 1YLDA 1V2WT 3A7TA 1C2GA 1JMOH 1ZPCA 3A86A 1QBVH 4I32A 1QNJA 5FX6A 1QL7A 2VIDA 2FYQA 3W94A 2BVSH 1Y8TA 4IN1A 2BX3A 5LGOA 2XCFA 3ESTA 1FV9A 4NA9H 1W7XH 2QN5T 2PGQB 1C1UH 2ANMH 1T8NA 1TGSZ 1VITF 1MQ6A 1SGYE 2ZGBH 2FOMB 3GDUA 3VEQB 1S6FA 4ABFA 1P03A 1TBQH 3S0NA 4TY7A 3KNXA 3RXBA 1BRUP 2JH6D 1B5GH 1DUEA 1EAUA 5CHAB 4X2WA 2DUCA 1FDPA 3TH3H 4MPVA 3KCGH 4NSVA 2ANYA 2BX4A 1UK2A 1DLKB 1C9TA 1XXDA 2AEIH 4YLUA 3KN2A 3SNCA 5AF9H 2G00A 5C67A 1S0QA 2BDAA 1V2KT 1MTNC 1YPHE 5LH8A 1UTKA 5E2OA 1C2FA 1PQ8A 2ILNA 1XUFA 3MU5A 2BYAX 3SU5A 1C1QA 2F9PA 2R2MB 2VVVA 2EC9H 3H7OA 1GGDB 2C8WB 2XBVA 1QBOA 2ZCHP 8GCHG 1HIAA 2GD4B 2HVXA 4O03A 3T26A 4SGBE 1AO5A 1IQNA 1HAVB 2A4QA 1ZHPA 3LGYA 1AKSA 1LDTT 2M5TA 1O3GA 3E0PB 1LQDB 5LPFA 1CHOG 1ELCA 2PKSB 3ZZBA 2UWPA 1FI8A 4I8HA 3U1IB 1O3HA 1AI8H 1KXCA 4INLA 1SLWB 5L6NH 1Z8RA 1L0ZA 1O2GH 1SGEE 1O30A 4OS2A 3KHVA 3S9CA 1O3LA 5A0AE 2BZAA 4X8UH 1O3EA 2FOEA 3BG8A 1MKXK 4F49A 3OY5U 1EQ9A 1KY9A 4KTSA 3ZVCA 3VB3A 3SJOA 1V2LT 3SGQE 1YKTA 3SI3H 2VB0A 2Y5HA 1W12U 3RMMH 2BMGB 4FU7A 3A7YA 1KXDA 2ZP0H 4O3UA 1G2MA 1WTGH 2WPKS 1NROH 1HXFH 1MCTA 3L3TA 4JYVH 1F0TA 4CH8B 1U6QA 3ZZ8A 1MBQA 2P59A 1WQVH 1DM4B 5LPRA 1EP5A 5DP3A 1G3DA 1YPLH 4AGKA 1BHXB 3C1KA 1MAXA 3LC3A 2W3IA 1YPEH 1NFUA 3M5LA 4JZFH 1AUJA 1LMWB 1ZMNA 1ETSH 2Z6BD 2ALVA 4FUDA 5A09A 2TPIZ 1PYTD 5CE1A 3SNAA 3TH2H 1LVBA 2NU4E 3LGVA 3QDZB 4Y8YA 1MU6B 2ANWA 4E05H 3KQEA 2BD5A 1O5CB 3BTWE 3SU6A 3MNSA 1P3CA 3TVJB 3SW2B 2GCHG 4ZKOU 2BLQA 3KL6A 1OKXA 1A0HB 1P01A 3EA9A 2FP7B 1TNKA 3I29A 3ZV9A 3DD2H 4MPWA 3NK8A 3SUGA 4Z6AH 4GHQA 4RN6A 1Z8IB 2JKHA 4KP0A 2Y6TA 4FUEA 2UUFB 1QB1A 3T62A 4AB8A 3ELAH 1MZAA 2NU3E 1NS3A 5PTPA 1BA8B 2FOHA 2Z9IA 1WCZA 3CENA 2WPHS 5F8XA 2F9BH 1L2EA 1VZQH 1SL3A 2GCTC 1UK3A 5CHAC 5C5NA 4ISHH 1VITH 1P05A 3AAUA 3ITIA 3RXMA 1MZDA 4CR9A 3Q3YA 1BMAA 1UVSH 2ZIQH 4JZEH 1UTNA 2ULLA 2BDHA 4UFEH 2AGGX 1K22H 1HPGA 1QBNA 1ZLRA 1EASA 1MCVA 4ISOA 3D23A 4GAWA 5I46H 3PWCA 1HUTH 5BRRE 2Z9JA 1C5XB 4DIIH 1AFQC 2CF8H 3VXEH 2D8WA 2VINA 3MH6A 3RXUA 3U1JB 1PYTC 3CP7A 2ZHEH 1TYNA 4K69A 1BBRK 1NRPH 3RXTA 3MU1A 3S7HB 1S81A 4Q7XA 1PPGE 3ZZDA 4XFQA 7GCHF 2P16A 4I33A 2W7UA 1HXEH 1WBGB 2ZFSA 4X2YA 1V2ST 3UNSA 4B75A 1AGJA 1TABE 1KXBA 4H6SB 1SGDE 1NRNH 3B23B 3VB6A 4E7RG 1LHFH 1EZSC 4X1SU 1C2EA 4SGAE 2ZU1A 4CRCA 3RXFA 1V2VT 3LGWA 4AOQA 1QRWA 2ZU2A 2STAE 3P92A 1J16A 3U8RH 1DWBH 1Q3XA 2SGDE 1HAXB 3LH3A 1G3BA 1IQMA 3V12A 2ZHWH 1VJ9U 4ASHA 3MU4A 3TJNA 1V2OT 2F9NA 4ZUHA 5IDKA 2V3OH 1GJBB 1UVUH 4NIYA 1SHYA 3A83A 1WOFA 1B0FA 2FI5E 3EAJA 4BAQB 5K0HA 1K2I1 1O2NA 1AB9B 3SU4A 1LCYA 3LGUA 5A8XA 1HAZB 2FXRA 3M7QA 3I77A 2ZU4A 1LPGB 1Y3YA 4FUHA 4KTCA 1Z6EA 3T28A 4BTUB 4BAHB 4X2VA 1E37B 1P9UA 1SFIA 2G4UA 1KXAA 1E0FD 2BDYA 4WH6A 1G37A 1YPHC 1H9HE 1W8BH 1O2HA 2VH6A 1MKWH 2Z94A 5TJXA 1D3PB 4ESTE 2OLGA 3Q3XA 1K1JA 2C3SA 2QY0B 3SNDA 5E0GA 3E6PH 1BITA 5JBCS 1C5NH 1TOCB 5ETXA 3ZVFA 2XC0A 1RJXB 1O3MA 1O2ZA 4KELA 4INKA 1DWEH 3QO6A 5G4BA 1ABJH 3MU8A 5HM9A 3DFLA 1OP2A 5T6GA 1GCTC 2QXHA 2WV4A 1EAWA 2CHAB 2G81E 3LDXH 1T31A 2ZDMA 1VCQA 5FBEA 1T8LA 1ZRBA 4IW4E 4NCYA 2A5IA 1CHGA 1WU1A 2CGAA 4ABBA 1BTPA 1N6XA 4K8YA 4XBDA 1LQEA 3HGNA 2CXVA 2QXGA 1HGTH 2BB4A 1IQKA 1O3AA 1NU9A 2A7HA 1C5SA 3VGCB 1SGFG 3SUEA 1NC6A 4I7YH 5H4IB 1ELVA 1CGIE 1TIOA 1VITG 1IOEA 3MU0A 1ZZZA 3PROA 4NIXA 3SBKA 1FQ3A 4FUFA 1YPJH 4GUXA 2ZO3H 4WMEA 5AHGH 1KLIH 1Z8JB 1GMCF 3HKIB 2GZ9A 1T4VH 4YLQH 1T32A 1A5IA 2QXIA 4LZ1H 1XM1A 1KTSB 1AE8H 3TJUA 3K65B 1EP6A 4ZXXH 1ESAA 3ATMA 4ZKRU 1GBIA 2PSYA 1CHOF 4FU8A 2CV3A 2B8OH 1FXYA 1FY1A 3GY6A 4YO9A 1EZUC 2BTCE 1O5GH 1W0YH 1HDTH 1LTOA 1ELGA 3IG6B 2XTTB 1V2TT 3TU7H 3B8JA 1SI5H 2W3KA 1B7XB 5SGAE 3ATIA 1TE0A 1SFQB 3M3VA 3V0XA 3STJA 2GMTB 4YTAA 1TB6H 2XXLA 1AKSB 1C5RA 1K9OE 2OD3B 3GDVA 5EQRA 3HATH 2IPHA 1TA6A 3UQOA 2AMDA 3MTYA 5A0BA 2ZNKH 3FVFB 2JH5D 2O8UA 4A5TS 2BHGA 4Y8ZA 1SMFE 2ZWLH 1AFEH 3ATKA 4IC6A 3D49H 1WTHD 3DHKH 1NRQH 2OXSA 1C5LH 1O2OA 2A0QB 1VJAU 2FI4E 1O2QA 5LPEA 1CT0E 1P3EA 1GHAG 5T6FA 4INHA 1YPGH 3H5CB 4WJG2 1QA0A 2O8WA 3S9AA 1SVPA 3SU2A 1AVGH 1RXPA 3BIUH 4I8JA 4CBNA 2OQUA 2C93B 4HFPB 1AQ7A 1DSTA 1GJ9B 3RXGA 2W5EA 3A82A 4ZH8A 1ZOMA 3RLYH 3M5MA 3K6YA 4MPUA 1ZMLA 2SGPE 1K1PA 4MDSA 4ABHA 1IQGA 1DFPA 1KDQB 1O2MA 2FZZA 5EPYA 4OS4A 1W3CA 3NZIA 1MH0A 3SJ8A 1TNGA 4ISIH 1GJ5H 1O36A 1Q31A 3SV2H 2BDIA 2XWAA 1O3OA 1GVKB 4J2YB 5C2ZA 2WINI 1DXWA 1CBWC 1XMNB 1C5QA 1GHWH 1TA2A 1VGCC 5DPAA 1QURH 4JCNA 3RXJA 1IHTH 1GBBA 1O2RA 2J92A 2A5KA 2FLRH 5FPSA 1P2JA 1W10U 1ELTA 2XYAA 1FY5A 3OSYA 1MUEB 3TPIZ 1BMNH 4NA7A 2XC5A 1P2QA 2H6MA 4AZ2B 1FUJA 1YCPM 2FDAA 1C4V2 1O38A 4CRBA 4VGCC 2Z3CA 1BTZA 1GJCB 1BMMH 1P2KA 1UTPA 1GCDA 2AS9A 4FVBA 1SGIB 3A7XA 1F2SE 1O3BA 1J8AA 2P8OC 3TJOA 5T6DA 2QA9E 2AYWA 3MO6A 2PFEA 1HJ8A 1T7CA 2SGAA 3A89A 1PFXC 2F83A 5C5OA 3SQHE 1MTSA 4MLFB 1CSOE 1L1NA 3NCLA 3KIDU 5I25A 5J4QA 3VGCC 2PV9B 1GBCA 2HNTE 4J1YA 2V6NA 1ZJKA 3QUMP 2P3TB 2YNAA 1XXFA 2C4FH 1RGQA 4ZHLU 3ZZ5A 2BDCA 1CT2E 2WV5A 5EXNA 2SGFE 4OS6A 4DVAU 4A92A 2Z9GA 3A7ZA 3MOCA 3P70B 5AVDA 1A0JA 5FCKA 1QJ7B 2OC1A 3EGKH 1ZHMA 2TIOA 2ZFTA 2FESH 1GJAB 4FUIA 3ZYEA 1SQAA 5AFYH 4YM9A 4X6MA 1SGRE 2QC2A 1C1OA 5FPTA 1IQFA 1O2VA 1O3DA 4AX9H 1HAVA 3E1XB 1O3FA 1GI3A 3RMLH 1SLXB 3LIWA 3GCTF 2VIQA 1GG6C 1TX6A 2R2WU 4YOIA 1MD8A 4DG4A 1V2PT 1Y3XA 3LONA 3SUDA 1P0SH 2BY9X 1SHHB 2AGEX 1G3EA 1YCPH 3ATWA 2A2XH 3P8OA 3O8BA 2A31A 1RTFB 1GI8B 3R0FA 4ISLA 3P8GA 3LGTA 1NFXA 4IC5A 3SN8A 5A0CA 1S84A 3DFJA 2NU2E 4FUJA 1P10A 3F6UH 1FJSA 1Y59T 1P09A 2EI7A 3QTOH 1QA7A 5EG4A 1P8VC 1GI7B 1IQIA 2GZ8A 1FONA 1SR5C 1TMBH 1NN6A 2ZGJA 3ZVBA 1T8OA 2BD3A 2G52A 1GJ6A 3FP7E 1PQAA 1MU8B 5ABWA 4GPGA 4HGCA 3SV6A 1E38B 1BB0B 1ELAA 2QV1A 1IQLA 4NFEA 1GBDA 2FM2A 3UFAA 4K1EA 3SOSA 4TYDA 3ENSB 3UOUA 5C1UA 1THRH 3RM2H 1Z1IA 2VIOA 1GI1A 2RCEA 1J9CH 3F1SB 4NZQA 5GPIB 4X6NA 3UR6A 3ODDA 1B0EA 1O2TA 1S5SA 2GT8A 1YLCA 2PTCE 2ZU5A 3SV8A 3E3TA 2HPQH 4F4OC 1TONA 4AG1A 3E0NB 2BM2A 1GHYH 1MTUA 1HAIH 2ANKH 1LHCH 1BTHH 1YF4A 3MMGA 4BAOB 1F5LA 1ZTKA 2VIVA 2HPPH 3TITA 2QCYA 1AUTC 4NGAH 2QXJA 4X6OA 2XC4A 1EB2A 4UFDH 3WY8A 3LJJA 1DY8A 1EAIA 3URCA 2ZPSA 4IS5A 1AFQB 1UVPA 5TCCA 3GCHB 2I6QA 1GBFA 1HAYB 1YPKH 1MTNB 4B74A 1X7AC 1EKBB 3A81A 3SZNA 5CMXH 2ZFQH 8KME2 1UTOA 1PPCE 4Q7ZA 1O0DH 1QRXA 2FWWA 3HGPA 3VB5A 2PW8H 3UREA 3QTVH 1G30B 1NPMA 1DSUA 4D7GA 4ZHAA 1YYY1 5F8TA 1C1RA 2WYJA 1Y5AT 1TPAE 1F5KU 2FYRA 2G5NA 1UCYE 2GCTB 1QFKH 2D2DA 1BT7A 1BTYA 1O2IA 1YGCH 5DP4A 1FNIA 6ESTA 2JH0D 2HWLB 3RXPA 1L1GA 3G01A 1PQ5A 1LHDH 1AZ8A 1L4DA 1BBRE 3LH1A 2VNTA 3T2NA 1BDAA 1AE5A 1ZTJA 4WWYA 1FY3A 2FLBH 4THNH 1GL1A 1SGPE 1C1PA 4NIWA 1YPMH 1HAOH 3LGIA 2R3UA 3RXDA 1GMHF 1O2PA 4ZHMU 1Z8GA 1BOQA 2QF3A 4MQAA 3NPSA 1PPBH 1ELFA 3M3SA 3S69A 3A87A 3DUXH 1F0RA 5HM2A 4FUCA 2TBSA 1SQOA 4IN2A 3QLPH 4ZMAH 2H9HA 1C5ZB 3QX5H 1TPSA 2C8XB 3MNBA 1HCGA 1GI4A 1ESBA 3B9FH 2Z9KA 1P11E 3V7TA 3T27A 4ABIA 2Q6DA 1JIMA 2A4RA 3ZYDA 2PKSC 1HJAB 1C4U2 2BXTH 3MI4A 1QJ1B 4DGJA 4UEHH 1QQ4A 3PV4A 3A7VA 5FAHA 3P17H 4E7NA 4HTCH 3ZVAA 2R9PA 3BTME 4XDEA 1E34B 1A7SA 1G36A 1DE7H 1UTQA 2SGEE 3BTEE 1O3IA 1XUIA 4MNXA 1JOUB 2B0FA 3E90B 5F03A 2XNIA 4XBBA 3LKWA 1H4WA 2V35A 3SV9A 5ESBA 1NZQH 2GV6A 2AMPA 2CN0H 1HB0B 4HZHA 3MNXA 1TLDA 1QL8A 3KQCA 3TLOA 1H1BA 1XKBC 2HNTC 3RU4E 3QK1A 3D65E 2ALPA 2BLWA 3TGIE 1NU7B 3L33A 3M3TA 1QRZA 2ZKSA 5DGJA 5HXFA 1GVLA 1GBHA 1EX3A 2Q6GA 3UQVA 4H4FA 1DWCH 1SGQE 2BQ6B 1GBJA 3A8BA 2UWLA 1O32A 2Y7ZA 1AVXA 4JZIA 2FO9A 3T29A 1AZZA 2FODA 1N1LA 4UDWH 1IQHA 1W2KH 3MFJA 1GJ8B 2HALA 4XSKU 2LPRA 2AIPA 1ANDA 2D1JA 1FAKH 4XOJA 1BHXF 4CRDA 1OP0A 4X1QU 1GMDF 1RS0A 3MH7A 1IQJA 3UR9A 4YOGA 1FLEE 2P95A 5L2YH 8LPRA 2GTBA 2V3HH 3P95A 4LOYH 1O34A 3BG4B 4JYUH 4B1TA 2GKVE 2TRMA 5EXMA 1LHGH 1MMJN 1P06A 3RDZA 2BVXH 5HGGA 3FANA 2ZDVH 3TGKE 2KAIB 3LOXA 5A8ZA 1T4UH 4NZLA 1V2JT 1AHTH 1FY8E 1AWHB 3RXVA 1C1NA 3TK9A 3EDXB 2OBOA 4UONA 4CRFA 1ELEE 4BXWA 1HV7A 3OYPA 4GCHF 2VIPA 2VWNA 4U32A 2ZQ2A 1GHXH 5GCHF 1QR3E 4CHAC 1M9UA 1O5BB 3A85A 3MNCA 1TPPA 2Z3DA 2PR3A 7GCHG 4K60A 2OBQA 2FS9A 3M37A 3RXEA 1G32B 1K1OA 3SNBA 1WV7H 5DG6A 2VWLA 1DY9A 3I78A 5DP5A 3BTQE 2Z9LA 1EUFA 1TBRH 3ZZ3A 2A1DB 1P02A 4JZDH 3KF2A 2W26A 3ATLA 3RXRA 1UCYH 1O39A 7KMEH 2VGCC 4IBLH 4U30A 4BOHA 3GCNA 4X1PU 1O2SA 1ZR0A 2BY8X 4Y0ZE 3NXPA 1V2UT 2XBYA 3HKJB 3EE0B 4UE7H 1Y5BT 1C1MA 2FOCA 1FY4A 1BRBE 3ZV8A 2FI3E 1Q2WA 1D6WA 1C5WB 1FIZA 3QZQA 4GLYA 2STBE 4X1RU 5HMAA 5C1XA 2C8YB 2OC7A 4YT7H 3MWIU 4K5ZA 1RD3B 1QL9A 2GDDA 2UWOA 4O97A 1GI5A 2H9TH 2BQ7B 1O3PB 2A5AA 3QZRA 4AFSA 4LK4A 1O5AB 1HAHH 1P2MA 2BDBA 2G5VA 4YOJA 3SJIA 2ZG0H 1BTXA 4D9RA 4Y6DA 1G9IE 4Q80A 1W11U 3A84A 3GY7A 1N8OB 1NM6A 2O9QA 4Y11E 3UUZA 5J4SA 3RXLA 2AERH 2R0KA 1CE5A 5ESTE 3GY3A 3QWCH 3A8CA 1W7GH 1C1VH 4MNVA 4KTUA 4TPYA 4AYVB 4FU9A 1D4PB 1G2LA 5K7RA 2FX6A 1GBLA 1TX7A 1UVTH 2A2QH 3BEUA 1TNJA 6GCHF 1V3XA 1EJNA 1GBAA 1KLTA 3BTTE 3PMHB 3LT3A 3ODFA 4DW2U 1MTWA 1BMLA 1O2UA 2NU1E 1ACBE 1EJAA 3RC4A 1ZSJA 5DJ7A 1TGBA 2XRCA 1L4ZA 4ZKSU 1Z7KA 2OTVA 2VWMA 5JDUB 3SORA 4NA8A 2WUCA 1O3CA 4U2WA 1J14A 2ZECA 3ZVGA 4VGCB 3PTBA 2QIQA 5JBAS 1ZGVA 3KQDA 1GL0E 4FUBA 4DCDA 1PPZA 3GY8A 1OPHB 1ELDE 1TNIA 1JRSA 1VR1H 3BN9A 5AFZH 6LPRA 2PKAA 2RG3A 3GY4A 2OC8A 4H42U 3M5OA 3OTJE 2ZFFH 3RM0H 4X1NU 3TNTA 1C2JA 1GDQA 1EOLA 3SGBE 3MH4A 2IN2A 4DY7B 2GZ7A 1DPOA 1C2KA 3FZZA 1GWAA 2OC0A 8GCHF 4ABAA 4QT8C 2QF0A 4BAKB 1GBTA 2BZ6H 1UTJA 3EQ0H 3PM3A 2VIWA 2FS8A 1GMHG 1W0ZU 3QGJA 4ZKNU 1GBKA 4B2BA 3KQBA 2AMQA 1Z1JA 3NKKA 1UVOA 3U8OH 3O8CA 1FN6A 1C2DA 1OYTH 1GJ7B 5A8YA 1C5PA 4WMFA 1SLVB 6GCHG 1GBMA 4Y7AA 2NU0E 3RU4T 2PSXA 4CBOA 3SUFA 1VGCB 1ESTA 1T8MA 1F0UA 1PQ7A 1A61H 3RC5A 1G3CA 3E91A 5DP9A 1V6DA 1Y5UT 4K8BA 5JB8S 2LNCA 1GMDG 2HOBA 2P94A 2SFAA 1DXPA 3OX7U 2ZHDA 1ANCA 4BAMB 1S85A 5JBTA 3BF6H 3VB4A 4RKOB 5DP6A 1NRRH 4I8LA 2VGCB 1EATA 2RDLA 3BEFB 3N7OA 3HK6B 1V2RT 3SU3A 4UFFH 3EA8A 3MHWU 5DKMA 4Y10E 5GDSH 3GYLB 1C5YB 1DICA 1AVWA 3A7WA 2BXUH 3TNSA 5EW1H 2EI6A 3RXSA 4IGDA 1SB1H 3SJ9A 1XVMA 2TGPZ 4OS1A 1F92A 1CT4E 1ZTLA 1AD8H 1XUGA 3FAOA 1BTWA 1CA0C 2SGQE 2XBXA 1ZSKA 1NFWA 1UK4A 2G8TA 1UHBA 2H1UA 3K6ZA 1BBRH 1AWFH 3M61U 1O5FH 4IMQA 2ZDNA 1A3BH 2ZPRA 2H2ZA 2XWBI 1Y3WA 2XCNA 3GICB 2GCHF 1MBMA 2ZDLA 1P2NA 1HBTH 4WMDA 1C5VA 1GI2A 2FEQH 1O33A 1UJ1A 1HAPH 3HK3B 4Y0YE 3T25A 4CR5A 2WYGA 4AGJA 1C2LA 3MYWA 1LPZB 1TNLA 4BXSA 1A3EH 1P57B 3IITA 2FTMA 2G4TA 2P8OB 4BANB 1O2KA 2BOKA 4Y76A 5EU8A 1C1SA 1WQSA 3A80A 1LVOA 3UIRA 5C20A 3ZVDA 1JXPA 2F9VA 1TQ7B 1MKXH 1XVOA 1ETTH 3GOVB 5EQQA 1KYNA 2G55A 3LU9B 1QHRB 1YCPK 1JWTA 2I6SA 3UWJH 1HJAC 3PB1E 1GHBG 4MNYA 2ODPA 3DT0H 4TWYA 1C2HA 3TJVA 3U8TH 3SJKA 3OU0A
chains in the Genus database with same CATH superfamily
2HNTF 5L30H 2BD2A 4GHTA 5EGMA 1DANH 2PUXB 3BSQA 2PTNA 4GVUA 1UO6A 1GBEA 3PLPA 1SG8B 1LVMA 2RA0A 3QGNB 1SBWA 1S0RA 1AN1E 2BY7X 5DSFA 1NTPA 2DE8A 2H5DA 3BTHE 2FPZA 1GG6B 1C2MA 4X8TH 2GVFA 4MVNA 1TNHA 3UWIA 1BJVA 1TAWA 2JETC 2BD7A 2PHBA 3RMOH 4R0IA 1SOZA 4RT1A 4A1VA 3SHAH 3ZVEA 1GDNA 1GCTB 3ZZ7A 1OWHA 2ZFPH 2OUAA 1K1IA 1GI9B 2BLVA 5IYTA 4JK5A 1HIAB 3A8DA 2TGDA 1P04A 2BLOA 2Y7XA 8ESTE 2FOBA 3AW1A 3M36A 3H09A 2ZPQA 2G51A 5GCHG 4I31A 4D7FA 3Q77A 4ZROA 3VFEA 3NUMA 4X8SH 1TPOA 1H8DH 1UMAH 2VH0A 5CHBA 1C1TA 3UNRA 3A8AA 2BDGA 1QZ8A 2J2UA 4MPXA 3JZ2B 1OWJA 2ZQ1A 3AAVA 1GJ4H 3M5NA 1CQQA 5C3NA 1NY22 1IQEA 1HAGE 3SNEA 1GHBF 2GT7A 5GWZA 1ZYOA 1OP8A 1RFNA 1GJDB 1BIOA 3AVZA 4YESB 1J17T 4R8TB 3N7DA 1GDUA 4CRAA 4X8VH 4ACBA 2OINA 5DP7A 4X2XA 1SGTA 2C90B 3U98H 4FXGH 2ZC9H 1LKAA 3RC6A 6CHAB 2RA3A 3Q3KA 3F9GA 4WF8A 2FOFA 2ZI2H 2A4OA 1F5RA 4NFFA 1EPTA 3ZZCA 1H8IH 2R3YA 1WUNH 3GISB 1OWDA 1D3TB 9LPRA 5FXLA 1GHZA 1SGFA 1O3KA 3PMBB 3O8RA 5JYIA 1TGTA 1QGFA 5TCAA 2OP9A 1CBWB 1LO6A 2GV7A 4D9QA 1EPTC 1TQ0B 2ZDAH 5A2MH 2GGVB 1FX0B 2ZCLP 2WPMS 3CS0A 5HYOA 4NWLA 3F0PA 4WH8A 4JZ1A 1SGNE 1V2MT 5JB9S 5DP8A 1DLEA 2PLXA 2SNWA 2J95A 1HNEE 3OAAD 5E0JA 3SQEE 2Y82A 2O8MA 3RXQA 3FZDA 4AORA 3PLKA 1FPCH 2H5CA 4D76A 1C1WH 2ZGXH 3TIUA 1F7ZA 3SU1A 1KMHB 1UTMA 1JBUH 1MAYA 6CHAC 5FPYA 1K0HA 3RP2A 2V0BA 4A1TA 1D6RA 2J4IA 4NG9H 5GJ4B 3LPRA 1TGCA 3JZ1B 3VPKA 3UTUH 4DURA 1W13U 1INCA 1MKWK 1S6LA 2Z3EA 4X6PA 1LHEH 3GDSA 4TPIZ 1K1LA 1MQ5A 3RXIA 1TWXB 3FP6E 1UCYK 3RLWH 3SO3A 4CREA 2ZEBA 3EA7A 1EXFA 1Y3UA 1CO7E 1S83A 4AC9A 1BQYA 1YM0A 4OS5A 1OSSA 1TBZH 4NIVA 1BTUA 2ZFRH 2WPJS 1O3NA 2FIRH 2IPQX 2XBWA 4A6LA 1GPZA 2ODQA 2ZZUH 3UNQA 5EJ1A 2KAIA 3K2UA 3SI4H 1RRKA 1YBWA 1OYQA 4AG2A 1ZPBA 1A0LA 1RTLA 3F9EA 1TMUH 7LPRA 2QAAA 2A32A 3A88A 2BY6X 1BZXE 4HG6A 1O2WA 1OWEA 2LELA 1XUKA 4XBCA 3EYDA 2Y81A 3STIA 4XE4A 2A7CA 4NWKA 4DOQA 3CS7A 2IOTA 3VXFH 4NSYA 3BTGE 4OS7A 4ABEA 1P9SA 2VVCA 3AASA 4DJZB 1S6HA 4B6FA 3P6ZB 4MTBA 3GY2A 3UPEA 4AN7A 2AIQA 2O8TA 3FOAA 3PMAB 1OWKA 2J9NA 2PWXA 3RMNH 3R3GB 1EZQA 2EY4C 1TOMH 3U9AH 1XUJA 2JJ2D 1TGNA 3SGAE 1VCWA 2ZTYA 4UFGH 1ZHRA 3KEEA 3O8DA 4I8KA 2F3CE 2PGBB 1HRTH 1GHAF 1FIWA 1C5OH 2VU8E 3DA9B 4ABJA 1TRYA 9ESTA 2VJ1A 3C27B 4K3JA 1YC0A 2GP9B 3SU0A 2A7JA 2WPIS 3RXHA 1ETRH 1GVZA 1O5EH 5GIBA 1D3QB 1Y3VA 1OS8A 3E8LA 1SLUB 5F8ZA 1QTFA 2BOHB 2QF4A 4B2CA 1O35A 4CHAB 2CJIA 3M7UA 2CHAC 1FMGA 2GX4A 4FUGA 2FOGA 4UD9H 1GMCG 2GDEH 1BRCE 3TK5A 1A4WH 4Q2KA 1QCPA 2VVUA 5EOKA 3LC5A 1QB6A 1BUIA 2NWNA 2WPLS 4K1SA 3RXOA 5KECA 1E35B 2WUBA 3S7KB 3TH4H 5FX5A 4K2YA 1A46H 1SQTA 1C5TA 1BRAA 1ORFA 4MG3A 3UY9A 1UHBB 2WZQA 3ZZ4A 2ZGCA 1BCUH 3KGPA 3PO1B 4D8NA 1N6YA 1CVWH 2EA3A 3P8FA 1YY3A 4CRGA 2F91A 3BTFE 1ELBA 3PWBA 3BG4C 5EXLA 1OOKB 2BD9A 4GSOA 1PPEE 5C1YA 4YT6H 1UTLM 3GCOA 2QYIA 1JIRA 1HLTH 4I8GA 1SSXA 1S82A 2J94A 1KXFA 2F9UA 5BPEA 1DX5M 1NFYA 1THSH 3W95A 1V2NT 1ANBA 3ZZ9A 3LJOA 1EFRD 1QQUA 1SPJA 1O31A 4MNWA 2ZHFH 2FX4A 4BTTB 2AH4X 4A1XA 3F9HA 2Z7FE 3GCHC 2FOAA 1KLJH 4B73A 1O37A 1KTTB 1IHSH 4IMZA 1CGJE 3PV2A 5E8EH 2ZTZA 5EQSA 3SV7A 2B7DH 2EEKA 4HI3A 1K1NA 5EPNA 2ZA5A 1WSSH 1CU1A 4H6TA 2P3FH 1K21H 2PKAB 2J34A 3Q76A 2TGTA 3M7TA 2A4GA 4AFZA 3F68H 1NT1A 3BTKE 1AB9C 1ID5H 4AB9A 5C17A 3D62A 5JPMH 5FBIA 3BEIB 1N8OC 2FMJA 1WYKA 4Y8XA 4A7IB 1NO9H 1SC8U 2AGIX 3URDA 5IK2D 5L2ZH 1EOJA 1HJ9A 1QJ6B 2J38A 1BJUA 1CA0B 2P93A 3V3MA 2BD8A 1NRSH 3SHCH 2Q1JA 4ZAEA 2HGTH 1XUHA 2A45B 2ASUB 3UOPA 1A5GH 2XW9A 1H9LB 1F0SA 1ZGIA 1H9IE 3H7TA 1DWDH 2BD4A 3M35A 4Y71A 3GCTG 1H8HD 1RIWB 2AFQB 1SOTA 2OQ5A 1V2QT 3PLBA 2HVYB 1O5DH 4JYTA 1FZZA 4RSPA 1P2OA 3OTPA 4BTIB 1HFDA 4RKJB 3BV9B 5KEDA 3MO9A 4GCHG 1GI6A 2EI8A 1EAXA 1HYLA 3PMJA 3RUOA 1ZRKA 1XX9A 1YP9A 2YOLA 3RXKA 3V13A 2THFB 3L6PA 3NWUA 1P12E 5EODA 1RTKA 2JIZD 4LXBH 3FKSD 4TWWA 3E16B 5GXPA 1FAXA 4KGAA 1RIWC 2KCOA 1SGCA 4LZ4B 1ZJDA 1CA8B 1DDJA 1E36B 5EW2H 1GHVH 5JBBS 2QGRA 3ZZ6A 1ZSLA 3K9XB 4OGYA 2ZHQH 1C2IA 3T5FH 4CH2B 4OGXA 2ZCKP 4Z0KA 2YNBA 1JRTA 5EJLA 2ZDKA 1EB1H 4KKDA 4ABGA 4B71A 3TK6A 1DVAH 4AYYB 4E06H 1EPTB 5B6OA 2RFKC 4PROA 3IWMA 4ISNA 1ARCA 1A5HA 4WVPE 2OCVB 1AIXH 1DS2E 2ZU3A 1O2XA 1GI0A 2ZTXA 1E79D 1ARBA 2Q6FA 4DT7B 1QIXB 3RXCA 1TFXA 1ZPZA 3WWFA 4TSFD 4X0WU 1QY6A 4WXIA 1O3JA 2TGAA 4FOUC 5DK1A 1GGDC 3RU4D 5E0HA 2HLCA 1O2JA 4WXVA 2BY5X 2B5TB 1MTVA 1EZXC 1LKBA 2Y5GA 2H9EH 1TX8A 1Z71A 3BTDE 3MO3A 4AFQA 4DIHH 1LVYA 1TRMA 2BQWB 2JETB 3FFGA 2VWOA 4Y7BA 3GY5A 1THPB 3HPTB 1PPFE 1C9PA 4JMYA 1AY6H 1PPHE 1OX1A 1ANEA 3TGJE 3Q00A 5DO4H 3PO1C 1ABIH 2ZGHA 3BIVH 3EE7A 1O2LA 3QN7A 4BNRA 1C5UA 3VB7A 4K1TA 1E1QD 2SNVA 2PUQH 3GYMA 2FTLE 1L1JA 2O8LA 4ZXYH 2DE9A 4TY6A 4U01A 3F9FA 1KXEA 1TALA 2F9OA 1A2CH 2R0LA 4M7GA 4JK6A 4ABDA 5FHTA 1K1MA 5FCRA 1XKAC 1D9IA 1FPHH 4F55A 4FVDA 5F6MA 1PJPA 1WAYB 1A1RA 4O9VA 1C5MD 2HRVA 3ZZAA 4WY3A 1IAUA 2IJOB 1DOJA 1KDQA 3PYHA 5E2PA 1DUAA 1C4Y2 1TRNA 3OEHD 4B2AA 1BMFD 1DT2A 3PTNA 1P2IA 1LPKB 2ESTE 2ODYB 3CNRA 3P8NA 3FP8E 2UUKB 2C8ZB 2Y5FA 2ZF0H 2W7SA 1KIGH 1SKYE 4Q7YA 3OY6U 1MD7A 1W14U 4YZUA 2CF9H 1O2YA 1FN8A 1CGHA 2GMTC 3U69H 1ZMJA 4AFUA 1D3DB 1AU8A 1K28D 4B6EA 1AMHA 1Z6JH 2K1QA 4O3TA 5CDFE 3MH5A 3DSPA 3RXAA 2D26C 1TMTH 7ESTE 2W6ID 2B9LA 2UUYA 4B76A 1NESE 3S9BA 2UUJB 1OXGA 1EJMA 4Y79A 2P3UB 1QB9A 1KSNA 1DITH 2Y80A 1VCPA 2BVRH 2CMYA 3AW0A 1J15A 1OWIA 5T3HA 1YLDA 1V2WT 3A7TA 1C2GA 1JMOH 1ZPCA 3A86A 1QBVH 4I32A 3FN8A 1QNJA 5FX6A 4Q63A 1QL7A 2VIDA 2FYQA 3W94A 2BVSH 1Y8TA 4IN1A 2BX3A 5LGOA 2XCFA 3ESTA 1FV9A 4NA9H 1W7XH 2QN5T 2PGQB 1C1UH 2ANMH 1T8NA 1TGSZ 1VITF 1MQ6A 1SGYE 2ZGBH 2FOMB 3GDUA 3VEQB 1S6FA 4ABFA 1P03A 1TBQH 3UB0A 3S0NA 4TY7A 3KNXA 3RXBA 1BRUP 2JH6D 1B5GH 4OM9A 1DUEA 1EAUA 5CHAB 4X2WA 2DUCA 1FDPA 3TH3H 4MPVA 3KCGH 2J98B 4NSVA 2ANYA 2BX4A 1UK2A 1DLKB 1C9TA 1XXDA 2AEIH 4YLUA 5FL7D 3KN2A 3SNCA 5AF9H 2G00A 5C67A 1S0QA 2BDAA 1V2KT 1MTNC 1YPHE 5LH8A 1UTKA 5E2OA 1C2FA 1PQ8A 2ILNA 1XUFA 3MU5A 2BYAX 3SU5A 1C1QA 2F9PA 2R2MB 1H8ED 2VVVA 2EC9H 3H7OA 1GGDB 2C8WB 2XBVA 1QBOA 2ZCHP 8GCHG 1HIAA 2GD4B 2HVXA 4O03A 4F48B 3T26A 4SGBE 1AO5A 1IQNA 1HAVB 2A4QA 1ZHPA 3LGYA 1AKSA 1LDTT 2M5TA 1O3GA 3E0PB 1LQDB 5LPFA 4XD7D 1CHOG 1ELCA 2PKSB 3ZZBA 2UWPA 1FI8A 4I8HA 3U1IB 1O3HA 1AI8H 1KXCA 1W0JD 1SLWB 4INLA 5L6NH 1Z8RA 1L0ZA 1O2GH 1SGEE 1O30A 4OS2A 3KHVA 3S9CA 1O3LA 5A0AE 2BZAA 4X8UH 5T1VA 1O3EA 2FOEA 3BG8A 1MKXK 4F49A 3OY5U 3F2GA 1EQ9A 1KY9A 4KTSA 3ZVCA 3VB3A 3SJOA 1V2LT 3SGQE 1YKTA 3SI3H 2VB0A 2Y5HA 1W12U 3RMMH 2BMGB 4FU7A 3A7YA 1KXDA 2ZP0H 4O3UA 1G2MA 1WTGH 2WPKS 1NROH 1HXFH 1MCTA 3L3TA 4JYVH 5DN6D 1F0TA 4CH8B 1U6QA 3ZZ8A 1MBQA 2P59A 1WQVH 1DM4B 5LPRA 1EP5A 5DP3A 1G3DA 1YPLH 4AGKA 1BHXB 3C1KA 1MAXA 3LC3A 2W3IA 1YPEH 2EQNA 1NFUA 3M5LA 4JZFH 1AUJA 1LMWB 1ZMNA 1ETSH 1YLNA 2Z6BD 2ALVA 4FUDA 5A09A 2TPIZ 1PYTD 5CE1A 3SNAA 3TH2H 1LVBA 2NU4E 3LGVA 3QDZB 4Y8YA 1WXRA 1MU6B 2ANWA 4E05H 3KQEA 2BD5A 1O5CB 3BTWE 3SU6A 3MNSA 1P3CA 3TVJB 3SW2B 2GCHG 4ZKOU 2BLQA 3KL6A 1OKXA 1A0HB 1P01A 3EA9A 2FP7B 1TNKA 3I29A 3ZV9A 3DD2H 4MPWA 3NK8A 2YMSD 3SUGA 4Z6AH 4GHQA 4RN6A 5C94A 1Z8IB 2JKHA 4KP0A 2Y6TA 4FUEA 2UUFB 1QB1A 3T62A 4AB8A 3ELAH 1MZAA 2NU3E 1NS3A 5PTPA 1BA8B 2FOHA 2Z9IA 3DSGA 1WCZA 3CENA 2WPHS 5F8XA 2F9BH 1L2EA 1VZQH 1SL3A 2GCTC 3OE7D 1UK3A 4P00A 5CHAC 2M2AA 5C5NA 4ISHH 1VITH 1P05A 3AAUA 3ITIA 3RXMA 1MZDA 4CR9A 3Q3YA 1BMAA 1UVSH 2ZIQH 4JZEH 2WSSD 1UTNA 2ULLA 2BDHA 4UFEH 2AGGX 1K22H 1HPGA 1QBNA 1ZLRA 1EASA 1MCVA 2JJ1D 4ISOA 3D23A 4GAWA 5I46H 3PWCA 3U28C 1HUTH 5BRRE 2Z9JA 1C5XB 4DIIH 1AFQC 2CF8H 3VXEH 2D8WA 2VINA 3MH6A 3RXUA 3U1JB 1PYTC 3CP7A 2KX4A 2ZHEH 1TYNA 4K69A 1BBRK 1NRPH 3RXTA 3MU1A 4ZCNA 3S7HB 1S81A 4Q7XA 1PPGE 3ZZDA 4XFQA 7GCHF 2P16A 4I33A 2W7UA 1HXEH 1WBGB 2ZFSA 4X2YA 1V2ST 3UNSA 4B75A 1AGJA 1TABE 1KXBA 4H6SB 1SGDE 1NRNH 3B23B 3VB6A 4E7RG 1LHFH 1EZSC 4X1SU 1C2EA 4SGAE 2ZU1A 4CRCA 3RXFA 1V2VT 3LGWA 4AOQA 1QRWA 2ZU2A 2STAE 3P92A 1J16A 3U8RH 1DWBH 1Q3XA 2SGDE 1HAXB 3LH3A 1G3BA 1IQMA 3V12A 2ZHWH 1VJ9U 4ASHA 3MU4A 3TJNA 1V2OT 2F9NA 4ZUHA 5IDKA 2V3OH 1GJBB 1UVUH 4NIYA 1SHYA 3A83A 1WOFA 1B0FA 2F43B 2FI5E 3EAJA 4BAQB 5K0HA 1K2I1 1O2NA 1AB9B 1SQRA 3SU4A 1LCYA 3LGUA 5A8XA 1HAZB 2FXRA 3M7QA 2XNDD 3I77A 2ZU4A 1LPGB 1Y3YA 4FUHA 4KTCA 1Z6EA 3T28A 4BTUB 4BAHB 4X2VA 1E37B 1P9UA 1SFIA 2G4UA 1KXAA 1E0FD 2BDYA 4WH6A 1G37A 1YPHC 1H9HE 1W8BH 1O2HA 2VH6A 1MKWH 2Z94A 5TJXA 1D3PB 4ESTE 2OLGA 3Q3XA 1K1JA 2C3SA 2QY0B 3SNDA 5E0GA 3E6PH 1BITA 3F2FA 5JBCS 1C5NH 1TOCB 5ETXA 3ZVFA 2XC0A 1RJXB 1O3MA 2F4LA 1O2ZA 3GS9A 4KELA 4INKA 1DWEH 3QO6A 5G4BA 1ABJH 3MU8A 5HM9A 3DFLA 1OP2A 5T6GA 1GCTC 2QXHA 2WV4A 1EAWA 2CHAB 3WW7A 2G81E 3LDXH 2JDID 1T31A 2ZDMA 1VCQA 5FBEA 1T8LA 1ZRBA 4IW4E 4NCYA 2A5IA 1CHGA 1WU1A 2CGAA 4ABBA 1BTPA 1N6XA 4K8YA 4XBDA 1LQEA 3NRLA 3HGNA 2CXVA 2QXGA 1HGTH 2BB4A 1IQKA 1O3AA 1NU9A 2A7HA 1C5SA 3VGCB 1SGFG 3SUEA 1NC6A 4I7YH 5H4IB 1ELVA 1CGIE 1TIOA 1VITG 1IOEA 3MU0A 1ZZZA 3PROA 4NIXA 3SBKA 2J98A 1FQ3A 4FUFA 1YPJH 4GUXA 2ZO3H 4WMEA 5AHGH 1KLIH 1Z8JB 1GMCF 3HKIB 2GZ9A 1T4VH 4YLQH 2KZ4A 1T32A 1A5IA 2QXIA 4LZ1H 1XM1A 1KTSB 1AE8H 3TJUA 3K65B 1EP6A 4ZXXH 1ESAA 3ATMA 4ZKRU 4DT4A 1GBIA 2PSYA 1CHOF 4FU8A 2CV3A 2B8OH 1FXYA 1FY1A 5C0TA 3GY6A 4YO9A 1EZUC 2BTCE 1O5GH 1W0YH 1HDTH 1LTOA 1ELGA 3IG6B 2XTTB 1V2TT 3TU7H 3B8JA 1SI5H 2W3KA 1B7XB 5SGAE 3ATIA 1TE0A 1SFQB 3M3VA 3V0XA 3STJA 2GMTB 4YTAA 1TB6H 2KCPA 1AKSB 2XXLA 1C5RA 3SYJA 1K9OE 5C0UA 2OD3B 3GDVA 5EQRA 3HATH 2IPHA 1TA6A 3OEED 3UQOA 2AMDA 3MTYA 5A0BA 2ZNKH 3FVFB 2JH5D 2O8UA 4A5TS 2BHGA 4Y8ZA 1SMFE 2ZWLH 1AFEH 3ATKA 4IC6A 3D49H 1WTHD 3DHKH 1NRQH 2OXSA 1C5LH 1O2OA 4FETA 2A0QB 1VJAU 2FI4E 1O2QA 5LPEA 1CT0E 1P3EA 1GHAG 5T6FA 4INHA 1YPGH 3H5CB 4WJG2 1QA0A 2O8WA 3S9AA 1SVPA 3SU2A 1MABB 1AVGH 1RXPA 3BIUH 4I8JA 4CBNA 2OQUA 2C93B 4HFPB 1AQ7A 1DSTA 1GJ9B 3RXGA 2W5EA 3A82A 4ZH8A 1ZOMA 3RLYH 3M5MA 3K6YA 4MPUA 1ZMLA 2SGPE 1K1PA 4MDSA 4ABHA 1IQGA 1DFPA 1KDQB 1O2MA 2FZZA 5EPYA 4OS4A 1W3CA 3NZIA 1MH0A 3SJ8A 4YXWD 1TNGA 4ISIH 1GJ5H 1O36A 1Q31A 3SV2H 3N7EA 2BDIA 2XWAA 1O3OA 1GVKB 4J2YB 5C2ZA 2WINI 1DXWA 1CBWC 1XMNB 1C5QA 1GHWH 1TA2A 1VGCC 5DPAA 1QURH 4JCNA 3RXJA 1IHTH 1GBBA 1O2RA 2J92A 2A5KA 2FLRH 5FPSA 1P2JA 1W10U 1ELTA 2XYAA 1FY5A 3OSYA 1MUEB 3TPIZ 1BMNH 4NA7A 1P2QA 2XC5A 2H6MA 4AZ2B 1FUJA 1YCPM 2FDAA 1C4V2 1O38A 4CRBA 4VGCC 2Z3CA 1BTZA 1GJCB 1BMMH 3FO8D 1P2KA 1UTPA 3W1EA 1GCDA 2AS9A 4FVBA 1SGIB 3A7XA 1F2SE 1O3BA 1J8AA 2P8OC 3TJOA 5T6DA 2QA9E 2AYWA 3MO6A 2PFEA 1HJ8A 1T7CA 2SGAA 3A89A 1PFXC 2F83A 5C5OA 3SQHE 1MTSA 4MLFB 1CSOE 1L1NA 3NCLA 3KIDU 1WDIA 5I25A 5J4QA 3VGCC 2PV9B 1GBCA 2HNTE 4J1YA 1NBMD 2V6NA 1ZJKA 3QUMP 2P3TB 2YNAA 1XXFA 2C4FH 1RGQA 4ZHLU 3ZZ5A 2BDCA 1CT2E 2WV5A 5EXNA 2SGFE 4OS6A 4DVAU 4A92A 2Z9GA 3A7ZA 3MOCA 3P70B 5AVDA 1A0JA 5FCKA 1QJ7B 2OC1A 3EGKH 1ZHMA 2TIOA 2ZFTA 2FESH 1GJAB 4FUIA 3ZYEA 1SQAA 5AFYH 4YM9A 4X6MA 4I86A 1SGRE 2QC2A 1C1OA 5FPTA 1IQFA 1O2VA 1O3DA 4AX9H 2YMSC 1HAVA 3E1XB 1O3FA 1GI3A 3RMLH 2WV9A 1SLXB 3LIWA 3GCTF 2VIQA 1GG6C 1TX6A 2R2WU 4YOIA 1MD8A 4DG4A 1V2PT 1Y3XA 3LONA 2AHME 3SUDA 3AK5A 1P0SH 2BY9X 1SHHB 2AGEX 1G3EA 1YCPH 3ATWA 2A2XH 3P8OA 3O8BA 2K0QA 2A31A 1RTFB 1GI8B 3R0FA 4ISLA 3P8GA 3LGTA 1NFXA 4IC5A 3SN8A 5A0CA 1S84A 3DFJA 2NU2E 4FUJA 1P10A 3F6UH 1FJSA 3F2HA 1Y59T 1P09A 2EI7A 3QTOH 1QA7A 5EG4A 1P8VC 1GI7B 1IQIA 2GZ8A 1FONA 1SR5C 1TMBH 1NN6A 2ZGJA 3ZVBA 1T8OA 2BD3A 2G52A 1GJ6A 3FP7E 1PQAA 1MU8B 3SZEA 5ABWA 4GPGA 4HGCA 3SV6A 1E38B 1BB0B 2QE7D 1ELAA 2QV1A 1IQLA 4NFEA 1GBDA 2FM2A 3UFAA 4K1EA 3SOSA 4TYDA 3ENSB 3UOUA 2KFWA 5C1UA 1THRH 3RM2H 1VKYA 1Z1IA 2VIOA 1GI1A 2RCEA 1J9CH 3F1SB 4NZQA 5GPIB 4X6NA 3UR6A 3ODDA 1B0EA 1O2TA 1S5SA 2GT8A 1YLCA 2PTCE 2ZU5A 3SV8A 3E3TA 2HPQH 4F4OC 1TONA 4AG1A 3E0NB 2BM2A 1GHYH 1MTUA 1HAIH 2ANKH 1LHCH 1BTHH 1YF4A 3MMGA 2L74A 4BAOB 1F5LA 3KQ5A 1ZTKA 2VIVA 2HPPH 3TITA 2QCYA 1AUTC 4NGAH 2QXJA 4X6OA 2XC4A 1EB2A 4UFDH 3WY8A 3LJJA 1DY8A 1EAIA 2GJGA 3URCA 2ZPSA 4IS5A 1AFQB 1UVPA 5TCCA 3GCHB 2I6QA 1GBFA 1HAYB 1YPKH 1MTNB 4B74A 1X7AC 1EKBB 3A81A 3SZNA 5CMXH 2ZFQH 8KME2 1UTOA 1PPCE 4Q7ZA 1O0DH 3F0OA 1QRXA 2W6JD 2FWWA 3HGPA 3VB5A 2PW8H 3UREA 3QTVH 1G30B 1NPMA 1DSUA 4D7GA 4ZHAA 1YYY1 2QF5A 5F8TA 1C1RA 2WYJA 1Y5AT 1TPAE 1F5KU 2FYRA 2G5NA 1UCYE 2GCTB 1QFKH 2D2DA 1BT7A 1BTYA 1O2IA 1YGCH 5DP4A 1FNIA 6ESTA 2JH0D 2HWLB 3RXPA 1L1GA 3G01A 1PQ5A 1LHDH 1AZ8A 1L4DA 1BBRE 3LH1A 2VNTA 3T2NA 1BDAA 5HKKD 2HLDD 1AE5A 1ZTJA 4WWYA 1FY3A 2FLBH 4THNH 1GL1A 1SGPE 1C1PA 4NIWA 1YPMH 1HAOH 3LGIA 2R3UA 3RXDA 1GMHF 1O2PA 4ZHMU 1Z8GA 1BOQA 2QF3A 4MQAA 3NPSA 1PPBH 1ELFA 3M3SA 3S69A 3A87A 3DUXH 1F0RA 5HM2A 4FUCA 2TBSA 1SQOA 4M9FA 4IN2A 3QLPH 4ZMAH 2H9HA 1C5ZB 3QX5H 1TPSA 2C8XB 3MNBA 1HCGA 1GI4A 1ESBA 3B9FH 2Z9KA 1P11E 3V7TA 3T27A 4P02A 4ABIA 2Q6DA 1JIMA 2A4RA 5HIYA 3ZYDA 2PKSC 1HJAB 1C4U2 2BXTH 3MI4A 1QJ1B 5EJZA 4DGJA 4UEHH 1QQ4A 3PV4A 3A7VA 5FAHA 3P17H 4E7NA 4HTCH 3ZVAA 2R9PA 3BTME 4XDEA 1E34B 1A7SA 1G36A 1DE7H 1UTQA 2K8IA 2SGEE 3BTEE 1O3IA 1XUIA 4MNXA 1JOUB 2B0FA 3E90B 5F03A 2XNIA 4XBBA 3LKWA 1H4WA 2V35A 2VBCA 3SV9A 5ESBA 1NZQH 2GV6A 2AMPA 2CN0H 1HB0B 4HZHA 3MNXA 4Z1MD 1TLDA 1QL8A 2KCYA 3KQCA 3TLOA 3KYGA 1H1BA 1XKBC 2HNTC 3RU4E 3QK1A 3D65E 2ALPA 2WPDD 2BLWA 3TGIE 1NU7B 5GNDA 3L33A 3M3TA 1QRZA 2KCAA 2ZKSA 5DGJA 5HXFA 1GVLA 1GBHA 1EX3A 2Q6GA 3UQVA 4H4FA 1DWCH 1SGQE 2BQ6B 1GBJA 3A8BA 2UWLA 1O32A 2Y7ZA 1AVXA 4JZIA 2IJD1 2FO9A 3PV5A 3T29A 1AZZA 2FODA 1N1LA 4UDWH 1IQHA 1W2KH 3MFJA 1GJ8B 2HALA 4XSKU 2LPRA 2AIPA 1ANDA 2D1JA 1FAKH 4XOJA 1BHXF 4CRDA 1OP0A 4X1QU 1GMDF 3ZIAD 1RS0A 3MH7A 1IQJA 3UR9A 2RDEA 4YOGA 1FLEE 2P95A 5L2YH 1COWD 8LPRA 2GTBA 2V3HH 4XRNA 3P95A 4LOYH 1O34A 3BG4B 4JYUH 4B1TA 2GKVE 2TRMA 5EXMA 1LHGH 1MMJN 1P06A 3RDZA 2BVXH 5HGGA 3FANA 3PRBA 2ZDVH 1OHHD 2KAIB 3TGKE 3LOXA 5A8ZA 1T4UH 4NZLA 1V2JT 1AHTH 1FY8E 1AWHB 3RXVA 4ASUD 2YMSB 1C1NA 3TK9A 3EDXB 2OBOA 4UONA 4CRFA 1ELEE 4BXWA 3DCLA 3DSOA 1HV7A 3OYPA 4GCHF 2VIPA 2VWNA 4U32A 2ZQ2A 1GHXH 5GCHF 1QR3E 4CHAC 1M9UA 5F53A 1O5BB 3A85A 3MNCA 1TPPA 2Z3DA 2PR3A 7GCHG 4K60A 2OBQA 2FS9A 3M37A 3RXEA 1G32B 1K1OA 3SNBA 1WV7H 5DG6A 2VWLA 1DY9A 3I78A 5DP5A 3BTQE 2Z9LA 1EUFA 1TBRH 3ZZ3A 2A1DB 1P02A 4JZDH 3KF2A 2W26A 3ATLA 3RXRA 1UCYH 1O39A 7KMEH 2VGCC 4IBLH 4U30A 4BOHA 3GCNA 4X1PU 1O2SA 1ZR0A 2BY8X 4Y0ZE 3NXPA 1V2UT 2XBYA 3HKJB 3EE0B 4UE7H 1Y5BT 1C1MA 2FOCA 1FY4A 1BRBE 3ZV8A 3MQKC 2FI3E 1Q2WA 1D6WA 1C5WB 1FIZA 3QZQA 4GLYA 2STBE 4X1RU 3N99A 5HMAA 5C1XA 3KYFA 2C8YB 2OC7A 4YT7H 3MWIU 4K5ZA 1RD3B 1QL9A 2GDDA 2UWOA 5B6LA 4O97A 1GI5A 2H9TH 2BQ7B 1O3PB 2A5AA 3QZRA 4AFSA 4LK4A 1O5AB 1HAHH 1P2MA 2BDBA 2G5VA 4YOJA 3SJIA 2ZG0H 1BTXA 4D9RA 4Y6DA 1G9IE 4Q80A 1W11U 3A84A 3GY7A 1N8OB 1NM6A 2O9QA 4Y11E 3UUZA 5J4SA 3RXLA 2AERH 2R0KA 1CE5A 5ESTE 3GY3A 3QWCH 3A8CA 1W7GH 1C1VH 4MNVA 4KTUA 4TPYA 4AYVB 4FU9A 1D4PB 1G2LA 5K7RA 2FX6A 1GBLA 1TX7A 1UVTH 2A2QH 3BEUA 1TNJA 6GCHF 1V3XA 1EJNA 1GBAA 1KLTA 3BTTE 3PMHB 3LT3A 5HIZA 3ODFA 4DW2U 1MTWA 2CK3D 1BMLA 1O2UA 2NU1E 1ACBE 1EJAA 5KGOA 3RC4A 2V3MA 1ZSJA 3F3BA 2KM0A 5DJ7A 1TGBA 2XRCA 1L4ZA 4ZKSU 1Z7KA 2OTVA 2VWMA 5JDUB 3SORA 2J97A 4NA8A 2WUCA 1O3CA 4U2WA 1J14A 2ZECA 3ZVGA 4VGCB 2KR7A 3PTBA 2QIQA 5JBAS 1ZGVA 3KQDA 1GL0E 2XOKD 4FUBA 4DCDA 1PPZA 3GY8A 1OPHB 1ELDE 1TNIA 1JRSA 1VR1H 3BN9A 5AFZH 6LPRA 2PKAA 2RG3A 3GY4A 2PP6A 2OC8A 4H42U 3M5OA 3OTJE 2V7QD 2ZFFH 3RM0H 4X1NU 3TNTA 1C2JA 1GDQA 1EOLA 3SGBE 1NBME 3MH4A 2IN2A 4DY7B 2GZ7A 1DPOA 5EIYA 1C2KA 3FZZA 1GWAA 2OC0A 8GCHF 4ABAA 4QT8C 2QF0A 4BAKB 1GBTA 2BZ6H 1UTJA 3EQ0H 3PM3A 2VIWA 2FS8A 1GMHG 1W0ZU 3QGJA 4ZKNU 1GBKA 4B2BA 3KQBA 2AMQA 1Z1JA 3NKKA 1UVOA 3U8OH 3O8CA 1FN6A 1C2DA 1OYTH 1GJ7B 5A8YA 1C5PA 4WMFA 1SLVB 6GCHG 1GBMA 4Y7AA 2NU0E 2L6OA 3RU4T 2PSXA 4ACAA 4CBOA 3SUFA 1VGCB 3WWBA 1ESTA 1T8MA 1F0UA 1PQ7A 1A61H 3RC5A 1G3CA 1UW7A 3E91A 5DP9A 1V6DA 1Y5UT 4K8BA 5JB8S 2LNCA 1GMDG 2HOBA 2P94A 2SFAA 1DXPA 3UAIC 2J5UA 3OX7U 2ZHDA 4Q4LA 1ANCA 4BAMB 2LP6A 1S85A 5JBTA 3BF6H 3VB4A 4RKOB 5DP6A 1NRRH 4I8LA 2VGCB 1EATA 2RDLA 3BEFB 3N7OA 3HK6B 1V2RT 3SU3A 4UFFH 4TT3D 3EA8A 3MHWU 5DKMA 4Y10E 5GDSH 3GYLB 1C5YB 1DICA 1AVWA 3A7WA 2BXUH 3TNSA 5EW1H 2EI6A 3RXSA 4IGDA 1SB1H 3SJ9A 1XVMA 2TGPZ 4OS1A 1F92A 1CT4E 1ZTLA 1AD8H 1XUGA 3FAOA 1BTWA 1CA0C 2SGQE 2XBXA 1ZSKA 1NFWA 1UK4A 2G8TA 1UHBA 2H1UA 3K6ZA 1BBRH 1AWFH 3M61U 1O5FH 3OFND 4IMQA 2ZDNA 1A3BH 2ZPRA 2H2ZA 2XWBI 2WHXA 1Y3WA 2XCNA 3GICB 2GCHF 1MBMA 2ZDLA 4RI0A 2OK5A 1P2NA 1HBTH 4WMDA 1C5VA 1GI2A 2FEQH 1O33A 1UJ1A 1HAPH 3HK3B 4Y0YE 3T25A 4CR5A 2WYGA 4AGJA 1C2LA 3MYWA 1LPZB 1TNLA 4BXSA 1A3EH 1P57B 3IITA 2FTMA 2G4TA 2P8OB 4BANB 1O2KA 2BOKA 4Y76A 5EU8A 1C1SA 1WQSA 3A80A 1LVOA 3UIRA 5C20A 3ZVDA 1JXPA 1YWUA 2F9VA 1TQ7B 1MKXH 3PRDA 1XVOA 1ETTH 3GOVB 5EQQA 1KYNA 2G55A 3VG8A 3LU9B 1QHRB 1YCPK 1JWTA 2I6SA 3UWJH 1E1RD 1HJAC 3PB1E 1GHBG 4MNYA 1W0KD 2ODPA 3DT0H 4TWYA 1C2HA 3TJVA 3U8TH 4RT0A 3SJKA 3OU0A
chains in the Genus database with same CATH topology
2HNTF 5L30H 2BD2A 4GHTA 5EGMA 1DANH 2PUXB 3BSQA 2PTNA 4GVUA 1UO6A 1GBEA 3PLPA 1SG8B 1LVMA 2RA0A 3QGNB 1SBWA 1S0RA 1AN1E 2BY7X 1NTPA 2DE8A 2H5DA 3BTHE 2FPZA 1GG6B 1C2MA 4X8TH 2GVFA 4MVNA 1TNHA 3UWIA 1BJVA 1TAWA 2JETC 2BD7A 2PHBA 3RMOH 4R0IA 1SOZA 4A1VA 3SHAH 3ZVEA 1GDNA 1GCTB 3ZZ7A 1OWHA 2ZFPH 2OUAA 1K1IA 1GI9B 2BLVA 5IYTA 4JK5A 1HIAB 3A8DA 2TGDA 1P04A 2BLOA 2Y7XA 8ESTE 2FOBA 3AW1A 3M36A 2ZPQA 2G51A 5GCHG 4I31A 4D7FA 3Q77A 4ZROA 3VFEA 3NUMA 4X8SH 1TPOA 1H8DH 1UMAH 2VH0A 1C1TA 3UNRA 3A8AA 2BDGA 2J2UA 4MPXA 3JZ2B 1OWJA 2ZQ1A 3AAVA 1GJ4H 3M5NA 1CQQA 5C3NA 1NY22 1IQEA 1HAGE 3SNEA 1GHBF 2GT7A 5GWZA 1ZYOA 1OP8A 1RFNA 1GJDB 1BIOA 3AVZA 4YESB 1J17T 4R8TB 1GDUA 4CRAA 4X8VH 2OINA 5DP7A 4X2XA 1SGTA 2C90B 3U98H 4FXGH 2ZC9H 1LKAA 3RC6A 6CHAB 2RA3A 3Q3KA 3F9GA 4WF8A 2FOFA 2ZI2H 2A4OA 1F5RA 4NFFA 1EPTA 3ZZCA 1H8IH 2R3YA 1WUNH 3GISB 1OWDA 1D3TB 9LPRA 5FXLA 1GHZA 1SGFA 1O3KA 3PMBB 3O8RA 5JYIA 1TGTA 1QGFA 5TCAA 2OP9A 1CBWB 1LO6A 2GV7A 4D9QA 1EPTC 1TQ0B 2ZDAH 5A2MH 2GGVB 2ZCLP 2WPMS 3CS0A 5HYOA 4NWLA 4WH8A 4JZ1A 1SGNE 1V2MT 5JB9S 5DP8A 1DLEA 2PLXA 2SNWA 2J95A 1HNEE 5E0JA 3SQEE 2Y82A 2O8MA 3RXQA 3FZDA 4AORA 3PLKA 1FPCH 2H5CA 4D76A 1C1WH 2ZGXH 3TIUA 1F7ZA 3SU1A 1UTMA 1JBUH 1MAYA 6CHAC 5FPYA 3RP2A 2V0BA 4A1TA 1D6RA 2J4IA 4NG9H 5GJ4B 3LPRA 1TGCA 3JZ1B 3VPKA 3UTUH 4DURA 1W13U 1INCA 1MKWK 2Z3EA 4X6PA 1LHEH 3GDSA 4TPIZ 1K1LA 1MQ5A 3RXIA 1TWXB 3FP6E 1UCYK 3RLWH 3SO3A 4CREA 2ZEBA 3EA7A 1EXFA 1Y3UA 1CO7E 1S83A 1BQYA 1YM0A 4OS5A 1OSSA 1TBZH 4NIVA 1BTUA 2ZFRH 2WPJS 1O3NA 2FIRH 2XBWA 4A6LA 1GPZA 2ODQA 2ZZUH 3UNQA 2KAIA 3K2UA 3SI4H 1RRKA 1YBWA 1OYQA 4AG2A 1ZPBA 1A0LA 1RTLA 3F9EA 1TMUH 7LPRA 2QAAA 2A32A 3A88A 2BY6X 1BZXE 1O2WA 1OWEA 1XUKA 4XBCA 3EYDA 2Y81A 3STIA 4XE4A 2A7CA 4NWKA 4DOQA 3CS7A 2IOTA 3VXFH 4NSYA 3BTGE 4OS7A 4ABEA 1P9SA 2VVCA 3AASA 4DJZB 1S6HA 3P6ZB 4MTBA 3GY2A 3UPEA 4AN7A 2AIQA 2O8TA 3PMAB 1OWKA 2J9NA 2PWXA 3RMNH 3R3GB 1EZQA 3U9AH 1TOMH 1XUJA 1TGNA 3SGAE 1VCWA 2ZTYA 4UFGH 1ZHRA 3KEEA 3O8DA 4I8KA 2F3CE 2PGBB 1HRTH 1GHAF 1FIWA 1C5OH 2VU8E 3DA9B 4ABJA 1TRYA 9ESTA 2VJ1A 3C27B 4K3JA 1YC0A 2GP9B 3SU0A 2A7JA 2WPIS 3RXHA 1ETRH 1GVZA 1O5EH 5GIBA 1D3QB 1Y3VA 1OS8A 3E8LA 1SLUB 5F8ZA 1QTFA 2BOHB 4B2CA 1O35A 4CHAB 2CJIA 3M7UA 2CHAC 1FMGA 2GX4A 4FUGA 2FOGA 4UD9H 1GMCG 2GDEH 1BRCE 3TK5A 1A4WH 4Q2KA 1QCPA 2VVUA 5EOKA 3LC5A 1QB6A 1BUIA 2NWNA 2WPLS 4K1SA 3RXOA 1E35B 2WUBA 3S7KB 3TH4H 5FX5A 4K2YA 1A46H 1SQTA 1C5TA 1BRAA 1ORFA 4MG3A 3UY9A 1UHBB 3ZZ4A 2ZGCA 1BCUH 3KGPA 3PO1B 4D8NA 1N6YA 1CVWH 2EA3A 3P8FA 4CRGA 2F91A 3BTFE 1ELBA 3PWBA 3BG4C 5EXLA 1OOKB 2BD9A 4GSOA 1PPEE 5C1YA 4YT6H 1UTLM 3GCOA 2QYIA 1JIRA 1HLTH 4I8GA 1SSXA 1S82A 2J94A 1KXFA 2F9UA 5BPEA 1DX5M 1NFYA 1THSH 3W95A 1V2NT 1ANBA 3ZZ9A 3LJOA 1QQUA 1SPJA 1O31A 4MNWA 2ZHFH 2FX4A 4BTTB 2AH4X 4A1XA 3F9HA 2Z7FE 3GCHC 2FOAA 1KLJH 4B73A 1O37A 1KTTB 1IHSH 4IMZA 1CGJE 5E8EH 2ZTZA 5EQSA 3SV7A 2B7DH 2EEKA 4HI3A 1K1NA 5EPNA 2ZA5A 1WSSH 1CU1A 4H6TA 2P3FH 1K21H 2PKAB 2J34A 3Q76A 2TGTA 3M7TA 2A4GA 4AFZA 3F68H 1NT1A 3BTKE 1AB9C 1ID5H 4AB9A 3D62A 5JPMH 5FBIA 3BEIB 1N8OC 2FMJA 1WYKA 4Y8XA 4A7IB 1NO9H 1SC8U 2AGIX 3URDA 5L2ZH 1EOJA 1HJ9A 1QJ6B 2J38A 1BJUA 1CA0B 2P93A 3V3MA 2BD8A 1NRSH 3SHCH 2Q1JA 4ZAEA 2HGTH 1XUHA 2A45B 2ASUB 3UOPA 1A5GH 2XW9A 1H9LB 1F0SA 1ZGIA 1H9IE 3H7TA 1DWDH 2BD4A 3M35A 4Y71A 3GCTG 1RIWB 2AFQB 1SOTA 2OQ5A 1V2QT 3PLBA 1O5DH 4JYTA 1FZZA 4RSPA 1P2OA 4BTIB 1HFDA 4RKJB 3BV9B 3MO9A 4GCHG 1GI6A 2EI8A 1EAXA 1HYLA 3PMJA 3RUOA 1ZRKA 1XX9A 1YP9A 2YOLA 3RXKA 3V13A 2THFB 3L6PA 3NWUA 1P12E 5EODA 1RTKA 4LXBH 4TWWA 3E16B 5GXPA 1FAXA 4KGAA 1RIWC 1SGCA 4LZ4B 1ZJDA 1CA8B 1DDJA 1E36B 5EW2H 1GHVH 5JBBS 2QGRA 3ZZ6A 1ZSLA 3K9XB 4OGYA 2ZHQH 1C2IA 3T5FH 4CH2B 4OGXA 2ZCKP 4Z0KA 2YNBA 1JRTA 2ZDKA 1EB1H 4KKDA 4ABGA 4B71A 3TK6A 1DVAH 4AYYB 4E06H 1EPTB 5B6OA 4PROA 3IWMA 4ISNA 1ARCA 1A5HA 4WVPE 2OCVB 1AIXH 1DS2E 2ZU3A 1O2XA 1GI0A 2ZTXA 1ARBA 2Q6FA 4DT7B 1QIXB 3RXCA 1TFXA 1ZPZA 4X0WU 1QY6A 4WXIA 1O3JA 2TGAA 5DK1A 1GGDC 3RU4D 5E0HA 2HLCA 1O2JA 4WXVA 2BY5X 2B5TB 1MTVA 1EZXC 1LKBA 2Y5GA 2H9EH 1TX8A 1Z71A 3BTDE 3MO3A 4AFQA 4DIHH 1LVYA 1TRMA 2BQWB 2JETB 3FFGA 2VWOA 4Y7BA 3GY5A 1THPB 3HPTB 1PPFE 1C9PA 4JMYA 1AY6H 1PPHE 1OX1A 1ANEA 3TGJE 3Q00A 5DO4H 3PO1C 1ABIH 2ZGHA 3BIVH 3QN7A 1O2LA 4BNRA 1C5UA 3VB7A 4K1TA 2SNVA 2PUQH 3GYMA 2FTLE 1L1JA 2O8LA 4ZXYH 2DE9A 4TY6A 4U01A 3F9FA 1KXEA 1TALA 2F9OA 1A2CH 2R0LA 4M7GA 4JK6A 4ABDA 5FHTA 1K1MA 5FCRA 1XKAC 1D9IA 1FPHH 4FVDA 5F6MA 1PJPA 1WAYB 1A1RA 4O9VA 1C5MD 2HRVA 3ZZAA 4WY3A 1IAUA 2IJOB 1DOJA 1KDQA 3PYHA 5E2PA 1DUAA 1C4Y2 1TRNA 4B2AA 3PTNA 1DT2A 1P2IA 1LPKB 2ESTE 2ODYB 3P8NA 3FP8E 2UUKB 2C8ZB 2Y5FA 2ZF0H 2W7SA 1KIGH 4Q7YA 3OY6U 1MD7A 1W14U 4YZUA 2CF9H 1O2YA 1FN8A 1CGHA 2GMTC 3U69H 1ZMJA 4AFUA 1D3DB 1AU8A 1K28D 1AMHA 1Z6JH 2K1QA 4O3TA 3MH5A 3RXAA 2D26C 1TMTH 7ESTE 2B9LA 2UUYA 4B76A 1NESE 3S9BA 2UUJB 1OXGA 1EJMA 4Y79A 2P3UB 1QB9A 1KSNA 1DITH 2Y80A 1VCPA 2BVRH 2CMYA 3AW0A 1J15A 1OWIA 5T3HA 1YLDA 1V2WT 3A7TA 1C2GA 1JMOH 1ZPCA 3A86A 1QBVH 4I32A 1QNJA 5FX6A 1QL7A 2VIDA 2FYQA 3W94A 2BVSH 1Y8TA 4IN1A 2BX3A 5LGOA 2XCFA 3ESTA 1FV9A 4NA9H 1W7XH 2QN5T 2PGQB 1C1UH 2ANMH 1T8NA 1TGSZ 1VITF 1MQ6A 1SGYE 2ZGBH 2FOMB 3GDUA 3VEQB 1S6FA 4ABFA 1P03A 1TBQH 3S0NA 4TY7A 3KNXA 3RXBA 1BRUP 2JH6D 1B5GH 1DUEA 1EAUA 5CHAB 4X2WA 2DUCA 1FDPA 3TH3H 4MPVA 3KCGH 4NSVA 2ANYA 2BX4A 1UK2A 1DLKB 1C9TA 1XXDA 2AEIH 4YLUA 3KN2A 3SNCA 5AF9H 2G00A 5C67A 1S0QA 2BDAA 1V2KT 1MTNC 1YPHE 5LH8A 1UTKA 5E2OA 1C2FA 1PQ8A 2ILNA 1XUFA 3MU5A 2BYAX 3SU5A 1C1QA 2F9PA 2R2MB 2VVVA 2EC9H 3H7OA 1GGDB 2C8WB 2XBVA 1QBOA 2ZCHP 8GCHG 1HIAA 2GD4B 2HVXA 4O03A 3T26A 4SGBE 1AO5A 1IQNA 1HAVB 2A4QA 1ZHPA 3LGYA 1AKSA 1LDTT 2M5TA 1O3GA 3E0PB 1LQDB 5LPFA 1CHOG 1ELCA 2PKSB 3ZZBA 2UWPA 1FI8A 4I8HA 3U1IB 1O3HA 1AI8H 1KXCA 4INLA 1SLWB 5L6NH 1Z8RA 1L0ZA 1O2GH 1SGEE 1O30A 4OS2A 3KHVA 3S9CA 1O3LA 5A0AE 2BZAA 4X8UH 1O3EA 2FOEA 3BG8A 1MKXK 4F49A 3OY5U 1EQ9A 1KY9A 4KTSA 3ZVCA 3VB3A 3SJOA 1V2LT 3SGQE 1YKTA 3SI3H 2VB0A 2Y5HA 1W12U 3RMMH 2BMGB 4FU7A 3A7YA 1KXDA 2ZP0H 4O3UA 1G2MA 1WTGH 2WPKS 1NROH 1HXFH 1MCTA 3L3TA 4JYVH 1F0TA 4CH8B 1U6QA 3ZZ8A 1MBQA 2P59A 1WQVH 1DM4B 5LPRA 1EP5A 5DP3A 1G3DA 1YPLH 4AGKA 1BHXB 3C1KA 1MAXA 3LC3A 2W3IA 1YPEH 1NFUA 3M5LA 4JZFH 1AUJA 1LMWB 1ZMNA 1ETSH 2Z6BD 2ALVA 4FUDA 5A09A 2TPIZ 1PYTD 5CE1A 3SNAA 3TH2H 1LVBA 2NU4E 3LGVA 3QDZB 4Y8YA 1MU6B 2ANWA 4E05H 3KQEA 2BD5A 1O5CB 3BTWE 3SU6A 3MNSA 1P3CA 3TVJB 3SW2B 2GCHG 4ZKOU 2BLQA 3KL6A 1OKXA 1A0HB 1P01A 3EA9A 2FP7B 1TNKA 3I29A 3ZV9A 3DD2H 4MPWA 3NK8A 3SUGA 4Z6AH 4GHQA 4RN6A 1Z8IB 2JKHA 4KP0A 2Y6TA 4FUEA 2UUFB 1QB1A 3T62A 4AB8A 3ELAH 1MZAA 2NU3E 1NS3A 5PTPA 1BA8B 2FOHA 2Z9IA 1WCZA 3CENA 2WPHS 5F8XA 2F9BH 1L2EA 1VZQH 1SL3A 2GCTC 1UK3A 5CHAC 5C5NA 4ISHH 1VITH 1P05A 3AAUA 3ITIA 3RXMA 1MZDA 4CR9A 3Q3YA 1BMAA 1UVSH 2ZIQH 4JZEH 1UTNA 2ULLA 2BDHA 4UFEH 2AGGX 1K22H 1HPGA 1QBNA 1ZLRA 1EASA 1MCVA 4ISOA 3D23A 4GAWA 5I46H 3PWCA 1HUTH 5BRRE 2Z9JA 1C5XB 4DIIH 1AFQC 2CF8H 3VXEH 2D8WA 2VINA 3MH6A 3RXUA 3U1JB 1PYTC 3CP7A 2ZHEH 1TYNA 4K69A 1BBRK 1NRPH 3RXTA 3MU1A 3S7HB 1S81A 4Q7XA 1PPGE 3ZZDA 4XFQA 7GCHF 2P16A 4I33A 2W7UA 1HXEH 1WBGB 2ZFSA 4X2YA 1V2ST 3UNSA 4B75A 1AGJA 1TABE 1KXBA 4H6SB 1SGDE 1NRNH 3B23B 3VB6A 4E7RG 1LHFH 1EZSC 4X1SU 1C2EA 4SGAE 2ZU1A 4CRCA 3RXFA 1V2VT 3LGWA 4AOQA 1QRWA 2ZU2A 2STAE 3P92A 1J16A 3U8RH 1DWBH 1Q3XA 2SGDE 1HAXB 3LH3A 1G3BA 1IQMA 3V12A 2ZHWH 1VJ9U 4ASHA 3MU4A 3TJNA 1V2OT 2F9NA 4ZUHA 5IDKA 2V3OH 1GJBB 1UVUH 4NIYA 1SHYA 3A83A 1WOFA 1B0FA 2FI5E 3EAJA 4BAQB 5K0HA 1K2I1 1O2NA 1AB9B 3SU4A 1LCYA 3LGUA 5A8XA 1HAZB 2FXRA 3M7QA 3I77A 2ZU4A 1LPGB 1Y3YA 4FUHA 4KTCA 1Z6EA 3T28A 4BTUB 4BAHB 4X2VA 1E37B 1P9UA 1SFIA 2G4UA 1KXAA 1E0FD 2BDYA 4WH6A 1G37A 1YPHC 1H9HE 1W8BH 1O2HA 2VH6A 1MKWH 2Z94A 5TJXA 1D3PB 4ESTE 2OLGA 3Q3XA 1K1JA 2C3SA 2QY0B 3SNDA 5E0GA 3E6PH 1BITA 5JBCS 1C5NH 1TOCB 5ETXA 3ZVFA 2XC0A 1RJXB 1O3MA 1O2ZA 4KELA 4INKA 1DWEH 3QO6A 5G4BA 1ABJH 3MU8A 5HM9A 3DFLA