3UR6A

1.5a resolution structure of apo norwalk virus protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
164
Chain Sequence
MAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase
total genus 37
structure length 164
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A01
1GVZA 5T3HA 1K1OA 3RXDA 1Z8RA 1K1LA 6CHAC 1BMLA 2IOTA 1AUTC 2I6SA 2Z3CA 1OS8A 2A2XH 1G36A 1YCPM 3SOSA 3BTHE 1ID5H 3PWBA 3TH2H 1O5EH 3P8OA 4HGCA 1IQGA 3FP8E 1KTSB 2QXGA 4TWYA 3ZZ8A 1C9TA 3GY3A 4AB9A 3VB7A 1CA0C 1CGIE 1GMCF 3E91A 1GMDF 3A88A 1GBHA 3B9FH 2H6MA 3GDUA 4K1EA 3K2UA 3PV4A 4VGCC 4YLQH 1XXFA 2ZP0H 1O5CB 3ATKA 1YPMH 2F9UA 4KP0A 5CHAC 4ESTE 2TGTA 1SQAA 1TGBA 1EAWA 5BRRE 3BTFE 5AHGH 2W5EA 2HRVA 3M35A 1BTWA 1TMUH 2BY6X 3RXVA 3I77A 3SU6A 8ESTE 2CXVA 2AH4X 2WV4A 3VGCB 3FP6E 4FVBA 1G3DA 1ZHMA 1D3PB 1A5IA 3R3GB 2Z3DA 1EPTB 1TWXB 2XCFA 1ZSJA 1ELGA 1HNEE 4KKDA 2FOMB 1V2OT 1P9SA 1K28D 2QIQA 1BTYA 4A1VA 3Q77A 1QB9A 3GCTF 1FUJA 4WXIA 3RC6A 1T4VH 4TY6A 2NU0E 4MNXA 1TMTH 2FWWA 2UUJB 1GJ9B 1WV7H 1A4WH 4WXVA 2NU3E 3BEFB 4TPYA 1O3IA 1O2HA 1TOCB 3GOVB 3ITIA 4JCNA 1O3DA 3F68H 3D65E 4Q7ZA 5HYOA 2FEQH 1GBMA 5T6GA 2OC7A 2UWPA 1UHBB 1BIOA 1EASA 1P2OA 1XKAC 3Q76A 5HM2A 1G2LA 5EGMA 1MBMA 1LDTT 2GX4A 3HPTB 4B73A 1O3BA 2FM2A 3F9FA 8GCHF 1FN6A 4Y8XA 1QRZA 1HJ8A 3HATH 2PUXB 1YPLH 4WH8A 4BAKB 1C5VA 2AGEX 1YPHC 4LXBH 1CSOE 2AYWA 1S82A 2BZ6H 1O2MA 4THNH 1F5LA 2FI3E 4X8SH 3STJA 8LPRA 2AERH 5DO4H 3HK6B 1SSXA 1RTLA 3ATIA 2ODYB 2V6NA 2XTTB 4MVNA 4AGKA 1JBUH 3WY8A 1C4Y2 1JMOH 1H4WA 1SGFA 2K1QA 2ZDLA 2P8OB 5JBTA 4X1QU 1RTFB 1EOJA 2ALVA 1JRSA 4JK5A 3UREA 1O36A 3V3MA 1LHCH 3A7ZA 2C8XB 1V2NT 2AS9A 2BVRH 3LJJA 3DFJA 3SZNA 4ABEA 1O3FA 2EA3A 1PPFE 3L3TA 4CRDA 2ZDMA 3VB3A 1JRTA 2ANKH 2FOGA 3A81A 2TGAA 5LPEA 1C4V2 3SUFA 2JH0D 3QWCH 1EKBB 5DP3A 2FS8A 1GDQA 2WV5A 3O8BA 4B2AA 1GCDA 1O2QA 1EATA 1YP9A 2ZU3A 1CU1A 2HWLB 1UO6A 1IQFA 4X0WU 3STIA 4JK6A 1OKXA 4XBCA 5K0HA 3SV9A 4YOIA 4NFEA 5GWZA 1O5AB 4NGAH 4GAWA 1C1RA 1IQHA 4MNYA 2BQ6B 4UD9H 3M5LA 3GCTG 3BG8A 3S9AA 3EYDA 3P17H 1UVOA 3UOPA 1L4ZA 3BIUH 3UPEA 2R9PA 2BDHA 2UUFB 4LZ4B 1TNJA 1IQLA 2XBXA 1IHSH 1SI5H 1KIGH 1HAHH 2CHAC 1MTVA 1LTOA 1VJAU 3HKJB 2JH5D 1JWTA 1TIOA 2FOHA 2P3FH 2A0QB 1HAVA 1KXEA 4X6PA 1QIXB 1SFQB 1Q2WA 4ABBA 1C5UA 1QB6A 1HAYB 1O3PB 3TJOA 1HIAA 2LNCA 4NFFA 1ANCA 1UMAH 2Z7FE 1OWEA 4JZFH 1FAXA 4WY3A 1A7SA 2FX6A 4INHA 1E36B 1DM4B 2BMGB 5CMXH 1XUIA 2PKAB 3M37A 1O38A 2PLXA 1D6WA 1O32A 5IDKA 1YPJH 1SL3A 2H9HA 3CP7A 1O39A 2QXHA 1UTKA 2O8UA 2IPHA 1EJMA 3OY6U 3I78A 3NKKA 4NWKA 1QBVH 5EPYA 2ZHEH 2XWAA 3L6PA 2PGQB 5GDSH 7KMEH 1CQQA 4AFSA 1TLDA 4YZUA 1K22H 3RUOA 4IMQA 4O3TA 3PMJA 3SBKA 2KAIA 3F9EA 2XCNA 1PYTD 3D23A 3TLOA 2PUQH 1G3CA 3MH5A 1ZYOA 1NRPH 1S6FA 2FOBA 2AMPA 3LGWA 3SJOA 2UUYA 4X1PU 1K1MA 1C1TA 2Y81A 1A46H 1IQEA 2Z3EA 1Y8TA 2WPKS 4U30A 1WU1A 4UONA 1O2NA 1ZGVA 3RM0H 1FDPA 1OWDA 5JB8S 2CGAA 1ABIH 2H1UA 1ELDE 1ANDA 2ZU4A 1TGTA 3TK5A 2BDGA 1AVWA 2ULLA 3F9HA 1O3JA 2C3SA 1OOKB 3MH6A 1T7CA 2BQWB 1G32B 3VB6A 1XUHA 8KME2 2A7CA 2W3IA 4XOJA 1U6QA 3T25A 2G5VA 4YTAA 3R0FA 3S9CA 1O2WA 4X2VA 1LHEH 2BLVA 2EI8A 1KY9A 3KQDA 1P04A 2QGRA 2ZFQH 1ZSKA 4Y79A 2CJIA 3LONA 3S9BA 1EB1H 1P06A 4I8HA 2GT8A 2UWLA 3PYHA 3KQEA 4NG9H 2FI5E 1DVAH 1MZDA 2P59A 4NZQA 1MKXH 3KHVA 5EG4A 1C1SA 1A0HB 1AIXH 2SNWA 1XM1A 4INLA 3AAUA 2PV9B 1HCGA 1TQ7B 1RS0A 1FY4A 4A1XA 3SORA 1F0TA 1UK2A 1W0ZU 3KEEA 4JYUH 4CHAB 2WUBA 4DURA 3QX5H 2DUCA 2C93B 4ISNA 5AVDA 4ZAEA 3M5OA 1ELFA 4K1TA 4IN1A 1O33A 3E6PH 1AB9C 1WYKA 2ZDKA 4AOQA 2ZGJA 1WCZA 3A7VA 1V2LT 2H9TH 1QL9A 2OD3B 4AGJA 1L1NA 5LGOA 5JDUB 2BD9A 5B6OA 1AFEH 1MD7A 3SV8A 1TQ0B 1RGQA 4I31A 5FX5A 1QCPA 3ZV8A 2V35A 3M5NA 2VVUA 5TJXA 2A7HA 2J4IA 3SNDA 4HTCH 1W2KH 1VITH 1Y59T 1QRXA 2A7JA 1BTPA 3GICB 1MZAA 2BM2A 1DXWA 1J9CH 1O5BB 4ZUHA 1ELTA 2PWXA 2ZG0H 2DE8A 3A8DA 4D8NA 3LGTA 5ESTE 3MO9A 1P05A 1TBZH 1ZPBA 1SVPA 3I29A 3E8LA 1V3XA 1QR3E 1GHAF 3QZRA 2VIQA 5EW1H 4FUCA 2H5CA 1O2IA 3S7HB 3ZVAA 4CH8B 1GJ4H 4NWLA 4H6TA 1G3EA 2ZCKP 2A5IA 1O3CA 1ELCA 1NFUA 5T6FA 1GI9B 3C27B 1P3EA 3TGIE 1W8BH 4Y0ZE 1P9UA 5FPYA 3Q3XA 1HXEH 3A86A 3CENA 1C5RA 1AGJA 3QLPH 1AN1E 1GI3A 1S83A 3FFGA 1SR5C 3S7KB 1FY1A 1TE0A 2P16A 5C5OA 4ZHMU 1THRH 1KXDA 2ZGCA 1O2RA 1WQVH 1NS3A 3TH4H 1HRTH 1GJAB 2J34A 1PQAA 2GZ8A 2B8OH 1Q31A 3M7QA 3UNRA 1UTJA 2ZQ2A 1SOTA 1IOEA 3RXBA 4GVUA 4YESB 5JPMH 1T8NA 4UFDH 3TJVA 1NZQH 1CVWH 3A85A 1DT2A 1MQ5A 1BMNH 1PYTC 1GHBF 5DK1A 4KTSA 4HI3A 1TBQH 3A87A 4ISIH 5FHTA 2TRMA 1XXDA 3AW0A 1C2JA 2GGVB 1O2OA 1GGDC 2VWMA 3OX7U 4XE4A 3P8NA 1WSSH 1F7ZA 4WWYA 3KGPA 2FLRH 3P6ZB 1TPAE 3LC5A 1V2KT 1QTFA 5DPAA 1XUFA 1HBTH 4ZKRU 2W26A 1JIMA 4BTIB 1CA8B 2OQUA 4NSVA 4U2WA 1YPGH 1F92A 1LPGB 3VEQB 2Y5GA 3MI4A 3GY7A 1L2EA 1NRNH 4X2WA 2F9VA 1DY9A 1GL0E 1DITH 3V12A 2GCHG 1BOQA 1UJ1A 4IBLH 3RXEA 4DJZB 2ZGHA 1ETSH 3AASA 1SGFG 3QTVH 3TITA 1TPSA 1WAYB 3SV7A 4BAOB 2G81E 3LGVA 1O2JA 2SGDE 1NU7B 4MTBA 3ZZAA 3UFAA 3RLYH 1Y3YA 4JZ1A 1F0UA 1CBWB 3B8JA 3F9GA 3SHCH 1AU8A 4AYVB 3SJ8A 5A8YA 2BLWA 4X6MA 2A32A 2QF3A 3M36A 2VH0A 5DJ7A 2D8WA 2FOFA 3TPIZ 2JETC 1HAIH 1KDQB 2C8YB 5L2YH 3V13A 2Y5FA 1ARBA 1NO9H 1EAIA 5K7RA 1FONA 1ESBA 1EXFA 4O03A 3BG4B 3OSYA 1P57B 2GDEH 1HLTH 1WOFA 2G4TA 5E2OA 5F8TA 1P10A 3EA9A 1C2HA 1J8AA 3HGPA 1DPOA 1IQIA 4K5ZA 3URDA 4F4OC 4A1TA 3GCOA 4XSKU 1XX9A 3C1KA 1FMGA 2BOKA 6GCHG 4RN6A 5EW2H 3D62A 5DP9A 1Z6JH 2VH6A 2ANYA 1LO6A 1AWHB 2V3OH 4XBBA 1Z6EA 3H7OA 1EP6A 7GCHF 1AKSB 1O2TA 1UVUH 1UTLM 3K6YA 4ZMAH 4OS2A 1P8VC 1MTUA 4X6NA 1XUGA 1MBQA 4FUGA 1CT0E 1FY5A 5A8XA 2VNTA 1QBNA 1GBIA 1P2QA 1H8IH 2OXSA 3MU5A 1P03A 4K3JA 4KTUA 1QGFA 1FIZA 1Y5AT 1W12U 2D1JA 4MDSA 4B2CA 3MU8A 2FDAA 3SV6A 2ZFFH 1GBTA 2EI6A 3A7WA 2QXIA 1W0YH 1KXAA 2VIVA 2FO9A 1HYLA 2VGCC 5F8ZA 1DWCH 3EA8A 2BD5A 1HJ9A 2VIPA 2BLOA 3ATWA 4IW4E 1EAXA 3BEUA 5GCHG 4X1SU 2RA3A 4E7NA 4DG4A 3TGKE 4CH2B 1FZZA 1WUNH 4O97A 1MAXA 1SGEE 2WPMS 4B75A 4Q80A 1BB0B 3TJNA 1O35A 5BPEA 2VJ1A 4X8VH 2QA9E 5PTPA 1YM0A 3BF6H 3GCHB 2F91A 2ZPSA 1C2DA 1WBGB 2STBE 1L0ZA 4GUXA 1ZJKA 4JYTA 1FNIA 1C1WH 1Z71A 1C5XB 4LOYH 1ZJDA 3ZZ9A 2BD4A 3DHKH 3SU3A 1EUFA 2A5KA 1L1GA 1O34A 5AF9H 1CGHA 2FZZA 3SO3A 3RP2A 1GHXH 2G00A 5FCKA 5I46H 2GDDA 1DUEA 1XVOA 3A8CA 3MNXA 3MU1A 1VCWA 3PO1C 5AFZH 1V2ST 1A0JA 3P92A 4GLYA 1UTOA 3RXCA 4D76A 1YLCA 2HNTE 3RXQA 5DGJA 3ENSB 3MWIU 1HPGA 3DFLA 1Y5UT 1TX8A 3GY8A 1Y3UA 1GJ6A 2TPIZ 5DP7A 1O5GH 1O5DH 3AVZA 1NN6A 4Q7XA 3DT0H 1QL8A 7GCHG 3ESTA 1SB1H 2WYJA 1NRQH 1AFQB 5HGGA 1WQSA 1YCPH 4CR9A 4ZHLU 1HUTH 2CF8H 2QXJA 3MYWA 2Q6DA 1V2JT 2BD8A 3SUEA 1T4UH 3LC3A 3TJUA 1GPZA 2R0LA 5IYTA 2ZDAH 5C1XA 3RXSA 1T8OA 1D6RA 4DCDA 1KXBA 1HAPH 1TA6A 2SGFE 1PQ8A 4B76A 2XBVA 3KNXA 2P93A 3PTNA 3RU4T 3V7TA 1VCPA 1ZMJA 1O2UA 9LPRA 2VWNA 1KLJH 2SFAA 1LPKB 1MKWK 1PPEE 1IQMA 1O2XA 3EGKH 5GPIB 1OWKA 2P3UB 1OP8A 4YM9A 2R2MB 3VGCC 3SU5A 4WJG2 3ZVDA 1P2IA 1AMHA 1C1OA 3UQOA 1KLTA 1UTQA 1C1UH 1EPTC 4IMZA 1C5LH 1VITG 4FUIA 1EZSC 4IGDA 1PPZA 2FYQA 3O8RA 2NU1E 2GKVE 2BDBA 1ELVA 4H42U 3RXFA 4ISLA 1AUJA 4D7GA 1ZHRA 3PMAB 3UOUA 1TFXA 2HALA 1VZQH 3ELAH 3LH3A 3M7TA 4Y7AA 3NWUA 3V0XA 1BBRE 4RKJB 1SPJA 2OP9A 1QQ4A 1RIWB 2YNBA 1ZGIA 3RMMH 4DIIH 1E34B 1THSH 2JKHA 1T32A 3N7OA 2GMTB 5GXPA 2QN5T 2BD2A 1EJAA 2ZNKH 1B7XB 1M9UA 4DGJA 5A09A 1V2VT 3W94A 1SOZA 4FUHA 1OYTH 5C5NA 3UNSA 2A5AA 1ZRKA 4D9RA 1SGTA 1SGCA 4A6LA 3LU9B 1V2PT 4A5TS 2WYGA 3A7XA 3TNSA 4RSPA 4CBOA 3SHAH 5DP8A 4WMDA 3T62A 2BDIA 1UCYE 2R2WU 3OTJE 1NTPA 1TMBH 1LVBA 4OS1A 1C5NH 1FY3A 2ESTE 4CRFA 1TBRH 3K65B 2P8OC 5E0HA 1O3MA 2WPLS 2FOEA 2Y5HA 4FUJA 4BNRA 2O9QA 2ZI2H 1SHYA 4Y0YE 2F9BH 1GI8B 2A31A 2G5NA 4R0IA 1O3NA 2B5TB 4NA9H 1OX1A 3U8RH 1IQJA 1S84A 3GDVA 4IN2A 3IWMA 2OLGA 2OINA 2W3KA 3PLKA 4FVDA 1GG6B 1W7XH 1RRKA 2P94A 1HAGE 3U69H 1K1NA 3BTGE 1V6DA 1XMNB 2FI4E 2QY0B 1K1PA 1GCTB 2ZDVH 3MFJA 2Z9LA 2BD7A 2W7UA 3GCNA 5FBEA 2A2QH 2F9OA 2V3HH 3T26A 1TGSZ 3UNQA 2PKSB 2BXUH 5J4SA 1YC0A 3RC5A 2BTCE 3T29A 3TIUA 1O3LA 4K8BA 2ZHWH 1ZMNA 2ZHFH 5DP4A 3M3VA 1TNIA 1P02A 1VR1H 3RMLH 2H5DA 3SW2B 1XUJA 3A84A 2PHBA 2Z9JA 4ZH8A 1NY22 1IQKA 4ZKOU 3M5MA 1D3QB 5JBBS 3P95A 2GVFA 1GI4A 2XXLA 1F0SA 4UFGH 5F8XA 3E3TA 1JXPA 1OP2A 2RG3A 3U1IB 1TRNA 1A3EH 1YCPK 2ZCLP 3P70B 2OC1A 2H9EH 2BDAA 3A7TA 3P8FA 5HXFA 5E0GA 3MTYA 1ESAA 4MLFB 1ZPZA 4NZLA 2C8WB 1BZXE 2ZO3H 4LZ1H 1CT2E 1INCA 3ZZ3A 2OCVB 3NZIA 2BVXH 5DP5A 1GJCB 4Y7BA 5CE1A 3RXMA 4Z0KA 1ETRH 3BTWE 3RXHA 1QA0A 1ZHPA 2BQ7B 4Y11E 4E05H 1NPMA 1ELBA 2VB0A 1GI0A 2V0BA 1ACBE 1ZR0A 2C4FH 6ESTA 2FLBH 4A92A 1OWIA 1J14A 5JB9S 2Y82A 4AYYB 2OBOA 2GZ9A 3RXUA 1P2NA 1RXPA 1S85A 2ALPA 1SC8U 2ZHDA 1GBLA 2XWBI 1C5OH 4WMFA 2Z9KA 3GY5A 1TNHA 4JZDH 4U32A 1LHFH 1C2GA 1TYNA 2VIOA 2VU8E 4B71A 2SGAA 5F6MA 1A3BH 5HMAA 3UY9A 3S0NA 2AIQA 1LVMA 3CS0A 3EDXB 3QUMP 2FOAA 3E16B 1GDUA 1GBEA 3RXKA 1AZ8A 1H1BA 4X1NU 1ZPCA 1E37B 1TAWA 2RA0A 4UDWH 1GJBB 1CO7E 1BJUA 1GI1A 2G51A 2R0KA 2W7SA 1UTPA 2ZWLH 3F6UH 3Q3KA 2OQ5A 1JOUB 1C5ZB 4FUEA 1BT7A 1DWBH 4YT6H 5C1YA 4WVPE 4AZ2B 5A8ZA 5L2ZH 3RXIA 2GCHF 3ZZ5A 3GYMA 1KXFA 1BRUP 2THFB 1KLIH 1SGYE 1BQYA 5FX6A 2F9PA 1UVTH 1E38B 4DT7B 1GBDA 2ZKSA 2P3TB 1O2GH 2D2DA 5EQQA 1SLXB 3LOXA 3MNBA 5G4BA 3KIDU 3IITA 2QYIA 2QAAA 1O3OA 1G30B 1Q3XA 1C2KA 1Y3XA 2ZDNA 3UR6A 2A1DB 1AE8H 2PTNA 2M5TA 4K8YA 1SQTA 3RXGA 2SGPE 1AVGH 3AW1A 3NPSA 1S5SA 3FANA 1PPBH 1S6HA 1VGCB 1GVKB 1BJVA 3PM3A 4YOJA 3QTOH 2J9NA 2BY7X 1F2SE 1BCUH 4MQAA 1CHGA 2GCTB 3LGIA 1SLUB 1Z8JB 4YLUA 3NUMA 1EB2A 1AO5A 1EPTA 4CHAC 2BHGA 3QK1A 4WMEA 4K1SA 3GY4A 2G55A 1MU8B 3UWIA 3Q00A 1HAVB 5LH8A 2ZTXA 3SI3H 4OS5A 6GCHF 1LQDB 5DP6A 1K1JA 1LHGH 2EC9H 4OS4A 2G8TA 3MNCA 1HIAB 3ODDA 1ZTLA 3LKWA 4HZHA 4I8JA 1HJAB 1S0QA 5L6NH 1OWJA 1F5KU 1MD8A 2ZFTA 2O8LA 1EZUC 1UHBA 1SLVB 5EU8A 2BDCA 1ANBA 1GI2A 5DG6A 3TGJE 1PPHE 4MPUA 3KF2A 1QB1A 1L4DA 1Z1JA 1O2SA 1W11U 1MTNB 4ZKSU 2GT7A 4GCHG 5A0BA 3KQCA 1XUKA 1GHVH 1ELAA 4WF8A 3RXRA 3L33A 2J2UA 1P2KA 1BDAA 1A5GH 4KGAA 4ZXXH 4K2YA 5ABWA 1B0FA 4K69A 5J4QA 1RTKA 3UTUH 1FN8A 2KAIB 5EPNA 3MOCA 1D3DB 1P09A 5GCHF 4NCYA 3A80A 4INKA 1GBBA 2RCEA 1BRCE 2AMQA 2TIOA 4Q7YA 1MU6B 4HFPB 1FIWA 1NT1A 3U9AH 4Y10E 4MNWA 1FV9A 2ZQ1A 1MCVA 1QL7A 3U8OH 6CHAB 3TH3H 4FU7A 5SGAE 4FUDA 4Y8YA 7ESTE 2Y7XA 1MUEB 3E0NB 1O5FH 3GDSA 4GPGA 5TCAA 2BDYA 1F5RA 5FXLA 1FAKH 3EQ0H 1Y3VA 3T5FH 1CA0B 1C5WB 4OS7A 1C2FA 4CRAA 2O8TA 1MKWH 2UUKB 1THPB 7LPRA 2O8WA 4AN7A 5DKMA 4LK4A 4I32A 1F0RA 1NESE 1O2VA 2Y80A 2EEKA 3SU0A 1MAYA 3QGNB 1AD8H 1SG8B 1G2MA 3CS7A 5CHAB 2J92A 2VWOA 4AFUA 3SJKA 2Z94A 2BY8X 2CMYA 2XC5A 4Y76A 3S69A 2GP9B 2BX3A 1QJ6B 1O2LA 4NA8A 2VIWA 2HNTC 1BUIA 3TNTA 1W3CA 2ANMH 3SGQE 1FPCH 1OP0A 4BAQB 2PSXA 1ESTA 4KELA 1LKBA 1H9HE 4X8TH 3F1SB 2J95A 1GBJA 3D49H 3RXLA 5C20A 1GVLA 2PSYA 3FZDA 2VINA 3SUDA 4JZIA 4U01A 1LVOA 2FS9A 1NFXA 2ODPA 1RD3B 1HAXB 1NRRH 2UWOA 3SI4H 1UCYK 2GV7A 3P8GA 1GBFA 2PKAA 1WTHD 3KN2A 3QZQA 1QURH 1A61H 2FODA 1CBWC 3MHWU 5A0AE 1HFDA 2RDLA 1TRYA 3LDXH 2C90B 4GHQA 2A4OA 2FMJA 2ZIQH 3LGUA 2FIRH 3DD2H 1SGDE 1SGIB 2A45B 3UQVA 1EOLA 4AORA 2QCYA 3U1JB 2Y7ZA 4I8KA 1ANEA 1RJXB 1VITF 2FESH 1LHDH 3BTEE 1C2IA 1S81A 3BG4C 1MTSA 5EOKA 1C1MA 1BRBE 1NC6A 4ABHA 1ABJH 4BXWA 1S0RA 3RXTA 1DUAA 1G9IE 1K21H 1C2MA 2ZPRA 1AI8H 9ESTA 1DLKB 1HAOH 1X7AC 2BLQA 2FPZA 1PPGE 2AGIX 5EXMA 2QC2A 3NCLA 3ZVBA 1C5QA 2AFQB 4ZROA 3ZYEA 1LMWB 3JZ2B 5LPFA 1SHHB 1W14U 4H6SB 1O31A 2SNVA 1C2EA 2BVSH 3PTBA 1TRMA 2F83A 3LJOA 1H9IE 3MO6A 3BEIB 3TU7H 3HKIB 1T8LA 3MU4A 1T31A 3SN8A 1ARCA 2CV3A 1QA7A 5ETXA 4B74A 3SU2A 1C5MD 2A4GA 4F49A 3O8CA 1O2YA 3FAOA 3HGNA 4NIWA 1ZLRA 2XW9A 4ZXYH 1TNGA 3M61U 3T27A 5TCCA 2J38A 3VB4A 3U8TH 3PB1E 2R3YA 3H7TA 1D9IA 2ZU5A 3BSQA 3UUZA 1NFWA 3GYLB 1J16A 4SGBE 1TA2A 1YYY1 1P01A 1KXCA 4B1TA 2BD3A 4I8GA 1CHOF 1C5YB 1BHXB 3DUXH 4KTCA 3GY6A 3OYPA 1O3HA 3A8AA 1TONA 4Q2KA 4X6OA 2XYAA 2OBQA 1OWHA 2ZCHP 1TX6A 1AE5A 1VCQA 2CHAB 3EE0B 5C1UA 3OU0A 3ZVGA 1OSSA 2AGGX 3KQBA 1ZMLA 3ZVEA 1BHXF 3GCHC 3LIWA 1FXYA 1DX5M 3PLBA 5T6DA 1C1NA 1N6XA 1O2ZA 3EA7A 3SNEA 1C1PA 3LH1A 1UVPA 3ZZDA 1NROH 1DFPA 3SUGA 1GHWH 1DOJA 2XBYA 4XBDA 3RXJA 1AQ7A 1ETTH 1Z7KA 3RM2H 5E0JA 4BTTB 2WPIS 4FUFA 2CF9H 1FQ3A 1GMCG 1L1JA 1SGRE 1GMDG 1MQ6A 1O2KA 5H4IB 3O8DA 2TBSA 2P95A 4YO9A 4CRBA 3ATMA 3SU4A 4DOQA 1V2MT 3RDZA 2D26C 4BOHA 1HXFH 3GISB 1V2WT 3PLPA 3SNAA 1DS2E 1BITA 2YOLA 3E0PB 4FU8A 1TNKA 1W13U 3SV2H 3RLWH 4DIHH 4TY7A 1YGCH 1AFQC 1JIRA 3FVFB 1QQUA 2Z9IA 2G52A 5GIBA 1O3AA 2EI7A 4GHTA 2ILNA 2ZF0H 1GJ7B 1QRWA 1TOMH 5FPSA 1C4U2 1V2TT 4FU9A 2ZU1A 2Z9GA 1SMFE 3SGBE 1TNLA 3MH7A 1A1RA 4MG3A 1YBWA 5A0CA 5FCRA 1P11E 1YPHE 2AIPA 5FBIA 1E0FD 4CR5A 3HK3B 3NK8A 1YF4A 4H4FA 3SNCA 2R3UA 2ZFSA 4ABJA 1UTMA 3RXPA 3UWJH 1CHOG 3ZZBA 4NIXA 1IQNA 2A4QA 8GCHG 1DSTA 4CRGA 4NIYA 5EXLA 1BTUA 3E1XB 4DW2U 2NWNA 1V2RT 5HM9A 1UK4A 2FXRA 2GV6A 4ISHH 1DWDH 1SFIA 2OTVA 3LT3A 1HAZB 1DY8A 1J17T 1A2CH 2ZA5A 1TX7A 1ZTKA 2PGBB 4J2YB 1C9PA 4RKOB 3A89A 3ZYDA 2B7DH 3K6ZA 3AAVA 2FX4A 1EAUA 2OC0A 4JMYA 1MH0A 2SGEE 5FAHA 1RIWC 2Q6GA 5A2MH 3RU4D 4BAHB 1ZOMA 2STAE 4MPXA 3RMOH 2GMTC 2GTBA 2ZGBH 4UFFH 4WH6A 4UEHH 3ZZ4A 1AB9B 3NXPA 1C5SA 3SGAE 3A7YA 5JYIA 1UTNA 2B0FA 4NSYA 1BTXA 4DVAU 3FP7E 1FPHH 1QY6A 2A4RA 1MCTA 2XRCA 3K9XB 1QHRB 1Y3WA 1FLEE 2NU4E 2XBWA 2BYAX 4ZKNU 2AEIH 3BTME 1IHTH 3T2NA 1ELEE 4YT7H 1MTWA 2HLCA 1GHYH 2ZZUH 3QGJA 2O8MA 5E2PA 2HVXA 5FPTA 2YNAA 2BX4A 3IG6B 1C1VH 1EQ9A 1CGJE 1GWAA 3UR9A 1KDQA 4X2XA 4NA7A 2G4UA 1PQ5A 2IJOB 1LVYA 3T28A 1EJNA 1TB6H 2ZFRH 3SU1A 3VB5A 4IC5A 4XFQA 4ABIA 2ZPQA 4ISOA 3PWCA 3VXFH 1J15A 1DSUA 3BN9A 1AWFH 3SJIA 3SNBA 3E90B 1LKAA 2QV1A 1BTZA 1GG6C 1WTGH 2B9LA 1GMHF 1KTTB 2DE9A 3RMNH 2BB4A 4D7FA 1GCTC 5F03A 3FZZA 1Y5BT 2XC4A 4A7IB 1TPOA 3PMHB 2JH6D 1EZQA 1P3CA 2Q6FA 1C1QA 4UFEH 5C2ZA 2PKSC 1VJ9U 2ASUB 3BTQE 1AHTH 5C67A 1IAUA 2ANWA 1GHZA 1BRAA 1RFNA 1N8OB 2HGTH 1AKSA 4I8LA 3RXAA 1LPZB 4CREA 4GCHF 1T8MA 4ASHA 2ZTZA 1QJ7B 1BTHH 1EZXC 3LPRA 1TGCA 2ZTYA 3PROA 2F3CE 5L30H 3GY2A 4I7YH 3EAJA 1O3EA 1BBRH 1ZTJA 3DA9B 3SJ9A 4J1YA 1QNJA 2CN0H 1YPEH 5C3NA 4Z6AH 4AG2A 1PQ7A 2ZFPH 3VFEA 4CRCA 2WUCA 4IC6A 2BY5X 1CT4E 2FTLE 3QN7A 1OPHB 1GDNA 1QJ1B 4JYVH 1GGDB 1N1LA 2WPHS 4ABDA 1FJSA 1BA8B 2HPPH 5EXNA 2FTMA 4MPVA 2BXTH 1UCYH 4I33A 3ATLA 1D4PB 3RC4A 5JBAS 4MPWA 1O0DH 2Z6BD 1B0EA 5EQRA 4JZEH 3ZVFA 1V2QT 1XKBC 5EQSA 5EODA 2C8ZB 2WINI 2BY9X 3URCA 1PFXC 4E06H 1HV7A 3QO6A 1AVXA 4BANB 5E8EH 1KSNA 3BTTE 3MNSA 1H9LB 4D9QA 3RXOA 1BMMH 1W10U 3TVJB 3QDZB 4M7GA 4ABFA 4X1RU 4GSOA 4OGXA 1DDJA 5GJ4B 4AFZA 3ZVCA 1DLEA 1GJ8B 3G01A 4MNVA 4Y71A 1SQOA 1Z8GA 1TALA 2HPQH 2GZ7A 1N8OC 1Z1IA 4O3UA 1O2PA 1P2MA 3A83A 2WPJS 5ESBA 1GMHG 3ODFA 2BZAA 3U98H 2VVVA 4YOGA 2JETB 1UK3A 4AG1A 2FOCA 4BXSA 2PW8H 3ZZCA 2GD4B 3M7UA 1KYNA 2QF0A 3M3SA 1DANH 1YPKH 3JZ1B 1ZSLA 3M3TA 1A0LA 2ZEBA 2ZECA 4X8UH 1FY8E 1XVMA 2HOBA 3BTDE 3TK6A 1G37A 2PFEA 2J94A 1QBOA 2TGPZ 2ZHQH 1D3TB 1H8DH 3MH4A 2ZC9H 3BV9B 1OXGA 3A8BA 2ODQA 1NM6A 1E35B 4AX9H 3A82A 3VXEH 1DXPA 1FI8A 4AB8A 1O3GA 4Y6DA 3ZZ6A 1BMAA 1G3BA 1DWEH 3W95A 4TPIZ 1ORFA 1HGTH 1TGNA 2NU2E 2F9NA 1O3KA 1SLWB 1GJ5H 1O37A 1C2LA 1VGCC 1YKTA 4QT8C 2SGQE 1DE7H 1CE5A 5I25A 1ZZZA 1P12E 4X2YA 3ZV9A 5LPRA 2XNIA 1LCYA 2OUAA 2Y6TA 4ZHAA 2GCTC 1V2UT 4IS5A 1SGQE 1PPCE 4Y8ZA 1GBCA 1GI6A 1NU9A 2HNTF 2BOHB 1Z8IB 1DICA 1GI5A 2FYRA 4O9VA 4NIVA 1C5PA 1NRSH 2H2ZA 4FUBA 1B5GH 1N6YA 1GHAG 1TABE 1QFKH 2OC8A 4CBNA 1K1IA 1MKXK 1P0SH 2VGCB 4ABAA 1GBKA 4VGCB 1HJAC 4PROA 3SQHE 1A5HA 1SBWA 1OYQA 3BIVH 1HB0B 1LQEA 4DY7B 2XC0A 2AMDA 1SGPE 1YLDA 4ABGA 3RU4E 3ZZ7A 1K2I1 3BTKE 2I6QA 1W7GH 4OS6A 2LPRA 1BBRK 3TK9A 1HDTH 4E7RG 4BAMB 3KL6A 1O30A 1MTNC 1ZRBA 2ZU2A 3MO3A 2PR3A 4B2BA 2Q1JA 4UE7H 1P2JA 1SGNE 1UVSH 4SGAE 3Q3YA 4XDEA 2VIDA 3VPKA 3MMGA 1TPPA 1AY6H 2PTCE 1GBAA 4TWWA 1AZZA 1K9OE 4FXGH 2IN2A 2ZGXH 3OY5U 3PMBB 4OGYA 3H5CB 6LPRA 1EP5A 3KCGH 2TGDA 3UIRA 2VVCA 3PO1B 1PJPA 5JBCS 4TYDA 1GJDB 1MMJN 1GI7B 4BTUB 5AFYH 1EX3A 1GHBG 4K60A 3SQEE 4AFQA 1C5TA 2FP7B 3B23B 1NFYA 3LGYA 4R8TB 3MU0A 1GL1A 2VWLA
chains in the Genus database with same CATH superfamily
1GVZA 5T3HA 1K1OA 3OEED 3RXDA 1Z8RA 1K1LA 6CHAC 1KMHB 1BMLA 2IOTA 1AUTC 2I6SA 2Z3CA 1OS8A 2A2XH 1G36A 1YCPM 3SOSA 3BTHE 1ID5H 3PWBA 3TH2H 1O5EH 3P8OA 4HGCA 1IQGA 3FP8E 5F53A 1KTSB 2QXGA 4TWYA 3ZZ8A 1C9TA 3GY3A 4AB9A 3VB7A 1CA0C 1CGIE 1GMCF 4B6FA 3E91A 1GMDF 3A88A 1GBHA 3B9FH 2H6MA 3GDUA 4K1EA 3K2UA 3PV4A 1WDIA 4VGCC 4YLQH 1XXFA 2ZP0H 1O5CB 3ATKA 1YPMH 2F9UA 4KP0A 5CHAC 4ESTE 2TGTA 1SQAA 1TGBA 1EAWA 5BRRE 3BTFE 5AHGH 2W5EA 2HRVA 3M35A 1BTWA 1TMUH 2BY6X 3RXVA 3I77A 3SU6A 8ESTE 2CXVA 2AH4X 2WV4A 3VGCB 3DCLA 3FP6E 1G3DA 4FVBA 1ZHMA 1D3PB 1A5IA 3R3GB 2Z3DA 1EPTB 1TWXB 2XCFA 1ZSJA 1ELGA 1HNEE 3GS9A 4KKDA 2FOMB 1V2OT 1P9SA 1K28D 2QIQA 1BTYA 4A1VA 3Q77A 1QB9A 3GCTF 1FUJA 4WXIA 3RC6A 1T4VH 4TY6A 2NU0E 4MNXA 1TMTH 2FWWA 2UUJB 1GJ9B 1WV7H 1A4WH 4WXVA 2NU3E 3BEFB 4TPYA 1O3IA 1O2HA 1TOCB 3GOVB 3ITIA 4JCNA 1O3DA 3F68H 3D65E 4Q7ZA 5HYOA 2FEQH 1GBMA 5T6GA 2OC7A 2UWPA 1UHBB 1BIOA 1EASA 1P2OA 1XKAC 3Q76A 5HM2A 1G2LA 5EGMA 1MBMA 1LDTT 2GX4A 3HPTB 4B73A 1O3BA 2FM2A 3F9FA 8GCHF 1FN6A 4Y8XA 1QRZA 1HJ8A 3HATH 2PUXB 1YPLH 4WH8A 4BAKB 1C5VA 2AGEX 1YPHC 4LXBH 1CSOE 2AYWA 1S82A 2BZ6H 1O2MA 4FOUC 4THNH 1F5LA 2FI3E 4X8SH 3STJA 8LPRA 2AERH 5DO4H 3HK6B 3UAIC 1SSXA 1RTLA 3ATIA 2ODYB 2V6NA 2XTTB 4MVNA 4AGKA 1JBUH 3WY8A 1C4Y2 1JMOH 1H4WA 1SGFA 2K1QA 2ZDLA 2P8OB 3WWFA 4X1QU 5C94A 5JBTA 1RTFB 1EOJA 2ALVA 1JRSA 4JK5A 3UREA 1O36A 3V3MA 1LHCH 3A7ZA 2C8XB 1V2NT 2AS9A 2BVRH 3LJJA 3DFJA 3SZNA 4ABEA 1O3FA 2EA3A 1PPFE 3L3TA 4CRDA 2ZDMA 3VB3A 1JRTA 2ANKH 2FOGA 3A81A 2TGAA 5LPEA 1C4V2 3SUFA 2JH0D 3QWCH 1EKBB 5DP3A 5B6LA 1K0HA 2FS8A 1GDQA 2WV5A 4B6EA 3O8BA 4B2AA 1GCDA 1O2QA 1EATA 1YP9A 2ZU3A 1CU1A 2HWLB 1UO6A 1IQFA 1E1RD 4X0WU 3FN8A 3STIA 4JK6A 4TT3D 1OKXA 4XBCA 5K0HA 3SV9A 4YOIA 4NFEA 5GWZA 1O5AB 4NGAH 3DSGA 2AHME 4GAWA 1C1RA 1IQHA 4MNYA 2BQ6B 4UD9H 3M5LA 3GCTG 3BG8A 3S9AA 3EYDA 3P17H 1UVOA 3UOPA 1L4ZA 3BIUH 3F2GA 3UPEA 2R9PA 2BDHA 2UUFB 4LZ4B 1TNJA 1IQLA 2XBXA 1IHSH 1SI5H 1KIGH 1HAHH 2CHAC 1MTVA 1LTOA 1VJAU 3HKJB 2JH5D 1JWTA 1TIOA 2FOHA 2P3FH 3VG8A 5HIZA 2A0QB 1HAVA 1KXEA 4X6PA 1QIXB 1SFQB 1Q2WA 4ABBA 1C5UA 1QB6A 1HAYB 1O3PB 3TJOA 1HIAA 2LNCA 4NFFA 1ANCA 1UMAH 2Z7FE 1OWEA 4JZFH 1FAXA 4WY3A 1A7SA 2FX6A 4INHA 1E36B 1DM4B 2BMGB 5CMXH 1XUIA 2PKAB 3M37A 1O38A 2PLXA 1D6WA 1O32A 5IDKA 1YPJH 1SL3A 2H9HA 3CP7A 2KCOA 1O39A 2QXHA 1UTKA 2O8UA 2IPHA 1EJMA 3OY6U 3I78A 3NKKA 4NWKA 1QBVH 5EPYA 2ZHEH 2XWAA 3L6PA 2PGQB 5GDSH 7KMEH 2W6JD 1CQQA 4AFSA 1TLDA 4YZUA 1K22H 3RUOA 4IMQA 4O3TA 3PMJA 3SBKA 2KAIA 3F9EA 2XCNA 1PYTD 3D23A 3TLOA 2PUQH 1G3CA 3MH5A 1ZYOA 1NRPH 1S6FA 2FOBA 2AMPA 3LGWA 3SJOA 2UUYA 4X1PU 1K1MA 1C1TA 2Y81A 1A46H 1IQEA 2KX4A 2Z3EA 1Y8TA 2LP6A 2WPKS 4U30A 1WU1A 4UONA 1O2NA 1ZGVA 3RM0H 1FDPA 1OWDA 5JB8S 2CGAA 1ABIH 2H1UA 1ELDE 1ANDA 2ZU4A 1TGTA 3TK5A 2BDGA 1AVWA 2ULLA 3F9HA 1O3JA 2C3SA 2JDID 1OOKB 3MH6A 1T7CA 2BQWB 1G32B 3VB6A 1XUHA 8KME2 2A7CA 2W3IA 4XOJA 1U6QA 4RT0A 3T25A 2G5VA 4YTAA 3R0FA 3S9CA 1H8ED 1O2WA 4X2VA 1LHEH 2BLVA 2EI8A 1KY9A 3KQDA 1P04A 2QGRA 2ZFQH 1ZSKA 4Y79A 2CJIA 3LONA 3S9BA 1EB1H 1P06A 4I8HA 2GT8A 2UWLA 3PYHA 2KR7A 3KQEA 4NG9H 2FI5E 1DVAH 1MZDA 2P59A 4NZQA 1MKXH 3KHVA 5EG4A 1C1SA 1A0HB 1AIXH 4F55A 2SNWA 1XM1A 4INLA 3AAUA 2PV9B 1HCGA 1TQ7B 1RS0A 1FY4A 4A1XA 3SORA 1F0TA 1UK2A 1W0ZU 3KEEA 4JYUH 4CHAB 2WUBA 4DURA 3QX5H 2DUCA 2C93B 4ISNA 5AVDA 4ZAEA 3M5OA 1ELFA 4K1TA 4IN1A 1O33A 3E6PH 1AB9C 1WYKA 2ZDKA 4AOQA 2ZGJA 1WCZA 3F0OA 3A7VA 1V2LT 2H9TH 1QL9A 2OD3B 4AGJA 1L1NA 5LGOA 4RI0A 5JDUB 2BD9A 5B6OA 1AFEH 1MD7A 3SV8A 1TQ0B 1RGQA 4I31A 5FX5A 1QCPA 3ZV8A 1EFRD 2V35A 3M5NA 2VVUA 5TJXA 2A7HA 2J4IA 3SNDA 4HTCH 1W2KH 1VITH 1Y59T 1QRXA 2A7JA 1BTPA 3GICB 1MZAA 2BM2A 1DXWA 1J9CH 1O5BB 4ZUHA 1ELTA 2PWXA 2ZG0H 2DE8A 3A8DA 4D8NA 3LGTA 5ESTE 3MO9A 1P05A 1TBZH 1ZPBA 1SVPA 3I29A 3E8LA 5C0TA 1V3XA 1QR3E 1GHAF 3QZRA 4ACAA 2VIQA 5EW1H 4FUCA 2H5CA 1O2IA 3S7HB 3ZVAA 4XD7D 4CH8B 3PRBA 1GJ4H 4NWLA 4H6TA 1G3EA 2ZCKP 2A5IA 1O3CA 1ELCA 1NFUA 5T6FA 1GI9B 3C27B 1P3EA 3TGIE 1W8BH 4Y0ZE 1P9UA 5FPYA 3Q3XA 1HXEH 3A86A 3CENA 1C5RA 1AGJA 3QLPH 1AN1E 1GI3A 1S83A 3FFGA 1SR5C 3S7KB 1FY1A 1TE0A 2P16A 5C5OA 4ZHMU 1THRH 1KXDA 2ZGCA 1O2RA 1WQVH 5C0UA 1NS3A 3TH4H 3FO8D 1HRTH 1GJAB 2J34A 1PQAA 2GZ8A 2B8OH 1Q31A 3M7QA 3UNRA 1UTJA 2ZQ2A 1SOTA 1IOEA 4P02A 3RXBA 4GVUA 4YESB 5JPMH 1T8NA 4UFDH 3TJVA 1NZQH 1CVWH 3A85A 1DT2A 1MQ5A 1BMNH 1PYTC 1GHBF 5DK1A 4KTSA 4HI3A 1TBQH 3A87A 4ISIH 5FHTA 2TRMA 1XXDA 3AW0A 1C2JA 2GGVB 1O2OA 1GGDC 2VWMA 3OX7U 4XE4A 3P8NA 1WSSH 1F7ZA 4WWYA 3KGPA 2FLRH 3P6ZB 2KFWA 1TPAE 3LC5A 1V2KT 1QTFA 5DPAA 1XUFA 1HBTH 4ZKRU 4Z1MD 2W26A 1JIMA 4BTIB 1CA8B 2OQUA 4NSVA 4U2WA 1YPGH 1F92A 1LPGB 3VEQB 2Y5GA 3MI4A 3GY7A 1L2EA 1NRNH 4X2WA 2F9VA 1DY9A 1GL0E 1DITH 3V12A 2GCHG 1BOQA 1UJ1A 4IBLH 3RXEA 4DJZB 2J98A 2ZGHA 1ETSH 3AASA 1SGFG 3QTVH 3TITA 1TPSA 1WAYB 4AC9A 3SV7A 4BAOB 2G81E 3LGVA 1O2JA 2SGDE 2KM0A 1NU7B 4MTBA 3ZZAA 3UFAA 3RLYH 1Y3YA 4JZ1A 1F0UA 1CBWB 3B8JA 3F9GA 3PRDA 3SHCH 1AU8A 3KYGA 4AYVB 3SJ8A 5A8YA 2BLWA 4X6MA 2A32A 2QF3A 3M36A 2VH0A 5DJ7A 2D8WA 2FOFA 3TPIZ 2JETC 1HAIH 1KDQB 2C8YB 5L2YH 3V13A 2Y5FA 1ARBA 1NO9H 1EAIA 5K7RA 1FONA 1ESBA 1EXFA 4O03A 3BG4B 3OSYA 1P57B 2GDEH 1HLTH 1WOFA 2G4TA 4OM9A 5E2OA 5F8TA 1P10A 3EA9A 1C2HA 1J8AA 3HGPA 1DPOA 1IQIA 4K5ZA 3URDA 4F4OC 4A1TA 3GCOA 4XSKU 1XX9A 3C1KA 1FMGA 2BOKA 6GCHG 4RN6A 5EW2H 3D62A 5DP9A 1Z6JH 2VH6A 2ANYA 1LO6A 1AWHB 2EY4C 2V3OH 4XBBA 1Z6EA 3H7OA 1EP6A 7GCHF 1AKSB 1O2TA 1UVUH 2K0QA 1UTLM 3K6YA 4ZMAH 4OS2A 1P8VC 1MTUA 2F43B 4X6NA 2XOKD 1XUGA 1MBQA 4FUGA 1CT0E 1FY5A 5A8XA 2VNTA 1QBNA 1GBIA 1P2QA 1H8IH 2OXSA 3MU5A 1P03A 4K3JA 1SQRA 4KTUA 1QGFA 1FIZA 1Y5AT 1W12U 2D1JA 4MDSA 4B2CA 3MU8A 2FDAA 3SV6A 2ZFFH 1GBTA 2EI6A 3A7WA 2QXIA 1W0YH 1KXAA 2VIVA 2FO9A 1HYLA 1W0KD 2VGCC 5F8ZA 1DWCH 3EA8A 2BD5A 1HJ9A 2VIPA 2BLOA 3ATWA 4IW4E 1EAXA 3BEUA 5GCHG 4X1SU 2RA3A 4E7NA 4DG4A 3TGKE 4CH2B 1FZZA 1WUNH 4O97A 1MAXA 1SGEE 2WPMS 4B75A 4Q80A 1BB0B 3TJNA 1O35A 5BPEA 2HVYB 2VJ1A 4X8VH 2QA9E 5PTPA 1YM0A 3BF6H 3GCHB 2F91A 2GJGA 2ZPSA 1C2DA 1WBGB 2STBE 1L0ZA 4GUXA 1ZJKA 4JYTA 1FNIA 1C1WH 1Z71A 1C5XB 4LOYH 1ZJDA 3ZZ9A 2BD4A 3DHKH 3SU3A 1EUFA 2A5KA 1L1GA 1O34A 5AF9H 1CGHA 2FZZA 3SO3A 3RP2A 1GHXH 2G00A 5FCKA 5I46H 3F0PA 2GDDA 1DUEA 1XVOA 3A8CA 3MNXA 3MU1A 1VCWA 3PO1C 5AFZH 1V2ST 1A0JA 3P92A 4GLYA 1UTOA 3RXCA 4D76A 1YLCA 2HNTE 3RXQA 5DGJA 3ENSB 3MWIU 1HPGA 3DFLA 3AK5A 1Y5UT 1TX8A 3GY8A 1Y3UA 1GJ6A 2TPIZ 5DP7A 1O5GH 1O5DH 3AVZA 1NN6A 4Q7XA 3DT0H 1QL8A 7GCHG 3ESTA 1SB1H 2WYJA 1NRQH 1AFQB 5HGGA 1WQSA 1YCPH 4CR9A 4ZHLU 2RDEA 1HUTH 2CF8H 2QXJA 3MYWA 2Q6DA 1V2JT 2BD8A 3SUEA 1T4UH 3LC3A 3TJUA 1GPZA 2R0LA 5IYTA 2ZDAH 2EQNA 5C1XA 3RXSA 1T8OA 1D6RA 4DCDA 1KXBA 1HAPH 1TA6A 3FOAA 2SGFE 1PQ8A 4B76A 2XBVA 3KNXA 2P93A 3PTNA 3RU4T 3V7TA 1VCPA 1ZMJA 1NBMD 1O2UA 9LPRA 2VWNA 1KLJH 2SFAA 1LPKB 1MKWK 1PPEE 1IQMA 1O2XA 3EGKH 5GPIB 1OWKA 2P3UB 1OP8A 4YM9A 2R2MB 3VGCC 3SU5A 4WJG2 3ZVDA 2J5UA 1P2IA 1AMHA 1C1OA 1OHHD 3UQOA 1KLTA 1UTQA 1C1UH 1EPTC 4IMZA 1C5LH 1VITG 4FUIA 1EZSC 4IGDA 1PPZA 2FYQA 3O8RA 2NU1E 2GKVE 2BDBA 1ELVA 4H42U 3RXFA 4ISLA 1AUJA 4D7GA 1ZHRA 3PMAB 3UOUA 1TFXA 2HALA 1VZQH 3ELAH 3LH3A 3M7TA 4Y7AA 3NWUA 3V0XA 1BBRE 4RKJB 1SPJA 2OP9A 1QQ4A 1RIWB 2YNBA 4ACBA 1ZGIA 3RMMH 4DIIH 1E34B 1THSH 2JKHA 1T32A 3N7OA 2GMTB 5GXPA 2QN5T 2BD2A 1EJAA 2ZNKH 1B7XB 1M9UA 4DGJA 5A09A 1V2VT 3W94A 1SOZA 4FUHA 1OYTH 5C5NA 3UNSA 2A5AA 1ZRKA 4D9RA 1SGTA 1SGCA 4A6LA 3LU9B 1V2PT 4A5TS 2WYGA 3A7XA 3TNSA 4RSPA 4CBOA 3SHAH 5DP8A 4WMDA 3T62A 2BDIA 1UCYE 2R2WU 3OTJE 1NTPA 1TMBH 1LVBA 4OS1A 1C5NH 1FY3A 2ESTE 4CRFA 3F3BA 1TBRH 3K65B 2P8OC 5E0HA 1O3MA 2WPLS 2FOEA 2Y5HA 4FUJA 4BNRA 2O9QA 2ZI2H 1SHYA 4Y0YE 2F9BH 1GI8B 2A31A 2G5NA 4R0IA 1O3NA 2B5TB 4NA9H 1OX1A 3U8RH 1IQJA 1S84A 3GDVA 4IN2A 3IWMA 2OLGA 2OINA 2W3KA 3PLKA 2K8IA 4FVDA 1GG6B 1W7XH 1RRKA 2P94A 1HAGE 3U69H 1K1NA 3BTGE 1V6DA 1XMNB 2FI4E 2QY0B 1K1PA 1GCTB 2ZDVH 3MFJA 2Z9LA 2BD7A 2W7UA 3GCNA 5FBEA 2A2QH 2F9OA 3MQKC 2V3HH 3T26A 1TGSZ 3UNQA 2PKSB 2BXUH 5J4SA 1YC0A 3RC5A 2BTCE 3T29A 3TIUA 1O3LA 2JIZD 4K8BA 2ZHWH 1ZMNA 2ZHFH 5DP4A 3M3VA 1TNIA 1P02A 1VR1H 3RMLH 2H5DA 3SW2B 1XUJA 3A84A 2PHBA 2VBCA 2Z9JA 4ZH8A 1NY22 1IQKA 4ZKOU 3M5MA 1D3QB 5JBBS 3P95A 2GVFA 1GI4A 2XXLA 3DSPA 1F0SA 4UFGH 5F8XA 3E3TA 1JXPA 1OP2A 2RG3A 3U1IB 3N7DA 3FKSD 1TRNA 1A3EH 1YCPK 2ZCLP 3P70B 2OC1A 4TSFD 2H9EH 2BDAA 3A7TA 3P8FA 5HXFA 5E0GA 2YMSD 3MTYA 1ESAA 4MLFB 1ZPZA 4NZLA 2C8WB 1BZXE 2ZO3H 4LZ1H 1CT2E 1INCA 3ZZ3A 2OCVB 3NZIA 2BVXH 5DP5A 1GJCB 4Y7BA 5CE1A 3RXMA 4Z0KA 1ETRH 3BTWE 3RXHA 1QA0A 1ZHPA 3H09A 2BQ7B 4Y11E 4E05H 1COWD 1NPMA 1ELBA 2VB0A 1GI0A 2V0BA 5IK2D 1ACBE 1ZR0A 2C4FH 6ESTA 2FLBH 4A92A 1OWIA 1J14A 5JB9S 2Y82A 4AYYB 2OBOA 5DSFA 2M2AA 2GZ9A 3RXUA 1P2NA 1RXPA 1S85A 2QF5A 2ALPA 1SC8U 2PP6A 2ZHDA 1GBLA 2XWBI 1C5OH 4WMFA 1QZ8A 2Z9KA 3GY5A 1TNHA 2KCPA 4JZDH 4U32A 1LHFH 1C2GA 1TYNA 3OAAD 2VIOA 2VU8E 4B71A 2SGAA 5F6MA 3KQ5A 1A3BH 5HMAA 3UY9A 3S0NA 4I86A 2AIQA 2KZ4A 1LVMA 3CS0A 3EDXB 3QUMP 2FOAA 3E16B 1GDUA 1GBEA 3RXKA 1AZ8A 1H1BA 4X1NU 1ZPCA 1E37B 4P00A 1TAWA 2RA0A 4UDWH 2J97A 3N7EA 1GJBB 2RFKC 1CO7E 1BJUA 1GI1A 2G51A 2R0KA 2W7SA 1UTPA 2ZWLH 3F6UH 3Q3KA 2OQ5A 1JOUB 1UW7A 1C5ZB 4FUEA 1BT7A 1DWBH 4YT6H 5C1YA 4WVPE 1FX0B 4AZ2B 5A8ZA 5L2ZH 3RXIA 2GCHF 3ZZ5A 1YLNA 3GYMA 2L74A 1KXFA 1BRUP 2THFB 1KLIH 1SGYE 1BQYA 5FX6A 2F9PA 1UVTH 1E38B 4Q63A 4DT7B 4ZCNA 5KECA 1GBDA 2ZKSA 2P3TB 1O2GH 2YMSB 2D2DA 5EQQA 1SLXB 3LOXA 3MNBA 5G4BA 3KIDU 3IITA 2QYIA 2QAAA 1O3OA 1G30B 1Q3XA 1C2KA 1Y3XA 2ZDNA 3UR6A 2A1DB 1AE8H 2PTNA 2M5TA 4K8YA 1SQTA 3RXGA 2SGPE 1AVGH 2HLDD 3AW1A 3NPSA 1S5SA 2IPQX 3FANA 1PPBH 1S6HA 1VGCB 1GVKB 1BJVA 1NBME 3PM3A 4YOJA 3QTOH 2J9NA 2BY7X 1F2SE 1BCUH 4MQAA 1CHGA 2GCTB 3LGIA 1SLUB 1Z8JB 4YLUA 3NUMA 1EB2A 1AO5A 1EPTA 4CHAC 2BHGA 3QK1A 4WMEA 4K1SA 3GY4A 2G55A 1MU8B 3UWIA 3Q00A 1HAVB 5LH8A 2ZTXA 3SI3H 4OS5A 6GCHF 1LQDB 5DP6A 1K1JA 1LHGH 2EC9H 4OS4A 2G8TA 3N99A 3MNCA 1HIAB 3ODDA 1ZTLA 3LKWA 4HZHA 4I8JA 1HJAB 3PV2A 1S0QA 5L6NH 1OWJA 1F5KU 1MD8A 2ZFTA 2O8LA 1EZUC 1UHBA 1SLVB 5EU8A 2BDCA 1ANBA 1GI2A 5DG6A 3TGJE 1PPHE 4MPUA 2JJ2D 3KF2A 1QB1A 1L4DA 1Z1JA 2WV9A 1O2SA 1W11U 1MTNB 4ZKSU 2GT7A 2V3MA 4GCHG 3ZIAD 5A0BA 3KQCA 1XUKA 1GHVH 1ELAA 4WF8A 3PV5A 3RXRA 3L33A 2J2UA 1P2KA 1BDAA 1A5GH 4KGAA 4ZXXH 4K2YA 5ABWA 1B0FA 4K69A 5J4QA 1RTKA 3UTUH 3OFND 1FN8A 2KAIB 5EPNA 3MOCA 1D3DB 1P09A 5GCHF 2QE7D 4NCYA 3A80A 4INKA 1GBBA 2RCEA 1BRCE 2AMQA 2TIOA 4Q7YA 1MU6B 4HFPB 1FIWA 5C17A 1NT1A 4RT1A 3U9AH 4Y10E 4MNWA 1FV9A 2ZQ1A 1MCVA 1QL7A 3U8OH 6CHAB 3TH3H 1VKYA 4FU7A 5SGAE 4FUDA 4Y8YA 7ESTE 2Y7XA 1MABB 1MUEB 3E0NB 1O5FH 3GDSA 4GPGA 5TCAA 2BDYA 1F5RA 3SYJA 5FXLA 1FAKH 3EQ0H 1Y3VA 2WZQA 3T5FH 2V7QD 1CA0B 1C5WB 4OS7A 1C2FA 4CRAA 2O8TA 1MKWH 2UUKB 1THPB 7LPRA 2O8WA 4AN7A 5DKMA 4LK4A 4I32A 1F0RA 1NESE 1O2VA 2Y80A 2EEKA 3SU0A 1MAYA 3WWBA 3QGNB 1AD8H 1SG8B 1G2MA 3CS7A 5CHAB 2J92A 2VWOA 4AFUA 3SJKA 2Z94A 2BY8X 2CMYA 2XC5A 4Y76A 3S69A 2GP9B 2BX3A 1QJ6B 1O2LA 4XRNA 4NA8A 2VIWA 2W6ID 2HNTC 1BUIA 3TNTA 1W3CA 2ANMH 3SGQE 1FPCH 1OP0A 4BAQB 2PSXA 1ESTA 4KELA 1LKBA 1H9HE 4X8TH 3F1SB 2J95A 1GBJA 3D49H 3RXLA 5C20A 1GVLA 2PSYA 3FZDA 2VINA 3SUDA 4JZIA 4U01A 1LVOA 2FS9A 1NFXA 2ODPA 1RD3B 1HAXB 1NRRH 2UWOA 3SI4H 1UCYK 2GV7A 3P8GA 1GBFA 2PKAA 1WTHD 3KN2A 3QZQA 1QURH 1A61H 2FODA 1CBWC 3MHWU 5A0AE 1HFDA 2RDLA 1TRYA 3LDXH 2C90B 4GHQA 2A4OA 2FMJA 2LELA 2ZIQH 3LGUA 2FIRH 3DD2H 1SGDE 1SGIB 2A45B 3UQVA 1EOLA 4AORA 2QCYA 3U1JB 2Y7ZA 4I8KA 1ANEA 4Q4LA 5DN6D 1RJXB 1VITF 2FESH 1LHDH 3BTEE 1C2IA 2QF4A 1S81A 3BG4C 1MTSA 5EOKA 1C1MA 1BRBE 1NC6A 4ABHA 1ABJH 4BXWA 1S0RA 3RXTA 1DUAA 1G9IE 1K21H 1C2MA 2ZPRA 1AI8H 9ESTA 1DLKB 1HAOH 1X7AC 2BLQA 2FPZA 3U28C 1PPGE 2AGIX 5EXMA 5KEDA 2QC2A 3NCLA 3ZVBA 1C5QA 2AFQB 4ZROA 3ZYEA 1LMWB 3JZ2B 5LPFA 1SHHB 1W14U 4H6SB 1O31A 2SNVA 1C2EA 3WW7A 5CDFE 2BVSH 3PTBA 1TRMA 2F83A 3LJOA 1H9IE 3MO6A 3BEIB 3TU7H 3HKIB 4YXWD 1T8LA 3MU4A 1T31A 3SN8A 1ARCA 2CV3A 1QA7A 1YWUA 5ETXA 4B74A 3SU2A 1C5MD 2A4GA 4F49A 3SZEA 3O8CA 1O2YA 3FAOA 3HGNA 4NIWA 1ZLRA 2XW9A 4ZXYH 1TNGA 3M61U 1E79D 3T27A 5TCCA 2J38A 3VB4A 3U8TH 3PB1E 2R3YA 3H7TA 1D9IA 3F2FA 2ZU5A 3BSQA 3UUZA 1NFWA 3GYLB 1J16A 4SGBE 1SKYE 1TA2A 1YYY1 1P01A 1KXCA 4B1TA 2BD3A 4I8GA 1CHOF 1C5YB 1BHXB 3DUXH 4KTCA 3GY6A 3OYPA 1O3HA 3A8AA 1TONA 4Q2KA 4X6OA 2XYAA 2OBQA 1OWHA 2ZCHP 1TX6A 1AE5A 1VCQA 2CHAB 3EE0B 2IJD1 5C1UA 3OU0A 3ZVGA 1OSSA 2AGGX 3KQBA 1ZMLA 3ZVEA 1BHXF 3GCHC 3LIWA 1FXYA 1DX5M 3PLBA 5EJLA 5T6DA 1C1NA 1N6XA 1O2ZA 3EA7A 3SNEA 1C1PA 3LH1A 2JJ1D 1UVPA 3ZZDA 1NROH 1DFPA 3SUGA 1GHWH 1DOJA 2XBYA 4XBDA 3RXJA 2J98B 1AQ7A 1ETTH 1Z7KA 3RM2H 1WXRA 5E0JA 4BTTB 2WPIS 4FUFA 5EIYA 2CF9H 1FQ3A 1GMCG 1L1JA 1SGRE 1GMDG 1MQ6A 1O2KA 5H4IB 3O8DA 2TBSA 2P95A 4YO9A 4CRBA 3ATMA 3SU4A 4DOQA 1V2MT 3RDZA 2D26C 4BOHA 1HXFH 3GISB 1V2WT 3PLPA 3SNAA 1DS2E 1BITA 2YOLA 3E0PB 4FU8A 1TNKA 1W13U 3SV2H 3RLWH 4DIHH 4TY7A 1YGCH 1AFQC 1JIRA 3FVFB 1QQUA 2CK3D 2Z9IA 2G52A 5GIBA 1O3AA 2EI7A 4GHTA 2ILNA 2ZF0H 1GJ7B 1QRWA 1TOMH 5FPSA 1C4U2 1V2TT 4FETA 4FU9A 2ZU1A 1E1QD 2Z9GA 1SMFE 3SGBE 1TNLA 3MH7A 1A1RA 4MG3A 1YBWA 5A0CA 5FCRA 1P11E 1YPHE 2AIPA 5FBIA 1E0FD 4CR5A 3KYFA 3HK3B 3NK8A 1YF4A 4H4FA 3SNCA 2R3UA 2ZFSA 4ABJA 1UTMA 3RXPA 3UWJH 1CHOG 3ZZBA 4NIXA 1IQNA 2A4QA 1W0JD 8GCHG 1DSTA 4CRGA 3CNRA 4NIYA 5EXLA 1BTUA 3E1XB 4DW2U 2NWNA 1V2RT 5HM9A 4F48B 1UK4A 1BMFD 2FXRA 2GV6A 4ISHH 5T1VA 1DWDH 1S6LA 1SFIA 5FL7D 2OTVA 3LT3A 1HAZB 1DY8A 1J17T 1A2CH 2ZA5A 1TX7A 1ZTKA 2PGBB 4J2YB 1C9PA 4RKOB 3A89A 3ZYDA 2B7DH 3K6ZA 3AAVA 2FX4A 1EAUA 3UB0A 1YY3A 2OC0A 4JMYA 1MH0A 2SGEE 5FAHA 1RIWC 2Q6GA 5A2MH 3RU4D 4BAHB 1ZOMA 2STAE 4MPXA 3RMOH 2GMTC 2GTBA 2ZGBH 4UFFH 4WH6A 4UEHH 3ZZ4A 1AB9B 3NXPA 1C5SA 3SGAE 3A7YA 5JYIA 1UTNA 2B0FA 4NSYA 1BTXA 4DVAU 3FP7E 1FPHH 1QY6A 2A4RA 1MCTA 2XRCA 3K9XB 1QHRB 1Y3WA 1FLEE 2NU4E 2XBWA 2BYAX 4ZKNU 2AEIH 3BTME 1IHTH 3T2NA 1ELEE 4YT7H 1MTWA 2HLCA 1GHYH 2ZZUH 3QGJA 2O8MA 5E2PA 2HVXA 2F4LA 5FPTA 2YNAA 2BX4A 3IG6B 1C1VH 1EQ9A 1CGJE 1GWAA 3UR9A 1KDQA 4X2XA 4NA7A 2G4UA 1PQ5A 2IJOB 1LVYA 3T28A 1EJNA 1TB6H 2ZFRH 3SU1A 3VB5A 4IC5A 4XFQA 4ABIA 2ZPQA 4ISOA 3PWCA 3VXFH 1J15A 1DSUA 3BN9A 1AWFH 3SJIA 3SNBA 3E90B 1LKAA 2QV1A 1BTZA 1GG6C 1WTGH 2B9LA 1GMHF 1KTTB 2DE9A 3RMNH 2BB4A 4D7FA 1GCTC 5F03A 3FZZA 1Y5BT 2XC4A 4A7IB 1TPOA 3OE7D 3PMHB 2JH6D 1EZQA 1P3CA 2Q6FA 1C1QA 4UFEH 5C2ZA 2PKSC 1VJ9U 2ASUB 3BTQE 1AHTH 5C67A 1IAUA 2ANWA 1GHZA 1BRAA 3DSOA 1RFNA 1N8OB 2HGTH 1AKSA 4I8LA 3RXAA 1LPZB 4CREA 4GCHF 1T8MA 4ASHA 2ZTZA 1QJ7B 1BTHH 4M9FA 1EZXC 3LPRA 1TGCA 2ZTYA 3PROA 2F3CE 5L30H 3GY2A 4I7YH 3EAJA 1O3EA 1BBRH 1ZTJA 3DA9B 3SJ9A 4J1YA 1QNJA 2CN0H 1YPEH 5CHBA 4Z6AH 5C3NA 4AG2A 1PQ7A 2ZFPH 3VFEA 4CRCA 2WUCA 5KGOA 4IC6A 2BY5X 1CT4E 2FTLE 3QN7A 1OPHB 1GDNA 1QJ1B 4JYVH 1GGDB 1N1LA 2KCAA 2WPHS 4ABDA 1FJSA 1BA8B 2HPPH 5EXNA 2FTMA 4MPVA 2BXTH 3NRLA 1UCYH 4I33A 3ATLA 1D4PB 3RC4A 5JBAS 4MPWA 1O0DH 2Z6BD 1B0EA 5EQRA 4JZEH 3ZVFA 1V2QT 1XKBC 5EQSA 5EODA 2C8ZB 2WINI 2BY9X 2WSSD 3URCA 1PFXC 3EE7A 4E06H 1HV7A 3QO6A 1AVXA 4BANB 5E8EH 1KSNA 3BTTE 3MNSA 1H9LB 3W1EA 4D9QA 3RXOA 1BMMH 1W10U 3TVJB 3QDZB 4M7GA 4ABFA 4X1RU 3OTPA 4GSOA 4OGXA 1DDJA 5GJ4B 4AFZA 3ZVCA 1DLEA 1GJ8B 3G01A 4MNVA 4Y71A 1SQOA 1Z8GA 1TALA 2HPQH 2GZ7A 1N8OC 1Z1IA 4O3UA 2XNDD 1O2PA 1P2MA 3A83A 2WPJS 5ESBA 1GMHG 3ODFA 2BZAA 3U98H 2VVVA 4YOGA 2JETB 1UK3A 4AG1A 2FOCA 4BXSA 2PW8H 3ZZCA 2GD4B 3M7UA 1KYNA 2QF0A 3M3SA 1DANH 1YPKH 3JZ1B 1ZSLA 3M3TA 1A0LA 2ZEBA 2KCYA 2ZECA 4X8UH 1FY8E 1XVMA 2HOBA 4HG6A 4DT4A 3BTDE 3TK6A 5HKKD 2OK5A 1G37A 2PFEA 2J94A 1QBOA 2TGPZ 2ZHQH 1D3TB 1H8DH 3MH4A 2ZC9H 3BV9B 1OXGA 2YMSC 3A8BA 5EJ1A 3F2HA 2ODQA 1NM6A 1E35B 4AX9H 3A82A 3VXEH 1DXPA 1FI8A 4AB8A 1O3GA 4Y6DA 3ZZ6A 1BMAA 1G3BA 1DWEH 3W95A 4TPIZ 1ORFA 1HGTH 1TGNA 2NU2E 2F9NA 3OEHD 1O3KA 1SLWB 1GJ5H 1O37A 1C2LA 1VGCC 1YKTA 4QT8C 2SGQE 1DE7H 1CE5A 5I25A 1ZZZA 1P12E 4X2YA 3ZV9A 5LPRA 2XNIA 1LCYA 2OUAA 2Y6TA 4ZHAA 2GCTC 1V2UT 4IS5A 1SGQE 1PPCE 4Y8ZA 1GBCA 1GI6A 1NU9A 2HNTF 5GNDA 2WHXA 2BOHB 1Z8IB 1DICA 1GI5A 2FYRA 4O9VA 4NIVA 1C5PA 1NRSH 2H2ZA 4FUBA 1B5GH 1N6YA 1GHAG 1TABE 1QFKH 2OC8A 4CBNA 1K1IA 1MKXK 5HIYA 1P0SH 2VGCB 4ABAA 1GBKA 4VGCB 1HJAC 4PROA 3SQHE 1A5HA 1SBWA 1OYQA 3BIVH 1HB0B 1LQEA 4DY7B 2XC0A 2AMDA 1SGPE 5EJZA 1YLDA 4ABGA 3RU4E 3ZZ7A 1K2I1 3BTKE 2I6QA 1W7GH 4OS6A 2LPRA 1BBRK 3TK9A 1H8HD 2WPDD 1HDTH 4E7RG 4BAMB 3KL6A 1O30A 1MTNC 1ZRBA 2ZU2A 3MO3A 4ASUD 2PR3A 4B2BA 2Q1JA 4UE7H 1P2JA 1SGNE 2L6OA 1UVSH 4SGAE 3Q3YA 4XDEA 2VIDA 3VPKA 3MMGA 1TPPA 1AY6H 2PTCE 1GBAA 4TWWA 1AZZA 1K9OE 4FXGH 2IN2A 2ZGXH 3OY5U 3PMBB 4OGYA 3H5CB 6LPRA 1EP5A 3KCGH 2TGDA 3UIRA 2VVCA 3PO1B 1PJPA 5JBCS 4TYDA 1GJDB 1MMJN 1GI7B 4BTUB 5AFYH 1EX3A 1GHBG 4K60A 3SQEE 4AFQA 1C5TA 2FP7B 3B23B 1NFYA 3LGYA 4R8TB 3MU0A 1GL1A 2VWLA
chains in the Genus database with same CATH topology
1GVZA 5T3HA 1K1OA 3RXDA 1Z8RA 1K1LA 6CHAC 1BMLA 2IOTA 1AUTC 2I6SA 2Z3CA 1OS8A 2A2XH 1G36A 1YCPM 3SOSA 3BTHE 1ID5H 3PWBA 3TH2H 1O5EH 3P8OA 4HGCA 1IQGA 3FP8E 1KTSB 2QXGA 4TWYA 3ZZ8A 1C9TA 3GY3A 4AB9A 3VB7A 1CA0C 1CGIE 1GMCF 3E91A 1GMDF 3A88A 1GBHA 3B9FH 2H6MA 3GDUA 4K1EA 3K2UA 3PV4A 4VGCC 4YLQH 1XXFA 2ZP0H 1O5CB 3ATKA 1YPMH 2F9UA 4KP0A 5CHAC 4ESTE 2TGTA 1SQAA 1TGBA 1EAWA 5BRRE 3BTFE 5AHGH 2W5EA 2HRVA 3M35A 1BTWA 1TMUH 2BY6X 3RXVA 3I77A 3SU6A 8ESTE 2CXVA 2AH4X 2WV4A 3VGCB 3FP6E 4FVBA 1G3DA 1ZHMA 1D3PB 1A5IA 3R3GB 2Z3DA 1EPTB 1TWXB 2XCFA 1ZSJA 1ELGA 1HNEE 4KKDA 2FOMB 1V2OT 1P9SA 1K28D 2QIQA 1BTYA 4A1VA 3Q77A 1QB9A 3GCTF 1FUJA 4WXIA 3RC6A 1T4VH 4TY6A 2NU0E 4MNXA 1TMTH 2FWWA 2UUJB 1GJ9B 1WV7H 1A4WH 4WXVA 2NU3E 3BEFB 4TPYA 1O3IA 1O2HA 1TOCB 3GOVB 3ITIA 4JCNA 1O3DA 3F68H 3D65E 4Q7ZA 5HYOA 2FEQH 1GBMA 5T6GA 2OC7A 2UWPA 1UHBB 1BIOA 1EASA 1P2OA 1XKAC 3Q76A 5HM2A 1G2LA 5EGMA 1MBMA 1LDTT 2GX4A 3HPTB 4B73A 1O3BA 2FM2A 3F9FA 8GCHF 1FN6A 4Y8XA 1QRZA 1HJ8A 3HATH 2PUXB 1YPLH 4WH8A 4BAKB 1C5VA 2AGEX 1YPHC 4LXBH 1CSOE 2AYWA 1S82A 2BZ6H 1O2MA 4THNH 1F5LA 2FI3E 4X8SH 3STJA 8LPRA 2AERH 5DO4H 3HK6B 1SSXA 1RTLA 3ATIA 2ODYB 2V6NA 2XTTB 4MVNA 4AGKA 1JBUH 3WY8A 1C4Y2 1JMOH 1H4WA 1SGFA 2K1QA 2ZDLA 2P8OB 5JBTA 4X1QU 1RTFB 1EOJA 2ALVA 1JRSA 4JK5A 3UREA 1O36A 3V3MA 1LHCH 3A7ZA 2C8XB 1V2NT 2AS9A 2BVRH 3LJJA 3DFJA 3SZNA 4ABEA 1O3FA 2EA3A 1PPFE 3L3TA 4CRDA 2ZDMA 3VB3A 1JRTA 2ANKH 2FOGA 3A81A 2TGAA 5LPEA 1C4V2 3SUFA 2JH0D 3QWCH 1EKBB 5DP3A 2FS8A 1GDQA 2WV5A 3O8BA 4B2AA 1GCDA 1O2QA 1EATA 1YP9A 2ZU3A 1CU1A 2HWLB 1UO6A 1IQFA 4X0WU 3STIA 4JK6A 1OKXA 4XBCA 5K0HA 3SV9A 4YOIA 4NFEA 5GWZA 1O5AB 4NGAH 4GAWA 1C1RA 1IQHA 4MNYA 2BQ6B 4UD9H 3M5LA 3GCTG 3BG8A 3S9AA 3EYDA 3P17H 1UVOA 3UOPA 1L4ZA 3BIUH 3UPEA 2R9PA 2BDHA 2UUFB 4LZ4B 1TNJA 1IQLA 2XBXA 1IHSH 1SI5H 1KIGH 1HAHH 2CHAC 1MTVA 1LTOA 1VJAU 3HKJB 2JH5D 1JWTA 1TIOA 2FOHA 2P3FH 2A0QB 1HAVA 1KXEA 4X6PA 1QIXB 1SFQB 1Q2WA 4ABBA 1C5UA 1QB6A 1HAYB 1O3PB 3TJOA 1HIAA 2LNCA 4NFFA 1ANCA 1UMAH 2Z7FE 1OWEA 4JZFH 1FAXA 4WY3A 1A7SA 2FX6A 4INHA 1E36B 1DM4B 2BMGB 5CMXH 1XUIA 2PKAB 3M37A 1O38A 2PLXA 1D6WA 1O32A 5IDKA 1YPJH 1SL3A 2H9HA 3CP7A 1O39A 2QXHA 1UTKA 2O8UA 2IPHA 1EJMA 3OY6U 3I78A 3NKKA 4NWKA 1QBVH 5EPYA 2ZHEH 2XWAA 3L6PA 2PGQB 5GDSH 7KMEH 1CQQA 4AFSA 1TLDA 4YZUA 1K22H 3RUOA 4IMQA 4O3TA 3PMJA 3SBKA 2KAIA 3F9EA 2XCNA 1PYTD 3D23A 3TLOA 2PUQH 1G3CA 3MH5A 1ZYOA 1NRPH 1S6FA 2FOBA 2AMPA 3LGWA 3SJOA 2UUYA 4X1PU 1K1MA 1C1TA 2Y81A 1A46H 1IQEA 2Z3EA 1Y8TA 2WPKS 4U30A 1WU1A 4UONA 1O2NA 1ZGVA 3RM0H 1FDPA 1OWDA 5JB8S 2CGAA 1ABIH 2H1UA 1ELDE 1ANDA 2ZU4A 1TGTA 3TK5A 2BDGA 1AVWA 2ULLA 3F9HA 1O3JA 2C3SA 1OOKB 3MH6A 1T7CA 2BQWB 1G32B 3VB6A 1XUHA 8KME2 2A7CA 2W3IA 4XOJA 1U6QA 3T25A 2G5VA 4YTAA 3R0FA 3S9CA 1O2WA 4X2VA 1LHEH 2BLVA 2EI8A 1KY9A 3KQDA 1P04A 2QGRA 2ZFQH 1ZSKA 4Y79A 2CJIA 3LONA 3S9BA 1EB1H 1P06A 4I8HA 2GT8A 2UWLA 3PYHA 3KQEA 4NG9H 2FI5E 1DVAH 1MZDA 2P59A 4NZQA 1MKXH 3KHVA 5EG4A 1C1SA 1A0HB 1AIXH 2SNWA 1XM1A 4INLA 3AAUA 2PV9B 1HCGA 1TQ7B 1RS0A 1FY4A 4A1XA 3SORA 1F0TA 1UK2A 1W0ZU 3KEEA 4JYUH 4CHAB 2WUBA 4DURA 3QX5H 2DUCA 2C93B 4ISNA 5AVDA 4ZAEA 3M5OA 1ELFA 4K1TA 4IN1A 1O33A 3E6PH 1AB9C 1WYKA 2ZDKA 4AOQA 2ZGJA 1WCZA 3A7VA 1V2LT 2H9TH 1QL9A 2OD3B 4AGJA 1L1NA 5LGOA 5JDUB 2BD9A 5B6OA 1AFEH 1MD7A 3SV8A 1TQ0B 1RGQA 4I31A 5FX5A 1QCPA 3ZV8A 2V35A 3M5NA 2VVUA 5TJXA 2A7HA 2J4IA 3SNDA 4HTCH 1W2KH 1VITH 1Y59T 1QRXA 2A7JA 1BTPA 3GICB 1MZAA 2BM2A 1DXWA 1J9CH 1O5BB 4ZUHA 1ELTA 2PWXA 2ZG0H 2DE8A 3A8DA 4D8NA 3LGTA 5ESTE 3MO9A 1P05A 1TBZH 1ZPBA 1SVPA 3I29A 3E8LA 1V3XA 1QR3E 1GHAF 3QZRA 2VIQA 5EW1H 4FUCA 2H5CA 1O2IA 3S7HB 3ZVAA 4CH8B 1GJ4H 4NWLA 4H6TA 1G3EA 2ZCKP 2A5IA 1O3CA 1ELCA 1NFUA 5T6FA 1GI9B 3C27B 1P3EA 3TGIE 1W8BH 4Y0ZE 1P9UA 5FPYA 3Q3XA 1HXEH 3A86A 3CENA 1C5RA 1AGJA 3QLPH 1AN1E 1GI3A 1S83A 3FFGA 1SR5C 3S7KB 1FY1A 1TE0A 2P16A 5C5OA 4ZHMU 1THRH 1KXDA 2ZGCA 1O2RA 1WQVH 1NS3A 3TH4H 1HRTH 1GJAB 2J34A 1PQAA 2GZ8A 2B8OH 1Q31A 3M7QA 3UNRA 1UTJA 2ZQ2A 1SOTA 1IOEA 3RXBA 4GVUA 4YESB 5JPMH 1T8NA 4UFDH 3TJVA 1NZQH 1CVWH 3A85A 1DT2A 1MQ5A 1BMNH 1PYTC 1GHBF 5DK1A 4KTSA 4HI3A 1TBQH 3A87A 4ISIH 5FHTA 2TRMA 1XXDA 3AW0A 1C2JA 2GGVB 1O2OA 1GGDC 2VWMA 3OX7U 4XE4A 3P8NA 1WSSH 1F7ZA 4WWYA 3KGPA 2FLRH 3P6ZB 1TPAE 3LC5A 1V2KT 1QTFA 5DPAA 1XUFA 1HBTH 4ZKRU 2W26A 1JIMA 4BTIB 1CA8B 2OQUA 4NSVA 4U2WA 1YPGH 1F92A 1LPGB 3VEQB 2Y5GA 3MI4A 3GY7A 1L2EA 1NRNH 4X2WA 2F9VA 1DY9A 1GL0E 1DITH 3V12A 2GCHG 1BOQA 1UJ1A 4IBLH 3RXEA 4DJZB 2ZGHA 1ETSH 3AASA 1SGFG 3QTVH 3TITA 1TPSA 1WAYB 3SV7A 4BAOB 2G81E 3LGVA 1O2JA 2SGDE 1NU7B 4MTBA 3ZZAA 3UFAA 3RLYH 1Y3YA 4JZ1A 1F0UA 1CBWB 3B8JA 3F9GA 3SHCH 1AU8A 4AYVB 3SJ8A 5A8YA 2BLWA 4X6MA 2A32A 2QF3A 3M36A 2VH0A 5DJ7A 2D8WA 2FOFA 3TPIZ 2JETC 1HAIH 1KDQB 2C8YB 5L2YH 3V13A 2Y5FA 1ARBA 1NO9H 1EAIA 5K7RA 1FONA 1ESBA 1EXFA 4O03A 3BG4B 3OSYA 1P57B 2GDEH 1HLTH 1WOFA 2G4TA 5E2OA 5F8TA 1P10A 3EA9A 1C2HA 1J8AA 3HGPA 1DPOA 1IQIA 4K5ZA 3URDA 4F4OC 4A1TA 3GCOA 4XSKU 1XX9A 3C1KA 1FMGA 2BOKA 6GCHG 4RN6A 5EW2H 3D62A 5DP9A 1Z6JH 2VH6A 2ANYA 1LO6A 1AWHB 2V3OH 4XBBA 1Z6EA 3H7OA 1EP6A 7GCHF 1AKSB 1O2TA 1UVUH 1UTLM 3K6YA 4ZMAH 4OS2A 1P8VC 1MTUA 4X6NA 1XUGA 1MBQA 4FUGA 1CT0E 1FY5A 5A8XA 2VNTA 1QBNA 1GBIA 1P2QA 1H8IH 2OXSA 3MU5A 1P03A 4K3JA 4KTUA 1QGFA 1FIZA 1Y5AT 1W12U 2D1JA 4MDSA 4B2CA 3MU8A 2FDAA 3SV6A 2ZFFH 1GBTA 2EI6A 3A7WA 2QXIA 1W0YH 1KXAA 2VIVA 2FO9A 1HYLA 2VGCC 5F8ZA 1DWCH 3EA8A 2BD5A 1HJ9A 2VIPA 2BLOA 3ATWA 4IW4E 1EAXA 3BEUA 5GCHG 4X1SU 2RA3A 4E7NA 4DG4A 3TGKE 4CH2B 1FZZA 1WUNH 4O97A 1MAXA 1SGEE 2WPMS 4B75A 4Q80A 1BB0B 3TJNA 1O35A 5BPEA 2VJ1A 4X8VH 2QA9E 5PTPA 1YM0A 3BF6H 3GCHB 2F91A 2ZPSA 1C2DA 1WBGB 2STBE 1L0ZA 4GUXA 1ZJKA 4JYTA 1FNIA 1C1WH 1Z71A 1C5XB 4LOYH 1ZJDA 3ZZ9A 2BD4A 3DHKH 3SU3A 1EUFA 2A5KA 1L1GA 1O34A 5AF9H 1CGHA 2FZZA 3SO3A 3RP2A 1GHXH 2G00A 5FCKA 5I46H 2GDDA 1DUEA 1XVOA 3A8CA 3MNXA 3MU1A 1VCWA 3PO1C 5AFZH 1V2ST 1A0JA 3P92A 4GLYA 1UTOA 3RXCA 4D76A 1YLCA 2HNTE 3RXQA 5DGJA 3ENSB 3MWIU 1HPGA 3DFLA 1Y5UT 1TX8A 3GY8A 1Y3UA 1GJ6A 2TPIZ 5DP7A 1O5GH 1O5DH 3AVZA 1NN6A 4Q7XA 3DT0H 1QL8A 7GCHG 3ESTA 1SB1H 2WYJA 1NRQH 1AFQB 5HGGA 1WQSA 1YCPH 4CR9A 4ZHLU 1HUTH 2CF8H 2QXJA 3MYWA 2Q6DA 1V2JT 2BD8A 3SUEA 1T4UH 3LC3A 3TJUA 1GPZA 2R0LA 5IYTA 2ZDAH 5C1XA 3RXSA 1T8OA 1D6RA 4DCDA 1KXBA 1HAPH 1TA6A 2SGFE 1PQ8A 4B76A 2XBVA 3KNXA 2P93A 3PTNA 3RU4T 3V7TA 1VCPA 1ZMJA 1O2UA 9LPRA 2VWNA 1KLJH 2SFAA 1LPKB 1MKWK 1PPEE 1IQMA 1O2XA 3EGKH 5GPIB 1OWKA 2P3UB 1OP8A 4YM9A 2R2MB 3VGCC 3SU5A 4WJG2 3ZVDA 1P2IA 1AMHA 1C1OA 3UQOA 1KLTA 1UTQA 1C1UH 1EPTC 4IMZA 1C5LH 1VITG 4FUIA 1EZSC 4IGDA 1PPZA 2FYQA 3O8RA 2NU1E 2GKVE 2BDBA 1ELVA 4H42U 3RXFA 4ISLA 1AUJA 4D7GA 1ZHRA 3PMAB 3UOUA 1TFXA 2HALA 1VZQH 3ELAH 3LH3A 3M7TA 4Y7AA 3NWUA 3V0XA 1BBRE 4RKJB 1SPJA 2OP9A 1QQ4A 1RIWB 2YNBA 1ZGIA 3RMMH 4DIIH 1E34B 1THSH 2JKHA 1T32A 3N7OA 2GMTB 5GXPA 2QN5T 2BD2A 1EJAA 2ZNKH 1B7XB 1M9UA 4DGJA 5A09A 1V2VT 3W94A 1SOZA 4FUHA 1OYTH 5C5NA 3UNSA 2A5AA 1ZRKA 4D9RA 1SGTA 1SGCA 4A6LA 3LU9B 1V2PT 4A5TS 2WYGA 3A7XA 3TNSA 4RSPA 4CBOA 3SHAH 5DP8A 4WMDA 3T62A 2BDIA 1UCYE 2R2WU 3OTJE 1NTPA 1TMBH 1LVBA 4OS1A 1C5NH 1FY3A 2ESTE 4CRFA 1TBRH 3K65B 2P8OC 5E0HA 1O3MA 2WPLS 2FOEA 2Y5HA 4FUJA 4BNRA 2O9QA 2ZI2H 1SHYA 4Y0YE 2F9BH 1GI8B 2A31A 2G5NA 4R0IA 1O3NA 2B5TB 4NA9H 1OX1A 3U8RH 1IQJA 1S84A 3GDVA 4IN2A 3IWMA 2OLGA 2OINA 2W3KA 3PLKA 4FVDA 1GG6B 1W7XH 1RRKA 2P94A 1HAGE 3U69H 1K1NA 3BTGE 1V6DA 1XMNB 2FI4E 2QY0B 1K1PA 1GCTB 2ZDVH 3MFJA 2Z9LA 2BD7A 2W7UA 3GCNA 5FBEA 2A2QH 2F9OA 2V3HH 3T26A 1TGSZ 3UNQA 2PKSB 2BXUH 5J4SA 1YC0A 3RC5A 2BTCE 3T29A 3TIUA 1O3LA 4K8BA 2ZHWH 1ZMNA 2ZHFH 5DP4A 3M3VA 1TNIA 1P02A 1VR1H 3RMLH 2H5DA 3SW2B 1XUJA 3A84A 2PHBA 2Z9JA 4ZH8A 1NY22 1IQKA 4ZKOU 3M5MA 1D3QB 5JBBS 3P95A 2GVFA 1GI4A 2XXLA 1F0SA 4UFGH 5F8XA 3E3TA 1JXPA 1OP2A 2RG3A 3U1IB 1TRNA 1A3EH 1YCPK 2ZCLP 3P70B 2OC1A 2H9EH 2BDAA 3A7TA 3P8FA 5HXFA 5E0GA 3MTYA 1ESAA 4MLFB 1ZPZA 4NZLA 2C8WB 1BZXE 2ZO3H 4LZ1H