3UR6A

1.5a resolution structure of apo norwalk virus protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
164
Chain Sequence
b'MAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase
total genus 37
structure length 164
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A01
4NA7A 1Z8IB 1AGJA 4AFZA 1GBBA 1XM1A 5JPMH 2VIPA 1VCWA 2GCTC 3NPSA 2SGEE 3FANA 1HRTH 1YPHC 1SBWA 4CH2B 2HPPH 1SMFE 3A8CA 3SU5A 6GCHF 4Z0KA 1GG6C 1EB1H 4MLFB 1IQIA 1ZSJA 3F9FA 1SGEE 2WPHS 1MTNB 5EG4A 4K8YA 1GL0E 3LGIA 1L4ZA 3FZDA 1GI2A 1FY3A 2J34A 2G5VA 1V2ST 3TIUA 1JWTA 2P59A 4I32A 3SW2B 2ZCHP 4K5ZA 1C1OA 3ZVGA 1SLWB 1HBTH 1QGFA 4CHAB 1DOJA 1TFXA 1H1BA 4B76A 3RXBA 4KTSA 3A82A 1T31A 2TBSA 1Z6JH 5GCHG 3NXPA 1IQGA 1BHXF 1CGIE 1LPGB 2ZNKH 5E0HA 1SGCA 5DP9A 3GDUA 3QGNB 3SV9A 1TBRH 5L30H 1SLVB 3QLPH 2THFB 2J95A 2Z3CA 1SHYA 1QRZA 4YT6H 3PTBA 4AYYB 4FUDA 4HFPB 4JYVH 1ELTA 1THSH 4AN7A 4WVPE 1IQHA 1AVGH 1CT2E 3MO6A 3SQHE 1FY5A 1ZRBA 1JIMA 1K1OA 2PW8H 3GISB 1GHWH 1Y59T 4AG2A 1CA0B 3LU9B 1IAUA 2QXGA 4X2XA 4Y0YE 1SR5C 1HJ8A 2R3UA 1XXFA 3SHCH 2J2UA 1CVWH 3RXCA 2IOTA 4INKA 3G01A 1GI1A 4INHA 2A7HA 1NM6A 2FLBH 2AYWA 3KQBA 1TALA 2VWLA 4A6LA 5DG6A 1IQNA 1QBOA 1SQAA 2ZTYA 4O3UA 4YOJA 1PPZA 2ZGCA 4NZQA 1O2LA 2BD9A 3TH3H 1DWCH 4E7RG 3RLYH 4M7GA 5EPYA 4ZUHA 1QBVH 1OOKB 1YPGH 1W3CA 1QQ4A 2BD8A 3QUMP 1F0RA 1GCDA 2ZFRH 2FO9A 2FMJA 1C1VH 2B9LA 4J1YA 3SUDA 2TGAA 3SUFA 2CHAC 2ZDLA 1IOEA 4GUXA 2TRMA 3RXLA 3M7UA 3ZVFA 3E8LA 1D4PB 5A2MH 3MNCA 1HFDA 1NRSH 4I7YH 3TK5A 3SU0A 5AFYH 5G4BA 1LVMA 1O2RA 1ZRKA 2Z9KA 1ZLRA 2XBVA 2VIVA 2JETB 4AB8A 3BG8A 3F6UH 1GBHA 4YTAA 3T26A 1H4WA 4K69A 2BQWB 3O8DA 1BMNH 4JZFH 4ZAEA 3VXFH 2ESTE 2OLGA 1DE7H 1GVKB 2GMTB 3MNBA 1C5WB 2G8TA 1W2KH 2GV7A 4BTTB 1L4DA 2BXTH 5E8EH 5IDKA 1MTNC 1ELFA 2QYIA 3MU0A 4B1TA 3MH7A 1YPKH 4MNYA 3A81A 2ZEBA 4X6NA 3E0NB 3ZVBA 3SNEA 4CHAC 1TGBA 1XX9A 4D9QA 3PLKA 1NPMA 2HNTC 1LHEH 3NK8A 4MTBA 1NESE 3PM3A 2ZPSA 2Y81A 1MTVA 2Y80A 5BPEA 1F5RA 1YBWA 2ZWLH 1O3AA 1GHVH 1TBZH 1IQMA 2OC1A 2VH6A 1FNIA 2BDIA 1G3CA 3M5NA 2Q1JA 2OC8A 2V3HH 1QQUA 1W0ZU 2ZDAH 1XUKA 2FWWA 4B2AA 4DG4A 2G4UA 3TNSA 5T6FA 4ZXYH 1EXFA 3EQ0H 1E36B 2XBWA 5EGMA 3SBKA 1BBRK 1CA0C 4K8BA 1DSTA 3SU3A 1ZYOA 3RMMH 3RXIA 1O38A 2QIQA 1P3CA 2O8TA 3MMGA 5A8ZA 5C1UA 1UVSH 2H5CA 5FX6A 3JZ1B 1XUIA 4KGAA 4YESB 3ZYEA 2KAIA 5GDSH 3Q3KA 1FIWA 1A3EH 2EEKA 3ZZ8A 3Q3YA 1WOFA 1CGJE 3QTVH 2XYAA 3BEIB 2FTLE 1MCVA 4MNXA 1VZQH 4JCNA 3LKWA 1SB1H 1O5GH 1SGQE 2A5KA 3RXRA 2RDLA 1A5GH 1GPZA 3EE0B 1SGFG 4WMFA 1G37A 3NCLA 5ABWA 2FOBA 3BTME 1EKBB 1K1IA 2D26C 1SFQB 1YYY1 1UK3A 3RMNH 4KP0A 4X1QU 1F5KU 2FX4A 2J92A 3KIDU 4WXVA 1CHGA 1EAUA 4CH8B 1V3XA 1Z6EA 2BOKA 2JETC 1A2CH 3QX5H 2GZ9A 1XVMA 4ISLA 2ZCKP 1C1NA 2CF8H 4UEHH 1SQOA 3U8TH 5CE1A 1V2UT 2GMTC 6GCHG 1S84A 1CHOF 1GI6A 2OP9A 5E2OA 4H42U 1KLTA 1SHHB 4NIWA 2VIDA 2ODPA 2GZ7A 4NWLA 1P9SA 3ITIA 1QHRB 3LIWA 4CR9A 1LCYA 2PGQB 2QXJA 2XTTB 1PPGE 2VNTA 3VXEH 1Z1JA 3QWCH 2BDAA 1OP2A 3SQEE 1JRTA 4GPGA 3SGQE 3F9GA 5FX5A 1O3GA 3E6PH 1S0RA 5LGOA 3VPKA 1AN1E 4ZXXH 1O5FH 3P8NA 4ABEA 2BD2A 1DT2A 2OQ5A 2AERH 2OBQA 2FYQA 1Q3XA 1QL8A 1P0SH 2ZCLP 8GCHF 1BMMH 2PKSB 4MPUA 4GHTA 1Z8JB 2BY5X 1C5VA 1DM4B 1TGNA 1WSSH 1C5QA 1LHCH 1J16A 1SPJA 1P2IA 4ZH8A 3GY4A 3SUGA 4X1NU 1NU9A 1C5UA 5EQQA 4SGAE 3SV8A 3UREA 2A7CA 2FM2A 3F68H 4ABHA 1PYTD 2AMQA 3ATLA 1KXEA 4ABBA 1J9CH 4OS1A 1AUTC 3LDXH 1G2LA 1K28D 3OY5U 3DT0H 4D7GA 2UUKB 3PO1B 3MU8A 2EI7A 2ZHQH 3ZZBA 1GMCF 2BLOA 3SNAA 5HYOA 4BTUB 2PR3A 1HAGE 1E38B 3BEUA 3ATWA 1W14U 1YPHE 1FONA 1SFIA 1LDTT 2ZHEH 1BZXE 4Y11E 5GWZA 3SJIA 1GBJA 1W7GH 1G30B 1GBDA 2AGEX 1V2WT 4OS5A 1VITH 1GI5A 1SC8U 1GJBB 3M5OA 2A32A 3TITA 4CR5A 2QA9E 1HB0B 2G52A 5FPSA 1EAXA 4YT7H 4U01A 2BZAA 1DSUA 5DK1A 5HMAA 3W94A 2HNTF 1CO7E 4R8TB 4WH8A 5IYTA 1O3LA 1B0FA 1O5AB 1DY9A 3LC5A 3UQOA 1DICA 2BD7A 1TA6A 4IBLH 1EASA 3A7VA 1A0HB 1BMLA 5AHGH 1Z8RA 1QA7A 1GWAA 2IN2A 3S0NA 4ISIH 3P8GA 5FXLA 1K9OE 3A8BA 3BTTE 1VCPA 2BD5A 4WMEA 1C5OH 1MTWA 5DO4H 1UJ1A 1ZR0A 5DGJA 1TMUH 4FUJA 2G5NA 1YGCH 1TX6A 3SHAH 1CGHA 1D3PB 3MH6A 2C8YB 2WYJA 2FOAA 3RXUA 1S5SA 2BDGA 1NT1A 1ORFA 4B2BA 1C5ZB 7LPRA 2BVSH 1AKSA 4X2VA 1THRH 1NZQH 2FX6A 3DFJA 1G32B 1LKBA 3M37A 3ESTA 2C90B 4MPVA 1GGDB 1GHAF 3VB6A 2QV1A 1DX5M 5J4QA 3M7TA 1F5LA 3A7XA 1BJUA 1CU1A 1BQYA 2PKSC 2GV6A 1C2KA 4BAKB 3BIUH 4UD9H 1GMDF 1MKWK 4E05H 1KXBA 2PTNA 3LGWA 4GAWA 5E0GA 1D3QB 1RTKA 2WUBA 4XFQA 1DWBH 1X7AC 3O8RA 4INLA 2AH4X 1C5TA 4X8TH 1ZSLA 1C2GA 2VU8E 4HGCA 1N8OB 3LC3A 3A7TA 5I25A 4FU8A 3BTEE 1A3BH 3PO1C 3U1JB 4K3JA 4ZKSU 4YOGA 3V7TA 1FAXA 1UCYE 1YCPM 3KHVA 4XSKU 5EW2H 3U69H 1O2YA 1DXWA 3BTGE 3TH4H 2XRCA 2V35A 1GHXH 2BTCE 3H5CB 4MNVA 1TGCA 1Y5BT 2Y5HA 1SGFA 1OSSA 1TGTA 1MU6B 4D7FA 3P92A 2F3CE 1SI5H 4Q7YA 3BIVH 1Q2WA 3MHWU 4GVUA 4UFDH 2SNVA 1HAXB 3LH3A 2FOEA 1K1LA 3JZ2B 2P3FH 1O3FA 1EOLA 1ETRH 1MH0A 3U98H 4D76A 3OX7U 3SV7A 4BAOB 2KAIB 1G9IE 1L1GA 3OTJE 3RXTA 1OWDA 1THPB 1LMWB 3F1SB 2ODQA 3MU4A 5LPRA 1VGCB 1Y3UA 1YPMH 1OWEA 3ZVAA 2OTVA 3P6ZB 3QZQA 1ACBE 2O8WA 3ZVEA 3E0PB 2SGAA 3KQEA 2W5EA 1BRCE 1MBQA 1HCGA 2V3OH 4WMDA 4THNH 1CHOG 6ESTA 1K1NA 1KDQA 2Y5FA 3MH5A 2EI8A 1SLXB 2OD3B 2OC7A 4ZROA 1JXPA 1GDUA 1C2FA 2SGQE 5A0AE 2BYAX 9ESTA 3MOCA 4AFUA 1WYKA 5ESBA 4ISHH 1O2JA 4J2YB 4U30A 2XWBI 7ESTE 1BCUH 5J4SA 4IN1A 1ZJDA 3TVJB 3RP2A 4LK4A 4MQAA 2BQ7B 1RRKA 1NC6A 2HPQH 2ZGXH 4XOJA 3RXEA 2C8ZB 2BY6X 3ATIA 2H5DA 1DWEH 2F9OA 5F8ZA 2AGGX 3A87A 1GGDC 2FP7B 4I8KA 4AYVB 1EAWA 1AY6H 3MH4A 1S81A 1C5LH 2WPJS 5JYIA 8GCHG 2FESH 1S6HA 2SGPE 2GZ8A 4LXBH 2UWPA 1XUJA 2GT8A 2WUCA 3E90B 8LPRA 1MAYA 1Z71A 3SV2H 4XBCA 1BRBE 1NFXA 3LPRA 4QT8C 2A45B 5EW1H 3TGKE 1AWHB 1V2JT 3L6PA 3ZZ9A 2CV3A 1HAOH 1N8OC 1DUEA 4JZDH 3CS7A 3I78A 1BRAA 2ZFQH 5HXFA 5T6GA 1ELGA 1S83A 1WTGH 4FUHA 1YCPK 2G81E 1BRUP 2QXIA 3MYWA 1PPCE 5C2ZA 1GMCG 4AFSA 1F92A 1S85A 2ZKSA 4K2YA 5FBEA 1HJ9A 2HGTH 2ZI2H 3NKKA 1V2VT 6CHAB 4E7NA 4IC6A 2G51A 1UCYH 3STIA 1TE0A 3B9FH 1FJSA 4NIVA 2BB4A 1HV7A 2ZU4A 4AORA 1P2QA 1KXAA 4ASHA 5EU8A 4LZ4B 4ABAA 2DE8A 4DW2U 4FVBA 2ZF0H 2AMPA 4O03A 1O31A 1W7XH 1LVYA 1EJNA 1LTOA 1AE8H 1ZHPA 2F9VA 3BTWE 1O3PB 1VITF 1ESAA 3O8BA 4DCDA 1BTYA 3S69A 1MAXA 1XKBC 3OU0A 3ZYDA 5LPEA 1VGCC 2ZECA 1BT7A 3D23A 2QY0B 1F0UA 3CP7A 3RXVA 4DGJA 2VVVA 1C5PA 1BTUA 2A4RA 2AIPA 2BD3A 1ZMLA 1BJVA 1UVPA 3EA9A 1ESTA 2Z3DA 2PGBB 3RMOH 3U8OH 2C93B 2Q6FA 5F8XA 1EZUC 1DVAH 5JBCS 2CMYA 1OP0A 1BUIA 2A4OA 3IITA 4NGAH 1IQFA 2NU3E 1GMHG 2P8OB 1HNEE 2F83A 3BTFE 4OS2A 1OYQA 2QCYA 1W11U 1BTPA 4X2YA 2RA3A 5CHAB 1C1UH 2JH6D 1LPKB 3SGAE 4IMZA 1VCQA 1TQ0B 4MNWA 1ZHRA 2Z7FE 1GHAG 3GDVA 4NCYA 1WTHD 1ARBA 1O2ZA 2XC0A 4XBBA 3UNRA 1FDPA 3VB5A 1N1LA 1QB6A 2ANKH 3QGJA 3TNTA 3FFGA 4I8JA 2F91A 3MFJA 1BTHH 2WV4A 1GMDG 1P10A 1O3KA 5EQSA 2A1DB 1HYLA 1JOUB 1MU8B 3C1KA 1V2NT 3O8CA 3UY9A 1TLDA 1TX8A 5E0JA 1AKSB 5TJXA 3ZZ4A 4Y10E 3SU1A 1QNJA 2UUYA 3HKJB 2ZQ1A 2ZFTA 4ABFA 4AGJA 2P16A 4GCHF 1C1WH 2ZFFH 3A7ZA 1L1NA 1O2KA 2BY7X 1AUJA 3OYPA 2TGDA 1C9TA 8ESTE 1HPGA 6CHAC 3FP7E 3BG4B 1FAKH 4NSYA 1SVPA 1O2XA 4GLYA 3D65E 1F0SA 4MPXA 5B6OA 3PV4A 4IMQA 3VB7A 3ZZDA 3TLOA 5LH8A 2EC9H 1RGQA 3PMJA 4AGKA 5C67A 2P3TB 4WXIA 1V6DA 4Y7AA 1ZPBA 2FOFA 1W10U 3ELAH 3V12A 2P95A 1TA2A 1AWFH 2H2ZA 3GCTF 1G3EA 3BEFB 1BDAA 2FI5E 3DA9B 1JBUH 2GGVB 4FVDA 1YPEH 3VB3A 3M5LA 1MUEB 3RXKA 1K2I1 1O5BB 2F9BH 1YPLH 1ELCA 1GI3A 4Y71A 1T8NA 1QY6A 2VVUA 2VJ1A 5GXPA 1W8BH 4NA9H 2RG3A 1GI7B 1O2NA 1BOQA 1WBGB 1O2UA 2XBYA 3S7KB 4AOQA 4ESTE 3M3SA 2VGCB 3TJUA 4BAMB 5EXNA 1GBAA 1CBWB 2ZU2A 1ANCA 2I6QA 2XC4A 1FI8A 3KQCA 1GDNA 2PWXA 3PB1E 1EAIA 4F49A 2Y6TA 1HXFH 3ENSB 4XE4A 2O8LA 2OXSA 1TAWA 3DD2H 3HKIB 5H4IB 2P8OC 3U9AH 1AVXA 2ULLA 1O2HA 3IWMA 5FPTA 4Y79A 3RDZA 1GI9B 2ZGBH 1Y8TA 5CHAC 1GJ4H 4U32A 1LO6A 1FIZA 2A7JA 3A8AA 1ANBA 1ZGVA 4BAHB 1TX7A 2ANYA 2AMDA 3D49H 3KQDA 2A5IA 3E16B 3FZZA 1KDQB 3PWBA 1YLCA 2WPKS 2FS9A 4TWYA 2ZA5A 3AAUA 5DP7A 1IQKA 1EQ9A 2B5TB 1HDTH 4TPIZ 1OYTH 2BDHA 3A7WA 2NU2E 4Q7XA 1NTPA 5F03A 1FPHH 1GHBF 1YKTA 3SJ8A 5DP5A 3SO3A 2B7DH 2ASUB 1AIXH 5HM2A 1FPCH 3KCGH 1P57B 1BHXB 3STJA 3OY6U 4X2WA 4K1EA 3A8DA 5F8TA 5FPYA 1GJDB 1QCPA 1JIRA 1QJ6B 1GBKA 3I29A 1QTFA 3R3GB 1AE5A 2A0QB 4HZHA 2R3YA 1CT4E 3BG4C 1XUHA 2HLCA 2FTMA 4Q7ZA 2HALA 4ZKRU 3DFLA 1FZZA 2PSXA 2STAE 4AX9H 5DJ7A 1RIWB 4I8GA 1P8VC 2VB0A 1AQ7A 1NN6A 5CMXH 4Y8ZA 2HRVA 4I8LA 1C5MD 1OXGA 4YLUA 3KF2A 4ABGA 2VWMA 4B71A 1KXDA 2Y7XA 3HGPA 2BD4A 1UHBA 2LPRA 1P12E 1UTJA 5DP4A 1T8MA 3ZZ3A 2CJIA 1VITG 3EAJA 2XBXA 4NA8A 1KYNA 1A0JA 1UVTH 5ETXA 3QK1A 1KLIH 4FUCA 4IW4E 5EPNA 3ZZ6A 3MU5A 4OS4A 3UNQA 2Q6DA 4OS6A 2VGCC 5FAHA 2OCVB 1CE5A 1CBWC 1ID5H 5DP6A 2OINA 1BTZA 1LHDH 3K6YA 3M36A 1EZSC 2ZU3A 3PYHA 4I8HA 4JK5A 3HGNA 1ZPCA 3BTHE 3F9HA 5GJ4B 3PWCA 2BHGA 2XCNA 2NU4E 3H7TA 2BY8X 3A7YA 1O3OA 1VJAU 3SNDA 2BX4A 1UTQA 2ILNA 1C4V2 1NO9H 1XUFA 1V2LT 1ETSH 1TNGA 3GCHB 1PFXC 4UONA 2BZ6H 1C4U2 2FYRA 4ABJA 4DURA 4WY3A 1GBIA 1D9IA 1MCTA 4WF8A 4CRCA 1QBNA 1IHSH 1S82A 4HI3A 1ABIH 2BVXH 1O3BA 2R9PA 3GCOA 4ISOA 1LPZB 2VH0A 3RXAA 1SGRE 4ZHAA 4U2WA 2V0BA 4CREA 1AU8A 1TB6H 2BMGB 2PFEA 3KEEA 3PMAB 1MMJN 2JH5D 1UK2A 2R2WU 1FY4A 1H9LB 3EYDA 1NFWA 3ZV8A 4NG9H 1AB9B 1LHFH 5JDUB 3URDA 1MQ5A 1FY8E 4TY7A 3B23B 2FEQH 1GBFA 2DE9A 2C3SA 2Z9IA 1PPFE 5EXLA 1M9UA 1UMAH 1GJ5H 3DHKH 1C2IA 1H8IH 2K1QA 2FLRH 1HJAB 1O2OA 1V2RT 1EX3A 5DP8A 1DLEA 1IQEA 4XDEA 4ZKNU 3LGVA 3SJOA 1B0EA 1QURH 5C3NA 3E1XB 5T6DA 1P2JA 1A61H 2BLWA 1GI4A 1TOMH 1PQAA 3AAVA 1HIAA 1YF4A 1KTTB 1W13U 1Y3YA 7GCHF 1TNJA 1RIWC 1ANDA 2QF0A 3MU1A 4FUBA 5L2ZH 2GD4B 1FXYA 5GIBA 3RXFA 1GCTB 1A5IA 4FU9A 5JB9S 5K0HA 5C5OA 3UUZA 3PTNA 4UFFH 4KKDA 4A92A 3P8FA 2FOHA 1T4VH 3GCTG 1J8AA 3VB4A 3LOXA 1HAYB 1TABE 4OGXA 1SGYE 1RD3B 3H7OA 1GI0A 4VGCB 1EJAA 4AFQA 4YLQH 1W0YH 3VEQB 1O5DH 1CQQA 2GT7A 3LJOA 6LPRA 3LJJA 2F9NA 3W95A 1AD8H 1C2HA 2BY9X 1HAVA 3FVFB 1WCZA 3QDZB 3S7HB 3SUEA 1ELEE 4X6OA 1YPJH 4AB9A 1FN6A 2FIRH 1DUAA 3A80A 1UVOA 4PROA 1ZZZA 1O2TA 1TGSZ 4ZKOU 3NZIA 4JYUH 3E3TA 3SNCA 1CA8B 1NRPH 1FY1A 1ELAA 3RXMA 2GVFA 3RUOA 4SGBE 1NFYA 1C2EA 2VWOA 1TQ7B 1TPSA 4K60A 4YO9A 1BBRE 3GCHC 4B73A 1O2IA 3V13A 4RSPA 1P2KA 2ZPRA 3ZZ7A 3MNXA 3BTDE 2RCEA 1N6XA 2XW9A 1AHTH 4O97A 1TPAE 2Z9GA 1ZMJA 1O0DH 4IN2A 1C4Y2 3GY5A 3RC4A 3A83A 1DXPA 3E91A 1OPHB 1K21H 1F0TA 5FCKA 1SGTA 2BLQA 5GPIB 3M5MA 4CRGA 1TNHA 3T2NA 1UTKA 1OX1A 1K1JA 3GY6A 3GCNA 1IQLA 1NRQH 1QRXA 3MO3A 2OQUA 2BXUH 2OC0A 4WJG2 1QR3E 2Z9JA 1QJ1B 1AB9C 2W7SA 1AO5A 2R0KA 1O3EA 1GHBG 1GI8B 5LPFA 1WAYB 4B75A 2AFQB 1C9PA 3SV6A 4K1SA 2W3IA 1WQSA 1UK4A 1B5GH 2QAAA 3Q77A 3NWUA 4JYTA 2PKAA 1P01A 3QN7A 1HJAC 1O5EH 3PMHB 1G2MA 2GKVE 1PQ5A 1MZAA 3QTOH 5L2YH 3GY7A 2C8XB 3P95A 3MNSA 2C8WB 1ESBA 5JBAS 2ZU5A 1C5YB 1C2DA 1LQEA 3TPIZ 3RU4E 3ZZCA 4UFGH 3SJ9A 4R0IA 1P03A 4D9RA 3TJNA 4NFFA 1GCTC 2EI6A 3VGCB 2WV5A 2BVRH 4NIXA 2STBE 1V2KT 1ELVA 4JZ1A 2GP9B 3CS0A 4O9VA 1MD7A 2R0LA 1TRMA 1O2PA 1CT0E 4JMYA 5DKMA 1PPHE 2J94A 4ISNA 3MI4A 4TYDA 1O36A 4VGCC 2ZG0H 1SLUB 1C2MA 1O2WA 4UFEH 4Y6DA 9LPRA 1LVBA 3OSYA 2VWNA 1IQJA 2FDAA 2Z9LA 1WQVH 3ZV9A 1FLEE 1MTUA 4HTCH 1FN8A 1Z8GA 1ABJH 2AS9A 1TOCB 1DANH 1T32A 3RMLH 1G3DA 1O3DA 1QRWA 4DY7B 1GVLA 1HXEH 1UO6A 1UHBB 2W26A 1GBCA 3P70B 1C1MA 3RXSA 4BOHA 1V2OT 1HAHH 2QGRA 1PYTC 5EQRA 1J17T 1VR1H 1GJAB 1J14A 2PV9B 1SOTA 1DPOA 1H8DH 2P94A 1BBRH 1OWKA 2HOBA 4FU7A 5A8XA 5JBBS 3RXQA 1A46H 1KTSB 2A5AA 1AFQB 1A5HA 1ZHMA 4GSOA 1TMBH 2J38A 2GDDA 1KXFA 1Y3XA 3A89A 2AIQA 2CGAA 2TGTA 2BDBA 4B74A 7KMEH 3FAOA 2D8WA 4AZ2B 1ZJKA 3RC5A 4BNRA 1YLDA 2ZHWH 2P3UB 2G00A 2Y7ZA 2UWLA 4CRFA 4WWYA 2ZTZA 5HM9A 2A4GA 2AGIX 3K6ZA 1HAIH 1NROH 2HWLB 5C20A 1YP9A 1UTLM 1XXDA 1FQ3A 4IS5A 2B8OH 1TBQH 1EJMA 1AMHA 1HLTH 1Y3WA 4Q80A 1ELDE 1O3MA 1EPTA 5BRRE 3SU6A 3PROA 2Z6BD 1BB0B 1C5SA 4RN6A 7GCHG 2ZFSA 4FUEA 4ZMAH 4MG3A 1EATA 2WPMS 3VGCC 1PQ7A 1TPOA 1NFUA 1C2LA 2SGDE 5HGGA 2H9TH 1UTMA 1BMAA 4IC5A 3BTQE 1WUNH 3KL6A 3GY3A 1E0FD 2VIWA 4CRBA 1C5XB 3RXOA 1DS2E 5ESTE 3PLBA 1W12U 4FUGA 1BIOA 1SQTA 4FXGH 1LVOA 1DDJA 3LGTA 1XUGA 4FUFA 5FHTA 3RU4T 5DPAA 3BV9B 3LONA 4NZLA 2PHBA 4X0WU 1DWDH 1GL1A 1SSXA 1O3HA 1PJPA 3ZVDA 3TK9A 1MKXH 1RFNA 2W3KA 1HIAB 1Y5UT 2A31A 1T8OA 3GDSA 2H9HA 1UCYK 4GHQA 2V6NA 4X8SH 1E34B 1O2VA 2ZU1A 3UIRA 5A0BA 1CSOE 1NU7B 1NY22 3SNBA 3I77A 3LT3A 3A85A 5JB8S 3M3VA 4BAQB 4A1VA 2QF3A 1TIOA 3SU2A 1EP5A 1ZOMA 1LHGH 3CENA 3SI3H 2SNWA 3DUXH 2Z3EA 2VINA 3ATKA 1P2NA 1HAVB 1NS3A 1QL9A 1UTNA 1ZSKA 4H4FA 5C1YA 5TCAA 1HAPH 4TPYA 3MTYA 1C1QA 2M5TA 1AZ8A 1D3DB 3PMBB 1C1PA 2PLXA 1DITH 2ZPQA 2F9PA 2ZDKA 4DOQA 2ZQ2A 1G36A 1P2OA 1P3EA 4X6PA 4CBOA 1AFQC 1RXPA 1BTWA 2DUCA 1P11E 1P2MA 1C1SA 2ANWA 2NWNA 4KTUA 3UOUA 2PSYA 5EXMA 1RS0A 3GY8A 4DJZB 4A7IB 1Z7KA 5E2PA 1GBMA 1RTFB 1TNKA 1ZTKA 2UWOA 3SI4H 3MO9A 2FOGA 3RXHA 1Y3VA 3GYMA 1GVZA 4BXWA 2CN0H 2WPLS 2Z94A 2ZDMA 4NFEA 3SJKA 4Q2KA 1C1TA 2Y82A 1MQ6A 1E35B 4X1SU 1DY8A 2ZHDA 2ZGHA 1L2EA 1L1JA 1O32A 1AZZA 3T27A 1DLKB 2FXRA 1S0QA 2YNBA 2VIQA 1QFKH 3RXPA 5JBTA 1JMOH 2O8UA 2A4QA 1EZXC 1GBTA 3A88A 2OUAA 2PUXB 3AVZA 2BDYA 3ODDA 4LOYH 1AFEH 2R2MB 5FCRA 2J4IA 3N7OA 4JK6A 3R0FA 4Y7BA 1H9IE 2FOCA 1A1RA 5PTPA 5C5NA 5A0CA 1GHYH 1EB2A 2D1JA 3AW1A 2ANMH 3TJVA 1RTLA 2ZTXA 1GBLA 1H9HE 3UWJH 2XWAA 2PKAB 2OBOA 1TRNA 1ZTJA 3M3TA 3SZNA 2FS8A 1SGDE 4YZUA 1SG8B 1O34A 1GHZA 1KLJH 2F9UA 2VVCA 2GCHF 1ARCA 2PTCE 1K1MA 1QB1A 2WPIS 1F2SE 1L0ZA 4RKOB 4JZEH 1KXCA 1OWIA 3TJOA 1EZQA 1AVWA 3A86A 1SL3A 2TPIZ 1MKXK 2J9NA 4OGYA 4YM9A 1FMGA 4RKJB 3UPEA 3HPTB 1HGTH 1TRYA 3LGYA 3V0XA 3GICB 5FBIA 4TY6A 3RM2H 1O30A 1O2GH 1FUJA 1QIXB 3GYLB 3K65B 4ABIA 4ZHLU 2WINI 2ZDVH 1D3TB 1P06A 4A1XA 1WV7H 3BN9A 3D62A 2Y5GA 3C27B 3KN2A 1RJXB 2ALVA 3T5FH 1T8LA 2IJOB 4WH6A 1SGIB 3FP6E 1MKWH 1GJ7B 3SU4A 3BSQA 4I33A 5K7RA 5AFZH 3RXGA 1YC0A 3AW0A 4YOIA 3S9BA 4BXSA 1KY9A 3A84A 1ETTH 4UE7H 1FV9A 1O35A 1TPPA 1K22H 1OWHA 3UOPA 3RC6A 1O3IA 2UUJB 1ZMNA 2TIOA 2ZGJA 3QO6A 2Q6GA 3V3MA 1PQ8A 1O37A 4BTIB 3QZRA 2H6MA 1GJ9B 2C4FH 5GCHF 1GJ8B 3M7QA 2NU1E 1VJ9U 2ODYB 5EODA 1C1RA 2NU0E 3S9CA 4NWKA 2P93A 1V2QT 3U8RH 1HAZB 3FP8E 2BM2A 1O2SA 1TWXB 1S6FA 1V2PT 2O9QA 2A2QH 3MWIU 1QJ7B 3UFAA 4DIHH 1OKXA 2YNAA 1N6YA 4A5TS 4DIIH 3EDXB 1UTPA 3GY2A 1MTSA 1O3NA 1U6QA 4I31A 5L6NH 5F6MA 1ZPZA 1A0LA 3L3TA 2XXLA 4TWWA 1YM0A 3B8JA 1TMTH 1TYNA 2ZP0H 2ZO3H 3Q76A 1C2JA 3Q3XA 3T62A 1D6RA 4KTCA 2CXVA 3SGBE 3WY8A 2B0FA 2IPHA 4LZ1H 4X8UH 3BF6H 3PLPA 1XKAC 3UR6A 5SGAE 1P09A 2FI4E 1GDQA 4H6TA 3HK6B 3KNXA 1E37B 1KIGH 1NRNH 5DP3A 3P17H 4Y76A 1T4UH 3TGIE 2FZZA 1A7SA 1OP8A 2QC2A 2ZIQH 1C5NH 3UNSA 1P9UA 2SFAA 2QN5T 3SORA 1O3CA 4GCHG 4XBDA 3T25A 1A4WH 1EPTB 1NRRH 3UTUH 4MDSA 3ZZAA 4CBNA 3ATMA 1Z1IA 1ANEA 1B7XB 3TGJE 4MPWA 1GMHF 5I46H 5AF9H 2XNIA 1K1PA 3U1IB 3ZVCA 1XVOA 1QL7A 3IG6B 5EOKA 3EGKH 4D8NA 1XMNB 1TNIA 5C1XA 3AASA 3HK3B 1BITA 2I6SA 2XC5A 2G4TA 2GCTB 1TNLA 5A8YA 3T28A 4E06H 1MZDA 1SGPE 3ZZ5A 1SGNE 1UVUH 3EA8A 2W7UA 4X1RU 2AEIH 2FOMB 1MBMA 3BTKE 1GG6B 1MD8A 3F9EA 1HUTH 3P8OA 2BLVA 1Y5AT 2UUFB 3NUMA 4BANB 2BQ6B 1EUFA 4IGDA 3UQVA 1TONA 1Q31A 2SGFE 1SOZA 3ODFA 4H6SB 4K1TA 1F7ZA 2BDCA 1P02A 1V2MT 1JRSA 2PUQH 1BA8B 4Z6AH 2ZZUH 2H1UA 2ZHFH 4B2CA 3SN8A 1YCPH 3Q00A 1QA0A 1P04A 1ZTLA 1EP6A 2HVXA 4DVAU 3KGPA 3RU4D 1G3BA 3RM0H 1LKAA 4Y8XA 1T7CA 4X1PU 3S9AA 3M35A 3HATH 1INCA 3SOSA 3LGUA 5T3HA 1BTXA 2ALPA 3TH2H 3T29A 2A2XH 2FI3E 3VFEA 4AG1A 2XCFA 1AI8H 2H9EH 2JH0D 1O3JA 1LQDB 2EA3A 3GOVB 1O2MA 4NSVA 3RXDA 3UR9A 4NIYA 1EOJA 4ABDA 1ELBA 1C5RA 4CRAA 1DFPA 4OS7A 2FODA 2ZC9H 1GJ6A 1J15A 1OS8A 4JZIA 2CF9H 2TGPZ 4Y8YA 4DT7B 2ZFPH 1UTOA 2HNTE 2GTBA 2VIOA 2BX3A 3LH1A 1QB9A 1O2QA 1WU1A 3URCA 1O5CB 1ZGIA 5AVDA 1IHTH 5A09A 1P05A 4MVNA 3RLWH 4ZHMU 3M61U 3EA7A 4X6MA 4X8VH 5TCCA 4FUIA 3K9XB 2BOHB 2YOLA 4O3TA 1O33A 4Y0ZE 2ZDNA 2JKHA 4UDWH 2GX4A 8KME2 2LNCA 1PPEE 2RA0A 4CRDA 2WYGA 1GBEA 3TK6A 2GDEH 2QXHA 2GCHG 4A1TA 1D6WA 1KSNA 3K2UA 1EPTC 2G55A 2FPZA 4F4OC 3RXJA 1O39A 2CHAB 3TU7H 3UWIA 1V2TT 4KELA 2D2DA 2O8MA 3L33A 1OWJA 1GJCB 1PPBH
chains in the Genus database with same CATH superfamily
4NA7A 5FL7D 1Z8IB 1AGJA 4AFZA 1GBBA 1XM1A 5JPMH 2VIPA 1VCWA 2GCTC 3NPSA 2SGEE 3FANA 1HRTH 1YPHC 1SBWA 4CH2B 2HPPH 1SMFE 3A8CA 2KCAA 3SU5A 6GCHF 4Z0KA 1GG6C 1EB1H 4MLFB 1IQIA 1ZSJA 3F9FA 1SGEE 2WPHS 1MTNB 5EG4A 4K8YA 1GL0E 3LGIA 1L4ZA 3FZDA 1GI2A 1FY3A 2J34A 2G5VA 1V2ST 3TIUA 1JWTA 2P59A 4I32A 3SW2B 2ZCHP 4K5ZA 1C1OA 3ZVGA 2QF4A 1SLWB 1HBTH 1QGFA 4ASUD 4CHAB 1DOJA 1TFXA 1H1BA 1W0KD 4B76A 3OEED 3RXBA 4KTSA 3A82A 1T31A 2TBSA 1Z6JH 5GCHG 3NXPA 1IQGA 1BHXF 1CGIE 1LPGB 2ZNKH 5E0HA 1SGCA 5DP9A 3GDUA 3QGNB 3SV9A 1TBRH 5L30H 1SLVB 3QLPH 2THFB 2J95A 2Z3CA 1SHYA 1QRZA 4YT6H 3PTBA 4AYYB 4FUDA 4HFPB 4JYVH 1ELTA 3AK5A 1THSH 4AN7A 4WVPE 1IQHA 1AVGH 1CT2E 3MO6A 3SQHE 1FY5A 1ZRBA 1JIMA 1K1OA 2PW8H 3GISB 1GHWH 1Y59T 3DSOA 4AG2A 3H09A 1CA0B 3LU9B 1IAUA 2QXGA 4X2XA 2QE7D 1SR5C 4Y0YE 1HJ8A 2R3UA 1XXFA 3SHCH 2J2UA 1CVWH 3RXCA 2IOTA 4INKA 3G01A 1GI1A 4INHA 2A7HA 1NM6A 2V3MA 2FLBH 2AYWA 3KQBA 1TALA 2VWLA 4A6LA 5DG6A 1IQNA 4F55A 1QBOA 1SQAA 2ZTYA 4O3UA 4YOJA 1PPZA 2ZGCA 4NZQA 1O2LA 2BD9A 4Q63A 3TH3H 1DWCH 4E7RG 3RLYH 4M7GA 5EPYA 4XRNA 4ZUHA 1QBVH 1OOKB 1YPGH 1W3CA 1QQ4A 2BD8A 3QUMP 1F0RA 1GCDA 2ZFRH 2FO9A 1NBMD 3UAIC 2FMJA 1C1VH 2B9LA 4J1YA 3SUDA 2TGAA 3SUFA 2CHAC 2ZDLA 1IOEA 4GUXA 2J98B 2TRMA 2L6OA 3RXLA 3M7UA 3ZVFA 3E8LA 1D4PB 5A2MH 2WSSD 3MNCA 1HFDA 2VBCA 4F48B 1NRSH 4I7YH 3TK5A 3SU0A 5AFYH 5G4BA 1LVMA 1O2RA 1ZRKA 2Z9KA 1ZLRA 2XBVA 2VIVA 2JETB 4AB8A 3BG8A 3F6UH 1GBHA 4YTAA 3T26A 1H4WA 4K69A 2BQWB 3O8DA 1BMNH 4JZFH 4ZAEA 3VXFH 2ESTE 3PV5A 2OLGA 1DE7H 1GVKB 2GMTB 3MNBA 1C5WB 2KCPA 2G8TA 1W2KH 2GV7A 4BTTB 1L4DA 2BXTH 5E8EH 5IDKA 1MTNC 3F0PA 1ELFA 2QYIA 3MU0A 4B1TA 3MH7A 1YPKH 4MNYA 2WV9A 3A81A 2ZEBA 4X6NA 3N7EA 3ZIAD 3E0NB 3ZVBA 3SNEA 4CHAC 1TGBA 1XX9A 4D9QA 3PLKA 1NPMA 2HNTC 1LHEH 3NK8A 4MTBA 1NESE 3PM3A 2ZPSA 2Y81A 2V7QD 1MTVA 4ACAA 2Y80A 5BPEA 1F5RA 1YBWA 2ZWLH 1O3AA 1GHVH 1TBZH 1IQMA 2OC1A 2VH6A 1FNIA 2BDIA 1G3CA 5DN6D 3M5NA 2Q1JA 2OC8A 2V3HH 1QQUA 3OEHD 1W0ZU 1UW7A 2ZDAH 1XUKA 4RT0A 2FWWA 4B2AA 4DG4A 2G4UA 3TNSA 5T6FA 4ZXYH 1EXFA 3EQ0H 1E36B 2XBWA 5EGMA 3SBKA 1BBRK 1CA0C 4K8BA 1DSTA 3SU3A 1ZYOA 3PRDA 3RMMH 3RXIA 1O38A 2QIQA 1P3CA 2O8TA 3MMGA 5A8ZA 5C1UA 2JJ1D 2WHXA 1UVSH 2H5CA 5FX6A 3JZ1B 1XUIA 4KGAA 4YESB 3ZYEA 2KAIA 5GDSH 3Q3KA 1FIWA 1A3EH 2EEKA 3ZZ8A 3Q3YA 1WOFA 1CGJE 3QTVH 2XYAA 3BEIB 2FTLE 1MCVA 4MNXA 1VZQH 4JCNA 3LKWA 1SB1H 1O5GH 1SGQE 2A5KA 3RXRA 2RDLA 1A5GH 1GPZA 3EE0B 1SGFG 4WMFA 2M2AA 1G37A 3NCLA 5ABWA 2FOBA 3BTME 1EKBB 1K1IA 2D26C 1SFQB 1YYY1 2GJGA 1UK3A 3RMNH 4KP0A 4X1QU 1F5KU 2FX4A 2K8IA 2J92A 3KIDU 4WXVA 1CHGA 1EAUA 4CH8B 1V3XA 2KX4A 1Z6EA 2BOKA 2JETC 1A2CH 3QX5H 2GZ9A 1XVMA 4ISLA 2ZCKP 1C1NA 2CF8H 4UEHH 1SQOA 3U8TH 2IPQX 5CE1A 1V2UT 2GMTC 6GCHG 1S84A 1CHOF 1GI6A 2OP9A 5E2OA 4H42U 1KLTA 1SHHB 4NIWA 2VIDA 2ODPA 2GZ7A 4NWLA 1P9SA 3ITIA 1QHRB 3LIWA 4CR9A 1LCYA 2PGQB 2QXJA 2XTTB 1PPGE 2VNTA 3VXEH 1Z1JA 3QWCH 2BDAA 1OP2A 3EE7A 3SQEE 1K0HA 1JRTA 4GPGA 3SGQE 3F9GA 5FX5A 1O3GA 3E6PH 3FN8A 1S0RA 5LGOA 3VPKA 1BMFD 1AN1E 4ZXXH 1O5FH 3P8NA 4ABEA 2BD2A 1DT2A 2OQ5A 2AERH 2OBQA 4M9FA 2FYQA 1Q3XA 1QL8A 1P0SH 2ZCLP 8GCHF 1BMMH 2PKSB 4MPUA 4GHTA 1Z8JB 2BY5X 1C5VA 3F2GA 1DM4B 1TGNA 1WSSH 1C5QA 1LHCH 1J16A 1SPJA 1P2IA 4ZH8A 3GY4A 3SUGA 4X1NU 1NU9A 1C5UA 5EQQA 4SGAE 3SV8A 3UREA 2A7CA 2FM2A 3F68H 4ABHA 1PYTD 2AMQA 3ATLA 1KXEA 4ABBA 4P00A 1J9CH 4OS1A 1AUTC 3LDXH 1G2LA 1K28D 2KFWA 3OY5U 3DT0H 4D7GA 2EY4C 4FOUC 2UUKB 3PO1B 3MU8A 2EI7A 2ZHQH 3ZZBA 1GMCF 2BLOA 3SNAA 5HYOA 4BTUB 2XNDD 2PR3A 1HAGE 1E38B 3BEUA 3ATWA 1W14U 1YPHE 1FONA 1SFIA 1LDTT 2ZHEH 1BZXE 4Y11E 5GWZA 3SJIA 1GBJA 1W7GH 1G30B 1GBDA 2AGEX 5KECA 1V2WT 3DSGA 4OS5A 1VITH 1GI5A 1SC8U 1GJBB 5HIZA 3M5OA 2A32A 3TITA 4CR5A 2QA9E 1HB0B 2G52A 5FPSA 1EAXA 4YT7H 4U01A 2BZAA 1DSUA 5DK1A 5HMAA 3W94A 2HNTF 1CO7E 4R8TB 4WH8A 5IYTA 1O3LA 1B0FA 1O5AB 1DY9A 3LC5A 3UQOA 1DICA 2BD7A 1TA6A 4IBLH 1EASA 3A7VA 1A0HB 1BMLA 5AHGH 1Z8RA 1QA7A 1GWAA 2IN2A 3S0NA 4ISIH 3P8GA 5FXLA 4Q4LA 1K9OE 3A8BA 3BTTE 1VCPA 2BD5A 4WMEA 1C5OH 1MTWA 5DO4H 1UJ1A 4DT4A 4HG6A 1ZR0A 5DGJA 1TMUH 4FUJA 2G5NA 1YGCH 1TX6A 3SHAH 3W1EA 1CGHA 1D3PB 3MH6A 2C8YB 2WYJA 2FOAA 3RXUA 1S5SA 2BDGA 1NT1A 1ORFA 4B2BA 1C5ZB 7LPRA 2BVSH 2L74A 1AKSA 4X2VA 1THRH 1NZQH 2FX6A 3DFJA 1G32B 1LKBA 3M37A 3ESTA 2C90B 4MPVA 1GGDB 1GHAF 3VB6A 2QV1A 1DX5M 5J4QA 3M7TA 1F5LA 3A7XA 1BJUA 1CU1A 1BQYA 2PKSC 2GV6A 1C2KA 4BAKB 3BIUH 4UD9H 1GMDF 1MKWK 4E05H 1KXBA 2PTNA 3LGWA 4GAWA 5E0GA 1D3QB 1RTKA 2WUBA 4XFQA 1DWBH 1X7AC 3O8RA 4INLA 2AH4X 1C5TA 4X8TH 1ZSLA 1C2GA 2VU8E 4HGCA 1N8OB 3LC3A 3A7TA 5I25A 4FU8A 3BTEE 1A3BH 3PO1C 3U1JB 4K3JA 4ZKSU 4YOGA 3V7TA 1FAXA 1UCYE 1YCPM 3KHVA 4XSKU 5EW2H 3U69H 1O2YA 1DXWA 3BTGE 3TH4H 2HVYB 2XRCA 2V35A 1GHXH 2BTCE 3H5CB 4MNVA 1TGCA 1Y5BT 2Y5HA 1SGFA 1OSSA 1TGTA 1YLNA 1MU6B 4D7FA 3P92A 5C17A 2F3CE 1SI5H 4Q7YA 3BIVH 5EJLA 1Q2WA 3MHWU 4GVUA 4UFDH 2SNVA 1HAXB 3LH3A 2FOEA 1K1LA 3JZ2B 5KGOA 2P3FH 1O3FA 1EOLA 5CDFE 1ETRH 1MH0A 3U98H 4D76A 3OX7U 3SV7A 4BAOB 2KAIB 1G9IE 1L1GA 3OTJE 3RXTA 1OWDA 1THPB 1LMWB 3F1SB 4TSFD 2ODQA 3MU4A 5LPRA 1VGCB 1Y3UA 1YPMH 1OWEA 3ZVAA 2OTVA 3P6ZB 3QZQA 1ACBE 2O8WA 3ZVEA 3E0PB 3MQKC 2SGAA 2IJD1 3KQEA 2W5EA 1BRCE 1MBQA 1HCGA 2V3OH 4WMDA 4THNH 1CHOG 6ESTA 1K1NA 1KDQA 2Y5FA 3MH5A 2EI8A 1SLXB 2OD3B 2OC7A 4ZROA 1JXPA 1GDUA 1C2FA 2SGQE 5A0AE 2BYAX 9ESTA 3MOCA 4AFUA 1WYKA 5ESBA 4ISHH 1O2JA 4J2YB 4U30A 2XWBI 7ESTE 1BCUH 5J4SA 4IN1A 1ZJDA 3TVJB 3RP2A 4LK4A 4MQAA 2BQ7B 1RRKA 1NC6A 2HPQH 2W6ID 2ZGXH 4XOJA 3RXEA 2QF5A 2C8ZB 2BY6X 3ATIA 2KZ4A 2H5DA 1E1QD 1DWEH 2F9OA 5F8ZA 2AGGX 3A87A 1GGDC 2FP7B 4I8KA 4AYVB 1EAWA 2F43B 1AY6H 3MH4A 1S81A 1C5LH 2WPJS 5JYIA 1SQRA 2FESH 1S6HA 8GCHG 2SGPE 2GZ8A 4LXBH 2UWPA 1XUJA 2GT8A 2WUCA 3E90B 8LPRA 1MAYA 1Z71A 3SV2H 4XBCA 1BRBE 1NFXA 3LPRA 4QT8C 2A45B 5EW1H 3TGKE 1AWHB 1V2JT 3L6PA 3ZZ9A 2CV3A 1HAOH 1N8OC 1DUEA 4JZDH 3CS7A 3I78A 2KCYA 1BRAA 2ZFQH 4AC9A 5HXFA 5T6GA 1ELGA 1S83A 1WTGH 4FUHA 1W0JD 1YCPK 2G81E 1BRUP 2QXIA 3MYWA 1PPCE 5C2ZA 1GMCG 1WXRA 4AFSA 1F92A 1S85A 2ZKSA 4K2YA 5FBEA 1HJ9A 2HGTH 2ZI2H 3NKKA 1V2VT 6CHAB 4E7NA 4IC6A 2G51A 1UCYH 3STIA 1TE0A 3B9FH 1FJSA 4NIVA 2BB4A 1HV7A 2ZU4A 4AORA 1P2QA 1KXAA 4ASHA 5EU8A 4LZ4B 4ABAA 2DE8A 4DW2U 4FVBA 2ZF0H 2AMPA 4O03A 1O31A 1W7XH 1KMHB 1LVYA 1EJNA 1LTOA 1AE8H 1ZHPA 5C0TA 2F9VA 3BTWE 1O3PB 1VITF 1ESAA 3O8BA 4DCDA 1BTYA 2YMSD 3S69A 1MAXA 1XKBC 1MABB 2LELA 3OU0A 3ZYDA 5LPEA 1VGCC 2ZECA 1BT7A 3D23A 2QY0B 1F0UA 3CP7A 3RXVA 4DGJA 2VVVA 1C5PA 1BTUA 2A4RA 2AIPA 2BD3A 1ZMLA 1BJVA 1UVPA 5HIYA 3EA9A 1ESTA 5CHBA 2Z3DA 2PGBB 3RMOH 3U8OH 2C93B 2Q6FA 5F8XA 1EZUC 1DVAH 5JBCS 2CMYA 1OP0A 1BUIA 2A4OA 3IITA 4NGAH 1IQFA 2NU3E 1GMHG 2P8OB 1HNEE 2F83A 3BTFE 4OS2A 1OYQA 2QCYA 4YXWD 1W11U 1BTPA 4X2YA 4ACBA 2RA3A 5CHAB 1C1UH 2JH6D 1LPKB 3SGAE 4IMZA 1VCQA 1TQ0B 4MNWA 1ZHRA 5EIYA 2Z7FE 1GHAG 3GDVA 4NCYA 1WTHD 1ARBA 1O2ZA 2XC0A 4XBBA 3UNRA 1FDPA 3VB5A 1N1LA 1QB6A 2ANKH 3QGJA 3TNTA 3FFGA 4I8JA 2F91A 3MFJA 1BTHH 2WV4A 1GMDG 1P10A 3UB0A 1O3KA 5EQSA 2A1DB 4Z1MD 1HYLA 1JOUB 1MU8B 3C1KA 1V2NT 3O8CA 3UY9A 1TLDA 1TX8A 5E0JA 1AKSB 5TJXA 3ZZ4A 4Y10E 3SU1A 1QNJA 2UUYA 3HKJB 2ZQ1A 2ZFTA 4ABFA 4AGJA 2P16A 4GCHF 1C1WH 2ZFFH 3A7ZA 1L1NA 1O2KA 2BY7X 1AUJA 3OYPA 2TGDA 1C9TA 8ESTE 1HPGA 6CHAC 3FP7E 3BG4B 3FOAA 1FAKH 4NSYA 1SVPA 1O2XA 4GLYA 3D65E 1F0SA 4MPXA 5B6OA 3PV4A 4IMQA 3VB7A 3ZZDA 3TLOA 5LH8A 2EC9H 1RGQA 3PMJA 4AGKA 5C67A 2P3TB 4WXIA 1V6DA 4Y7AA 1ZPBA 2FOFA 1W10U 3ELAH 3V12A 2P95A 1TA2A 1AWFH 2H2ZA 3GCTF 1G3EA 3BEFB 1BDAA 2FI5E 3DA9B 1JBUH 2GGVB 2KR7A 1YPEH 4FVDA 3VB3A 3M5LA 1MUEB 3RXKA 1K2I1 1O5BB 4P02A 2F9BH 1YPLH 1ELCA 4XD7D 1GI3A 4Y71A 1H8ED 1T8NA 1QY6A 5GNDA 2VVUA 2VJ1A 5GXPA 1W8BH 4NA9H 2RG3A 3SYJA 1GI7B 1O2NA 1BOQA 1WBGB 1O2UA 2XBYA 3S7KB 4AOQA 4ESTE 3M3SA 2VGCB 3TJUA 4BAMB 5EXNA 1GBAA 1CBWB 5HKKD 2ZU2A 1ANCA 2I6QA 3WW7A 2XC4A 1FI8A 3KQCA 1VKYA 1GDNA 2PWXA 3PB1E 1EAIA 4F49A 2Y6TA 1HXFH 3ENSB 4XE4A 2O8LA 2OXSA 1TAWA 3DD2H 3HKIB 5H4IB 2P8OC 3U9AH 1AVXA 2ULLA 1O2HA 3IWMA 5FPTA 4Y79A 3RDZA 1GI9B 2ZGBH 1Y8TA 5CHAC 1GJ4H 4U32A 1LO6A 1FIZA 2A7JA 3A8AA 1ANBA 1ZGVA 4BAHB 1TX7A 2ANYA 2AMDA 3D49H 3KQDA 2A5IA 3E16B 3FZZA 1KDQB 3PWBA 4TT3D 1YLCA 2WPKS 2FS9A 4TWYA 2ZA5A 3AAUA 5DP7A 1IQKA 1EQ9A 2B5TB 5EJZA 1HDTH 4TPIZ 1OYTH 2BDHA 3A7WA 2NU2E 4Q7XA 1NTPA 5F03A 1FPHH 1GHBF 1YKTA 3SJ8A 5DP5A 3SO3A 2B7DH 2ASUB 1AIXH 5HM2A 1FPCH 3KCGH 1P57B 1BHXB 3STJA 3OY6U 4X2WA 4K1EA 3A8DA 5F8TA 5FPYA 1GJDB 1QCPA 1COWD 1JIRA 1QJ6B 1GBKA 3I29A 1QZ8A 1QTFA 3R3GB 1AE5A 2A0QB 3WWBA 4HZHA 2R3YA 1CT4E 3BG4C 1XUHA 2HLCA 2FTMA 4Q7ZA 2HALA 4ZKRU 3DFLA 1FZZA 2PSXA 2STAE 4AX9H 5DJ7A 1RIWB 5DSFA 4I8GA 1P8VC 2VB0A 1AQ7A 1NN6A 5CMXH 4Y8ZA 2HRVA 4I8LA 1C5MD 1OXGA 4YLUA 3KF2A 4ABGA 2VWMA 4B71A 1KXDA 2Y7XA 3HGPA 2BD4A 1UHBA 2LPRA 1P12E 1UTJA 5DP4A 1T8MA 3ZZ3A 2CJIA 1VITG 3EAJA 2XOKD 2XBXA 4NA8A 1KYNA 1A0JA 1UVTH 5ETXA 3QK1A 1KLIH 4FUCA 4IW4E 5EPNA 3ZZ6A 3MU5A 4OS4A 3UNQA 2Q6DA 3KYFA 4OS6A 2VGCC 5FAHA 2OCVB 1CE5A 1CBWC 1ID5H 5DP6A 2OINA 1BTZA 1LHDH 3K6YA 3M36A 1EZSC 2ZU3A 3PYHA 4I8HA 4JK5A 3HGNA 1ZPCA 3BTHE 3F9HA 5GJ4B 3PWCA 2BHGA 2XCNA 2NU4E 3H7TA 2BY8X 3A7YA 3SZEA 1O3OA 1VJAU 3SNDA 2BX4A 1UTQA 2ILNA 1C4V2 1NO9H 1XUFA 1V2LT 3PV2A 1ETSH 1TNGA 3GCHB 1PFXC 3WWFA 2RDEA 4UONA 2BZ6H 1C4U2 2FYRA 4ABJA 2JJ2D 4DURA 4WY3A 1GBIA 1D9IA 1MCTA 4WF8A 4CRCA 5IK2D 1QBNA 1IHSH 2KM0A 1S82A 4HI3A 1ABIH 2BVXH 1O3BA 2R9PA 3GCOA 4ISOA 1LPZB 2VH0A 3RXAA 1SGRE 4ZHAA 4U2WA 2V0BA 4CREA 1AU8A 1TB6H 2BMGB 2PFEA 3KEEA 3PMAB 1MMJN 2JH5D 1UK2A 2R2WU 1FY4A 1H9LB 3EYDA 1NFWA 3ZV8A 2WPDD 1AB9B 4NG9H 1LHFH 5JDUB 3URDA 1MQ5A 1FY8E 4TY7A 3B23B 2FEQH 1GBFA 2DE9A 2C3SA 2J97A 2Z9IA 1PPFE 5EXLA 3KQ5A 1M9UA 1WDIA 1UMAH 1GJ5H 3DHKH 1C2IA 1H8IH 2K1QA 2FLRH 1HJAB 1O2OA 1V2RT 1EX3A 5DP8A 1DLEA 1IQEA 4XDEA 4ZKNU 3LGVA 3SJOA 1B0EA 5B6LA 5F53A 1QURH 5C3NA 3E1XB 5T6DA 1P2JA 1A61H 5EJ1A 2BLWA 1GI4A 1TOMH 1PQAA 3AAVA 1HIAA 1YF4A 1KTTB 1W13U 1Y3YA 7GCHF 1TNJA 1RIWC 1ANDA 2QF0A 3MU1A 4FUBA 5L2ZH 2GD4B 1FXYA 5GIBA 3RXFA 1GCTB 1A5IA 4FU9A 5JB9S 5K0HA 5C5OA 3UUZA 3PTNA 4UFFH 4KKDA 2HLDD 4A92A 3P8FA 2FOHA 1T4VH 3GCTG 1J8AA 3VB4A 3LOXA 2OK5A 1HAYB 1TABE 4OGXA 1SGYE 1RD3B 3H7OA 1GI0A 4VGCB 1EJAA 4AFQA 4YLQH 1W0YH 3VEQB 1O5DH 1CQQA 2GT7A 3LJOA 6LPRA 3LJJA 2F9NA 3W95A 1AD8H 1C2HA 2BY9X 1HAVA 3FVFB 1WCZA 3QDZB 3S7HB 3SUEA 1ELEE 4X6OA 1YPJH 4AB9A 1FN6A 2FIRH 1DUAA 3A80A 1UVOA 4PROA 1ZZZA 1O2TA 1TGSZ 4ZKOU 3NZIA 4JYUH 3E3TA 3SNCA 1CA8B 1NRPH 1FY1A 1ELAA 3RXMA 2GVFA 3RUOA 4SGBE 1NFYA 1C2EA 2W6JD 2VWOA 1TQ7B 1TPSA 4K60A 4YO9A 1BBRE 3GCHC 4B73A 1O2IA 3V13A 4RSPA 1P2KA 2ZPRA 3ZZ7A 3MNXA 3BTDE 2RCEA 1N6XA 2XW9A 1AHTH 4O97A 1TPAE 2Z9GA 1ZMJA 1O0DH 4IN2A 1C4Y2 3GY5A 3RC4A 3A83A 1DXPA 3E91A 1OPHB 3CNRA 1K21H 2WZQA 1F0TA 5FCKA 1SGTA 2BLQA 5GPIB 3M5MA 4CRGA 1TNHA 3T2NA 1UTKA 1OX1A 1K1JA 3GY6A 1E79D 3GCNA 1IQLA 1NRQH 1QRXA 3FKSD 3MO3A 2OQUA 2BXUH 2OC0A 4WJG2 1QR3E 2Z9JA 1QJ1B 1AB9C 2W7SA 1AO5A 2R0KA 1O3EA 1GHBG 1GI8B 5LPFA 1WAYB 4B75A 2AFQB 3OTPA 1C9PA 3SV6A 4K1SA 2W3IA 1WQSA 1UK4A 1B5GH 2QAAA 3Q77A 3NWUA 4JYTA 2PKAA 1P01A 3QN7A 1HJAC 1O5EH 3PMHB 1G2MA 4B6EA 2GKVE 1PQ5A 1MZAA 2EQNA 3QTOH 5L2YH 3GY7A 2C8XB 3P95A 3MNSA 2C8WB 1E1RD 1ESBA 5JBAS 2ZU5A 1C5YB 1C2DA 1LQEA 3TPIZ 2LP6A 3RU4E 3ZZCA 4UFGH 3SJ9A 4R0IA 1P03A 4D9RA 3TJNA 4NFFA 1GCTC 2EI6A 2F4LA 3VGCB 2WV5A 2BVRH 4NIXA 2STBE 1V2KT 1ELVA 4JZ1A 2GP9B 3CS0A 4O9VA 1MD7A 2R0LA 1TRMA 1O2PA 1CT0E 4JMYA 5DKMA 1PPHE 2J94A 4ISNA 3MI4A 4TYDA 1O36A 4VGCC 2ZG0H 4RI0A 1SLUB 1C2MA 1O2WA 4UFEH 4Y6DA 9LPRA 1LVBA 3OSYA 2VWNA 1IQJA 2FDAA 2Z9LA 1WQVH 3ZV9A 1FLEE 1MTUA 4HTCH 1FN8A 1Z8GA 2CK3D 1ABJH 2AS9A 1TOCB 1DANH 1T32A 4B6FA 3RMLH 1G3DA 1O3DA 1QRWA 4DY7B 1GVLA 1HXEH 1UO6A 1UHBB 2W26A 1GBCA 3P70B 1C1MA 3RXSA 4BOHA 1V2OT 1HAHH 2QGRA 1PYTC 5EQRA 1J17T 1VR1H 1GJAB 1J14A 2PV9B 1SOTA 1DPOA 1H8DH 2P94A 1BBRH 3DCLA 1OWKA 2HOBA 4FU7A 5A8XA 5JBBS 3RXQA 3PRBA 1A46H 1KTSB 2A5AA 3OAAD 1AFQB 1A5HA 1ZHMA 4GSOA 1TMBH 2J38A 2GDDA 1KXFA 1Y3XA 3A89A 3U28C 2AIQA 2CGAA 2TGTA 2BDBA 4B74A 7KMEH 3FAOA 2D8WA 4AZ2B 1ZJKA 3RC5A 4BNRA 1YLDA 2ZHWH 2P3UB 2G00A 2Y7ZA 2UWLA 4CRFA 4WWYA 2ZTZA 3F0OA 5HM9A 2A4GA 2AGIX 3K6ZA 1HAIH 1NROH 2HWLB 5C20A 1YP9A 1UTLM 1XXDA 1FQ3A 4IS5A 2B8OH 1TBQH 1EJMA 1SKYE 1AMHA 1HLTH 1Y3WA 4Q80A 1ELDE 1O3MA 1EPTA 5BRRE 3F2FA 3SU6A 3PROA 2Z6BD 1BB0B 1C5SA 4RN6A 1S6LA 7GCHG 2ZFSA 4FUEA 4ZMAH 4MG3A 1EATA 2WPMS 3VGCC 1PQ7A 1TPOA 1NFUA 1C2LA 2SGDE 5HGGA 2H9TH 1UTMA 1BMAA 4IC5A 3BTQE 1WUNH 3KL6A 3GY3A 1E0FD 2VIWA 4CRBA 1C5XB 3RXOA 1DS2E 5ESTE 3PLBA 1W12U 4FUGA 1BIOA 1SQTA 4FXGH 1LVOA 2AHME 1DDJA 3LGTA 1XUGA 4FUFA 5FHTA 3RU4T 5DPAA 3BV9B 3LONA 4NZLA 2PHBA 4X0WU 1DWDH 1GL1A 1SSXA 1O3HA 1PJPA 3ZVDA 3TK9A 1MKXH 1RFNA 2W3KA 3NRLA 5C0UA 1HIAB 1Y5UT 2A31A 1T8OA 3GDSA 2H9HA 1UCYK 4GHQA 2V6NA 4X8SH 2RFKC 1E34B 1O2VA 2ZU1A 3UIRA 5A0BA 1CSOE 1NU7B 1NY22 3SNBA 3I77A 3LT3A 3A85A 5JB8S 3M3VA 4BAQB 4A1VA 2QF3A 1TIOA 3SU2A 1EP5A 1ZOMA 1LHGH 2JDID 3CENA 3SI3H 1NBME 2SNWA 3DUXH 2Z3EA 2VINA 3ATKA 1P2NA 1HAVB 1NS3A 1QL9A 1UTNA 1ZSKA 4H4FA 5C1YA 5TCAA 1HAPH 4TPYA 3MTYA 1C1QA 2M5TA 1AZ8A 1OHHD 1D3DB 3PMBB 1C1PA 2PLXA 1DITH 2ZPQA 3F2HA 2F9PA 2ZDKA 4DOQA 2ZQ2A 1G36A 1P2OA 1P3EA 4X6PA 4CBOA 1AFQC 1RXPA 1BTWA 2DUCA 1P11E 1P2MA 1C1SA 2ANWA 2NWNA 4KTUA 4RT1A 3UOUA 2PSYA 5EXMA 1RS0A 3GY8A 4DJZB 4A7IB 1Z7KA 5E2PA 1GBMA 1RTFB 1TNKA 1ZTKA 2UWOA 3SI4H 3MO9A 2FOGA 3RXHA 1Y3VA 3GYMA 1GVZA 4BXWA 2CN0H 2WPLS 2Z94A 2ZDMA 4NFEA 3SJKA 4Q2KA 1C1TA 2Y82A 1MQ6A 1E35B 4X1SU 1DY8A 2ZHDA 2ZGHA 1L2EA 1L1JA 1O32A 1AZZA 3T27A 1DLKB 2FXRA 1S0QA 2YNBA 2VIQA 1QFKH 3RXPA 5JBTA 1JMOH 2O8UA 2A4QA 1EZXC 1GBTA 3A88A 2OUAA 2PUXB 3AVZA 2YMSB 2BDYA 3ODDA 4LOYH 1AFEH 2R2MB 5FCRA 2J4IA 3N7OA 4JK6A 3R0FA 4Y7BA 1H9IE 2FOCA 1A1RA 5PTPA 5C5NA 5A0CA 1GHYH 1EB2A 3KYGA 2D1JA 3AW1A 2JIZD 2ANMH 3TJVA 1RTLA 2ZTXA 1GBLA 1H9HE 3UWJH 2XWAA 2PKAB 3GS9A 2OBOA 1TRNA 1ZTJA 3M3TA 3SZNA 2FS8A 1SGDE 4YZUA 1SG8B 1O34A 1GHZA 1KLJH 2F9UA 2VVCA 2GCHF 1ARCA 2PTCE 1K1MA 1QB1A 2WPIS 1F2SE 1L0ZA 4RKOB 4JZEH 1KXCA 1OWIA 3TJOA 1EZQA 1AVWA 3A86A 1SL3A 2TPIZ 1MKXK 2J9NA 4OGYA 4YM9A 1FMGA 4RKJB 3UPEA 3HPTB 1HGTH 1TRYA 3LGYA 3V0XA 3GICB 5FBIA 4TY6A 3RM2H 1O30A 1O2GH 1FUJA 1QIXB 3GYLB 3K65B 4ABIA 4ZHLU 1FX0B 2WINI 2ZDVH 1D3TB 1P06A 4A1XA 1WV7H 3BN9A 3D62A 2Y5GA 3C27B 3KN2A 1RJXB 2ALVA 3T5FH 1T8LA 2IJOB 4WH6A 1SGIB 3FP6E 1MKWH 1GJ7B 3SU4A 3BSQA 4I33A 5K7RA 5AFZH 3RXGA 1YC0A 3AW0A 4YOIA 3S9BA 3OE7D 4BXSA 1KY9A 3A84A 1ETTH 4UE7H 1FV9A 1O35A 1TPPA 1K22H 1OWHA 1YY3A 3UOPA 3RC6A 1O3IA 2UUJB 1ZMNA 2TIOA 2ZGJA 3QO6A 2Q6GA 3V3MA 1PQ8A 1O37A 4BTIB 3QZRA 2H6MA 1GJ9B 2C4FH 5GCHF 1GJ8B 3M7QA 2NU1E 1VJ9U 2ODYB 5EODA 1C1RA 2NU0E 3S9CA 4NWKA 2P93A 1V2QT 3U8RH 1HAZB 3FP8E 2BM2A 1O2SA 1TWXB 1S6FA 1V2PT 2O9QA 2A2QH 3MWIU 1QJ7B 3UFAA 4DIHH 1OKXA 2YNAA 1N6YA 4A5TS 4DIIH 3EDXB 1UTPA 3GY2A 1MTSA 1O3NA 1U6QA 4I31A 5L6NH 5F6MA 1ZPZA 3VG8A 1A0LA 3L3TA 2XXLA 4TWWA 2YMSC 1YM0A 3B8JA 1TMTH 1TYNA 2ZP0H 2ZO3H 3Q76A 2J98A 1C2JA 3Q3XA 3T62A 1D6RA 4KTCA 2CXVA 3SGBE 3WY8A 2B0FA 2IPHA 4LZ1H 4X8UH 3BF6H 3PLPA 1XKAC 3UR6A 5SGAE 1P09A 2FI4E 1GDQA 4H6TA 3HK6B 3KNXA 1E37B 1KIGH 1NRNH 5DP3A 3P17H 4Y76A 1T4UH 3TGIE 3N7DA 2FZZA 1A7SA 1OP8A 2QC2A 2ZIQH 1C5NH 3UNSA 1P9UA 1EFRD 2K0QA 2QN5T 2SFAA 3SORA 1O3CA 4GCHG 4XBDA 3T25A 1A4WH 1EPTB 1NRRH 3UTUH 5KEDA 4MDSA 3ZZAA 4CBNA 3ATMA 1Z1IA 1ANEA 1B7XB 3TGJE 4MPWA 1GMHF 3N99A 5I46H 5AF9H 2XNIA 1K1PA 3U1IB 3ZVCA 1XVOA 2PP6A 1QL7A 3IG6B 5EOKA 3EGKH 4D8NA 1XMNB 1TNIA 5C1XA 3AASA 3HK3B 1BITA 2I6SA 2XC5A 4I86A 2G4TA 2GCTB 1TNLA 5A8YA 3T28A 3FO8D 4E06H 1MZDA 1SGPE 3ZZ5A 1SGNE 1UVUH 3EA8A 2W7UA 4X1RU 2AEIH 2FOMB 1MBMA 3BTKE 1GG6B 1MD8A 3F9EA 1HUTH 2J5UA 3P8OA 2BLVA 1Y5AT 2UUFB 3NUMA 4BANB 2BQ6B 1EUFA 4IGDA 3UQVA 5C94A 1TONA 1Q31A 2SGFE 1SOZA 3ODFA 4H6SB 4K1TA 1F7ZA 2BDCA 1P02A 1V2MT 1JRSA 2PUQH 1BA8B 4Z6AH 2KCOA 2ZZUH 2H1UA 2ZHFH 4B2CA 3SN8A 1YCPH 3Q00A 1QA0A 1P04A 1ZTLA 1EP6A 2HVXA 4DVAU 3KGPA 3RU4D 1G3BA 3DSPA 3RM0H 4ZCNA 1LKAA 4Y8XA 1T7CA 4X1PU 4FETA 3S9AA 3M35A 3HATH 1INCA 3SOSA 3LGUA 5T3HA 1BTXA 2ALPA 3TH2H 3T29A 2A2XH 2FI3E 3VFEA 4AG1A 1YWUA 2XCFA 1AI8H 2H9EH 2JH0D 1O3JA 1LQDB 2EA3A 3GOVB 1O2MA 4NSVA 3RXDA 3UR9A 4NIYA 1EOJA 4ABDA 1ELBA 1C5RA 4CRAA 1DFPA 4OS7A 2FODA 2ZC9H 1GJ6A 1J15A 1OS8A 3OFND 2CF9H 2TGPZ 4JZIA 4Y8YA 4DT7B 2ZFPH 1UTOA 2HNTE 2GTBA 2VIOA 2BX3A 3LH1A 1QB9A 1O2QA 1WU1A 5T1VA 3URCA 1O5CB 1ZGIA 5AVDA 1IHTH 5A09A 1P05A 4MVNA 3RLWH 4ZHMU 3M61U 3EA7A 4X6MA 4OM9A 4X8VH 5TCCA 4FUIA 3K9XB 2BOHB 2YOLA 4O3TA 1O33A 4Y0ZE 2ZDNA 2JKHA 4UDWH 2GX4A 8KME2 2LNCA 1PPEE 2RA0A 4CRDA 2WYGA 1GBEA 3TK6A 2GDEH 1H8HD 2QXHA 3F3BA 2GCHG 4A1TA 1D6WA 1KSNA 3K2UA 1EPTC 2G55A 2FPZA 4F4OC 3RXJA 1O39A 2CHAB 3TU7H 3UWIA 1V2TT 4KELA 2D2DA 2O8MA 3L33A 1OWJA 1GJCB 1PPBH
chains in the Genus database with same CATH topology
4NA7A 1Z8IB 1AGJA 4AFZA 1GBBA 1XM1A 5JPMH 2VIPA 1VCWA 2GCTC 3NPSA 2SGEE 3FANA 1HRTH 1YPHC 1SBWA 4CH2B 2HPPH 1SMFE 3A8CA 3SU5A 6GCHF 4Z0KA 1GG6C 1EB1H 4MLFB 1IQIA 1ZSJA 3F9FA 1SGEE 2WPHS 1MTNB 5EG4A 4K8YA 1GL0E 3LGIA 1L4ZA 3FZDA 1GI2A 1FY3A 2J34A 2G5VA 1V2ST 3TIUA 1JWTA 2P59A 4I32A 3SW2B 2ZCHP 4K5ZA 1C1OA 3ZVGA 1SLWB 1HBTH 1QGFA 4CHAB 1DOJA 1TFXA 1H1BA 4B76A 3RXBA 4KTSA 3A82A 1T31A 2TBSA 1Z6JH 5GCHG 3NXPA 1IQGA 1BHXF 1CGIE 1LPGB 2ZNKH 5E0HA 1SGCA 5DP9A 3GDUA 3QGNB 3SV9A 1TBRH 5L30H 1SLVB 3QLPH 2THFB 2J95A 2Z3CA 1SHYA 1QRZA 4YT6H 3PTBA 4AYYB 4FUDA 4HFPB 4JYVH 1ELTA 1THSH 4AN7A 4WVPE 1IQHA 1AVGH 1CT2E 3MO6A 3SQHE 1FY5A 1ZRBA 1JIMA 1K1OA 2PW8H 3GISB 1GHWH 1Y59T 4AG2A 1CA0B 3LU9B 1IAUA 2QXGA 4X2XA 4Y0YE 1SR5C 1HJ8A 2R3UA 1XXFA 3SHCH 2J2UA 1CVWH 3RXCA 2IOTA 4INKA 3G01A 1GI1A 4INHA 2A7HA 1NM6A 2FLBH 2AYWA 3KQBA 1TALA 2VWLA 4A6LA 5DG6A 1IQNA 1QBOA 1SQAA 2ZTYA 4O3UA 4YOJA 1PPZA 2ZGCA 4NZQA 1O2LA 2BD9A 3TH3H 1DWCH 4E7RG 3RLYH 4M7GA 5EPYA 4ZUHA 1QBVH 1OOKB 1YPGH 1W3CA 1QQ4A 2BD8A 3QUMP 1F0RA 1GCDA 2ZFRH 2FO9A 2FMJA 1C1VH 2B9LA 4J1YA 3SUDA 2TGAA 3SUFA 2CHAC 2ZDLA 1IOEA 4GUXA 2TRMA 3RXLA 3M7UA 3ZVFA 3E8LA 1D4PB 5A2MH 3MNCA 1HFDA 1NRSH 4I7YH 3TK5A 3SU0A 5AFYH 5G4BA 1LVMA 1O2RA 1ZRKA 2Z9KA 1ZLRA 2XBVA 2VIVA 2JETB 4AB8A 3BG8A 3F6UH 1GBHA 4YTAA 3T26A 1H4WA 4K69A 2BQWB 3O8DA 1BMNH 4JZFH 4ZAEA 3VXFH 2ESTE 2OLGA 1DE7H 1GVKB 2GMTB 3MNBA 1C5WB 2G8TA 1W2KH 2GV7A 4BTTB 1L4DA 2BXTH 5E8EH 5IDKA 1MTNC 1ELFA 2QYIA 3MU0A 4B1TA 3MH7A 1YPKH 4MNYA 3A81A 2ZEBA 4X6NA 3E0NB 3ZVBA 3SNEA 4CHAC 1TGBA 1XX9A 4D9QA 3PLKA 1NPMA 2HNTC 1LHEH 3NK8A 4MTBA 1NESE 3PM3A 2ZPSA 2Y81A 1MTVA 2Y80A 5BPEA 1F5RA 1YBWA 2ZWLH 1O3AA 1GHVH 1TBZH 1IQMA 2OC1A 2VH6A 1FNIA 2BDIA 1G3CA 3M5NA 2Q1JA 2OC8A 2V3HH 1QQUA 1W0ZU 2ZDAH 1XUKA 2FWWA 4B2AA 4DG4A 2G4UA 3TNSA 5T6FA 4ZXYH 1EXFA 3EQ0H 1E36B 2XBWA 5EGMA 3SBKA 1BBRK 1CA0C 4K8BA 1DSTA 3SU3A 1ZYOA 3RMMH 3RXIA 1O38A 2QIQA 1P3CA 2O8TA 3MMGA 5A8ZA 5C1UA 1UVSH 2H5CA 5FX6A 3JZ1B 1XUIA 4KGAA 4YESB 3ZYEA 2KAIA 5GDSH 3Q3KA 1FIWA 1A3EH 2EEKA 3ZZ8A 3Q3YA 1WOFA 1CGJE 3QTVH 2XYAA 3BEIB 2FTLE 1MCVA 4MNXA 1VZQH 4JCNA 3LKWA 1SB1H 1O5GH 1SGQE 2A5KA 3RXRA 2RDLA 1A5GH 1GPZA 3EE0B 1SGFG 4WMFA 1G37A 3NCLA 5ABWA 2FOBA 3BTME 1EKBB 1K1IA 2D26C 1SFQB 1YYY1 1UK3A 3RMNH 4KP0A 4X1QU 1F5KU 2FX4A 2J92A 3KIDU 4WXVA 1CHGA 1EAUA 4CH8B 1V3XA 1Z6EA 2BOKA 2JETC 1A2CH 3QX5H 2GZ9A 1XVMA 4ISLA 2ZCKP 1C1NA 2CF8H 4UEHH 1SQOA 3U8TH 5CE1A 1V2UT 2GMTC 6GCHG 1S84A 1CHOF 1GI6A 2OP9A 5E2OA 4H42U 1KLTA 1SHHB 4NIWA 2VIDA 2ODPA 2GZ7A 4NWLA 1P9SA 3ITIA 1QHRB 3LIWA 4CR9A 1LCYA 2PGQB 2QXJA 2XTTB 1PPGE 2VNTA 3VXEH 1Z1JA 3QWCH 2BDAA 1OP2A 3SQEE 1JRTA 4GPGA 3SGQE 3F9GA 5FX5A 1O3GA 3E6PH 1S0RA 5LGOA 3VPKA 1AN1E 4ZXXH 1O5FH 3P8NA 4ABEA 2BD2A 1DT2A 2OQ5A 2AERH 2OBQA 2FYQA 1Q3XA 1QL8A 1P0SH 2ZCLP 8GCHF 1BMMH 2PKSB 4MPUA 4GHTA 1Z8JB 2BY5X 1C5VA 1DM4B 1TGNA 1WSSH 1C5QA 1LHCH 1J16A 1SPJA 1P2IA 4ZH8A 3GY4A 3SUGA 4X1NU 1NU9A 1C5UA 5EQQA 4SGAE 3SV8A 3UREA 2A7CA 2FM2A 3F68H 4ABHA 1PYTD 2AMQA 3ATLA 1KXEA 4ABBA 1J9CH 4OS1A 1AUTC 3LDXH 1G2LA 1K28D 3OY5U 3DT0H 4D7GA 2UUKB 3PO1B 3MU8A 2EI7A 2ZHQH 3ZZBA 1GMCF 2BLOA 3SNAA 5HYOA 4BTUB 2PR3A 1HAGE 1E38B 3BEUA 3ATWA 1W14U 1YPHE 1FONA 1SFIA 1LDTT 2ZHEH 1BZXE 4Y11E 5GWZA 3SJIA 1GBJA 1W7GH 1G30B 1GBDA 2AGEX 1V2WT 4OS5A 1VITH 1GI5A 1SC8U 1GJBB 3M5OA 2A32A 3TITA 4CR5A 2QA9E 1HB0B 2G52A 5FPSA 1EAXA 4YT7H 4U01A 2BZAA 1DSUA 5DK1A 5HMAA 3W94A 2HNTF 1CO7E 4R8TB 4WH8A 5IYTA 1O3LA 1B0FA 1O5AB 1DY9A 3LC5A 3UQOA 1DICA 2BD7A 1TA6A 4IBLH 1EASA 3A7VA 1A0HB 1BMLA 5AHGH 1Z8RA 1QA7A 1GWAA 2IN2A 3S0NA 4ISIH 3P8GA 5FXLA 1K9OE 3A8BA 3BTTE 1VCPA 2BD5A 4WMEA 1C5OH 1MTWA 5DO4H 1UJ1A 1ZR0A 5DGJA 1TMUH 4FUJA 2G5NA 1YGCH 1TX6A 3SHAH 1CGHA 1D3PB 3MH6A 2C8YB 2WYJA 2FOAA 3RXUA 1S5SA 2BDGA 1NT1A 1ORFA 4B2BA 1C5ZB 7LPRA 2BVSH 1AKSA 4X2VA 1THRH 1NZQH 2FX6A 3DFJA 1G32B 1LKBA 3M37A 3ESTA 2C90B 4MPVA 1GGDB 1GHAF 3VB6A 2QV1A 1DX5M 5J4QA 3M7TA 1F5LA 3A7XA 1BJUA 1CU1A 1BQYA 2PKSC 2GV6A 1C2KA 4BAKB 3BIUH 4UD9H 1GMDF 1MKWK 4E05H 1KXBA 2PTNA 3LGWA 4GAWA 5E0GA 1D3QB 1RTKA 2WUBA 4XFQA 1DWBH 1X7AC 3O8RA 4INLA 2AH4X 1C5TA 4X8TH 1ZSLA 1C2GA 2VU8E 4HGCA 1N8OB 3LC3A 3A7TA 5I25A 4FU8A 3BTEE 1A3BH 3PO1C 3U1JB 4K3JA 4ZKSU 4YOGA 3V7TA 1FAXA 1UCYE 1YCPM 3KHVA 4XSKU 5EW2H 3U69H 1O2YA 1DXWA 3BTGE 3TH4H 2XRCA 2V35A 1GHXH 2BTCE 3H5CB 4MNVA 1TGCA 1Y5BT 2Y5HA 1SGFA 1OSSA 1TGTA 1MU6B 4D7FA 3P92A 2F3CE 1SI5H 4Q7YA 3BIVH 1Q2WA 3MHWU 4GVUA 4UFDH 2SNVA 1HAXB 3LH3A 2FOEA 1K1LA 3JZ2B 2P3FH 1O3FA 1EOLA 1ETRH 1MH0A 3U98H 4D76A 3OX7U 3SV7A 4BAOB 2KAIB 1G9IE 1L1GA 3OTJE 3RXTA 1OWDA 1THPB 1LMWB 3F1SB 2ODQA 3MU4A 5LPRA 1VGCB 1Y3UA 1YPMH 1OWEA 3ZVAA 2OTVA 3P6ZB 3QZQA 1ACBE 2O8WA 3ZVEA 3E0PB 2SGAA 3KQEA 2W5EA 1BRCE 1MBQA 1HCGA 2V3OH 4WMDA 4THNH 1CHOG 6ESTA 1K1NA 1KDQA 2Y5FA 3MH5A 2EI8A 1SLXB 2OD3B 2OC7A 4ZROA 1JXPA 1GDUA 1C2FA 2SGQE 5A0AE 2BYAX 9ESTA 3MOCA 4AFUA 1WYKA 5ESBA 4ISHH 1O2JA 4J2YB 4U30A 2XWBI 7ESTE 1BCUH 5J4SA 4IN1A 1ZJDA 3TVJB 3RP2A 4LK4A 4MQAA 2BQ7B 1RRKA 1NC6A 2HPQH 2ZGXH 4XOJA 3RXEA 2C8ZB 2BY6X 3ATIA 2H5DA 1DWEH 2F9OA 5F8ZA 2AGGX 3A87A 1GGDC 2FP7B 4I8KA 4AYVB 1EAWA 1AY6H 3MH4A 1S81A 1C5LH 2WPJS 5JYIA 8GCHG 2FESH 1S6HA 2SGPE 2GZ8A 4LXBH 2UWPA 1XUJA 2GT8A 2WUCA 3E90B 8LPRA 1MAYA 1Z71A 3SV2H 4XBCA 1BRBE 1NFXA 3LPRA 4QT8C 2A45B 5EW1H 3TGKE 1AWHB 1V2JT 3L6PA 3ZZ9A 2CV3A 1HAOH 1N8OC 1DUEA 4JZDH 3CS7A 3I78A 1BRAA 2ZFQH 5HXFA 5T6GA 1ELGA 1S83A 1WTGH 4FUHA 1YCPK 2G81E 1BRUP 2QXIA 3MYWA 1PPCE 5C2ZA 1GMCG 4AFSA 1F92A 1S85A 2ZKSA 4K2YA 5FBEA 1HJ9A 2HGTH 2ZI2H 3NKKA 1V2VT 6CHAB 4E7NA 4IC6A 2G51A 1UCYH 3STIA 1TE0A 3B9FH 1FJSA 4NIVA 2BB4A 1HV7A 2ZU4A 4AORA 1P2QA 1KXAA 4ASHA 5EU8A 4LZ4B 4ABAA 2DE8A 4DW2U 4FVBA 2ZF0H 2AMPA 4O03A 1O31A 1W7XH 1LVYA 1EJNA 1LTOA 1AE8H 1ZHPA 2F9VA 3BTWE 1O3PB 1VITF 1ESAA 3O8BA 4DCDA 1BTYA 3S69A 1MAXA 1XKBC 3OU0A 3ZYDA 5LPEA 1VGCC 2ZECA 1BT7A 3D23A 2QY0B 1F0UA 3CP7A 3RXVA 4DGJA 2VVVA 1C5PA 1BTUA 2A4RA 2AIPA 2BD3A 1ZMLA 1BJVA 1UVPA 3EA9A 1ESTA 2Z3DA 2PGBB 3RMOH 3U8OH 2C93B 2Q6FA 5F8XA 1EZUC 1DVAH 5JBCS 2CMYA 1OP0A 1BUIA 2A4OA 3IITA 4NGAH 1IQFA 2NU3E 1GMHG 2P8OB 1HNEE 2F83A 3BTFE 4OS2A 1OYQA 2QCYA 1W11U 1BTPA 4X2YA 2RA3A 5CHAB 1C1UH 2JH6D 1LPKB 3SGAE 4IMZA 1VCQA 1TQ0B 4MNWA 1ZHRA 2Z7FE 1GHAG 3GDVA 4NCYA 1WTHD 1ARBA 1O2ZA 2XC0A 4XBBA 3UNRA 1FDPA 3VB5A 1N1LA 1QB6A 2ANKH 3QGJA 3TNTA 3FFGA 4I8JA 2F91A 3MFJA 1BTHH 2WV4A 1GMDG 1P10A 1O3KA 5EQSA 2A1DB 1HYLA 1JOUB 1MU8B 3C1KA 1V2NT 3O8CA 3UY9A 1TLDA 1TX8A 5E0JA 1AKSB 5TJXA 3ZZ4A 4Y10E 3SU1A 1QNJA 2UUYA 3HKJB 2ZQ1A 2ZFTA 4ABFA 4AGJA 2P16A 4GCHF 1C1WH 2ZFFH 3A7ZA 1L1NA 1O2KA 2BY7X 1AUJA 3OYPA 2TGDA 1C9TA 8ESTE 1HPGA 6CHAC 3FP7E 3BG4B 1FAKH 4NSYA 1SVPA 1O2XA 4GLYA 3D65E 1F0SA 4MPXA 5B6OA 3PV4A 4IMQA 3VB7A 3ZZDA 3TLOA 5LH8A 2EC9H 1RGQA 3PMJA 4AGKA 5C67A 2P3TB 4WXIA 1V6DA 4Y7AA 1ZPBA 2FOFA 1W10U 3ELAH 3V12A 2P95A 1TA2A 1AWFH 2H2ZA 3GCTF 1G3EA 3BEFB 1BDAA 2FI5E 3DA9B 1JBUH 2GGVB 4FVDA 1YPEH 3VB3A 3M5LA 1MUEB 3RXKA 1K2I1 1O5BB 2F9BH 1YPLH 1ELCA 1GI3A 4Y71A 1T8NA 1QY6A 2VVUA 2VJ1A 5GXPA 1W8BH 4NA9H 2RG3A 1GI7B 1O2NA 1BOQA 1WBGB 1O2UA 2XBYA 3S7KB 4AOQA 4ESTE 3M3SA 2VGCB 3TJUA 4BAMB 5EXNA 1GBAA 1CBWB 2ZU2A 1ANCA 2I6QA 2XC4A 1FI8A 3KQCA 1GDNA 2PWXA 3PB1E 1EAIA 4F49A 2Y6TA 1HXFH 3ENSB 4XE4A 2O8LA 2OXSA 1TAWA 3DD2H 3HKIB 5H4IB 2P8OC 3U9AH 1AVXA 2ULLA 1O2HA 3IWMA 5FPTA 4Y79A 3RDZA 1GI9B 2ZGBH 1Y8TA 5CHAC 1GJ4H 4U32A 1LO6A 1FIZA 2A7JA 3A8AA 1ANBA 1ZGVA 4BAHB 1TX7A 2ANYA 2AMDA 3D49H 3KQDA 2A5IA 3E16B 3FZZA 1KDQB 3PWBA 1YLCA 2WPKS 2FS9A 4TWYA 2ZA5A 3AAUA 5DP7A 1IQKA 1EQ9A 2B5TB 1HDTH 4TPIZ 1OYTH 2BDHA 3A7WA 2NU2E 4Q7XA 1NTPA 5F03A 1FPHH 1GHBF 1YKTA 3SJ8A 5DP5A 3SO3A 2B7DH 2ASUB 1AIXH 5HM2A 1FPCH 3KCGH 1P57B 1BHXB 3STJA 3OY6U 4X2WA 4K1EA 3A8DA 5F8TA 5FPYA 1GJDB 1QCPA 1JIRA 1QJ6B 1GBKA 3I29A 1QTFA 3R3GB 1AE5A 2A0QB 4HZHA 2R3YA 1CT4E 3BG4C 1XUHA 2HLCA 2FTMA 4Q7ZA 2HALA 4ZKRU 3DFLA 1FZZA 2PSXA 2STAE 4AX9H 5DJ7A 1RIWB 4I8GA 1P8VC 2VB0A <