3UR6A

1.5a resolution structure of apo norwalk virus protease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
164
Chain Sequence
MAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like protease
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Norovirus
total genus 37
structure length 164
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ur6A01
3FZDA 1NFUA 1K28D 1UK3A 1QJ6B 3ATMA 3KQDA 4K1EA 3MH6A 1K1PA 1BBRK 1MD8A 2ZPQA 1A3BH 3OY5U 1UTMA 1KSNA 3BIUH 4X0WU 3A84A 2O8WA 1O2KA 2PSYA 5LPFA 2R3YA 5F8TA 4QT8C 2B7DH 1AUJA 4O3UA 3LIWA 2BVRH 3SJKA 3PWCA 2SNWA 4ISLA 5LPEA 3A7ZA 4E06H 2OC1A 2W3IA 1FPCH 1OWJA 1O2IA 4FUIA 1O5FH 1IQLA 1BTUA 1LPZB 1Y3XA 1VCPA 3TU7H 3VB5A 3BG4B 3VFEA 3SGQE 3M3VA 1RRKA 5F8ZA 1BZXE 4NSYA 2C4FH 3PLBA 9ESTA 1BBRH 1OXGA 4BAMB 1B0EA 3T2NA 4B76A 1SL3A 2OBQA 3RP2A 1RGQA 1EXFA 4MNYA 5DO4H 2A2QH 2ZFTA 3KHVA 1LVOA 4MPXA 5HGGA 1VITG 5JBTA 1C1VH 1CA8B 3AVZA 1F7ZA 1OP8A 1C2FA 4XDEA 3LGWA 1P2OA 1C1OA 4YOIA 4NGAH 2F3CE 1DS2E 1GHBF 3LDXH 2QV1A 2P95A 1EPTA 1RTFB 2OCVB 4NSVA 2SGPE 2ZQ2A 2BXTH 2OTVA 4NWKA 1VJ9U 1RS0A 2FLBH 4X1RU 4NA8A 1UMAH 1V2RT 2XBYA 2ZCKP 1TMBH 1V2OT 1Y8TA 2P3FH 1KXEA 6ESTA 3O8CA 2EI8A 1DLEA 2Y5HA 5L6NH 2WV4A 3M5LA 3O8BA 1CHOG 5FHTA 1PQ8A 2BDAA 2BVSH 4U30A 4NA7A 1D6RA 1P8VC 1NO9H 1GI0A 1C5PA 3P70B 4DCDA 2FOAA 4ISOA 1O2TA 5FBIA 2V6NA 2OC7A 1HDTH 1HAGE 1XX9A 1UVOA 1XM1A 2G51A 2WPHS 1D3QB 1AB9C 2R2MB 1PPZA 1MD7A 1ZPBA 1HYLA 5E0JA 6CHAC 3SO3A 3Q3KA 3NPSA 2Y5GA 1O2ZA 1YPKH 1O2PA 2PKSC 4NFFA 4I8JA 1N8OC 3SN8A 5LH8A 1JIMA 1THPB 5G4BA 1ZRKA 1EJMA 1O3AA 1UTKA 2CHAB 2BOKA 3FVFB 1KY9A 3WY8A 5E2OA 2GKVE 4ABBA 3VB3A 1YCPK 2BDHA 2HPQH 1EZXC 3AW0A 4CBNA 5LGOA 1U6QA 1TLDA 2O8LA 4CH2B 4CREA 1KIGH 4JYUH 1BCUH 1ZSKA 1S85A 1AY6H 1GMHF 2TGPZ 4BAKB 2CHAC 3RXQA 4YLQH 1EAUA 1WOFA 2A4OA 1QFKH 1C5QA 2FOBA 5JBAS 1TIOA 2H9TH 3TH4H 2XC0A 2ZPRA 4ZKSU 4DW2U 2WINI 1TNIA 2BD5A 1G3CA 4IMZA 3A8CA 3LJJA 1GBKA 2G4UA 8GCHF 5EPYA 1C5UA 2SGEE 3A85A 2F9UA 1FI8A 1C9PA 1P03A 2A7JA 2ZGHA 2NU2E 1AVXA 1GCTC 1YCPH 2F9NA 1MTSA 5AFZH 2ZTYA 2CF9H 4JZEH 2WPIS 3GCHB 1Z8GA 1T32A 2GCHF 1S0RA 2FOMB 4MQAA 2QY0B 1TRNA 4AYVB 4FUBA 1YP9A 1DE7H 1GHVH 3ZVAA 5GPIB 3UOUA 1FUJA 2VWLA 1PYTC 4AFSA 1MCTA 9LPRA 4X8SH 2CXVA 2AS9A 3D49H 1D4PB 3RXJA 1BITA 3PO1C 2IOTA 2ALPA 1FPHH 2P8OB 3ATIA 1NM6A 1MTNB 1OOKB 4A92A 1HAOH 2OP9A 2PKAB 8KME2 3M37A 1K1IA 1NT1A 1XKAC 3A88A 4BXSA 3A81A 3MU1A 1P9SA 1FJSA 2Z7FE 3M7UA 2OC8A 3MU0A 5EODA 5ESBA 2XCFA 1EZQA 1TNGA 1Z1JA 1SGCA 1IQJA 1T8NA 1ZSJA 4GCHF 1YPMH 1P2QA 3QN7A 2Y7ZA 4CRBA 1HAXB 3SJ8A 1O30A 1O2YA 3VXEH 1C5XB 3EAJA 1D3DB 1J15A 1GCDA 3UOPA 1HAPH 1ZMNA 4FU8A 5JBBS 4TWWA 3PV4A 1Y5BT 1YKTA 1W11U 2OQUA 1B0FA 1YBWA 2A32A 2H9HA 2FYQA 1LMWB 3P8FA 1GG6C 1LCYA 1SGIB 4K5ZA 4Y0ZE 1HLTH 3RXKA 3EQ0H 2G4TA 1DX5M 2OC0A 4ESTE 2BX3A 1T7CA 2VNTA 4KKDA 1TGBA 3HK3B 3HK6B 1J9CH 4DT7B 2XC4A 4BAQB 1G37A 4B2AA 1NZQH 3M7QA 4Y10E 1E37B 1A0HB 1OSSA 4IBLH 1GMDF 1SC8U 2XBXA 1CU1A 4TY6A 4D9QA 3TITA 1KXBA 4MNVA 1L2EA 1XVMA 1LPKB 4I7YH 1G32B 4AFUA 4CRCA 3H5CB 2ZU3A 3M3SA 2FX4A 4VGCC 1ESBA 2Z9JA 3ZVGA 1EZSC 1QRWA 4NA9H 3T26A 3QGNB 1TFXA 1C2MA 4ZXXH 3ZZ8A 3U8OH 4A5TS 5DJ7A 2WPJS 1HAVB 2ODPA 2QGRA 1NRNH 3GY3A 2W3KA 3PTBA 4XFQA 3EYDA 3KGPA 2V0BA 3F68H 3RDZA 3A7YA 1C2EA 2VIDA 2FODA 4ZHLU 1Z8JB 3A89A 4ZROA 5C20A 1AD8H 3ZVCA 1TPAE 1QL7A 1SG8B 2XBWA 1GBTA 1W3CA 2W26A 1LQEA 4WXVA 1ANDA 1SLVB 5GCHF 3RXMA 1UCYK 1GI7B 4Y11E 3QZQA 2BD7A 1AZ8A 1NRQH 2H2ZA 1QR3E 2GD4B 2R9PA 3A86A 3MOCA 2VWNA 4DURA 1BMMH 3JZ2B 3LGVA 4OS1A 5L2YH 1QQ4A 2BD4A 3RLYH 3D62A 1HIAB 2ZPSA 4MPVA 4E7RG 2JH6D 1GVKB 4WMDA 3RXGA 1GHAF 1QBVH 2A4GA 1THSH 1ELEE 1IHSH 2ZI2H 3VB7A 3MU4A 2QF0A 2P3TB 3V12A 1CGIE 1TA6A 1W14U 2PHBA 2B9LA 1A1RA 2GV7A 2ANMH 2Q6FA 3RU4E 1S82A 2JH0D 1UCYH 2PTNA 2UWOA 1TWXB 2C90B 4X1SU 1IQGA 8LPRA 4LK4A 4WY3A 5T6DA 2FM2A 1CQQA 2J9NA 2QF3A 1SVPA 1JXPA 4NG9H 3STIA 1JBUH 1BT7A 3MH5A 1MKXK 4K2YA 4NCYA 1W13U 4AB9A 3D65E 4Q80A 3EA7A 3RC6A 4IS5A 2BY7X 1GBAA 2PKAA 1GBMA 2FOCA 2Z9LA 5AVDA 3RXUA 3RXTA 4ZKRU 4X1PU 1NRPH 4X2VA 3ZYEA 3OSYA 2VGCC 3RXVA 1HXFH 1DWEH 4Z0KA 4YZUA 2XWBI 1IQEA 3BTFE 5C1XA 1AFQB 4FUGA 5T6FA 3KQEA 3SU1A 2PTCE 1CE5A 2G81E 1T31A 3QK1A 4ZUHA 2TGAA 5AFYH 1EQ9A 1YPJH 3LPRA 5E0HA 3EE0B 1GHBG 1GI5A 4AX9H 1B7XB 1ACBE 1MKXH 2O8TA 3A7VA 4I32A 1G2LA 1DWDH 2CN0H 2Z3DA 2FESH 3KL6A 4HTCH 4XBBA 2BY6X 1RIWC 1GBEA 3KN2A 1P05A 4WWYA 3V7TA 3OTJE 1IQNA 1K1OA 2Z3CA 3PROA 5DP9A 3BTGE 1WV7H 3LONA 4I8HA 1RD3B 3QTOH 4OS5A 4WF8A 4XE4A 5FCKA 1O3NA 2FLRH 4YT6H 4FXGH 1V2QT 5F6MA 2ZP0H 2XC5A 4M7GA 3SI3H 3BF6H 1EATA 3H7OA 3MH7A 4B2CA 1PPFE 1E36B 4AFZA 1C5SA 3M5NA 4TWYA 1C2KA 1NFYA 2PLXA 1DUEA 4FUEA 2ASUB 1EPTC 1Z71A 3ATWA 3NWUA 2UUFB 2ZHFH 1WYKA 2ZDAH 5FPSA 1BRAA 3HKJB 1LKBA 5EOKA 1ZHRA 1S5SA 1A46H 4Y71A 4R8TB 1KTTB 1FLEE 5F8XA 1DXWA 1AU8A 1E38B 4Q7XA 4D76A 3ZV9A 3D23A 1QA7A 2Y5FA 1HJAB 1SLXB 2Y81A 1AI8H 3UWIA 1P2JA 1QGFA 1SGNE 4KP0A 4MNWA 1H4WA 3ZZ7A 2FX6A 3UREA 1ETRH 2XW9A 1AGJA 1SFQB 1K21H 1GMHG 2FPZA 4WXIA 1LHEH 4GUXA 3ZVBA 1P04A 2H9EH 4HFPB 4CBOA 1TX8A 2WPKS 4BOHA 3M3TA 2VIPA 4CR9A 1ZTKA 3BSQA 2PUQH 1V2JT 1C1MA 1GVZA 1F0SA 3SU6A 1G36A 5BPEA 4JYVH 1WTGH 5GXPA 1QL9A 2XRCA 1UTOA 1ABIH 3T25A 5SGAE 3QTVH 3S9BA 1HIAA 1DY9A 4JZFH 4MLFB 4X2YA 8GCHG 1H9LB 2AYWA 1NC6A 3K9XB 3PMBB 3A80A 1PPGE 3RLWH 4RKOB 2PWXA 3MWIU 4YESB 1C5RA 1M9UA 1H9IE 1O36A 3GISB 1N6YA 1G3BA 3W95A 1JIRA 2A4QA 3TJVA 1C1UH 4J1YA 2GCHG 1ZGVA 1C2IA 2P16A 1SGDE 4X8UH 3LGTA 3TH3H 4DJZB 1QL8A 1WCZA 3LU9B 1O2SA 3RMMH 1FY5A 1O3PB 1O2RA 3E6PH 1JRSA 1BRCE 2VIOA 5HM9A 1Z8IB 2FS9A 2W7SA 4K3JA 1GBCA 2A5AA 3RU4D 1QNJA 3ZYDA 2NU4E 3GICB 1ELCA 4X8TH 1WU1A 1IQFA 3GDVA 2ZDKA 2P93A 3B23B 4Y7BA 1HNEE 3QGJA 1QA0A 1VGCB 4JYTA 1IAUA 4B74A 2V3HH 1ANCA 5FBEA 4YM9A 1XVOA 1K2I1 1H9HE 1YLDA 4J2YB 4OS6A 2F9BH 4UD9H 1ANEA 4Y76A 4ZKNU 3UIRA 4ASHA 4WH8A 1C5TA 1BTPA 4GCHG 1C1TA 4XBCA 1F0UA 1XXFA 8ESTE 1UK4A 4Z6AH 5C3NA 2FOEA 4DIIH 2GDEH 1GVLA 5JBCS 4OS2A 2ZFQH 2G00A 4INHA 2ZEBA 2R3UA 2GCTB 4D7FA 1DOJA 3FFGA 4JCNA 3M61U 3RXBA 1DM4B 4XSKU 1O37A 5E2PA 1L4DA 1FONA 1TONA 1YPGH 3GDUA 2BTCE 4HI3A 1W10U 1AFEH 4NIXA 2HGTH 3BG4C 2RG3A 1MQ6A 1WQVH 3Q00A 3ZZ3A 4RN6A 5DP5A 3EA8A 2ODQA 3TH2H 1S6HA 1GJDB 3BV9B 1TNHA 3RM0H 1O3GA 1QJ7B 1J8AA 3GOVB 5GDSH 3SV7A 3LJOA 3PM3A 2YNBA 1SGEE 2BLVA 2BB4A 1AHTH 1H8DH 2B0FA 1SI5H 1UTNA 1IHTH 4YOGA 3MU5A 1V2WT 1GMDG 1YPLH 3M35A 1DUAA 1XMNB 2XNIA 1SOTA 4MTBA 1DWBH 1ZHPA 3K6YA 1Y3UA 1PFXC 1K1LA 1LDTT 1KXCA 1UO6A 3QDZB 1T4UH 4A1XA 3E0PB 3SQEE 1O2HA 1QJ1B 2DUCA 3SUGA 1DY8A 4JZDH 1AMHA 4Y7AA 1F0RA 1ELTA 4ABFA 4O97A 1TNLA 1FQ3A 1TOCB 2ZFPH 4YT7H 1Z6EA 1P2IA 1G30B 1EOLA 3TJUA 2BQ6B 3GYMA 1FY4A 1LO6A 4B75A 1P12E 1IOEA 1GI2A 3NZIA 2DE9A 1GHXH 1PJPA 3SOSA 2G55A 2QXHA 4NIYA 2JH5D 1L4ZA 1SMFE 4ABIA 1OYTH 3BN9A 4OGYA 5GCHG 1E35B 1KLJH 4WJG2 2XBVA 3GY6A 2YNAA 2HVXA 2AGGX 5EQRA 3GY7A 2BXUH 2UWPA 1O32A 1Y59T 2ZU4A 1S0QA 1KXDA 1PPCE 1ESAA 1GMCF 1DSUA 1C1QA 3UNRA 2HOBA 2ZHDA 4TPIZ 4A7IB 2Z3EA 5TCCA 3UPEA 2H5DA 2Y80A 1HV7A 4NZQA 2G52A 1TPOA 2ZCHP 4X8VH 1YPHE 1N6XA 4D7GA 2AIQA 3HPTB 1GHAG 1AUTC 1OWDA 2ZHQH 5AF9H 5EW2H 4AB8A 2BYAX 4FUCA 1O5GH 2ZKSA 3QLPH 1LHGH 1ZLRA 4K1SA 1C2LA 1SGRE 3FZZA 3ZVEA 3E0NB 1O5EH 2A45B 1VJAU 1MCVA 3U8RH 3T28A 4NWLA 2TGDA 4OS4A 1A2CH 3IITA 2QYIA 4BAOB 1VZQH 4AOQA 2Q6GA 3ZZ6A 2QIQA 4ZH8A 2ZHEH 3BTME 2AFQB 2CJIA 1RJXB 5CHAB 5DP8A 3QO6A 4GPGA 1MMJN 3KQCA 3RMLH 1DANH 5A09A 2VIWA 2ZNKH 4CR5A 1NY22 2VJ1A 1Y3VA 3V13A 3S69A 3ZZ5A 4D8NA 1W0ZU 3UY9A 5EW1H 1AKSB 2LNCA 3UR6A 1SBWA 3GCNA 1UTJA 4U01A 2BDYA 3ITIA 4H4FA 3RXIA 5K7RA 1X7AC 2BVXH 1P3CA 3GCHC 3RXCA 4IC5A 3SNDA 1TE0A 1YYY1 4YO9A 1A5GH 3RXDA 3A8AA 1HAZB 4IMQA 5CMXH 4CH8B 4OGXA 4Y79A 4TPYA 2ILNA 5H4IB 4BTTB 1TX6A 3ZVFA 3KQBA 3MMGA 1C1NA 2GMTB 1BTWA 2QA9E 1SGPE 2BLWA 1V6DA 3UNQA 1WBGB 3JZ1B 1MZAA 2P8OC 3GCTF 2NU0E 1MTNC 4D9RA 4OS7A 5C5NA 5BRRE 3E16B 3E3TA 2RCEA 4IC6A 2VH6A 3RXHA 3KIDU 1C2DA 1WQSA 5IYTA 2STAE 4ABDA 5C1YA 2ANWA 4ISHH 3BTEE 3TK5A 5JPMH 3EDXB 2ZGXH 2H6MA 1WUNH 3C27B 4K60A 4O03A 1XUGA 3A83A 2XYAA 1GGDB 4UFFH 2BQ7B 1CHGA 4JK5A 3M5MA 2ZU2A 2BDCA 4AYYB 1EASA 2QAAA 4ISIH 3MU8A 2LPRA 4X6NA 3KNXA 1XXDA 5K0HA 1QRXA 3BTHE 4MVNA 3F9FA 3SQHE 3PMAB 2ZGBH 2AIPA 2FO9A 3OYPA 2D2DA 2OLGA 1HRTH 5T3HA 1Q31A 2D1JA 1SGTA 1CT0E 1GDUA 4AFQA 2GGVB 4I8GA 1XUIA 1ZJDA 3SJIA 3DHKH 1HB0B 1O3LA 3CP7A 3SNBA 1THRH 1D9IA 1SSXA 2A5IA 2Q1JA 5EXLA 3W94A 1PPEE 1O2UA 2Z9GA 5L30H 1G9IE 1CT4E 1FAKH 2FTMA 2VWOA 3FAOA 5A8XA 1O2OA 1FXYA 1HJ8A 1UTQA 4UDWH 2H5CA 2FEQH 3T62A 1V2PT 1O5AB 2UUYA 2FXRA 1V2UT 4ZKOU 4X1NU 1UHBA 1IQMA 3M36A 1EZUC 3A82A 1C4U2 5DKMA 1ID5H 1ZZZA 2F9VA 3RM2H 3BEUA 1VCQA 2UUKB 4NIVA 2R0KA 4Y6DA 1O2GH 2BY5X 1O3FA 2G5NA 2J2UA 1O3DA 3Q77A 2PR3A 4BXWA 2C3SA 3SORA 1MTUA 5EXNA 1C2JA 3AAVA 2PGBB 5CE1A 5GWZA 5FXLA 2CF8H 1A4WH 7LPRA 1P3EA 2PV9B 1LHFH 1SLUB 5DG6A 3UQVA 3U1JB 3KEEA 3CENA 3TGIE 4KTCA 3NXPA 1KLTA 1GI3A 4MDSA 4X6PA 1O2VA 3O8DA 2SGQE 3K6ZA 1C2HA 1K22H 1GI6A 1GJ8B 1AVWA 5C2ZA 1TPPA 1TGSZ 3SHAH 1Q2WA 3I29A 1EB2A 4IW4E 1LTOA 2GVFA 4GAWA 1Z7KA 3BEFB 1C1SA 4BAHB 4I8LA 1BTXA 3MNSA 3RU4T 1OP0A 5ETXA 3O8RA 5I46H 1BOQA 3U8TH 1AKSA 1C2GA 1UTPA 2KAIB 1GDNA 1LHDH 1YLCA 1S84A 3EA9A 4Y8ZA 4B73A 2AGEX 3VXFH 1EUFA 1ZOMA 2O9QA 3AW1A 3PYHA 1K9OE 1SQAA 3NK8A 1XUKA 1V2VT 5AHGH 2GDDA 3AAUA 2JETB 3BTTE 1L1JA 3FANA 2Q6DA 2XTTB 3MO6A 1J16A 1W12U 1TMUH 1JWTA 2CGAA 3Q3YA 5DP6A 2FIRH 2WV5A 2TIOA 1BA8B 4IN2A 1O3OA 1ZMJA 1W2KH 2OXSA 5E8EH 5JB9S 4HGCA 4B71A 1T8OA 1ZGIA 1MBMA 1O35A 1GJ6A 1N1LA 4MPWA 1ZMLA 4FUJA 4WVPE 3U9AH 1HAYB 5ABWA 1SQTA 4THNH 2A31A 3VGCB 1OWHA 2SGFE 4H42U 1P0SH 4UFGH 4WMFA 5J4SA 3PWBA 4XOJA 2ZWLH 2ZQ1A 4JMYA 1F5RA 3TIUA 1AFQC 3OU0A 4FU9A 3L33A 4Q2KA 1GBFA 2ZC9H 2OUAA 3DUXH 3UQOA 2G8TA 4U2WA 1EX3A 1C4V2 3ZVDA 5C67A 4K8BA 5B6OA 1DITH 1O2NA 3SUFA 2Z9IA 3ESTA 2J94A 1EP5A 1UK2A 2BDIA 5EPNA 3UNSA 1FDPA 1GWAA 1ELGA 1GBJA 2ODYB 5A0AE 4AN7A 4TYDA 1PQ5A 1C5ZB 4WMEA 3RXOA 3A87A 3TGKE 5EXMA 4ABEA 1V2NT 3CS7A 1PQAA 4FUDA 1F0TA 1TRYA 1D6WA 1MBQA 2J34A 1CSOE 3LC5A 1HCGA 3URCA 2BD3A 2GX4A 2ANKH 4CHAB 1SOZA 1P9UA 2F9PA 2ZDMA 4UONA 4KGAA 1ELDE 2A0QB 2VIVA 3DFLA 1CO7E 2J38A 1SGFA 1NRSH 1UTLM 2WYJA 1P2NA 4AORA 1C1RA 4X6MA 3ZZCA 3ZZ9A 1GMCG 1K1MA 4NFEA 2C8XB 2R2WU 1SPJA 2M5TA 1MU6B 5EGMA 1ETSH 1O2QA 2W5EA 3FP7E 3MH4A 2ZDLA 1SLWB 1FIWA 2W7UA 3PMHB 4B2BA 2P59A 2A5KA 1KXAA 3SNEA 2ZDNA 1HJAC 3BEIB 3SHCH 1O33A 2ZO3H 3LKWA 4DOQA 1GBHA 1W0YH 4ABHA 1LVMA 2FOFA 3C1KA 1EJAA 1FY1A 1CBWB 1LKAA 4ABJA 4TY7A 3ODFA 2TPIZ 3P95A 1V2KT 3GY8A 1BTYA 1WAYB 1XUHA 4ZHMU 3NUMA 3ATLA 1RFNA 4DG4A 3LGUA 3SI4H 3T29A 4MG3A 2ANYA 1GBDA 4LOYH 5HXFA 2XXLA 1D3TB 1FZZA 1AO5A 3SNCA 2UWLA 3QUMP 2RDLA 3TNSA 2KAIA 3SBKA 4BTIB 4K8YA 2SGAA 3LOXA 1YPEH 3BTKE 6GCHF 3CS0A 1OWKA 2FI5E 2STBE 2GT7A 3HATH 2DE8A 1J17T 4FVDA 3H7TA 3E91A 1AZZA 1DVAH 2EC9H 2OBOA 1HFDA 2VVUA 1BIOA 1BHXB 1QB9A 1AVGH 2ZGCA 1DICA 1GBIA 2VB0A 3S7KB 3R3GB 1GJBB 1NRRH 1ZPCA 2EI6A 3PMJA 1ZSLA 3GCTG 2GZ7A 4I8KA 1DFPA 2BD2A 2WPMS 2FP7B 4INKA 4MNXA 1XKBC 2QN5T 2ZCLP 1CA0B 2BDGA 1TNJA 3HGNA 1VGCC 3VPKA 2AEIH 2BZ6H 3GCOA 4JK6A 2VIQA 2SNVA 5EQSA 3ATKA 3TNTA 4O9VA 4LZ1H 1V2TT 4AG1A 3ZZ4A 2J92A 3RUOA 1NS3A 3SGAE 7GCHF 3TK9A 1GPZA 3RMNH 1CA0C 1GL1A 1P57B 2ZFFH 1C9TA 2SGDE 2GCTC 3OY6U 4BTUB 1G3DA 2ZA5A 4ABAA 4JZIA 2IN2A 1ZTJA 5GIBA 3RXSA 4F4OC 1ELBA 3SW2B 1QB6A 1QHRB 1L0ZA 3M5OA 2FS8A 2NWNA 3STJA 4KTSA 3SNAA 5F03A 3SGBE 1A0LA 1BBRE 3GY2A 5HMAA 1TA2A 3RMOH 3SZNA 1S6FA 1TBRH 1V2ST 4Y0YE 1OWEA 6LPRA 1O0DH 1AB9B 3RXPA 5FX5A 1OX1A 2D26C 1ZRBA 1ESTA 1QTFA 3F9GA 6CHAB 1YPHC 3VB6A 3L3TA 1HUTH 1UJ1A 1ZTLA 1QBNA 1O3CA 2BM2A 3FP6E 1J14A 1NESE 1K1JA 4GHQA 2PKSB 1N8OB 1PPHE 5GJ4B 3SV8A 3S7HB 1C5MD 2PW8H 3RXAA 1KDQB 2HNTF 3URDA 1GBBA 5FX6A 2ULLA 1DT2A 1TGCA 1HGTH 1BRUP 1FY8E 1UHBB 1WSSH 3L6PA 3DFJA 2JKHA 3TJNA 5A8ZA 2IJOB 1C5LH 3A7WA 2BDBA 2R0LA 3ZZDA 1OS8A 2BY8X 1VCWA 3S0NA 3PTNA 1ANBA 1O3HA 2P3UB 2WYGA 4A6LA 3T27A 2F91A 1QIXB 3SU0A 1MAXA 3P8NA 1KYNA 2YOLA 3MNCA 2ZFRH 5DK1A 4U32A 2VVCA 1O5BB 2A4RA 1MKWK 1SFIA 2BZAA 2SFAA 3LH3A 1ORFA 2HLCA 1P06A 1GJCB 3AASA 1FNIA 2TRMA 2PSXA 1GJ4H 2Y6TA 4CRGA 1C5YB 3RC5A 2EA3A 1EAIA 2BY9X 1YGCH 4DGJA 2P94A 5A8YA 4B1TA 2K1QA 4BANB 3Q76A 1GCTB 3HGPA 4DVAU 1O2JA 1LVYA 3SUEA 2F83A 1GHYH 1L1GA 1OKXA 3BG8A 1EJNA 4GSOA 1O3KA 7KMEH 3VEQB 1IQKA 3S9CA 1A7SA 1GDQA 2PUXB 3GDSA 4LXBH 1UVTH 1WTHD 1LPGB 3MHWU 3SU3A 1MKWH 3V0XA 4UFEH 1GL0E 1BQYA 1S83A 2PGQB 1YCPM 2BMGB 1W7GH 1T8MA 1DLKB 1EAXA 3MNBA 1C1WH 2GP9B 5DP4A 3PO1B 2EI7A 1A61H 1EOJA 3B9FH 2ZF0H 1AWFH 4K69A 5CHAC 2D8WA 5T6GA 3T5FH 3GYLB 2I6SA 1BMNH 3RXRA 4ZMAH 1A0JA 1O2WA 4ZAEA 1ZYOA 5TCAA 1B5GH 2ZHWH 1TBQH 2OD3B 4YLUA 1YF4A 2ESTE 4H6TA 2J95A 1Y3WA 3P8OA 2I6QA 1P02A 1H1BA 3GY4A 2UUJB 4AG2A 3U98H 1MUEB 1QBOA 1GI8B 2C8ZB 7ESTE 1O31A 4AGJA 1EAWA 5FCRA 5FPTA 1O3JA 2ZU5A 3KCGH 1NPMA 1TGTA 3TK6A 1F92A 5A0BA 5EU8A 3A7XA 2VWMA 1INCA 1E34B 1HJ9A 2FI4E 1GG6B 3RXLA 4CRDA 1A3EH 1A5IA 1ELFA 2A1DB 2BQWB 2GMTC 3NKKA 4BNRA 4MPUA 4AGKA 2HNTC 1HBTH 3P8GA 3SU5A 2BD8A 4KELA 2ZG0H 2NU1E 1DSTA 1O34A 1V2LT 2ZTXA 1MH0A 2CV3A 1TOMH 3TLOA 1BRBE 1ELAA 4CRFA 1TQ0B 1TABE 5HM2A 1QB1A 1ZHMA 3ZV8A 1TNKA 1VITF 5A2MH 1TB6H 1BB0B 1O3BA 1MZDA 1QY6A 2FDAA 1CT2E 2QC2A 3DT0H 1SR5C 1BDAA 1BJVA 1TQ7B 2AERH 3BTQE 5C1UA 5IDKA 3R0FA 3UWJH 2ZTZA 1AIXH 1GI9B 1GGDC 2HRVA 1HPGA 1P09A 1W7XH 2O8UA 3MI4A 1BTZA 4VGCB 2AGIX 1NU9A 1TGNA 2GZ9A 4E05H 1W8BH 2ZDVH 1EKBB 2ZZUH 5DPAA 3UUZA 2HNTE 2AH4X 3PLPA 2RA0A 3QX5H 1KXFA 1ZPZA 1KDQA 1C5OH 4I33A 3OX7U 3IWMA 1RTLA 2O8MA 4JZ1A 1CHOF 2FTLE 5FPYA 4K1TA 2B8OH 2WUBA 1LHCH 4Y8YA 3SU4A 2BHGA 1CVWH 3HKIB 1GHZA 2J4IA 1RTKA 3F1SB 1FV9A 1GI1A 3A8BA 3TJOA 1NFXA 3KF2A 3SJOA 1S81A 1O5DH 3SUDA 2FOGA 1PQ7A 1P2MA 3TPIZ 3SV6A 4LZ4B 4UEHH 1MTWA 5FAHA 1P11E 2Z94A 5E0GA 2FMJA 1E0FD 2V3OH 1FAXA 1BMAA 1ZJKA 3UTUH 1FN8A 1QURH 1O2LA 1KLIH 1T8LA 2C8YB 2G5VA 3RXFA 2AMQA 1ETTH 1O38A 2HALA 2A7HA 4X1QU 3S9AA 1TAWA 4IGDA 2FWWA 5C5OA 1FY3A 1K1NA 2NU3E 1JMOH 1Y5AT 5I25A 1GBLA 1CGHA 3QWCH 4DY7B 6GCHG 1NN6A 1AN1E 2AMDA 3ZZAA 4CRAA 1Y5UT 3ENSB 3MFJA 2F9OA 4IN1A 2WUCA 3TGJE 5ESTE 3NCLA 1RXPA 5LPRA 2PFEA 1A5HA 4HZHA 1TALA 1TMTH 1KTSB 1VR1H 1LQDB 3RXEA 1FIZA 1SGQE 1V2MT 4RSPA 4O3TA 2GV6A 3SJ9A 2BOHB 3MTYA 5A0CA 1AE8H 1IQIA 2VGCB 2BX4A 4KTUA 1UVUH 1FMGA 2BLOA 1JOUB 4WH6A 3UFAA 3ZZBA 2QXJA 1C1PA 1GJ9B 4I31A 1MAYA 2OQ5A 4H6SB 1HAHH 2H1UA 4NZLA 1NTPA 3B8JA 1ARCA 1P2KA 3LGYA 2ZFSA 3ODDA 1UCYE 2GT8A 2BLQA 3MO3A 7GCHG 4X2XA 3F9EA 1VITH 1ARBA 3EGKH 2JETC 1P01A 1BTHH 1YM0A 3FP8E 3U69H 1ABJH 4NIWA 1RIWB 4YTAA 1UVPA 1TX7A 4GLYA 3IG6B 4XBDA 1O5CB 5JDUB 1O3IA 3I77A 1XUJA 3GY5A 1HAIH 1XUFA 4ZHAA 3A7TA 2WPLS 1P10A 1EB1H 1V3XA 3V3MA 3Q3XA 2IPHA 2V35A 1LVBA 5J4QA 1BMLA 3PB1E 2VH0A 1AE5A 1SGYE 1TPSA 3I78A 1Z6JH 1QQUA 3P17H 3VGCC 4Y8XA 2A7CA 4E7NA 1SB1H 1BUIA 2HWLB 5JB8S 3BIVH 3MO9A 2QCYA 1C5NH 1Y3YA 5EQQA 4AZ2B 3P92A 1EP6A 4A1VA 1F5LA 2ZECA 1PYTD 3RC4A 1O2MA 2C93B 3A8DA 4SGBE 1DPOA 1D3PB 1EPTB 1OWIA 2Y7XA 2C8WB 5JYIA 3E1XB 3MNXA 1GI4A 3SU2A 5L2ZH 1BHXF 1DXPA 4INLA 1L1NA 3LC3A 2XWAA 4DIHH 3P6ZB 4UE7H 4ZXYH 1O2XA 2Z6BD 2B5TB 4FVBA 4Q7YA 1SHYA 1IQHA 4UFDH 3SV2H 2QXGA 2VVVA 1CGJE 5TJXA 4YOJA 5HYOA 3BTDE 4F49A 3QZRA 1QRZA 4Q7ZA 2EEKA 2TGTA 3K65B 2BD9A 4GHTA 4X6OA 4GVUA 4FUFA 2OINA 5PTPA 1C5VA 1MU8B 2CMYA 1QCPA 1NROH 1O3EA 4SGAE 2Z9KA 4PROA 1UVSH 2FI3E 1HAVA 2FZZA 1F2SE 4CHAC 1YC0A 1TRMA 5DP7A 3LT3A 1MTVA 3BTWE 3F6UH 5DP3A 1DWCH 5DGJA 3DD2H 3E8LA 1PPBH 1TBZH 1TYNA 1GJ5H 3LGIA 2ZIQH 1G2MA 3M7TA 4ISNA 1DDJA 1F5KU 2FYRA 2GTBA 2VU8E 2ZGJA 3K2UA 3U1IB 1T4VH 2AMPA 2ALVA 2HPPH 1ZR0A 4RKJB 3UR9A 3MYWA 1OP2A 1MQ5A 3G01A 4R0IA 1JRTA 2FOHA 3PLKA 1H8IH 1OPHB 3VB4A 2A2XH 2VINA 3N7OA 1Q3XA 4ABGA 3TVJB 5EG4A 1HXEH 1SHHB 1GJ7B 3SV9A 1AQ7A 3E90B 1NU7B 1AWHB 1FN6A 1O3MA 4X2WA 1G3EA 2ZU1A 2TBSA 3ELAH 4A1TA 1OYQA 1ELVA 3DA9B 1CBWC 2XCNA 1C4Y2 1Z8RA 4FUHA 2THFB 1O39A 1Z1IA 1GJAB 2Y82A 4FU7A 1SGFG 3F9HA 1BJUA 3LH1A 2GZ8A 1GHWH 2RA3A 1NFWA 1SQOA 2QXIA 1C5WB
chains in the Genus database with same CATH superfamily
3FZDA 1NFUA 1K28D 1UK3A 1QJ6B 3ATMA 3KQDA 4K1EA 3MH6A 1K1PA 1BBRK 1MD8A 2ZPQA 1A3BH 3OY5U 1UTMA 1KSNA 4B6FA 3BIUH 4X0WU 3A84A 2O8WA 1O2KA 2PSYA 5LPFA 2R3YA 5F8TA 4QT8C 2B7DH 1AUJA 4O3UA 3LIWA 2BVRH 2KCPA 3SJKA 3PWCA 2SNWA 4ISLA 5LPEA 3A7ZA 4E06H 2OC1A 2W3IA 1FPCH 1OWJA 1O2IA 4FUIA 1O5FH 1IQLA 1BTUA 1LPZB 1Y3XA 1VCPA 3TU7H 3VB5A 3BG4B 3VFEA 3SGQE 3M3VA 1RRKA 5F8ZA 1BZXE 4NSYA 2C4FH 3OE7D 3PLBA 9ESTA 1BBRH 1OXGA 4BAMB 1B0EA 3T2NA 4B76A 1SL3A 2OBQA 3RP2A 1RGQA 1EXFA 4MNYA 1NBMD 2XOKD 5DO4H 2A2QH 2ZFTA 2LELA 3KHVA 1LVOA 4MPXA 5HGGA 1VITG 5JBTA 1C1VH 1CA8B 3AVZA 1F7ZA 1OP8A 1C2FA 4XDEA 3LGWA 1P2OA 2F4LA 1C1OA 4YOIA 4NGAH 2F3CE 1DS2E 1GHBF 3LDXH 2QV1A 2P95A 1EPTA 1RTFB 2OCVB 4NSVA 2SGPE 2ZQ2A 2BXTH 2OTVA 4NWKA 1VJ9U 1RS0A 2FLBH 4X1RU 4NA8A 1UMAH 1V2RT 2XBYA 2ZCKP 5F53A 1TMBH 1V2OT 1Y8TA 2P3FH 1KXEA 6ESTA 3O8CA 2EI8A 1DLEA 2Y5HA 5L6NH 2WV4A 3M5LA 3O8BA 1CHOG 5FHTA 1PQ8A 2BDAA 2BVSH 4U30A 4NA7A 1D6RA 1P8VC 1NO9H 1GI0A 1C5PA 3P70B 4DCDA 2FOAA 4ISOA 1O2TA 5FBIA 2V6NA 2OC7A 1HDTH 1HAGE 1XX9A 1UVOA 1XM1A 2G51A 2WPHS 1D3QB 1AB9C 2R2MB 1PPZA 1MD7A 1ZPBA 1HYLA 5E0JA 6CHAC 3SO3A 3Q3KA 3GS9A 3NPSA 2Y5GA 1O2ZA 2QF5A 1YPKH 1O2PA 2PKSC 4NFFA 4I8JA 1N8OC 3SN8A 5LH8A 1JIMA 1THPB 5G4BA 1ZRKA 2W6ID 1EJMA 1O3AA 1UTKA 2CHAB 2BOKA 3FVFB 3VG8A 1KY9A 3WY8A 5E2OA 3FN8A 2GKVE 4ABBA 3VB3A 1YCPK 2BDHA 2HPQH 1EZXC 3AW0A 1W0KD 4FETA 1U6QA 4CBNA 5LGOA 1TLDA 2O8LA 4CH2B 4CREA 1KIGH 4JYUH 1BCUH 1ZSKA 1S85A 1AY6H 3DCLA 1GMHF 2TGPZ 4BAKB 2CHAC 3RXQA 4YLQH 1EAUA 1WOFA 2A4OA 1QFKH 1C5QA 2FOBA 5JBAS 1TIOA 2H9TH 3TH4H 2XC0A 2QF4A 2ZPRA 4ZKSU 4DW2U 2WINI 1TNIA 2BD5A 1G3CA 4IMZA 3A8CA 3LJJA 1GBKA 2G4UA 8GCHF 5EPYA 1C5UA 2SGEE 3A85A 2F9UA 1FI8A 1C9PA 1P03A 3W1EA 2A7JA 2ZGHA 2NU2E 1AVXA 5EJ1A 1GCTC 1YCPH 3KYFA 2F9NA 1MTSA 5AFZH 2ZTYA 2CF9H 4JZEH 2WPIS 3GCHB 1Z8GA 1T32A 1YLNA 2LP6A 2GCHF 1S0RA 2FOMB 4MQAA 2QY0B 1TRNA 4AYVB 4FUBA 1YP9A 1DE7H 1GHVH 3ZVAA 5GPIB 3UOUA 1FUJA 2VWLA 1PYTC 4AFSA 1MCTA 9LPRA 4X8SH 2CXVA 2AS9A 3D49H 1D4PB 3RXJA 1BITA 3PO1C 2IOTA 2ALPA 1FPHH 2P8OB 3ATIA 1NM6A 1MTNB 2AHME 1OOKB 4A92A 1HAOH 2OP9A 2PKAB 8KME2 3M37A 1K1IA 1NT1A 1XKAC 3A88A 5CHBA 4BXSA 3A81A 3MU1A 1P9SA 1FJSA 2Z7FE 3M7UA 2OC8A 3MU0A 5EODA 5ESBA 2XCFA 1EZQA 1TNGA 1Z1JA 1SGCA 1IQJA 1T8NA 1ZSJA 4GCHF 1YPMH 1P2QA 3QN7A 2Y7ZA 4CRBA 1HAXB 3SJ8A 1O30A 1O2YA 3VXEH 1C5XB 3EAJA 1D3DB 1J15A 1GCDA 3UOPA 1HAPH 1ZMNA 4FU8A 5JBBS 4TWWA 3UB0A 3PV4A 1Y5BT 1YKTA 1W11U 2OQUA 2KCYA 1B0FA 1YBWA 2A32A 2H9HA 2FYQA 1LMWB 3P8FA 1GG6C 1LCYA 1SGIB 4K5ZA 4Y0ZE 1VKYA 1HLTH 3RXKA 2JIZD 3EQ0H 2G4TA 1DX5M 3OAAD 2OC0A 4ESTE 2BX3A 1T7CA 1SQRA 2VNTA 4KKDA 1TGBA 3HK3B 3HK6B 1J9CH 4DT7B 2XC4A 1BMFD 4BAQB 1FX0B 1G37A 4B2AA 4Z1MD 1NZQH 3M7QA 4Y10E 1E37B 1A0HB 1OSSA 3OTPA 2J97A 4IBLH 1GMDF 1SC8U 2XBXA 1CU1A 4TY6A 4D9QA 3TITA 1KXBA 4MNVA 1L2EA 1XVMA 1LPKB 4I7YH 1G32B 4AFUA 4CRCA 3H5CB 2ZU3A 3M3SA 2FX4A 4VGCC 1ESBA 2Z9JA 3ZVGA 1EZSC 1QRWA 4NA9H 3T26A 3QGNB 1TFXA 1C2MA 2KR7A 4ZXXH 3ZZ8A 3U8OH 4A5TS 5DJ7A 2WPJS 1HAVB 2ODPA 2QGRA 1NRNH 3GY3A 2W3KA 3PTBA 4XFQA 3EYDA 3KGPA 2V0BA 3F68H 3RDZA 3A7YA 1C2EA 2VIDA 2FODA 4ZHLU 1Z8JB 3A89A 4ZROA 5C20A 5C17A 1AD8H 3ZVCA 1TPAE 3KYGA 5HIZA 1QL7A 1SG8B 2XBWA 1GBTA 1W3CA 2W26A 1LQEA 4WXVA 1ANDA 1SLVB 5GCHF 3RXMA 1UCYK 4RI0A 1GI7B 4Y11E 3QZQA 2BD7A 1AZ8A 1NRQH 2H2ZA 3F2HA 1QR3E 1YWUA 2GD4B 2R9PA 3A86A 3MOCA 2KCAA 2VWNA 4DURA 1BMMH 3JZ2B 3LGVA 4OS1A 5L2YH 1QQ4A 2BD4A 3RLYH 3SYJA 3D62A 1HIAB 2ZPSA 4MPVA 4E7RG 3OEHD 2JH6D 1GVKB 4WMDA 3RXGA 1GHAF 1K0HA 1QBVH 2A4GA 1THSH 1ELEE 1IHSH 2ZI2H 3VB7A 3MU4A 2QF0A 2P3TB 3V12A 1CGIE 1TA6A 1W14U 4P00A 2PHBA 2B9LA 1A1RA 2GV7A 2ANMH 2Q6FA 3RU4E 1S82A 2JH0D 1UCYH 2PTNA 2UWOA 1TWXB 2C90B 4X1SU 1IQGA 8LPRA 5C0UA 4LK4A 4WY3A 5T6DA 2FM2A 1CQQA 2J9NA 2QF3A 1SVPA 1JXPA 4NG9H 3STIA 1JBUH 1BT7A 3MH5A 2HVYB 1MKXK 4K2YA 4NCYA 1W13U 4AB9A 3D65E 4Q80A 3EA7A 3RC6A 4HG6A 4IS5A 2BY7X 1GBAA 2KZ4A 2PKAA 1GBMA 2FOCA 2W6JD 2Z9LA 5AVDA 4AC9A 3RXUA 5DSFA 3RXTA 4ZKRU 2WV9A 4X1PU 1NRPH 4X2VA 3ZYEA 3OSYA 2VGCC 3RXVA 1HXFH 1DWEH 4Z0KA 4YZUA 2XWBI 1IQEA 3BTFE 5C1XA 1AFQB 4FUGA 5T6FA 3KQEA 3SU1A 2PTCE 1CE5A 2G81E 1T31A 3QK1A 3F2GA 4ZUHA 2TGAA 5AFYH 1EQ9A 1YPJH 3LPRA 5E0HA 3EE0B 1GHBG 1GI5A 4AX9H 1B7XB 1ACBE 1MKXH 2O8TA 3A7VA 4I32A 1G2LA 1DWDH 2CN0H 2Z3DA 2FESH 3KL6A 4HTCH 4XBBA 2BY6X 2K0QA 1RIWC 1GBEA 3KN2A 1P05A 4WWYA 3V7TA 3OTJE 1IQNA 1K1OA 2Z3CA 3PROA 5DP9A 3BTGE 1WV7H 3LONA 4I8HA 1RD3B 3QTOH 3N7DA 4OS5A 4WF8A 4XE4A 5FCKA 1O3NA 2FLRH 1WDIA 4YT6H 4FXGH 3EE7A 1V2QT 5F6MA 2ZP0H 2XC5A 4M7GA 3SI3H 3BF6H 1EATA 3H7OA 3MH7A 4B2CA 1PPFE 1E36B 2L74A 4AFZA 1C5SA 3M5NA 4TWYA 1C2KA 1NFYA 2PLXA 1DUEA 4FUEA 2ASUB 1EPTC 1Z71A 3ATWA 3NWUA 5FL7D 2UUFB 2ZHFH 2XNDD 1WYKA 2ZDAH 5FPSA 1BRAA 3HKJB 1LKBA 5EOKA 1ZHRA 1S5SA 1A46H 4Y71A 4R8TB 1KTTB 1FLEE 5F8XA 1DXWA 3F2FA 4FOUC 1AU8A 1E38B 4Q7XA 4D76A 3ZV9A 3D23A 1QA7A 2Y5FA 1HJAB 1SLXB 2Y81A 1AI8H 3UWIA 1P2JA 1QGFA 1SGNE 4KP0A 4MNWA 1H4WA 3ZZ7A 1W0JD 2FX6A 3UREA 1ETRH 2XW9A 1AGJA 1SFQB 1K21H 1GMHG 2FPZA 4WXIA 1LHEH 4GUXA 3ZVBA 1P04A 2H9EH 4HFPB 4CBOA 1TX8A 2WPKS 4BOHA 3M3TA 2VIPA 4CR9A 1ZTKA 3BSQA 2PUQH 1V2JT 1C1MA 1GVZA 1F0SA 3SU6A 1G36A 5BPEA 4JYVH 1WTGH 5GXPA 1QL9A 2XRCA 1UTOA 1ABIH 3T25A 5SGAE 3QTVH 3S9BA 1HIAA 1DY9A 4JZFH 4MLFB 4X2YA 8GCHG 1H9LB 2AYWA 1NC6A 3K9XB 3PMBB 3A80A 1PPGE 3RLWH 4RKOB 2PWXA 3MWIU 4YESB 1C5RA 1M9UA 1H9IE 1O36A 3GISB 1N6YA 1G3BA 3W95A 1JIRA 2A4QA 3TJVA 1C1UH 4J1YA 2GCHG 1ZGVA 1C2IA 2P16A 1SGDE 4X8UH 3LGTA 3TH3H 4DJZB 1QL8A 1WCZA 3LU9B 1O2SA 3RMMH 1FY5A 1O3PB 3F0PA 1O2RA 3E6PH 1JRSA 1BRCE 2VIOA 5HM9A 1Z8IB 2FS9A 2W7SA 4K3JA 1GBCA 2A5AA 3RU4D 1QNJA 3ZYDA 2NU4E 3GICB 2JDID 1ELCA 4X8TH 1WU1A 1IQFA 3GDVA 2ZDKA 2P93A 3B23B 4Y7BA 1HNEE 3QGJA 1QA0A 1VGCB 4JYTA 1H8HD 1IAUA 4B74A 2V3HH 3MQKC 1ANCA 5FBEA 4YM9A 1XVOA 1K2I1 1H9HE 1YLDA 4J2YB 4OS6A 2F9BH 4UD9H 1ANEA 4Y76A 4ZKNU 3UIRA 4ASHA 4WH8A 1C5TA 1BTPA 1H8ED 4GCHG 1C1TA 4XBCA 1F0UA 1XXFA 8ESTE 1UK4A 4Z6AH 5C3NA 2FOEA 4DIIH 2GDEH 1GVLA 5JBCS 4OS2A 2ZFQH 2G00A 4INHA 2ZEBA 2R3UA 2GCTB 4D7FA 1DOJA 3FFGA 4JCNA 3M61U 3RXBA 1DM4B 4XSKU 1O37A 5E2PA 3WWFA 1L4DA 1FONA 1TONA 1YPGH 3GDUA 4M9FA 2BTCE 4HI3A 1W10U 1AFEH 4NIXA 2HGTH 2HLDD 3BG4C 2RG3A 1MQ6A 1WQVH 3Q00A 3ZZ3A 4RN6A 5DP5A 3EA8A 2ODQA 3TH2H 1S6HA 1GJDB 3BV9B 2V3MA 1TNHA 3RM0H 1O3GA 1QJ7B 1J8AA 3GOVB 5GDSH 3SV7A 3LJOA 3PM3A 2YNBA 1SGEE 2BLVA 2BB4A 1AHTH 1H8DH 2B0FA 1SI5H 1UTNA 1IHTH 4YOGA 3MU5A 1V2WT 1GMDG 1YPLH 3M35A 1DUAA 1XMNB 2XNIA 1SOTA 4MTBA 1DWBH 1ZHPA 3K6YA 1Y3UA 1PFXC 1K1LA 1LDTT 1KXCA 1UO6A 3QDZB 5B6LA 1T4UH 4A1XA 3E0PB 3SQEE 1O2HA 1QJ1B 2DUCA 3SUGA 1DY8A 4JZDH 1AMHA 4Y7AA 1F0RA 1ELTA 4ABFA 4O97A 1TNLA 1FQ3A 1TOCB 2ZFPH 4YT7H 1Z6EA 1P2IA 1G30B 1EOLA 3TJUA 2BQ6B 3GYMA 1QZ8A 1FY4A 3PV2A 1LO6A 4B75A 1P12E 1IOEA 1GI2A 3NZIA 2DE9A 1GHXH 1PJPA 5EJLA 3SOSA 2G55A 2QXHA 4NIYA 2JH5D 1L4ZA 1SMFE 4ABIA 1OYTH 3BN9A 4OGYA 5GCHG 1E35B 1KLJH 4WJG2 2XBVA 3GY6A 2YNAA 2HVXA 2AGGX 5EQRA 3GY7A 2BXUH 2UWPA 1O32A 1Y59T 2ZU4A 1S0QA 1KXDA 1PPCE 1ESAA 1GMCF 1DSUA 1C1QA 3UNRA 2HOBA 2ZHDA 4TPIZ 4A7IB 2Z3EA 5TCCA 3UPEA 2H5DA 2Y80A 1HV7A 4NZQA 2G52A 1TPOA 2ZCHP 5IK2D 4X8VH 1YPHE 1N6XA 4D7GA 2AIQA 3HPTB 1GHAG 1AUTC 1OWDA 2ZHQH 5AF9H 5EW2H 4AB8A 2BYAX 4FUCA 1O5GH 2ZKSA 3QLPH 1LHGH 1ZLRA 4K1SA 1YY3A 1C2LA 1SGRE 3FZZA 3ZVEA 3E0NB 3F3BA 1O5EH 2A45B 1VJAU 3DSPA 1MCVA 3U8RH 3T28A 4NWLA 2TGDA 4OS4A 1A2CH 3IITA 4RT0A 2QYIA 4BAOB 1VZQH 4AOQA 2Q6GA 3ZZ6A 2QIQA 4ZH8A 2ZHEH 2JJ1D 3BTME 2AFQB 2WPDD 2CJIA 1RJXB 5CHAB 5DP8A 3QO6A 4GPGA 1MMJN 3KQCA 3RMLH 5C0TA 1DANH 5A09A 2VIWA 2ZNKH 4CR5A 1NY22 2L6OA 2VJ1A 1Y3VA 4Q4LA 3S69A 3V13A 3ZZ5A 4D8NA 5C94A 1W0ZU 3UY9A 5EW1H 1AKSB 2LNCA 3UR6A 1SBWA 3GCNA 3DSGA 1UTJA 4U01A 2BDYA 3ITIA 4H4FA 2WSSD 3RXIA 4DT4A 5K7RA 3F0OA 1X7AC 2BVXH 1P3CA 3GCHC 3RXCA 4IC5A 3SNDA 1TE0A 1YYY1 4YO9A 1A5GH 3RXDA 3A8AA 1HAZB 4IMQA 5T1VA 5CMXH 4CH8B 4OGXA 4Y79A 4TPYA 2ILNA 5H4IB 4BTTB 1TX6A 3ZVFA 3KQBA 3MMGA 1C1NA 2GMTB 1BTWA 2QA9E 1SGPE 2BLWA 1V6DA 3UNQA 1WBGB 3JZ1B 1MZAA 2P8OC 3GCTF 2NU0E 1MTNC 4D9RA 4OS7A 5C5NA 5BRRE 3E16B 3E3TA 2RCEA 4IC6A 2VH6A 3RXHA 3KIDU 1C2DA 1WQSA 5IYTA 2STAE 4ABDA 5C1YA 2ANWA 4ISHH 3BTEE 3TK5A 5JPMH 3EDXB 2ZGXH 2H6MA 1WUNH 3C27B 4K60A 4O03A 1XUGA 3A83A 3N99A 2XYAA 1GGDB 5EJZA 4UFFH 2BQ7B 1CHGA 4JK5A 3M5MA 2ZU2A 2BDCA 4AYYB 1EASA 2QAAA 4ISIH 3MU8A 2LPRA 4X6NA 3KNXA 1XXDA 2IPQX 5K0HA 1QRXA 3BTHE 4MVNA 3F9FA 3SQHE 3PMAB 2ZGBH 2AIPA 2FO9A 3OYPA 2D2DA 2OLGA 1HRTH 5T3HA 1Q31A 1E79D 1SGTA 1CT0E 1GDUA 2D1JA 4AFQA 2GGVB 4I8GA 1XUIA 1ZJDA 3SJIA 3DHKH 3PRBA 1HB0B 1O3LA 3CP7A 3SNBA 1THRH 1D9IA 1SSXA 2A5IA 2J5UA 2Q1JA 5EXLA 3W94A 1PPEE 1O2UA 2Z9GA 5L30H 1G9IE 1CT4E 1FAKH 2FTMA 2VWOA 3FAOA 5A8XA 1O2OA 1FXYA 1HJ8A 1UTQA 4UDWH 2H5CA 2FEQH 3T62A 1V2PT 1O5AB 2UUYA 3H09A 2FXRA 1V2UT 4ZKOU 4X1NU 1UHBA 1IQMA 3M36A 1EZUC 3A82A 1C4U2 5DKMA 1ID5H 3WW7A 1ZZZA 3ZIAD 2F9VA 3RM2H 3BEUA 1VCQA 2UUKB 4NIVA 2R0KA 4Y6DA 1O2GH 2BY5X 1O3FA 2G5NA 2J2UA 1O3DA 3Q77A 2PR3A 4BXWA 2C3SA 3SORA 1MTUA 5EXNA 1C2JA 3AAVA 2PGBB 5CE1A 5GWZA 5FXLA 2CF8H 1A4WH 7LPRA 1P3EA 2PV9B 1LHFH 1SLUB 5DG6A 3UQVA 3U1JB 3KEEA 3CENA 3TGIE 4KTCA 3NXPA 1KLTA 1GI3A 4MDSA 4X6PA 1O2VA 3O8DA 2SGQE 3K6ZA 1C2HA 1K22H 1GI6A 1GJ8B 1AVWA 5C2ZA 1TPPA 1TGSZ 2YMSB 3SHAH 2RFKC 1Q2WA 3I29A 3UAIC 1EB2A 4IW4E 1LTOA 2GVFA 4GAWA 1Z7KA 3BEFB 1C1SA 4BAHB 2WZQA 4I8LA 1BTXA 3MNSA 3RU4T 1OP0A 5ETXA 3O8RA 5I46H 1BOQA 3U8TH 1AKSA 1C2GA 1MABB 1UTPA 2KAIB 1GDNA 1LHDH 1YLCA 1S84A 3EA9A 4Y8ZA 4B73A 2AGEX 3VXFH 1EUFA 1ZOMA 2O9QA 2GJGA 3AW1A 3PYHA 1K9OE 1SQAA 2F43B 3NK8A 1XUKA 1V2VT 5AHGH 2GDDA 3AAUA 2JETB 3BTTE 1L1JA 3FANA 2Q6DA 2XTTB 3MO6A 1J16A 1W12U 1TMUH 1JWTA 2CGAA 3Q3YA 5DP6A 2FIRH 2WV5A 2TIOA 1BA8B 4IN2A 1O3OA 1ZMJA 1W2KH 2OXSA 5E8EH 5JB9S 4HGCA 4B71A 1T8OA 1ZGIA 1MBMA 2CK3D 1GJ6A 1O35A 1N1LA 4MPWA 1ZMLA 4FUJA 4WVPE 3U9AH 1HAYB 5ABWA 1UW7A 1SQTA 4THNH 2A31A 3VGCB 1OWHA 2SGFE 4H42U 1P0SH 4UFGH 4WMFA 5J4SA 2V7QD 3PWBA 4F55A 4XOJA 2ZWLH 2ZQ1A 4JMYA 1F5RA 3TIUA 1AFQC 3OU0A 1WXRA 4FU9A 3L33A 2EY4C 4Q2KA 4XRNA 1GBFA 2ZC9H 2OUAA 3DUXH 3UQOA 2G8TA 4U2WA 1EX3A 1C4V2 3ZVDA 5C67A 4K8BA 3U28C 1DITH 1O2NA 5B6OA 3N7EA 3SUFA 2Z9IA 3ESTA 2J94A 1EP5A 1UK2A 2BDIA 5EPNA 3UNSA 3NRLA 2IJD1 1FDPA 1GWAA 1ELGA 1GBJA 2ODYB 5A0AE 3AK5A 4AN7A 4TYDA 1PQ5A 1C5ZB 4WMEA 3RXOA 3A87A 3TGKE 5EXMA 4ABEA 1V2NT 3CS7A 1PQAA 4FUDA 1F0TA 1TRYA 1D6WA 1MBQA 2J34A 1CSOE 3LC5A 1HCGA 3URCA 2BD3A 3WWBA 2GX4A 2ANKH 4CHAB 1SOZA 3OFND 1P9UA 2F9PA 2ZDMA 4UONA 4KGAA 1ELDE 2A0QB 2VIVA 3DFLA 1CO7E 2J38A 1SGFA 1NRSH 1UTLM 2WYJA 1P2NA 5KEDA 4AORA 1C1RA 4X6MA 3ZZCA 3ZZ9A 1GMCG 1K1MA 4NFEA 2C8XB 5DN6D 2R2WU 1SPJA 2M5TA 1MU6B 5EGMA 1ETSH 1O2QA 2W5EA 3FP7E 3MH4A 2ZDLA 1SLWB 1FIWA 2W7UA 3PMHB 4B2BA 2P59A 2A5KA 1KXAA 3SNEA 2ZDNA 4Q63A 1HJAC 3BEIB 3SHCH 1O33A 2ZO3H 3LKWA 4DOQA 1GBHA 1W0YH 4ABHA 1LVMA 2FOFA 3C1KA 1EJAA 1FY1A 1CBWB 1LKAA 4ABJA 4TY7A 3ODFA 2TPIZ 3P95A 1V2KT 3GY8A 1BTYA 1WAYB 1XUHA 3DSOA 4ZHMU 3NUMA 3ATLA 1RFNA 4DG4A 3LGUA 3SI4H 3T29A 4MG3A 2ANYA 5KGOA 1GBDA 4LOYH 5HXFA 2XXLA 1D3TB 1FZZA 1AO5A 3SNCA 2UWLA 3QUMP 2RDLA 3TNSA 2KAIA 3SBKA 4BTIB 4K8YA 2SGAA 1OHHD 3LOXA 1YPEH 3BTKE 6GCHF 3CS0A 1OWKA 2FI5E 2STBE 2GT7A 3HATH 2DE8A 1J17T 4FVDA 3H7TA 3E91A 1AZZA 1DVAH 2EC9H 2OBOA 2QE7D 3SZEA 1HFDA 2VVUA 1BIOA 1BHXB 1QB9A 1AVGH 2ZGCA 1DICA 1GBIA 2VB0A 3S7KB 3R3GB 1GJBB 1NRRH 1ZPCA 2EI6A 3PMJA 1ZSLA 3GCTG 2GZ7A 4I8KA 1DFPA 2BD2A 2WPMS 2FP7B 4INKA 4MNXA 1XKBC 2QN5T 2ZCLP 1CA0B 2BDGA 1TNJA 3HGNA 1VGCC 3VPKA 2AEIH 2BZ6H 2M2AA 3GCOA 4JK6A 2VIQA 2SNVA 2KCOA 5EQSA 3ATKA 3TNTA 4O9VA 4LZ1H 1V2TT 4AG1A 3ZZ4A 2J92A 1S6LA 3RUOA 1NS3A 3SGAE 7GCHF 3TK9A 2YMSD 1GPZA 3RMNH 1CA0C 1GL1A 1P57B 2ZFFH 1C9TA 2K8IA 2SGDE 2GCTC 3OY6U 4BTUB 1G3DA 3FO8D 2ZA5A 4ABAA 4JZIA 2IN2A 1ZTJA 5GIBA 3RXSA 4F4OC 1ELBA 3SW2B 1QB6A 1QHRB 1L0ZA 3M5OA 2FS8A 2NWNA 3STJA 3FKSD 4KTSA 5EIYA 3SNAA 5F03A 3SGBE 1A0LA 1BBRE 3GY2A 5HMAA 1TA2A 3RMOH 3SZNA 1S6FA 1TBRH 1V2ST 4Y0YE 1OWEA 6LPRA 5GNDA 1O0DH 1AB9B 3RXPA 5FX5A 1OX1A 2D26C 1ZRBA 1ESTA 1QTFA 3F9GA 6CHAB 1YPHC 3VB6A 3L3TA 1HUTH 1UJ1A 1ZTLA 1QBNA 1O3CA 2WHXA 2BM2A 3FP6E 1J14A 1NESE 1K1JA 4GHQA 2PKSB 1N8OB 1PPHE 5GJ4B 3SV8A 3S7HB 3CNRA 1C5MD 2PW8H 3RXAA 1KDQB 2HNTF 3URDA 1GBBA 5FX6A 2ULLA 4ACAA 1DT2A 1TGCA 1HGTH 1BRUP 1FY8E 1UHBB 1WSSH 3L6PA 3DFJA 2JKHA 3TJNA 5A8ZA 2IJOB 1C5LH 3A7WA 2BDBA 2R0LA 3ZZDA 1OS8A 2BY8X 1VCWA 3S0NA 3PTNA 1ANBA 1O3HA 2P3UB 2WYGA 4A6LA 3T27A 2F91A 1QIXB 2EQNA 1MAXA 3P8NA 3SU0A 1KYNA 4TSFD 2YOLA 3MNCA 2ZFRH 5DK1A 4U32A 2VVCA 1O5BB 2A4RA 1MKWK 1SFIA 2BZAA 2SFAA 3LH3A 1ORFA 2HLCA 1P06A 1GJCB 3AASA 2OK5A 1FNIA 2TRMA 2PSXA 1GJ4H 2Y6TA 4CRGA 1C5YB 3RC5A 2EA3A 1EAIA 2BY9X 1YGCH 4DGJA 2P94A 5A8YA 5CDFE 4B1TA 2K1QA 4BANB 3Q76A 1GCTB 3HGPA 4DVAU 1O2JA 2J98A 1LVYA 3SUEA 2F83A 1GHYH 1L1GA 1OKXA 3BG8A 1EJNA 4GSOA 1O3KA 7KMEH 3VEQB 1IQKA 3S9CA 4YXWD 1A7SA 1GDQA 2PUXB 3GDSA 4LXBH 1UVTH 1WTHD 1LPGB 3MHWU 4ZCNA 3SU3A 1MKWH 3V0XA 4UFEH 1GL0E 1BQYA 1S83A 2PGQB 1YCPM 2BMGB 4OM9A 1W7GH 1T8MA 1DLKB 1EAXA 3MNBA 1C1WH 2GP9B 5DP4A 3PO1B 2EI7A 1A61H 1EOJA 3B9FH 2ZF0H 1AWFH 3PV5A 4K69A 2D8WA 5CHAC 5T6GA 3T5FH 3GYLB 2I6SA 1BMNH 3RXRA 4ZMAH 1A0JA 1O2WA 4ZAEA 1ZYOA 5TCAA 1B5GH 2ZHWH 1TBQH 2OD3B 4YLUA 1YF4A 2ESTE 4H6TA 2RDEA 2J95A 1Y3WA 3P8OA 2I6QA 1P02A 1H1BA 3GY4A 2UUJB 4AG2A 3U98H 1MUEB 1QBOA 1GI8B 2C8ZB 7ESTE 1O31A 4AGJA 1EAWA 5FCRA 5FPTA 1O3JA 2ZU5A 3KCGH 1NPMA 1TGTA 3TK6A 1F92A 5A0BA 2VBCA 5EU8A 3A7XA 2VWMA 1INCA 1E34B 1HJ9A 2FI4E 1GG6B 3RXLA 4CRDA 1A3EH 1A5IA 1ELFA 2A1DB 2BQWB 2GMTC 3NKKA 4BNRA 5KECA 4MPUA 4AGKA 2HNTC 1HBTH 1SKYE 3P8GA 3SU5A 2BD8A 4KELA 2ZG0H 2NU1E 1DSTA 1O34A 1V2LT 2ZTXA 1MH0A 2CV3A 1TOMH 3TLOA 1BRBE 1ELAA 4CRFA 1TQ0B 1TABE 5HM2A 1QB1A 1ZHMA 3ZV8A 1TNKA 1VITF 5A2MH 1TB6H 1BB0B 1O3BA 1MZDA 1QY6A 2FDAA 1CT2E 2QC2A 3DT0H 1SR5C 1BDAA 1BJVA 1TQ7B 2AERH 3BTQE 5C1UA 5IDKA 3R0FA 3UWJH 2ZTZA 1AIXH 1GI9B 1GGDC 2HRVA 1HPGA 1P09A 1W7XH 2O8UA 3MI4A 1BTZA 4TT3D 4VGCB 2AGIX 1NU9A 1TGNA 2GZ9A 4E05H 1W8BH 2ZDVH 1EKBB 2ZZUH 5DPAA 3UUZA 2HNTE 2AH4X 3PLPA 2RA0A 3QX5H 1KXFA 1ZPZA 1KDQA 1C5OH 4I33A 3OX7U 3IWMA 1RTLA 2O8MA 4JZ1A 1CHOF 2FTLE 5FPYA 4K1TA 2B8OH 2WUBA 1LHCH 4Y8YA 3SU4A 2BHGA 1CVWH 3HKIB 1GHZA 2J4IA 1RTKA 3F1SB 1FV9A 1GI1A 3A8BA 3TJOA 1NFXA 3KF2A 3SJOA 1S81A 1O5DH 3SUDA 2FOGA 1PQ7A 1P2MA 3TPIZ 3SV6A 4LZ4B 4UEHH 1MTWA 5FAHA 1P11E 2Z94A 5E0GA 2FMJA 1E0FD 2V3OH 1FAXA 1BMAA 1ZJKA 3UTUH 1FN8A 1QURH 1O2LA 1KLIH 1E1RD 1T8LA 2C8YB 2G5VA 3RXFA 1KMHB 2AMQA 1ETTH 1O38A 2HALA 2A7HA 4X1QU 3S9AA 1TAWA 4IGDA 2FWWA 5C5OA 1FY3A 1K1NA 2NU3E 1JMOH 1Y5AT 5I25A 1GBLA 4XD7D 1CGHA 3QWCH 4DY7B 6GCHG 1NN6A 1AN1E 2AMDA 3ZZAA 4CRAA 1Y5UT 3ENSB 3MFJA 2F9OA 4IN1A 2WUCA 3TGJE 3FOAA 5ESTE 3NCLA 2YMSC 1RXPA 5LPRA 2PFEA 1A5HA 4HZHA 1TALA 1TMTH 1KTSB 1VR1H 1LQDB 3RXEA 1FIZA 1SGQE 1V2MT 4RSPA 4B6EA 4O3TA 1E1QD 2GV6A 3SJ9A 2BOHB 3MTYA 4RT1A 5A0CA 1AE8H 1IQIA 2VGCB 2BX4A 4KTUA 1UVUH 4ACBA 1FMGA 2BLOA 1JOUB 4WH6A 2KM0A 3UFAA 3ZZBA 2QXJA 1C1PA 1GJ9B 4I31A 1MAYA 2OQ5A 4H6SB 1HAHH 2H1UA 4NZLA 5HKKD 1NTPA 3B8JA 1ARCA 1P2KA 3LGYA 2ZFSA 3ODDA 1UCYE 2GT8A 2KX4A 2BLQA 3MO3A 7GCHG 4X2XA 3F9EA 1VITH 1ARBA 3EGKH 2JETC 1P01A 1BTHH 1YM0A 3FP8E 3U69H 1ABJH 4NIWA 1RIWB 4YTAA 1UVPA 1TX7A 4GLYA 3IG6B 4XBDA 2JJ2D 1NBME 1O5CB 1O3IA 3I77A 5JDUB 1XUJA 3GY5A 1HAIH 1XUFA 4ZHAA 3A7TA 5HIYA 2WPLS 1P10A 1EB1H 1V3XA 3V3MA 3Q3XA 2IPHA 2V35A 1LVBA 5J4QA 1BMLA 3PB1E 2VH0A 1AE5A 1SGYE 1TPSA 3I78A 1Z6JH 4P02A 1QQUA 3P17H 3VGCC 4Y8XA 2A7CA 4E7NA 1SB1H 1BUIA 2HWLB 5JB8S 3BIVH 3MO9A 1EFRD 2QCYA 1C5NH 1Y3YA 5EQQA 4AZ2B 3P92A 1EP6A 4A1VA 1F5LA 2ZECA 1PYTD 3RC4A 1O2MA 2C93B 3A8DA 4SGBE 3KQ5A 1DPOA 1D3PB 1EPTB 4ASUD 1OWIA 2Y7XA 2C8WB 5JYIA 3E1XB 3MNXA 1GI4A 3SU2A 5L2ZH 1BHXF 1DXPA 4INLA 1L1NA 3LC3A 4I86A 2XWAA 4DIHH 3P6ZB 4UE7H 4ZXYH 1O2XA 2Z6BD 2B5TB 4FVBA 4Q7YA 1SHYA 1IQHA 4UFDH 3SV2H 2QXGA 2VVVA 1CGJE 5TJXA 4YOJA 5HYOA 2PP6A 3BTDE 4F49A 3QZRA 1QRZA 4Q7ZA 2EEKA 2TGTA 3K65B 2BD9A 4GHTA 4X6OA 4GVUA 4FUFA 2OINA 5PTPA 1C5VA 1MU8B 2CMYA 1QCPA 1NROH 1O3EA 4SGAE 2Z9KA 4PROA 1UVSH 2FI3E 1HAVA 2FZZA 1F2SE 4CHAC 1YC0A 1TRMA 5DP7A 3LT3A 1MTVA 3BTWE 3F6UH 5DP3A 1DWCH 5DGJA 2KFWA 4F48B 3DD2H 3E8LA 1COWD 1PPBH 1TBZH 1TYNA 1GJ5H 3LGIA 2ZIQH 1G2MA 3M7TA 4ISNA 1DDJA 1F5KU 2FYRA 2GTBA 2VU8E 2ZGJA 3K2UA 3U1IB 1T4VH 2AMPA 2ALVA 2HPPH 1ZR0A 4RKJB 3UR9A 3MYWA 1OP2A 1MQ5A 3G01A 4R0IA 1JRTA 2FOHA 3PRDA 3PLKA 1H8IH 1OPHB 3VB4A 2A2XH 2VINA 3N7OA 1Q3XA 4ABGA 3TVJB 5EG4A 1HXEH 1SHHB 1GJ7B 3SV9A 1AQ7A 3E90B 1NU7B 1AWHB 1FN6A 1O3MA 4X2WA 1G3EA 2ZU1A 2TBSA 3ELAH 4A1TA 2J98B 3OEED 1OYQA 1ELVA 3DA9B 1CBWC 2XCNA 1C4Y2 1Z8RA 4FUHA 2THFB 1O39A 1Z1IA 1GJAB 2Y82A 4FU7A 1SGFG 3F9HA 1BJUA 3LH1A 2GZ8A 1GHWH 2RA3A 1NFWA 1SQOA 2QXIA 1C5WB
chains in the Genus database with same CATH topology
3FZDA 1NFUA 1K28D 1UK3A 1QJ6B 3ATMA 3KQDA 4K1EA 3MH6A 1K1PA 1BBRK 1MD8A 2ZPQA 1A3BH 3OY5U 1UTMA 1KSNA 3BIUH 4X0WU 3A84A 2O8WA 1O2KA 2PSYA 5LPFA 2R3YA 5F8TA 4QT8C 2B7DH 1AUJA 4O3UA 3LIWA 2BVRH 3SJKA 3PWCA 2SNWA 4ISLA 5LPEA 3A7ZA 4E06H 2OC1A 2W3IA 1FPCH 1OWJA 1O2IA 4FUIA 1O5FH 1IQLA 1BTUA 1LPZB 1Y3XA 1VCPA 3TU7H 3VB5A 3BG4B 3VFEA 3SGQE 3M3VA 1RRKA 5F8ZA 1BZXE 4NSYA 2C4FH 3PLBA 9ESTA 1BBRH 1OXGA 4BAMB 1B0EA 3T2NA 4B76A 1SL3A 2OBQA 3RP2A 1RGQA 1EXFA 4MNYA 5DO4H 2A2QH 2ZFTA 3KHVA 1LVOA 4MPXA 5HGGA 1VITG 5JBTA 1C1VH 1CA8B 3AVZA 1F7ZA 1OP8A 1C2FA 4XDEA 3LGWA 1P2OA 1C1OA 4YOIA 4NGAH 2F3CE 1DS2E 1GHBF 3LDXH 2QV1A 2P95A 1EPTA 1RTFB 2OCVB 4NSVA 2SGPE 2ZQ2A 2BXTH 2OTVA 4NWKA 1VJ9U 1RS0A 2FLBH 4X1RU 4NA8A 1UMAH 1V2RT 2XBYA 2ZCKP 1TMBH 1V2OT 1Y8TA 2P3FH 1KXEA 6ESTA 3O8CA 2EI8A 1DLEA 2Y5HA 5L6NH 2WV4A 3M5LA 3O8BA 1CHOG 5FHTA 1PQ8A 2BDAA 2BVSH 4U30A 4NA7A 1D6RA 1P8VC 1NO9H 1GI0A 1C5PA 3P70B 4DCDA 2FOAA 4ISOA 1O2TA 5FBIA 2V6NA 2OC7A 1HDTH 1HAGE 1XX9A 1UVOA 1XM1A 2G51A 2WPHS 1D3QB 1AB9C 2R2MB 1PPZA 1MD7A 1ZPBA 1HYLA 5E0JA 6CHAC 3SO3A 3Q3KA 3NPSA 2Y5GA 1O2ZA 1YPKH 1O2PA 2PKSC 4NFFA 4I8JA 1N8OC 3SN8A 5LH8A 1JIMA 1THPB 5G4BA 1ZRKA 1EJMA 1O3AA 1UTKA 2CHAB 2BOKA 3FVFB 1KY9A 3WY8A 5E2OA 2GKVE 4ABBA 3VB3A 1YCPK 2BDHA 2HPQH 1EZXC 3AW0A 4CBNA 5LGOA 1U6QA 1TLDA 2O8LA 4CH2B 4CREA 1KIGH 4JYUH 1BCUH 1ZSKA 1S85A 1AY6H 1GMHF 2TGPZ 4BAKB 2CHAC 3RXQA 4YLQH 1EAUA 1WOFA 2A4OA 1QFKH 1C5QA 2FOBA 5JBAS 1TIOA 2H9TH 3TH4H 2XC0A 2ZPRA 4ZKSU 4DW2U 2WINI 1TNIA 2BD5A 1G3CA 4IMZA 3A8CA 3LJJA 1GBKA 2G4UA 8GCHF 5EPYA 1C5UA 2SGEE 3A85A 2F9UA 1FI8A 1C9PA 1P03A 2A7JA 2ZGHA 2NU2E 1AVXA 1GCTC 1YCPH 2F9NA 1MTSA 5AFZH 2ZTYA 2CF9H 4JZEH 2WPIS 3GCHB 1Z8GA 1T32A 2GCHF 1S0RA 2FOMB 4MQAA 2QY0B 1TRNA 4AYVB 4FUBA 1YP9A 1DE7H 1GHVH 3ZVAA 5GPIB 3UOUA 1FUJA 2VWLA 1PYTC 4AFSA 1MCTA 9LPRA 4X8SH 2CXVA 2AS9A 3D49H 1D4PB 3RXJA 1BITA 3PO1C 2IOTA 2ALPA 1FPHH 2P8OB 3ATIA 1NM6A 1MTNB 1OOKB 4A92A 1HAOH 2OP9A 2PKAB 8KME2 3M37A 1K1IA 1NT1A 1XKAC 3A88A 4BXSA 3A81A 3MU1A 1P9SA 1FJSA 2Z7FE 3M7UA 2OC8A 3MU0A 5EODA 5ESBA 2XCFA 1EZQA 1TNGA 1Z1JA 1SGCA 1IQJA 1T8NA 1ZSJA 4GCHF 1YPMH 1P2QA 3QN7A 2Y7ZA 4CRBA 1HAXB 3SJ8A 1O30A 1O2YA 3VXEH 1C5XB 3EAJA 1D3DB 1J15A 1GCDA 3UOPA 1HAPH 1ZMNA 4FU8A 5JBBS 4TWWA 3PV4A 1Y5BT 1YKTA 1W11U 2OQUA 1B0FA 1YBWA 2A32A 2H9HA 2FYQA 1LMWB 3P8FA 1GG6C 1LCYA 1SGIB 4K5ZA 4Y0ZE 1HLTH 3RXKA 3EQ0H 2G4TA 1DX5M 2OC0A 4ESTE 2BX3A 1T7CA 2VNTA 4KKDA 1TGBA 3HK3B 3HK6B 1J9CH 4DT7B 2XC4A 4BAQB 1G37A 4B2AA 1NZQH 3M7QA 4Y10E 1E37B 1A0HB 1OSSA 4IBLH 1GMDF 1SC8U 2XBXA 1CU1A 4TY6A 4D9QA 3TITA 1KXBA 4MNVA 1L2EA 1XVMA 1LPKB 4I7YH 1G32B 4AFUA 4CRCA 3H5CB 2ZU3A 3M3SA 2FX4A 4VGCC 1ESBA 2Z9JA 3ZVGA 1EZSC 1QRWA 4NA9H 3T26A 3QGNB 1TFXA 1C2MA 4ZXXH 3ZZ8A 3U8OH 4A5TS 5DJ7A 2WPJS 1HAVB 2ODPA 2QGRA 1NRNH 3GY3A 2W3KA 3PTBA 4XFQA 3EYDA 3KGPA 2V0BA 3F68H 3RDZA 3A7YA 1C2EA 2VIDA 2FODA 4ZHLU 1Z8JB 3A89A 4ZROA 5C20A 1AD8H 3ZVCA 1TPAE 1QL7A 1SG8B 2XBWA 1GBTA 1W3CA 2W26A 1LQEA 4WXVA 1ANDA 1SLVB 5GCHF 3RXMA 1UCYK 1GI7B 4Y11E 3QZQA 2BD7A 1AZ8A 1NRQH 2H2ZA 1QR3E 2GD4B 2R9PA 3A86A 3MOCA 2VWNA 4DURA 1BMMH 3JZ2B 3LGVA 4OS1A 5L2YH 1QQ4A 2BD4A 3RLYH 3D62A 1HIAB 2ZPSA 4MPVA 4E7RG 2JH6D 1GVKB 4WMDA 3RXGA 1GHAF 1QBVH 2A4GA 1THSH 1ELEE 1IHSH 2ZI2H 3VB7A 3MU4A 2QF0A 2P3TB 3V12A 1CGIE 1TA6A 1W14U 2PHBA 2B9LA 1A1RA 2GV7A 2ANMH 2Q6FA 3RU4E 1S82A 2JH0D 1UCYH 2PTNA 2UWOA 1TWXB 2C90B 4X1SU 1IQGA 8LPRA 4LK4A 4WY3A 5T6DA 2FM2A 1CQQA 2J9NA 2QF3A 1SVPA 1JXPA 4NG9H 3STIA 1JBUH 1BT7A 3MH5A 1MKXK 4K2YA 4NCYA 1W13U 4AB9A 3D65E 4Q80A 3EA7A 3RC6A 4IS5A 2BY7X 1GBAA 2PKAA 1GBMA 2FOCA 2Z9LA 5AVDA 3RXUA 3RXTA 4ZKRU 4X1PU 1NRPH 4X2VA 3ZYEA 3OSYA 2VGCC 3RXVA 1HXFH 1DWEH 4Z0KA 4YZUA 2XWBI 1IQEA 3BTFE 5C1XA 1AFQB 4FUGA 5T6FA 3KQEA 3SU1A 2PTCE 1CE5A 2G81E 1T31A 3QK1A 4ZUHA 2TGAA 5AFYH 1EQ9A 1YPJH 3LPRA 5E0HA 3EE0B 1GHBG 1GI5A 4AX9H 1B7XB 1ACBE 1MKXH 2O8TA 3A7VA 4I32A 1G2LA 1DWDH 2CN0H 2Z3DA 2FESH 3KL6A 4HTCH 4XBBA 2BY6X 1RIWC 1GBEA 3KN2A 1P05A 4WWYA 3V7TA 3OTJE 1IQNA 1K1OA 2Z3CA 3PROA 5DP9A 3BTGE 1WV7H 3LONA 4I8HA 1RD3B 3QTOH 4OS5A 4WF8A 4XE4A 5FCKA 1O3NA 2FLRH 4YT6H 4FXGH 1V2QT 5F6MA 2ZP0H 2XC5A 4M7GA 3SI3H 3BF6H 1EATA 3H7OA 3MH7A 4B2CA 1PPFE 1E36B 4AFZA 1C5SA 3M5NA 4TWYA 1C2KA 1NFYA 2PLXA 1DUEA 4FUEA 2ASUB 1EPTC 1Z71A 3ATWA 3NWUA 2UUFB 2ZHFH 1WYKA 2ZDAH 5FPSA 1BRAA 3HKJB 1LKBA 5EOKA 1ZHRA 1S5SA 1A46H 4Y71A 4R8TB 1KTTB 1FLEE 5F8XA 1DXWA 1AU8A 1E38B 4Q7XA 4D76A 3ZV9A 3D23A 1QA7A 2Y5FA 1HJAB 1SLXB 2Y81A 1AI8H 3UWIA 1P2JA 1QGFA 1SGNE 4KP0A 4MNWA 1H4WA 3ZZ7A 2FX6A 3UREA 1ETRH 2XW9A 1AGJA 1SFQB 1K21H 1GMHG 2FPZA 4WXIA 1LHEH 4GUXA 3ZVBA 1P04A 2H9EH 4HFPB 4CBOA 1TX8A 2WPKS 4BOHA 3M3TA 2VIPA 4CR9A 1ZTKA 3BSQA 2PUQH 1V2JT 1C1MA 1GVZA 1F0SA 3SU6A 1G36A 5BPEA 4JYVH 1WTGH 5GXPA 1QL9A 2XRCA 1UTOA 1ABIH 3T25A 5SGAE 3QTVH 3S9BA 1HIAA 1DY9A 4JZFH 4MLFB 4X2YA 8GCHG 1H9LB 2AYWA 1NC6A 3K9XB 3PMBB 3A80A 1PPGE 3RLWH 4RKOB 2PWXA 3MWIU 4YESB 1C5RA 1M9UA 1H9IE 1O36A 3GISB 1N6YA 1G3BA 3W95A 1JIRA 2A4QA 3TJVA 1C1UH 4J1YA 2GCHG 1ZGVA 1C2IA 2P16A 1SGDE 4X8UH 3LGTA 3TH3H 4DJZB 1QL8A 1WCZA 3LU9B 1O2SA 3RMMH 1FY5A 1O3PB 1O2RA 3E6PH 1JRSA 1BRCE 2VIOA 5HM9A 1Z8IB 2FS9A 2W7SA 4K3JA 1GBCA 2A5AA 3RU4D 1QNJA 3ZYDA 2NU4E 3GICB 1ELCA 4X8TH 1WU1A 1IQFA 3GDVA 2ZDKA 2P93A 3B23B 4Y7BA 1HNEE 3QGJA 1QA0A 1VGCB 4JYTA 1IAUA 4B74A 2V3HH 1ANCA 5FBEA 4YM9A 1XVOA 1K2I1 1H9HE 1YLDA 4J2YB 4OS6A 2F9BH 4UD9H 1ANEA 4Y76A 4ZKNU 3UIRA 4ASHA 4WH8A 1C5TA 1BTPA 4GCHG 1C1TA 4XBCA 1F0UA 1XXFA 8ESTE 1UK4A 4Z6AH 5C3NA 2FOEA 4DIIH 2GDEH 1GVLA 5JBCS 4OS2A 2ZFQH 2G00A 4INHA 2ZEBA 2R3UA 2GCTB 4D7FA 1DOJA 3FFGA 4JCNA 3M61U 3RXBA 1DM4B 4XSKU 1O37A 5E2PA 1L4DA 1FONA 1TONA 1YPGH 3GDUA 2BTCE 4HI3A 1W10U 1AFEH 4NIXA 2HGTH 3BG4C 2RG3A 1MQ6A 1WQVH 3Q00A 3ZZ3A 4RN6A 5DP5A 3EA8A 2ODQA 3TH2H 1S6HA 1GJDB 3BV9B 1TNHA 3RM0H 1O3GA 1QJ7B 1J8AA 3GOVB 5GDSH 3SV7A 3LJOA 3PM3A 2YNBA 1SGEE 2BLVA 2BB4A 1AHTH 1H8DH 2B0FA 1SI5H 1UTNA 1IHTH 4YOGA 3MU5A 1V2WT 1GMDG 1YPLH 3M35A 1DUAA 1XMNB 2XNIA 1SOTA 4MTBA 1DWBH 1ZHPA 3K6YA 1Y3UA 1PFXC 1K1LA 1LDTT 1KXCA 1UO6A 3QDZB 1T4UH 4A1XA 3E0PB 3SQEE 1O2HA 1QJ1B 2DUCA 3SUGA 1DY8A 4JZDH 1AMHA 4Y7AA 1F0RA 1ELTA 4ABFA 4O97A 1TNLA 1FQ3A 1TOCB 2ZFPH 4YT7H 1Z6EA 1P2IA 1G30B 1EOLA 3TJUA 2BQ6B 3GYMA 1FY4A 1LO6A 4B75A 1P12E 1IOEA 1GI2A 3NZIA 2DE9A 1GHXH 1PJPA 3SOSA 2G55A 2QXHA 4NIYA 2JH5D 1L4ZA 1SMFE 4ABIA 1OYTH 3BN9A 4OGYA 5GCHG 1E35B 1KLJH 4WJG2 2XBVA 3GY6A 2YNAA 2HVXA 2AGGX 5EQRA 3GY7A 2BXUH 2UWPA 1O32A 1Y59T 2ZU4A 1S0QA 1KXDA 1PPCE 1ESAA 1GMCF 1DSUA 1C1QA 3UNRA 2HOBA 2ZHDA 4TPIZ 4A7IB 2Z3EA 5TCCA 3UPEA 2H5DA 2Y80A 1HV7A 4NZQA 2G52A 1TPOA 2ZCHP 4X8VH 1YPHE 1N6XA 4D7GA 2AIQA 3HPTB 1GHAG 1AUTC 1OWDA 2ZHQH 5AF9H 5EW2H 4AB8A 2BYAX 4FUCA 1O5GH 2ZKSA 3QLPH 1LHGH 1ZLRA 4K1SA 1C2LA 1SGRE 3FZZA 3ZVEA 3E0NB 1O5EH 2A45B 1VJAU 1MCVA 3U8RH 3T28A 4NWLA 2TGDA 4OS4A 1A2CH 3IITA 2QYIA 4BAOB 1VZQH 4AOQA 2Q6GA 3ZZ6A 2QIQA 4ZH8A 2ZHEH 3BTME 2AFQB 2CJIA 1RJXB 5CHAB 5DP8A 3QO6A 4GPGA 1MMJN 3KQCA 3RMLH 1DANH 5A09A 2VIWA 2ZNKH 4CR5A 1NY22 2VJ1A 1Y3VA 3V13A 3S69A 3ZZ5A 4D8NA 1W0ZU 3UY9A 5EW1H 1AKSB 2LNCA 3UR6A 1SBWA 3GCNA 1UTJA 4U01A 2BDYA 3ITIA 4H4FA 3RXIA 5K7RA 1X7AC 2BVXH 1P3CA 3GCHC 3RXCA 4IC5A 3SNDA 1TE0A 1YYY1 4YO9A 1A5GH 3RXDA 3A8AA 1HAZB 4IMQA 5CMXH 4CH8B 4OGXA 4Y79A 4TPYA 2ILNA 5H4IB 4BTTB 1TX6A 3ZVFA 3KQBA 3MMGA 1C1NA 2GMTB 1BTWA 2QA9E 1SGPE 2BLWA 1V6DA 3UNQA 1WBGB 3JZ1B 1MZAA 2P8OC 3GCTF 2NU0E 1MTNC 4D9RA 4OS7A 5C5NA 5BRRE 3E16B 3E3TA 2RCEA 4IC6A 2VH6A 3RXHA 3KIDU 1C2DA 1WQSA 5IYTA 2STAE 4ABDA 5C1YA 2ANWA 4ISHH 3BTEE 3TK5A 5JPMH 3EDXB 2ZGXH 2H6MA 1WUNH 3C27B 4K60A 4O03A 1XUGA 3A83A 2XYAA 1GGDB 4UFFH 2BQ7B 1CHGA 4JK5A 3M5MA 2ZU2A 2BDCA 4AYYB 1EASA 2QAAA 4ISIH 3MU8A 2LPRA 4X6NA 3KNXA 1XXDA 5K0HA 1QRXA 3BTHE 4MVNA 3F9FA 3SQHE 3PMAB 2ZGBH 2AIPA 2FO9A 3OYPA 2D2DA 2OLGA 1HRTH 5T3HA 1Q31A 2D1JA 1SGTA 1CT0E 1GDUA 4AFQA 2GGVB 4I8GA 1XUIA 1ZJDA 3SJIA 3DHKH 1HB0B 1O3LA 3CP7A 3SNBA