1TGCA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgcA02
3AAVA 4OGYA 1L1NA 1D6WA 3B23B 3E0NB 2OCVB 1G3CA 3M36A 1HJ9A 5E8EH 4RSPA 3BTTE 2WPKS 3WY8A 1KXEA 7LPRA 1RGQA 4FVBA 4TWWA 1V2RT 1UCYH 1GHBF 1E0FD 3S9CA 3PO1B 5EU8A 4DCDA 4FUEA 4BTUB 2WPIS 1AVXA 3VB3A 1A5GH 3RMOH 2OC1A 3S9BA 5HXFA 1NRNH 3D65E 3U98H 4DURA 2RG3A 1HJAB 3PWCA 1FJSA 2UUFB 3VB6A 1BA8B 2C8XB 8KME2 3MH7A 1ANDA 1AMHA 1B5GH 1RRKA 2BD2A 2A1DB 3FFGA 1AB9B 2G55A 2FI5E 2FLBH 3R3GB 1EASA 2R3UA 1BRCE 1E36B 5A0BA 3FP7E 4Q7ZA 5C1YA 1V2UT 4DT7B 1VGCB 3TGIE 1C2DA 2G5VA 1IAUA 4X1QU 4X1SU 1HJ8A 1KY9A 2FX6A 4X2WA 4MNWA 1MU8B 5C5NA 2Z9GA 1AE8H 1O2NA 3M5MA 2C93B 1RIWB 3D62A 2YOLA 2FS9A 1N1LA 7GCHG 1HDTH 1ZHMA 1GHAG 2PKAB 1THSH 3AW0A 2BD3A 1Y5AT 3F9GA 1V2QT 1PPHE 3NKKA 4BANB 5HYOA 3S7HB 1H9IE 8GCHF 2A2QH 1ZR0A 1BRUP 5EGMA 4Y8YA 3G01A 1P10A 1O2RA 5EG4A 2P95A 1P06A 2AERH 2Y5HA 4Q2KA 1ETRH 1EZUC 2F9VA 1TONA 4ABGA 1GJ6A 3PROA 3RXAA 1RXPA 3T29A 3KEEA 2AMQA 1BTWA 1WSSH 1AWFH 2QF0A 3LDXH 1GBJA 2JH0D 1D3TB 2VIDA 5GCHF 3VXEH 4RN6A 3M7UA 3BF6H 2O9QA 2QF3A 3A88A 2TBSA 1KLJH 3VFEA 1UTLM 3A86A 1C2LA 2WPJS 4MPUA 1EJNA 1CVWH 1L4DA 3BIVH 1ELAA 1H1BA 5FPYA 1ID5H 1TGTA 5FCKA 2QIQA 3OU0A 3PTNA 4CRGA 1DS2E 4K8BA 1DOJA 3UNQA 1UTOA 3SU6A 4B2CA 1ELTA 5GWZA 4X2YA 4AB9A 1QA7A 3MU4A 2Q6FA 2GZ8A 1C5RA 1GL0E 1P2MA 1JBUH 3BEUA 1AFQB 1LDTT 3ZVCA 4X6NA 3PO1C 1WBGB 3M5LA 4E06H 3SGQE 1G9IE 1TRNA 1C4V2 1O2ZA 2ANWA 2QV1A 2FOAA 1HB0B 2ZU2A 4JZIA 1GL1A 5LH8A 2UUKB 1WQVH 3V12A 1C5MD 2BOKA 3UPEA 2BVXH 2BVRH 1AB9C 2SGPE 3T27A 2VNTA 5JB9S 4KTSA 2J38A 3E91A 1MKXK 3BEIB 4I33A 1OPHB 1O37A 1VGCC 2P3FH 1ANCA 3C1KA 4FUCA 2J95A 5TCAA 2CXVA 1DSUA 1S83A 2G51A 1SB1H 1AFEH 1RIWC 4NFEA 2G4TA 3W94A 4Y6DA 7GCHF 3ZZ9A 1PPEE 1AZZA 1GI0A 1GHAF 3FP8E 1MAXA 1C1OA 2AMPA 2BD8A 4AN7A 3IWMA 2NU1E 1K1NA 2NU0E 5B6OA 3RXVA 3KQCA 2G00A 4ZHMU 1TNJA 3UOUA 1BTPA 5DO4H 5DP7A 1GMDG 1BIOA 2A4QA 1FLEE 2FOCA 1XUJA 3V13A 5EXMA 1DXPA 1EUFA 2WV5A 4FUDA 1UTNA 4Y8ZA 3UIRA 1VR1H 2F3CE 3E8LA 4GUXA 1LHEH 2JKHA 1GJCB 3PM3A 2Y81A 1TAWA 1ABJH 4NIWA 5F6MA 2H6MA 3ATWA 3MH4A 1TRYA 4WY3A 2FTMA 3FZDA 2FESH 2VVVA 4NGAH 1K28D 3GY7A 2BY7X 1CGIE 1C1RA 1O2TA 1OX1A 1DE7H 4GLYA 3OY6U 1F5LA 3RU4T 1QJ1B 1UVPA 1GI4A 4A6LA 1ZOMA 4D7GA 1S85A 4GCHG 1C1TA 3ZZCA 2FWWA 5L2YH 1BBRE 2GT8A 4I31A 3F9FA 5A8ZA 4YM9A 8ESTE 1NROH 1P2KA 2TIOA 4WH6A 2BD5A 3U8RH 5GPIB 3QZQA 1FV9A 1K1IA 1EX3A 4MLFB 4AG2A 2H5CA 1O2UA 3HGNA 3RC6A 2QGRA 1ZJDA 2WUBA 1O5AB 1ELCA 3NXPA 4LK4A 2CF8H 4AYYB 5A8XA 1IQNA 4K2YA 5C5OA 3EQ0H 1AFQC 4ZROA 3SGAE 4ISIH 3U8OH 1D6RA 4INLA 1DY8A 1DT2A 4I32A 2CGAA 1ANEA 4A7IB 1ELFA 1K1MA 3UREA 1L1GA 1OWEA 1W13U 3NK8A 4UD9H 1GBHA 5FXLA 1LTOA 1TRMA 2GP9B 2P93A 2VVUA 1ZMLA 3Q3KA 1GI2A 1GCTB 3RXPA 1O2JA 1W11U 1SGQE 3D49H 1WV7H 2PV9B 2BVSH 4NCYA 1FNIA 3UWJH 1AQ7A 4GPGA 3SNDA 1P57B 5FPTA 3UY9A 1OOKB 3NPSA 3PMJA 1BB0B 2Y5GA 3BG8A 2CN0H 1O35A 3S9AA 4A1XA 1IQJA 3HK3B 3TH3H 1GJ4H 3FANA 1QB6A 1TPPA 2HRVA 2ZFRH 1O0DH 2PSXA 1PFXC 1EZQA 1O3PB 3AVZA 1P9UA 1V2LT 3SJ9A 2ZI2H 2BDAA 1GMDF 1Y3VA 5E0HA 4AORA 2FDAA 4RKJB 2QXGA 3SUDA 1HV7A 1GBLA 4A5TS 2F83A 4IC5A 1O3AA 1MBQA 1WOFA 1C2KA 1GI9B 4HGCA 5JDUB 2YNAA 3C27B 3B9FH 2A5KA 1XVOA 7KMEH 3SZNA 3TGKE 2HNTC 2VIWA 3JZ2B 4OS1A 3UNSA 1C2IA 4B74A 1FAKH 3TK5A 5EODA 5AFYH 1H9LB 2XRCA 1ELVA 4ZMAH 3RC5A 4I8GA 3CENA 2BD4A 2Z3CA 5T6GA 1QJ6B 4BTTB 2V3OH 1VCPA 1C2FA 4GCHF 1QCPA 1TOMH 3GDVA 3V3MA 4CHAB 3M5NA 1EZXC 1TMUH 3MO3A 1K22H 2ZFQH 2EC9H 2UUJB 3MH5A 3SN8A 3ZZAA 1OSSA 2TGPZ 4IC6A 4LOYH 3SORA 1FONA 1AE5A 1GDNA 4MPWA 5GIBA 1O5CB 1TX8A 4K8YA 4A1VA 3M3VA 2C8YB 3RMMH 1TPAE 1PPZA 3RXEA 4AGJA 4D9RA 3EAJA 1YPHC 1P8VC 3GDSA 1UHBB 1ETTH 2C4FH 3KQEA 3A81A 4LXBH 1FN8A 1VITH 5FX5A 3V0XA 2XCFA 1CBWB 1ELEE 2OC7A 3TJUA 2FP7B 2R3YA 2D2DA 2GT7A 2FOFA 3M7QA 1DWBH 3IITA 1C2HA 2HNTF 1C1NA 2QCYA 5DP3A 1LVYA 2VIPA 1BTHH 1UHBA 4NIVA 3FP6E 1GCTC 4IS5A 3SV6A 5DK1A 5EPYA 5G4BA 1F0TA 1MKWK 1P02A 3GDUA 1FIZA 4E7RG 5E2PA 2WPHS 1O3NA 4TY7A 2XNIA 1O2IA 2OTVA 5FPSA 3P8OA 3Q00A 3SNAA 2HVXA 3SV8A 2BXUH 4R0IA 3TNTA 1XUIA 1QBNA 2BY6X 4IW4E 2JH6D 4NZQA 4X0WU 2HOBA 2ZHEH 4E05H 1L0ZA 5TCCA 3E1XB 2GDEH 4WJG2 1GVLA 1F2SE 2FIRH 3ESTA 2XYAA 3SU0A 3TNSA 1IOEA 4CRDA 5EW2H 1VCWA 2XWAA 4NSYA 3SUGA 1PPBH 2B0FA 1G3DA 1NTPA 3MOCA 1TOCB 2BLWA 2VIOA 1SPJA 1GBBA 3ZZDA 2F9PA 2Z9KA 1O33A 3QTVH 1T4UH 4DIIH 2OBOA 3K9XB 3MO6A 3MYWA 3QK1A 4B75A 3A85A 2R2MB 2Z7FE 1YPGH 3A87A 1SGEE 1V3XA 4ABBA 4NSVA 1LMWB 2AH4X 3QGNB 3SUFA 1JIMA 3RM0H 4AYVB 4NFFA 4JK6A 4H42U 1QY6A 1P03A 1MZAA 2CJIA 3GOVB 1BTXA 3KHVA 3H5CB 1XKBC 4X2VA 1TYNA 3ZYDA 2BY8X 4CRCA 1VITG 1YPMH 2NWNA 1SHYA 4BAMB 1Y3WA 4O97A 4DOQA 1XXFA 1A3BH 3BTDE 4CHAC 1SGYE 1Z8GA 3ZZ6A 1FI8A 4HI3A 1TMBH 1ZTJA 2B7DH 1NZQH 1XUFA 1NFUA 4WXIA 4X6OA 4AFQA 5A0AE 1C1UH 1HAHH 3GY4A 3D23A 4GVUA 1JOUB 1O3DA 1CBWC 1FY5A 2ZFTA 1SBWA 2BXTH 1A3EH 3LGUA 1P01A 2ZHQH 1HXEH 4TPIZ 2ZGCA 3PTBA 3P8FA 1P05A 1W2KH 1GGDB 4WXVA 5T6FA 3RM2H 3RMLH 4BAKB 1O3MA 2PUQH 3EDXB 1O3KA 3F1SB 5JBAS 3UNRA 3KIDU 3V7TA 3A7YA 3MTYA 2FOHA 1SR5C 2CHAB 3O8RA 1C5XB 2FODA 1F7ZA 1WYKA 2HPPH 3VGCB 2A5IA 4R8TB 1QIXB 1YLDA 2ANYA 1SLWB 1WTHD 1FMGA 2FI3E 1GWAA 1GHWH 1NFWA 3MMGA 3RXHA 1GBAA 3GICB 1FY3A 2LPRA 1OYTH 4BTIB 2GDDA 5E0GA 1T8MA 1TBZH 1GBDA 2Q1JA 4UFFH 8LPRA 1QHRB 2FM2A 4AOQA 2FYRA 1QR3E 1CGHA 2GKVE 3ZVFA 1EJMA 1GBIA 3E6PH 2XW9A 4I8JA 2Z94A 2ZDKA 3LONA 2BQWB 2ZGBH 5DP5A 1O31A 1S5SA 5TJXA 2A4RA 3TVJB 2GGVB 3M7TA 3QLPH 1DWDH 1PQ5A 2SNVA 3RUOA 3TGJE 2THFB 3EGKH 3PLPA 3U1IB 1QRWA 1GI1A 1O5DH 3UUZA 1Z8RA 3GYMA 1QTFA 4O3TA 1GVKB 1NFYA 3M3SA 2VH0A 1A61H 1OWKA 4OS7A 3O8CA 1NC6A 2PHBA 2AEIH 3M3TA 1TABE 2W7UA 1ZRKA 4VGCB 1UK4A 2AGEX 2STAE 2DE9A 3NZIA 1VITF 1WTGH 2BD7A 1P3EA 4YT7H 3ATIA 1AGJA 2ZO3H 1DM4B 2UUYA 1C2JA 1LPGB 1GHXH 1MU6B 1UCYK 2PUXB 2PGQB 1ZHPA 2FS8A 1O2VA 2BDYA 2IOTA 3MH6A 3SW2B 3TK6A 1V2VT 4ABIA 5C20A 1RTLA 1EOJA 1J9CH 5AFZH 4D76A 3LGWA 1AI8H 1O3FA 3E3TA 1SVPA 2FMJA 3SNCA 1D9IA 1XXDA 1ZJKA 3PMAB 2GMTB 1NRSH 3A82A 3DHKH 1A0HB 1H8DH 1KXFA 4H6SB 4WMEA 3K65B 5LGOA 2BDIA 2WPMS 1G36A 4WWYA 1ANBA 1PYTC 3JZ1B 4J1YA 4X1RU 1QFKH 3MO9A 3SJ8A 2J94A 1GJAB 1PYTD 2P3TB 3L6PA 4ZH8A 1O2SA 1W7XH 2OP9A 3TITA 2ZTYA 3O8DA 1BT7A 1GBFA 1GGDC 4IN1A 4YTAA 3NUMA 3U69H 3BTME 3NWUA 1TNLA 1HAIH 3MU8A 4GAWA 1KDQA 2A5AA 1P3CA 2NU2E 2CHAC 4FXGH 4MNYA 1BMMH 1SFQB 1GBKA 1B0EA 4XSKU 6GCHG 1VCQA 1DVAH 2O8TA 4NA7A 1A5IA 1AVWA 2P8OC 2ZHDA 1G32B 2VH6A 3LPRA 1BBRH 3A89A 1F0SA 1YPEH 1LQDB 1K1OA 3ZVEA 1C2GA 1W8BH 1Z71A 3VPKA 4PROA 4MVNA 1ARCA 2LNCA 3A8DA 3KCGH 2A0QB 3OX7U 2D1JA 9LPRA 1OP8A 2ZPQA 5DPAA 2ZDVH 1C9PA 2V0BA 2ZFSA 1TNGA 1D3QB 1YCPH 1GBTA 3U8TH 4JYTA 4Y8XA 4AX9H 4X8UH 1C5YB 1UK2A 2GZ9A 1NRQH 3BTKE 1JRTA 2VWNA 1Q3XA 2BLOA 4TYDA 3R0FA 1HJAC 1TA6A 3S7KB 3MU0A 1QL7A 3RXJA 1SSXA 1SGCA 2ZWLH 4INKA 5FHTA 1TQ0B 1UCYE 2VJ1A 3LT3A 3Q3XA 4E7NA 3LGTA 4TPYA 4VGCC 1C5WB 1GBEA 2VWOA 1NU9A 4I7YH 1Q2WA 5DP8A 1BHXB 2ZDMA 2W5EA 3KNXA 2WYGA 2ZDLA 3OTJE 3QDZB 4AG1A 2G81E 1GHVH 1IQGA 2FXRA 1V2NT 1QL8A 2I6QA 3GYLB 3M61U 3SO3A 1C2MA 2FOBA 1YP9A 2XBXA 3PMBB 2HALA 1UVUH 5JBTA 1EOLA 2FYQA 1MTNB 2PWXA 1Z6EA 3GCNA 1ZGVA 1HNEE 5FX6A 1IHTH 1D4PB 1GJDB 1SGPE 2A2XH 1DPOA 4YESB 2SGAA 2Z3EA 1GG6B 3H7OA 3T25A 1VJ9U 2A45B 4YT6H 2XC5A 1OP2A 2PSYA 3W95A 6CHAB 3BIUH 4IMQA 2GMTC 3ITIA 2ZDAH 3RP2A 1VJAU 5F03A 1LKAA 1IQMA 1THPB 3KL6A 1MBMA 1ZSJA 3CP7A 2BLVA 1O39A 1AHTH 2GX4A 4MNVA 1S0QA 3F68H 4DG4A 1Q31A 1DITH 1ZMJA 2ILNA 5T6DA 2A7JA 4JZDH 3PYHA 1MQ6A 4B76A 1QJ7B 2OC8A 2ZG0H 3K2UA 1FPCH 6GCHF 1FPHH 1Y3YA 3BG4B 3O8BA 5LPEA 4O9VA 1NU7B 1S81A 2FOEA 3MU5A 4MPXA 4U01A 5AHGH 5J4SA 2OD3B 2Y80A 4A92A 1LHDH 4AFSA 1LVBA 4BNRA 3STIA 1K9OE 2VWMA 2IJOB 1F0UA 1AKSB 1A0JA 4UFDH 5EXNA 1FQ3A 2ALVA 1NFXA 2Z9JA 4CREA 2ZP0H 1JMOH 2OLGA 4H6TA 2FLRH 1ETSH 3SJOA 1JXPA 4CRFA 7ESTE 3P17H 1IQEA 3KF2A 1S6HA 1CA0B 1SMFE 2BB4A 3N7OA 2CF9H 1OP0A 4NIYA 3ODFA 1SOTA 3ODDA 3SNEA 1HCGA 4D7FA 3MWIU 3NCLA 1EKBB 1DX5M 1AKSA 1D3DB 1W7GH 2OQUA 1T4VH 4Q7XA 4Y0ZE 3A84A 2TRMA 3QWCH 1YM0A 3HATH 2F9NA 4AGKA 4K60A 1O36A 2FI4E 1ARBA 1ELGA 1OYQA 2W3KA 1QQUA 3ZV9A 4NA9H 1Z1IA 1T31A 1BTUA 4UE7H 5FBIA 1V2PT 5AF9H 1T8OA 4HTCH 1GI5A 4OS2A 3TU7H 1FN6A 3P92A 1W3CA 1LPZB 1BMNH 2G5NA 3BTHE 1HXFH 4TWYA 3SJIA 4AB8A 3RXOA 3K6YA 3U1JB 3UQVA 2ZNKH 4CR5A 4ASHA 1H9HE 2PTCE 1GG6C 4AFUA 2F9OA 1V2OT 1HBTH 1O34A 1AVGH 6CHAC 1UTKA 3E16B 4INHA 3EA8A 5HM9A 1UO6A 3RXTA 2GCHG 2B5TB 1OWHA 1O5GH 1YGCH 2ZDNA 5AVDA 2CV3A 4ZKSU 3RXDA 1J16A 1GDQA 3RXQA 1C4Y2 1HAXB 2OC0A 1EQ9A 1NPMA 5C2ZA 2AYWA 1FAXA 4CR9A 5C1XA 3UOPA 2BLQA 2PR3A 4ZXYH 2XBYA 1AIXH 1ZHRA 1O2GH 2ZPSA 2R0LA 2Y5FA 1SGDE 5A0CA 1HYLA 1LCYA 5BRRE 5DG6A 1V2MT 1BHXF 4B71A 4KP0A 1TLDA 1SL3A 1YCPM 3SHAH 3STJA 1SQOA 1TQ7B 2SFAA 1LHCH 1NESE 4MQAA 4AFZA 1RS0A 4FUGA 4X1PU 1C1MA 4H4FA 2BDGA 2V35A 1ZTKA 4I8KA 1V2KT 4OS6A 1A1RA 4CH8B 3SI4H 4O3UA 2Q6GA 3MNCA 1C5VA 1TX6A 2AFQB 5JBBS 3LKWA 4SGAE 1GHYH 1GMHG 4Y76A 5F8TA 5BPEA 2FEQH 1P9SA 4FUHA 5FBEA 3MFJA 4JYVH 1HAZB 5GJ4B 1GMCG 4CH2B 1QRZA 1LPKB 1HPGA 1C5TA 4YO9A 2ZPRA 1N8OB 1QURH 5ETXA 2VU8E 3S69A 3A8BA 1J15A 1BCUH 1FIWA 1MTVA 2W7SA 4Z6AH 2FX4A 5JYIA 4RKOB 1F0RA 2D26C 2J9NA 5E0JA 1V2ST 3VB7A 3GCOA 3LJJA 1O2WA 2Y7XA 5GDSH 3UR6A 3ATLA 1BOQA 1DANH 1V2WT 2RA0A 2W26A 3LC5A 1IHSH 1EPTA 2PGBB 2ZQ2A 2ZCKP 2I6SA 4ZKOU 1EATA 4XBBA 4LZ1H 1ZGIA 2BY9X 2XC4A 1P2OA 2O8MA 2AGIX 1DSTA 1OXGA 2ODPA 2HGTH 3S0NA 2BM2A 3GCTG 5JPMH 3EE0B 2OXSA 3KQBA 4U30A 1IQIA 2B9LA 5C67A 3AASA 6ESTA 5EXLA 1ZYOA 4BXSA 1HAPH 4CBOA 4Q7YA 1EP6A 2ANMH 3A7VA 3GY5A 1SGIB 2BDCA 1MTSA 2GCHF 2QY0B 2H2ZA 2D8WA 2PKSB 4ESTE 2R2WU 4I8LA 3EA9A 4J2YB 3T28A 2H9TH 2KAIB 4Q80A 1YPKH 1AO5A 1C5SA 1LHFH 2AGGX 1X7AC 2ZECA 1P2IA 3TJVA 1BMAA 2ZF0H 4B73A 4DW2U 1GCDA 1TGNA 3BV9B 3Q77A 2XTTB 4ZKRU 1E34B 4XOJA 5T3HA 1NS3A 2PLXA 1ZLRA 5DP6A 3ATMA 2VGCB 2KAIA 1EP5A 1XUGA 2TGDA 2P94A 2ZU4A 2ALPA 2FTLE 1CSOE 3BTEE 3T5FH 5F8XA 1WCZA 1U6QA 1Y59T 5A2MH 1O5BB 4K1TA 1CT4E 2QXIA 1ABIH 1SGNE 1TFXA 4OS5A 2IN2A 3FAOA 3E90B 3SV7A 2SGFE 1J8AA 5C1UA 2GCTB 3VB4A 1GMHF 1TPOA 1SG8B 2STBE 2F91A 2ZC9H 1LKBA 1UK3A 2ASUB 2EEKA 1K1PA 1TE0A 3TLOA 1C5OH 3RXFA 3ZV8A 1SC8U 2VWLA 1N8OC 1BJVA 2P16A 1UVTH 1TGSZ 1O2OA 1BJUA 3TH2H 3QZRA 1AY6H 3LC3A 3PV4A 1SI5H 1TB6H 2GV6A 4XBDA 5EQRA 5HMAA 1CA8B 1PQ8A 3LH1A 3UR9A 1ZPZA 3BTQE 4F4OC 1HFDA 4JK5A 2JETB 1FY1A 3BSQA 1QBVH 3CS0A 4FVDA 2AIQA 1TIOA 4DGJA 1XUHA 5ESBA 1GHZA 1N6YA 2FOGA 1EB1H 2AMDA 3SV2H 3MU1A 4ABDA 1Y5BT 1YKTA 4ISOA 3HKJB 1J17T 3GCTF 1QL9A 4K69A 1ZPCA 3HKIB 1P2JA 3M35A 1YC0A 3ZVAA 1GI7B 2ZGJA 2GVFA 2ZHFH 3A7WA 5EPNA 1O2XA 1E38B 2BQ7B 3LIWA 1MAYA 1A46H 5DP4A 5L2ZH 2PKSC 1O3BA 4U32A 3SI3H 1G37A 2EI8A 2OBQA 2B8OH 2WUCA 3UQOA 1G2MA 1QGFA 2HLCA 4MPVA 1ESBA 1S0RA 1EJAA 3OSYA 1QB9A 3M5OA 5ESTE 1G30B 4ZXXH 2BTCE 1HAOH 3BTGE 1KYNA 3OYPA 3SOSA 1C1VH 2A7CA 1UTJA 3F9HA 1PJPA 3Q3YA 1PPFE 4UEHH 1AU8A 1LQEA 2VGCC 3T26A 1UTQA 1KLTA 1TNIA 3EA7A 4BAQB 1XUKA 4YOIA 3LJOA 5EOKA 9ESTA 1A5HA 1O2HA 3E0PB 1HUTH 1LO6A 1G3BA 3QTOH 1E35B 4HFPB 1AZ8A 3QUMP 1RJXB 1WU1A 1WQSA 2PW8H 5CHAB 2BOHB 5A8YA 3K6ZA 1PPCE 1KDQB 3GCHB 1CU1A 1KSNA 2GCTC 1CHOG 1C5LH 1L2EA 2O8WA 5F8ZA 3SNBA 3AW1A 1O3CA 1ZPBA 3SGBE 4X6MA 4DJZB 2ZEBA 1C1PA 2ZTXA 3PLBA 4IGDA 1QQ4A 4OS4A 1OWIA 2VIQA 4X6PA 2RA3A 3RC4A 3RXMA 1EAXA 1DWEH 5I25A 1Z7KA 4U2WA 3BEFB 1SGTA 1O5EH 1O38A 1TNHA 4MDSA 1UTPA 1C5NH 4WH8A 3ELAH 1FY4A 3TPIZ 2QYIA 4ABJA 1JIRA 4X8TH 3I78A 2WPLS 1BDAA 3PMHB 1FZZA 5E2OA 4X8VH 4YLUA 5K7RA 3VGCC 2BYAX 2PFEA 1P0SH 1O3IA 2JETC 2PKAA 1ESAA 2H9HA 2HWLB 5EQSA 4Y71A 3KGPA 5IYTA 3PWBA 3VXFH 2R0KA 1BUIA 1O2LA 2JH5D 3DT0H 2BHGA 4IBLH 1TPSA 3CS7A 4KELA 1NO9H 4K5ZA 1M9UA 1DICA 1MKXH 2FO9A 3LGYA 1O32A 1FDPA 2J34A 4NWLA 1MCVA 1DLEA 1BZXE 1C2EA 1EXFA 4ISNA 1UMAH 4Z0KA 5JBCS 5A09A 1SGFA 1T8NA 2WV4A 2QXHA 1TALA 1S82A 3HPTB 3U9AH 4TY6A 2J92A 1W0ZU 1C5PA 1C1SA 2BX4A 2Z9IA 1ZZZA 3L3TA 3BTWE 1BBRK 1BTZA 2G4UA 2GTBA 1UVOA 2W3IA 4Y7AA 1NRRH 4A1TA 3TJOA 2ZA5A 1O2MA 3LH3A 6LPRA 3ZZ4A 5FAHA 3DFJA 1DDJA 1O2YA 3GY3A 1K1JA 1BMLA 4K1EA 1MUEB 2A7HA 2ZCHP 2SGEE 2VIVA 2SGQE 4B2AA 2CMYA 1O30A 3RDZA 1SGFG 1YCPK 4D9QA 1SQTA 3SBKA 1IQFA 3I77A 4Y0YE 2QA9E 1HIAB 3ZVBA 1ORFA 2ZU1A 3RLYH 2TPIZ 2SGDE 3TIUA 2QC2A 5CHAC 2XWBI 1BRAA 1T8LA 2ZGHA 1TX7A 4ABFA 1UJ1A 1B7XB 3GCHC 1CHOF 4O03A 2BD9A 1Y5UT 2NU4E 3GISB 1P09A 4UFGH 2C8ZB 1GJ7B 1XMNB 3HK6B 1TBQH 2F9BH 1HAGE 2OQ5A 1AUJA 1GI8B 1HGTH 4ZAEA 1MCTA 2VB0A 3MI4A 4MG3A 5HM2A 1MD8A 2QN5T 1HAYB 3QO6A 1O3HA 4FU9A 5LPRA 5ABWA 1HIAA 1GJBB 3SU2A 1GJ8B 1WAYB 4X1NU 3URCA 1HRTH 1MD7A 4ISHH 1OKXA 5EW1H 1RD3B 1O5FH 1UVSH 2ZGXH 1A0LA 1YF4A 4K1SA 1F5KU 4YZUA 2ANKH 4KTUA 1KIGH 2A32A 2ODYB 4Y79A 1EAWA 2FPZA 1KTTB 4XE4A 4FUBA 3VB5A 3PLKA 2ZU5A 1MH0A 4DY7B 1RTFB 3A83A 4WVPE 4Y7BA 1PPGE 2Z9LA 3QN7A 2WINI 2IPHA 1PQ7A 1NRPH 2Z3DA 1O3GA 1MTUA 2QAAA 4NIXA 2AS9A 2ULLA 5DJ7A 2A4OA 1O3EA 1Y3XA 1GVZA 3LOXA 1S6FA 1LVOA 1FY8E 5DP9A 2EI7A 3RLWH 3DUXH 4GHTA 4MTBA 4ABEA 3SHCH 4ABHA 3A7ZA 2GZ7A 1XX9A 3HGPA 4BAOB 2ZTZA 3L33A 2UWPA 1OWJA 5EQQA 3SU5A 2ZIQH 4NWKA 1O2PA 5J4QA 1P2NA 3EYDA 2WYJA 3BTFE 3KN2A 4CBNA 1GBCA 3F6UH 1KXCA 4FUJA 1CHGA 1FXYA 2V3HH 4IMZA 2VVCA 3P8NA 1SOZA 2A31A 3TH4H 3GY6A 1SLUB 1ZTLA 4UDWH 1IQHA 1O2QA 1GPZA 1W10U 5CMXH 1K21H 3P8GA 4DIHH 4FU7A 3SU1A 1QRXA 2K1QA 5L6NH 1CT2E 1MTNC 5I46H 2ZFFH 1J14A 2V6NA 2XBWA 4WF8A 1MQ5A 1GDUA 3FZZA 1C5ZB 4D8NA 1ZSLA 1GJ9B 4BAHB 1QB1A 3PB1E 3RXIA 3IG6B 3VEQB 1KXBA 2OUAA 2H1UA 3ZVGA 3GY2A 1V6DA 1JWTA 4THNH 1P04A 1MMJN 1YPLH 4JZEH 2G52A 3ZVDA 1E37B 4AZ2B 2ESTE 2ZCLP 1NN6A 1W0YH 3BN9A 1S84A 4NZLA 3RXKA 1C4U2 2BY5X 4IN2A 3MNXA 2C8WB 2RCEA 2HNTE 2C3SA 1EAIA 3UTUH 3P70B 1W14U 3SJKA 1NT1A 1C1QA 2BDHA 2F9UA 1Z1JA 2NU3E 3BG4C 2TGAA 1YLCA 1MZDA 2G8TA 1LHGH 4DVAU 1DUEA 1UTMA 1BRBE 1CO7E 5LPFA 4KGAA 3ZZ8A 4JZFH 3UWIA 1DY9A 3A80A 1P11E 3A7TA 2XXLA 1K2I1 1YPHE 4BXWA 1BTYA 1KXDA 3A8CA 1YPJH 4I8HA 1W12U 1CA0C 1ESTA 3AAUA 4YOJA 1TBRH 1H8IH 3SU4A 5SGAE 1BQYA 1MKWH 4NA8A 1FUJA 3RXLA 2EI6A 2EA3A 2M5TA 4XBCA 1AN1E 2XC0A 2BX3A 1O3LA 1JRSA 1EPTB 1F5RA 4KTCA 2A4GA 3ZZ5A 4ZKNU 1ZMNA 3GY8A 3URDA 1Y8TA 2VINA 1PQAA 1EB2A 1SGRE 1GJ5H 2BDBA 5PTPA 4NG9H 1C5QA 3DA9B 3RXUA 1OWDA 3MHWU 2OINA 3ZZBA 1SQAA 4JCNA 3RXRA 1MTWA 5DKMA 5FCRA 1B0FA 2ZKSA 5JB8S 3RXCA 4CRBA 4JMYA 1NY22 1DFPA 1HAVB 4GSOA 4GHQA 4OGXA 4X8SH 3SQHE 1SFIA 1CQQA 4UFEH 4MNXA 1IQKA 1AD8H 1KTSB 2ODQA 2O8LA 1GBMA 1RFNA 1C1WH 2YNBA 4M7GA 1IQLA 3RXGA 1DLKB 2BZ6H 4FU8A 1AWHB 2BZAA 4Y11E 4ZUHA 4HZHA 4B1TA 1XVMA 1P2QA 3T2NA 1AUTC 4JZ1A 3MNBA 2RDLA 4UONA 1TGBA 1NM6A 2DE8A 2UWLA 3SU3A 5DGJA 5C3NA 1KXAA 3LU9B 4X2XA 1YYY1 1A4WH 4SGBE 1HAVA 1CT0E 3A8AA 4CRAA 1C5UA 1T7CA 4ISLA 4JYUH 2GV7A 1O3OA 3UFAA 1TNKA 3Q76A 1Z8JB 1QBOA 2FZZA 5GXPA 1ELBA 4Y10E 4ZHLU 1L1JA 1GHBG 1SHHB 1BITA 1VZQH 3B8JA 3QGJA 3DFLA 1D3PB 3TJNA 4BOHA 3LGIA 3RU4E 4FUIA 3KQDA 1V2JT 3QX5H 1ELDE 2R9PA 4KKDA 1DXWA 1EZSC 3RXSA 4ZHAA 2ZQ1A 1XKAC 1G2LA 2Y6TA 1V2TT 3DD2H 1XM1A 1ACBE 4YLQH 1P12E 1RTKA 2GD4B 3SUEA 5HGGA 3P6ZB 4FUFA 2C90B 3A7XA 2XCNA 2Y82A 3RU4D 2ZU3A 1TA2A 4K3JA 2H5DA 1Z8IB 1G3EA 2J2UA 3ENSB 1N6XA 1DUAA 3H7TA 3M37A 1Z6JH 1OS8A 1YBWA 1CE5A 5K0HA 3P95A 1INCA 3T62A 3RMNH 2O8UA 2UWOA 1GMCF 1CGJE 2H9EH 2ZZUH 4WMDA 3ZZ7A 2Y7ZA 2P3UB 2Q6DA 1EPTC 1H4WA 3TK9A 4XDEA 2HPQH 1K1LA 1O2KA 3I29A 1QA0A 8GCHG 1C9TA 1WUNH 2Z6BD 1SLXB 5CE1A 1L4ZA 4ABAA 3SQEE 3SV9A 3RXBA 4XFQA 1O3JA 1GI6A 1LVMA 4WMFA 1QNJA 5L30H 2J4IA 3F9EA 3ATKA 1F92A 5GCHG 1THRH 4QT8C 1Y3UA 1TGCA 1TMTH 4YOGA 3ZYEA 1T32A 2AIPA 3ZZ3A 2SNWA 4LZ4B 1GI3A 1DWCH 1TWXB 4F49A 2QXJA 2BMGB 5H4IB 4B2BA 2XBVA 2BQ6B 2P8OB 5IDKA 3OY5U 1A7SA 2P59A 2ZFPH 2ZHWH 2TGTA 1SLVB 2PTNA 1EAUA 1HLTH 1KLIH 1ZRBA 1ZSKA 3MNSA 2FOMB 3LGVA 3FVFB 2DUCA 1A2CH
chains in the Genus database with same CATH superfamily
3AAVA 4OGYA 1L1NA 1D6WA 3B23B 3E0NB 4FOUC 2OCVB 1G3CA 3M36A 1HJ9A 5E8EH 4RSPA 3BTTE 2WPKS 3WY8A 1KXEA 7LPRA 1RGQA 4FVBA 4TWWA 1V2RT 1UCYH 1GHBF 1E0FD 3S9CA 5C94A 3PO1B 5EU8A 4DCDA 4FUEA 4BTUB 2WPIS 1AVXA 3F2FA 3VB3A 1A5GH 3RMOH 2OC1A 3S9BA 5HXFA 1NRNH 3D65E 3U98H 4DURA 2RG3A 1HJAB 3PWCA 1FJSA 2UUFB 3VB6A 1BA8B 2C8XB 8KME2 3MH7A 1ANDA 1AMHA 1B5GH 1RRKA 2KM0A 2BD2A 2A1DB 3FFGA 1AB9B 2G55A 2FI5E 2FLBH 3R3GB 1EASA 2R3UA 1BRCE 1E36B 5A0BA 3FP7E 4Q7ZA 5C1YA 1UW7A 2LELA 1V2UT 4DT7B 1VGCB 3TGIE 1C2DA 2G5VA 1IAUA 4X1QU 4X1SU 1HJ8A 1KY9A 5KEDA 2FX6A 4X2WA 4MNWA 1MU8B 5C5NA 2Z9GA 1AE8H 1O2NA 3M5MA 2C93B 1RIWB 3D62A 2YOLA 2FS9A 1N1LA 7GCHG 1HDTH 1ZHMA 1GHAG 2PKAB 1THSH 3AW0A 4TT3D 2BD3A 1Y5AT 3F9GA 1V2QT 1PPHE 3NKKA 4BANB 5HYOA 3S7HB 1H9IE 8GCHF 2A2QH 1ZR0A 1BRUP 5EGMA 3MQKC 4Y8YA 3G01A 1P10A 1O2RA 5EG4A 2P95A 1P06A 2AERH 2WHXA 2Y5HA 4Q2KA 1ETRH 1EZUC 2F9VA 1TONA 4ABGA 1GJ6A 3KQ5A 3PROA 3RXAA 1RXPA 3T29A 3KEEA 2AMQA 1BTWA 2K0QA 1WSSH 1AWFH 2QF0A 3LDXH 1GBJA 2JH0D 1D3TB 2VIDA 5GCHF 3VXEH 4RN6A 3F3BA 3M7UA 3BF6H 2O9QA 2QF3A 3A88A 2TBSA 5EJLA 1KLJH 3VFEA 1UTLM 3A86A 1C2LA 2WPJS 4MPUA 1EJNA 1CVWH 1L4DA 2GJGA 3BIVH 1ELAA 1H1BA 5FPYA 1ID5H 1TGTA 5FCKA 1YLNA 2QIQA 3OU0A 2J97A 3PTNA 4CRGA 1DS2E 4K8BA 1DOJA 3UNQA 1UTOA 3SU6A 4B2CA 1ELTA 5GWZA 4X2YA 4AB9A 1QA7A 3MU4A 2Q6FA 2GZ8A 1C5RA 1H8HD 1GL0E 1P2MA 1JBUH 3BEUA 1AFQB 1LDTT 3H09A 3ZVCA 4X6NA 3PO1C 1WBGB 3M5LA 4E06H 3SGQE 1G9IE 1TRNA 1C4V2 2AHME 1O2ZA 2ANWA 2QV1A 2FOAA 1HB0B 2ZU2A 4JZIA 1GL1A 5LH8A 2UUKB 1WQVH 3V12A 1C5MD 2BOKA 3UPEA 2BVXH 2BVRH 5GNDA 1AB9C 2SGPE 3T27A 2J5UA 2VNTA 5JB9S 4OM9A 4KTSA 2J38A 3E91A 1MKXK 5C0UA 3BEIB 4I33A 1OPHB 1O37A 1VGCC 2P3FH 1ANCA 3C1KA 4FUCA 2J95A 5TCAA 3FN8A 2CXVA 1DSUA 1S83A 2G51A 1SB1H 1AFEH 1RIWC 4NFEA 2G4TA 3W94A 4Y6DA 7GCHF 3ZZ9A 1PPEE 1AZZA 1GI0A 1GHAF 3FP8E 1MAXA 1C1OA 2AMPA 2BD8A 4AN7A 3IWMA 2NU1E 1K1NA 2NU0E 5B6OA 3RXVA 3KQCA 2G00A 4ZHMU 1TNJA 2K8IA 3UOUA 4XRNA 1BTPA 5DO4H 5DP7A 1GMDG 1BIOA 2A4QA 1FLEE 2FOCA 1XUJA 3V13A 1E1QD 5EXMA 1DXPA 1EUFA 2WV5A 4FUDA 1UTNA 4Y8ZA 3UIRA 1VR1H 2F3CE 3E8LA 4GUXA 1LHEH 2JKHA 1GJCB 3PM3A 2Y81A 1TAWA 1ABJH 4NIWA 5F6MA 2H6MA 3ATWA 3MH4A 1TRYA 4WY3A 2FTMA 3FZDA 2FESH 2VVVA 4NGAH 1K28D 3GY7A 1WDIA 2BY7X 1CGIE 1C1RA 1O2TA 1OX1A 1DE7H 4GLYA 3OY6U 1F5LA 3RU4T 1QJ1B 1UVPA 1GI4A 4A6LA 1ZOMA 4D7GA 1S85A 4GCHG 1C1TA 3ZZCA 2FWWA 5L2YH 5DSFA 1BBRE 2GT8A 2J98B 3F9FA 4I31A 5A8ZA 4YM9A 8ESTE 1NROH 1P2KA 2TIOA 4WH6A 2BD5A 3U8RH 5GPIB 3QZQA 1FV9A 1K1IA 1EX3A 4MLFB 4AG2A 2H5CA 1O2UA 3HGNA 3RC6A 2QGRA 1ZJDA 2WUBA 1O5AB 1ELCA 3NXPA 4LK4A 2CF8H 4AYYB 5A8XA 1IQNA 4K2YA 5C5OA 3EQ0H 1AFQC 4ZROA 3SGAE 4ISIH 3U8OH 1D6RA 2J98A 1DY8A 4INLA 1DT2A 4I32A 2CGAA 1ANEA 4A7IB 1ELFA 1K1MA 3UREA 1L1GA 1OWEA 2VBCA 1W13U 3NK8A 4UD9H 1GBHA 5FXLA 1LTOA 1TRMA 2GP9B 2P93A 2VVUA 1ZMLA 3Q3KA 1GI2A 1GCTB 3RXPA 1O2JA 1W11U 1SGQE 3D49H 2YMSD 1WV7H 2PV9B 2BVSH 4NCYA 1FNIA 3UWJH 1AQ7A 4GPGA 3SNDA 1P57B 5FPTA 2XNDD 3UY9A 1OOKB 3NPSA 3PMJA 1BB0B 2Y5GA 3BG8A 2CN0H 1O35A 3S9AA 4A1XA 1IQJA 5HIZA 3HK3B 3TH3H 1GJ4H 3FANA 1QB6A 1TPPA 2HRVA 2ZFRH 1O0DH 2PSXA 4ACAA 1PFXC 3AK5A 1EZQA 1O3PB 1KMHB 3AVZA 1P9UA 1V2LT 3SJ9A 2ZI2H 2BDAA 1GMDF 1Y3VA 5E0HA 4AORA 2FDAA 4RKJB 2QXGA 3FKSD 3SUDA 1HV7A 1GBLA 4A5TS 2F83A 4IC5A 1O3AA 5HIYA 2PP6A 1MBQA 1WOFA 1C2KA 1GI9B 4HGCA 5JDUB 2YNAA 3C27B 3B9FH 4HG6A 2A5KA 1XVOA 7KMEH 3SZNA 3TGKE 2HNTC 2VIWA 3JZ2B 4OS1A 3UNSA 1C2IA 4B74A 1FAKH 3TK5A 5EODA 5AFYH 1H9LB 2XRCA 1ELVA 4ZMAH 3RC5A 4I8GA 3CENA 2BD4A 2Z3CA 5T6GA 3F2HA 3DSPA 1QJ6B 4BTTB 2V3OH 1VCPA 1C2FA 4GCHF 1WXRA 1QCPA 1TOMH 3GDVA 3V3MA 4CHAB 3M5NA 1EZXC 1TMUH 3MO3A 1K22H 5DN6D 2ZFQH 2EC9H 2UUJB 3MH5A 3SN8A 3ZZAA 1OSSA 2TGPZ 4IC6A 4LOYH 4Z1MD 3SORA 1FONA 1AE5A 1GDNA 4MPWA 5GIBA 3KYGA 1O5CB 1TX8A 2KCYA 3PV2A 4K8YA 1K0HA 4A1VA 3M3VA 2C8YB 3RMMH 1TPAE 1PPZA 3RXEA 4AGJA 4D9RA 3EAJA 1YPHC 1P8VC 3GDSA 1UHBB 1ETTH 2C4FH 3KQEA 3A81A 4LXBH 1FN8A 1VITH 5FX5A 3V0XA 2XCFA 1CBWB 1ELEE 2OC7A 3TJUA 2FP7B 2R3YA 2D2DA 2GT7A 2FOFA 3M7QA 1DWBH 2F43B 3IITA 1C2HA 2HNTF 1C1NA 2QCYA 5DP3A 1LVYA 2VIPA 1BTHH 1UHBA 4NIVA 3FP6E 1GCTC 4IS5A 3SV6A 5DK1A 5EPYA 5G4BA 1F0TA 1MKWK 1P02A 3GDUA 1FIZA 4E7RG 2IPQX 5E2PA 2WPHS 1O3NA 4TY7A 2XNIA 1O2IA 2OTVA 5FPSA 3P8OA 3Q00A 3SNAA 2HVXA 3SV8A 2BXUH 3F2GA 4R0IA 3FO8D 3TNTA 1XUIA 1QBNA 2BY6X 4IW4E 2JH6D 4NZQA 4X0WU 2HOBA 2ZHEH 4E05H 2F4LA 1L0ZA 5TCCA 3E1XB 2GDEH 4WJG2 1GVLA 1F2SE 2FIRH 3ESTA 2XYAA 3SU0A 3TNSA 1IOEA 4CRDA 5EW2H 1VCWA 2XWAA 4NSYA 3SUGA 1PPBH 2B0FA 1G3DA 1NTPA 3MOCA 1TOCB 2BLWA 1OHHD 2VIOA 1SPJA 1GBBA 3ZZDA 2F9PA 2Z9KA 1O33A 3QTVH 1T4UH 4DIIH 2OBOA 3K9XB 3MO6A 3MYWA 3QK1A 4B75A 3A85A 2R2MB 2Z7FE 1YPGH 3A87A 1SGEE 1V3XA 4ABBA 4NSVA 1LMWB 2AH4X 3QGNB 3SUFA 1JIMA 3RM0H 4AYVB 4NFFA 4JK6A 4H42U 1QY6A 1P03A 1MZAA 2CJIA 3GOVB 1BTXA 3KHVA 3H5CB 1XKBC 4X2VA 1TYNA 3ZYDA 2BY8X 4CRCA 1VITG 1YPMH 3U28C 2NWNA 1SHYA 4BAMB 1Y3WA 4O97A 4DOQA 1XXFA 1A3BH 3BTDE 4CHAC 1SGYE 1Z8GA 3ZZ6A 1FI8A 4HI3A 1TMBH 1ZTJA 2B7DH 1NZQH 1XUFA 1NFUA 4WXIA 4X6OA 4AFQA 5A0AE 1C1UH 1HAHH 3GY4A 3D23A 4GVUA 4RT1A 1JOUB 1O3DA 1CBWC 1FY5A 2ZFTA 1SBWA 2BXTH 1A3EH 3LGUA 1P01A 2ZHQH 1E1RD 1HXEH 4TPIZ 2ZGCA 3PTBA 3P8FA 1P05A 1W2KH 1GGDB 4WXVA 5T6FA 3RM2H 3RMLH 4BAKB 1O3MA 2PUQH 3EDXB 1O3KA 3F1SB 5JBAS 3UNRA 3KIDU 3V7TA 3A7YA 3MTYA 2FOHA 1SR5C 2CHAB 3O8RA 1C5XB 2FODA 1F7ZA 1WYKA 2HPPH 3VGCB 2A5IA 4R8TB 1QIXB 1YLDA 2ANYA 1SLWB 1WTHD 1FMGA 2FI3E 1GWAA 1GHWH 1NFWA 3MMGA 3RXHA 1GBAA 3GICB 1FY3A 2LPRA 1OYTH 4BTIB 2GDDA 5E0GA 4B6FA 1T8MA 1TBZH 1GBDA 2Q1JA 4UFFH 8LPRA 1QHRB 2FM2A 4AOQA 2FYRA 1QR3E 1CGHA 2GKVE 3ZVFA 1EJMA 1GBIA 3E6PH 2XW9A 4I8JA 2Z94A 2ZDKA 3LONA 2BQWB 2ZGBH 1YWUA 5DP5A 1O31A 1S5SA 5TJXA 2A4RA 3TVJB 2GGVB 3M7TA 3QLPH 1DWDH 1PQ5A 2SNVA 2V3MA 3RUOA 3TGJE 2THFB 3EGKH 3PLPA 3U1IB 1QRWA 1GI1A 1O5DH 4P02A 1Z8RA 3GYMA 3UUZA 1QTFA 4O3TA 1GVKB 1NFYA 3M3SA 2VH0A 1A61H 1OWKA 4OS7A 3O8CA 1NC6A 2PHBA 2AEIH 3M3TA 1TABE 2W7UA 1ZRKA 4VGCB 1UK4A 3UAIC 4P00A 2AGEX 2STAE 2DE9A 3NZIA 1VITF 1WTGH 2BD7A 1P3EA 4YT7H 3ATIA 1AGJA 2ZO3H 1DM4B 2UUYA 1C2JA 1LPGB 1GHXH 3OEED 1MU6B 1UCYK 2PUXB 2PGQB 1ZHPA 2FS8A 1O2VA 2BDYA 2IOTA 3MH6A 3SW2B 3TK6A 1V2VT 4ABIA 5C20A 1RTLA 1EOJA 3WWFA 1J9CH 5AFZH 4D76A 3LGWA 1AI8H 1O3FA 5B6LA 3E3TA 1SVPA 2FMJA 2WSSD 3SNCA 1D9IA 1XXDA 1ZJKA 2JIZD 3PMAB 2GMTB 1NRSH 3A82A 3DHKH 1A0HB 1H8DH 1KXFA 4H6SB 4WMEA 3K65B 5LGOA 2BDIA 2WPMS 1G36A 4WWYA 1ANBA 1PYTC 3JZ1B 4J1YA 4X1RU 1QFKH 3MO9A 3SJ8A 2J94A 1GJAB 1PYTD 1VKYA 2P3TB 3L6PA 4ZH8A 1O2SA 1SKYE 1W7XH 2OP9A 3TITA 2ZTYA 3O8DA 1BT7A 1GBFA 4B6EA 1GGDC 4IN1A 4YTAA 3NUMA 1W0JD 3U69H 3BTME 3NWUA 1TNLA 1HAIH 3MU8A 4GAWA 1KDQA 2A5AA 5CHBA 1P3CA 5KECA 3DCLA 2NU2E 2CHAC 4FXGH 4MNYA 1BMMH 1SFQB 1GBKA 1B0EA 4XSKU 6GCHG 1VCQA 1DVAH 2O8TA 4NA7A 1A5IA 1AVWA 2P8OC 2ZHDA 1G32B 2VH6A 3LPRA 1BBRH 3A89A 1F0SA 1YPEH 1LQDB 1K1OA 3ZVEA 1C2GA 1W8BH 1Z71A 3VPKA 4PROA 4MVNA 1ARCA 2LNCA 3A8DA 3KCGH 2A0QB 3OX7U 2D1JA 9LPRA 1OP8A 2ZPQA 5DPAA 2ZDVH 1C9PA 2V0BA 2ZFSA 4Q63A 1TNGA 1D3QB 1YCPH 1GBTA 3U8TH 4JYTA 4Y8XA 4AX9H 4X8UH 1C5YB 1UK2A 2GZ9A 3DSGA 1NRQH 3BTKE 1JRTA 4YXWD 2VWNA 1Q3XA 2BLOA 4TYDA 3R0FA 1HJAC 1TA6A 3S7KB 1NBME 3MU0A 1QL7A 3RXJA 1SSXA 1SGCA 2ZWLH 4INKA 5FHTA 1TQ0B 1UCYE 2VJ1A 3LT3A 3Q3XA 4E7NA 3LGTA 4TPYA 4VGCC 1C5WB 1GBEA 2VWOA 1NU9A 3DSOA 1Q2WA 4I7YH 2YMSB 5DP8A 1BHXB 2ZDMA 2W5EA 3KNXA 2WYGA 2ZDLA 3OTJE 3QDZB 4AG1A 2G81E 1GHVH 1IQGA 2FXRA 1V2NT 1QL8A 2I6QA 3GYLB 3M61U 3SO3A 1C2MA 2FOBA 1YP9A 2XBXA 1NBMD 2HALA 1UVUH 3PMBB 5JBTA 1EOLA 2FYQA 1MTNB 2PWXA 5F53A 1Z6EA 3GCNA 1ZGVA 1HNEE 5FX6A 1IHTH 1D4PB 1GJDB 1SGPE 2A2XH 1DPOA 2WV9A 4YESB 2SGAA 2Z3EA 1GG6B 3H7OA 3T25A 1VJ9U 2A45B 4YT6H 2XC5A 1OP2A 2PSYA 3W95A 6CHAB 3BIUH 4IMQA 2GMTC 3ITIA 2ZDAH 3RP2A 1VJAU 5F03A 1LKAA 1IQMA 1THPB 3KL6A 1MBMA 1ZSJA 3CP7A 2BLVA 1O39A 1AHTH 2GX4A 4MNVA 1S0QA 3F68H 4DG4A 1Q31A 1DITH 1ZMJA 2ILNA 5T6DA 2A7JA 4JZDH 3PYHA 1MQ6A 4B76A 1QJ7B 2OC8A 2ZG0H 3K2UA 1FPCH 6GCHF 1FPHH 1Y3YA 2HLDD 3BG4B 3O8BA 5LPEA 4O9VA 1NU7B 1S81A 2FOEA 3MU5A 4MPXA 4U01A 5AHGH 5J4SA 2OD3B 2Y80A 4A92A 1LHDH 4AFSA 1S6LA 4RT0A 1LVBA 4BNRA 3STIA 1K9OE 2VWMA 2IJOB 1F0UA 1AKSB 1A0JA 4UFDH 5EXNA 1FQ3A 2ALVA 1NFXA 2Z9JA 4CREA 5EIYA 2ZP0H 1JMOH 2OLGA 4H6TA 2FLRH 1ETSH 3SJOA 1JXPA 4CRFA 7ESTE 3P17H 1IQEA 3KF2A 1S6HA 1CA0B 1SMFE 2BB4A 3N7OA 2CF9H 4TSFD 2WZQA 1OP0A 4NIYA 5C17A 3ODFA 1SOTA 3ODDA 3SNEA 1HCGA 2EQNA 4D7FA 3MWIU 3NCLA 1EKBB 1DX5M 1AKSA 1COWD 1D3DB 1W7GH 2OQUA 1T4VH 4Q7XA 4Y0ZE 3A84A 2TRMA 3QWCH 1YM0A 3HATH 2F9NA 4AGKA 4K60A 1O36A 2FI4E 1ARBA 2W6JD 1ELGA 1OYQA 2YMSC 2W3KA 1QQUA 3ZV9A 4NA9H 1Z1IA 1T31A 1BTUA 4UE7H 5FBIA 1V2PT 5AF9H 1T8OA 4HTCH 1GI5A 4OS2A 3TU7H 1FN6A 3P92A 1W3CA 1LPZB 1BMNH 2G5NA 2KFWA 3BTHE 1HXFH 4TWYA 3SJIA 4AB8A 3RXOA 3K6YA 3U1JB 3UQVA 2ZNKH 2JJ2D 4CR5A 4ASHA 1H9HE 2PTCE 1GG6C 4AFUA 2F9OA 1V2OT 1HBTH 1O34A 1AVGH 6CHAC 1UTKA 3E16B 4INHA 3EA8A 5HM9A 1UO6A 3RXTA 1QZ8A 2GCHG 2B5TB 1OWHA 1O5GH 1YGCH 2ZDNA 5AVDA 2CV3A 4ZKSU 3RXDA 1J16A 1GDQA 3KYFA 3RXQA 1C4Y2 1HAXB 2OC0A 1EQ9A 1NPMA 5C2ZA 2AYWA 1FAXA 4CR9A 5C1XA 1H8ED 3UOPA 2BLQA 2PR3A 4ZXYH 2XBYA 1AIXH 1ZHRA 1O2GH 2ZPSA 2R0LA 2Y5FA 1SGDE 5A0CA 1HYLA 1LCYA 5BRRE 5DG6A 1V2MT 1BHXF 4B71A 4KP0A 1TLDA 1SL3A 1YCPM 2CK3D 3SHAH 3STJA 1SQOA 1TQ7B 2SFAA 1LHCH 1NESE 4MQAA 4AFZA 1RS0A 4FUGA 4X1PU 1C1MA 4H4FA 2BDGA 2V35A 1ZTKA 4I8KA 1V2KT 4OS6A 1A1RA 4CH8B 3SI4H 4O3UA 2Q6GA 3FOAA 3MNCA 1C5VA 1TX6A 2AFQB 5JBBS 3LKWA 4SGAE 1GHYH 1GMHG 4Y76A 5F8TA 5BPEA 3WWBA 2FEQH 1P9SA 4FUHA 5FBEA 5HKKD 3MFJA 4JYVH 3PV5A 1HAZB 5GJ4B 1GMCG 4CH2B 1QRZA 1LPKB 1HPGA 1C5TA 4YO9A 2ZPRA 1N8OB 1QURH 5ETXA 2VU8E 3S69A 3A8BA 1J15A 1BCUH 1FIWA 1MTVA 2W7SA 4Z6AH 2FX4A 5JYIA 4RKOB 1F0RA 2D26C 2J9NA 5E0JA 1V2ST 3VB7A 3GCOA 3LJJA 2W6ID 1O2WA 2Y7XA 5GDSH 3UR6A 3ATLA 1BOQA 1DANH 1V2WT 2RA0A 2W26A 3LC5A 1IHSH 1EPTA 2PGBB 2ZQ2A 2ZCKP 2I6SA 4ZKOU 1EATA 4XBBA 4LZ1H 1ZGIA 2BY9X 2XC4A 2OK5A 1P2OA 2O8MA 2AGIX 1DSTA 1OXGA 2ODPA 2HGTH 3S0NA 2BM2A 3GCTG 5JPMH 3EE0B 3PRDA 2OXSA 3KQBA 4U30A 1IQIA 2B9LA 5C67A 3AASA 6ESTA 5EXLA 1ZYOA 4BXSA 1HAPH 2QF4A 4CBOA 4Q7YA 1EP6A 2ANMH 3A7VA 3GY5A 1SGIB 2BDCA 1MTSA 2GCHF 2QY0B 2H2ZA 2D8WA 2PKSB 4ESTE 2R2WU 4I8LA 3EA9A 4J2YB 3T28A 3VG8A 2H9TH 2KAIB 4Q80A 1YPKH 3ZIAD 1AO5A 1C5SA 1LHFH 2AGGX 1X7AC 2ZECA 1P2IA 3TJVA 1BMAA 2ZF0H 4B73A 4DW2U 1GCDA 1TGNA 3BV9B 3Q77A 2XTTB 4ZKRU 1E34B 4XOJA 5T3HA 1NS3A 2PLXA 1ZLRA 5DP6A 3ATMA 2VGCB 2KAIA 1EP5A 1XUGA 2TGDA 2P94A 2ZU4A 2ALPA 2FTLE 1CSOE 3BTEE 3T5FH 2RFKC 3N7DA 5F8XA 1WCZA 1U6QA 1Y59T 1FX0B 5A2MH 1O5BB 4K1TA 1CT4E 2QXIA 1ABIH 1SGNE 1TFXA 4OS5A 2IN2A 3FAOA 3E90B 3SV7A 2SGFE 1J8AA 3EE7A 5C1UA 2GCTB 3VB4A 1GMHF 1TPOA 1SG8B 5EJZA 2STBE 2F91A 2ZC9H 3OTPA 1LKBA 1UK3A 2ASUB 2EEKA 1K1PA 1TE0A 3TLOA 1C5OH 3RXFA 3ZV8A 1SC8U 2VWLA 1N8OC 1BJVA 1BMFD 2P16A 1UVTH 1TGSZ 1O2OA 1BJUA 3TH2H 3QZRA 1AY6H 3LC3A 3PV4A 1SI5H 1TB6H 2GV6A 4XBDA 5EQRA 5HMAA 1CA8B 1PQ8A 3LH1A 3UR9A 1ZPZA 3BTQE 4F4OC 1HFDA 4JK5A 2JETB 1FY1A 3BSQA 1QBVH 3CS0A 4FVDA 2AIQA 1TIOA 1MABB 4DGJA 1XUHA 5ESBA 1GHZA 1N6YA 2FOGA 1EB1H 2AMDA 3SV2H 3MU1A 4ABDA 1Y5BT 1YKTA 4ISOA 3HKJB 1J17T 3GCTF 1QL9A 4K69A 1ZPCA 3HKIB 1P2JA 5KGOA 3M35A 1YC0A 3ZVAA 1GI7B 2ZGJA 2GVFA 2ZHFH 3A7WA 5EPNA 2RDEA 1O2XA 1E38B 2BQ7B 3LIWA 1MAYA 1A46H 5DP4A 5L2ZH 2PKSC 1O3BA 4U32A 3SI3H 1G37A 2EI8A 2OBQA 2B8OH 2WUCA 3UQOA 1G2MA 1QGFA 2HLCA 4MPVA 1ESBA 1S0RA 1EJAA 3OSYA 1QB9A 3M5OA 5ESTE 1G30B 4ZXXH 3NRLA 2BTCE 1HAOH 3BTGE 1KYNA 3OYPA 3SOSA 1C1VH 2A7CA 1UTJA 3F9HA 1PJPA 3Q3YA 1PPFE 4UEHH 1AU8A 1LQEA 2VGCC 3T26A 1UTQA 1SQRA 1KLTA 1TNIA 3EA7A 4BAQB 1XUKA 4YOIA 3LJOA 2KCAA 5EOKA 1A5HA 9ESTA 1O2HA 3E0PB 1HUTH 1LO6A 1G3BA 3QTOH 1E35B 4HFPB 1AZ8A 3QUMP 1RJXB 1WU1A 1WQSA 4DT4A 2PW8H 5CHAB 2BOHB 5A8YA 3K6ZA 1PPCE 1KDQB 3GCHB 3SYJA 1CU1A 2QF5A 1KSNA 2GCTC 1CHOG 1C5LH 1L2EA 2O8WA 5F8ZA 3SNBA 5EJ1A 3AW1A 1O3CA 1ZPBA 3SGBE 4X6MA 4DJZB 2ZEBA 1C1PA 2ZTXA 3PLBA 4IGDA 1QQ4A 4OS4A 1OWIA 2VIQA 4X6PA 2RA3A 3RC4A 3RXMA 1EAXA 1DWEH 5I25A 3N99A 1Z7KA 4U2WA 3BEFB 1SGTA 1O5EH 1O38A 1TNHA 4MDSA 1UTPA 1C5NH 4WH8A 3ELAH 1FY4A 3TPIZ 2QYIA 4ABJA 1JIRA 4X8TH 3I78A 2WPLS 1BDAA 3PMHB 1FZZA 5E2OA 4X8VH 4AC9A 4YLUA 5K7RA 5FL7D 3VGCC 2BYAX 2PFEA 1P0SH 1O3IA 2JETC 2PKAA 1YY3A 1ESAA 2H9HA 2V7QD 2HWLB 5EQSA 4Y71A 3KGPA 5IYTA 3PWBA 3VXFH 2R0KA 1BUIA 1O2LA 2JH5D 3DT0H 2BHGA 4IBLH 1TPSA 3WW7A 5IK2D 3CS7A 4KELA 1NO9H 4K5ZA 1M9UA 1DICA 1MKXH 2FO9A 3LGYA 1O32A 1FDPA 4F48B 2J34A 4NWLA 1MCVA 1DLEA 1BZXE 1C2EA 1EXFA 4ISNA 1UMAH 4Z0KA 5JBCS 5A09A 1SGFA 1T8NA 2WV4A 3OFND 2QXHA 1TALA 1S82A 3HPTB 3U9AH 4TY6A 2J92A 1W0ZU 1C5PA 1C1SA 2BX4A 2Z9IA 1ZZZA 3L3TA 3BTWE 1BBRK 1BTZA 2G4UA 2GTBA 1UVOA 2W3IA 4Y7AA 1NRRH 3F0PA 2KCPA 2QE7D 4A1TA 3TJOA 2ZA5A 1O2MA 3LH3A 4ACBA 2KR7A 6LPRA 3ZZ4A 5FAHA 3DFJA 1DDJA 1O2YA 3GY3A 1K1JA 1BMLA 4K1EA 1MUEB 2A7HA 2ZCHP 2SGEE 2VIVA 2SGQE 4B2AA 2CMYA 1O30A 3RDZA 1SGFG 1YCPK 4D9QA 1SQTA 3SBKA 1IQFA 3I77A 4Y0YE 2QA9E 1HIAB 3ZVBA 1ORFA 2ZU1A 3RLYH 2TPIZ 2SGDE 3TIUA 2QC2A 5CHAC 2XWBI 1BRAA 1T8LA 2ZGHA 1TX7A 4ABFA 1UJ1A 1B7XB 3GCHC 1CHOF 4O03A 2BD9A 1Y5UT 2NU4E 3GISB 1P09A 4UFGH 2C8ZB 1GJ7B 1XMNB 3HK6B 1TBQH 2F9BH 1HAGE 2OQ5A 1AUJA 1GI8B 1HGTH 4ZAEA 1MCTA 2VB0A 3MI4A 4MG3A 5HM2A 1MD8A 2QN5T 1HAYB 3QO6A 1O3HA 4FU9A 5LPRA 5ABWA 1HIAA 3SZEA 1GJBB 3SU2A 1GJ8B 1WAYB 4X1NU 3URCA 1HRTH 1MD7A 4ISHH 1OKXA 5EW1H 1RD3B 1O5FH 1UVSH 2ZGXH 1A0LA 1YF4A 4K1SA 1F5KU 4YZUA 2ANKH 4KTUA 1KIGH 2A32A 2ODYB 4Y79A 1EAWA 2FPZA 1KTTB 4XE4A 4FUBA 3VB5A 3PLKA 2ZU5A 1MH0A 4DY7B 1RTFB 3A83A 4WVPE 4Y7BA 1PPGE 2Z9LA 3QN7A 2WINI 2IPHA 1PQ7A 1NRPH 2Z3DA 1O3GA 1MTUA 2QAAA 4NIXA 2AS9A 2ULLA 5DJ7A 2A4OA 1O3EA 1Y3XA 1GVZA 3LOXA 1S6FA 4ASUD 1LVOA 1FY8E 5DP9A 2EI7A 3OAAD 3RLWH 3DUXH 4GHTA 4MTBA 4ABEA 1E79D 3SHCH 3A7ZA 4ABHA 2GZ7A 1XX9A 3HGPA 2M2AA 4BAOB 2ZTZA 3L33A 2UWPA 1OWJA 5EQQA 3SU5A 2ZIQH 4NWKA 1O2PA 3PRBA 5J4QA 1P2NA 3EYDA 2WYJA 3BTFE 3KN2A 4CBNA 1GBCA 3F6UH 1KXCA 3N7EA 4FUJA 1CHGA 1FXYA 2V3HH 4IMZA 2VVCA 3P8NA 1SOZA 2A31A 3TH4H 3GY6A 1SLUB 2WPDD 1ZTLA 4UDWH 1IQHA 1O2QA 1GPZA 1W10U 5CMXH 1K21H 3P8GA 4DIHH 4FU7A 3SU1A 1QRXA 2K1QA 5L6NH 1CT2E 1MTNC 5I46H 2ZFFH 1J14A 2V6NA 2XBWA 4WF8A 1MQ5A 1GDUA 3FZZA 1C5ZB 4D8NA 1ZSLA 1GJ9B 4BAHB 1QB1A 3PB1E 4Q4LA 3RXIA 3IG6B 3VEQB 1KXBA 2OUAA 2H1UA 3ZVGA 3GY2A 1V6DA 1JWTA 1W0KD 4THNH 1P04A 1MMJN 1YPLH 4JZEH 2G52A 3ZVDA 1E37B 4AZ2B 2ESTE 2ZCLP 1NN6A 1W0YH 3BN9A 2KZ4A 1S84A 4NZLA 3RXKA 1C4U2 4ZCNA 2EY4C 2JJ1D 2BY5X 4IN2A 3MNXA 3CNRA 2C8WB 2RCEA 2HNTE 2C3SA 1EAIA 3UTUH 3P70B 1W14U 3SJKA 1NT1A 1C1QA 2BDHA 2F9UA 1Z1JA 2NU3E 3BG4C 2TGAA 1YLCA 1MZDA 2G8TA 2LP6A 1LHGH 4DVAU 4RI0A 1DUEA 1UTMA 1BRBE 1CO7E 5LPFA 4KGAA 3ZZ8A 4JZFH 3UWIA 1DY9A 3A80A 1P11E 3A7TA 2XXLA 1K2I1 1YPHE 4BXWA 1BTYA 1KXDA 3A8CA 1YPJH 4I8HA 1W12U 1CA0C 1ESTA 3AAUA 4YOJA 1TBRH 1H8IH 3SU4A 5SGAE 1BQYA 1MKWH 4NA8A 1FUJA 3RXLA 5CDFE 2EI6A 2EA3A 2M5TA 4XBCA 1AN1E 2XC0A 2BX3A 1O3LA 1JRSA 1EPTB 1F5RA 4KTCA 2A4GA 3ZZ5A 4ZKNU 1ZMNA 3GY8A 3URDA 1Y8TA 2VINA 1PQAA 1EB2A 1SGRE 1GJ5H 2BDBA 5PTPA 3F0OA 4NG9H 1C5QA 3DA9B 3RXUA 1OWDA 3MHWU 2OINA 3ZZBA 1SQAA 4I86A 4JCNA 3RXRA 1MTWA 5DKMA 5FCRA 2KCOA 1B0FA 2ZKSA 5JB8S 3RXCA 4CRBA 4JMYA 1NY22 1DFPA 2HVYB 1HAVB 4GSOA 4GHQA 4OGXA 4X8SH 3SQHE 1SFIA 1CQQA 4UFEH 4MNXA 1IQKA 1AD8H 1KTSB 2ODQA 3W1EA 2O8LA 1GBMA 1RFNA 1C1WH 2YNBA 4M7GA 1IQLA 3RXGA 2JDID 1DLKB 2BZ6H 4FU8A 1AWHB 2BZAA 4Y11E 4ZUHA 4HZHA 4B1TA 1XVMA 1P2QA 3T2NA 1AUTC 4JZ1A 3MNBA 2RDLA 4UONA 1TGBA 1NM6A 2DE8A 2UWLA 3SU3A 5DGJA 5C3NA 1KXAA 3LU9B 4X2XA 1YYY1 1A4WH 3OE7D 4SGBE 1HAVA 1CT0E 3A8AA 4CRAA 1C5UA 1T7CA 4ISLA 4JYUH 2GV7A 1O3OA 3UFAA 1TNKA 3Q76A 1Z8JB 1QBOA 2FZZA 5GXPA 1ELBA 4Y10E 4XD7D 4ZHLU 1L1JA 1GHBG 1SHHB 1BITA 1VZQH 3B8JA 3QGJA 3DFLA 1D3PB 4M9FA 3TJNA 5C0TA 5T1VA 4BOHA 3LGIA 3RU4E 4FUIA 3KQDA 1V2JT 3QX5H 3UB0A 1ELDE 2R9PA 4KKDA 1DXWA 1EZSC 3RXSA 4ZHAA 3GS9A 2ZQ1A 1XKAC 2KX4A 1G2LA 2Y6TA 1V2TT 3DD2H 1XM1A 1ACBE 4YLQH 4F55A 1P12E 1RTKA 2GD4B 3SUEA 4FETA 2L6OA 1EFRD 3P6ZB 5HGGA 4FUFA 2C90B 3A7XA 2XCNA 2Y82A 3RU4D 2ZU3A 1TA2A 4K3JA 2H5DA 1Z8IB 1G3EA 2J2UA 3ENSB 1N6XA 1DUAA 3H7TA 3M37A 1Z6JH 1OS8A 1YBWA 1CE5A 5K0HA 3P95A 1INCA 3T62A 3RMNH 2O8UA 2UWOA 1GMCF 1CGJE 2H9EH 2ZZUH 4WMDA 3ZZ7A 2Y7ZA 2P3UB 2Q6DA 1EPTC 1H4WA 3TK9A 4XDEA 2HPQH 1K1LA 1O2KA 3I29A 1QA0A 8GCHG 1C9TA 1WUNH 2Z6BD 1SLXB 5CE1A 1L4ZA 4ABAA 3SQEE 3SV9A 3RXBA 4XFQA 1O3JA 1GI6A 1LVMA 4WMFA 1QNJA 5L30H 2J4IA 3F9EA 2IJD1 3ATKA 1F92A 5GCHG 1THRH 2XOKD 4QT8C 1Y3UA 1TGCA 1TMTH 4YOGA 3ZYEA 1T32A 2AIPA 3OEHD 2SNWA 3ZZ3A 4LZ4B 1GI3A 1DWCH 1TWXB 4F49A 2QXJA 2BMGB 5H4IB 4B2BA 2XBVA 2BQ6B 2P8OB 5IDKA 3OY5U 1A7SA 2P59A 2ZFPH 2ZHWH 2TGTA 1SLVB 2PTNA 1EAUA 1HLTH 1KLIH 1ZRBA 1ZSKA 3MNSA 2FOMB 3LGVA 3FVFB 2DUCA 1A2CH 2L74A
chains in the Genus database with same CATH topology
3AAVA 4OGYA 1L1NA 1D6WA 3B23B 3E0NB 2OCVB 1G3CA 3M36A 1HJ9A 5E8EH 4RSPA 3BTTE 2WPKS 3WY8A 1KXEA 7LPRA 1RGQA 4FVBA 4TWWA 1V2RT 1UCYH 1GHBF 1E0FD 3S9CA 3PO1B 5EU8A 4DCDA 4FUEA 4BTUB 2WPIS 1AVXA 3VB3A 1A5GH 3RMOH 2OC1A 3S9BA 5HXFA 1NRNH 3D65E 3U98H 4DURA 2RG3A 1HJAB 3PWCA 1FJSA 2UUFB 3VB6A 1BA8B 2C8XB 8KME2 3MH7A 1ANDA 1AMHA 1B5GH 1RRKA 2BD2A 2A1DB 3FFGA 1AB9B 2G55A 2FI5E 2FLBH 3R3GB 1EASA 2R3UA 1BRCE 1E36B 5A0BA 3FP7E 4Q7ZA 5C1YA 1V2UT 4DT7B 1VGCB 3TGIE 1C2DA 2G5VA 1IAUA 4X1QU 4X1SU 1HJ8A 1KY9A 2FX6A 4X2WA 4MNWA 1MU8B 5C5NA 2Z9GA 1AE8H 1O2NA 3M5MA 2C93B 1RIWB 3D62A 2YOLA 2FS9A 1N1LA 7GCHG 1HDTH 1ZHMA 1GHAG 2PKAB 1THSH 3AW0A 2BD3A 1Y5AT 3F9GA 1V2QT 1PPHE 3NKKA 4BANB 5HYOA 3S7HB 1H9IE 8GCHF 2A2QH 1ZR0A 1BRUP 5EGMA 4Y8YA 3G01A 1P10A 1O2RA 5EG4A 2P95A 1P06A 2AERH 2Y5HA 4Q2KA 1ETRH 1EZUC 2F9VA 1TONA 4ABGA 1GJ6A 3PROA 3RXAA 1RXPA 3T29A 3KEEA 2AMQA 1BTWA 1WSSH 1AWFH 2QF0A 3LDXH 1GBJA 2JH0D 1D3TB 2VIDA 5GCHF 3VXEH 4RN6A 3M7UA 3BF6H 2O9QA 2QF3A 3A88A 2TBSA 1KLJH 3VFEA 1UTLM 3A86A 1C2LA 2WPJS 4MPUA 1EJNA 1CVWH 1L4DA 3BIVH 1ELAA 1H1BA 5FPYA 1ID5H 1TGTA 5FCKA 2QIQA 3OU0A 3PTNA 4CRGA 1DS2E 4K8BA 1DOJA 3UNQA 1UTOA 3SU6A 4B2CA 1ELTA 5GWZA 4X2YA 4AB9A 1QA7A 3MU4A 2Q6FA 2GZ8A 1C5RA 1GL0E 1P2MA 1JBUH 3BEUA 1AFQB 1LDTT 3ZVCA 4X6NA 3PO1C 1WBGB 3M5LA 4E06H 3SGQE 1G9IE 1TRNA 1C4V2 1O2ZA 2ANWA 2QV1A 2FOAA 1HB0B 2ZU2A 4JZIA 1GL1A 5LH8A 2UUKB 1WQVH 3V12A 1C5MD 2BOKA 3UPEA 2BVXH 2BVRH 1AB9C 2SGPE 3T27A 2VNTA 5JB9S 4KTSA 2J38A 3E91A 1MKXK 3BEIB 4I33A 1OPHB 1O37A 1VGCC 2P3FH 1ANCA 3C1KA 4FUCA 2J95A 5TCAA 2CXVA 1DSUA 1S83A 2G51A 1SB1H 1AFEH 1RIWC 4NFEA 2G4TA 3W94A 4Y6DA 7GCHF 3ZZ9A 1PPEE 1AZZA 1GI0A 1GHAF 3FP8E 1MAXA 1C1OA 2AMPA 2BD8A 4AN7A 3IWMA 2NU1E 1K1NA 2NU0E 5B6OA 3RXVA 3KQCA 2G00A 4ZHMU 1TNJA 3UOUA 1BTPA 5DO4H 5DP7A 1GMDG 1BIOA 2A4QA 1FLEE 2FOCA 1XUJA 3V13A 5EXMA 1DXPA 1EUFA 2WV5A 4FUDA 1UTNA 4Y8ZA 3UIRA 1VR1H 2F3CE 3E8LA 4GUXA 1LHEH 2JKHA 1GJCB 3PM3A 2Y81A 1TAWA 1ABJH 4NIWA 5F6MA 2H6MA 3ATWA 3MH4A 1TRYA 4WY3A 2FTMA 3FZDA 2FESH 2VVVA 4NGAH 1K28D 3GY7A 2BY7X 1CGIE 1C1RA 1O2TA 1OX1A 1DE7H 4GLYA 3OY6U 1F5LA 3RU4T 1QJ1B 1UVPA 1GI4A 4A6LA 1ZOMA 4D7GA 1S85A 4GCHG 1C1TA 3ZZCA 2FWWA 5L2YH 1BBRE 2GT8A 4I31A 3F9FA 5A8ZA 4YM9A 8ESTE 1NROH 1P2KA 2TIOA 4WH6A 2BD5A 3U8RH 5GPIB 3QZQA 1FV9A 1K1IA 1EX3A 4MLFB 4AG2A 2H5CA 1O2UA 3HGNA 3RC6A 2QGRA 1ZJDA 2WUBA 1O5AB 1ELCA 3NXPA 4LK4A 2CF8H 4AYYB 5A8XA 1IQNA 4K2YA 5C5OA 3EQ0H 1AFQC 4ZROA 3SGAE 4ISIH 3U8OH 1D6RA 4INLA 1DY8A 1DT2A 4I32A 2CGAA 1ANEA 4A7IB 1ELFA 1K1MA 3UREA 1L1GA 1OWEA 1W13U 3NK8A 4UD9H 1GBHA 5FXLA 1LTOA 1TRMA 2GP9B 2P93A 2VVUA 1ZMLA 3Q3KA 1GI2A 1GCTB 3RXPA 1O2JA 1W11U 1SGQE 3D49H 1WV7H 2PV9B 2BVSH 4NCYA 1FNIA 3UWJH 1AQ7A 4GPGA 3SNDA 1P57B 5FPTA 3UY9A 1OOKB 3NPSA 3PMJA 1BB0B 2Y5GA 3BG8A 2CN0H 1O35A 3S9AA 4A1XA 1IQJA 3HK3B 3TH3H 1GJ4H 3FANA 1QB6A 1TPPA 2HRVA 2ZFRH 1O0DH 2PSXA 1PFXC 1EZQA 1O3PB 3AVZA 1P9UA 1V2LT 3SJ9A 2ZI2H 2BDAA 1GMDF 1Y3VA 5E0HA 4AORA 2FDAA 4RKJB 2QXGA 3SUDA 1HV7A 1GBLA 4A5TS 2F83A 4IC5A 1O3AA 1MBQA 1WOFA 1C2KA 1GI9B 4HGCA 5JDUB 2YNAA 3C27B 3B9FH 2A5KA 1XVOA 7KMEH 3SZNA 3TGKE 2HNTC 2VIWA 3JZ2B 4OS1A 3UNSA 1C2IA 4B74A 1FAKH 3TK5A 5EODA 5AFYH 1H9LB 2XRCA 1ELVA 4ZMAH 3RC5A 4I8GA 3CENA 2BD4A 2Z3CA 5T6GA 1QJ6B 4BTTB 2V3OH 1VCPA 1C2FA 4GCHF 1QCPA 1TOMH 3GDVA 3V3MA 4CHAB 3M5NA 1EZXC 1TMUH 3MO3A 1K22H 2ZFQH 2EC9H 2UUJB 3MH5A 3SN8A 3ZZAA 1OSSA 2TGPZ 4IC6A 4LOYH 3SORA 1FONA 1AE5A 1GDNA 4MPWA 5GIBA 1O5CB 1TX8A 4K8YA 4A1VA 3M3VA 2C8YB 3RMMH 1TPAE 1PPZA 3RXEA 4AGJA 4D9RA 3EAJA 1YPHC 1P8VC 3GDSA 1UHBB 1ETTH 2C4FH 3KQEA 3A81A 4LXBH 1FN8A 1VITH 5FX5A 3V0XA 2XCFA 1CBWB 1ELEE 2OC7A 3TJUA 2FP7B 2R3YA 2D2DA 2GT7A 2FOFA 3M7QA 1DWBH 3IITA 1C2HA 2HNTF 1C1NA 2QCYA 5DP3A 1LVYA 2VIPA 1BTHH 1UHBA 4NIVA 3FP6E 1GCTC 4IS5A 3SV6A 5DK1A 5EPYA 5G4BA 1F0TA 1MKWK 1P02A 3GDUA 1FIZA 4E7RG 5E2PA 2WPHS 1O3NA 4TY7A 2XNIA 1O2IA 2OTVA 5FPSA 3P8OA 3Q00A 3SNAA 2HVXA 3SV8A 2BXUH 4R0IA 3TNTA 1XUIA 1QBNA 2BY6X 4IW4E 2JH6D 4NZQA 4X0WU 2HOBA 2ZHEH 4E05H 1L0ZA 5TCCA 3E1XB 2GDEH 4WJG2 1GVLA 1F2SE 2FIRH 3ESTA 2XYAA 3SU0A 3TNSA 1IOEA 4CRDA 5EW2H 1VCWA 2XWAA 4NSYA 3SUGA 1PPBH 2B0FA 1G3DA 1NTPA 3MOCA 1TOCB 2BLWA 2VIOA 1SPJA 1GBBA 3ZZDA 2F9PA 2Z9KA 1O33A 3QTVH 1T4UH 4DIIH 2OBOA 3K9XB 3MO6A 3MYWA 3QK1A 4B75A 3A85A 2R2MB 2Z7FE 1YPGH 3A87A 1SGEE 1V3XA 4ABBA 4NSVA 1LMWB 2AH4X 3QGNB 3SUFA 1JIMA 3RM0H 4AYVB 4NFFA 4JK6A 4H42U 1QY6A 1P03A 1MZAA 2CJIA 3GOVB 1BTXA 3KHVA 3H5CB 1XKBC 4X2VA 1TYNA 3ZYDA 2BY8X 4CRCA 1VITG 1YPMH 2NWNA 1SHYA 4BAMB 1Y3WA 4O97A 4DOQA 1XXFA 1A3BH 3BTDE 4CHAC 1SGYE 1Z8GA 3ZZ6A 1FI8A 4HI3A 1TMBH 1ZTJA 2B7DH 1NZQH 1XUFA 1NFUA 4WXIA 4X6OA 4AFQA 5A0AE 1C1UH 1HAHH 3GY4A 3D23A 4GVUA 1JOUB 1O3DA 1CBWC 1FY5A 2ZFTA 1SBWA 2BXTH 1A3EH 3LGUA 1P01A 2ZHQH 1HXEH 4TPIZ 2ZGCA 3PTBA 3P8FA 1P05A 1W2KH 1GGDB 4WXVA 5T6FA 3RM2H 3RMLH 4BAKB 1O3MA 2PUQH 3EDXB 1O3KA 3F1SB 5JBAS 3UNRA 3KIDU 3V7TA 3A7YA 3MTYA 2FOHA 1SR5C 2CHAB 3O8RA 1C5XB 2FODA 1F7ZA 1WYKA 2HPPH 3VGCB 2A5IA 4R8TB 1QIXB 1YLDA 2ANYA 1SLWB 1WTHD 1FMGA 2FI3E 1GWAA 1GHWH 1NFWA 3MMGA 3RXHA 1GBAA 3GICB 1FY3A 2LPRA 1OYTH 4BTIB 2GDDA 5E0GA 1T8MA 1TBZH 1GBDA 2Q1JA 4UFFH 8LPRA 1QHRB 2FM2A 4AOQA 2FYRA 1QR3E 1CGHA 2GKVE 3ZVFA 1EJMA 1GBIA 3E6PH 2XW9A 4I8JA 2Z94A 2ZDKA 3LONA 2BQWB 2ZGBH 5DP5A 1O31A 1S5SA 5TJXA 2A4RA 3TVJB 2GGVB 3M7TA 3QLPH 1DWDH 1PQ5A 2SNVA 3RUOA 3TGJE 2THFB 3EGKH 3PLPA 3U1IB 1QRWA 1GI1A 1O5DH 3UUZA 1Z8RA 3GYMA 1QTFA 4O3TA 1GVKB 1NFYA 3M3SA 2VH0A 1A61H 1OWKA 4OS7A 3O8CA 1NC6A 2PHBA 2AEIH 3M3TA 1TABE 2W7UA 1ZRKA 4VGCB 1UK4A 2AGEX 2STAE 2DE9A 3NZIA 1VITF 1WTGH 2BD7A 1P3EA 4YT7H 3ATIA 1AGJA 2ZO3H 1DM4B 2UUYA 1C2JA 1LPGB 1GHXH 1MU6B 1UCYK 2PUXB 2PGQB 1ZHPA 2FS8A 1O2VA 2BDYA 2IOTA 3MH6A 3SW2B 3TK6A 1V2VT 4ABIA 5C20A 1RTLA 1EOJA 1J9CH 5AFZH 4D76A 3LGWA 1AI8H 1O3FA 3E3TA 1SVPA 2FMJA 3SNCA 1D9IA 1XXDA 1ZJKA 3PMAB 2GMTB 1NRSH 3A82A 3DHKH 1A0HB 1H8DH 1KXFA 4H6SB 4WMEA 3K65B 5LGOA 2BDIA 2WPMS 1G36A 4WWYA 1ANBA 1PYTC 3JZ1B 4J1YA 4X1RU 1QFKH 3MO9A 3SJ8A 2J94A 1GJAB 1PYTD 2P3TB 3L6PA 4ZH8A 1O2SA 1W7XH 2OP9A 3TITA 2ZTYA 3O8DA 1BT7A 1GBFA 1GGDC 4IN1A 4YTAA 3NUMA 3U69H 3BTME 3NWUA 1TNLA 1HAIH 3MU8A 4GAWA 1KDQA 2A5AA 1P3CA 2NU2E 2CHAC 4FXGH 4MNYA 1BMMH 1SFQB 1GBKA 1B0EA 4XSKU 6GCHG 1VCQA 1DVAH 2O8TA 4NA7A 1A5IA 1AVWA 2P8OC 2ZHDA 1G32B 2VH6A 3LPRA 1BBRH 3A89A 1F0SA 1YPEH 1LQDB 1K1OA 3ZVEA 1C2GA 1W8BH 1Z71A 3VPKA 4PROA 4MVNA 1ARCA 2LNCA 3A8DA 3KCGH 2A0QB 3OX7U 2D1JA 9LPRA 1OP8A 2ZPQA 5DPAA 2ZDVH 1C9PA 2V0BA 2ZFSA 1TNGA 1D3QB 1YCPH 1GBTA 3U8TH 4JYTA 4Y8XA 4AX9H 4X8UH 1C5YB 1UK2A 2GZ9A 1NRQH 3BTKE 1JRTA 2VWNA 1Q3XA 2BLOA 4TYDA 3R0FA 1HJAC 1TA6A 3S7KB 3MU0A 1QL7A 3RXJA 1SSXA 1SGCA 2ZWLH 4INKA 5FHTA 1TQ0B 1UCYE 2VJ1A 3LT3A 3Q3XA 4E7NA 3LGTA 4TPYA 4VGCC 1C5WB 1GBEA 2VWOA 1NU9A 4I7YH 1Q2WA 5DP8A 1BHXB 2ZDMA 2W5EA 3KNXA 2WYGA 2ZDLA 3OTJE 3QDZB 4AG1A 2G81E 1GHVH 1IQGA 2FXRA 1V2NT 1QL8A 2I6QA 3GYLB 3M61U 3SO3A 1C2MA 2FOBA 1YP9A 2XBXA 3PMBB 2HALA 1UVUH 5JBTA 1EOLA 2FYQA 1MTNB 2PWXA 1Z6EA 3GCNA 1ZGVA 1HNEE 5FX6A 1IHTH 1D4PB 1GJDB 1SGPE 2A2XH 1DPOA 4YESB 2SGAA 2Z3EA 1GG6B 3H7OA 3T25A 1VJ9U 2A45B 4YT6H 2XC5A 1OP2A 2PSYA 3W95A 6CHAB 3BIUH 4IMQA 2GMTC 3ITIA 2ZDAH 3RP2A 1VJAU 5F03A 1LKAA 1IQMA 1THPB 3KL6A 1MBMA 1ZSJA 3CP7A 2BLVA 1O39A 1AHTH 2GX4A 4MNVA 1S0QA 3F68H 4DG4A 1Q31A 1DITH 1ZMJA 2ILNA 5T6DA 2A7JA 4JZDH 3PYHA 1MQ6A 4B76A 1QJ7B 2OC8A 2ZG0H 3K2UA 1FPCH 6GCHF 1FPHH 1Y3YA 3BG4B 3O8BA 5LPEA 4O9VA 1NU7B 1S81A 2FOEA 3MU5A 4MPXA 4U01A 5AHGH 5J4SA 2OD3B 2Y80A 4A92A 1LHDH 4AFSA 1LVBA 4BNRA 3STIA 1K9OE 2VWMA 2IJOB 1F0UA 1AKSB 1A0JA 4UFDH 5EXNA 1FQ3A 2ALVA 1NFXA 2Z9JA 4CREA 2ZP0H 1JMOH 2OLGA 4H6TA 2FLRH 1ETSH 3SJOA 1JXPA 4CRFA 7ESTE 3P17H 1IQEA 3KF2A 1S6HA 1CA0B 1SMFE 2BB4A 3N7OA 2CF9H 1OP0A 4NIYA 3ODFA 1SOTA 3ODDA 3SNEA 1HCGA 4D7FA 3MWIU 3NCLA 1EKBB 1DX5M 1AKSA 1D3DB 1W7GH 2OQUA 1T4VH 4Q7XA 4Y0ZE 3A84A 2TRMA 3QWCH 1YM0A 3HATH 2F9NA 4AGKA 4K60A 1O36A 2FI4E