1TGCA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgcA02
1DY8A 1XUGA 2Y5FA 1UTKA 1GI1A 2TBSA 4NCYA 1K1NA 2Z9JA 5A8XA 2NU3E 1SR5C 1FN8A 1KLTA 1DLEA 1IHTH 3BTGE 4FU8A 2PTCE 8GCHG 1ANEA 4CH2B 3K6ZA 8KME2 3E1XB 2O8TA 2WYGA 3E3TA 1BMLA 2ZGXH 1YPHC 2V3HH 4IMQA 3GY7A 1UJ1A 2Q6GA 1G3DA 1O0DH 1W2KH 3VB4A 1BUIA 1QURH 4CRDA 1KYNA 3RC6A 3Q3KA 1GHAG 3FP7E 3SNEA 3RXSA 1QB6A 3A8AA 3LKWA 4UFFH 2P8OC 3ZZ4A 1NM6A 1ETRH 5EGMA 5DGJA 1G3BA 1K9OE 4GCHG 1UVOA 1ZHMA 4IMZA 1S6FA 1KTSB 1C1PA 2RCEA 3SV9A 3GY2A 4UFGH 1WV7H 2J95A 1QRXA 3BIUH 3QDZB 3DUXH 3O8BA 1O2YA 2ZU4A 4WXIA 2TRMA 5C20A 1J15A 4E05H 4ZUHA 4BXWA 5G4BA 4Y8YA 1P2OA 2A7HA 1A1RA 1HRTH 2ZG0H 1KXEA 4KP0A 1C1TA 1GG6C 4LK4A 1B0EA 3RXPA 2CF9H 2FX4A 3OX7U 1GBTA 2OC7A 3L6PA 1OWHA 1LVBA 3TJNA 1DWDH 4NZQA 3FZZA 2FLBH 1ELTA 1QQUA 1AUJA 3RM0H 1BTYA 5CE1A 2VINA 3RXJA 1LVMA 4YZUA 1LQEA 1YCPH 1YPGH 1QIXB 2AYWA 2PUQH 1FY8E 4U01A 2GCHF 4TY6A 1CA0B 3BIVH 5E0HA 2RDLA 2F9BH 1SBWA 3HGPA 3HKIB 3OSYA 4AYYB 4WMEA 3LH3A 1MU8B 1GI5A 4WY3A 1AY6H 3RLWH 3FP6E 1QA0A 1CA8B 4JCNA 1D3PB 3M5LA 1TNGA 2SGEE 3A7TA 1AIXH 5EW1H 1E34B 3I78A 2J92A 2P3UB 3TH4H 2OLGA 3TPIZ 1WCZA 2ZDLA 4X8TH 1OWKA 4IC6A 1EPTC 1YPMH 1MKXH 1UCYH 1CVWH 2ZP0H 4FUGA 1GMCG 2QC2A 1TPSA 2W5EA 5JB8S 3GY4A 2FXRA 5GXPA 4A1XA 3UNSA 1HAPH 1O2NA 2IJOB 1K1OA 2QY0B 1GVKB 3K6YA 3DFJA 1W14U 3C27B 4I8GA 1AVWA 1YKTA 2HALA 3A7VA 3FVFB 3NK8A 4YM9A 1FMGA 3TK9A 4CBNA 1T4UH 2CXVA 2G5NA 4MLFB 1S85A 3IITA 1BZXE 1FY5A 2PKAB 1XMNB 3F1SB 4RSPA 5I25A 3P95A 1MU6B 1ZGVA 2Q1JA 1ESBA 3SJKA 2C90B 3M5NA 1ARBA 2OBQA 1A0HB 1FLEE 4NG9H 2QXGA 2ZFSA 4Y6DA 1P2JA 2ZEBA 4OS5A 1SC8U 4GLYA 1ANBA 4IW4E 1EJMA 2G00A 1O38A 2UWLA 1BQYA 4DG4A 1FN6A 1GHAF 2ZFQH 1DS2E 2TGAA 4IN2A 1IAUA 5C1YA 2R3UA 4OGXA 5AF9H 3U69H 2Z3EA 1ZSLA 3ZZ3A 8LPRA 4GCHF 3RXCA 4X1SU 1AWHB 2BMGB 3UY9A 1FIZA 3GCTF 2RA3A 2TPIZ 1O32A 1P2QA 3FFGA 2ZCLP 3BTKE 3M7UA 2BD9A 2FTLE 1O30A 1GHVH 2AEIH 5C5OA 2H9TH 1EJNA 1EZQA 1UVSH 3MTYA 3MYWA 2WPKS 4ZHAA 3DHKH 4ISHH 4MNXA 1FIWA 2FOFA 3BG8A 2ZDVH 1BBRE 2XC5A 1TRNA 2EEKA 1MBQA 1LVYA 1QY6A 3SNBA 4ASHA 1V2JT 1N1LA 3EYDA 4CHAB 1BITA 1V6DA 3UNQA 1C5WB 2GCTB 4ABBA 4OS2A 2Y82A 2ZQ2A 2R0KA 3M5OA 3SUGA 1WYKA 3MO3A 4XOJA 4KTCA 3QGNB 3O8CA 1TNLA 1XVOA 4CRCA 3VB7A 1ID5H 1PPZA 3SU3A 3SU0A 1P9UA 1HBTH 1S83A 2P59A 5DP5A 1DWBH 4X1NU 3N7OA 2A7CA 1YCPM 1O39A 1L1GA 2PW8H 2W7UA 2XNIA 2XWAA 2ZDAH 3I77A 3LDXH 3E6PH 9ESTA 1GHWH 1ABJH 1MKWH 1AZ8A 1DY9A 1THPB 2ZHWH 3P8GA 3RXRA 1GHBF 4DGJA 5JPMH 1GI6A 1LPGB 3BTFE 3ZVEA 1OYQA 3BTEE 3SU1A 1CSOE 1PQ5A 1H1BA 1KXCA 3GOVB 3T29A 3SV8A 3T2NA 4WMFA 3WY8A 3P92A 5F8XA 1IQGA 1GCTB 1G3EA 2BDAA 4AG2A 2DE9A 1LMWB 3TH2H 4AZ2B 1BHXB 4I7YH 5TCCA 4CH8B 1OOKB 5LPEA 3VB5A 4FUBA 3LGTA 1FY4A 3SJ8A 1GWAA 3UNRA 5C2ZA 3ZZ7A 2BQWB 2LNCA 3BTQE 4O3TA 1AFEH 1YPKH 3ZVBA 2ZDKA 3EDXB 2EA3A 1HB0B 2SGAA 3ZZAA 2BTCE 1OX1A 5T3HA 1GBHA 3PM3A 1H8DH 2VB0A 3L33A 1SGPE 2GV6A 3QK1A 3BTHE 1C1RA 1PFXC 1MD8A 3U8TH 5EQRA 3MU8A 3ATMA 2BQ7B 3Q77A 1CGIE 2W7SA 1EP5A 3SI3H 3SJ9A 4X8VH 1IHSH 3KQEA 1BJVA 3TH3H 3STJA 1SOTA 3EA9A 2B9LA 3KIDU 1SQTA 2ZC9H 1TE0A 2FODA 3LH1A 1HUTH 1BTZA 1SGQE 4A1TA 1BTWA 3Q3YA 1G32B 4AFZA 5CHAB 1P2NA 3SUDA 1GJCB 1DICA 2AMPA 1UTPA 4YOIA 2Y7XA 3E91A 4OS4A 3AVZA 4I8JA 1ANCA 1QHRB 2QF0A 1JWTA 1KSNA 4J1YA 4J2YB 1Z8IB 3FANA 1BTUA 2KAIA 1UO6A 2J2UA 1PYTC 1A3EH 2R2MB 1DXWA 3M7TA 1AVXA 5FCKA 2VIDA 1K1LA 5AVDA 4FVBA 2M5TA 1O2RA 4BTUB 2BVSH 4BAKB 3U98H 1GGDB 2WUBA 3SW2B 1L4ZA 3UFAA 3OTJE 4H6TA 1HLTH 4GSOA 1MMJN 4HFPB 2V6NA 1LO6A 3KF2A 3O8DA 2PR3A 1ZYOA 1Y5AT 1S6HA 2PLXA 1P9SA 1C2MA 1P09A 2OC8A 5E0GA 1P12E 3GISB 1IQLA 1ELCA 4LZ1H 1G36A 3ZVAA 2BY8X 2G81E 1O2HA 1D6RA 4GAWA 4XSKU 3T28A 4MPUA 1HAZB 1EOJA 4TPYA 1C5UA 2BD8A 1MCVA 1TABE 3ATWA 3BTTE 4NIXA 1AB9C 1RGQA 1GHYH 1F0UA 4AORA 4XDEA 3RXLA 1O3NA 1INCA 1S84A 4FU7A 5F8TA 4D7GA 5K0HA 5A0BA 5LGOA 1TPAE 1JRTA 1EQ9A 2ZF0H 1FPHH 3UOPA 3RXVA 3RXOA 2SFAA 2QCYA 2P95A 4BAOB 1TMBH 2QA9E 1C1MA 1K2I1 1LHFH 4MVNA 2B7DH 1ZZZA 4K1TA 4DCDA 1J14A 5C67A 1LHCH 1PPFE 2ZFPH 4TWWA 1JXPA 1C2FA 2PKSC 1SLXB 5FBIA 1VCQA 4JMYA 1CU1A 3HK3B 7GCHF 1CHOG 3FAOA 2PV9B 3LC3A 3VB6A 4ZHLU 3ZZ6A 3TK6A 5DK1A 2ZNKH 1EUFA 1G2MA 4OS1A 3TGKE 1J8AA 1FUJA 2C93B 2Z9KA 4INHA 1GI7B 1OWJA 5FCRA 1O2GH 1Z1IA 2H9HA 2CMYA 2XBVA 1UTNA 1CT2E 1VGCC 1XXFA 2FI4E 1HJ8A 2VVUA 2YNAA 2ZKSA 1JRSA 2ZFRH 1MUEB 1N8OC 3ZYEA 4X2YA 1SG8B 1D3DB 1UVPA 1JOUB 4NA9H 1NFYA 1CBWB 3TLOA 1ZTJA 2ZHEH 1BDAA 2JETC 1HJAB 2GCHG 3NCLA 4BOHA 3E8LA 1KXDA 3GCHC 3SBKA 4ZXXH 1FNIA 5FPTA 1C2JA 1GL1A 5JB9S 5GIBA 1KXBA 1A0LA 3BEIB 1YYY1 4R8TB 1XUJA 1TX6A 1PPHE 2R0LA 6LPRA 2VIWA 1ZLRA 5C1UA 1TQ7B 1K1JA 2WYJA 1WOFA 1ZMJA 1OP2A 3LC5A 1V2UT 1BIOA 4YO9A 1C1OA 1V2LT 3VGCB 1ESTA 2ZU2A 1KXFA 1Z7KA 3B9FH 1HDTH 3MMGA 1QL8A 4Y10E 3LJOA 1BMMH 2A4QA 1V2TT 3LONA 2HRVA 3RXEA 1YPLH 3OY5U 4TWYA 3S7HB 2BY5X 1TMTH 3BG4C 1E38B 4AB9A 1YCPK 4GPGA 4X2WA 1C5XB 1HJ9A 1L2EA 1UTLM 1O3IA 1SGYE 2ASUB 1O3EA 4CREA 1O5DH 4JZIA 5A2MH 1W8BH 2FI5E 1G3CA 4Y7AA 1O2JA 3F6UH 1P0SH 6CHAB 1XX9A 5I46H 1CGHA 2DUCA 4NA7A 1THSH 2BDGA 1IQIA 3KCGH 4CRAA 2YNBA 3PTBA 2F9PA 2ODYB 3ATIA 4UE7H 1W0ZU 1TBQH 4ISIH 5B6OA 1HV7A 1F5RA 2A45B 1NFWA 1FY3A 1TPOA 2A1DB 1Z8JB 1MKXK 1UCYK 3QZQA 2UUYA 1GBJA 3SN8A 3ITIA 2FOMB 1DM4B 2ZGCA 3RC4A 1M9UA 1EB1H 1UHBA 1OXGA 1XKAC 3PROA 4HTCH 4VGCB 3HGNA 2V3OH 3A83A 4R0IA 1W7GH 3MNSA 1KTTB 1GMDF 3GY5A 4ZKOU 2A7JA 1BOQA 1QRZA 1MTNB 1LTOA 3QWCH 1J9CH 4MQAA 1A2CH 1SLWB 4QT8C 5EPYA 4IGDA 1AI8H 3GCTG 3KN2A 1TOCB 1TGBA 2AGIX 3F9HA 3DFLA 2O8UA 1OKXA 3PYHA 1AO5A 5JBAS 1DITH 1MQ6A 3OYPA 2FX6A 1RIWC 1C4U2 1CHOF 3KGPA 1P8VC 5GCHG 3QTVH 2Z9GA 2HGTH 3A8CA 2Y81A 5AHGH 2UWOA 1W7XH 4WVPE 3RXKA 2YOLA 1SL3A 1O34A 1AKSB 1GI8B 3A84A 1ABIH 4UEHH 6GCHF 1TAWA 2FIRH 3RXGA 1ZHPA 2BX4A 3CENA 2P3FH 2BLWA 4TY7A 1O5EH 3MWIU 5AFYH 3UREA 3LPRA 1BRAA 3ZZ9A 4IN1A 1LVOA 1AFQB 4NWLA 2VNTA 1XUFA 1ANDA 2CHAC 1GBAA 1GMHF 1NRNH 4NFEA 3TNTA 1ZSKA 3V12A 1ZTLA 1K21H 3TNSA 2FI3E 4NSYA 4UONA 1L0ZA 1GHBG 4GHTA 1W10U 1P2IA 1WAYB 4D8NA 4KTUA 1K28D 5GPIB 1G2LA 5GWZA 4AGKA 1O3CA 3RDZA 3S9CA 5PTPA 1P11E 1O2PA 2HWLB 2FOBA 1O2MA 1O3LA 5DG6A 2P16A 1F5KU 5JYIA 2FOCA 1TX7A 1MZAA 1FJSA 1RD3B 3TVJB 1O2IA 2I6SA 2NU0E 1BBRH 1IQFA 2BY9X 2J34A 4NIYA 4ZAEA 2JH0D 2ZGJA 4X6OA 4A92A 5C5NA 2XBYA 1B5GH 1Y3VA 3GYMA 5HM2A 1SHYA 1W12U 3VFEA 5DP3A 4A7IB 4RKJB 2GP9B 4KKDA 4MG3A 4MNVA 2Q6DA 1DWEH 2H5DA 4WXVA 3V7TA 4JYTA 1TGNA 1C5SA 3E0NB 1X7AC 1P03A 4WH8A 5EODA 1AE8H 4YOJA 2F3CE 4D7FA 1DUAA 1HAYB 3VEQB 3LU9B 4E7RG 1MKWK 2DE8A 1BCUH 4AG1A 3ELAH 3A88A 1ELFA 5BRRE 1LHDH 1GJ4H 2ZTXA 3QUMP 2ZA5A 2ZI2H 3VXEH 1W0YH 3A80A 1RS0A 1ZOMA 2Z94A 4FXGH 4CRFA 2ZTZA 1C1SA 2STAE 4A6LA 3QGJA 4YESB 7LPRA 1DE7H 1O5AB 1K1PA 1YGCH 1C4V2 1F92A 3RMMH 3U8OH 3AW0A 1HIAA 1RTKA 4JK6A 4K1SA 2G51A 2BVXH 1C1NA 2FZZA 4FVDA 2BX3A 3SV2H 1C5RA 1ELBA 1EB2A 3UR9A 3P8FA 1FV9A 3S69A 4X8UH 2C8YB 1CT0E 3BF6H 4X1RU 2ZFFH 4X6NA 1VJAU 2OXSA 1YP9A 2VU8E 3CS7A 3P70B 1FI8A 4FUEA 4ZKSU 3ATKA 1HXFH 3PWCA 1S82A 1GJ8B 1ZSJA 1SGCA 3SOSA 1ELEE 4ZHMU 1PYTD 4XBBA 1TRYA 1C2LA 1KDQB 4MDSA 1C2IA 3R3GB 1L1JA 1XM1A 4Q7ZA 1TMUH 1ZJKA 2C8ZB 1YLDA 3VGCC 2WPMS 1D3TB 1HAHH 3T25A 3MH6A 4OS7A 1Y3WA 2P93A 1CHGA 5GCHF 1JMOH 4JZFH 4YT7H 2FTMA 4YLUA 1TNIA 1O3AA 4ABFA 1UTOA 1Z8RA 1HAVA 1Z1JA 1DOJA 2GD4B 3T5FH 3SNAA 3ENSB 4E06H 5EPNA 2Z3DA 5EQSA 2IOTA 1V2PT 1S5SA 1UTQA 2ZDMA 1FAKH 4WF8A 4I32A 1NTPA 1QBNA 1EAXA 1Y8TA 4A1VA 2FOHA 1T32A 1P3EA 2GZ9A 4Q7YA 4Y7BA 3A7WA 2ZU1A 2ILNA 1VR1H 3M61U 4NZLA 2Z3CA 4Y0YE 3ZZ5A 2XW9A 1Z6EA 4Y11E 4I33A 1GJ7B 3GDSA 4Q7XA 1Y3YA 4K60A 4X2VA 4AGJA 1PQ7A 1SSXA 1C2GA 2FMJA 2BHGA 5FHTA 1GJ6A 3EGKH 3I29A 3LJJA 3Q3XA 1MTVA 3RU4D 5AFZH 1WUNH 1Q31A 4DOQA 2HLCA 4U32A 4CR5A 3BTDE 3RMLH 4B71A 5A8ZA 4O03A 1SGNE 2ANMH 1Y3UA 7GCHG 2B5TB 1GJ9B 4NSVA 5E8EH 3P8NA 3NXPA 1V2MT 2VWOA 4AYVB 2R9PA 2B0FA 3RMOH 3OY6U 4B2AA 2XRCA 3UPEA 1C5QA 1O3BA 1ZPCA 1DANH 1GI9B 5DP6A 1C5ZB 4X0WU 1C1UH 2FDAA 3EAJA 1K1IA 1MAYA 1Y5BT 5HMAA 3RXAA 5A0CA 2P94A 2PGBB 1RXPA 3ESTA 4MTBA 1ETSH 1C5VA 1UTMA 2QAAA 1IQEA 3MNCA 1RTFB 1SI5H 1HXEH 4SGBE 1GI3A 1KXAA 1BA8B 1XUHA 1C5MD 1MTWA 1SGTA 1NPMA 1MZDA 1TNHA 5LPRA 4Z0KA 1GI0A 2OUAA 3A85A 3V0XA 1BMAA 1G37A 5E2OA 1GVZA 1GVLA 1THRH 1U6QA 3DD2H 4NIVA 5T6DA 1ELAA 1UK2A 2P8OB 1DSTA 2GDDA 1AE5A 1P10A 2BDHA 2G5VA 3PMHB 2FYQA 3ZZCA 1N6YA 2XC0A 1AFQC 1CQQA 1SOZA 1VZQH 3CP7A 1B7XB 1CA0C 3PMAB 7ESTE 1WTHD 1GDNA 3TJUA 2PSYA 1ZRBA 3EA8A 2BD4A 3UQVA 3S0NA 4DVAU 3NUMA 1BJUA 2ZDNA 3A89A 3MU4A 1GBLA 2BD3A 2FP7B 4FUIA 3SNDA 1GG6B 2A2QH 3RU4E 1NZQH 1XKBC 2VWMA 1NESE 5FPSA 2BD7A 1O35A 4Y79A 3TIUA 3P8OA 1NN6A 1P05A 2BDBA 2VVVA 4WJG2 1UVTH 1K22H 1SB1H 1TLDA 3M7QA 1G9IE 4FUFA 3UWIA 1T8LA 1BTPA 1ELDE 2GX4A 3AAVA 2AFQB 1O3MA 1B0FA 3BSQA 3ZV8A 2ZHDA 1Q2WA 1C2KA 1XUIA 3NKKA 1P06A 1YBWA 2ANYA 1WTGH 3A81A 1LQDB 4CRGA 1D3QB 2EI7A 3IWMA 4B1TA 2F9NA 1GBBA 4UFDH 3D23A 5ETXA 4B2CA 3PTNA 1MBMA 2FOEA 1IQHA 1YLCA 3SI4H 1GMDG 2WPIS 1GBEA 3K65B 1GI2A 1T31A 2FYRA 3B8JA 3BN9A 2BLOA 5H4IB 1ARCA 2C8XB 3U9AH 3SUEA 2UUFB 4HGCA 3MOCA 3RXFA 1D4PB 1EPTB 2G4UA 2PWXA 2A5AA 1O2VA 1A5HA 8ESTE 3RXHA 4LXBH 2WV4A 1Y5UT 1PPBH 4I8KA 1TOMH 3BTWE 3F9FA 2QN5T 3HKJB 4K8YA 2NWNA 4AFUA 1GBIA 1H4WA 5J4SA 1C2HA 3QX5H 1LKAA 2OP9A 2THFB 1OWDA 2Y5HA 3RXIA 1KLIH 2D1JA 2BOHB 1DT2A 1C2DA 3S7KB 1YM0A 3ZZDA 6GCHG 2PTNA 1EZUC 1LCYA 4JYUH 3T27A 1O2XA 1VJ9U 3DA9B 3LGIA 3C1KA 3RMNH 1C4Y2 4DT7B 2BZAA 2GZ8A 1CT4E 1NU9A 2HVXA 3RU4T 5IDKA 2HNTE 4KELA 3VXFH 2VIPA 2C4FH 2XBXA 1ESAA 1O5GH 2OCVB 4BAMB 2P3TB 2UUKB 1GMHG 3A7XA 1NRQH 2W26A 2ZCHP 3F68H 3S9AA 2FS9A 1O3OA 1A0JA 3E90B 3PO1B 5E0JA 1C1QA 4CHAC 3LGVA 1VITG 2A4GA 2GCTC 3MNBA 3ZVDA 1E36B 1NROH 2TGPZ 7KMEH 4GHQA 3M5MA 1O3KA 1EAWA 4B76A 2ZU5A 1V2RT 1BRCE 4F4OC 1OP8A 1DXPA 1TFXA 1LHEH 3BV9B 3PLKA 3RXBA 4YTAA 3BEUA 1FZZA 2GT8A 1TGSZ 3A87A 2ZIQH 1FQ3A 2A0QB 4JK5A 3CS0A 1A5IA 1GBDA 2GMTB 1K1MA 1F0RA 1Y3XA 1GJDB 3KHVA 4A5TS 1QB1A 4NWKA 3RM2H 2GGVB 1BT7A 3M3SA 3VB3A 5L2YH 3AAUA 3UUZA 1BMNH 2HNTC 1MD7A 4YLQH 1LPKB 5DP7A 1TA2A 3RC5A 4MPVA 3HK6B 2ZU3A 1CGJE 5EXMA 2VGCB 3LGWA 4NFFA 1TA6A 2OC0A 1YC0A 1GCTC 3SQHE 2F9UA 4FUCA 5LH8A 4JZ1A 2CGAA 4IS5A 3ZZ8A 1F7ZA 5GJ4B 4M7GA 1BRUP 3UIRA 3TJOA 5TJXA 1LKBA 5L6NH 3TJVA 1P04A 1WQSA 3ODDA 1SHHB 1W11U 1O2UA 3ATLA 4K8BA 4WWYA 2SNWA 4ZKRU 1QJ1B 1NT1A 1AHTH 2V0BA 3E0PB 1TGTA 4HZHA 4X1QU 5DJ7A 1BBRK 3D49H 2FOAA 3PB1E 5BPEA 1O3HA 5IYTA 4H4FA 1O2ZA 4FUDA 2J4IA 4AFSA 2O8WA 1DSUA 1A3BH 2ALPA 1AKSA 3BTME 4Y0ZE 3H5CB 4KTSA 4XFQA 1AN1E 4BAQB 1BB0B 1YF4A 1QBVH 4HI3A 5E2PA 3W95A 5GDSH 2BDCA 1T8NA 3NWUA 2WV5A 5EW2H 2SGDE 2ANWA 1YPJH 1E0FD 3ZVFA 1UMAH 4IC5A 3SO3A 3IG6B 3GY6A 1O31A 2WPLS 2ZO3H 2VWNA 4JZEH 4BTTB 5C3NA 5FXLA 3A8DA 5CHAC 4D76A 2QXIA 3P17H 1PQ8A 1VCPA 1WBGB 4DURA 1EZSC 3W94A 1TPPA 1T7CA 2BDYA 2GDEH 1KLJH 3URDA 2FO9A 1TBZH 2ODPA 1ETTH 1C9PA 3LGYA 2UUJB 4D9QA 2EI8A 3UOUA 2ZGBH 2ESTE 1WSSH 1ZJDA 5J4QA 3GCOA 2H5CA 3M36A 1GBMA 1AMHA 3V3MA 5EXLA 4OGYA 1PJPA 2GTBA 1DFPA 1QJ6B 3MU5A 2V35A 4ZKNU 1GGDC 1GHXH 1GBFA 1UHBB 2ZTYA 3GY3A 4ZH8A 1AWFH 1L1NA 4X2XA 3RLYH 1ACBE 1MAXA 1ZHRA 4LOYH 2F83A 2QF3A 4O3UA 1H9HE 4K2YA 3U1IB 2HOBA 2IN2A 1ZPBA 5FBEA 1F0SA 1WQVH 1PPGE 1FDPA 2CF8H 4IBLH 5T6FA 1ZGIA 1MTUA 2C8WB 3SHAH 3R0FA 2WUCA 1QGFA 3MU1A 1SQOA 2LPRA 1QJ7B 1VITF 1QL7A 3GICB 2F9VA 2EC9H 1TB6H 1CE5A 3MH7A 1SFIA 2PKAA 1ZR0A 1UTJA 2NU4E 4AX9H 1SMFE 1A46H 4JYVH 1HNEE 1C2EA 1OS8A 3M3VA 4Q2KA 2Z9IA 3M37A 1AD8H 1SFQB 3ODFA 1D9IA 4F49A 3EQ0H 1W13U 3KQBA 1DUEA 5FX6A 4U30A 4O9VA 3SU2A 3NPSA 2ZPSA 2FPZA 3MH5A 3RP2A 2PGQB 4ABDA 1SPJA 1SGFG 1E37B 3GY8A 3SU5A 1QR3E 2SNVA 4ZXYH 1DLKB 2BOKA 4YT6H 3JZ2B 1UVUH 3PLBA 1VITH 4CR9A 1IQMA 1UK4A 5FPYA 4B2BA 2FESH 2SGPE 2TIOA 2A31A 6ESTA 1JBUH 1DDJA 4BNRA 1O5BB 5EU8A 3TK5A 2Z7FE 1IQJA 1EOLA 1SLUB 3FZDA 4INLA 4Y8XA 3M35A 3F9GA 1TONA 4YOGA 1C9TA 1AB9B 4FUHA 1KDQA 1O2LA 5CMXH 1HPGA 1WU1A 1XXDA 1BTHH 1F5LA 1MQ5A 4X6MA 1NO9H 3AASA 3E16B 1SGRE 2I6QA 5HM9A 3STIA 4H42U 5HXFA 1Z71A 2ZGHA 1D6WA 1QFKH 1GJAB 1LHGH 1CBWC 3GYLB 3KNXA 1HJAC 1C5LH 2ZZUH 2ZPQA 2JKHA 4K1EA 8GCHF 1P01A 3LIWA 2TGTA 2PKSB 2BVRH 5TCAA 3MH4A 1TQ0B 1VCWA 1SGFA 2BQ6B 2Z6BD 1EAUA 1O5FH 1AU8A 3PO1C 3KL6A 3T62A 4FUJA 3PMJA 1J17T 1S0QA 1W3CA 4AN7A 3PWBA 3UR6A 1O36A 2HPQH 4MPXA 1RTLA 3T26A 1JIRA 2BXUH 1EASA 4O97A 5ABWA 4DIIH 2PUXB 4BAHB 1QCPA 2G55A 2OINA 3L3TA 2J94A 1L4DA 1V2QT 2A5IA 2GVFA 2ZECA 2GMTC 1VGCB 4GUXA 2ALVA 1O3DA 1O33A 1O5CB 1F2SE 1J16A 1NY22 4ZROA 2FS8A 5T6GA 5F03A 2BZ6H 2BD2A 1KIGH 1N8OB 2WPJS 3RXDA 1TWXB 3ZVGA 3U8RH 1TALA 1T8OA 4DW2U 4Y76A 2JETB 5DP8A 3SNCA 4NA8A 3GCHB 1HIAB 5JBCS 1O2TA 1V2VT 2VGCC 3TITA 1UCYE 1PPEE 1C1VH 2R3YA 1N6XA 4INKA 3SHCH 3SU4A 2BLVA 1GCDA 6CHAC 5EG4A 3SGQE 3A86A 1S81A 1TIOA 1GJ5H 1AVGH 2VH0A 1GBCA 3JZ1B 2RG3A 1OWIA 2ZHQH 2QYIA 2XCFA 5F8ZA 4ABIA 5K7RA 2XCNA 1NRPH 2GZ7A 2WPHS 4AOQA 4ABGA 2ZFTA 1DWCH 2VIQA 4RKOB 1GPZA 2NU2E 2XXLA 1E35B 4VGCC 3SUFA 2BYAX 1GBKA 1OYTH 4TYDA 3SGAE 1H9LB 3BG4B 1HCGA 3Q00A 3U1JB 1MTNC 1FPCH 1HAVB 2D2DA 2Y80A 1XUKA 4ABJA 1HYLA 3S9BA 1GL0E 2BXTH 1ELGA 3A82A 3SU6A 4X8SH 2J9NA 2ZPRA 1GMCF 1C5NH 4X1PU 5EXNA 2CJIA 1NRRH 3PLPA 2H2ZA 2JH5D 4RN6A 3DT0H 1P2KA 1QQ4A 1F0TA 3MHWU 2AIPA 4KGAA 3RXUA 1HAIH 1Y59T 2GKVE 4K69A 9LPRA 1V2OT 1GDUA 3B23B 2BD5A 1H9IE 2BY6X 3TGIE 2A5KA 4XBDA 1V2NT 3UTUH 3SV6A 4FU9A 1OWEA 2R2WU 2AMDA 1TBRH 2H6MA 2JH6D 1C5YB 1QL9A 1RRKA 2HNTF 2XTTB 5JDUB 2TGDA 2FWWA 1ZMNA 3P6ZB 2Y5GA 3K9XB 4MNWA 1SGIB 1SVPA 2C3SA 1C5TA 2XWBI 1A61H 3LT3A 4XE4A 4B73A 2AIQA 2QGRA 4D9RA 1ZTKA 3MFJA 2VVCA 3SV7A 2OC1A 2OQ5A 2VIVA 2CV3A 4WMDA 3URCA 1V2WT 3UWJH 3AW1A 2G4TA 1EZXC 1Z6JH 1PQAA 3HPTB 4JZDH 3D62A 1A5GH 2UWPA 4ISLA 1BHXF 1UK3A 2GV7A 4I8HA 5ESTE 2RA0A 2W3IA 5FX5A 1ELVA 3SZNA 5L30H 5DP9A 1C5PA 2BY7X 4K3JA 1RJXB 1O3JA 3FP8E 1TYNA 1P57B 1RIWB 2ODQA 1Q3XA 1CO7E 4MPWA 5DO4H 3UQOA 2SGQE 3GCNA 4ZMAH 3A8BA 2FLRH 3EE0B 4CRBA 4XBCA 1HFDA 2Q6FA 5DKMA 2VWLA 4MNYA 1EJAA 1EX3A 2AS9A 1Z8GA 3PMBB 3QZRA 4WH6A 3SORA 1EPTA 5HYOA 3MI4A 3QO6A 4GVUA 1H8IH 2Z9LA 3NZIA 1TX8A 1OP0A 2XYAA 2OBOA 4UD9H 2A4RA 1TNKA 1HAOH 1BTXA 3KQDA 4ABHA 1GJBB 1O3PB 1O2WA 3O8RA 4ESTE 2A4OA 2CHAB 1EXFA 4Z6AH 2BDIA 3GDUA 3PV4A 2HPPH 1OSSA 3MO6A 1TGCA 2PSXA 4AB8A 4BXSA 1MH0A 1QB9A 5DPAA 1C5OH 3RXTA 4BANB 2CN0H 5L2ZH 2BLQA 1QRWA 5EQQA 2ULLA 3OU0A 1TRMA 1DVAH 3TU7H 3H7OA 2KAIB 3G01A 4B75A 2O9QA 1SQAA 1DX5M 1P2MA 3TGJE 3LGUA 2ANKH 2OTVA 2BM2A 3GDVA 4UDWH 2NU1E 1BRBE 2PHBA 5LPFA 4ABEA 2D8WA 5EOKA 5C1XA 2OQUA 2FOGA 3ZVCA 3A7ZA 2FEQH 1IQNA 2ZQ1A 3A7YA 2GT7A 3QLPH 1QTFA 4SGAE 1SGDE 1AZZA 5ESBA 4DIHH 1SGEE 2VH6A 1EKBB 3QTOH 4Q80A 5A8YA 2O8MA 3RXMA 2H9EH 4H6SB 4NGAH 5A09A 2K1QA 4ISOA 2OD3B 2ZHFH 3M3TA 1KY9A 3RUOA 5FAHA 1FAXA 3RXQA 1C1WH 1MCTA 1JIMA 4DY7B 1V2ST 2Y6TA 1NRSH 1OPHB 2QXJA 1HGTH 1O3FA 1S0RA 4Y71A 1FY1A 4DJZB 1EP6A 2AMQA 1FXYA 1T4VH 3Q76A 3EA7A 4UFEH 2G52A 1O2SA 3V13A 2QV1A 1ORFA 4THNH 4ABAA 4Y8ZA 2VJ1A 2F9OA 1V2KT 3SQEE 2AH4X 1QNJA 2QXHA 1NC6A 3K2UA 2IPHA 3F9EA 2BB4A 4E7NA 1MTSA 1IQKA 2EI6A 3SJIA 4I8LA 1NS3A 3ZZBA 2B8OH 1IOEA 3HATH 1O37A 2STBE 1RFNA 1T8MA 3KEEA 3D65E 4I31A 4TPIZ 3SGBE 4ISNA 4PROA 1O2OA 4AFQA 2PFEA 1SLVB 1EAIA 5SGAE 2AERH 1P3CA 1NFXA 3LOXA 1GI4A 5JBBS 1DPOA 4CBOA 1AQ7A 1HAGE 2ZWLH 1NFUA 2FM2A 2D26C 1O2QA 1XVMA 2H1UA 1LDTT 1A7SA 1PPCE 3QN7A 1QBOA 2AGGX 2VIOA 3ZV9A 1AGJA 1YPHE 4U2WA 4BTIB 1ZPZA 5F6MA 1O3GA 1A4WH 2AGEX 1P02A 4B74A 2ZCKP 1AUTC 4LZ4B 1GDQA 3ZYDA 3BEFB 2QIQA 1ZMLA 2G8TA 1G30B 2W3KA 2F91A 2SGFE 3KQCA 1EATA 1HAXB 4K5ZA 2J38A 1TNJA 1NU7B 2XC4A 4X6PA 3MNXA 5JBTA 2Y7ZA 2O8LA 3MO9A 5DP4A 1LPZB 3H7TA 2A2XH 5A0AE 1O2KA 5HGGA 2XBWA 1GHZA 2A32A 1QA7A 4OS6A 3MU0A 1V3XA 4NIWA 1FONA 3SJOA 1ZRKA 1YPEH 3VPKA 2WINI
chains in the Genus database with same CATH superfamily
1DY8A 1XUGA 2Y5FA 1UTKA 1GI1A 2TBSA 4NCYA 1K1NA 2Z9JA 5A8XA 2NU3E 1SR5C 1FN8A 1KLTA 1DLEA 1IHTH 3BTGE 4FU8A 2PTCE 8GCHG 1ANEA 4CH2B 3K6ZA 8KME2 1K0HA 3E1XB 2O8TA 2WYGA 3E3TA 1BMLA 2ZGXH 1YPHC 2V3HH 4IMQA 3GY7A 1UJ1A 2Q6GA 1G3DA 1O0DH 1W2KH 3VB4A 1BUIA 1QURH 4CRDA 1KYNA 3RC6A 3Q3KA 1GHAG 1YWUA 3FP7E 3SNEA 3RXSA 1QB6A 3A8AA 3LKWA 4UFFH 2P8OC 3ZZ4A 1NM6A 1ETRH 5EGMA 5DGJA 1G3BA 1K9OE 4GCHG 1UVOA 1ZHMA 4IMZA 1S6FA 1KTSB 1C1PA 2RCEA 3SV9A 3GY2A 4UFGH 1WV7H 2J95A 1QRXA 3BIUH 3QDZB 3DUXH 3O8BA 1O2YA 2JJ1D 2ZU4A 4WXIA 2TRMA 5C20A 1J15A 4E05H 3F0OA 4ZUHA 4BXWA 5G4BA 4Y8YA 1P2OA 2A7HA 1A1RA 1HRTH 2ZG0H 1KXEA 4KP0A 1C1TA 1GG6C 4LK4A 1B0EA 3RXPA 2CF9H 2FX4A 3OX7U 1GBTA 2OC7A 3L6PA 1OWHA 1LVBA 3TJNA 1DWDH 2F43B 4NZQA 3FZZA 2FLBH 1ELTA 1QQUA 1AUJA 3RM0H 1BTYA 3H09A 5CE1A 2VINA 3RXJA 1LVMA 4YZUA 1LQEA 1YCPH 1YPGH 1QIXB 2AYWA 2PUQH 1FY8E 4U01A 2GCHF 4TY6A 1CA0B 3BIVH 5E0HA 2RDLA 2F9BH 1SBWA 3HGPA 3HKIB 3OSYA 4AYYB 2GJGA 4WMEA 3LH3A 1MU8B 1GI5A 4WY3A 1AY6H 3RLWH 3FP6E 1QA0A 1CA8B 4JCNA 1D3PB 3M5LA 1TNGA 2SGEE 3A7TA 1AIXH 5EW1H 1E34B 3I78A 2J92A 2P3UB 3TH4H 2OLGA 3TPIZ 1WCZA 2ZDLA 4X8TH 1OWKA 4IC6A 1EPTC 1YPMH 1MKXH 1UCYH 1CVWH 2ZP0H 4FUGA 1GMCG 2QC2A 4FOUC 1TPSA 2W5EA 5JB8S 3GY4A 2FXRA 5GXPA 4A1XA 3UNSA 1HAPH 1O2NA 2IJOB 3FOAA 1K1OA 2QY0B 1GVKB 3K6YA 3DFJA 1W14U 3C27B 4I8GA 3DSOA 2F4LA 1AVWA 1YKTA 2HALA 3A7VA 3FVFB 3NK8A 4YM9A 1FMGA 3TK9A 4CBNA 1T4UH 2CXVA 2G5NA 4XD7D 4MLFB 1S85A 3IITA 3UB0A 1BZXE 1FY5A 2PKAB 1XMNB 3F1SB 4RSPA 5I25A 3P95A 1MU6B 1ZGVA 2Q1JA 1ESBA 3SJKA 2C90B 3M5NA 2OK5A 1ARBA 2OBQA 1A0HB 1FLEE 4NG9H 2QXGA 2ZFSA 4Y6DA 1P2JA 2ZEBA 4OS5A 1SC8U 4GLYA 1ANBA 4IW4E 1EJMA 2G00A 1O38A 2UWLA 1BQYA 4DG4A 1FN6A 1GHAF 2ZFQH 1DS2E 2TGAA 4IN2A 1IAUA 5C1YA 2R3UA 4OGXA 5AF9H 3U69H 2Z3EA 1ZSLA 3ZZ3A 8LPRA 4GCHF 3RXCA 4X1SU 1AWHB 2BMGB 3UY9A 1FIZA 3GCTF 2RA3A 2TPIZ 1O32A 1P2QA 3FFGA 2ZCLP 3BTKE 2KFWA 3M7UA 4RI0A 2BD9A 2FTLE 1O30A 1GHVH 2AEIH 5C5OA 2H9TH 1EJNA 1EZQA 1UVSH 3MTYA 3MYWA 2WPKS 4ZHAA 3DHKH 4ISHH 4MNXA 1FIWA 2FOFA 3BG8A 2ZDVH 1BBRE 5T1VA 2XC5A 2J97A 1TRNA 2EEKA 1MBQA 1LVYA 1QY6A 3SNBA 4ASHA 1V2JT 1N1LA 3EYDA 4CHAB 1BITA 1V6DA 3UNQA 1C5WB 2CK3D 2GCTB 4ABBA 4OS2A 2Y82A 2ZQ2A 2R0KA 3M5OA 3SUGA 1WYKA 3MO3A 4XOJA 4KTCA 3QGNB 3O8CA 1TNLA 1XVOA 4CRCA 3VB7A 1ID5H 1PPZA 3SU3A 3SU0A 1P9UA 1HBTH 1S83A 2P59A 5DP5A 1DWBH 4X1NU 3N7OA 2A7CA 1YCPM 1O39A 1L1GA 2PW8H 2W7UA 2XNIA 2XWAA 2ZDAH 3I77A 3LDXH 3E6PH 9ESTA 1GHWH 1ABJH 1MKWH 3FN8A 1QZ8A 1AZ8A 1DY9A 1THPB 2ZHWH 3P8GA 3RXRA 1GHBF 4DGJA 5JPMH 1GI6A 1LPGB 3BTFE 3ZVEA 1OYQA 3BTEE 3SU1A 1CSOE 1PQ5A 1H1BA 1KXCA 3GOVB 3T29A 3SV8A 3T2NA 4WMFA 5HIZA 3WY8A 3P92A 5F8XA 1IQGA 1GCTB 3F2GA 1G3EA 2BDAA 4AG2A 2DE9A 1LMWB 3TH2H 4AZ2B 1BHXB 4I7YH 2KZ4A 5TCCA 4CH8B 1OOKB 5LPEA 3VB5A 4ASUD 4FUBA 3LGTA 4RT1A 1FY4A 3SJ8A 1GWAA 3UNRA 5C2ZA 3ZZ7A 2BQWB 2LNCA 3BTQE 4O3TA 1AFEH 1YPKH 3ZVBA 2ZDKA 3EDXB 2EA3A 1HB0B 2SGAA 3ZZAA 2BTCE 1OX1A 5T3HA 1GBHA 3PM3A 1H8DH 2VB0A 3L33A 1S6LA 5C17A 1SGPE 2GV6A 3QK1A 3BTHE 1C1RA 1PFXC 1MD8A 3U8TH 5EQRA 3MU8A 3ATMA 2BQ7B 3Q77A 1CGIE 2W7SA 1EP5A 3SI3H 3SJ9A 4X8VH 1IHSH 3KQEA 1BJVA 3TH3H 3STJA 1SOTA 3EA9A 2B9LA 3KIDU 1SQTA 2ZC9H 1TE0A 2FODA 3LH1A 3OFND 1HUTH 1BTZA 1SGQE 4A1TA 1BTWA 3Q3YA 1G32B 4AFZA 5CHAB 1P2NA 3SUDA 1GJCB 3DSPA 1DICA 2AMPA 1UTPA 4YOIA 2Y7XA 5EJ1A 3E91A 4OS4A 3AVZA 4I8JA 1ANCA 1QHRB 2QF0A 1JWTA 1KSNA 4J1YA 4J2YB 1Z8IB 3FANA 1BTUA 2KAIA 1UO6A 2J2UA 1PYTC 1A3EH 2R2MB 1DXWA 3M7TA 1AVXA 5FCKA 2VIDA 1K1LA 5AVDA 4FVBA 1O2RA 2M5TA 4BTUB 2BVSH 4BAKB 3U98H 1GGDB 2WUBA 3SW2B 1L4ZA 3UFAA 3OTJE 4H6TA 1HLTH 4GSOA 3EE7A 1MMJN 4HFPB 2V6NA 1LO6A 3KF2A 3O8DA 2PR3A 1ZYOA 1Y5AT 1S6HA 2PLXA 1P9SA 1C2MA 1P09A 2OC8A 5E0GA 1P12E 3GISB 1IQLA 1ELCA 4LZ1H 1G36A 3ZVAA 2BY8X 2G81E 4TSFD 1O2HA 1D6RA 4GAWA 4XSKU 3T28A 4MPUA 1HAZB 1EOJA 4TPYA 1C5UA 2BD8A 1MCVA 1TABE 3ATWA 3BTTE 4NIXA 1AB9C 1RGQA 1GHYH 1F0UA 4AORA 4XDEA 3RXLA 1O3NA 1INCA 1S84A 4FU7A 5F8TA 4D7GA 5K0HA 5A0BA 5LGOA 1TPAE 1JRTA 1EQ9A 2ZF0H 1FPHH 3UOPA 3RXVA 3RXOA 2SFAA 2QCYA 5CHBA 1SKYE 2P95A 4BAOB 1TMBH 2QA9E 1C1MA 1K2I1 1LHFH 4MVNA 2B7DH 1ZZZA 4K1TA 4DCDA 1J14A 4XRNA 5C67A 1LHCH 1PPFE 2ZFPH 4TWWA 1JXPA 1C2FA 2PKSC 1SLXB 5FBIA 1VCQA 4JMYA 1CU1A 3HK3B 3F3BA 7GCHF 1CHOG 3FAOA 2PV9B 3LC3A 3VB6A 4ZHLU 3ZZ6A 3TK6A 5DK1A 2ZNKH 1EUFA 1G2MA 4OS1A 3TGKE 1J8AA 1FUJA 2C93B 2Z9KA 4INHA 4ZCNA 1GI7B 1OWJA 5FCRA 1O2GH 1Z1IA 2H9HA 2CMYA 2XBVA 1UTNA 1CT2E 1VGCC 1XXFA 2FI4E 1HJ8A 2VVUA 2YNAA 2ZKSA 1JRSA 2ZFRH 1MUEB 1N8OC 3ZYEA 4X2YA 1SG8B 1D3DB 1UVPA 1JOUB 4NA9H 1NFYA 1CBWB 3TLOA 1ZTJA 2ZHEH 1BDAA 2JETC 1HJAB 2GCHG 3NCLA 4BOHA 3E8LA 1KXDA 3GCHC 3SBKA 4ZXXH 1FNIA 5FPTA 1C2JA 1GL1A 5JB9S 5GIBA 1KXBA 1A0LA 3BEIB 1YYY1 4R8TB 1XUJA 1TX6A 1PPHE 2R0LA 6LPRA 2VIWA 1ZLRA 2YMSD 5C1UA 1TQ7B 1WDIA 1K1JA 2WYJA 1WOFA 1ZMJA 1OP2A 3LC5A 1V2UT 1BIOA 4YO9A 3PRBA 1C1OA 1V2LT 3VGCB 1ESTA 2ZU2A 1KXFA 1Z7KA 2J98B 3B9FH 1HDTH 3MMGA 1QL8A 4OM9A 4Y10E 3LJOA 1BMMH 2A4QA 2RFKC 1V2TT 3LONA 2HRVA 3RXEA 1W0KD 1YPLH 3OY5U 4TWYA 3S7HB 2BY5X 1TMTH 3BG4C 1E38B 4AB9A 1YCPK 4GPGA 4X2WA 1C5XB 1HJ9A 1L2EA 1UTLM 1O3IA 1SGYE 2ASUB 1O3EA 4CREA 1O5DH 4JZIA 5A2MH 1W8BH 2FI5E 1G3CA 4Y7AA 1O2JA 3F6UH 1P0SH 6CHAB 1XX9A 5I46H 1CGHA 2DUCA 4NA7A 1THSH 2BDGA 1IQIA 3KCGH 4CRAA 2YNBA 3PTBA 2F9PA 2ODYB 3ATIA 4UE7H 1W0ZU 3MQKC 1TBQH 4ISIH 5B6OA 1HV7A 1F5RA 2A45B 1NFWA 1FY3A 1TPOA 2A1DB 1Z8JB 1MKXK 1UCYK 3QZQA 2UUYA 1GBJA 3SN8A 2W6JD 3ITIA 2FOMB 1DM4B 2ZGCA 3RC4A 1M9UA 1EB1H 1UHBA 1OXGA 1XKAC 3PROA 4HTCH 4VGCB 3HGNA 2V3OH 3A83A 4B6FA 4R0IA 1NBMD 1W7GH 3MNSA 1KTTB 1VKYA 1GMDF 3GY5A 4ZKOU 2A7JA 1BOQA 1QRZA 1MTNB 1LTOA 3QWCH 1J9CH 4MQAA 1A2CH 1SLWB 4QT8C 5EPYA 4IGDA 1AI8H 3GCTG 3KN2A 1TOCB 1TGBA 2AGIX 3F9HA 3DFLA 2O8UA 5KEDA 1OKXA 3PYHA 1AO5A 5JBAS 1DITH 1MQ6A 3OYPA 2FX6A 1RIWC 1C4U2 1CHOF 3KGPA 1P8VC 5GCHG 3QTVH 2Z9GA 2HGTH 3A8CA 2Y81A 5AHGH 2UWOA 1W7XH 4WVPE 3RXKA 2YOLA 1SL3A 1O34A 1AKSB 1GI8B 3A84A 1ABIH 4UEHH 5CDFE 6GCHF 1TAWA 2FIRH 3RXGA 1ZHPA 4YXWD 2BX4A 3CENA 2P3FH 2BLWA 3OTPA 4TY7A 1O5EH 3MWIU 5AFYH 3UREA 3LPRA 1BRAA 3ZZ9A 4IN1A 1LVOA 1AFQB 4NWLA 2VNTA 1XUFA 1ANDA 2CHAC 1GBAA 1GMHF 1NRNH 4NFEA 3TNTA 1ZSKA 2YMSC 3V12A 1ZTLA 1K21H 3TNSA 2FI3E 4NSYA 4UONA 1L0ZA 1GHBG 4GHTA 1W10U 1P2IA 1WAYB 4D8NA 1YY3A 4KTUA 1K28D 5GPIB 1G2LA 5GWZA 4AGKA 1O3CA 3RDZA 3S9CA 5PTPA 1P11E 1O2PA 2HWLB 2FOBA 1O2MA 2HVYB 1O3LA 5DG6A 2P16A 1F5KU 5JYIA 2FOCA 1TX7A 1MZAA 1FJSA 1RD3B 3TVJB 1O2IA 2I6SA 2NU0E 1BBRH 1IQFA 2BY9X 2J34A 4NIYA 4ZAEA 2JH0D 2ZGJA 4X6OA 4A92A 5C5NA 1NBME 2XBYA 1B5GH 1Y3VA 3GYMA 5HM2A 1SHYA 1W12U 2JJ2D 3VFEA 5DP3A 4A7IB 4RKJB 2GP9B 4KKDA 4MG3A 4MNVA 2Q6DA 1DWEH 2H5DA 4WXVA 3V7TA 4JYTA 1TGNA 1C5SA 3E0NB 1X7AC 1P03A 4WH8A 5EODA 1AE8H 4YOJA 2F3CE 4D7FA 1DUAA 1HAYB 3VEQB 3LU9B 4E7RG 1MKWK 3F2FA 2DE8A 1BCUH 4AG1A 3ELAH 3A88A 1ELFA 5BRRE 1LHDH 1GJ4H 2ZTXA 3QUMP 2ZA5A 2ZI2H 3VXEH 1W0YH 3A80A 1RS0A 1ZOMA 2Z94A 4FXGH 4CRFA 2ZTZA 1C1SA 2STAE 4A6LA 3QGJA 4YESB 7LPRA 1DE7H 1O5AB 1K1PA 1YGCH 3F2HA 2WV9A 1C4V2 1F92A 3RMMH 3U8OH 3AW0A 1HIAA 1RTKA 4JK6A 2WZQA 4K1SA 2G51A 2BVXH 1C1NA 2FZZA 4FVDA 2BX3A 3SV2H 1C5RA 1ELBA 1EB2A 3UR9A 3P8FA 1FV9A 3S69A 4X8UH 2HLDD 2C8YB 1CT0E 3OE7D 3BF6H 4X1RU 2ZFFH 4X6NA 1VJAU 2OXSA 1H8ED 1YP9A 2VU8E 2W6ID 3CS7A 3P70B 1FI8A 4FUEA 4ZKSU 3ATKA 1HXFH 3PWCA 1S82A 1GJ8B 1ZSJA 1SGCA 3SOSA 1ELEE 4ZHMU 1PYTD 4XBBA 1TRYA 1C2LA 1KDQB 4MDSA 3WW7A 1C2IA 3R3GB 1L1JA 1XM1A 4Q7ZA 1TMUH 1ZJKA 2C8ZB 1YLDA 3VGCC 2WPMS 4F55A 2K0QA 1D3TB 1HAHH 3T25A 3MH6A 4OS7A 1Y3WA 2KR7A 2P93A 1CHGA 5GCHF 2EQNA 2KCPA 1JMOH 4JZFH 4YT7H 2FTMA 4YLUA 1TNIA 1O3AA 4ABFA 1UTOA 1Z8RA 1HAVA 1Z1JA 5FL7D 1DOJA 2GD4B 3T5FH 3KQ5A 3SNAA 3ENSB 4E06H 5EPNA 2Z3DA 5EQSA 2IOTA 1V2PT 1S5SA 1COWD 1UTQA 2ZDMA 1FAKH 3OAAD 4WF8A 4I32A 1SQRA 1NTPA 1QBNA 1EAXA 1Y8TA 4A1VA 2FOHA 1T32A 1P3EA 2GZ9A 4Q7YA 4Y7BA 3A7WA 2ZU1A 5EIYA 2ILNA 1VR1H 3M61U 4NZLA 2Z3CA 4Y0YE 3CNRA 3ZZ5A 1E1QD 2XW9A 1Z6EA 4Y11E 4I33A 1GJ7B 3GDSA 3N7EA 1Y3YA 4K60A 4Q7XA 4X2VA 4AGJA 1PQ7A 1SSXA 1C2GA 2QE7D 2FMJA 2BHGA 5FHTA 1GJ6A 3EGKH 3I29A 3LJJA 3GS9A 1MTVA 3Q3XA 3RU4D 5AFZH 5DN6D 1WUNH 1Q31A 2M2AA 4DOQA 2HLCA 4U32A 4CR5A 3BTDE 3RMLH 4B71A 5A8ZA 4O03A 1SGNE 2ANMH 1Y3UA 7GCHG 2B5TB 1GJ9B 4NSVA 5E8EH 3P8NA 3NXPA 1V2MT 2VWOA 4AYVB 2R9PA 2B0FA 3RMOH 3OY6U 4B2AA 2XRCA 3UPEA 1C5QA 1O3BA 1ZPCA 1DANH 3UAIC 1GI9B 5DP6A 1C5ZB 4X0WU 1C1UH 2FDAA 3EAJA 1K1IA 3KYGA 3U28C 1MAYA 1Y5BT 5HMAA 3RXAA 5A0CA 2P94A 2PGBB 1RXPA 3ESTA 4MTBA 1ETSH 1C5VA 1UTMA 2QAAA 1IQEA 3MNCA 1RTFB 1SI5H 1FX0B 1HXEH 4SGBE 1GI3A 1KXAA 1BA8B 1XUHA 1C5MD 1MTWA 1SGTA 1NPMA 1MZDA 2JIZD 1TNHA 5LPRA 4Z0KA 2QF5A 1GI0A 3AK5A 2OUAA 3A85A 3V0XA 1BMAA 1G37A 5E2OA 1GVZA 1GVLA 1THRH 1U6QA 3DD2H 4NIVA 5T6DA 1ELAA 1UK2A 2P8OB 1DSTA 2GDDA 1AE5A 1P10A 2BDHA 2G5VA 3PMHB 2FYQA 3ZZCA 1N6YA 2XC0A 1AFQC 1CQQA 1SOZA 1VZQH 2J5UA 3CP7A 1B7XB 1CA0C 3PMAB 7ESTE 1EFRD 1WTHD 1GDNA 3TJUA 2PSYA 1ZRBA 3EA8A 2LELA 2BD4A 3UQVA 3S0NA 4DVAU 3NUMA 1BJUA 2ZDNA 3A89A 3MU4A 1GBLA 2BD3A 2FP7B 4FUIA 3SNDA 1GG6B 2A2QH 3RU4E 1NZQH 1XKBC 2VWMA 1NESE 5FPSA 2BD7A 1O35A 4Y79A 3TIUA 3P8OA 5GNDA 2KCYA 1NN6A 1P05A 2BDBA 2VVVA 4WJG2 1UVTH 1K22H 1SB1H 1TLDA 3M7QA 1G9IE 4FUFA 3UWIA 1T8LA 1BTPA 1ELDE 1E1RD 2GX4A 3AAVA 2AFQB 1O3MA 1B0FA 3BSQA 3ZV8A 2ZHDA 1Q2WA 1C2KA 1XUIA 3NKKA 1P06A 1YBWA 2ANYA 1WTGH 3A81A 1LQDB 4CRGA 1D3QB 2EI7A 3IWMA 4B1TA 2F9NA 1GBBA 4UFDH 3D23A 2KCOA 5ETXA 4B2CA 3PTNA 1MBMA 2FOEA 1IQHA 1YLCA 3SI4H 1GMDG 2WPIS 1GBEA 3K65B 1GI2A 1T31A 2FYRA 3B8JA 3BN9A 4Q4LA 2BLOA 5H4IB 1ARCA 2C8XB 3U9AH 3SUEA 2UUFB 4I86A 4HGCA 3MOCA 3RXFA 1D4PB 1EPTB 2G4UA 2PWXA 2A5AA 1O2VA 1A5HA 8ESTE 3RXHA 4LXBH 2WV4A 1Y5UT 1PPBH 4I8KA 1TOMH 3BTWE 3F9FA 2QN5T 3HKJB 4K8YA 2NWNA 4AFUA 1GBIA 1H4WA 5J4SA 2EY4C 1C2HA 3QX5H 1LKAA 2OP9A 2THFB 1OWDA 2Y5HA 3RXIA 1KLIH 2D1JA 2BOHB 1DT2A 1C2DA 3S7KB 1YM0A 3ZZDA 6GCHG 2PTNA 1EZUC 1LCYA 4JYUH 3T27A 1O2XA 1VJ9U 3DA9B 3LGIA 3C1KA 3RMNH 1C4Y2 4DT7B 5HKKD 2BZAA 2GZ8A 1CT4E 1NU9A 2HVXA 3RU4T 5IDKA 2HNTE 4KELA 3VXFH 2VIPA 2C4FH 2XBXA 1ESAA 1O5GH 2OCVB 4BAMB 2P3TB 2UUKB 1GMHG 3A7XA 1NRQH 5B6LA 2W26A 2ZCHP 3F68H 3S9AA 2FS9A 1O3OA 1A0JA 3E90B 3PO1B 5E0JA 1C1QA 4CHAC 4Q63A 3LGVA 1VITG 2A4GA 2GCTC 3MNBA 3ZVDA 1E36B 1NROH 2TGPZ 7KMEH 4GHQA 3M5MA 1O3KA 1EAWA 4B76A 2ZU5A 1V2RT 1BRCE 2LP6A 4F4OC 1OP8A 1DXPA 1TFXA 1LHEH 3BV9B 3PLKA 3RXBA 4YTAA 3BEUA 1FZZA 2GT8A 3W1EA 1TGSZ 3A87A 2ZIQH 1FQ3A 2A0QB 4JK5A 3CS0A 1A5IA 1GBDA 2GMTB 1K1MA 1F0RA 1Y3XA 1GJDB 3KHVA 4A5TS 1QB1A 4NWKA 3RM2H 2GGVB 3F0PA 1BT7A 3M3SA 3VB3A 3N7DA 4F48B 5L2YH 3AAUA 3UUZA 1BMNH 2HNTC 1MD7A 4YLQH 1LPKB 5DP7A 1TA2A 3RC5A 4MPVA 3HK6B 2ZU3A 3PRDA 3OEED 1CGJE 5EXMA 2VGCB 3LGWA 4NFFA 1TA6A 2OC0A 1YC0A 1GCTC 3SQHE 2F9UA 4FUCA 5LH8A 4JZ1A 2CGAA 4IS5A 3ZZ8A 1F7ZA 5GJ4B 4M7GA 1BRUP 3UIRA 3VG8A 3TJOA 5TJXA 1LKBA 4P02A 5L6NH 3TJVA 1P04A 1WQSA 3ODDA 1SHHB 1W11U 1O2UA 3ATLA 4K8BA 4WWYA 2SNWA 4ZKRU 1QJ1B 1NT1A 1AHTH 2V0BA 3E0PB 1TGTA 4HZHA 4X1QU 5DJ7A 1BBRK 3D49H 2FOAA 3PB1E 5BPEA 3SYJA 1MABB 1O3HA 5IYTA 4H4FA 1O2ZA 4FUDA 2J4IA 4AFSA 2O8WA 2V7QD 1DSUA 1A3BH 2ALPA 1AKSA 3BTME 4Y0ZE 3H5CB 4KTSA 4XFQA 1AN1E 4BAQB 1BB0B 1YF4A 1QBVH 4HI3A 5E2PA 3W95A 1H8HD 5GDSH 2BDCA 1T8NA 3NWUA 2WV5A 5EW2H 2SGDE 2ANWA 2QF4A 1YPJH 3ZIAD 1E0FD 3ZVFA 1UMAH 4IC5A 3SO3A 3IG6B 3GY6A 1O31A 2WPLS 2ZO3H 2VWNA 4JZEH 4BTTB 5C3NA 2V3MA 5FXLA 1WXRA 3A8DA 5CHAC 4D76A 2QXIA 3P17H 1PQ8A 2KCAA 1VCPA 1WBGB 4DURA 1EZSC 3W94A 1TPPA 1T7CA 2BDYA 2GDEH 1KLJH 3URDA 2FO9A 5KGOA 1TBZH 2ODPA 4ACBA 1ETTH 1C9PA 3LGYA 2UUJB 4D9QA 2EI8A 3UOUA 2ZGBH 2ESTE 1WSSH 1ZJDA 5J4QA 3GCOA 2H5CA 3M36A 1GBMA 1AMHA 3V3MA 5EXLA 4OGYA 1PJPA 5F53A 2GTBA 1DFPA 1QJ6B 3MU5A 2V35A 5IK2D 4ZKNU 1GGDC 1GHXH 1GBFA 1UHBB 2ZTYA 3GY3A 4ZH8A 1AWFH 1L1NA 2L74A 4X2XA 3RLYH 1ACBE 1MAXA 1ZHRA 2IPQX 4LOYH 2F83A 2QF3A 2XOKD 4O3UA 1H9HE 4K2YA 3U1IB 2HOBA 2IN2A 1ZPBA 5FBEA 1F0SA 1WQVH 1PPGE 1FDPA 2CF8H 4IBLH 5T6FA 1ZGIA 1MTUA 5C0TA 2C8WB 3SHAH 3R0FA 2WUCA 1QGFA 3MU1A 1SQOA 2LPRA 1QJ7B 1VITF 1QL7A 3GICB 2F9VA 2EC9H 1TB6H 1CE5A 3MH7A 1SFIA 2PKAA 1ZR0A 1UTJA 2NU4E 4AX9H 1SMFE 1A46H 4JYVH 1HNEE 1C2EA 1OS8A 3M3VA 4Q2KA 2Z9IA 3M37A 1AD8H 1SFQB 3ODFA 1D9IA 4F49A 3EQ0H 1W13U 3KQBA 1DUEA 1UW7A 5FX6A 4U30A 4O9VA 3SU2A 3NPSA 2ZPSA 4P00A 2FPZA 3MH5A 3RP2A 2PGQB 4ABDA 1SPJA 1SGFG 1E37B 3GY8A 3SU5A 1QR3E 2SNVA 4ZXYH 1DLKB 2BOKA 4YT6H 3JZ2B 1UVUH 3PLBA 1VITH 4CR9A 1IQMA 1UK4A 5FPYA 4B2BA 2FESH 2SGPE 2TIOA 2A31A 6ESTA 1JBUH 1DDJA 4BNRA 1O5BB 5EU8A 3TK5A 2Z7FE 1IQJA 1EOLA 1SLUB 3FZDA 4INLA 4Y8XA 3M35A 3F9GA 1TONA 4YOGA 1C9TA 1AB9B 4FUHA 1KDQA 1O2LA 5CMXH 1HPGA 1WU1A 1XXDA 1BTHH 1F5LA 1MQ5A 4X6MA 1NO9H 3AASA 3E16B 1SGRE 2I6QA 5HM9A 3STIA 4H42U 5HXFA 1Z71A 2ZGHA 1D6WA 1QFKH 1GJAB 1LHGH 1CBWC 3GYLB 2JDID 3KNXA 1HJAC 1C5LH 2ZZUH 2ZPQA 2JKHA 4K1EA 8GCHF 1P01A 3LIWA 5DSFA 2TGTA 2PKSB 2BVRH 2VBCA 5TCAA 3MH4A 1TQ0B 1VCWA 1SGFA 2BQ6B 2Z6BD 1EAUA 1O5FH 1AU8A 3PO1C 4AC9A 3KL6A 2XNDD 3T62A 4FUJA 3PMJA 1J17T 1S0QA 1W3CA 4AN7A 3PWBA 3UR6A 1O36A 4HG6A 2HPQH 4MPXA 1RTLA 3T26A 1JIRA 2BXUH 1EASA 4O97A 5ABWA 4DIIH 2PUXB 4BAHB 5EJZA 1QCPA 2G55A 2OINA 3L3TA 2J94A 1L4DA 1V2QT 2A5IA 2GVFA 2ZECA 2GMTC 1VGCB 4GUXA 2ALVA 1O3DA 1O33A 1O5CB 1F2SE 4TT3D 1J16A 1NY22 4ZROA 2FS8A 5T6GA 5F03A 2BZ6H 2BD2A 1KIGH 1N8OB 2WPJS 3RXDA 1TWXB 3ZVGA 3U8RH 1TALA 1T8OA 4DW2U 4Y76A 2JETB 5DP8A 3SNCA 4NA8A 3GCHB 1HIAB 5JBCS 1O2TA 1V2VT 2VGCC 3TITA 5HIYA 1UCYE 1PPEE 1C1VH 2R3YA 1N6XA 4INKA 3SHCH 3SU4A 2BLVA 1GCDA 6CHAC 5EG4A 3SGQE 3A86A 1S81A 1TIOA 1GJ5H 1AVGH 2VH0A 1GBCA 3JZ1B 2RG3A 1OWIA 3FO8D 2ZHQH 2QYIA 2XCFA 5F8ZA 4ABIA 5K7RA 2XCNA 1NRPH 2GZ7A 2WPHS 4AOQA 4ABGA 2WSSD 2ZFTA 1DWCH 2VIQA 3FKSD 4RKOB 1GPZA 2NU2E 2XXLA 3PV2A 1E35B 4VGCC 3SUFA 3DCLA 2BYAX 4RT0A 1GBKA 1OYTH 4TYDA 3SGAE 1H9LB 3BG4B 1HCGA 3Q00A 3U1JB 1MTNC 1FPCH 1HAVB 2D2DA 2Y80A 1XUKA 4ABJA 1HYLA 3S9BA 1GL0E 2BXTH 3N99A 1ELGA 3A82A 3SU6A 4X8SH 2J9NA 2ZPRA 1GMCF 1C5NH 4X1PU 5EXNA 2CJIA 1NRRH 3PLPA 2H2ZA 2JH5D 4RN6A 3DT0H 2K8IA 1P2KA 1QQ4A 1F0TA 3MHWU 2AIPA 4KGAA 3RXUA 1HAIH 1Y59T 2GKVE 4K69A 9LPRA 1V2OT 1GDUA 3B23B 2BD5A 1H9IE 2BY6X 3TGIE 2A5KA 4XBDA 1V2NT 3UTUH 3SV6A 4FU9A 1OWEA 2R2WU 2AMDA 1TBRH 1YLNA 2H6MA 2JH6D 1C5YB 1QL9A 1RRKA 2HNTF 2XTTB 4M9FA 5JDUB 2TGDA 2FWWA 1ZMNA 3P6ZB 2Y5GA 3K9XB 4MNWA 1SGIB 1SVPA 2C3SA 1C5TA 2XWBI 1A61H 3LT3A 4XE4A 4B73A 2AIQA 2QGRA 4D9RA 1ZTKA 3MFJA 2VVCA 3SV7A 2OC1A 2OQ5A 4FETA 2VIVA 2CV3A 4WMDA 3URCA 1V2WT 3UWJH 3AW1A 4B6EA 2G4TA 1EZXC 1Z6JH 1PQAA 3HPTB 4JZDH 3D62A 1A5GH 2UWPA 4ISLA 1BHXF 1UK3A 2GV7A 2WPDD 4I8HA 1OHHD 5ESTE 2RA0A 2W3IA 3NRLA 5FX5A 1ELVA 3SZNA 5L30H 3WWBA 5DP9A 1C5PA 2BY7X 4K3JA 1RJXB 1O3JA 3FP8E 1TYNA 1P57B 1RIWB 2AHME 2ODQA 1Q3XA 1CO7E 4MPWA 5DO4H 1KMHB 3UQOA 2SGQE 3GCNA 4ZMAH 3A8BA 2FLRH 3EE0B 4CRBA 4XBCA 1HFDA 2Q6FA 5DKMA 2VWLA 4MNYA 1EJAA 1EX3A 2AS9A 1Z8GA 3PMBB 3QZRA 4WH6A 3SORA 1EPTA 3WWFA 5HYOA 3MI4A 3QO6A 4GVUA 4DT4A 1H8IH 2Z9LA 3NZIA 1TX8A 1OP0A 2XYAA 2KM0A 2OBOA 4UD9H 2A4RA 1TNKA 1HAOH 1BTXA 3KQDA 4ABHA 1GJBB 1O3PB 1O2WA 3O8RA 4ESTE 1BMFD 2A4OA 2CHAB 1EXFA 4Z6AH 5C0UA 2BDIA 3GDUA 3PV4A 3KYFA 2HPPH 1OSSA 3MO6A 1TGCA 2PSXA 4AB8A 4BXSA 1MH0A 1QB9A 2YMSB 5DPAA 1C5OH 3RXTA 2RDEA 2CN0H 4BANB 5L2ZH 2BLQA 1QRWA 5EQQA 2ULLA 3OU0A 1TRMA 1DVAH 3TU7H 3H7OA 2KAIB 3G01A 4B75A 2O9QA 1SQAA 5C94A 1E79D 1DX5M 1P2MA 3TGJE 3LGUA 2ANKH 2OTVA 2BM2A 3GDVA 4UDWH 2NU1E 1BRBE 2PHBA 1W0JD 5LPFA 4ABEA 2D8WA 5EOKA 5C1XA 2OQUA 2FOGA 3ZVCA 3A7ZA 2FEQH 1IQNA 2ZQ1A 3DSGA 3A7YA 2GT7A 3PV5A 3QLPH 1QTFA 4SGAE 1SGDE 1AZZA 5ESBA 4DIHH 1SGEE 2VH6A 1EKBB 3QTOH 4Q80A 5A8YA 2O8MA 5EJLA 3RXMA 2H9EH 4H6SB 4NGAH 5A09A 2K1QA 4ISOA 2OD3B 2ZHFH 3M3TA 1KY9A 3RUOA 5FAHA 2J98A 1FAXA 3RXQA 1C1WH 2IJD1 1MCTA 1JIMA 4DY7B 1V2ST 2Y6TA 1NRSH 1OPHB 3SZEA 2QXJA 1HGTH 1O3FA 1S0RA 4Y71A 1FY1A 4DJZB 1EP6A 2AMQA 1FXYA 1T4VH 3Q76A 3EA7A 4UFEH 2G52A 1O2SA 3V13A 2QV1A 1ORFA 4THNH 4ABAA 4Y8ZA 2VJ1A 2F9OA 1V2KT 3SQEE 2AH4X 1QNJA 2KX4A 2QXHA 1NC6A 3K2UA 5KECA 2IPHA 3F9EA 2BB4A 2WHXA 1MTSA 4E7NA 1IQKA 2EI6A 3SJIA 4I8LA 1NS3A 3ZZBA 2B8OH 3OEHD 1IOEA 3HATH 1O37A 2STBE 1RFNA 1T8MA 3KEEA 3D65E 4I31A 4TPIZ 3SGBE 4ISNA 4ACAA 4PROA 4Z1MD 1O2OA 4AFQA 2PFEA 1SLVB 1EAIA 5SGAE 2AERH 1P3CA 1NFXA 3LOXA 1GI4A 5JBBS 1DPOA 4CBOA 1AQ7A 1HAGE 2ZWLH 1NFUA 2FM2A 2D26C 1O2QA 1XVMA 2H1UA 1LDTT 1A7SA 1PPCE 3QN7A 1QBOA 2AGGX 2VIOA 3ZV9A 1AGJA 1YPHE 2PP6A 4U2WA 4BTIB 1ZPZA 5F6MA 1O3GA 1A4WH 2AGEX 1P02A 4B74A 2ZCKP 1AUTC 4LZ4B 1GDQA 3ZYDA 3BEFB 2QIQA 1ZMLA 2G8TA 1G30B 2W3KA 2F91A 2SGFE 3KQCA 1EATA 1HAXB 2L6OA 4K5ZA 2J38A 1TNJA 1NU7B 2XC4A 4X6PA 3MNXA 5JBTA 2Y7ZA 2O8LA 3MO9A 5DP4A 1LPZB 3H7TA 2A2XH 5A0AE 1O2KA 5HGGA 2XBWA 1GHZA 2A32A 1QA7A 4OS6A 3MU0A 1V3XA 4NIWA 1FONA 3SJOA 1ZRKA 1YPEH 3VPKA 2WINI
chains in the Genus database with same CATH topology
1DY8A 1XUGA 2Y5FA 1UTKA 1GI1A 2TBSA 4NCYA 1K1NA 2Z9JA 5A8XA 2NU3E 1SR5C 1FN8A 1KLTA 1DLEA 1IHTH 3BTGE 4FU8A 2PTCE 8GCHG 1ANEA 4CH2B 3K6ZA 8KME2 3E1XB 2O8TA 2WYGA 3E3TA 1BMLA 2ZGXH 1YPHC 2V3HH 4IMQA 3GY7A 1UJ1A 2Q6GA 1G3DA 1O0DH 1W2KH 3VB4A 1BUIA 1QURH 4CRDA 1KYNA 3RC6A 3Q3KA 1GHAG 3FP7E 3SNEA 3RXSA 1QB6A 3A8AA 3LKWA 4UFFH 2P8OC 3ZZ4A 1NM6A 1ETRH 5EGMA 5DGJA 1G3BA 1K9OE 4GCHG 1UVOA 1ZHMA 4IMZA 1S6FA 1KTSB 1C1PA 2RCEA 3SV9A 3GY2A 4UFGH 1WV7H 2J95A 1QRXA 3BIUH 3QDZB 3DUXH 3O8BA 1O2YA 2ZU4A 4WXIA 2TRMA 5C20A 1J15A 4E05H 4ZUHA 4BXWA 5G4BA 4Y8YA 1P2OA 2A7HA 1A1RA 1HRTH 2ZG0H 1KXEA 4KP0A 1C1TA 1GG6C 4LK4A 1B0EA 3RXPA 2CF9H 2FX4A 3OX7U 1GBTA 2OC7A 3L6PA 1OWHA 1LVBA 3TJNA 1DWDH 4NZQA 3FZZA 2FLBH 1ELTA 1QQUA 1AUJA 3RM0H 1BTYA 5CE1A 2VINA 3RXJA 1LVMA 4YZUA 1LQEA 1YCPH 1YPGH 1QIXB 2AYWA 2PUQH 1FY8E 4U01A 2GCHF 4TY6A 1CA0B 3BIVH 5E0HA 2RDLA 2F9BH 1SBWA 3HGPA 3HKIB 3OSYA 4AYYB 4WMEA 3LH3A 1MU8B 1GI5A 4WY3A 1AY6H 3RLWH 3FP6E 1QA0A 1CA8B 4JCNA 1D3PB 3M5LA 1TNGA 2SGEE 3A7TA 1AIXH 5EW1H 1E34B 3I78A 2J92A 2P3UB 3TH4H 2OLGA 3TPIZ 1WCZA 2ZDLA 4X8TH 1OWKA 4IC6A 1EPTC 1YPMH 1MKXH 1UCYH 1CVWH 2ZP0H 4FUGA 1GMCG 2QC2A 1TPSA 2W5EA 5JB8S 3GY4A 2FXRA 5GXPA 4A1XA 3UNSA 1HAPH 1O2NA 2IJOB 1K1OA 2QY0B 1GVKB 3K6YA 3DFJA 1W14U 3C27B 4I8GA 1AVWA 1YKTA 2HALA 3A7VA 3FVFB 3NK8A 4YM9A 1FMGA 3TK9A 4CBNA 1T4UH 2CXVA 2G5NA 4MLFB 1S85A 3IITA 1BZXE 1FY5A 2PKAB 1XMNB 3F1SB 4RSPA 5I25A 3P95A 1MU6B 1ZGVA 2Q1JA 1ESBA 3SJKA 2C90B 3M5NA 1ARBA 2OBQA 1A0HB 1FLEE 4NG9H 2QXGA 2ZFSA 4Y6DA 1P2JA 2ZEBA 4OS5A 1SC8U 4GLYA 1ANBA 4IW4E 1EJMA 2G00A 1O38A 2UWLA 1BQYA 4DG4A 1FN6A 1GHAF 2ZFQH 1DS2E 2TGAA 4IN2A 1IAUA 5C1YA 2R3UA 4OGXA 5AF9H 3U69H 2Z3EA 1ZSLA 3ZZ3A 8LPRA 4GCHF 3RXCA 4X1SU 1AWHB 2BMGB 3UY9A 1FIZA 3GCTF 2RA3A 2TPIZ 1O32A 1P2QA 3FFGA 2ZCLP 3BTKE 3M7UA 2BD9A 2FTLE 1O30A 1GHVH 2AEIH 5C5OA 2H9TH 1EJNA 1EZQA 1UVSH 3MTYA 3MYWA 2WPKS 4ZHAA 3DHKH 4ISHH 4MNXA 1FIWA 2FOFA 3BG8A 2ZDVH 1BBRE 2XC5A 1TRNA 2EEKA 1MBQA 1LVYA 1QY6A 3SNBA 4ASHA 1V2JT 1N1LA 3EYDA 4CHAB 1BITA 1V6DA 3UNQA 1C5WB 2GCTB 4ABBA 4OS2A 2Y82A 2ZQ2A 2R0KA 3M5OA 3SUGA 1WYKA 3MO3A 4XOJA 4KTCA 3QGNB 3O8CA 1TNLA 1XVOA 4CRCA 3VB7A 1ID5H 1PPZA 3SU3A 3SU0A 1P9UA 1HBTH 1S83A 2P59A 5DP5A 1DWBH 4X1NU 3N7OA 2A7CA 1YCPM 1O39A 1L1GA 2PW8H 2W7UA 2XNIA 2XWAA 2ZDAH 3I77A 3LDXH 3E6PH 9ESTA 1GHWH 1ABJH 1MKWH 1AZ8A 1DY9A 1THPB 2ZHWH 3P8GA 3RXRA 1GHBF 4DGJA 5JPMH 1GI6A 1LPGB 3BTFE 3ZVEA 1OYQA 3BTEE 3SU1A 1CSOE 1PQ5A 1H1BA 1KXCA 3GOVB 3T29A 3SV8A 3T2NA 4WMFA 3WY8A 3P92A 5F8XA 1IQGA 1GCTB 1G3EA 2BDAA 4AG2A 2DE9A 1LMWB 3TH2H 4AZ2B 1BHXB 4I7YH 5TCCA 4CH8B 1OOKB 5LPEA 3VB5A 4FUBA 3LGTA 1FY4A 3SJ8A 1GWAA 3UNRA 5C2ZA 3ZZ7A 2BQWB 2LNCA 3BTQE 4O3TA 1AFEH 1YPKH 3ZVBA 2ZDKA 3EDXB 2EA3A 1HB0B 2SGAA 3ZZAA 2BTCE 1OX1A 5T3HA 1GBHA 3PM3A 1H8DH 2VB0A 3L33A 1SGPE 2GV6A 3QK1A 3BTHE 1C1RA 1PFXC 1MD8A 3U8TH 5EQRA 3MU8A 3ATMA 2BQ7B 3Q77A 1CGIE 2W7SA 1EP5A 3SI3H 3SJ9A 4X8VH 1IHSH 3KQEA 1BJVA 3TH3H 3STJA 1SOTA 3EA9A 2B9LA 3KIDU 1SQTA 2ZC9H 1TE0A 2FODA 3LH1A 1HUTH 1BTZA 1SGQE 4A1TA 1BTWA 3Q3YA 1G32B 4AFZA 5CHAB 1P2NA 3SUDA 1GJCB 1DICA 2AMPA 1UTPA 4YOIA 2Y7XA 3E91A 4OS4A 3AVZA 4I8JA 1ANCA 1QHRB 2QF0A 1JWTA 1KSNA 4J1YA 4J2YB 1Z8IB 3FANA 1BTUA 2KAIA 1UO6A 2J2UA 1PYTC 1A3EH 2R2MB 1DXWA 3M7TA 1AVXA 5FCKA 2VIDA 1K1LA 5AVDA 4FVBA 2M5TA 1O2RA 4BTUB 2BVSH 4BAKB 3U98H 1GGDB 2WUBA 3SW2B 1L4ZA 3UFAA 3OTJE 4H6TA 1HLTH 4GSOA 1MMJN 4HFPB 2V6NA 1LO6A 3KF2A 3O8DA 2PR3A 1ZYOA 1Y5AT 1S6HA 2PLXA 1P9SA 1C2MA 1P09A 2OC8A 5E0GA 1P12E 3GISB 1IQLA 1ELCA 4LZ1H 1G36A 3ZVAA 2BY8X 2G81E 1O2HA 1D6RA 4GAWA 4XSKU 3T28A 4MPUA 1HAZB 1EOJA 4TPYA 1C5UA 2BD8A 1MCVA 1TABE 3ATWA 3BTTE 4NIXA 1AB9C 1RGQA 1GHYH 1F0UA 4AORA 4XDEA 3RXLA 1O3NA 1INCA 1S84A 4FU7A 5F8TA 4D7GA 5K0HA 5A0BA 5LGOA 1TPAE 1JRTA 1EQ9A 2ZF0H 1FPHH 3UOPA 3RXVA 3RXOA 2SFAA 2QCYA 2P95A 4BAOB 1TMBH 2QA9E 1C1MA 1K2I1 1LHFH 4MVNA 2B7DH 1ZZZA 4K1TA 4DCDA 1J14A 5C67A 1LHCH 1PPFE 2ZFPH 4TWWA 1JXPA 1C2FA 2PKSC 1SLXB 5FBIA 1VCQA 4JMYA 1CU1A 3HK3B 7GCHF 1CHOG 3FAOA 2PV9B 3LC3A 3VB6A 4ZHLU 3ZZ6A 3TK6A 5DK1A 2ZNKH 1EUFA 1G2MA 4OS1A 3TGKE 1J8AA 1FUJA 2C93B 2Z9KA 4INHA 1GI7B 1OWJA 5FCRA 1O2GH 1Z1IA 2H9HA 2CMYA 2XBVA 1UTNA 1CT2E 1VGCC 1XXFA 2FI4E 1HJ8A 2VVUA 2YNAA 2ZKSA 1JRSA 2ZFRH 1MUEB 1N8OC 3ZYEA 4X2YA 1SG8B 1D3DB 1UVPA 1JOUB 4NA9H 1NFYA 1CBWB 3TLOA 1ZTJA 2ZHEH 1BDAA 2JETC 1HJAB 2GCHG 3NCLA 4BOHA 3E8LA 1KXDA 3GCHC 3SBKA 4ZXXH 1FNIA 5FPTA 1C2JA 1GL1A 5JB9S 5GIBA 1KXBA 1A0LA 3BEIB 1YYY1 4R8TB 1XUJA 1TX6A 1PPHE 2R0LA 6LPRA 2VIWA 1ZLRA 5C1UA 1TQ7B 1K1JA 2WYJA 1WOFA 1ZMJA 1OP2A 3LC5A 1V2UT 1BIOA 4YO9A 1C1OA 1V2LT 3VGCB 1ESTA 2ZU2A 1KXFA 1Z7KA 3B9FH 1HDTH 3MMGA 1QL8A 4Y10E 3LJOA 1BMMH 2A4QA 1V2TT 3LONA 2HRVA 3RXEA 1YPLH 3OY5U 4TWYA 3S7HB 2BY5X 1TMTH 3BG4C 1E38B 4AB9A 1YCPK 4GPGA 4X2WA 1C5XB 1HJ9A 1L2EA 1UTLM 1O3IA 1SGYE 2ASUB 1O3EA 4CREA 1O5DH 4JZIA 5A2MH 1W8BH 2FI5E 1G3CA 4Y7AA 1O2JA 3F6UH 1P0SH 6CHAB 1XX9A 5I46H 1CGHA 2DUCA 4NA7A 1THSH 2BDGA 1IQIA 3KCGH 4CRAA 2YNBA 3PTBA 2F9PA 2ODYB 3ATIA 4UE7H 1W0ZU 1TBQH 4ISIH 5B6OA 1HV7A 1F5RA 2A45B 1NFWA 1FY3A 1TPOA 2A1DB 1Z8JB 1MKXK 1UCYK 3QZQA 2UUYA 1GBJA 3SN8A 3ITIA 2FOMB 1DM4B 2ZGCA 3RC4A 1M9UA 1EB1H 1UHBA 1OXGA 1XKAC 3PROA 4HTCH 4VGCB 3HGNA 2V3OH 3A83A 4R0IA 1W7GH 3MNSA 1KTTB 1GMDF 3GY5A 4ZKOU 2A7JA 1BOQA 1QRZA 1MTNB 1LTOA 3QWCH 1J9CH 4MQAA 1A2CH 1SLWB 4QT8C 5EPYA 4IGDA 1AI8H 3GCTG 3KN2A 1TOCB 1TGBA 2AGIX 3F9HA 3DFLA 2O8UA 1OKXA 3PYHA 1AO5A 5JBAS 1DITH 1MQ6A 3OYPA 2FX6A 1RIWC 1C4U2 1CHOF 3KGPA 1P8VC 5GCHG 3QTVH 2Z9GA 2HGTH 3A8CA 2Y81A 5AHGH 2UWOA 1W7XH 4WVPE 3RXKA 2YOLA 1SL3A 1O34A 1AKSB 1GI8B 3A84A 1ABIH 4UEHH 6GCHF 1TAWA 2FIRH 3RXGA 1ZHPA 2BX4A 3CENA 2P3FH 2BLWA 4TY7A 1O5EH 3MWIU 5AFYH 3UREA 3LPRA 1BRAA 3ZZ9A 4IN1A 1LVOA 1AFQB 4NWLA 2VNTA 1XUFA 1ANDA 2CHAC 1GBAA 1GMHF 1NRNH 4NFEA 3TNTA 1ZSKA 3V12A 1ZTLA 1K21H 3TNSA 2FI3E 4NSYA 4UONA 1L0ZA 1GHBG 4GHTA 1W10U 1P2IA 1WAYB 4D8NA 4KTUA 1K28D 5GPIB 1G2LA 5GWZA 4AGKA 1O3CA 3RDZA 3S9CA 5PTPA 1P11E 1O2PA 2HWLB 2FOBA 1O2MA 1O3LA 5DG6A 2P16A 1F5KU 5JYIA 2FOCA 1TX7A 1MZAA 1FJSA 1RD3B 3TVJB 1O2IA 2I6SA 2NU0E 1BBRH 1IQFA 2BY9X 2J34A 4NIYA 4ZAEA 2JH0D 2ZGJA 4X6OA 4A92A 5C5NA 2XBYA 1B5GH 1Y3VA 3GYMA 5HM2A 1SHYA 1W12U 3VFEA 5DP3A 4A7IB 4RKJB 2GP9B 4KKDA 4MG3A 4MNVA 2Q6DA 1DWEH 2H5DA 4WXVA 3V7TA 4JYTA 1TGNA 1C5SA 3E0NB 1X7AC 1P03A 4WH8A 5EODA 1AE8H 4YOJA 2F3CE 4D7FA 1DUAA 1HAYB 3VEQB 3LU9B 4E7RG 1MKWK 2DE8A 1BCUH 4AG1A 3ELAH 3A88A 1ELFA 5BRRE 1LHDH 1GJ4H 2ZTXA 3QUMP 2ZA5A 2ZI2H 3VXEH 1W0YH 3A80A 1RS0A 1ZOMA 2Z94A 4FXGH 4CRFA 2ZTZA 1C1SA 2STAE 4A6LA 3QGJA 4YESB 7LPRA 1DE7H 1O5AB 1K1PA 1YGCH 1C4V2 1F92A 3RMMH 3U8OH 3AW0A 1HIAA 1RTKA 4JK6A 4K1SA 2G51A 2BVXH 1C1NA 2FZZA 4FVDA 2BX3A 3SV2H 1C5RA 1ELBA 1EB2A 3UR9A 3P8FA 1FV9A 3S69A 4X8UH 2C8YB 1CT0E 3BF6H 4X1RU 2ZFFH 4X6NA 1VJAU 2OXSA 1YP9A 2VU8E 3CS7A 3P70B 1FI8A 4FUEA 4ZKSU 3ATKA 1HXFH 3PWCA 1S82A 1GJ8B 1ZSJA 1SGCA 3SOSA 1ELEE 4ZHMU 1PYTD 4XBBA 1TRYA 1C2LA 1KDQB 4MDSA 1C2IA 3R3GB 1L1JA 1XM1A 4Q7ZA 1TMUH 1ZJKA 2C8ZB 1YLDA 3VGCC 2WPMS 1D3TB 1HAHH 3T25A 3MH6A 4OS7A 1Y3WA 2P93A 1CHGA 5GCHF 1JMOH 4JZFH 4YT7H 2FTMA 4YLUA 1TNIA 1O3AA 4ABFA 1UTOA 1Z8RA 1HAVA 1Z1JA 1DOJA 2GD4B 3T5FH 3SNAA 3ENSB 4E06H 5EPNA 2Z3DA 5EQSA 2IOTA 1V2PT 1S5SA 1UTQA 2ZDMA 1FAKH 4WF8A 4I32A 1NTPA 1QBNA 1EAXA 1Y8TA 4A1VA 2FOHA 1T32A 1P3EA 2GZ9A 4Q7YA 4Y7BA 3A7WA 2ZU1A 2ILNA 1VR1H 3M61U 4NZLA 2Z3CA 4Y0YE 3ZZ5A 2XW9A 1Z6EA 4Y11E 4I33A 1GJ7B 3GDSA 4Q7XA 1Y3YA 4K60A 4X2VA 4AGJA 1PQ7A 1SSXA 1C2GA 2FMJA 2BHGA 5FHTA 1GJ6A 3EGKH 3I29A 3LJJA 3Q3XA 1MTVA 3RU4D 5AFZH 1WUNH 1Q31A 4DOQA 2HLCA 4U32A 4CR5A 3BTDE 3RMLH 4B71A 5A8ZA 4O03A 1SGNE 2ANMH 1Y3UA 7GCHG 2B5TB 1GJ9B 4NSVA 5E8EH 3P8NA 3NXPA 1V2MT 2VWOA 4AYVB 2R9PA 2B0FA 3RMOH 3OY6U 4B2AA 2XRCA 3UPEA 1C5QA 1O3BA 1ZPCA 1DANH 1GI9B 5DP6A 1C5ZB 4X0WU 1C1UH 2FDAA 3EAJA 1K1IA 1MAYA 1Y5BT 5HMAA 3RXAA 5A0CA 2P94A 2PGBB 1RXPA 3ESTA 4MTBA 1ETSH 1C5VA 1UTMA 2QAAA 1IQEA 3MNC<