2ZEBA

Potent, nonpeptide inhibitors of human mast cell tryptase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zebA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zebA01
2C8XB 4LZ4B 5ABWA 2Z6BD 4K1EA 3EE0B 4X1QU 3TJOA 5J4SA 1TMTH 2C3SA 2AH4X 1AE5A 1YPKH 3O8CA 2VIQA 1QL7A 2FIRH 1LO6A 1P2OA 3RXEA 3RC5A 1XUFA 4MTBA 3SOSA 2PKAB 4AYVB 1BMLA 4DJZB 4DIHH 4VGCC 2G81E 1DLKB 1QQ4A 4JZIA 1ZPCA 1C5RA 1TPOA 1TRMA 1F5LA 2WUCA 5HYOA 1BMNH 1KTTB 1MAXA 3BIUH 3A85A 5J4QA 4OS6A 1GJ9B 2BD2A 1EB2A 4LXBH 2HNTE 1CT4E 2A2QH 2XBYA 2ZHFH 3QX5H 3HK6B 5FCKA 1Y59T 3M7TA 1DSUA 2ZFPH 2FWWA 4U01A 4ZKNU 1P12E 4K5ZA 3K6ZA 3U8TH 1C2IA 1GJ4H 1AB9C 1QB9A 3L3TA 5HM9A 1IQNA 4DURA 1HAPH 1BBRE 4GLYA 1O2OA 1W3CA 2AS9A 2BY5X 3BIVH 3BTDE 4J2YB 4H4FA 3E3TA 3SU2A 3K2UA 4CH8B 1BB0B 3M7UA 3U69H 3MTYA 2J2UA 4GHQA 2Z9LA 4NSVA 4AOQA 1O2MA 1Z6JH 1HLTH 2Y7XA 3UIRA 1UHBB 1K2I1 4AX9H 1BIOA 1JIRA 1XKBC 1AZZA 1CA0B 1T7CA 1PQ7A 3RUOA 1WAYB 3MOCA 1O3NA 1O3MA 2BD5A 2H9HA 2SGPE 2A1DB 2GCHG 2B7DH 1KTSB 2P16A 3SV6A 3HGNA 1DY8A 3P8NA 2Z3CA 2ZPSA 2SGQE 3BV9B 1MQ6A 1ZSKA 1AVXA 8GCHG 1XUKA 1RXPA 3A8CA 1GI3A 2XBWA 1ESAA 1GI2A 2ZCLP 1Z6EA 5ESBA 1UTPA 3GICB 3ATIA 3IITA 5BRRE 2XTTB 1XXDA 3RU4T 1GHAG 2ZTXA 3ENSB 1O3GA 3VXFH 5T6GA 2D8WA 1YP9A 2BZ6H 1FONA 1H9IE 2P8OC 3ZYDA 2OC0A 3CENA 1OYTH 3LDXH 1CT2E 3BF6H 3GY3A 2XC0A 2KAIB 3TGIE 4NGAH 1C4U2 4X8TH 4Y7AA 1TRYA 3KHVA 2VVVA 3LGUA 4YOIA 3V7TA 4ZKOU 1VCQA 3RU4E 2CF9H 1B0EA 2Y7ZA 4A92A 3FZDA 2AYWA 1TWXB 5DJ7A 1H4WA 3KF2A 1P04A 1V2UT 2PUXB 3TLOA 1O2ZA 3LC3A 2YNBA 3TH3H 1TQ7B 2D2DA 1K1LA 3MU8A 4GSOA 1RFNA 3ZZ5A 3GY2A 1DWBH 1O2YA 4FVDA 1TX8A 1F92A 1AFEH 1GMCG 1HAGE 1P10A 2WPJS 1SSXA 1G9IE 1F0SA 1TOMH 4ISHH 3OX7U 3ZZ7A 2HALA 2CF8H 5EPYA 2FTLE 2OQUA 2CHAC 1A0JA 4DOQA 2ASUB 1K1JA 5PTPA 4HZHA 4IBLH 1EOJA 1ELTA 1SQTA 1OWIA 3ZV9A 1BQYA 4MPXA 1UTQA 1NFXA 2UUFB 1YPLH 2WPIS 3S7KB 3M3SA 2HRVA 1GBHA 1QIXB 2UWPA 3LH1A 3C1KA 2IOTA 3NXPA 1A1RA 1G2MA 1AFQC 1PPHE 3ESTA 4I8LA 2OLGA 1P2KA 1O3AA 2UWLA 1NT1A 1O2XA 3UUZA 1YCPK 2GX4A 1QHRB 5FX6A 1SQOA 3RM0H 1ZHRA 1V2TT 2A5AA 3VFEA 1F5KU 2PV9B 4O3TA 3LGIA 1AHTH 5TCAA 5F8ZA 3ZZ9A 1MTSA 1LKBA 2BOHB 2CXVA 2FLRH 2VB0A 3MO3A 1O3HA 1GBDA 5T6FA 1YF4A 1E35B 1SGRE 4Y10E 4X0WU 1ZJKA 2PSXA 1SC8U 3KQEA 1GMHF 1O2LA 4KTUA 1AB9B 1O2TA 1FY8E 3PLBA 4OS7A 8ESTE 4SGAE 2I6QA 1QL8A 3U1JB 4U30A 3QLPH 2V6NA 1ZPZA 3F6UH 4AGJA 1GWAA 2WV4A 4IW4E 1P57B 3TNTA 1HPGA 1N8OB 2FX4A 2BQWB 1GPZA 2OXSA 2Q6DA 4XBDA 4JCNA 2C8ZB 1WU1A 3QGNB 2ZFTA 1HIAA 1C1QA 3A8AA 5EOKA 4XFQA 1J17T 2AGEX 4AFUA 4NA9H 1RTKA 4UFDH 3E16B 2STAE 1S82A 1GHWH 4IN2A 1PFXC 1TNHA 1WOFA 1AVWA 1D6WA 2J34A 1IQGA 5LH8A 1ZRBA 1AGJA 1BT7A 3VB4A 3MU0A 1HAVA 3SGQE 1NRNH 3PTBA 3M5MA 1MU6B 2BDGA 3RXCA 1GJDB 1LHEH 1OWEA 4ZKSU 4NG9H 4GPGA 1NM6A 2BMGB 5JBAS 1QCPA 1MZDA 2RA0A 4UFGH 3RLYH 1CGIE 1UVOA 1V2NT 1FJSA 3GDUA 3A86A 4AFSA 2FOAA 3Q3YA 3DHKH 1TGTA 2GCTB 1NROH 2ZPRA 1IHTH 1G3EA 2P8OB 2H5DA 3RXIA 2BXUH 2G51A 1O31A 1Z8RA 3LGTA 1E36B 4TY6A 2XCNA 1KLIH 2AFQB 1S84A 2QIQA 1OP8A 3OY5U 1TGCA 3C27B 1ELEE 1K1NA 2QXJA 1FNIA 1QTFA 1XMNB 2JKHA 2VIVA 1BBRK 3KCGH 1DICA 1P2NA 1C4Y2 1C1MA 1GCDA 1TA6A 5DP3A 1FI8A 2VWOA 1X7AC 1NZQH 4Z6AH 2F91A 2SFAA 2NU4E 1NN6A 4K8YA 1VZQH 3UR6A 1EPTC 3FP7E 4FUDA 1DUAA 5TJXA 1K1MA 2C90B 1EAIA 1NESE 1SG8B 4JZEH 1E0FD 3P70B 2W7SA 1BRCE 2OCVB 1P9SA 1HJAC 2ZGCA 5EXMA 1HIAB 5CHAB 3GCTG 3DFLA 1TQ0B 5FX5A 3STJA 4ABEA 1GMDG 1P06A 2VWMA 1MQ5A 3F9FA 4BXSA 1VJAU 1HDTH 1LVBA 4ZXXH 3KQCA 5A0AE 2PW8H 4K60A 1OPHB 3T29A 3MMGA 1C5NH 1NFWA 1HAVB 1IQFA 2DE8A 2XC4A 2LNCA 1AI8H 1ZHMA 2GZ8A 1E37B 4AGKA 3A7VA 1AFQB 1EKBB 2A45B 2SGAA 3LPRA 5EPNA 4KKDA 1V2VT 3BEIB 2YOLA 3I78A 2QGRA 1PQAA 3I29A 3UTUH 2VIPA 1TOCB 1QJ6B 4XOJA 2RA3A 1AMHA 4B2AA 1TYNA 5C1XA 1C5YB 1UCYH 1Q3XA 4Q7ZA 4AFZA 5EGMA 1LQEA 2P93A 2TIOA 2ODPA 3PMBB 2B5TB 2WYGA 5FBEA 1W13U 4NWLA 1KXCA 3OY6U 2XC5A 2ZFRH 4MPUA 5AHGH 3M35A 1FV9A 4JZDH 5HMAA 3PWCA 5K0HA 2VINA 2ANKH 2G52A 3DA9B 4YESB 5C67A 3SJOA 2O8WA 3BTTE 1ANDA 3TIUA 3OYPA 3RXAA 3ZVBA 4MG3A 1TFXA 1V2WT 4INLA 1KXBA 1YLCA 3BTQE 1TGBA 2VNTA 3RXMA 4IMQA 3LGWA 1NY22 1FQ3A 1EJAA 1MCTA 3PMJA 2K1QA 3E6PH 1O2KA 1O5AB 2P59A 1XVOA 4FUGA 3Q76A 1WBGB 4JYVH 3KL6A 5GDSH 3DT0H 3A87A 4FUJA 3PB1E 1H9LB 3FP6E 4X2VA 3QDZB 4DT7B 1C2KA 3R0FA 4FUFA 2ZHWH 4WVPE 2BLVA 4OS5A 2XYAA 2C8YB 2OQ5A 3HK3B 1MBMA 1YM0A 3BEFB 3JZ1B 3LJJA 1ZJDA 1A0LA 1C1VH 2QF0A 1GGDB 2FYRA 1HAYB 1SMFE 1UK4A 2EI8A 2FOBA 4WMEA 1OS8A 2PTCE 1G37A 2VIWA 3S7HB 1OOKB 2FOGA 1P0SH 1FY5A 2PUQH 4BTUB 1O33A 7GCHG 4HTCH 1QBVH 1TBRH 5DP6A 5A8XA 3AW1A 4X1RU 2NU3E 2XRCA 3UQVA 1AO5A 4HI3A 1J16A 2OC8A 1C5WB 5CMXH 3RMMH 1HBTH 3UOPA 4JMYA 2Y5HA 1VCWA 3VB5A 3NZIA 2P94A 1NPMA 2BLQA 4B2BA 1FY1A 5GIBA 1Y5AT 2EC9H 1EPTB 7ESTE 2F3CE 3TH2H 2VU8E 1WV7H 5ETXA 3RP2A 4GAWA 1V2KT 1HJAB 1ZZZA 1ANCA 4Q2KA 4YT7H 1C5VA 2GMTB 3A7XA 2A7HA 1OWDA 1AD8H 1ZGIA 1NFUA 1C1SA 1FLEE 1ZSLA 1AY6H 2GDEH 2A5IA 2ZECA 4CRCA 1A5IA 1GDNA 4X2YA 1LPZB 1ZYOA 4IC5A 4XE4A 2FX6A 1O2QA 3UNQA 3RXFA 2R2WU 1D3TB 1GBKA 3E1XB 2ZFFH 1BTUA 1ABIH 1GBBA 3E8LA 1FAKH 2UUYA 3A8DA 2BVSH 1YBWA 1SGTA 1C1TA 3GOVB 3M3TA 4DW2U 1ACBE 1C5QA 3GY6A 4KP0A 1GVZA 1MKXK 1DWCH 1PQ5A 1S83A 2FOFA 4IGDA 3SU5A 1C2FA 3SORA 2CMYA 1FAXA 2TGAA 1QBOA 2R2MB 4DG4A 1DWEH 4KTSA 2QA9E 1C5ZB 2XWAA 4CHAB 1SGFA 1AWFH 3A8BA 4MLFB 2WPHS 1LPKB 4HGCA 3SNAA 2QY0B 3PYHA 1RD3B 1KXEA 4AZ2B 3LH3A 3RXKA 1FIWA 1P8VC 1GDQA 3SUEA 2QN5T 2TBSA 3SW2B 5LPEA 1EQ9A 2BM2A 3PV4A 3IG6B 3HGPA 1VGCB 1CSOE 3K6YA 4INHA 4UEHH 2GCHF 8LPRA 3O8DA 1HAXB 4D9RA 1NFYA 5FPSA 1FPHH 1MMJN 4I7YH 1GHBF 1JIMA 4UDWH 1EZSC 2ZF0H 8GCHF 2BY7X 4FUEA 1KLJH 4A1VA 4ABFA 4CRBA 1SL3A 2SGDE 1FMGA 3GCNA 1SGYE 1GJCB 2BHGA 4YLQH 4Q80A 1ZMJA 1L1GA 3DD2H 2JETB 2W3IA 1Y5UT 1WQVH 1P11E 1GHAF 1Y5BT 2C4FH 4DIIH 4CBNA 1VCPA 1E34B 1J8AA 4Y7BA 2PFEA 3SNDA 1C1PA 4OS1A 1JRTA 1HCGA 1UK2A 1CGHA 1O2PA 1XKAC 3HPTB 1H8DH 1TNLA 3BTHE 4F49A 1O5FH 4M7GA 1IQIA 2ZHEH 5LGOA 4B1TA 1GBMA 2OD3B 3AW0A 3OU0A 1L1NA 2ZU5A 3URCA 3KQDA 1K1IA 4H6TA 1DPOA 1YKTA 3SHCH 1Z71A 1DLEA 1G3BA 2GVFA 2AMPA 1LCYA 3A7YA 3URDA 1T8LA 1GMCF 5DP4A 4NZQA 1GI7B 1N8OC 1ANBA 2Y81A 4JZ1A 1F0TA 2ZC9H 3NKKA 3P92A 1D4PB 3O8RA 2Z9GA 4MVNA 3UY9A 1SBWA 2RG3A 2J92A 3D62A 1QFKH 1ZLRA 3RXUA 5F8TA 3RC6A 4ASHA 4K3JA 1TMUH 1C5SA 1DDJA 3M3VA 3EGKH 1INCA 2H9TH 1O3FA 5A8ZA 1GBTA 4Z0KA 2FPZA 1O5EH 4K1SA 3ZZ8A 1SFQB 4FVBA 1AN1E 5A0BA 4CRAA 2Z7FE 1UTKA 3ZVFA 1YPHE 5AFZH 3BEUA 1O5DH 4NIYA 3Q77A 2HLCA 1SHHB 1K1PA 2H6MA 3SO3A 1TPSA 2Z9IA 2GCTC 4NCYA 2ZDMA 1BMAA 1EOLA 2XXLA 1KXFA 1RJXB 4A1TA 4Y8YA 1GDUA 1NRQH 1Y3YA 4Y71A 1GJBB 2THFB 5LPRA 3N7OA 3EAJA 3SUGA 1TNIA 2J9NA 2ZQ1A 4JK6A 5T3HA 2QAAA 2PKSC 4THNH 4AB8A 2V3OH 5FBIA 1IQHA 3T62A 1C2LA 1QY6A 1TNJA 3ZV8A 2G5NA 3QN7A 5HM2A 2WV5A 2Y82A 4ZHAA 2P3FH 1QA7A 2J38A 3P8OA 3OTJE 5FHTA 1EX3A 1O2IA 4MNYA 2VIDA 2TGPZ 2UUJB 3U98H 1UJ1A 1K22H 2A7CA 1XM1A 1O3KA 2AIQA 5EQSA 4I31A 3G01A 3ZYEA 1ELDE 1PYTC 1KDQA 5CHAC 4ZROA 3H7OA 5EU8A 1N6XA 3PM3A 3ZZCA 2F9BH 2HVXA 1JWTA 2VH6A 1GHVH 3MNBA 2BD4A 3UWIA 1FUJA 4GHTA 1GBEA 1F5RA 1DE7H 3SN8A 1NS3A 1C2DA 1PPEE 2J94A 5GPIB 5DO4H 1LMWB 1THSH 1FY3A 1Y3XA 1IHSH 3STIA 1LHGH 3SQEE 2SNWA 2BX4A 1BTWA 1TX7A 3KIDU 3WY8A 2EI7A 1F7ZA 1IQKA 1GBJA 1F0UA 3RXHA 3LGYA 1LVOA 2ZU3A 3BTFE 1UO6A 3RXSA 2Q1JA 1SGQE 2GD4B 4A1XA 1C1UH 2FYQA 3M5LA 1EATA 1DS2E 1DT2A 1V2LT 2H9EH 4I8GA 2HGTH 5IDKA 3BTWE 1GI5A 1T8OA 2FXRA 4Y8ZA 5DGJA 9LPRA 1LHCH 3TK9A 5DG6A 3RLWH 1GHXH 2ZTZA 1O3BA 1Y3UA 4ISNA 4ISLA 2BXTH 4MNVA 4TPYA 2XBXA 2FS9A 1NC6A 3GCOA 1GI1A 1SOTA 2CV3A 2ZIQH 3FANA 3RMNH 3D23A 2EEKA 1MTNB 1TNKA 4NA7A 5L6NH 1LHDH 1DM4B 1P02A 3QUMP 5EODA 2NU2E 3GCTF 4H6SB 5T6DA 5GJ4B 1D3QB 3QZRA 3Q00A 1D3DB 4X1PU 2J4IA 1KDQB 3TPIZ 2PWXA 3AVZA 1S85A 3ODFA 2ALPA 1JRSA 3SNEA 1RTLA 1THRH 2H5CA 4INKA 3UNSA 2VH0A 1LDTT 4MQAA 3JZ2B 3GDSA 1CGJE 2G55A 2NU1E 3ZZAA 2V0BA 1K21H 1T8NA 4A6LA 1OP2A 4X1NU 5E2PA 3SUFA 1GI0A 3LC5A 2W5EA 2A7JA 1SGEE 2PTNA 3MO6A 4YM9A 1C5XB 4CRGA 1XUIA 4A7IB 1GGDC 3UPEA 1PPZA 1O0DH 5DKMA 3F9HA 5C1YA 3NCLA 3SU3A 1OWJA 1AQ7A 1EJMA 1Z1IA 1ARBA 3UR9A 3UQOA 2ZGBH 3LGVA 1O2VA 3BN9A 5DP9A 3FP8E 4YZUA 1D9IA 4Y76A 1BRBE 1SLVB 3LONA 3TGJE 1IOEA 1W2KH 2PKSB 1QURH 1SB1H 2ZPQA 3A80A 1GJ6A 1K28D 1OKXA 5E0JA 3NPSA 5FCRA 1TALA 4NZLA 2B8OH 2IPHA 1D6RA 4YO9A 3SU4A 3SV8A 3TGKE 1YPMH 1PPCE 2GZ7A 3M5NA 4AB9A 2ZG0H 3RXVA 5GCHF 3MNCA 1MTVA 4MPVA 4D9QA 4B74A 4FU8A 1O30A 2QF3A 2QC2A 4AORA 1U6QA 1MKWH 3RXLA 3A7ZA 4I8HA 3RXQA 3SNBA 1BITA 4UONA 3A88A 1HAOH 4ABIA 4MDSA 1DOJA 4CR9A 5F8XA 2GMTC 4NFEA 1SGFG 2TRMA 1GMHG 4X6PA 2UWOA 4MNXA 5E0HA 1UTLM 1XXFA 4R8TB 3RMOH 2AIPA 5HXFA 3AASA 3HKJB 3TH4H 1V2ST 4ABDA 3SV9A 1C9PA 1P01A 2I6SA 2H1UA 2TPIZ 2VVUA 1W8BH 2ZDNA 7KMEH 1A5HA 2HPPH 2BDHA 1O38A 1ETTH 1P3EA 1V3XA 3GCHC 2BY8X 2ZP0H 1GJ5H 1UCYE 1CU1A 4K69A 6GCHG 8KME2 2AGGX 1S0RA 2HNTC 5DP8A 1MAYA 3MFJA 4E06H 3IWMA 1MD8A 4ZMAH 1EAUA 1LPGB 1B5GH 1BA8B 1MU8B 3QO6A 1SLXB 1ZRKA 3Q3XA 1PPBH 1MTWA 1O3LA 3P8FA 2FS8A 2ZU4A 1BMMH 3KGPA 2C8WB 5DK1A 2BY9X 2SGFE 1CVWH 4CRDA 2M5TA 1S81A 4GCHG 4CHAC 1AKSA 1W12U 2ZCKP 1N6YA 3P17H 2G4TA 4ZHMU 3VXEH 5JDUB 1SI5H 1O3DA 5F6MA 3U9AH 1W0YH 3D49H 2QXGA 1EZQA 1ZSJA 1AWHB 2Z3DA 2Q6FA 3LT3A 2C93B 1VGCC 2R0LA 2JH6D 1P3CA 2Z94A 1H8IH 1FZZA 1JXPA 1TMBH 2FI5E 1MH0A 3GY5A 5DP7A 3ODDA 2BVXH 2CGAA 2OUAA 1O36A 3FAOA 3SBKA 3GY8A 2O8TA 3GYMA 4A5TS 4UFFH 2TGDA 1UTOA 1BUIA 1WUNH 2JETC 4X1SU 1O37A 1PPGE 2GTBA 1W7XH 3VB7A 2OP9A 3A83A 4BNRA 1VR1H 1O35A 1W0ZU 4JK5A 1DX5M 4TPIZ 3TJUA 1DSTA 3ZZ6A 2GZ9A 4Y6DA 3V3MA 4UE7H 5C2ZA 1EAXA 4Q7XA 2W7UA 2ZQ2A 2IN2A 4YOGA 5FAHA 2PGBB 2O8LA 2QYIA 1QNJA 4FU9A 4WY3A 1NTPA 4O3UA 4DVAU 2Y5GA 3F9EA 1CBWB 1O39A 2ZWLH 5BPEA 3W94A 1ZMLA 2ZZUH 4BAHB 4B75A 1C5MD 1BTZA 1CA8B 1ELVA 5AFYH 5C20A 7LPRA 4Y0YE 1IQJA 1BTHH 3SV7A 1AKSB 2QCYA 3TK5A 3S69A 1DFPA 5EQRA 2PHBA 2DE9A 5EW2H 4UD9H 1BTXA 1P2JA 1BTPA 3M7QA 4I33A 4OGXA 2PR3A 4AN7A 4DGJA 2A2XH 4ESTE 1C9TA 3I77A 3FZZA 3VEQB 1SGCA 1J9CH 1V2OT 3SZNA 3KQBA 1UK3A 2B9LA 2D26C 1ZTLA 2TGTA 2ILNA 5EXLA 1EZUC 3BTME 4RKJB 1ZTKA 3MO9A 1T8MA 2GKVE 3S0NA 4YOJA 1CQQA 4JZFH 2NWNA 5JBCS 3A84A 3PWBA 5B6OA 1WTGH 1K9OE 4WMDA 1Z1JA 1O3PB 1O3EA 3A89A 1SGIB 4LK4A 3GCHB 5FPYA 3HATH 4XDEA 4FUCA 2PKAA 3RXJA 1G32B 1ELAA 2HOBA 1EUFA 4JYUH 3EA9A 1E38B 1MTUA 3VGCB 1O2GH 3RXOA 5A09A 2STBE 4BANB 1O2RA 1ZHPA 5C5OA 3SGAE 2Q6GA 1A5GH 1GCTC 1SQAA 1TIOA 2A32A 3RXGA 2FESH 4HFPB 4BAOB 2ZNKH 2PSYA 5IYTA 1TA2A 1GJ8B 4E7RG 1TB6H 1ZPBA 1GBIA 4FUHA 1QR3E 1PJPA 1YCPH 4O03A 1QQUA 3E91A 5SGAE 3MU4A 1G36A 4WXIA 3BG4B 1CO7E 4BTIB 2ALVA 4I32A 1VJ9U 2ANMH 2GV6A 4UFEH 1A3BH 1VITG 4ZAEA 1C2HA 2GP9B 1OXGA 6CHAB 1WCZA 1UVPA 2BTCE 1P9UA 1A2CH 1G2LA 1B0FA 4B2CA 4BAQB 4TWYA 1LHFH 4TY7A 3EYDA 4NIVA 1MBQA 3LIWA 1P2IA 4IN1A 1GI9B 2FDAA 3NK8A 4U2WA 1GG6C 1A7SA 3UNRA 1JMOH 2ZGXH 2ZHQH 3BTKE 2J95A 2QXHA 2BDBA 3B23B 5JPMH 1LKAA 1LQDB 3MYWA 4OGYA 2FI4E 1UCYK 1SOZA 5GXPA 1TONA 1P2QA 3QGJA 3S9AA 4O97A 1KSNA 2BY6X 4WJG2 2HWLB 3QK1A 3V13A 2FI3E 4CREA 1S6FA 2VIOA 1T4VH 1KXAA 1UVSH 1ESTA 4WMFA 1OSSA 1HGTH 3T25A 4KTCA 4BTTB 2F9OA 2LPRA 5JYIA 3M61U 2KAIA 2ZGJA 2R3YA 1MTNC 6ESTA 4K8BA 1BTYA 1EZXC 1RRKA 1WTHD 2NU0E 1A4WH 1ZMNA 4NIWA 5CE1A 1AIXH 5DPAA 5F03A 1YPJH 3RU4D 1HXFH 2FOHA 2A4RA 2BD3A 2FM2A 3T2NA 1Q31A 4QT8C 2ANYA 1HYLA 1O2UA 1RIWB 3A82A 1V6DA 1HAHH 1O2SA 3MH6A 2Z9JA 2F9NA 1NU7B 1YPGH 2F83A 1DITH 2VVCA 4ISOA 1BBRH 1EXFA 1IQEA 1CHOG 3GY7A 2O8UA 1IQLA 2IJOB 4XBBA 1O34A 4B71A 4CBOA 1TE0A 1QB1A 3BTGE 5L2YH 3NUMA 1AE8H 1C5UA 1EJNA 1KY9A 1SLWB 3F1SB 3P95A 1UVUH 3V0XA 1L0ZA 2XNIA 5A2MH 5C1UA 1C2JA 1C5PA 3SGBE 1MUEB 3R3GB 1YC0A 2D1JA 1ETRH 1GHBG 3FFGA 1RGQA 2ZU1A 2GV7A 2CJIA 3E0PB 1FPCH 1Z8GA 3SQHE 4X6MA 3ZVEA 1ZGVA 3RXRA 1TX6A 1Y3WA 2BDYA 2HNTF 4NIXA 1V2RT 1H1BA 3MWIU 1YGCH 5I25A 1FDPA 1EAWA 1GCTB 2P3UB 3Q3KA 1C4V2 1SR5C 4K1TA 1ZR0A 1FN8A 1EP6A 1PQ8A 3CP7A 4X6OA 4ZH8A 1V2JT 4X8VH 2EA3A 3U8OH 4X6NA 5G4BA 2OC7A 3ZVAA 1TLDA 1NRPH 2A5KA 2ZDLA 4IMZA 1G3DA 5H4IB 2BD8A 1WSSH 1GBCA 1YCPM 1V2MT 2A4QA 1SGDE 2A4OA 1GHZA 3SUDA 3O8BA 4BAKB 3MH7A 1ABJH 5AF9H 1QJ1B 1HAIH 2A0QB 1KYNA 4FUBA 4ISIH 5EQQA 3NWUA 1HJ8A 3BTEE 4AYYB 1HNEE 1MCVA 4NSYA 3SJ8A 4MPWA 1ELFA 2W26A 3MNXA 3B9FH 4U32A 2ZHDA 1O5GH 1YPEH 3T28A 2R3UA 1QA0A 2BX3A 4ABHA 1BOQA 5L30H 2BQ7B 2OBOA 4I8JA 2OBQA 4NFFA 5FPTA 4BOHA 1AVGH 1Q2WA 2AEIH 2F9PA 1L4ZA 1P2MA 2FOEA 4XSKU 3VPKA 4ZKRU 5K7RA 1GG6B 3VB3A 2FMJA 2BD9A 2ZU2A 3QZQA 5ESTE 2YNAA 1DWDH 1W14U 3P6ZB 1FN6A 4ABBA 1C1OA 3RDZA 3GISB 1OWHA 1DY9A 1C1WH 1EASA 3SI4H 3RC4A 3MH4A 2BLOA 2ZEBA 2A31A 1UTJA 1CT0E 1FY4A 2FLBH 4VGCB 2BD7A 1XVMA 2ZI2H 2GT7A 1BDAA 2Y6TA 4B73A 4RKOB 3ZZ3A 1TPPA 1SFIA 3K9XB 2R9PA 2BDAA 1T32A 5JBBS 1C1NA 2BOKA 3TU7H 3RXBA 3L33A 3GY4A 1WQSA 1KLTA 1ORFA 2F9UA 2ZKSA 2ZCHP 5C5NA 1TABE 3EQ0H 2G5VA 2ZDVH 3BSQA 1RS0A 1J14A 1XX9A 1C2EA 3CS0A 1GI8B 2FO9A 3QTVH 5TCCA 5AVDA 4ZXYH 2B0FA 1CE5A 3LKWA 4Y0ZE 1GMDF 5FXLA 4ABAA 1OX1A 1D3PB 1TBZH 3EA8A 1W10U 2RCEA 1GBLA 2JH5D 1P05A 1RTFB 4Y8XA 4D7FA 1QRWA 2PLXA 1AUJA 1HV7A 4XBCA 1XUHA 1O2NA 1WYKA 6GCHF 2VJ1A 3KEEA 3MU1A 3ZZDA 3OSYA 1QGFA 9ESTA 1NO9H 4GUXA 1O3OA 2XBVA 4YLUA 1MD7A 1GJ7B 2BQ6B 4ABGA 5GWZA 2OINA 1KXDA 2DUCA 1HFDA 3HKIB 1OP0A 1HRTH 1L1JA 2P95A 1HAZB 5JB8S 1V2PT 1S6HA 2AMDA 4R0IA 5DP5A 1DANH 3MU5A 1CBWC 1NU9A 3FVFB 3PMAB 1DUEA 3BG8A 4GCHF 4WH8A 1YYY1 3SV2H 2VWNA 3UREA 2UUKB 4I8KA 3MHWU 2SGEE 3PMHB 3MH5A 2V35A 2V3HH 4OS4A 3T5FH 1OYQA 3F9GA 4BAMB 1SVPA 5HGGA 3S9BA 1H9HE 3RXDA 1MKXH 4J1YA 2ZO3H 1G3CA 5EG4A 1C5OH 2ANWA 4Y79A 4SGBE 4B76A 3RM2H 1G30B 1L4DA 1HUTH 1BZXE 1GL1A 1GVKB 2SNVA 3LOXA 2G8TA 3E90B 1C2GA 3PO1C 3F68H 4YT6H 2VGCC 2ZA5A 1QRZA 1ANEA 1C5LH 4AG1A 1ELGA 1OWKA 2O8MA 1BHXB 1UMAH 2ZTYA 4NA8A 1S0QA 1LTOA 1NRSH 1PYTD 4ABJA 5LPFA 2CHAB 1EP5A 3ZZ4A 2CN0H 3TVJB 2ODYB 1ESBA 1SPJA 2GDDA 2WUBA 4K2YA 2O9QA 2FP7B 5A8YA 3SI3H 1DVAH 2FEQH 3VGCC 4O9VA 3SHAH 2WINI 3ZZBA 3AAVA 1TGSZ 3ATLA 4TWWA 7GCHF 3SJ9A 3ELAH 1XUJA 2ZFSA 3K65B 1UTMA 2XCFA 3QWCH 4AFQA 1Y3VA 4WH6A 3E0NB 1P09A 4FXGH 3DUXH 2WPLS 5E8EH 4X2WA 3TNSA 1IQMA 1Z7KA 2OC1A 4AG2A 1BJVA 3BG4C 5I46H 1TRNA 1FXYA 1T31A 3ZVCA 1UTNA 1A3EH 6CHAC 2BB4A 1AZ8A 4OS2A 1YLDA 3M5OA 3S9CA 1TAWA 4X2XA 2ULLA 2BVRH 1A46H 2FZZA 1C2MA 1JBUH 3LU9B 1AUTC 1K1OA 2F9VA 1M9UA 4Q7YA 3RXPA 4Y11E 3SU6A 1VITH 1GJAB 1N1LA 3ATKA 1O2JA 3D65E 1EPTA 1T4UH 2FTMA 4KGAA 2FOCA 3PTNA 4TYDA 1ARCA 4YTAA 1XUGA 1YPHC 3H5CB 4BXWA 2VWLA 3RXTA 3ZVGA 5GCHG 1LVYA 2ODQA 3TITA 1BRUP 5E0GA 2AGIX 5EXNA 2AERH 4IS5A 1LVMA 1F0RA 2G00A 1ID5H 3U8RH 3TJNA 2Z3EA 3PROA 1QJ7B 1NRRH 1GBFA 1GI6A 1DXPA 1W7GH 3EDXB 2WYJA 3A81A 2XWBI 2PGQB 1ETSH 5EW1H 5C3NA 1ZOMA 4PROA 4E05H 4CH2B 1ELCA 2BLWA 4ZUHA 4WWYA 3W95A 1GHYH 3KN2A 3VB6A 2P3TB 3M36A 3QTOH 1CHGA 1O3IA 1P03A 4X8UH 3RMLH 1B7XB 3UFAA 4JYTA 4FUIA 1VITF 1A0HB 3A7TA 1AU8A 1S5SA 4CRFA 3DFJA 4FU7A 4X8SH 2FODA 3MI4A 2ZDAH 1HXEH 3LJOA 2QXIA 2ZFQH 1QB6A 3UOUA 1RIWC 2ZDKA 1Z8JB 1A61H 2XW9A 3T26A 4RSPA 3AAUA 3CS7A 1MZAA 2HPQH 3A7WA 4IC6A 4D76A 3B8JA 4KELA 1THPB 1GL0E 2JH0D 1DXWA 2BDIA 1CA0C 2W3KA 4E7NA 3PO1B 1EB1H 2VGCB 3TJVA 4H42U 5JB9S 1TBQH 3T27A 1J15A 1O3JA 1TGNA 3GYLB 3MNSA 3PLKA 3ITIA 1W11U 1UVTH 5E2OA 5L2ZH 2WPKS 2FOMB 1SGNE 4MNWA 3SJKA 1O2WA 4DCDA 2Y5FA 3L6PA 2ESTE 1BHXF 2QV1A 4LZ1H 1GI4A 1FIZA 2Y80A 1O5BB 1SLUB 4GVUA 3TK6A 4DY7B 4WXVA 1QBNA 2ZGHA 3ATMA 4CR5A 4LOYH 2Z9KA 1Z8IB 2A4GA 1SHYA 2GGVB 1C1RA 3SU0A 1ELBA 1ZTJA 3P8GA 3SJIA 2EI6A 3KNXA 1QL9A 3M37A 1BCUH 5A0CA 4NWKA 2BZAA 1QRXA 1O32A 2H2ZA 1GVLA 4D8NA 1HJ9A 1IAUA 4RN6A 2G4UA 3SU1A 2GT8A 1C5TA 1TNGA 2AMQA 1JOUB 1O5CB 2BYAX 1MKWK 3EA7A 1BJUA 1O2HA 3ATWA 3PLPA 4F4OC 6LPRA 3H7TA 1Y8TA 1SGPE 2OTVA 1GBAA 1KIGH 3SNCA 4WF8A 1PPFE 1O3CA 1CHOF 2R0KA 1TPAE 1UHBA 1L2EA 3GDVA 2RDLA 1HB0B 1BRAA 3UWJH 4D7GA 3U1IB 3ZVDA 2BDCA 1V2QT 3V12A 1F2SE 2WPMS 5JBTA 4ZHLU
chains in the Genus database with same CATH superfamily
2C8XB 4LZ4B 5ABWA 2Z6BD 4K1EA 3EE0B 4X1QU 3TJOA 5J4SA 1TMTH 2C3SA 1VKYA 2AH4X 1AE5A 1YPKH 3O8CA 2VIQA 1QL7A 2FIRH 1LO6A 1P2OA 3N7DA 3RXEA 3RC5A 1XUFA 4MTBA 3SOSA 2PKAB 4AYVB 1BMLA 4DJZB 4DIHH 4VGCC 2G81E 1DLKB 1QQ4A 1H8ED 4JZIA 1ZPCA 1C5RA 1TPOA 1TRMA 1F5LA 2WUCA 5HYOA 1BMNH 1KTTB 1MAXA 3BIUH 2WZQA 3A85A 1W0KD 4OS6A 5J4QA 1GJ9B 2BD2A 1EB2A 4LXBH 2HNTE 1CT4E 2A2QH 2XBYA 2ZHFH 3QX5H 1H8HD 3HK6B 5FCKA 1Y59T 3M7TA 1DSUA 2ZFPH 2FWWA 4U01A 4ZKNU 1P12E 4K5ZA 3K6ZA 3U8TH 1C2IA 1GJ4H 1SKYE 1AB9C 1QB9A 3L3TA 5CHBA 5HM9A 1IQNA 4DURA 1HAPH 1BBRE 4GLYA 4TT3D 1O2OA 1W3CA 2AS9A 2BY5X 3BIVH 3BTDE 4J2YB 4H4FA 3E3TA 3SU2A 3K2UA 4CH8B 1BB0B 3M7UA 3U69H 3MTYA 2J2UA 4GHQA 2Z9LA 4NSVA 4AOQA 1O2MA 1Z6JH 2W6ID 1HLTH 2Y7XA 3UIRA 1UHBB 1K2I1 4AX9H 1BIOA 1JIRA 1XKBC 1AZZA 1CA0B 1T7CA 1PQ7A 3RUOA 1WAYB 3MOCA 1O3NA 1O3MA 2BD5A 5C0TA 2H9HA 2SGPE 2A1DB 1QZ8A 2GCHG 2B7DH 1KTSB 2P16A 3SV6A 3HGNA 1DY8A 3P8NA 2Z3CA 2ZPSA 2SGQE 3BV9B 1MQ6A 1ZSKA 1OHHD 1AVXA 3F2GA 8GCHG 1XUKA 1RXPA 3A8CA 1GI3A 2IPQX 2XBWA 1ESAA 1GI2A 2ZCLP 1Z6EA 5ESBA 1UTPA 3GICB 3KYGA 3ATIA 3IITA 5BRRE 2XTTB 1XXDA 2KCPA 3RU4T 1GHAG 2ZTXA 3ENSB 1O3GA 3VXFH 5T6GA 2D8WA 1YP9A 2BZ6H 1FONA 2AHME 1H9IE 2P8OC 3FO8D 3ZYDA 2OC0A 3CENA 1OYTH 3LDXH 1CT2E 3BF6H 3GY3A 2XC0A 2KAIB 3TGIE 4NGAH 1C4U2 4X8TH 4Y7AA 5DSFA 1TRYA 3KHVA 2VVVA 3LGUA 4YOIA 2XOKD 3V7TA 4ZKOU 1VCQA 3RU4E 2CF9H 1B0EA 2Y7ZA 4A92A 3FZDA 4YXWD 2AYWA 1TWXB 5DJ7A 1H4WA 3KF2A 1P04A 1V2UT 2PUXB 3TLOA 1O2ZA 3LC3A 2YNBA 3TH3H 1TQ7B 4RI0A 2D2DA 1K1LA 3MU8A 4GSOA 1RFNA 3ZZ5A 3GY2A 1DWBH 1O2YA 4FVDA 1TX8A 1F92A 1AFEH 1GMCG 1HAGE 4ACBA 1P10A 2WPJS 1SSXA 1G9IE 1F0SA 1TOMH 4ISHH 3OX7U 3ZZ7A 2HALA 2CF8H 5EPYA 2FTLE 2OQUA 2CHAC 4TSFD 1A0JA 4DOQA 2ASUB 1K1JA 5PTPA 4HZHA 4IBLH 2JJ2D 1EOJA 1ELTA 1SQTA 1OWIA 3ZV9A 1BQYA 2QE7D 4MPXA 1UTQA 1NFXA 2UUFB 1YPLH 2WPIS 3S7KB 3M3SA 2HRVA 1GBHA 1QIXB 2UWPA 3LH1A 3C1KA 2IOTA 3NXPA 1A1RA 4I86A 1G2MA 1AFQC 1PPHE 3ESTA 4I8LA 4ACAA 2OLGA 1P2KA 1O3AA 4Q4LA 2UWLA 1NT1A 1O2XA 3UUZA 1YCPK 2GX4A 1QHRB 5FX6A 1SQOA 3RM0H 1ZHRA 1V2TT 2A5AA 3VFEA 1F5KU 2PV9B 4O3TA 3LGIA 1AHTH 5TCAA 2K0QA 3FN8A 5F8ZA 1MTSA 1LKBA 2BOHB 2CXVA 1KMHB 2FLRH 2VB0A 3MO3A 1O3HA 1GBDA 5T6FA 1YF4A 1E35B 2V3MA 1SGRE 4Y10E 4X0WU 1ZJKA 2PSXA 1SC8U 3KQEA 1GMHF 1O2LA 4KTUA 1AB9B 1O2TA 1FY8E 3PLBA 4OS7A 8ESTE 4SGAE 2I6QA 1QL8A 3U1JB 4U30A 3QLPH 2V6NA 1ZPZA 3F6UH 4AGJA 1GWAA 3AK5A 2WV4A 4IW4E 5HKKD 1P57B 3TNTA 1HPGA 1N8OB 2FX4A 2BQWB 1GPZA 3OFND 2OXSA 2Q6DA 4XBDA 4JCNA 2C8ZB 1WU1A 3QGNB 2ZFTA 1HIAA 1C1QA 3A8AA 5EOKA 4XFQA 1J17T 2AGEX 4AFUA 4NA9H 1RTKA 4UFDH 3E16B 2STAE 1S82A 1GHWH 4IN2A 1PFXC 1TNHA 1WOFA 1AVWA 1D6WA 2J34A 1IQGA 5LH8A 1ZRBA 1AGJA 1BT7A 3VB4A 3MU0A 1HAVA 3SGQE 1NRNH 3PTBA 3M5MA 1MU6B 2KCOA 2BDGA 3RXCA 1GJDB 1LHEH 1OWEA 4ZKSU 4NG9H 4GPGA 1NM6A 2BMGB 5JBAS 1QCPA 1MZDA 2RA0A 4UFGH 3RLYH 1CGIE 1UVOA 1V2NT 1FJSA 3GDUA 3A86A 4AFSA 2FOAA 3Q3YA 3DHKH 1TGTA 2GCTB 4HG6A 1NROH 2ZPRA 1IHTH 1G3EA 2P8OB 2H5DA 3RXIA 2BXUH 2G51A 1O31A 1Z8RA 3OE7D 3LGTA 1E36B 4TY6A 2XCNA 1KLIH 2AFQB 1S84A 2QIQA 1OP8A 3OY5U 4Z1MD 1TGCA 3C27B 1ELEE 1K1NA 2QXJA 1FNIA 1QTFA 1XMNB 2JKHA 2VIVA 1BBRK 3KCGH 1DICA 1P2NA 1C4Y2 1C1MA 1GCDA 1TA6A 5DP3A 1FI8A 2VWOA 1X7AC 1NZQH 4Z6AH 2F91A 2SFAA 2NU4E 1NN6A 4K8YA 1VZQH 2XNDD 3UR6A 1EPTC 3FP7E 4FUDA 1DUAA 5TJXA 1K1MA 2C90B 1EAIA 1NESE 1SG8B 3VG8A 4JZEH 1E0FD 3P70B 2W7SA 1BRCE 2OCVB 1P9SA 1HJAC 2ZGCA 5EXMA 1HIAB 5CHAB 3GCTG 3DFLA 1TQ0B 5FX5A 3STJA 4ABEA 1GMDG 1P06A 2VWMA 1MQ5A 3F9FA 4BXSA 1VJAU 1HDTH 1LVBA 4ZXXH 3KQCA 5A0AE 2PW8H 4K60A 1OPHB 3T29A 3MMGA 1C5NH 1NFWA 1HAVB 1IQFA 2DE8A 2XC4A 2LNCA 1AI8H 1ZHMA 2GZ8A 1E37B 4AGKA 3A7VA 1AFQB 1EKBB 2A45B 2SGAA 3LPRA 5EPNA 4KKDA 1V2VT 3BEIB 2YOLA 3I78A 2QGRA 1PQAA 3I29A 3UTUH 2VIPA 1TOCB 1QJ6B 4XOJA 2RA3A 1AMHA 4B2AA 1TYNA 5C1XA 1C5YB 1UCYH 3DCLA 1Q3XA 4Q7ZA 4AFZA 5EGMA 1LQEA 2P93A 2TIOA 2ODPA 3PMBB 2B5TB 2WYGA 5FBEA 1W13U 4NWLA 1KXCA 3OY6U 2XC5A 2ZFRH 4MPUA 5AHGH 3M35A 1FV9A 4JZDH 5HMAA 3PWCA 5K0HA 2VINA 2ANKH 2G52A 3DA9B 4YESB 5C67A 3SJOA 2O8WA 3BTTE 1ANDA 3TIUA 3OYPA 3RXAA 3ZVBA 4MG3A 1TFXA 1V2WT 4INLA 1KXBA 1YLCA 3BTQE 1TGBA 2VNTA 3RXMA 4IMQA 3LGWA 1NY22 1FQ3A 1EJAA 1MCTA 3PMJA 2K1QA 3E6PH 1O2KA 1O5AB 2P59A 1XVOA 4FUGA 3Q76A 4XRNA 1WBGB 4JYVH 3KL6A 5GDSH 3DT0H 3A87A 4FUJA 3PB1E 1H9LB 3FP6E 4X2VA 3QDZB 4DT7B 1C2KA 4P02A 3R0FA 4FUFA 2ZHWH 4WVPE 2BLVA 2YMSC 4OS5A 2XYAA 2C8YB 2OQ5A 3HK3B 1MBMA 1YM0A 3BEFB 3JZ1B 3LJJA 1ZJDA 1A0LA 1C1VH 2QF0A 1GGDB 5C0UA 2FYRA 1HAYB 1SMFE 1UK4A 2EI8A 2FOBA 4WMEA 1OS8A 2PTCE 1G37A 3PRDA 2VIWA 2LELA 3S7HB 1OOKB 2FOGA 1P0SH 1FY5A 2PUQH 4BTUB 1O33A 7GCHG 4HTCH 1QBVH 1TBRH 5DP6A 5A8XA 3AW1A 4X1RU 2NU3E 2XRCA 3UQVA 1AO5A 4HI3A 1J16A 2OC8A 1C5WB 5CMXH 3RMMH 1HBTH 3UOPA 3DSOA 4JMYA 2Y5HA 1VCWA 3VB5A 3NZIA 1WXRA 2P94A 1NPMA 2BLQA 4B2BA 1FY1A 5GIBA 1Y5AT 2EC9H 4RT1A 1EPTB 7ESTE 4AC9A 1YWUA 2F3CE 3TH2H 2VU8E 1WV7H 5ETXA 3RP2A 4GAWA 1V2KT 1HJAB 1ZZZA 1ANCA 4Q2KA 4YT7H 1C5VA 2GMTB 3A7XA 3F2HA 2A7HA 1OWDA 1AD8H 1ZGIA 1NFUA 1C1SA 1FLEE 1ZSLA 1AY6H 2GDEH 2A5IA 2ZECA 4CRCA 1A5IA 1GDNA 5KGOA 4X2YA 1LPZB 1ZYOA 4IC5A 4XE4A 2FX6A 1O2QA 3UNQA 3RXFA 2R2WU 1D3TB 3DSPA 1GBKA 3E1XB 2ZFFH 1BTUA 1ABIH 1GBBA 3E8LA 1FAKH 2UUYA 3A8DA 2BVSH 1YBWA 3UB0A 1SGTA 1C1TA 3GOVB 1NBME 3M3TA 4F48B 4DW2U 1ACBE 1C5QA 3GY6A 4KP0A 1GVZA 2F43B 5F53A 1MKXK 1DWCH 1PQ5A 1S83A 2FOFA 4IGDA 3SU5A 1C2FA 3SORA 2CMYA 3F0OA 1FAXA 2TGAA 1QBOA 2R2MB 4DG4A 1DWEH 4KTSA 2QA9E 1C5ZB 2XWAA 4CHAB 1SGFA 1AWFH 3A8BA 4MLFB 2WPHS 1LPKB 4HGCA 3SNAA 2QY0B 3PYHA 1RD3B 1KXEA 4AZ2B 3LH3A 5HIYA 3RXKA 1FIWA 1P8VC 1GDQA 3SUEA 2QN5T 2TBSA 3SW2B 5LPEA 1EQ9A 2BM2A 3PV4A 3IG6B 3HGPA 1VGCB 1CSOE 3K6YA 4INHA 4UEHH 2GCHF 8LPRA 3O8DA 1HAXB 4D9RA 1NFYA 5FPSA 1FPHH 1MMJN 4I7YH 1GHBF 1JIMA 2QF5A 4UDWH 1EZSC 5KECA 2ZF0H 8GCHF 2BY7X 4FUEA 1KLJH 4A1VA 4ABFA 4CRBA 1SL3A 2SGDE 3PRBA 1FMGA 3GCNA 1SGYE 1GJCB 2BHGA 4YLQH 4Q80A 2JIZD 1ZMJA 1L1GA 3DD2H 2JETB 2W3IA 1Y5UT 1WQVH 1P11E 1GHAF 1Y5BT 2C4FH 4DIIH 4CBNA 1VCPA 1E34B 1J8AA 4ASUD 4Y7BA 2PFEA 3SNDA 1C1PA 4OS1A 1JRTA 1HCGA 1UK2A 1CGHA 1O2PA 3DSGA 2YMSB 1XKAC 3HPTB 1H8DH 1TNLA 3BTHE 4F49A 1O5FH 4M7GA 1IQIA 2ZHEH 5LGOA 2WV9A 4B1TA 1GBMA 2OD3B 3F2FA 3AW0A 3OU0A 1L1NA 2ZU5A 3URCA 3KQDA 1K1IA 4H6TA 1DPOA 1YKTA 3SHCH 1Z71A 1DLEA 2J5UA 1G3BA 2GVFA 2AMPA 1LCYA 3A7YA 3URDA 1T8LA 1GMCF 5DP4A 4NZQA 4M9FA 1GI7B 1N8OC 1ANBA 2Y81A 4JZ1A 3SZEA 1F0TA 2ZC9H 3NKKA 3P92A 1D4PB 3O8RA 2Z9GA 4MVNA 3UY9A 1SBWA 2RG3A 2J92A 3D62A 1QFKH 1ZLRA 3RXUA 5F8TA 3RC6A 4ASHA 4K3JA 1TMUH 2KR7A 1C5SA 1DDJA 3M3VA 3EGKH 1INCA 2H9TH 1O3FA 5A8ZA 1GBTA 4Z0KA 2FPZA 1O5EH 4K1SA 3ZZ8A 1SFQB 4FVBA 1AN1E 5A0BA 4CRAA 2Z7FE 1UTKA 3ZVFA 1YPHE 5AFZH 3BEUA 1O5DH 4NIYA 3Q77A 4FETA 2HLCA 1SHHB 1K1PA 2H6MA 3SO3A 1TPSA 2Z9IA 2GCTC 4NCYA 2ZDMA 1BMAA 1EOLA 2XXLA 1KXFA 1RJXB 4A1TA 4Y8YA 1GDUA 1NRQH 1Y3YA 3N99A 4Y71A 1GJBB 2THFB 5LPRA 3N7OA 3EAJA 2QF4A 1TNIA 2J9NA 2ZQ1A 4JK6A 3SUGA 5T3HA 2QAAA 2PKSC 4THNH 4AB8A 2V3OH 5FBIA 1IQHA 3T62A 1C2LA 1QY6A 1TNJA 4Q63A 3ZV8A 2G5NA 3QN7A 5HM2A 2WV5A 2Y82A 4ZHAA 2P3FH 1QA7A 2J38A 3P8OA 3OTJE 5FHTA 1EX3A 1O2IA 4MNYA 2VIDA 2TGPZ 2UUJB 3U98H 1UJ1A 1K22H 2A7CA 1XM1A 1O3KA 2AIQA 5EQSA 4I31A 3G01A 3ZYEA 1ELDE 1PYTC 1KDQA 5CHAC 4ZROA 3H7OA 5EU8A 1N6XA 3PM3A 3ZZCA 2F9BH 2HVXA 1JWTA 2VH6A 1GHVH 3MNBA 2BD4A 3UWIA 1FUJA 4GHTA 1GBEA 1F5RA 1DE7H 3SN8A 1NS3A 1C2DA 1PPEE 2J94A 5GPIB 2EY4C 5DO4H 1LMWB 1THSH 1FY3A 1Y3XA 1IHSH 3STIA 1LHGH 3SQEE 2SNWA 2BX4A 1BTWA 1TX7A 3KIDU 3WY8A 2EI7A 1F7ZA 1IQKA 1GBJA 2L74A 1F0UA 3RXHA 3LGYA 1LVOA 2ZU3A 3BTFE 1UO6A 3RXSA 2Q1JA 1SGQE 2GD4B 4A1XA 1C1UH 2FYQA 3M5LA 1EATA 1DS2E 1DT2A 1V2LT 2H9EH 4I8GA 2HGTH 3U28C 5IDKA 3BTWE 1GI5A 1T8OA 2FXRA 4Y8ZA 5DGJA 9LPRA 1LHCH 3TK9A 5DG6A 3RLWH 1GHXH 2ZTZA 1O3BA 1Y3UA 4ISNA 4ISLA 2KM0A 2BXTH 4MNVA 4TPYA 2XBXA 2FS9A 1NC6A 3GCOA 1GI1A 1SOTA 2CV3A 2ZIQH 3FANA 3RMNH 3D23A 2EEKA 1MTNB 1TNKA 4NA7A 5L6NH 1LHDH 1DM4B 1P02A 3QUMP 5EODA 2NU2E 3GCTF 4H6SB 5T6DA 5GJ4B 1D3QB 3QZRA 3Q00A 1D3DB 4X1PU 2J4IA 1KDQB 4B6FA 3TPIZ 2PWXA 3AVZA 1S85A 3ODFA 5GNDA 2ALPA 1JRSA 3SNEA 1RTLA 1THRH 2H5CA 4INKA 3UNSA 2VH0A 1LDTT 4MQAA 3JZ2B 3GDSA 1CGJE 2G55A 2NU1E 3ZZAA 2V0BA 1K21H 1T8NA 4A6LA 1OP2A 4X1NU 5E2PA 3SUFA 1GI0A 3LC5A 2W5EA 2A7JA 1SGEE 2PTNA 3MO6A 4YM9A 1C5XB 4CRGA 1XUIA 4A7IB 1GGDC 3UPEA 1PPZA 1O0DH 5DKMA 3F9HA 5C1YA 3NCLA 3SU3A 1OWJA 5B6LA 1AQ7A 1EJMA 1Z1IA 1ARBA 3UR9A 3UQOA 2ZGBH 3LGVA 1O2VA 3BN9A 5DP9A 3FP8E 4YZUA 1D9IA 4Y76A 1BRBE 1SLVB 3LONA 3TGJE 1IOEA 1W2KH 2PKSB 1QURH 1SB1H 2ZPQA 3A80A 3F3BA 1GJ6A 1K28D 1OKXA 5E0JA 3NPSA 5FCRA 1TALA 4NZLA 2B8OH 2IPHA 2WSSD 1D6RA 4YO9A 3SU4A 3SV8A 3TGKE 1YPMH 1PPCE 3ZZ9A 2GZ7A 3M5NA 4AB9A 2ZG0H 3RXVA 5GCHF 3MNCA 1MTVA 4MPVA 4D9QA 4B74A 4FU8A 1O30A 2QF3A 2QC2A 5DN6D 4AORA 1U6QA 1MKWH 1E1QD 3RXLA 3A7ZA 5HIZA 4I8HA 3RXQA 3SNBA 1BITA 4UONA 3A88A 1HAOH 4ABIA 4MDSA 1DOJA 4CR9A 5F8XA 2HVYB 2GMTC 4NFEA 1SGFG 2TRMA 1GMHG 4X6PA 2UWOA 4MNXA 5E0HA 1UTLM 1XXFA 4R8TB 3RMOH 2AIPA 5HXFA 3AASA 3HKJB 3TH4H 1V2ST 2KCAA 4ABDA 3SV9A 3CNRA 1C9PA 1P01A 2I6SA 2H1UA 2TPIZ 2VVUA 1W8BH 2ZDNA 7KMEH 1A5HA 2HPPH 2BDHA 1O38A 1ETTH 1P3EA 1V3XA 3GCHC 2BY8X 2ZP0H 1GJ5H 1UCYE 2OK5A 1CU1A 4K69A 6GCHG 8KME2 2AGGX 1S0RA 2HNTC 5DP8A 1MAYA 3MFJA 4E06H 3IWMA 1MD8A 1COWD 4B6EA 4ZMAH 1EAUA 2VBCA 1LPGB 1B5GH 3OEED 1BA8B 1MU8B 3QO6A 3PV5A 1SLXB 1ZRKA 3Q3XA 1PPBH 1MTWA 1O3LA 3P8FA 2FS8A 2ZU4A 1BMMH 3KGPA 2C8WB 5DK1A 2BY9X 2SGFE 1CVWH 4CRDA 2M5TA 1S81A 4RT0A 4GCHG 4CHAC 1AKSA 1W12U 2ZCKP 1N6YA 3P17H 2G4TA 4ZHMU 3VXEH 5JDUB 1SI5H 1O3DA 5F6MA 3U9AH 1W0YH 3D49H 2QXGA 1EZQA 1ZSJA 1AWHB 2Z3DA 2Q6FA 3LT3A 2PP6A 2C93B 1VGCC 2R0LA 2JH6D 1P3CA 2Z94A 1H8IH 1FZZA 5FL7D 1JXPA 1TMBH 2FI5E 1MH0A 3GY5A 5DP7A 3ODDA 2BVXH 2CGAA 2OUAA 1O36A 3FAOA 3SBKA 3GY8A 2O8TA 3GYMA 4A5TS 4UFFH 2TGDA 1UTOA 1BUIA 1WUNH 1W0JD 2JETC 4X1SU 1BMFD 1O37A 1PPGE 2GTBA 1W7XH 3VB7A 2OP9A 3A83A 4BNRA 1VR1H 1O35A 1W0ZU 4JK5A 1DX5M 4TPIZ 3TJUA 1DSTA 3ZZ6A 2GZ9A 4Y6DA 3V3MA 4UE7H 5C2ZA 1EAXA 4Q7XA 3WW7A 2W7UA 2K8IA 2ZQ2A 2IN2A 4YOGA 2JJ1D 5FAHA 2PGBB 2O8LA 2QYIA 1QNJA 4FU9A 4WY3A 1NTPA 4O3UA 4DVAU 2Y5GA 3F9EA 1CBWB 1O39A 2L6OA 2ZWLH 5BPEA 3W94A 1ZMLA 2ZZUH 2W6JD 4BAHB 4B75A 1C5MD 1BTZA 1CA8B 1ELVA 5AFYH 5C20A 7LPRA 4Y0YE 1IQJA 1BTHH 3SV7A 1AKSB 2QCYA 4F55A 3TK5A 2CK3D 3S69A 1DFPA 5T1VA 5EQRA 2PHBA 2DE9A 5C94A 5EW2H 4UD9H 1BTXA 1P2JA 1BTPA 3M7QA 4I33A 4OGXA 2PR3A 4AN7A 4DGJA 2LP6A 2A2XH 4ESTE 1C9TA 3I77A 3FZZA 3VEQB 1SGCA 2WPDD 1J9CH 1V2OT 3SZNA 3KQBA 1UK3A 2B9LA 2D26C 1ZTLA 2TGTA 2ILNA 5EXLA 1EZUC 3BTME 4RKJB 1ZTKA 3MO9A 1T8MA 2GKVE 3S0NA 4YOJA 1CQQA 4JZFH 2NWNA 5JBCS 3A84A 3PWBA 5B6OA 1WTGH 1K9OE 5CDFE 4WMDA 1Z1JA 1O3PB 1O3EA 3A89A 1SGIB 3OAAD 4LK4A 3GCHB 5FPYA 3HATH 4XDEA 4FUCA 2PKAA 3RXJA 3UAIC 3N7EA 1G32B 1ELAA 2HOBA 1EUFA 4JYUH 3EA9A 1E38B 1MTUA 3VGCB 1O2GH 3RXOA 5A09A 2STBE 4BANB 1O2RA 1ZHPA 5C5OA 3SGAE 2Q6GA 1A5GH 1GCTC 1SQAA 1TIOA 2A32A 4OM9A 3RXGA 2FESH 4HFPB 4BAOB 2RDEA 2PSYA 2ZNKH 5IYTA 1TA2A 1GJ8B 4E7RG 1TB6H 1ZPBA 1GBIA 3H09A 4FUHA 1QR3E 1PJPA 1YCPH 4O03A 1QQUA 3E91A 5SGAE 3MU4A 1G36A 4WXIA 3BG4B 1CO7E 1EFRD 3ZIAD 4BTIB 2ALVA 4I32A 1VJ9U 2ANMH 2GV6A 4UFEH 1A3BH 1VITG 4ZAEA 1C2HA 2GP9B 1OXGA 6CHAB 1WCZA 1UVPA 2BTCE 1P9UA 1A2CH 1G2LA 1B0FA 4B2CA 4BAQB 1SQRA 4TWYA 1LHFH 2WHXA 4TY7A 3EYDA 4NIVA 3EE7A 1MBQA 3LIWA 1P2IA 4IN1A 1GI9B 2FDAA 3NK8A 4U2WA 1GG6C 1A7SA 3UNRA 1JMOH 2ZGXH 2ZHQH 3BTKE 2J95A 2QXHA 2BDBA 3B23B 5JPMH 2IJD1 1LKAA 1LQDB 3MYWA 4OGYA 2FI4E 1UCYK 2J97A 1SOZA 5GXPA 1TONA 1P2QA 3QGJA 3S9AA 4O97A 1KSNA 2BY6X 4WJG2 2HWLB 3QK1A 3V13A 2FI3E 4CREA 1S6FA 2VIOA 1T4VH 1KXAA 1UVSH 1ESTA 4WMFA 1OSSA 1HGTH 3T25A 2YMSD 4KTCA 4BTTB 2F9OA 2LPRA 3NRLA 5JYIA 3M61U 2KAIA 2ZGJA 2R3YA 1MTNC 6ESTA 4K8BA 1BTYA 1EZXC 1RRKA 1WTHD 2NU0E 1A4WH 1ZMNA 4NIWA 3FOAA 1AIXH 5DPAA 5CE1A 5F03A 1YPJH 3RU4D 1HXFH 2FOHA 2A4RA 2BD3A 2FM2A 3T2NA 1Q31A 3WWFA 4QT8C 2ANYA 1HYLA 1O2UA 1RIWB 2F4LA 3A82A 1V6DA 1HAHH 1O2SA 3MH6A 2Z9JA 2F9NA 1NU7B 1YPGH 2F83A 2KCYA 1DITH 2VVCA 4ISOA 1BBRH 1EXFA 1IQEA 1CHOG 3GY7A 2O8UA 1IQLA 2IJOB 4XBBA 1O34A 4B71A 4CBOA 1TE0A 3W1EA 1QB1A 3BTGE 5L2YH 3NUMA 1AE8H 1WDIA 1C5UA 1EJNA 1KY9A 1SLWB 3F1SB 3P95A 1UVUH 3V0XA 1L0ZA 2XNIA 5A2MH 5C1UA 1C2JA 1C5PA 3SGBE 1MUEB 3R3GB 1YC0A 2D1JA 1ETRH 1GHBG 3FFGA 1RGQA 2ZU1A 2GV7A 2CJIA 3E0PB 1FPCH 1Z8GA 3SQHE 4X6MA 3ZVEA 1ZGVA 3RXRA 1TX6A 2GJGA 1Y3WA 2BDYA 2HNTF 4NIXA 1V2RT 1H1BA 3MWIU 1YGCH 5I25A 1FDPA 1EAWA 1GCTB 2P3UB 3Q3KA 1C4V2 1SR5C 4K1TA 1ZR0A 1FN8A 1E79D 1EP6A 1PQ8A 3CP7A 4X6OA 4ZH8A 1V2JT 4X8VH 2EA3A 3U8OH 4X6NA 5G4BA 2OC7A 3ZVAA 1TLDA 1NRPH 2A5KA 2ZDLA 4IMZA 1G3DA 5H4IB 2BD8A 1WSSH 1GBCA 1YCPM 1V2MT 2A4QA 1SGDE 2A4OA 1GHZA 3SUDA 3O8BA 4BAKB 3MH7A 1ABJH 5AF9H 1QJ1B 1HAIH 2A0QB 1KYNA 4FUBA 4ISIH 5EQQA 3NWUA 1HJ8A 3BTEE 4P00A 4AYYB 1HNEE 1MCVA 4NSYA 3SJ8A 4MPWA 1ELFA 2W26A 3MNXA 3B9FH 4U32A 3OEHD 2ZHDA 1O5GH 1YPEH 3T28A 2R3UA 1QA0A 2BX3A 4ABHA 1BOQA 5L30H 2BQ7B 2OBOA 4I8JA 2OBQA 4NFFA 5FPTA 4BOHA 1AVGH 1Q2WA 2AEIH 2F9PA 1L4ZA 1P2MA 2KX4A 2FOEA 4XSKU 3VPKA 4ZKRU 5K7RA 1GG6B 3VB3A 2FMJA 2BD9A 2ZU2A 3QZQA 5ESTE 2YNAA 1DWDH 1W14U 3P6ZB 1FN6A 4ABBA 1C1OA 3RDZA 3GISB 1OWHA 1DY9A 1C1WH 1EASA 3SI4H 3RC4A 2HLDD 3MH4A 2BLOA 2ZEBA 2A31A 1UTJA 1CT0E 1FY4A 2FLBH 4VGCB 2BD7A 1XVMA 2ZI2H 2GT7A 1BDAA 2Y6TA 3SYJA 4B73A 4RKOB 5EJ1A 3ZZ3A 1TPPA 1SFIA 5IK2D 3K9XB 2R9PA 2BDAA 1T32A 5JBBS 1C1NA 2BOKA 3MQKC 3TU7H 3RXBA 3L33A 3GY4A 1WQSA 1KLTA 1ORFA 2F9UA 2ZKSA 2ZCHP 5C5NA 1TABE 3EQ0H 2G5VA 2ZDVH 3BSQA 1RS0A 1J14A 1XX9A 1C2EA 3CS0A 1GI8B 2FO9A 3QTVH 5TCCA 5AVDA 4ZXYH 2B0FA 1CE5A 3LKWA 4Y0ZE 1GMDF 5FXLA 4ABAA 1OX1A 1D3PB 1TBZH 3EA8A 1W10U 2RCEA 1GBLA 3PV2A 2JH5D 1P05A 1RTFB 4Y8XA 4D7FA 1QRWA 2PLXA 1AUJA 1HV7A 4XBCA 1XUHA 1O2NA 1WYKA 1UW7A 5KEDA 6GCHF 2VJ1A 3KEEA 3MU1A 3ZZDA 3OSYA 1QGFA 9ESTA 1NO9H 4GUXA 1O3OA 2XBVA 4YLUA 1MD7A 1GJ7B 2BQ6B 4ABGA 5GWZA 2OINA 1KXDA 2DUCA 1HFDA 3HKIB 1OP0A 1HRTH 1L1JA 2P95A 1HAZB 5JB8S 1V2PT 1S6HA 2AMDA 4R0IA 5DP5A 1DANH 3MU5A 1CBWC 1NU9A 3FVFB 3PMAB 1DUEA 3BG8A 4GCHF 4WH8A 1YYY1 3SV2H 2VWNA 3UREA 3KQ5A 2UUKB 4I8KA 3MHWU 2SGEE 3PMHB 3MH5A 2V35A 2V3HH 1S6LA 4OS4A 3T5FH 1OYQA 3F9GA 4DT4A 4BAMB 1SVPA 5HGGA 3S9BA 1H9HE 3RXDA 1MKXH 4J1YA 2ZO3H 1G3CA 5EG4A 1C5OH 2ANWA 1FX0B 4Y79A 4SGBE 4B76A 3RM2H 1G30B 3OTPA 1L4DA 1HUTH 1BZXE 1GL1A 1GVKB 2SNVA 3LOXA 2G8TA 1MABB 3E90B 4FOUC 1C2GA 3PO1C 3F68H 4YT6H 2VGCC 2ZA5A 1QRZA 1ANEA 1C5LH 4AG1A 1ELGA 1OWKA 2O8MA 1BHXB 1UMAH 2ZTYA 4NA8A 1S0QA 1LTOA 1NRSH 1PYTD 4ABJA 5LPFA 2CHAB 1EP5A 3ZZ4A 2CN0H 3TVJB 2ODYB 1ESBA 1SPJA 2GDDA 2WUBA 4K2YA 2O9QA 2FP7B 5A8YA 3SI3H 1DVAH 2FEQH 3VGCC 4O9VA 3FKSD 3SHAH 2WINI 3ZZBA 3AAVA 1TGSZ 3ATLA 4TWWA 3F0PA 7GCHF 3SJ9A 3ELAH 1XUJA 2ZFSA 3K65B 1UTMA 2XCFA 3QWCH 2J98A 4AFQA 1Y3VA 4WH6A 3E0NB 1P09A 4FXGH 3DUXH 2WPLS 5E8EH 4X2WA 3TNSA 1IQMA 1Z7KA 2OC1A 4AG2A 1BJVA 3BG4C 5I46H 1TRNA 1FXYA 1T31A 3ZVCA 1UTNA 1A3EH 6CHAC 2BB4A 1AZ8A 4ZCNA 4OS2A 1YLDA 3M5OA 3S9CA 1TAWA 4X2XA 2ULLA 2BVRH 1A46H 2FZZA 1YLNA 1C2MA 1JBUH 3LU9B 1AUTC 1K1OA 2F9VA 1M9UA 4Q7YA 3RXPA 4Y11E 3SU6A 1VITH 1GJAB 1N1LA 3ATKA 1O2JA 3D65E 1EPTA 1T4UH 2FTMA 4KGAA 2FOCA 3PTNA 4TYDA 1ARCA 4YTAA 1XUGA 1YPHC 3H5CB 4BXWA 2VWLA 3RXTA 3ZVGA 2EQNA 5GCHG 1LVYA 2ODQA 3TITA 5EIYA 1BRUP 5E0GA 2AGIX 5EXNA 2AERH 4IS5A 1LVMA 1F0RA 2G00A 1ID5H 3U8RH 3TJNA 2Z3EA 3GS9A 3PROA 1QJ7B 1NRRH 1GBFA 1GI6A 1DXPA 1W7GH 3EDXB 2WYJA 3A81A 2KFWA 2XWBI 2PGQB 1ETSH 5EW1H 1NBMD 5C3NA 1ZOMA 4PROA 4E05H 4CH2B 1ELCA 2BLWA 2J98B 4ZUHA 4WWYA 3W95A 1GHYH 3KN2A 3VB6A 2P3TB 3M36A 3QTOH 1CHGA 1O3IA 1P03A 4X8UH 3KYFA 3RMLH 1B7XB 4XD7D 3UFAA 4JYTA 4FUIA 1VITF 1A0HB 3A7TA 1AU8A 1S5SA 4CRFA 3DFJA 4FU7A 4X8SH 2FODA 3MI4A 2ZDAH 1HXEH 3LJOA 2QXIA 2ZFQH 1QB6A 3UOUA 1RIWC 2ZDKA 1Z8JB 1A61H 2XW9A 3T26A 4RSPA 3AAUA 3CS7A 1MZAA 2HPQH 3A7WA 4IC6A 4D76A 3B8JA 4KELA 1THPB 1GL0E 1E1RD 2JH0D 1DXWA 2BDIA 1CA0C 2W3KA 4E7NA 3PO1B 1EB1H 2VGCB 3TJVA 4H42U 5JB9S 1TBQH 3T27A 1J15A 1O3JA 1TGNA 3GYLB 3MNSA 3PLKA 3ITIA 1W11U 1UVTH 5E2OA 5L2ZH 2WPKS 2FOMB 1SGNE 4MNWA 2V7QD 3SJKA 1O2WA 4DCDA 2Y5FA 3L6PA 3WWBA 2ESTE 1BHXF 2QV1A 4LZ1H 1GI4A 2KZ4A 5EJZA 1FIZA 2Y80A 1O5BB 1SLUB 4GVUA 3TK6A 4DY7B 4WXVA 1QBNA 2ZGHA 3ATMA 4CR5A 4LOYH 2Z9KA 1Z8IB 2A4GA 1SHYA 5C17A 2GGVB 1C1RA 3SU0A 1ELBA 1ZTJA 3P8GA 3SJIA 2EI6A 3KNXA 1QL9A 3M37A 1BCUH 2M2AA 5A0CA 4NWKA 2BZAA 1QRXA 1O32A 2H2ZA 1GVLA 4D8NA 1HJ9A 1IAUA 4RN6A 2G4UA 3SU1A 2RFKC 2GT8A 1C5TA 1TNGA 2AMQA 1JOUB 1O5CB 2BYAX 1MKWK 3EA7A 1BJUA 1O2HA 1YY3A 3ATWA 3PLPA 5EJLA 4F4OC 6LPRA 2JDID 3H7TA 1Y8TA 1K0HA 1SGPE 2OTVA 1GBAA 1KIGH 3SNCA 4WF8A 1PPFE 1O3CA 1CHOF 2R0KA 1TPAE 1UHBA 1L2EA 3GDVA 2RDLA 1HB0B 1BRAA 3UWJH 4D7GA 3U1IB 3ZVDA 2BDCA 1V2QT 3V12A 1F2SE 2WPMS 5JBTA 4ZHLU
chains in the Genus database with same CATH topology
2C8XB 4LZ4B 5ABWA 2Z6BD 4K1EA 3EE0B 4X1QU 3TJOA 5J4SA 1TMTH 2C3SA 2AH4X 1AE5A 1YPKH 3O8CA 2VIQA 1QL7A 2FIRH 1LO6A 1P2OA 3RXEA 3RC5A 1XUFA 4MTBA 3SOSA 2PKAB 4AYVB 1BMLA 4DJZB 4DIHH 4VGCC 2G81E 1DLKB 1QQ4A 4JZIA 1ZPCA 1C5RA 1TPOA 1TRMA 1F5LA 2WUCA 5HYOA 1BMNH 1KTTB 1MAXA 3BIUH 3A85A 5J4QA 4OS6A 1GJ9B 2BD2A 1EB2A 4LXBH 2HNTE 1CT4E 2A2QH 2XBYA 2ZHFH 3QX5H 3HK6B 5FCKA 1Y59T 3M7TA 1DSUA 2ZFPH 2FWWA 4U01A 4ZKNU 1P12E 4K5ZA 3K6ZA 3U8TH 1C2IA 1GJ4H 1AB9C 1QB9A 3L3TA 5HM9A 1IQNA 4DURA 1HAPH 1BBRE 4GLYA 1O2OA 1W3CA 2AS9A 2BY5X 3BIVH 3BTDE 4J2YB 4H4FA 3E3TA 3SU2A 3K2UA 4CH8B 1BB0B 3M7UA 3U69H 3MTYA 2J2UA 4GHQA 2Z9LA 4NSVA 4AOQA 1O2MA 1Z6JH 1HLTH 2Y7XA 3UIRA 1UHBB 1K2I1 4AX9H 1BIOA 1JIRA 1XKBC 1AZZA 1CA0B 1T7CA 1PQ7A 3RUOA 1WAYB 3MOCA 1O3NA 1O3MA 2BD5A 2H9HA 2SGPE 2A1DB 2GCHG 2B7DH 1KTSB 2P16A 3SV6A 3HGNA 1DY8A 3P8NA 2Z3CA 2ZPSA 2SGQE 3BV9B 1MQ6A 1ZSKA 1AVXA 8GCHG 1XUKA 1RXPA 3A8CA 1GI3A 2XBWA 1ESAA 1GI2A 2ZCLP 1Z6EA 5ESBA 1UTPA 3GICB 3ATIA 3IITA 5BRRE 2XTTB 1XXDA 3RU4T 1GHAG 2ZTXA 3ENSB 1O3GA 3VXFH 5T6GA 2D8WA 1YP9A 2BZ6H 1FONA 1H9IE 2P8OC 3ZYDA 2OC0A 3CENA 1OYTH 3LDXH 1CT2E 3BF6H 3GY3A 2XC0A 2KAIB 3TGIE 4NGAH 1C4U2 4X8TH 4Y7AA 1TRYA 3KHVA 2VVVA 3LGUA 4YOIA 3V7TA 4ZKOU 1VCQA 3RU4E 2CF9H 1B0EA 2Y7ZA 4A92A 3FZDA 2AYWA 1TWXB 5DJ7A 1H4WA 3KF2A 1P04A 1V2UT 2PUXB 3TLOA 1O2ZA 3LC3A 2YNBA 3TH3H 1TQ7B 2D2DA 1K1LA 3MU8A 4GSOA 1RFNA 3ZZ5A 3GY2A 1DWBH 1O2YA 4FVDA 1TX8A 1F92A 1AFEH 1GMCG 1HAGE 1P10A 2WPJS 1SSXA 1G9IE 1F0SA 1TOMH 4ISHH 3OX7U 3ZZ7A 2HALA 2CF8H 5EPYA 2FTLE 2OQUA 2CHAC 1A0JA 4DOQA 2ASUB 1K1JA 5PTPA 4HZHA 4IBLH 1EOJA 1ELTA 1SQTA 1OWIA 3ZV9A 1BQYA 4MPXA 1UTQA 1NFXA 2UUFB 1YPLH 2WPIS 3S7KB 3M3SA 2HRVA 1GBHA 1QIXB 2UWPA 3LH1A 3C1KA 2IOTA 3NXPA 1A1RA 1G2MA 1AFQC 1PPHE 3ESTA 4I8LA 2OLGA 1P2KA 1O3AA 2UWLA 1NT1A 1O2XA 3UUZA 1YCPK 2GX4A 1QHRB 5FX6A 1SQOA 3RM0H 1ZHRA 1V2TT 2A5AA 3VFEA 1F5KU 2PV9B 4O3TA 3LGIA 1AHTH 5TCAA 5F8ZA 3ZZ9A 1MTSA 1LKBA 2BOHB 2CXVA 2FLRH 2VB0A 3MO3A 1O3HA 1GBDA 5T6FA 1YF4A 1E35B 1SGRE 4Y10E 4X0WU 1ZJKA 2PSXA 1SC8U 3KQEA 1GMHF 1O2LA 4KTUA 1AB9B 1O2TA 1FY8E 3PLBA 4OS7A 8ESTE 4SGAE 2I6QA 1QL8A 3U1JB 4U30A 3QLPH 2V6NA 1ZPZA 3F6UH 4AGJA 1GWAA 2WV4A 4IW4E 1P57B 3TNTA 1HPGA 1N8OB 2FX4A 2BQWB 1GPZA 2OXSA 2Q6DA 4XBDA 4JCNA 2C8ZB 1WU1A 3QGNB 2ZFTA 1HIAA 1C1QA 3A8AA 5EOKA 4XFQA 1J17T 2AGEX 4AFUA 4NA9H 1RTKA 4UFDH 3E16B 2STAE 1S82A 1GHWH 4IN2A 1PFXC 1TNHA 1WOFA 1AVWA 1D6WA 2J34A 1IQGA 5LH8A 1ZRBA 1AGJA 1BT7A 3VB4A 3MU0A 1HAVA 3SGQE 1NRNH 3PTBA 3M5MA 1MU6B 2BDGA 3RXCA 1GJDB 1LHEH 1OWEA 4ZKSU 4NG9H 4GPGA 1NM6A 2BMGB 5JBAS 1QCPA 1MZDA 2RA0A 4UFGH 3RLYH 1CGIE 1UVOA 1V2NT 1FJSA 3GDUA 3A86A 4AFSA 2FOAA 3Q3YA 3DHKH 1TGTA 2GCTB 1NROH 2ZPRA 1IHTH 1G3EA 2P8OB 2H5DA 3RXIA 2BXUH 2G51A 1O31A 1Z8RA 3LGTA 1E36B 4TY6A 2XCNA 1KLIH 2AFQB 1S84A 2QIQA 1OP8A 3OY5U 1TGCA 3C27B 1ELEE 1K1NA 2QXJA 1FNIA 1QTFA 1XMNB 2JKHA 2VIVA 1BBRK 3KCGH 1DICA 1P2NA 1C4Y2 1C1MA 1GCDA 1TA6A 5DP3A 1FI8A 2VWOA 1X7AC 1NZQH 4Z6AH 2F91A 2SFAA 2NU4E 1NN6A 4K8YA 1VZQH 3UR6A 1EPTC 3FP7E 4FUDA 1DUAA 5TJXA 1K1MA 2C90B 1EAIA 1NESE 1SG8B 4JZEH 1E0FD 3P70B 2W7SA 1BRCE 2OCVB 1P9SA 1HJAC 2ZGCA 5EXMA 1HIAB 5CHAB 3GCTG 3DFLA 1TQ0B 5FX5A 3STJA 4ABEA 1GMDG 1P06A 2VWMA 1MQ5A 3F9FA 4BXSA 1VJAU 1HDTH 1LVBA 4ZXXH 3KQCA 5A0AE 2PW8H 4K60A 1OPHB 3T29A 3MMGA 1C5NH 1NFWA 1HAVB 1IQFA 2DE8A 2XC4A 2LNCA 1AI8H 1ZHMA 2GZ8A 1E37B 4AGKA 3A7VA 1AFQB 1EKBB 2A45B 2SGAA 3LPRA 5EPNA 4KKDA 1V2VT 3BEIB 2YOLA 3I78A 2QGRA 1PQAA 3I29A 3UTUH 2VIPA 1TOCB 1QJ6B 4XOJA 2RA3A 1AMHA 4B2AA 1TYNA 5C1XA 1C5YB 1UCYH 1Q3XA 4Q7ZA 4AFZA 5EGMA 1LQEA 2P93A 2TIOA 2ODPA 3PMBB 2B5TB 2WYGA 5FBEA 1W13U 4NWLA 1KXCA 3OY6U 2XC5A 2ZFRH 4MPUA 5AHGH 3M35A 1FV9A 4JZDH 5HMAA 3PWCA 5K0HA 2VINA 2ANKH 2G52A 3DA9B 4YESB 5C67A 3SJOA 2O8WA 3BTTE 1ANDA 3TIUA 3OYPA 3RXAA 3ZVBA 4MG3A 1TFXA 1V2WT 4INLA 1KXBA 1YLCA 3BTQE 1TGBA 2VNTA 3RXMA 4IMQA 3LGWA 1NY22 1FQ3A 1EJAA 1MCTA 3PMJA 2K1QA 3E6PH 1O2KA 1O5AB 2P59A 1XVOA 4FUGA 3Q76A 1WBGB 4JYVH 3KL6A 5GDSH 3DT0H 3A87A 4FUJA 3PB1E 1H9LB 3FP6E 4X2VA 3QDZB 4DT7B 1C2KA 3R0FA 4FUFA 2ZHWH 4WVPE 2BLVA 4OS5A 2XYAA 2C8YB 2OQ5A 3HK3B 1MBMA 1YM0A 3BEFB 3JZ1B 3LJJA 1ZJDA 1A0LA 1C1VH 2QF0A 1GGDB 2FYRA 1HAYB 1SMFE 1UK4A 2EI8A 2FOBA 4WMEA 1OS8A 2PTCE 1G37A 2VIWA 3S7HB 1OOKB 2FOGA 1P0SH 1FY5A 2PUQH 4BTUB 1O33A 7GCHG 4HTCH 1QBVH 1TBRH 5DP6A 5A8XA 3AW1A 4X1RU 2NU3E 2XRCA 3UQVA 1AO5A 4HI3A 1J16A 2OC8A 1C5WB 5CMXH 3RMMH 1HBTH 3UOPA 4JMYA 2Y5HA 1VCWA 3VB5A 3NZIA 2P94A 1NPMA 2BLQA 4B2BA 1FY1A 5GIBA 1Y5AT 2EC9H 1EPTB 7ESTE 2F3CE 3TH2H 2VU8E 1WV7H 5ETXA 3RP2A 4GAWA 1V2KT 1HJAB 1ZZZA 1ANCA 4Q2KA 4YT7H 1C5VA 2GMTB 3A7XA 2A7HA 1OWDA 1AD8H 1ZGIA 1NFUA 1C1SA 1FLEE 1ZSLA 1AY6H 2GDEH 2A5IA 2ZECA 4CRCA 1A5IA 1GDNA 4X2YA 1LPZB 1ZYOA 4IC5A 4XE4A 2FX6A 1O2QA 3UNQA 3RXFA 2R2WU 1D3TB 1GBKA 3E1XB 2ZFFH 1BTUA 1ABIH 1GBBA 3E8LA 1FAKH 2UUYA 3A8DA 2BVSH 1YBWA 1SGTA 1C1TA 3GOVB 3M3TA 4DW2U 1ACBE 1C5QA 3GY6A 4KP0A 1GVZA 1MKXK 1DWCH 1PQ5A 1S83A 2FOFA 4IGDA 3SU5A 1C2FA 3SORA 2CMYA 1FAXA 2TGAA 1QBOA 2R2MB 4DG4A 1DWEH 4KTSA 2QA9E 1C5ZB 2XWAA 4CHAB 1SGFA 1AWFH 3A8BA 4MLFB 2WPHS 1LPKB 4HGCA 3SNAA 2QY0B 3PYHA 1RD3B 1KXEA 4AZ2B 3LH3A 3RXKA 1FIWA 1P8VC 1GDQA 3SUEA 2QN5T 2TBSA 3SW2B 5LPEA 1EQ9A 2BM2A 3PV4A 3IG6B 3HGPA 1VGCB 1CSOE 3K6YA 4INHA 4UEHH 2GCHF 8LPRA 3O8DA 1HAXB 4D9RA 1NFYA 5FPSA 1FPHH 1MMJN 4I7YH 1GHBF 1JIMA 4UDWH 1EZSC 2ZF0H 8GCHF 2BY7X 4FUEA 1KLJH 4A1VA 4ABFA 4CRBA 1SL3A 2SGDE 1FMGA 3GCNA 1SGYE 1GJCB 2BHGA 4YLQH 4Q80A 1ZMJA 1L1GA 3DD2H 2JETB 2W3IA 1Y5UT 1WQVH 1P11E 1GHAF 1Y5BT 2C4FH 4DIIH 4CBNA 1VCPA 1E34B 1J8AA 4Y7BA 2PFEA 3SNDA 1C1PA 4OS1A 1JRTA 1HCGA 1UK2A 1CGHA 1O2PA 1XKAC 3HPTB 1H8DH 1TNLA 3BTHE 4F49A 1O5FH 4M7GA 1IQIA 2ZHEH 5LGOA 4B1TA 1GBMA 2OD3B 3AW0A 3OU0A 1L1NA 2ZU5A 3URCA 3KQDA 1K1IA 4H6TA 1DPOA 1YKTA 3SHCH 1Z71A 1DLEA 1G3BA 2GVFA 2AMPA 1LCYA 3A7YA 3URDA 1T8LA 1GMCF 5DP4A 4NZQA 1GI7B 1N8OC 1ANBA 2Y81A 4JZ1A 1F0TA 2ZC9H 3NKKA 3P92A 1D4PB 3O8RA 2Z9GA 4MVNA 3UY9A 1SBWA 2RG3A 2J92A 3D62A 1QFKH 1ZLRA 3RXUA 5F8TA 3RC6A 4ASHA 4K3JA 1TMUH 1C5SA 1DDJA 3M3VA 3EGKH 1INCA 2H9TH 1O3FA 5A8ZA 1GBTA 4Z0KA 2FPZA 1O5EH 4K1SA 3ZZ8A 1SFQB 4FVBA 1AN1E 5A0BA 4CRAA 2Z7FE 1UTKA 3ZVFA 1YPHE 5AFZH 3BEUA 1O5DH 4NIYA 3Q77A 2HLCA 1SHHB 1K1PA 2H6MA 3SO3A 1TPSA 2Z9IA 2GCTC 4NCYA 2ZDMA 1BMAA 1EOLA 2XXLA 1KXFA 1RJXB 4A1TA 4Y8YA 1GDUA 1NRQH 1Y3YA 4Y71A 1GJBB 2THFB 5LPRA 3N7OA 3EAJA 3SUGA 1TNIA 2J9NA 2ZQ1A 4JK6A 5T3HA 2QAAA 2PKSC 4THNH 4AB8A 2V3OH 5FBIA 1IQHA 3T62A 1C2LA 1QY6A 1TNJA 3ZV8A 2G5NA 3QN7A 5HM2A 2WV5A 2Y82A 4ZHAA 2P3FH 1QA7A 2J38A 3P8OA 3OTJE 5FHTA 1EX3A 1O2IA 4MNYA 2VIDA 2TGPZ 2UUJB 3U98H 1UJ1A 1K22H 2A7CA 1XM1A 1O3KA 2AIQA 5EQSA 4I31A 3G01A 3ZYEA 1ELDE 1PYTC 1KDQA 5CHAC 4ZROA 3H7OA 5EU8A 1N6XA 3PM3A 3ZZCA 2F9BH 2HVXA 1JWTA 2VH6A 1GHVH 3MNBA 2BD4A 3UWIA 1FUJA 4GHTA 1GBEA 1F5RA 1DE7H 3SN8A 1NS3A 1C2DA 1PPEE 2J94A 5GPIB 5DO4H 1LMWB 1THSH 1FY3A 1Y3XA 1IHSH 3STIA 1LHGH 3SQEE 2SNWA 2BX4A 1BTWA 1TX7A 3KIDU 3WY8A 2EI7A 1F7ZA 1IQKA 1GBJA 1F0UA 3RXHA 3LGYA 1LVOA 2ZU3A 3BTFE 1UO6A 3RXSA 2Q1JA 1SGQE 2GD4B 4A1XA 1C1UH 2FYQA 3M5LA 1EATA 1DS2E 1DT2A 1V2LT 2H9EH 4I8GA 2HGTH 5IDKA 3BTWE 1GI5A 1T8OA 2FXRA 4Y8ZA 5DGJA 9LPRA 1LHCH 3TK9A 5DG6A 3RLWH 1GHXH 2ZTZA 1O3BA 1Y3UA 4ISNA 4ISLA 2BXTH 4MNVA 4TPYA 2XBXA 2FS9A 1NC6A 3GCOA 1GI1A 1SOTA 2CV3A 2ZIQH 3FANA 3RMNH 3D23A 2EEKA 1MTNB 1TNKA 4NA7A 5L6NH 1LHDH 1DM4B 1P02A 3QUMP 5EODA 2NU2E 3GCTF 4H6SB 5T6DA 5GJ4B 1D3QB 3QZRA 3Q00A 1D3DB 4X1PU 2J4IA 1KDQB 3TPIZ 2PWXA 3AVZA 1S85A 3ODFA 2ALPA 1JRSA 3SNEA 1RTLA 1THRH 2H5CA 4INKA 3UNSA 2VH0A 1LDTT 4MQAA 3JZ2B 3GDSA 1CGJE 2G55A 2NU1E 3ZZAA 2V0BA 1K21H 1T8NA 4A6LA 1OP2A 4X1NU 5E2PA 3SUFA 1GI0A 3LC5A 2W5EA 2A7JA 1SGEE 2PTNA 3MO6A 4YM9A 1C5XB 4CRGA 1XUIA 4A7IB 1GGDC 3UPEA 1PPZA 1O0DH 5DKMA 3F9HA 5C1YA 3NCLA 3SU3A 1OWJA 1AQ7A 1EJMA 1Z1IA 1ARBA 3UR9A 3UQOA 2ZGBH 3LGVA 1O2VA 3BN9A 5DP9A 3FP8E 4YZUA 1D9IA 4Y76A