2ZEBA

Potent, nonpeptide inhibitors of human mast cell tryptase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zebA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zebA01
3H7OA 2P59A 1HJAC 4YLQH 1OSSA 9LPRA 3TGIE 1C2IA 3LJOA 1CA0B 4NFEA 1YPHC 1PPBH 5IYTA 1UCYH 4A7IB 4Y8XA 1O2TA 1Q2WA 4O9VA 3PLPA 2FX6A 3UQVA 4NWKA 8KME2 1C1QA 4E06H 1Z6JH 2QY0B 1QL7A 4AZ2B 1NC6A 1O2OA 1FY8E 5GPIB 5FX5A 1G3CA 3T26A 1ANEA 1F5LA 3A80A 2J38A 2GP9B 2BDCA 3LGVA 1QA7A 2C4FH 1UVSH 4CRCA 3MHWU 1YP9A 1SFIA 1MD7A 4WVPE 2BDHA 4ZKSU 5DP6A 1DXWA 1EAXA 1RTLA 3L3TA 3ZZDA 2ZP0H 3UWJH 3ZYEA 3M3SA 4Y0ZE 1O2MA 4WMFA 3SV7A 3URCA 3ZYDA 2V6NA 1QHRB 1TBRH 1OP2A 2CF8H 1A4WH 4MPWA 4TPYA 5LGOA 3RXVA 2EA3A 4I31A 1EZSC 2ANYA 4NA9H 1HAOH 3FP7E 1HDTH 1HAZB 5E0JA 1K1JA 3P8OA 1UTNA 3OY6U 5JBTA 3RM2H 1JWTA 1ZR0A 1XUGA 3QGNB 1C5UA 3SZNA 1TMTH 3BF6H 1KLIH 1RFNA 1TOMH 2Z9GA 4JYTA 2DUCA 3KGPA 4UFDH 1ZJDA 1UTOA 2CXVA 3RC6A 4D76A 1UVTH 2AMPA 5AFZH 1NROH 2FX4A 1UTJA 4ZUHA 4ZHLU 4A1TA 1DX5M 1SGQE 3ATLA 2FMJA 2BQ6B 3BTDE 1EPTC 1EUFA 3RUOA 5E2OA 4WF8A 1SL3A 2FIRH 3BTKE 1IQJA 1N6XA 2HPPH 3RXOA 3A83A 1XX9A 4DIHH 2ZDKA 1DE7H 1W0ZU 4AB8A 3TNSA 4D9RA 1OP0A 3M7UA 2JH0D 2R0KA 3HKIB 2GKVE 1T4UH 5AVDA 1D3QB 2P93A 2H9HA 1DY9A 3SJIA 3SOSA 1IHSH 5A09A 1IHTH 1DM4B 1LQEA 1C1TA 2YNAA 2PKAB 4NCYA 3VB6A 3UNQA 2V35A 1EPTB 1O0DH 4Y8YA 1P09A 5C1UA 4O03A 5T6DA 3I78A 2FOFA 2AFQB 1O2JA 2VVCA 1UK3A 1GBFA 4IS5A 2UUKB 4R0IA 1RTFB 2UUYA 1GHBF 1BRUP 1RS0A 1S0QA 5JBAS 3EA8A 2QC2A 5F6MA 3ZZCA 1GBLA 2V0BA 5T6FA 4ABIA 2QF0A 3UY9A 2G00A 2VU8E 3RXEA 3RXKA 3CENA 4ABEA 3GY2A 3OX7U 2ZU3A 4RSPA 1WUNH 4YOJA 1FY1A 4MNXA 3EDXB 3O8DA 3R3GB 2Z3EA 4K8YA 1G2MA 4X1PU 3GCOA 3SUEA 3TIUA 4H6SB 1MKWK 3S0NA 1AY6H 1GL1A 1P2MA 1TGNA 1O2GH 2FI4E 2R0LA 3GISB 1GMDG 1NPMA 4XSKU 3NUMA 1G3DA 3MH4A 1TFXA 3VB3A 4KTCA 1D6WA 2WYJA 3TK6A 2C8YB 2HWLB 3BTWE 3MH6A 5L2YH 1C1VH 1FXYA 2NU3E 1N6YA 1C5RA 1KSNA 5HGGA 1GJBB 3STJA 3URDA 1C5YB 5A8ZA 1NT1A 2QXIA 3GICB 1DXPA 2F9NA 2Y5FA 1TGBA 1HNEE 1BMAA 4F49A 4BXWA 1TE0A 1FMGA 1FY5A 1HUTH 4ZKRU 1GHAF 1AGJA 1OWHA 1K1MA 5JB8S 1GI5A 3HGPA 3SW2B 2PTCE 2PTNA 3SQHE 4XFQA 2HNTC 3E0PB 2BLWA 3T2NA 2D1JA 1DLKB 2BLVA 2BY6X 3DD2H 1EJNA 1GI0A 4DJZB 1G37A 2IPHA 1TAWA 3T28A 2OQUA 2BY9X 1YM0A 3ZZ3A 1ELTA 1EP5A 2A5AA 5C1XA 1QNJA 4X8SH 3LC3A 4FU7A 5A0CA 2VIOA 5C20A 2SGEE 3U98H 1C1WH 2AERH 1GJ7B 3BTQE 1ZHPA 2QYIA 1OYTH 3GY4A 1OWDA 1BIOA 1GCTB 1EZXC 3DUXH 1OOKB 2VINA 2BLQA 4LK4A 2VGCC 4CR5A 1PYTD 4HZHA 4DURA 2P3UB 4MNWA 4GHTA 3S69A 2ZKSA 3IG6B 4X0WU 1O5DH 4FVBA 1BCUH 1C5SA 1WU1A 2PGBB 1IQHA 3RXDA 4ISNA 3ATIA 1SR5C 1C2KA 1MH0A 1O2WA 2OC0A 2W7UA 1C1OA 2W3KA 3A84A 1TNKA 1T8LA 5T6GA 1SB1H 2VGCB 1YPEH 2Y81A 1P2QA 1WSSH 1L4ZA 3G01A 1HAVA 1P2NA 3QK1A 1DOJA 5HXFA 2FLRH 2QN5T 1AQ7A 1V6DA 1ZSLA 2ZDVH 1C5PA 4MNYA 2THFB 3VXEH 4BAOB 2OC1A 1C1MA 1J14A 1A1RA 1ORFA 1GHXH 2O8LA 1GI9B 4F4OC 4WXIA 5A0BA 1MQ6A 2D8WA 2EI8A 2ZTZA 2XBXA 1AMHA 4Y76A 2Z9IA 4Y7AA 2CV3A 2OCVB 3BTTE 1SGYE 3MFJA 1Z8JB 4R8TB 1OWIA 5C3NA 1HAVB 3RXJA 1K1OA 2BX4A 7LPRA 4JZDH 1BTWA 2BD9A 2C8XB 4UFEH 4ABAA 2VB0A 1HXEH 3JZ2B 1G30B 3M5OA 3RU4D 2BOKA 1BMNH 4XE4A 1ARCA 1ACBE 3SI4H 5A2MH 4K1TA 3BN9A 3SGQE 1O2SA 1H9IE 5LH8A 3F9GA 4AYVB 1GI7B 2FZZA 1BZXE 3MO3A 2CGAA 1YPGH 4AOQA 2ZGJA 1C2FA 1IQMA 1QBVH 1XKAC 1GMCF 4DGJA 1ZPZA 4I8GA 3EGKH 2H5DA 2ZCKP 5FBEA 3S7HB 3ODFA 1F5KU 4I32A 1TA2A 1XVMA 1LMWB 3AAVA 2ZHFH 3TJOA 2NU2E 1HJ9A 4E7RG 5ESBA 1BBRE 1P9SA 3KN2A 8GCHF 4MLFB 4UFGH 3P70B 1KXAA 1X7AC 2BQWB 3KQEA 2J94A 3LKWA 4MDSA 1YCPM 2ZEBA 3SGBE 2ZHEH 2XC4A 4IN1A 2ZPRA 1TGSZ 4A6LA 5DP4A 3WY8A 2SGQE 4ASHA 1TNHA 2OINA 1O5EH 1N1LA 1A3BH 5HYOA 1CHGA 3UWIA 3GDVA 5DP5A 1B0EA 3NCLA 5PTPA 3ZZAA 3OTJE 2PHBA 3JZ1B 5GCHF 2FOGA 1DWCH 1SI5H 2Q6FA 5EQQA 3Q77A 1YBWA 1P3CA 1MAXA 1THSH 3ENSB 1PQAA 2A2XH 2BXTH 3MI4A 1O2YA 3PM3A 1ANBA 1W13U 1BRAA 1Y5BT 3FP8E 4FUFA 3LH1A 3M3TA 4JK6A 3SBKA 2AMQA 4OS7A 1G32B 4LZ1H 1NFWA 1PYTC 3LOXA 3K6YA 1AO5A 4I8LA 4DVAU 2FLBH 3TLOA 1XUFA 1E34B 1VITG 4BAKB 3PROA 3TK5A 2GT7A 1W8BH 2ZTXA 1D3DB 1XVOA 2FM2A 4NSVA 3A86A 1PPHE 1ZLRA 4JYUH 1EOJA 3ATMA 1A5GH 3M7QA 5A8YA 1CSOE 1GMHG 2AGIX 2FDAA 1UTLM 2VH0A 1C2EA 3DT0H 4I7YH 1B5GH 2J4IA 1O33A 3LGWA 3BG8A 1FPHH 1HCGA 5JDUB 2HNTF 2PKSC 4DT7B 1PQ5A 3SV8A 1C5ZB 1GJ5H 3GYLB 1BA8B 2GZ7A 2QV1A 4K8BA 1XUKA 1TNLA 1OWKA 5TJXA 1XUIA 2QXJA 3RLWH 4IMQA 2OC7A 1EAWA 2CJIA 1Y5UT 1LVBA 1MQ5A 2B9LA 2FWWA 3I29A 1THPB 3O8CA 1SGIB 1FJSA 2Y82A 2ZDNA 1ZSKA 4X2YA 3BV9B 4X8TH 1GBTA 3UIRA 3TGJE 4JCNA 5EODA 4IBLH 1ZRBA 1ANDA 1W3CA 1SGCA 2PKSB 4GPGA 3PV4A 3UFAA 1BT7A 1O39A 2ANKH 1EKBB 1UTQA 1BTPA 2G52A 4PROA 5LPEA 2A2QH 1G2LA 2H9TH 4OS6A 2VNTA 3B8JA 1C2LA 3M36A 4BAMB 2IN2A 1OS8A 1TMUH 2FO9A 2Z9KA 3ZVAA 4Y8ZA 4GCHF 4DIIH 5FPTA 1UHBB 1P3EA 1C5LH 4UEHH 4ZMAH 1C5VA 2GTBA 2Y6TA 1MCVA 2VIDA 3PWBA 1A3EH 1CHOF 2FTMA 2CN0H 2VIQA 1SGTA 1ELBA 2GCTC 3PTBA 3LONA 1V2NT 4FU8A 1C1SA 1QA0A 1C1NA 3BTEE 3DFLA 3M5MA 3PB1E 4BOHA 1TGTA 2A4QA 1F0TA 7ESTE 2GDEH 5CMXH 3MWIU 4HTCH 1AWHB 1WCZA 4B71A 2H9EH 4AGJA 4NIXA 1EOLA 2ALPA 3GCTF 4INKA 4ISLA 4BTUB 4NIYA 3B9FH 3FAOA 3PLBA 3FZDA 4X2WA 1FNIA 1NO9H 2FOBA 3Q00A 3RXGA 3E8LA 1UCYE 1ZZZA 2BDGA 2ODQA 1IQFA 3VB7A 2GCTB 1AFQC 4HI3A 2V3HH 5F8TA 1WV7H 3LH3A 2A1DB 2Z3CA 4U2WA 1NU7B 1XM1A 3RXUA 1IQGA 1L1NA 1VGCC 1MTNC 2ZGBH 3GY8A 3BEUA 4X6NA 3U1IB 3U8TH 4Y0YE 1GGDC 1UVPA 1HAIH 1Y3YA 1YLDA 4OGYA 6GCHF 4GHQA 1D3TB 2O8MA 4FUBA 4Y6DA 3SUFA 2ZC9H 2WUCA 1AFQB 1SBWA 2Y7XA 5JPMH 2FYRA 1O3CA 2G51A 1ZTLA 5DK1A 1HJAB 2GDDA 2PV9B 3ZVGA 3F9FA 4BAQB 3UQOA 1UO6A 2HLCA 1K1NA 1BTZA 3MH5A 3A7XA 1GHVH 1VGCB 1O36A 1MTNB 1ELEE 2EEKA 3MU4A 4B74A 4YESB 4UONA 5E0HA 5C5NA 1GGDB 1FI8A 2Y5HA 4X2XA 3KEEA 4K1SA 1O3IA 3HGNA 3RMOH 3GY3A 5E0GA 1C4V2 2GV6A 1VR1H 3P8FA 5C67A 1G3EA 1HGTH 5EGMA 2PSXA 1Z8GA 4INHA 1XMNB 1O5CB 3RXHA 1HXFH 2AYWA 4AG2A 1HV7A 2ZFSA 1LHDH 3E91A 4WH8A 2P3TB 3F9EA 1TYNA 3E90B 2TRMA 4GAWA 3RXRA 1EXFA 1TX8A 4NG9H 4ABBA 1RGQA 2G81E 2ZGHA 1ZHRA 1O3FA 1QTFA 2WV5A 5HMAA 1FUJA 3F68H 1G9IE 7GCHG 3KF2A 3SU0A 2NU4E 1P02A 3UPEA 5LPRA 1FN6A 4SGAE 3T62A 1A5IA 4K60A 3HK6B 3GY7A 4YO9A 5G4BA 2A4OA 5JYIA 2EC9H 1BJUA 1KTTB 2F83A 2AGEX 2SGPE 4XBCA 3GY6A 2BXUH 1SQOA 2EI7A 1NRSH 5ETXA 2TGTA 1O3LA 5FCRA 1GHBG 1D4PB 1O2ZA 2KAIA 3CS7A 1GI6A 1C4Y2 1NFXA 1P04A 2C8ZB 2P95A 4MTBA 3A7WA 5DP7A 4I8KA 1S5SA 1IQLA 2BD4A 3ATWA 3UR6A 1GJ8B 4NZQA 1JOUB 3V0XA 1K22H 1BMLA 2LPRA 2I6SA 3PMHB 1GHZA 4ZAEA 3C1KA 5EOKA 1IQKA 2F9BH 2O8WA 1PPEE 2GZ8A 2ZIQH 3FP6E 3MO6A 3EQ0H 2HOBA 3RXSA 4UD9H 1O2XA 3ZVFA 4AB9A 4B76A 5JBCS 3KL6A 3SN8A 1ZTJA 3GCNA 1TGCA 2UUFB 3RXBA 2ZPQA 1MMJN 5C5OA 1KDQA 4WY3A 3E0NB 1BRCE 3SV9A 1SGPE 4ABHA 2BHGA 2FODA 1P06A 2ANWA 1TBZH 3NXPA 1T32A 4INLA 2ZDAH 5DP3A 2ZFRH 5ESTE 2B8OH 2A45B 1C5TA 1TA6A 1K2I1 1AIXH 3RXAA 1GI2A 3D49H 2J9NA 2UWPA 2AH4X 3SORA 1GHAG 1F5RA 1QURH 1TLDA 1W10U 4NA8A 1FIZA 5FHTA 1J9CH 1F0SA 1C2JA 3MH7A 2ZFFH 3GDUA 2FOEA 4UFFH 5FAHA 4THNH 2G4UA 3CP7A 3M5LA 3U8RH 3KHVA 3ZV8A 1XKBC 5ABWA 1K21H 3Q3YA 1NM6A 4GUXA 4MG3A 1WBGB 4KTSA 3HATH 4AGKA 1YC0A 1GJDB 2XBWA 4YTAA 2FEQH 4KKDA 1O3EA 3A7ZA 3A85A 1ELVA 1IAUA 3M37A 4K69A 4VGCC 2BD8A 1TALA 3BEFB 1ESBA 4JZFH 1TRNA 1AN1E 2Q6DA 4NFFA 3RU4T 1Z1IA 1ANCA 3TH2H 4ZXXH 1BTXA 5SGAE 1GDNA 1D6RA 1UK4A 2BX3A 2XXLA 2BD5A 2RA3A 1PPCE 3KIDU 3ATKA 4CRGA 4BANB 5DP9A 1RJXB 2FXRA 2XC0A 1O5GH 1LKAA 4Q7YA 3SO3A 3STIA 2R2MB 2GCHF 4WH6A 4ZROA 2P16A 3U8OH 4CH8B 1TQ0B 1TX6A 3A88A 2Y80A 3RXCA 4VGCB 1W11U 5EXNA 1H4WA 1ARBA 4RN6A 1O38A 1BBRK 1GI8B 1P8VC 3M61U 4YZUA 4DOQA 1BRBE 1GJ6A 2VVVA 3V3MA 1V2OT 4CHAC 2VVUA 3LJJA 5EQSA 1G3BA 1NRQH 1O31A 5FBIA 4LOYH 3BTME 5CHAC 2RG3A 1YPJH 3DFJA 4XBBA 4YT6H 4JMYA 4CRAA 4FUGA 3FZZA 3ESTA 1PFXC 4Q7ZA 3K9XB 2ZDLA 3Q3XA 2F9OA 3RXTA 2VWMA 1EP6A 1ZMJA 5DKMA 4Q80A 3SQEE 1SLVB 1C2DA 3UR9A 2XCFA 4UE7H 4ABGA 4CHAB 2G8TA 1HAHH 1QGFA 3KQCA 1GVKB 1K28D 4DCDA 2QA9E 1GWAA 1AKSA 2A4GA 1K9OE 1HAYB 1LHGH 1AI8H 1FZZA 4Z6AH 1EATA 1KIGH 3ZZ4A 1GHYH 3QX5H 5GJ4B 3SJ9A 2ZTYA 1O2NA 1C9PA 1H8IH 4A5TS 1KLJH 2ZQ1A 1O5BB 3BIVH 1A46H 1W0YH 1NY22 2R3YA 3HPTB 3H7TA 1LQDB 1QY6A 1HAGE 1GI4A 4MPVA 1QBNA 1IQIA 4O3UA 1GMCG 3P95A 3RXIA 1KXFA 1V2KT 3SI3H 4CR9A 1GJCB 1EAIA 2FYQA 4HGCA 1BQYA 1O3GA 5J4QA 1DUAA 3FANA 3MNBA 4X1RU 2BTCE 4FUDA 1JRSA 1A0JA 3U69H 2BDBA 4Y71A 2VIWA 4B75A 1A2CH 4K2YA 2XRCA 2PUXB 5EQRA 8GCHG 2PSYA 1LVOA 2SGDE 3TH4H 1T31A 5BPEA 1QFKH 1NRRH 3RDZA 4D9QA 1DUEA 1QRWA 1S82A 2WPMS 2O8UA 3MYWA 4H42U 3F1SB 3S9AA 2FOAA 1HLTH 2BDAA 1E35B 1UTPA 2A7JA 3BG4C 3D23A 2DE9A 3TH3H 3CS0A 2ZU1A 1OX1A 4J2YB 2W7SA 4CRFA 1W7GH 1DS2E 3SU3A 4NIVA 1AZZA 1L1JA 1WQVH 2OBOA 1GDUA 1QRXA 1E0FD 5GCHG 2YOLA 1LPGB 1B0FA 3R0FA 4ZKNU 5EPNA 1CT2E 2ZG0H 1XUHA 1H9HE 1S0RA 1TNGA 2NU1E 1C5XB 1O3KA 1O3DA 3LIWA 3LU9B 1Z7KA 1O5FH 1O30A 1YPKH 1FLEE 2Q6GA 1UMAH 2PR3A 1TRMA 3EA9A 4IC5A 1NN6A 1T4VH 2ZHDA 1AHTH 2Y5GA 3Q76A 4AFUA 2A31A 2GT8A 1E38B 1BUIA 1NU9A 1E36B 4ISIH 1O2UA 3BG4B 2H5CA 3SV6A 1GG6C 1S85A 1Y3UA 2XCNA 1ZYOA 2IJOB 4J1YA 1BBRH 3MU0A 1O3HA 2XW9A 1AU8A 1QJ1B 3A89A 3NPSA 2R2WU 4FUHA 3BTFE 1V2MT 3SNAA 1GPZA 3UNRA 3S7KB 4NA7A 1P12E 3SJKA 1KXCA 3ZVCA 3NZIA 3PTNA 1P0SH 2A7HA 2ZO3H 3OSYA 4LXBH 1GBEA 2HVXA 1YPMH 4MPXA 1CA8B 2B0FA 4CRDA 1GG6B 5DG6A 4NZLA 1DY8A 1O5AB 1MTWA 3T5FH 2FP7B 2J95A 4ZKOU 4CBNA 1Y3WA 3RLYH 2ALVA 1TOCB 1AD8H 1TX7A 1JIMA 3A7TA 3SNDA 2UUJB 1UTKA 3VXFH 5JB9S 2SGAA 3ODDA 1Z8RA 2M5TA 1QJ7B 4WMDA 5K7RA 2ZU4A 4JK5A 4OS2A 2BMGB 2ZFQH 1PPFE 1Q3XA 3P17H 1PQ8A 4QT8C 4O97A 2ZFPH 1LKBA 1C1UH 4XBDA 1OKXA 1LHCH 4Y11E 1FQ3A 4SGBE 1P57B 5EXMA 4GCHG 1KTSB 2UWOA 3UOUA 1SMFE 5AF9H 2PFEA 3UTUH 1ZPBA 4CBOA 1QB1A 2WPHS 4DG4A 2Z7FE 2W26A 1TABE 2STAE 1S6HA 2TIOA 3RC5A 1CHOG 1Y3XA 1FY4A 3AW1A 2BVRH 3SU2A 1NESE 5C2ZA 1LPKB 1ZOMA 5AHGH 1XXDA 1DITH 1WOFA 3PMBB 1CE5A 2XNIA 2A5KA 1QIXB 3QO6A 1MBMA 2GV7A 1JIRA 4BTIB 1L4DA 2D26C 2C8WB 1EX3A 1DLEA 1MU8B 3GCTG 4AG1A 1O35A 2ODYB 1EZUC 2BVXH 2XYAA 3GY5A 2AGGX 3KCGH 3ZV9A 3SNBA 5EU8A 3SGAE 1EJMA 2RA0A 4X1SU 1CT0E 1C1PA 1QB9A 2BZAA 1CGHA 1B7XB 1GJ9B 1LO6A 1O3JA 4BTTB 2OP9A 4GVUA 1QQUA 1UJ1A 2STBE 1OWEA 3A87A 1DSUA 2VH6A 1A5HA 2QAAA 1VJAU 1MBQA 5F03A 2AEIH 4FUJA 3RMLH 2J2UA 1ESTA 3A82A 2BD7A 3ZVEA 4WWYA 6GCHG 1L2EA 4IC6A 4OS5A 3ITIA 4FVDA 2B5TB 3NK8A 3T29A 1O3NA 4MNVA 2ZF0H 1W2KH 1Y59T 4WXVA 3IWMA 2XTTB 4TY7A 3QN7A 1C2MA 1G36A 4D8NA 4DY7B 1SGFG 3EAJA 2GVFA 5FX6A 1GJ4H 4U32A 1C5QA 2H2ZA 3NKKA 2XBYA 1VCPA 4WMEA 2Z6BD 2ZHWH 3TJVA 2WPLS 5DGJA 1TPAE 1Y8TA 3AVZA 4U01A 1GBKA 1FN8A 4ZXYH 2TGDA 1O2HA 1U6QA 1S84A 3V13A 2QCYA 5GXPA 3GCHC 1O37A 1KLTA 1RIWC 2ANMH 3BEIB 1CVWH 1PPZA 5F8XA 3MU5A 1IOEA 5FXLA 3UREA 2BDIA 3M5NA 8ESTE 1SSXA 1ZGIA 1K1PA 2ZPSA 4UDWH 3RXMA 3NWUA 1HJ8A 5EPYA 1RD3B 2Q1JA 1IQNA 5LPFA 1O34A 1HB0B 1NRNH 2P94A 2OLGA 3A7YA 1ELAA 1LPZB 2HGTH 3P92A 1HPGA 3AW0A 4IGDA 2FOHA 2QGRA 1H1BA 1VJ9U 3K6ZA 4K3JA 3RC4A 5K0HA 3GCHB 1RIWB 2PW8H 3SU6A 5TCAA 1FPCH 2VWLA 1T7CA 4IW4E 4AN7A 1SQAA 1O2QA 1LVYA 2C3SA 5EW1H 3OYPA 3L33A 1YKTA 3BTHE 4YLUA 3S9BA 1INCA 1ZMNA 2BDYA 1HAPH 1OWJA 5E2PA 1J8AA 2ZFTA 3ZVBA 4Y79A 3T25A 4I8JA 1YPLH 5C1YA 1HIAA 2FTLE 2ZECA 1NTPA 1W7XH 1T8OA 5J4SA 3V12A 2FS9A 4IN2A 3PWCA 4X1QU 2PWXA 2Z3DA 4ISOA 3TITA 3SUDA 4ZH8A 5DO4H 3H5CB 1QL8A 2G5VA 2WUBA 2FOMB 3VB5A 1L0ZA 1THRH 2XWBI 2PUQH 2BVSH 1BJVA 1SLXB 3W95A 1Y5AT 1MZAA 1QL9A 3W94A 3UOPA 1CU1A 5L2ZH 1TRYA 1Z1JA 2PKAA 1CT4E 1SFQB 1HIAB 1C1RA 1QCPA 3VEQB 1AUTC 1SLWB 1N8OC 1EPTA 2V3OH 1GHWH 3MNSA 1FV9A 1SQTA 4ABJA 1SHYA 4ABFA 1TB6H 3QTVH 4K5ZA 4OGXA 1MKXH 3QDZB 2VWNA 4BXSA 3SJ8A 1SGRE 4NGAH 4DW2U 2C93B 1TONA 1C4U2 2FI5E 2W5EA 2HPQH 3PLKA 7GCHF 5DPAA 1OPHB 4OS4A 3K2UA 4ISHH 1JRTA 4WJG2 1C2HA 1RRKA 1KYNA 3D62A 2KAIB 2OC8A 2ZGCA 3Q3KA 1KXBA 1SGEE 4YT7H 1WAYB 2AIQA 3OY5U 2ODPA 2BY5X 1V2QT 2ZZUH 2R9PA 3GYMA 3A7VA 1N8OB 1T8MA 3GOVB 3IITA 4K1EA 1HRTH 5F8ZA 1V2UT 1O2IA 3L6PA 1GDQA 3MU8A 3A81A 4ZHAA 5A0AE 2IOTA 2OTVA 1YCPH 1RTKA 1AB9C 4H4FA 5EW2H 1ELFA 1GBAA 2I6QA 4BAHB 4FUIA 4NWLA 3C27B 1MTVA 2CF9H 4KGAA 1NRPH 4LZ4B 4TY6A 1YLCA 1VCWA 2BZ6H 2WINI 1O2LA 4XOJA 1KDQB 4M7GA 1SOZA 3LT3A 3TK9A 3RXQA 3SU4A 4Y7BA 1A0LA 1AZ8A 3FFGA 2BY8X 2ZI2H 2ILNA 3F6UH 1Z71A 2C90B 1AWFH 1LVMA 3TU7H 2ZCHP 1TWXB 4CREA 2JH6D 1CGJE 1AB9B 8LPRA 5B6OA 5JBBS 1O3OA 1TPOA 3A8CA 2JH5D 1A0HB 1L1GA 5I46H 2F3CE 4FUEA 2GCHG 1ABIH 1DANH 2BYAX 6CHAC 1GI3A 3MTYA 1NFYA 4ESTE 1NZQH 1C5WB 1KY9A 1BDAA 1GMDF 1V2RT 2A4RA 3MU1A 1LDTT 3RU4E 1TQ7B 1PJPA 2JKHA 1GCTC 2LNCA 2TGAA 4CH2B 1P2OA 2K1QA 3D65E 2W3IA 1UVOA 3A8BA 3ZZ6A 4D7GA 1J17T 1UTMA 2J34A 1F0UA 5HM2A 3RP2A 3AASA 1TMBH 2Z9JA 3MO9A 2FI3E 4KP0A 6CHAB 1IQEA 2BM2A 3V7TA 1UVUH 3P8GA 2XWAA 1ELDE 1YF4A 4E05H 3QZRA 1HFDA 1V2ST 1SVPA 1SGDE 3MNCA 1O32A 4AFSA 4RKJB 1SOTA 1ABJH 3TPIZ 1HYLA 1MUEB 2QIQA 3P8NA 5AFYH 1DWBH 1AFEH 1GBIA 2B7DH 3T27A 3PMJA 1YYY1 1QJ6B 4B73A 1AVXA 1ETSH 5IDKA 3ZZ8A 3LGYA 4B2BA 1P10A 1O2PA 1C5MD 3VGCC 1SGNE 1ELGA 1O3BA 1KXDA 4MVNA 5TCCA 4BNRA 4E7NA 1MZDA 4JZEH 5T3HA 1A61H 3QWCH 1GBBA 5CHAB 2GGVB 2J92A 5CE1A 1SG8B 1CGIE 2GX4A 1J16A 1ELCA 2PGQB 1JXPA 2NU0E 4A92A 1YPHE 2GMTC 1DWDH 1C9TA 6LPRA 1HAXB 3P6ZB 2G55A 3LDXH 1O3MA 3BSQA 5EXLA 4X6PA 5GDSH 3VGCB 1HBTH 1WTHD 2Y7ZA 2ZU5A 3VB4A 2WYGA 1GVZA 1VCQA 1ESAA 2ULLA 1AKSB 4IMZA 2SFAA 1AVGH 4FUCA 3E3TA 2BD2A 2P8OC 1GI1A 1M9UA 4AORA 2ZU2A 4AYYB 2VIVA 3LPRA 4ZHMU 1WQSA 1O2VA 2BOHB 1OYQA 2BQ7B 1NS3A 1XUJA 2GMTB 2TBSA 3RMNH 1TNJA 1V2PT 1AUJA 3KNXA 2WPJS 1OXGA 4FU9A 2BD3A 2GD4B 1MKWH 4O3TA 4KELA 3O8RA 2O8TA 1AE8H 3HKJB 1TBQH 1MTUA 2ZWLH 3ZVDA 3TJUA 3UUZA 1EB1H 1V2WT 2P8OB 2CHAC 5GIBA 5L30H 3ZZBA 3LC5A 1TPSA 2FPZA 3GDSA 1DVAH 1EQ9A 1WTGH 3TJNA 1CQQA 1T8NA 1EB2A 2G4TA 1V2LT 3MNXA 1BHXB 1K1LA 1BTYA 4X2VA 3M35A 3SHCH 2A5IA 2H6MA 1E37B 2ZDMA 3RXLA 2D2DA 2YNBA 1FDPA 2ZGXH 1D3PB 2VJ1A 3TGKE 5HM9A 1XXFA 1SGFA 1O2KA 1V3XA 4GLYA 1S81A 4H6TA 2CHAB 1NFUA 3E16B 4XDEA 3SHAH 1ETTH 1PPGE 2G5NA 2QXHA 1Q31A 1GCDA 4I33A 3HK3B 4B2AA 4X6OA 3EYDA 1GVLA 4AX9H 4D7FA 2JETC 3MOCA 2EI6A 1S6FA 1DSTA 2UWLA 1S83A 1UK2A 2XBVA 1P2KA 3FVFB 1DWEH 9ESTA 4B2CA 4MPUA 2RDLA 3O8BA 2OQ5A 1ZTKA 2WPIS 3SUGA 4A1XA 5BRRE 3SU1A 1P2IA 2Z94A 1Z6EA 2A0QB 5FPYA 4AFZA 4YM9A 2XC5A 1F0RA 2A7CA 1LCYA 3KQDA 2WPKS 1UCYK 1BTUA 1Z8IB 3SNEA 3M3VA 4JZIA 2BY7X 3OU0A 1FY3A 1JMOH 3B23B 1CBWC 1Y3VA 4TYDA 1P11E 2QXGA 1P2JA 1ZSJA 2F9VA 1O3AA 2JETB 3A8DA 3QZQA 4TPIZ 1ZJKA 3LGUA 1EZQA 2OD3B 1FAXA 1EAUA 4MQAA 4NIWA 5EG4A 3PYHA 5DJ7A 3LGTA 1C5NH 3VFEA 1C2GA 3S9CA 1DICA 1BB0B 2F9UA 4I8HA 2GZ9A 4TWWA 6ESTA 2A32A 2ASUB 3QTOH 3AAUA 2HRVA 2OBQA 4JYVH 1ETRH 1C5OH 1F7ZA 2SGFE 1BMMH 1QB6A 1F2SE 3TNTA 2CMYA 2TPIZ 1EJAA 4JZ1A 3BIUH 1VITF 1K1IA 3ELAH 1GJAB 1D9IA 3SNCA 3QLPH 1DPOA 1CBWB 1DT2A 3QGJA 1GBMA 4Q2KA 3I77A 4GSOA 1GMHF 3DA9B 3BTGE 3MMGA 2SNVA 1DFPA 4FXGH 3U1JB 1EASA 3RXFA 1H9LB 2OXSA 2NWNA 1UHBA 1QBOA 1ZGVA 2QF3A 1A7SA 1ZRKA 3RM0H 2RCEA 3DHKH 4RKOB 2AS9A 3EE0B 7KMEH 3UNSA 1GBCA 2ESTE 2ZHQH 4Z0KA 1QQ4A 3M7TA 2TGPZ 3A8AA 2F9PA 1GL0E 4KTUA 2FESH 1FAKH 1P03A 1GBHA 5A8XA 1SLUB 2ZA5A 2HNTE 2BB4A 2WV4A 1BITA 1ID5H 3PO1C 1KXEA 1W14U 4YOIA 3RMMH 4YOGA 3SV2H 5FCKA 3SU5A 2ZQ2A 1MU6B 1ZPCA 2FS8A 1BOQA 1P05A 1ZMLA 5GWZA 1SHHB 4TWYA 2PLXA 1W12U 3RXPA 5DP8A 3SJOA 1V2JT 2SNWA 3K65B 4Q7XA 1O2RA 2OUAA 1MCTA 1SC8U 2DE8A 3E1XB 4HFPB 4ABDA 1GBJA 4A1VA 1AE5A 1J15A 1P9UA 2BLOA 3LGIA 1QR3E 1PQ7A 2O9QA 2Z9LA 1CO7E 3PMAB 5L6NH 1MKXK 1V2TT 3N7OA 1LTOA 3KQBA 3E6PH 4OS1A 1WYKA 4U30A 1DDJA 1LHFH 1VITH 4Y10E 2FOCA 3PO1B 5FPSA 1ZHMA 2P3FH 2H1UA 1TNIA 1H8DH 5H4IB 1CA0C 1SPJA 4CRBA 1JBUH 3TVJB 1O3PB 1AVWA 4NSYA 1GBDA 1OP8A 4X8VH 3VPKA 2R3UA 5E8EH 2AIPA 4X8UH 4B1TA 1V2VT 2ZCLP 3EA7A 1FIWA 1MTSA 2F91A 1F92A 2ZNKH 3ZZ7A 1YCPK 1MD8A 2VWOA 3ZZ5A 3U9AH 1TPPA 1VZQH 3ZZ9A 1YGCH 1BHXF 1BTHH 1QRZA 1RXPA 1MAYA 3QUMP 1LHEH 1P01A 2AMDA 3F9HA 2VIPA 1FONA 4X1NU 4X6MA 5I25A 1TIOA 2HALA 4AFQA
chains in the Genus database with same CATH superfamily
3H7OA 2P59A 4TSFD 1HJAC 4YLQH 1OSSA 9LPRA 3TGIE 1C2IA 2OK5A 3LJOA 1CA0B 4NFEA 1YPHC 2JDID 1PPBH 5IYTA 1UCYH 4A7IB 4Y8XA 1O2TA 1Q2WA 4O9VA 3PLPA 2FX6A 3UQVA 4NWKA 8KME2 1C1QA 4E06H 1Z6JH 2QY0B 1QL7A 4AZ2B 1NC6A 1O2OA 1FY8E 5GPIB 5FX5A 1G3CA 3T26A 1ANEA 1F5LA 3A80A 2J38A 2GP9B 2BDCA 3LGVA 1QA7A 2C4FH 1UVSH 4CRCA 3MHWU 1YP9A 1SFIA 1MD7A 4WVPE 2BDHA 4ZKSU 5DP6A 1DXWA 1EAXA 1RTLA 3L3TA 3ZZDA 2ZP0H 3UWJH 3ZYEA 3M3SA 4Y0ZE 1O2MA 4WMFA 3SV7A 3URCA 3ZYDA 3F2FA 2V6NA 1QHRB 5C0UA 1TBRH 1OP2A 2CF8H 1A4WH 4MPWA 4TPYA 5LGOA 3RXVA 2EA3A 4I31A 1EZSC 2RFKC 2ANYA 4NA9H 1HAOH 3FP7E 1HDTH 1HAZB 5E0JA 1K1JA 3P8OA 1UTNA 3OY6U 5JBTA 3RM2H 1JWTA 1ZR0A 1XUGA 3QGNB 1C5UA 3SZNA 1TMTH 3BF6H 1KLIH 1RFNA 1TOMH 2Z9GA 4JYTA 2DUCA 3KGPA 4UFDH 1ZJDA 1UTOA 2CXVA 3RC6A 4D76A 1UVTH 2AMPA 5AFZH 1NROH 2FX4A 1UTJA 4ZUHA 4ZHLU 4A1TA 1DX5M 1SGQE 3ATLA 2FMJA 2BQ6B 3BTDE 1EPTC 1EUFA 3RUOA 4FETA 5E2OA 4WF8A 1SL3A 2FIRH 3BTKE 1IQJA 2VBCA 1N6XA 2HPPH 3RXOA 3A83A 1XX9A 4DIHH 2ZDKA 1DE7H 1W0ZU 4AB8A 3TNSA 4D9RA 1OP0A 3M7UA 2JH0D 2R0KA 3HKIB 2GKVE 1T4UH 5AVDA 1D3QB 2P93A 2H9HA 1DY9A 3SJIA 3SOSA 1IHSH 5A09A 1IHTH 1DM4B 1LQEA 4OM9A 1C1TA 2YNAA 2PKAB 4NCYA 3VB6A 3UNQA 2V35A 4RI0A 1EPTB 1O0DH 4Y8YA 1P09A 5C1UA 4O03A 5T6DA 3I78A 2FOFA 2AFQB 1O2JA 2VVCA 1UK3A 1GBFA 4IS5A 2UUKB 4R0IA 1RTFB 2UUYA 1GHBF 1MABB 1BRUP 1RS0A 1S0QA 2YMSB 3PRDA 5JBAS 3EA8A 2QC2A 5F6MA 3ZZCA 1GBLA 2V0BA 5T6FA 4ABIA 2QF0A 3UY9A 2G00A 2VU8E 3RXEA 3RXKA 3CENA 4ABEA 3GY2A 3OX7U 2ZU3A 4RSPA 1WUNH 4YOJA 1FY1A 4MNXA 3EDXB 3O8DA 4M9FA 3R3GB 2Z3EA 4K8YA 1G2MA 4X1PU 3GCOA 3OTPA 3SUEA 4H6SB 3TIUA 1MKWK 3S0NA 1AY6H 1GL1A 1P2MA 1TGNA 1O2GH 2FI4E 2R0LA 3GISB 1GMDG 1NPMA 4XSKU 3NUMA 1G3DA 3MH4A 1TFXA 3VB3A 4KTCA 1D6WA 2WYJA 3TK6A 2C8YB 2HWLB 3BTWE 3MH6A 5L2YH 1C1VH 1FXYA 2NU3E 1N6YA 2J98A 1C5RA 1KSNA 5HGGA 1GJBB 3STJA 3URDA 1C5YB 5A8ZA 1NT1A 2QXIA 3GICB 1DXPA 2F9NA 2Y5FA 1TGBA 2KM0A 1HNEE 1BMAA 4F49A 4BXWA 1TE0A 1FMGA 1FY5A 1HUTH 4ZKRU 1GHAF 1S6LA 1AGJA 1OWHA 1K1MA 5JB8S 1GI5A 3HGPA 3SW2B 2PTCE 2PTNA 3SQHE 4XFQA 2HNTC 3E0PB 2BLWA 3T2NA 2D1JA 1DLKB 2BLVA 2BY6X 3DD2H 1FX0B 1EJNA 1GI0A 4DJZB 1G37A 4XRNA 2IPHA 4F55A 1TAWA 3T28A 2OQUA 2BY9X 1YM0A 3ZZ3A 1ELTA 1EP5A 2A5AA 5C1XA 1QNJA 4X8SH 3LC3A 4FU7A 5A0CA 2VIOA 5C20A 5B6LA 3VG8A 2SGEE 3U98H 1C1WH 2AERH 1GJ7B 1W0KD 3BTQE 1ZHPA 2QYIA 1OYTH 3GY4A 2F4LA 1OWDA 1BIOA 1GCTB 2KR7A 1EZXC 3DUXH 3DSPA 1OOKB 3MQKC 2VINA 2BLQA 4LK4A 2VGCC 3SYJA 4CR5A 1PYTD 4HZHA 4DURA 2P3UB 4MNWA 4GHTA 3S69A 2ZKSA 3IG6B 5T1VA 4X0WU 1O5DH 4FVBA 1BCUH 1C5SA 1WU1A 2PGBB 1IQHA 2J5UA 3RXDA 4ISNA 3ATIA 1SR5C 1C2KA 1MH0A 1O2WA 2OC0A 2W7UA 1C1OA 2W3KA 3A84A 1TNKA 1T8LA 5T6GA 1SB1H 2VGCB 1YPEH 2Y81A 1P2QA 1WSSH 1L4ZA 3G01A 1HAVA 1P2NA 3QK1A 1DOJA 5HXFA 2FLRH 2QN5T 1AQ7A 1V6DA 1ZSLA 2ZDVH 1C5PA 4MNYA 2THFB 3VXEH 4BAOB 2OC1A 1C1MA 1J14A 1A1RA 1ORFA 1GHXH 2O8LA 1GI9B 4F4OC 4WXIA 5A0BA 1MQ6A 2D8WA 2EI8A 2ZTZA 2XBXA 1AMHA 4Y76A 2Z9IA 4Y7AA 2CV3A 2OCVB 3BTTE 1SGYE 3MFJA 1Z8JB 4R8TB 1OWIA 5C3NA 1HAVB 3RXJA 1K1OA 2BX4A 7LPRA 4JZDH 1BTWA 2BD9A 2C8XB 4UFEH 5KECA 4ABAA 2VB0A 1HXEH 3JZ2B 1G30B 3M5OA 3RU4D 2BOKA 1BMNH 4XE4A 1ARCA 1ACBE 3SI4H 5A2MH 4K1TA 3BN9A 3SGQE 1O2SA 1H9IE 5LH8A 3F9GA 4AYVB 1GI7B 2FZZA 1BZXE 3MO3A 2CGAA 3N7EA 1YPGH 4AOQA 2ZGJA 1C2FA 5C17A 1IQMA 1QBVH 1XKAC 2GJGA 1GMCF 4DGJA 1ZPZA 4I8GA 3EGKH 2H5DA 2ZCKP 5FBEA 3S7HB 3ODFA 1F5KU 4I32A 1TA2A 1XVMA 1LMWB 2XOKD 3AAVA 2ZHFH 3TJOA 2NU2E 1HJ9A 4E7RG 5CHBA 5ESBA 1BBRE 1P9SA 3KN2A 8GCHF 4MLFB 4UFGH 3P70B 4B6EA 1KXAA 1X7AC 2BQWB 3KQEA 2J94A 3LKWA 1VKYA 4MDSA 1YCPM 2ZEBA 3SGBE 2ZHEH 2XC4A 4IN1A 2ZPRA 1TGSZ 4A6LA 5DP4A 3WY8A 2SGQE 4ASHA 1TNHA 2OINA 1O5EH 1N1LA 1A3BH 5HYOA 1CHGA 3UWIA 3GDVA 5DP5A 1B0EA 3NCLA 5PTPA 3ZZAA 3OTJE 2PHBA 3JZ1B 5GCHF 2FOGA 1DWCH 1SI5H 2Q6FA 5EQQA 3OFND 3Q77A 1YBWA 1P3CA 1MAXA 1THSH 3ENSB 1PQAA 2A2XH 2BXTH 3MI4A 1O2YA 3PM3A 1ANBA 1W13U 1BRAA 1Y5BT 3FP8E 4FUFA 3LH1A 3M3TA 4JK6A 3SBKA 2AMQA 4OS7A 1G32B 4LZ1H 1NFWA 1PYTC 3LOXA 3K6YA 1AO5A 4I8LA 4DVAU 2FLBH 3TLOA 1XUFA 1E34B 1VITG 4BAKB 3PROA 3TK5A 2GT7A 1W8BH 2ZTXA 1OHHD 3F3BA 1D3DB 1XVOA 3H09A 2FM2A 4NSVA 3A86A 1PPHE 1ZLRA 4JYUH 1EOJA 3ATMA 1A5GH 3M7QA 5A8YA 1CSOE 1GMHG 2AGIX 2FDAA 1UTLM 2CK3D 2VH0A 1C2EA 3DT0H 4I7YH 1B5GH 2J4IA 1O33A 3LGWA 3BG8A 1FPHH 1HCGA 5JDUB 2HNTF 2PKSC 4DT7B 1PQ5A 3SV8A 1C5ZB 3F0OA 5KGOA 1GJ5H 3GYLB 1BA8B 5C94A 2GZ7A 2QV1A 4K8BA 1XUKA 1TNLA 1OWKA 5EJZA 5TJXA 1XUIA 2QXJA 3RLWH 4IMQA 2OC7A 1EAWA 2CJIA 3WWFA 1Y5UT 1LVBA 1MQ5A 2B9LA 2FWWA 3I29A 2PP6A 1THPB 3O8CA 1SGIB 1FJSA 1YLNA 2Y82A 2ZDNA 1ZSKA 4X2YA 3BV9B 4X8TH 1GBTA 3UIRA 3TGJE 4JCNA 5EODA 4IBLH 1ZRBA 1ANDA 1W3CA 1SGCA 2PKSB 4GPGA 3PV4A 3UFAA 1BT7A 1O39A 2ANKH 1EKBB 1UTQA 1BTPA 2G52A 4PROA 5LPEA 2A2QH 1G2LA 2H9TH 4OS6A 2VNTA 3B8JA 1C2LA 1K0HA 3M36A 4BAMB 2IN2A 1OS8A 1TMUH 2FO9A 2Z9KA 3ZVAA 4Y8ZA 4GCHF 4DIIH 5FPTA 1UHBB 1P3EA 1C5LH 3WWBA 4UEHH 4ZMAH 1C5VA 2GTBA 2Y6TA 1MCVA 2VIDA 3PWBA 1A3EH 1CHOF 2FTMA 2CN0H 2VIQA 1SGTA 1ELBA 2GCTC 3PTBA 3LONA 1V2NT 4FU8A 1C1SA 1QA0A 4AC9A 1C1NA 3BTEE 3DFLA 3M5MA 3PB1E 4BOHA 1TGTA 2A4QA 1F0TA 7ESTE 2GDEH 5CMXH 3MWIU 4HTCH 1AWHB 1WCZA 4B71A 2H9EH 4AGJA 4NIXA 1EOLA 2ALPA 3GCTF 4INKA 3SZEA 4ISLA 4BTUB 4NIYA 3B9FH 3FAOA 3PLBA 3FZDA 4X2WA 1FNIA 1NO9H 2FOBA 3Q00A 3RXGA 3E8LA 1UCYE 1ZZZA 2BDGA 2ODQA 1IQFA 3VB7A 2GCTB 1AFQC 4HI3A 2V3HH 5F8TA 3N99A 1WV7H 3LH3A 2A1DB 2Z3CA 4U2WA 1NU7B 1XM1A 3RXUA 1IQGA 3F2HA 1L1NA 1VGCC 3OAAD 1MTNC 2WHXA 2ZGBH 3GY8A 3BEUA 4X6NA 3U1IB 3U8TH 4Y0YE 1GGDC 1KMHB 1UVPA 1HAIH 1Y3YA 1YLDA 4OGYA 6GCHF 4GHQA 1D3TB 2O8MA 4FUBA 4Y6DA 3SUFA 1QZ8A 2ZC9H 2WUCA 1AFQB 1SBWA 2Y7XA 5JPMH 2FYRA 3NRLA 1O3CA 2G51A 1ZTLA 5DK1A 1HJAB 2GDDA 2PV9B 3ZVGA 3F9FA 4BAQB 3UQOA 1UO6A 2HLCA 1K1NA 1BTZA 3MH5A 3A7XA 1GHVH 1VGCB 1O36A 1MTNB 1ELEE 2EEKA 3MU4A 4B74A 4YESB 4UONA 5E0HA 5C5NA 1GGDB 1FI8A 2Y5HA 4X2XA 3KEEA 4K1SA 1O3IA 3HGNA 1E79D 3RMOH 3GY3A 4ZCNA 5E0GA 1C4V2 2GV6A 1VR1H 3P8FA 5C67A 1G3EA 1HGTH 5EGMA 2PSXA 1Z8GA 4INHA 1XMNB 1O5CB 3RXHA 1HXFH 2AYWA 4AG2A 1HV7A 2ZFSA 1LHDH 3E91A 4WH8A 2P3TB 3F9EA 1TYNA 3E90B 2TRMA 4GAWA 3RXRA 1EXFA 1TX8A 4NG9H 4ABBA 1RGQA 2G81E 2ZGHA 2K0QA 1ZHRA 1O3FA 1QTFA 3AK5A 2WV5A 5HMAA 1FUJA 3F68H 1G9IE 7GCHG 3KF2A 3SU0A 2NU4E 1P02A 3UPEA 5LPRA 1FN6A 4SGAE 3T62A 1A5IA 4K60A 3HK6B 3GY7A 4YO9A 5G4BA 2A4OA 5JYIA 2EC9H 1BJUA 1KTTB 2F83A 2AGEX 2SGPE 4XBCA 3GY6A 2BXUH 1SQOA 2EI7A 1NRSH 5ETXA 2TGTA 1O3LA 5FCRA 1GHBG 1D4PB 1O2ZA 2KAIA 3CS7A 4HG6A 5EIYA 1GI6A 1C4Y2 1NFXA 1P04A 2C8ZB 2P95A 4MTBA 3A7WA 5DP7A 4I8KA 1S5SA 1IQLA 2BD4A 3ATWA 3UR6A 1GJ8B 4NZQA 1JOUB 3UAIC 3V0XA 1K22H 1BMLA 2LPRA 2I6SA 3PMHB 1GHZA 4ZAEA 3C1KA 5EOKA 1IQKA 2F9BH 2O8WA 1PPEE 2GZ8A 2ZIQH 3FP6E 3MO6A 3EQ0H 2HOBA 3RXSA 4UD9H 1O2XA 3ZVFA 4AB9A 4B76A 5JBCS 3KL6A 3SN8A 1ZTJA 3GCNA 1TGCA 2UUFB 3RXBA 2ZPQA 1MMJN 5C5OA 1KDQA 4WY3A 3E0NB 1BRCE 3SV9A 1SGPE 4ABHA 2BHGA 2FODA 1P06A 2ANWA 1E1RD 1TBZH 3NXPA 1T32A 4INLA 2ZDAH 5DP3A 2ZFRH 4ACAA 5ESTE 2B8OH 2A45B 1C5TA 1TA6A 1K2I1 3N7DA 4YXWD 1AIXH 3RXAA 1GI2A 3D49H 2J9NA 2UWPA 2AH4X 3SORA 1GHAG 1F5RA 1QURH 1TLDA 1W10U 4NA8A 1FIZA 5FHTA 1H8ED 1J9CH 1F0SA 1C2JA 3MH7A 2ZFFH 3GDUA 2FOEA 2WPDD 4UFFH 5FAHA 4THNH 2G4UA 3CP7A 3M5LA 3U8RH 3KHVA 3ZV8A 1XKBC 5ABWA 1K21H 3Q3YA 1NM6A 4GUXA 4MG3A 1WBGB 4KTSA 3HATH 4AGKA 1YC0A 1GJDB 2XBWA 4YTAA 2FEQH 4KKDA 1O3EA 3A7ZA 3A85A 1ELVA 1IAUA 3M37A 4K69A 4VGCC 2BD8A 1TALA 3BEFB 1ESBA 4JZFH 1TRNA 1AN1E 2Q6DA 4NFFA 3RU4T 1Z1IA 1ANCA 3TH2H 4B6FA 2J98B 4ZXXH 1BTXA 5SGAE 1GDNA 1D6RA 2BX3A 1UK4A 2XXLA 2BD5A 2RA3A 1PPCE 3KIDU 3ATKA 4CRGA 4BANB 2KX4A 5DP9A 1RJXB 2FXRA 2XC0A 2J97A 3F0PA 1O5GH 1LKAA 4Q7YA 3SO3A 3STIA 2R2MB 2GCHF 4WH6A 4ZROA 2P16A 3U8OH 4CH8B 1TQ0B 1TX6A 3A88A 4ACBA 2Y80A 3RXCA 4VGCB 3KYGA 1W11U 5EXNA 1H4WA 2KCAA 1ARBA 4RN6A 1O38A 1BBRK 1GI8B 1P8VC 3M61U 4YZUA 4DOQA 1BRBE 1GJ6A 2VVVA 3V3MA 1V2OT 4CHAC 2VVUA 3LJJA 5EQSA 1G3BA 1NRQH 1O31A 4Q63A 5FBIA 4LOYH 3BTME 5CHAC 2RG3A 1YPJH 3DFJA 4XBBA 4YT6H 4JMYA 4CRAA 5C0TA 4FUGA 3FZZA 3ESTA 1PFXC 4Q7ZA 3K9XB 2ZDLA 3Q3XA 2F9OA 3RXTA 3WW7A 2VWMA 1EP6A 1ZMJA 5DKMA 4Q80A 3SQEE 1SLVB 1C2DA 3UR9A 2XCFA 4UE7H 4ABGA 4CHAB 1WXRA 2G8TA 1HAHH 1QGFA 3KQCA 1GVKB 1K28D 4DCDA 2QA9E 1GWAA 1AKSA 2A4GA 1K9OE 1EFRD 3PV5A 1HAYB 1LHGH 1AI8H 1FZZA 4Z6AH 1EATA 1KIGH 3ZZ4A 1GHYH 3QX5H 5GJ4B 3SJ9A 2ZTYA 1O2NA 1C9PA 1H8IH 4A5TS 1KLJH 2ZQ1A 1O5BB 3BIVH 1A46H 1W0YH 1NY22 2R3YA 3HPTB 3H7TA 1LQDB 1QY6A 3DSOA 1HAGE 1GI4A 4MPVA 1QBNA 1IQIA 4O3UA 1GMCG 3P95A 3RXIA 1KXFA 1V2KT 3SI3H 4CR9A 1GJCB 1EAIA 2FYQA 4HGCA 1BQYA 1O3GA 5J4QA 1DUAA 3FANA 3MNBA 4X1RU 2BTCE 4FUDA 1JRSA 1A0JA 3U69H 2BDBA 4Y71A 2VIWA 4B75A 1A2CH 4K2YA 2XRCA 1WDIA 2PUXB 5EQRA 2PSYA 1LVOA 8GCHG 2SGDE 3TH4H 1T31A 5BPEA 1QFKH 1NRRH 3RDZA 4D9QA 3OEHD 1DUEA 1QRWA 1S82A 2WPMS 2O8UA 3MYWA 1NBME 2W6JD 4H42U 3F1SB 3S9AA 2FOAA 1HLTH 2BDAA 1E35B 1UTPA 2A7JA 3BG4C 3D23A 2DE9A 3TH3H 3CS0A 2ZU1A 1OX1A 4J2YB 4DT4A 2W7SA 4CRFA 1W7GH 1DS2E 3SU3A 3FOAA 4NIVA 1AZZA 1L1JA 1WQVH 2OBOA 1GDUA 1QRXA 1E0FD 5GCHG 2YOLA 1LPGB 1B0FA 3R0FA 4ZKNU 5EPNA 1CT2E 2ZG0H 1XUHA 1H9HE 1S0RA 1TNGA 2KCOA 2NU1E 1C5XB 1O3KA 1O3DA 3LIWA 3LU9B 1Z7KA 1O5FH 1O30A 1YPKH 1FLEE 5GNDA 2Q6GA 1UMAH 2PR3A 1TRMA 3EA9A 4IC5A 1NN6A 1T4VH 2ZHDA 1AHTH 2KFWA 2Y5GA 3Q76A 4AFUA 2A31A 2GT8A 1E38B 1BUIA 1NU9A 1E36B 4ISIH 1O2UA 3BG4B 2H5CA 3SV6A 2KCPA 1GG6C 1S85A 1Y3UA 2XCNA 1ZYOA 2IJOB 4J1YA 1BBRH 2WZQA 3MU0A 1O3HA 2XW9A 1AU8A 1QJ1B 3A89A 3NPSA 2R2WU 4FUHA 3BTFE 1V2MT 3SNAA 1GPZA 3UNRA 3S7KB 4NA7A 1P12E 3SJKA 1KXCA 3ZVCA 3NZIA 3PTNA 1P0SH 2A7HA 2ZO3H 3OSYA 4LXBH 1GBEA 2HVXA 1YPMH 4MPXA 1CA8B 2B0FA 5HKKD 4CRDA 1GG6B 5DG6A 1UW7A 1DY8A 4NZLA 1O5AB 1MTWA 3T5FH 2FP7B 2J95A 4ZKOU 4CBNA 1Y3WA 3RLYH 2ALVA 1TOCB 1AD8H 1TX7A 1JIMA 3A7TA 3SNDA 2UUJB 1UTKA 5FL7D 3VXFH 1E1QD 5JB9S 2SGAA 3ODDA 1Z8RA 2M5TA 2QF5A 1QJ7B 4WMDA 5K7RA 2ZU4A 2L74A 4JK5A 4OS2A 2BMGB 2ZFQH 1PPFE 1Q3XA 3P17H 1PQ8A 4QT8C 4O97A 2ZFPH 1LKBA 1C1UH 4XBDA 1OKXA 1LHCH 4Y11E 1FQ3A 4SGBE 1P57B 5EXMA 4GCHG 1KTSB 2UWOA 3UOUA 1SMFE 1NBMD 5AF9H 2PFEA 3UTUH 1ZPBA 4CBOA 1QB1A 2WPHS 4DG4A 2Z7FE 2W26A 1TABE 2STAE 1S6HA 3UB0A 2TIOA 3RC5A 1CHOG 1Y3XA 1FY4A 3AW1A 2BVRH 3OEED 3SU2A 1NESE 5C2ZA 1LPKB 1ZOMA 3EE7A 5AHGH 1XXDA 1DITH 1WOFA 3PMBB 1CE5A 2XNIA 2A5KA 1QIXB 3QO6A 1MBMA 2GV7A 1JIRA 4BTIB 1L4DA 2D26C 2HVYB 2C8WB 1EX3A 1DLEA 1MU8B 3GCTG 4AG1A 1O35A 2ODYB 1EZUC 2BVXH 2XYAA 3GY5A 2AGGX 2IJD1 3KCGH 3ZV9A 3SNBA 5EU8A 3SGAE 1EJMA 2QE7D 2RA0A 4X1SU 1CT0E 2EQNA 1C1PA 1QB9A 2BZAA 1CGHA 1B7XB 3KYFA 1GJ9B 2YMSD 1LO6A 1O3JA 4BTTB 2OP9A 4GVUA 1QQUA 1UJ1A 2STBE 2L6OA 1OWEA 3A87A 1DSUA 2VH6A 1A5HA 2QAAA 1VJAU 1MBQA 5F03A 2AEIH 4FUJA 3RMLH 2J2UA 1YWUA 1ESTA 3A82A 2BD7A 3ZVEA 4WWYA 6GCHG 2JJ1D 1L2EA 4IC6A 4OS5A 3ITIA 4FVDA 2B5TB 3NK8A 3T29A 1O3NA 4MNVA 2ZF0H 1W2KH 1Y59T 4WXVA 3IWMA 2XTTB 4TY7A 3QN7A 1C2MA 1G36A 4D8NA 4DY7B 1SGFG 4F48B 3EAJA 2GVFA 5FX6A 1GJ4H 4U32A 1C5QA 2H2ZA 3NKKA 2XBYA 1VCPA 4WMEA 2Z6BD 2ZHWH 3TJVA 2WPLS 5DGJA 1TPAE 1Y8TA 3AVZA 5IK2D 4U01A 1GBKA 1FN8A 4ZXYH 2TGDA 1O2HA 1U6QA 1S84A 3V13A 2QCYA 5GXPA 3GCHC 1O37A 1KLTA 1RIWC 2ANMH 3BEIB 3GS9A 1CVWH 1PPZA 5F8XA 3MU5A 1IOEA 5FXLA 3UREA 2BDIA 3M5NA 8ESTE 1SSXA 1ZGIA 1K1PA 2ZPSA 4UDWH 3RXMA 3NWUA 4Z1MD 1HJ8A 5EPYA 1RD3B 2Q1JA 1IQNA 5LPFA 1O34A 1HB0B 1NRNH 2P94A 2OLGA 3A7YA 1ELAA 1LPZB 2HGTH 3P92A 1HPGA 3AW0A 4IGDA 2FOHA 2QGRA 1H1BA 1VJ9U 3K6ZA 4K3JA 3RC4A 5K0HA 3GCHB 1RIWB 2PW8H 3SU6A 5TCAA 1FPCH 2VWLA 1T7CA 4IW4E 1SQRA 1SQAA 4AN7A 1O2QA 1LVYA 2C3SA 5EW1H 3OYPA 5DN6D 2XNDD 3L33A 1YKTA 3BTHE 4YLUA 3S9BA 1INCA 1ZMNA 2BDYA 1HAPH 1OWJA 5E2PA 5HIZA 1SKYE 1J8AA 2ZFTA 3ZVBA 2M2AA 4Y79A 3T25A 4I8JA 1YPLH 5C1YA 1HIAA 2FTLE 2ZECA 1NTPA 1W7XH 3DSGA 1T8OA 5J4SA 3V12A 2FS9A 4IN2A 3PWCA 4X1QU 2PWXA 2Z3DA 4ISOA 3TITA 3SUDA 4ZH8A 5DO4H 3H5CB 1QL8A 2G5VA 2WUBA 2FOMB 3VB5A 1L0ZA 1THRH 2XWBI 2PUQH 2BVSH 1BJVA 1SLXB 3W95A 3F2GA 1Y5AT 1MZAA 1QL9A 3W94A 3UOPA 1CU1A 5L2ZH 1TRYA 1Z1JA 1CT4E 1SFQB 2PKAA 1HIAB 1C1RA 1QCPA 3VEQB 1AUTC 1SLWB 1N8OC 1EPTA 2V3OH 1GHWH 3MNSA 1FV9A 1SQTA 4ABJA 1SHYA 4ABFA 1TB6H 3QTVH 4K5ZA 4OGXA 1MKXH 3QDZB 2VWNA 4BXSA 3SJ8A 1SGRE 4NGAH 4DW2U 2C93B 2YMSC 1TONA 1C4U2 2FI5E 2W5EA 2HPQH 3PLKA 7GCHF 5DPAA 1OPHB 4OS4A 3K2UA 4ISHH 1JRTA 4WJG2 5EJLA 1C2HA 1RRKA 1KYNA 3D62A 2KAIB 2OC8A 2ZGCA 3Q3KA 1KXBA 2V3MA 1SGEE 2K8IA 4YT7H 1WAYB 2AIQA 3OY5U 2ODPA 2BY5X 1V2QT 2ZZUH 2R9PA 3GYMA 3A7VA 1N8OB 1T8MA 3GOVB 3IITA 4K1EA 3W1EA 1HRTH 5F8ZA 1V2UT 1O2IA 2RDEA 3L6PA 3FN8A 1GDQA 3MU8A 3A81A 4ZHAA 5A0AE 2IOTA 2OTVA 1YCPH 1RTKA 1AB9C 4H4FA 5EW2H 1ELFA 1GBAA 2I6QA 4BAHB 4FUIA 2KCYA 4NWLA 3C27B 5DSFA 1MTVA 2CF9H 4KGAA 1NRPH 2QF4A 4LZ4B 4TY6A 1YLCA 1VCWA 2BZ6H 2WINI 1O2LA 4XOJA 1KDQB 4M7GA 1SOZA 3LT3A 2AHME 3TK9A 3RXQA 3SU4A 4Y7BA 1A0LA 1AZ8A 4Q4LA 3FFGA 2BY8X 2JJ2D 2ZI2H 2ILNA 3F6UH 1Z71A 2C90B 1AWFH 1LVMA 3TU7H 2ZCHP 1TWXB 4CREA 2JH6D 1CGJE 1AB9B 8LPRA 5B6OA 5JBBS 1O3OA 1TPOA 3A8CA 2JH5D 1A0HB 1L1GA 5I46H 2F3CE 4FUEA 2GCHG 1ABIH 1DANH 2BYAX 6CHAC 4RT1A 1COWD 1GI3A 2EY4C 3MTYA 1NFYA 4ESTE 2LELA 1NZQH 1C5WB 1KY9A 1BDAA 1GMDF 1V2RT 5HIYA 2A4RA 3MU1A 1LDTT 3RU4E 3KQ5A 1TQ7B 1PJPA 2JKHA 1GCTC 2LNCA 2TGAA 4CH2B 1P2OA 2K1QA 3D65E 2LP6A 2W3IA 1UVOA 3A8BA 3ZZ6A 4D7GA 1J17T 1UTMA 2J34A 1F0UA 5HM2A 3RP2A 3AASA 1TMBH 2Z9JA 3MO9A 2FI3E 4KP0A 6CHAB 1IQEA 2BM2A 3V7TA 3ZIAD 1UVUH 3P8GA 2XWAA 1ELDE 1YF4A 4E05H 3FO8D 4FOUC 3QZRA 1HFDA 1V2ST 3PV2A 1SVPA 1SGDE 3MNCA 1O32A 4AFSA 4RKJB 1SOTA 1ABJH 3TPIZ 1HYLA 5EJ1A 1MUEB 2QIQA 3P8NA 5AFYH 1DWBH 1AFEH 1GBIA 2B7DH 3T27A 3PMJA 1YYY1 1YY3A 1QJ6B 4B73A 1AVXA 1ETSH 5IDKA 3ZZ8A 3LGYA 4B2BA 1P10A 1O2PA 1C5MD 3VGCC 1SGNE 1ELGA 1O3BA 1KXDA 4MVNA 5TCCA 4BNRA 4E7NA 4TT3D 1MZDA 4JZEH 5T3HA 1A61H 3QWCH 1GBBA 5CHAB 2GGVB 2J92A 4ASUD 1SG8B 5CE1A 1CGIE 2GX4A 1J16A 1ELCA 2PGQB 1JXPA 2NU0E 4A92A 1YPHE 2GMTC 1DWDH 1C9TA 6LPRA 1HAXB 3P6ZB 2G55A 3LDXH 1O3MA 3BSQA 5CDFE 5EXLA 4X6PA 5GDSH 3VGCB 1HBTH 1WTHD 2Y7ZA 2ZU5A 3VB4A 2WYGA 1GVZA 1VCQA 2V7QD 1ESAA 2ULLA 1AKSB 4IMZA 2W6ID 2SFAA 1AVGH 4FUCA 3E3TA 2BD2A 2P8OC 1GI1A 1M9UA 4AORA 2ZU2A 4AYYB 2VIVA 3LPRA 4ZHMU 1WQSA 1O2VA 2BOHB 1OYQA 2BQ7B 1NS3A 1XUJA 2GMTB 2TBSA 3RMNH 1TNJA 1V2PT 2F43B 1AUJA 3KNXA 2WPJS 1OXGA 4FU9A 2BD3A 2GD4B 1MKWH 4O3TA 4KELA 3O8RA 2O8TA 1AE8H 3HKJB 4XD7D 1TBQH 1MTUA 2ZWLH 3ZVDA 3TJUA 3UUZA 1EB1H 1V2WT 2P8OB 2CHAC 5GIBA 5L30H 3ZZBA 3LC5A 1TPSA 2FPZA 3GDSA 1DVAH 1EQ9A 1WTGH 3TJNA 1CQQA 1T8NA 1EB2A 2G4TA 1H8HD 1V2LT 2WSSD 3MNXA 1BHXB 1K1LA 3DCLA 1BTYA 4X2VA 3M35A 3SHCH 2A5IA 2H6MA 1E37B 2ZDMA 3RXLA 1W0JD 2D2DA 2YNBA 1FDPA 2ZGXH 1D3PB 2VJ1A 3TGKE 5HM9A 3OE7D 1XXFA 2HLDD 1SGFA 1O2KA 1V3XA 4GLYA 1S81A 4H6TA 5F53A 4P02A 2CHAB 3FKSD 1NFUA 3E16B 4XDEA 3SHAH 1ETTH 1PPGE 2G5NA 2QXHA 1Q31A 1GCDA 4I33A 3HK3B 4B2AA 4X6OA 3EYDA 1GVLA 4AX9H 4D7FA 2JETC 3MOCA 2EI6A 1S6FA 1DSTA 2UWLA 1S83A 1UK2A 2XBVA 1P2KA 3FVFB 1DWEH 9ESTA 4B2CA 4MPUA 2RDLA 3CNRA 2OQ5A 3O8BA 1ZTKA 2WPIS 4I86A 3SUGA 4A1XA 5BRRE 3PRBA 3SU1A 1P2IA 2Z94A 1Z6EA 2A0QB 5FPYA 4AFZA 4YM9A 2XC5A 1F0RA 2A7CA 1LCYA 3KQDA 5KEDA 2WPKS 1UCYK 1BTUA 1Z8IB 3SNEA 3M3VA 4JZIA 2BY7X 3OU0A 4P00A 1FY3A 2JIZD 1JMOH 3B23B 2WV9A 1CBWC 1Y3VA 4TYDA 1P11E 2QXGA 1P2JA 1ZSJA 2F9VA 1O3AA 2JETB 3A8DA 3QZQA 4TPIZ 1ZJKA 3LGUA 1EZQA 2OD3B 1FAXA 1EAUA 4MQAA 4NIWA 5EG4A 3PYHA 5DJ7A 3LGTA 1C5NH 3VFEA 1C2GA 3S9CA 3U28C 1DICA 1BB0B 2F9UA 4I8HA 2GZ9A 4TWWA 6ESTA 2A32A 2ASUB 3QTOH 3AAUA 2HRVA 2OBQA 2KZ4A 4JYVH 1ETRH 1C5OH 1F7ZA 2SGFE 1BMMH 1QB6A 1F2SE 3TNTA 2CMYA 2TPIZ 1EJAA 4JZ1A 3BIUH 1VITF 1K1IA 3ELAH 1GJAB 1D9IA 3SNCA 3QLPH 1DPOA 1CBWB 1DT2A 3QGJA 1GBMA 4Q2KA 3I77A 4GSOA 1GMHF 3DA9B 3BTGE 3MMGA 2SNVA 1DFPA 4FXGH 3U1JB 1EASA 3RXFA 1H9LB 2OXSA 2NWNA 2IPQX 1QBOA 1UHBA 1ZGVA 2QF3A 1A7SA 1ZRKA 3RM0H 2RCEA 3DHKH 4RKOB 2AS9A 3EE0B 7KMEH 3UNSA 1GBCA 2ESTE 2ZHQH 4Z0KA 1QQ4A 3M7TA 2TGPZ 3A8AA 2F9PA 1GL0E 4KTUA 2FESH 1FAKH 1P03A 1GBHA 5A8XA 1SLUB 2ZA5A 2HNTE 2BB4A 2WV4A 1BITA 1ID5H 3PO1C 1KXEA 1W14U 4YOIA 3RMMH 4YOGA 3SV2H 5FCKA 3SU5A 2ZQ2A 1MU6B 1ZPCA 2FS8A 1BOQA 1P05A 1ZMLA 5GWZA 1SHHB 4TWYA 2PLXA 1W12U 3RXPA 5DP8A 3SJOA 1V2JT 2SNWA 3K65B 4Q7XA 1O2RA 2OUAA 1MCTA 1SC8U 2DE8A 3E1XB 4HFPB 4ABDA 1GBJA 4A1VA 1AE5A 1J15A 1P9UA 2BLOA 3LGIA 1QR3E 1PQ7A 2O9QA 2Z9LA 1CO7E 3PMAB 5L6NH 1MKXK 1V2TT 3N7OA 1LTOA 3KQBA 3E6PH 4OS1A 1WYKA 4U30A 1BMFD 1DDJA 1LHFH 1VITH 4Y10E 2FOCA 3PO1B 5FPSA 1ZHMA 2P3FH 2H1UA 1TNIA 1H8DH 5H4IB 1CA0C 1SPJA 4CRBA 1JBUH 3TVJB 1O3PB 1AVWA 4NSYA 1GBDA 1OP8A 4X8VH 3VPKA 2R3UA 5E8EH 2AIPA 4X8UH 4B1TA 1V2VT 2ZCLP 3EA7A 1FIWA 1MTSA 2F91A 1F92A 2ZNKH 3ZZ7A 1YCPK 4RT0A 1MD8A 2VWOA 3ZZ5A 3U9AH 1TPPA 1VZQH 3ZZ9A 1YGCH 1BHXF 1BTHH 1QRZA 1RXPA 1MAYA 3QUMP 1LHEH 1P01A 2AMDA 3F9HA 2VIPA 1FONA 4X1NU 4X6MA 5I25A 1TIOA 2HALA 4AFQA
chains in the Genus database with same CATH topology
3H7OA 2P59A 1HJAC 4YLQH 1OSSA 9LPRA 3TGIE 1C2IA 3LJOA 1CA0B 4NFEA 1YPHC 1PPBH 5IYTA 1UCYH 4A7IB 4Y8XA 1O2TA 1Q2WA 4O9VA 3PLPA 2FX6A 3UQVA 4NWKA 8KME2 1C1QA 4E06H 1Z6JH 2QY0B 1QL7A 4AZ2B 1NC6A 1O2OA 1FY8E 5GPIB 5FX5A 1G3CA 3T26A 1ANEA 1F5LA 3A80A 2J38A 2GP9B 2BDCA 3LGVA 1QA7A 2C4FH 1UVSH 4CRCA 3MHWU 1YP9A 1SFIA 1MD7A 4WVPE 2BDHA 4ZKSU 5DP6A 1DXWA 1EAXA 1RTLA 3L3TA 3ZZDA 2ZP0H 3UWJH 3ZYEA 3M3SA 4Y0ZE 1O2MA 4WMFA 3SV7A 3URCA 3ZYDA 2V6NA 1QHRB 1TBRH 1OP2A 2CF8H 1A4WH 4MPWA 4TPYA 5LGOA 3RXVA 2EA3A 4I31A 1EZSC 2ANYA 4NA9H 1HAOH 3FP7E 1HDTH 1HAZB 5E0JA 1K1JA 3P8OA 1UTNA 3OY6U 5JBTA 3RM2H 1JWTA 1ZR0A 1XUGA 3QGNB 1C5UA 3SZNA 1TMTH 3BF6H 1KLIH 1RFNA 1TOMH 2Z9GA 4JYTA 2DUCA 3KGPA 4UFDH 1ZJDA 1UTOA 2CXVA 3RC6A 4D76A 1UVTH 2AMPA 5AFZH 1NROH 2FX4A 1UTJA 4ZUHA 4ZHLU 4A1TA 1DX5M 1SGQE 3ATLA 2FMJA 2BQ6B 3BTDE 1EPTC 1EUFA 3RUOA 5E2OA 4WF8A 1SL3A 2FIRH 3BTKE 1IQJA 1N6XA 2HPPH 3RXOA 3A83A 1XX9A 4DIHH 2ZDKA 1DE7H 1W0ZU 4AB8A 3TNSA 4D9RA 1OP0A 3M7UA 2JH0D 2R0KA 3HKIB 2GKVE 1T4UH 5AVDA 1D3QB 2P93A 2H9HA 1DY9A 3SJIA 3SOSA 1IHSH 5A09A 1IHTH 1DM4B 1LQEA 1C1TA 2YNAA 2PKAB 4NCYA 3VB6A 3UNQA 2V35A 1EPTB 1O0DH 4Y8YA 1P09A 5C1UA 4O03A 5T6DA 3I78A 2FOFA 2AFQB 1O2JA 2VVCA 1UK3A 1GBFA 4IS5A 2UUKB 4R0IA 1RTFB 2UUYA 1GHBF 1BRUP 1RS0A 1S0QA 5JBAS 3EA8A 2QC2A 5F6MA 3ZZCA 1GBLA 2V0BA 5T6FA 4ABIA 2QF0A 3UY9A 2G00A 2VU8E 3RXEA 3RXKA 3CENA 4ABEA 3GY2A 3OX7U 2ZU3A 4RSPA 1WUNH 4YOJA 1FY1A 4MNXA 3EDXB 3O8DA 3R3GB 2Z3EA 4K8YA 1G2MA 4X1PU 3GCOA 3SUEA 3TIUA 4H6SB 1MKWK 3S0NA 1AY6H 1GL1A 1P2MA 1TGNA 1O2GH 2FI4E 2R0LA 3GISB 1GMDG 1NPMA 4XSKU 3NUMA 1G3DA 3MH4A 1TFXA 3VB3A 4KTCA 1D6WA 2WYJA 3TK6A 2C8YB 2HWLB 3BTWE 3MH6A 5L2YH 1C1VH 1FXYA 2NU3E 1N6YA 1C5RA 1KSNA 5HGGA 1GJBB 3STJA 3URDA 1C5YB 5A8ZA 1NT1A 2QXIA 3GICB 1DXPA 2F9NA 2Y5FA 1TGBA 1HNEE 1BMAA 4F49A 4BXWA 1TE0A 1FMGA 1FY5A 1HUTH 4ZKRU 1GHAF 1AGJA 1OWHA 1K1MA 5JB8S 1GI5A 3HGPA 3SW2B 2PTCE 2PTNA 3SQHE 4XFQA 2HNTC 3E0PB 2BLWA 3T2NA 2D1JA 1DLKB 2BLVA 2BY6X 3DD2H 1EJNA 1GI0A 4DJZB 1G37A 2IPHA 1TAWA 3T28A 2OQUA 2BY9X 1YM0A 3ZZ3A 1ELTA 1EP5A 2A5AA 5C1XA 1QNJA 4X8SH 3LC3A 4FU7A 5A0CA 2VIOA 5C20A 2SGEE 3U98H 1C1WH 2AERH 1GJ7B 3BTQE 1ZHPA 2QYIA 1OYTH 3GY4A 1OWDA 1BIOA 1GCTB 1EZXC 3DUXH 1OOKB 2VINA 2BLQA 4LK4A 2VGCC 4CR5A 1PYTD 4HZHA 4DURA 2P3UB 4MNWA 4GHTA 3S69A 2ZKSA 3IG6B 4X0WU 1O5DH 4FVBA 1BCUH 1C5SA 1WU1A 2PGBB 1IQHA 3RXDA 4ISNA 3ATIA 1SR5C 1C2KA 1MH0A 1O2WA 2OC0A 2W7UA 1C1OA 2W3KA 3A84A 1TNKA 1T8LA 5T6GA 1SB1H 2VGCB 1YPEH 2Y81A 1P2QA 1WSSH 1L4ZA 3G01A 1HAVA 1P2NA 3QK1A 1DOJA 5HXFA 2FLRH 2QN5T 1AQ7A 1V6DA 1ZSLA 2ZDVH 1C5PA 4MNYA 2THFB 3VXEH 4BAOB 2OC1A 1C1MA 1J14A 1A1RA 1ORFA 1GHXH 2O8LA 1GI9B 4F4OC 4WXIA 5A0BA 1MQ6A 2D8WA 2EI8A 2ZTZA 2XBXA 1AMHA 4Y76A 2Z9IA 4Y7AA 2CV3A 2OCVB 3BTTE 1SGYE 3MFJA 1Z8JB 4R8TB 1OWIA 5C3NA 1HAVB 3RXJA 1K1OA 2BX4A 7LPRA 4JZDH 1BTWA 2BD9A 2C8XB 4UFEH 4ABAA 2VB0A 1HXEH 3JZ2B 1G30B 3M5OA 3RU4D 2BOKA 1BMNH 4XE4A 1ARCA 1ACBE 3SI4H 5A2MH 4K1TA 3BN9A 3SGQE 1O2SA 1H9IE 5LH8A 3F9GA 4AYVB 1GI7B 2FZZA 1BZXE 3MO3A 2CGAA 1YPGH 4AOQA 2ZGJA 1C2FA 1IQMA 1QBVH 1XKAC 1GMCF 4DGJA 1ZPZA 4I8GA 3EGKH 2H5DA 2ZCKP 5FBEA 3S7HB 3ODFA 1F5KU 4I32A 1TA2A 1XVMA 1LMWB 3AAVA 2ZHFH 3TJOA 2NU2E 1HJ9A 4E7RG 5ESBA 1BBRE 1P9SA 3KN2A 8GCHF 4MLFB 4UFGH 3P70B 1KXAA 1X7AC 2BQWB 3KQEA 2J94A 3LKWA 4MDSA 1YCPM 2ZEBA 3SGBE 2ZHEH 2XC4A 4IN1A 2ZPRA 1TGSZ 4A6LA 5DP4A 3WY8A 2SGQE 4ASHA 1TNHA 2OINA 1O5EH 1N1LA 1A3BH 5HYOA 1CHGA 3UWIA 3GDVA 5DP5A 1B0EA 3NCLA 5PTPA 3ZZAA 3OTJE 2PHBA 3JZ1B 5GCHF 2FOGA 1DWCH 1SI5H 2Q6FA 5EQQA 3Q77A 1YBWA 1P3CA 1MAXA 1THSH 3ENSB 1PQAA 2A2XH 2BXTH 3MI4A 1O2YA 3PM3A 1ANBA 1W13U 1BRAA 1Y5BT 3FP8E 4FUFA 3LH1A 3M3TA 4JK6A 3SBKA 2AMQA 4OS7A 1G32B 4LZ1H 1NFWA 1PYTC 3LOXA 3K6YA 1AO5A 4I8LA 4DVAU 2FLBH 3TLOA 1XUFA 1E34B 1VITG 4BAKB 3PROA 3TK5A 2GT7A 1W8BH 2ZTXA 1D3DB 1XVOA 2FM2A 4NSVA 3A86A 1PPHE 1ZLRA 4JYUH 1EOJA 3ATMA 1A5GH 3M7QA 5A8YA 1CSOE 1GMHG 2AGIX 2FDAA 1UTLM 2VH0A 1C2EA 3DT0H 4I7YH 1B5GH 2J4IA 1O33A 3LGWA 3BG8A 1FPHH 1HCGA 5JDUB 2HNTF 2PKSC 4DT7B 1PQ5A 3SV8A 1C5ZB 1GJ5H 3GYLB 1BA8B 2GZ7A 2QV1A 4K8BA 1XUKA 1TNLA 1OWKA 5TJXA 1XUIA 2QXJA 3RLWH 4IMQA 2OC7A 1EAWA 2CJIA 1Y5UT 1LVBA 1MQ5A 2B9LA 2FWWA 3I29A 1THPB 3O8CA 1SGIB 1FJSA 2Y82A 2ZDNA 1ZSKA 4X2YA 3BV9B 4X8TH 1GBTA 3UIRA 3TGJE 4JCNA 5EODA 4IBLH 1ZRBA 1ANDA 1W3CA 1SGCA 2PKSB 4GPGA 3PV4A 3UFAA 1BT7A 1O39A 2ANKH 1EKBB 1UTQA 1BTPA 2G52A 4PROA 5LPEA 2A2QH 1G2LA 2H9TH 4OS6A 2VNTA 3B8JA 1C2LA 3M36A 4BAMB 2IN2A 1OS8A 1TMUH 2FO9A 2Z9KA 3ZVAA 4Y8ZA 4GCHF 4DIIH 5FPTA 1UHBB 1P3EA 1C5LH 4UEHH 4ZMAH 1C5VA 2GTBA 2Y6TA 1MCVA 2VIDA 3PWBA 1A3EH 1CHOF 2FTMA 2CN0H 2VIQA 1SGTA 1ELBA 2GCTC 3PTBA 3LONA 1V2NT 4FU8A 1C1SA 1QA0A 1C1NA 3BTEE 3DFLA 3M5MA 3PB1E 4BOHA 1TGTA 2A4QA 1F0TA 7ESTE 2GDEH 5CMXH 3MWIU 4HTCH 1AWHB 1WCZA 4B71A 2H9EH 4AGJA 4NIXA 1EOLA 2ALPA 3GCTF 4INKA 4ISLA 4BTUB 4NIYA 3B9FH 3FAOA 3PLBA 3FZDA 4X2WA 1FNIA 1NO9H 2FOBA 3Q00A 3RXGA 3E8LA 1UCYE 1ZZZA 2BDGA 2ODQA 1IQFA 3VB7A 2GCTB 1AFQC 4HI3A 2V3HH 5F8TA 1WV7H 3LH3A 2A1DB 2Z3CA 4U2WA 1NU7B 1XM1A 3RXUA 1IQGA 1L1NA 1VGCC 1MTNC 2ZGBH 3GY8A 3BEUA 4X6NA 3U1IB 3U8TH 4Y0YE 1GGDC 1UVPA 1HAIH 1Y3YA 1YLDA 4OGYA 6GCHF 4GHQA 1D3TB 2O8MA 4FUBA 4Y6DA 3SUFA 2ZC9H 2WUCA 1AFQB 1SBWA 2Y7XA 5JPMH 2FYRA 1O3CA 2G51A 1ZTLA 5DK1A 1HJAB 2GDDA 2PV9B 3ZVGA 3F9FA 4BAQB 3UQOA 1UO6A 2HLCA 1K1NA 1BTZA 3MH5A 3A7XA 1GHVH 1VGCB 1O36A 1MTNB 1ELEE 2EEKA 3MU4A 4B74A 4YESB 4UONA 5E0HA 5C5NA 1GGDB 1FI8A 2Y5HA 4X2XA 3KEEA 4K1SA 1O3IA 3HGNA 3RMOH 3GY3A 5E0GA 1C4V2 2GV6A 1VR1H 3P8FA 5C67A 1G3EA 1HGTH 5EGMA 2PSXA 1Z8GA 4INHA 1XMNB 1O5CB 3RXHA 1HXFH 2AYWA 4AG2A 1HV7A 2ZFSA 1LHDH 3E91A 4WH8A 2P3TB 3F9EA 1TYNA 3E90B 2TRMA 4GAWA 3RXRA 1EXFA 1TX8A 4NG9H 4ABBA 1RGQA 2G81E 2ZGHA 1ZHRA 1O3FA 1QTFA 2WV5A 5HMAA 1FUJA 3F68H 1G9IE 7GCHG 3KF2A 3SU0A 2NU4E 1P02A 3UPEA 5LPRA 1FN6A 4SGAE 3T62A 1A5IA 4K60A 3HK6B 3GY7A 4YO9A 5G4BA 2A4OA 5JYIA 2EC9H 1BJUA 1KTTB 2F83A 2AGEX 2SGPE 4XBCA 3GY6A 2BXUH 1SQOA 2EI7A 1NRSH 5ETXA 2TGTA 1O3LA 5FCRA 1GHBG 1D4PB 1O2ZA 2KAIA 3CS7A 1GI6A 1C4Y2 1NFXA 1P04A 2C8ZB 2P95A 4MTBA 3A7WA 5DP7A 4I8KA 1S5SA 1IQLA 2BD4A 3ATWA 3UR6A 1GJ8B 4NZQA 1JOUB 3V0XA 1K22H 1BMLA 2LPRA 2I6SA 3PMHB 1GHZA 4ZAEA 3C1KA 5EOKA 1IQKA 2F9BH 2O8WA 1PPEE 2GZ8A 2ZIQH 3FP6E 3MO6A 3EQ0H 2HOBA 3RXSA 4UD9H 1O2XA 3ZVFA 4AB9A 4B76A 5JBCS 3KL6A 3SN8A 1ZTJA 3GCNA 1TGCA 2UUFB 3RXBA 2ZPQA 1MMJN 5C5OA 1KDQA 4WY3A 3E0NB 1BRCE 3SV9A 1SGPE 4ABHA 2BHGA 2FODA 1P06A 2ANWA 1TBZH 3NXPA 1T32A 4INLA 2ZDAH 5DP3A 2ZFRH 5ESTE 2B8OH 2A45B 1C5TA 1TA6A 1K2I1 1AIXH 3RXAA 1GI2A 3D49H 2J9NA 2UWPA 2AH4X 3SORA 1GHAG 1F5RA 1QURH 1TLDA 1W10U 4NA8A 1FIZA 5FHTA 1J9CH 1F0SA 1C2JA 3MH7A 2ZFFH 3GDUA 2FOEA 4UFFH 5FAHA 4THNH 2G4UA 3CP7A 3M5LA 3U8RH 3KHVA 3ZV8A 1XKBC 5ABWA 1K21H 3Q3YA 1NM6A 4GUXA 4MG3A 1WBGB 4KTSA 3HATH 4AGKA 1YC0A 1GJDB 2XBWA 4YTAA 2FEQH 4KKDA 1O3EA 3A7ZA 3A85A 1ELVA 1IAUA 3M37A 4K69A 4VGCC 2BD8A 1TALA 3BEFB 1ESBA 4JZFH 1TRNA 1AN1E 2Q6DA 4NFFA 3RU4T 1Z1IA 1ANCA 3TH2H 4ZXXH 1BTXA 5SGAE 1GDNA 1D6RA 1UK4A 2BX3A 2XXLA 2BD5A 2RA3A 1PPCE 3KIDU 3ATKA 4CRGA 4BANB 5DP9A 1RJXB 2FXRA 2XC0A 1O5GH 1LKAA 4Q7YA 3SO3A 3STIA 2R2MB 2GCHF 4WH6A 4ZROA 2P16A 3U8OH 4CH8B 1TQ0B 1TX6A 3A88A 2Y80A 3RXCA 4VGCB 1W11U 5EXNA 1H4WA 1ARBA 4RN6A 1O38A 1BBRK 1GI8B 1P8VC 3M61U 4YZUA 4DOQA 1BRBE 1GJ6A 2VVVA 3V3MA 1V2OT 4CHAC 2VVUA 3LJJA 5EQSA 1G3BA 1NRQH 1O31A 5FBIA 4LOYH 3BTME 5CHAC 2RG3A 1YPJH 3DFJA 4XBBA 4YT6H 4JMYA 4CRAA 4FUGA 3FZZA 3ESTA 1PFXC 4Q7ZA 3K9XB 2ZDLA 3Q3XA 2F9OA 3RXTA 2VWMA 1EP6A 1ZMJA 5DKMA 4Q80A 3SQEE 1SLVB 1C2DA 3UR9A 2XCFA 4UE7H 4ABGA 4CHAB 2G8TA 1HAHH 1QGFA 3KQCA 1GVKB 1K28D 4DCDA 2QA9E 1GWAA 1AKSA 2A4GA 1K9OE 1HAYB 1LHGH 1AI8H 1FZZA 4Z6AH 1EATA 1KIGH 3ZZ4A 1GHYH 3QX5H 5GJ4B 3SJ9A 2ZTYA 1O2NA 1C9PA 1H8IH 4A5TS 1KLJH 2ZQ1A 1O5BB 3BIVH 1A46H 1W0YH 1NY22 2R3YA 3HPTB 3H7TA 1LQDB 1QY6A 1HAGE 1GI4A 4MPVA 1QBNA 1IQIA 4O3UA 1GMCG 3P95A 3RXIA