2FS9A

Human beta tryptase ii with inhibitor cra-28427
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta-2
total genus 48
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A01
3ELAH 2HRVA 1GJBB 1VITF 5EXNA 3TU7H 5L30H 1KYNA 2VH0A 1D3PB 3ATMA 1W7XH 4YOJA 4Q80A 4UE7H 1SQOA 1O2NA 1BHXF 3TITA 1JRTA 3SGAE 1TALA 1CT4E 1TB6H 5I25A 3I78A 4BXWA 1BTHH 2AS9A 1MTSA 1DICA 4CH8B 4TWYA 1BT7A 2AGGX 1ARCA 4JZDH 3LT3A 3G01A 1BOQA 1PPCE 5FXLA 4RSPA 1SGTA 1BDAA 1G30B 2NU4E 4DIHH 1NM6A 1V2KT 4AB8A 2QXIA 1H1BA 1YLCA 1SQAA 1HJ9A 3O8CA 1YF4A 4XBDA 3SO3A 2H5CA 1C4Y2 1IQJA 3TJVA 1C1NA 2XRCA 1O3NA 4XBBA 1BBRK 3PTNA 4JYUH 5BPEA 1ZTKA 1GCTC 5CMXH 5JBTA 1AE5A 5FPYA 4ABGA 1OYQA 1WQVH 1ZPCA 1EQ9A 3KF2A 2D1JA 1BJVA 4OS6A 3ZV9A 3SHCH 3O8BA 1O2XA 1C2DA 4KTSA 5DP4A 2FLRH 3QK1A 2BY9X 2JH0D 5TCCA 3GDSA 3E3TA 1OX1A 4FU9A 4X6MA 1J14A 9ESTA 3M3TA 4NA7A 5EQSA 3VB7A 1S84A 3M3SA 1DSTA 1WQSA 3EGKH 1GMDG 5E0HA 3RXUA 4K69A 1F5LA 4ZMAH 2Y82A 1GBLA 1E38B 1GBTA 2EI8A 5FBIA 1T32A 5CE1A 1P04A 2GCTC 1QL8A 4WMEA 3LOXA 3D62A 3SOSA 2BXUH 4AFSA 3A7XA 5E2PA 1C2KA 1P09A 2BDGA 1ZMLA 2VVCA 3MHWU 1EZXC 3KN2A 1GDQA 4H6TA 1LTOA 1IQLA 3GOVB 4Q7ZA 4TYDA 3TK9A 1EX3A 3HKJB 4Q2KA 1UK3A 3ZV8A 1S0QA 1V2UT 1LPZB 2CF8H 2OBQA 3ZYDA 3VB6A 5J4SA 1NS3A 1FIWA 2A5IA 2PHBA 1Y59T 3GICB 1SLWB 5C5OA 5ABWA 4CBNA 4DVAU 2ODPA 3P8NA 5JB9S 1H9IE 1JWTA 1ETSH 4IBLH 1L1JA 1NZQH 3RXAA 5BRRE 1IQEA 1FMGA 2V3OH 2ZTXA 1BUIA 2R3YA 1MBMA 3SQEE 1VR1H 2F91A 1HBTH 1O3AA 1KDQA 1T7CA 4YTAA 3RMOH 3S9BA 2Z9LA 4KGAA 1AVXA 1JXPA 1DUEA 3ZZDA 1HRTH 4MNWA 1D6WA 3RLYH 1P2IA 5GCHF 1SFIA 2Z3DA 2Q1JA 5E2OA 3FP7E 2EC9H 1P02A 5L2YH 1L1NA 2AYWA 1MZAA 2R9PA 1BHXB 1HGTH 2BQ6B 3SU6A 1Q3XA 1N1LA 4I8LA 4JK5A 5C5NA 5EW1H 1PPHE 4LOYH 2ZDKA 3GCOA 5L6NH 4FVDA 1YPHC 2OXSA 1SOTA 1BJUA 1XVOA 2KAIA 1YP9A 8LPRA 1ELTA 4XOJA 1A61H 1P05A 2OINA 5ESTE 4ZKOU 3M7QA 3RXBA 4O9VA 3SU2A 3H5CB 1G3CA 1LHFH 4R8TB 2BD3A 4D7GA 3E90B 1GI9B 4OGXA 3I29A 1TONA 3ZZ4A 2TBSA 1C2IA 1SGNE 1AWHB 4GAWA 1FAXA 1ZMJA 3UUZA 5FAHA 1PYTD 2JETC 2CV3A 1CGIE 1A0LA 3QDZB 2GMTB 1VGCB 1WV7H 1C5NH 1ZMNA 1LVOA 2GMTC 4YM9A 1G9IE 1SGPE 1GL1A 2PUQH 4TWWA 5EQQA 4A1XA 4IMQA 3QTVH 1L1GA 1P3CA 1FV9A 2V0BA 1NU7B 1EZQA 5E0GA 3GY8A 2BHGA 3RC6A 4ABEA 3TH3H 3LJJA 3T62A 4LZ4B 3TIUA 4PROA 1OSSA 2F3CE 3ATWA 2BZ6H 4A7IB 2PGQB 1OP8A 1SBWA 1GHBF 4FVBA 2C93B 2SGPE 1WYKA 1XUIA 2A2QH 3V0XA 1AFQC 2WV4A 1VCPA 3U8RH 4U2WA 2QXGA 4TPYA 4H4FA 2ZHWH 4CRBA 1GMCG 1NFUA 1HAPH 1OWEA 1A5IA 2WPJS 7GCHG 1G37A 1C4V2 1XM1A 4AFZA 2DE9A 4IC6A 3M36A 2PUXB 3PMBB 1QHRB 2GZ9A 3VB4A 3A89A 3Q3XA 2ZQ1A 3RU4D 1WCZA 3IITA 3SV8A 3AW1A 2BLOA 4AOQA 3RM0H 3SU5A 3AAVA 5ETXA 4I7YH 2PKAB 3D23A 1GJDB 1XX9A 3BEFB 4NCYA 5AHGH 1CA8B 1E0FD 1QB6A 1S85A 2HGTH 5EOKA 4I8JA 2H6MA 1BMAA 4K8BA 3ITIA 1O32A 4Y10E 1OYTH 3TGJE 4TY7A 3SNEA 4Y0ZE 1YLDA 2QA9E 1LKAA 3U98H 4E7NA 3BTEE 2ALPA 2ZDLA 3SHAH 3SN8A 2ZFTA 4ABIA 2C8ZB 1A2CH 1OWJA 4UD9H 1V6DA 1AZZA 4BOHA 1P2OA 2P93A 2AEIH 1LPGB 1A5GH 2ZGJA 2ZPSA 1PQ7A 3V12A 1RS0A 3UPEA 5DJ7A 4DT7B 2Z94A 3QGNB 1QIXB 4NWLA 1SR5C 2R2MB 1FUJA 2BD2A 1C5OH 1NT1A 5IYTA 2XCNA 1OWHA 5AF9H 3RDZA 3TNTA 1TYNA 1DWEH 1Z8IB 1H9HE 2F9OA 4I8KA 5A09A 1HAOH 1KSNA 3PWBA 4O3UA 1K1IA 2GZ7A 2WPLS 3VB3A 2XCFA 4K1EA 1C5VA 2OLGA 4M7GA 1BRAA 1Z1JA 1IQIA 4ISOA 1V2MT 2AH4X 3BEUA 5F8ZA 1EASA 2GT7A 2PKSC 3LGYA 3RMMH 1O3PB 1C5UA 2VJ1A 4THNH 1RRKA 2YNAA 2PKSB 1FN8A 3KCGH 2PGBB 1Z7KA 3DUXH 1N8OB 3MYWA 2PSXA 1U6QA 1YCPK 3U8OH 2FS8A 4OS4A 1E35B 2A5KA 3SUEA 1TX7A 4I31A 3SQHE 1ZSLA 2A32A 1AMHA 3RXKA 3PTBA 1G36A 1UTOA 3S7HB 3QGJA 1JRSA 2BD7A 1EAWA 3SV7A 3ZVEA 4GUXA 1SPJA 3EDXB 2WPHS 5EXMA 1B0FA 4X6NA 4JZEH 1Z1IA 1P2KA 2P94A 3MNSA 3LGUA 1J15A 2C4FH 2QCYA 1TNIA 2EA3A 1M9UA 1BBRH 4AB9A 1QR3E 3FZDA 3JZ2B 1HAVA 1KXFA 1BTZA 1KY9A 1V2VT 4DCDA 5E8EH 2UUFB 3BTDE 3RXPA 1QNJA 1NRQH 8GCHG 4ZXYH 1T4UH 1IHTH 3AVZA 2HNTC 1UTMA 3RC5A 1N6YA 3M37A 1T8MA 3M5NA 3SUFA 3LONA 1ZOMA 2TGAA 3GCTF 2G4TA 5AFZH 2P95A 2HLCA 4KTCA 1ZJDA 1F0TA 1PQAA 4XE4A 4X2XA 2XNIA 1BMMH 1AZ8A 1AGJA 1EB1H 2F83A 1ANEA 2BVSH 1ARBA 2O8LA 1Y3WA 1IQFA 2QIQA 4MDSA 1MTNC 1NO9H 1VCWA 1HPGA 2Y80A 1P2MA 2ZIQH 1TFXA 3KQCA 1KXDA 2ULLA 1S6HA 3P70B 3GCNA 5LPRA 3Q76A 2OC7A 2FTLE 1NRNH 2GTBA 2FIRH 1D9IA 1Y5AT 3SZNA 1TMUH 3TH2H 5LPFA 1RTLA 3TJOA 1OXGA 3R0FA 1TABE 4H6SB 1UTJA 4WMDA 3SNDA 1C2JA 3B23B 1ZTLA 5LGOA 3KEEA 3ZZ7A 2B9LA 2OTVA 4UFGH 5EODA 3ZVDA 4B76A 2P8OB 5A8ZA 3VFEA 1C5LH 1BRUP 2FX4A 2QGRA 4Y11E 1E36B 3BTME 1TNJA 1E37B 1AHTH 2H2ZA 3ZZ5A 3A81A 4MPUA 3E16B 1MKWH 2JH5D 2WUCA 2QAAA 5JPMH 1W3CA 2G55A 3EA8A 2UWOA 1AVWA 2CJIA 1QBOA 2VNTA 3PV4A 3URDA 2P3UB 4AN7A 1V2TT 4DOQA 5EPYA 5CHAB 2B5TB 5TCAA 1F92A 1MKWK 1UK2A 1ABIH 1C5WB 5CHAC 1TX8A 3SJ9A 1YPKH 3STIA 2J2UA 1BA8B 1NN6A 1C1MA 2O8WA 1N8OC 1BB0B 2RCEA 1GMHF 1GBJA 1G3DA 4GPGA 1TMTH 1JOUB 5EXLA 1HJ8A 1DX5M 2GDDA 1BTWA 1QTFA 4BAQB 2VGCB 2SGQE 1OPHB 4VGCB 2A7JA 4BNRA 3HK3B 3UQVA 2VWNA 2GZ8A 4UFEH 5GPIB 1W14U 4E06H 4WJG2 1HCGA 1QA0A 2AIQA 3GDUA 1N6XA 1CBWC 3BTGE 5GCHG 1ESTA 5SGAE 1BTXA 2B7DH 2ZEBA 4ZHLU 1P06A 1SGFA 1GHYH 2W5EA 4B71A 1SGRE 2FX6A 1UVUH 2FOFA 4FUGA 1P9UA 3E91A 1GDNA 2ZG0H 3Q77A 3SV2H 2QYIA 4X2VA 1GJ8B 5HYOA 2CHAC 3K65B 1Z6EA 1NESE 2WPIS 5GIBA 1SHYA 5FPTA 5FPSA 1O38A 1Y5BT 4YT6H 2BDHA 4GLYA 3KGPA 4BAHB 2HPPH 4J2YB 3A80A 4AFQA 1O5BB 2Q6DA 2GD4B 4AYVB 3MU5A 4RKOB 4ZAEA 1ORFA 1DSUA 2ZU1A 4NGAH 1O2ZA 1HB0B 1O36A 1HAHH 1GI8B 4MPVA 4NIWA 2W26A 4U01A 1GHAG 1QCPA 1YPJH 1LO6A 2OUAA 3PLPA 3SV6A 2H9EH 5PTPA 1MQ6A 1GJ7B 4DJZB 1L2EA 1IQNA 1ZSJA 1BMLA 2G00A 4ZHAA 1W0YH 3NWUA 1CO7E 2OC0A 3PMHB 3P8GA 3LGIA 1GHWH 2QV1A 1UCYK 1PJPA 1TGBA 4BAOB 2DE8A 2TRMA 1KTSB 3SUDA 1O2HA 3ZZAA 4BXSA 3LKWA 4X1NU 5EG4A 2ZFSA 2ASUB 4NSVA 4ZUHA 3L6PA 3SI3H 3P8OA 1AO5A 2ZGCA 2VINA 1C5TA 1Y3XA 5C67A 1SOZA 4HGCA 2UWPA 3GY3A 4IN2A 4NIYA 3U69H 3ZZCA 3M5LA 3EA9A 4X1SU 1KXCA 2TIOA 4J1YA 1GL0E 1P12E 2GV6A 1JBUH 4X6OA 1MU6B 4NZQA 1FN6A 2ZU4A 4INKA 2J92A 4MNYA 1O2JA 1S5SA 4NA9H 1A0JA 1C9TA 1C5RA 1EP5A 1IQMA 3F9FA 5I46H 1INCA 1O3DA 4GHQA 1K21H 2TGPZ 3GCHB 1UMAH 3A85A 5GDSH 1P10A 2ZDNA 3QN7A 1GCDA 1EAXA 2A2XH 2BD8A 3DT0H 4A1VA 3F9EA 1O37A 3PM3A 2Z9KA 1HAGE 1TQ7B 2FOCA 2BY6X 3Q00A 4X1QU 1O3EA 1O3MA 2ZGHA 2BXTH 2FPZA 3QLPH 1BTUA 1UO6A 2WYGA 1C5ZB 1Y8TA 4WF8A 4LZ1H 1OOKB 2ZHEH 1SLUB 1NC6A 1DXWA 1C1WH 2J94A 2BD5A 1DDJA 3H7TA 3LC5A 4CR5A 2XC5A 5G4BA 3UIRA 1O35A 3RXLA 1VJ9U 1V2QT 4UONA 3VXEH 1TNLA 1P9SA 1FPHH 2AFQB 2R0LA 4ISNA 4A92A 2QF0A 2VIQA 1GHAF 1QA7A 1LHGH 1TLDA 3E1XB 2BMGB 1L0ZA 2I6QA 1SGFG 4ISHH 5EW2H 5T3HA 1V2LT 2M5TA 1WAYB 2ZECA 1UVTH 5LH8A 1HFDA 1Z8JB 1AUTC 4BTUB 1FIZA 3OU0A 2Z7FE 2ZGXH 1A1RA 1LDTT 2ZA5A 3LH1A 1MCVA 2XC0A 3BTFE 2YOLA 3STJA 2RA0A 2Q6GA 3M5OA 1YPLH 4GSOA 3RXJA 1VITG 2VIVA 4K1SA 1GJ9B 1TPOA 3GY6A 1AFQB 1GBBA 1T8OA 1ZLRA 1TA6A 3ESTA 5FBEA 2ZC9H 2A5AA 1BRCE 4E05H 4ABJA 2XWBI 3LH3A 2ANWA 1OP0A 5AVDA 1C2MA 1FQ3A 2G5NA 2FODA 3RMLH 2SGAA 1GVZA 2ZPQA 1SSXA 3ZZ9A 3RU4E 2G81E 2FOAA 1QQUA 3A83A 1EJNA 3MOCA 1TNGA 3MU0A 4X8VH 2ESTE 2AMDA 4X8TH 3RXEA 1ZHMA 1P2NA 1O31A 2A7HA 1PFXC 2XWAA 3GY2A 2PTCE 2ZI2H 4YT7H 4YOGA 3S9AA 4U32A 5JDUB 3RP2A 4B2BA 3OYPA 1VZQH 1WU1A 1QB1A 3RMNH 1MD7A 3UFAA 1IHSH 2IPHA 3E8LA 1O33A 1GBAA 4MG3A 1GHVH 2GVFA 1SLXB 3A7TA 1C2GA 3IG6B 3A84A 1NFWA 4AGKA 2STBE 1THSH 1TRMA 3S7KB 1W8BH 5GJ4B 3RXOA 1SB1H 4Z0KA 1XUFA 1QFKH 4MVNA 3QTOH 1KLTA 1Y3VA 1H8DH 1UJ1A 3KQEA 1G2MA 2ZQ2A 1PPGE 4IW4E 2BLWA 4ISIH 2HNTF 4Q7YA 4XSKU 1FY1A 1V2RT 5E0JA 1DY8A 1D4PB 3MH4A 3SGBE 2HNTE 1Z8RA 3AW0A 1O2WA 2Z9IA 2IOTA 2IN2A 4JZFH 2XBWA 2R3UA 1KLJH 1H8IH 1PQ8A 2VIOA 2Q6FA 1LHDH 3BG4C 1O5CB 2VWMA 1TPAE 1K22H 1SGEE 1C4U2 1DM4B 1ESBA 1TNKA 3RXCA 1A7SA 1V2WT 1O2GH 5J4QA 3BG4B 1GJ6A 3UWIA 2BDYA 1QJ7B 3V13A 2AGEX 2P59A 2FOHA 2FZZA 4NA8A 2OP9A 5B6OA 1O2QA 3K6ZA 2WYJA 2G51A 3GDVA 1SGQE 5DP8A 4X6PA 1NFYA 1UTQA 1YM0A 1EPTB 1NU9A 1UVPA 4ASHA 3MI4A 1GVLA 1W12U 3PMJA 2YNBA 1ESAA 1GVKB 3RXTA 2I6SA 1CGJE 2D26C 3KIDU 1O0DH 4O03A 3RXSA 1GBEA 1MAYA 3SU0A 1HJAB 1KLIH 1EUFA 4YZUA 5DP9A 1F2SE 1AUJA 3LPRA 1IQKA 2W3IA 1EAIA 1HJAC 2H9TH 1FY5A 3P8FA 1CE5A 1T8NA 5EU8A 1NRRH 5C1XA 4WXIA 1NFXA 2G52A 1FLEE 2ZCKP 3SNBA 3MNCA 1XUGA 1XUHA 3TH4H 3ZZBA 8GCHF 1DWCH 5L2ZH 4DG4A 3O8DA 1KXEA 4BTIB 2NU0E 4NIVA 1GHBG 1W0ZU 2VWLA 1GG6B 2ILNA 3RM2H 2F9UA 3DFJA 3Q3YA 1HIAA 3K9XB 4OS5A 1O3KA 3SV9A 1SMFE 4ZH8A 3UOUA 2FOMB 1G32B 1UHBA 5A0BA 2Z6BD 2OBOA 1RGQA 4O3TA 1AI8H 1O2OA 1ZSKA 3ZVFA 1WSSH 2QF3A 3U1IB 1EKBB 1B7XB 1DFPA 1HAVB 2XC4A 3SU1A 2AGIX 2ANKH 3KQDA 1FJSA 3BIUH 3FP6E 3TNSA 3PO1B 4H42U 1MAXA 1AN1E 1V2NT 5JBAS 3SW2B 4A1TA 3LC3A 1QRWA 2D8WA 6ESTA 1TWXB 1TRNA 2Z9GA 4CRDA 3DA9B 1EPTA 1QRZA 2GP9B 3CP7A 5FX6A 3ZVGA 2J9NA 1ELDE 2A4GA 1C1UH 3A88A 4WWYA 1HAXB 5ESBA 2AIPA 4ABHA 1DWBH 2THFB 2BZAA 3L3TA 4FU8A 3BSQA 2C3SA 3RXMA 4FUEA 2W7UA 4WVPE 1C1PA 2P8OC 3EE0B 3OTJE 6GCHF 2NU3E 4WY3A 3NCLA 4OS1A 1IQGA 3RXDA 1EJAA 1GI2A 2WUBA 2BX3A 2VWOA 1SGCA 4IGDA 1QJ6B 2ZFQH 2F9VA 1YPGH 3NUMA 1K1MA 1S81A 3FP8E 3VXFH 4MQAA 5FCKA 2GCHG 1SL3A 3UNQA 1XXDA 2GKVE 3MO6A 1C5PA 3ENSB 1LQEA 1HAZB 1YKTA 2BDIA 3ZYEA 3V7TA 1T31A 3MH6A 3MH7A 1HIAB 4X2WA 1ZJKA 5A8XA 1HDTH 1BBRE 3PB1E 2SNWA 3T29A 3U8TH 1TOMH 1ZTJA 3OY5U 1CHOG 1XKBC 1ZRKA 1EAUA 4FU7A 4RKJB 1PYTC 6CHAB 1C1QA 1JMOH 2VIWA 1OWIA 1EZUC 1O2VA 1QURH 3ZVCA 2PTNA 1MTUA 2HPQH 2ZHQH 6CHAC 1P3EA 3S69A 2P3TB 1ZYOA 4YOIA 3TK6A 4GVUA 1YGCH 2BY8X 2WPKS 3T27A 3RC4A 2PW8H 3UNSA 3UY9A 1GJ5H 4ZXXH 3UNRA 3A8AA 4I32A 4WMFA 2P3FH 2AERH 2EEKA 2ZFRH 2OC8A 2J38A 3T28A 3KNXA 1ZHRA 4Y8XA 2G8TA 2ODYB 1ZHPA 4MLFB 5TJXA 1F0SA 5C20A 1OWKA 1YC0A 1AVGH 2B8OH 3F68H 5GXPA 3SNAA 5F6MA 2FTMA 4MTBA 1RFNA 1V2JT 3C27B 1OS8A 2ZTYA 1AE8H 4Y7BA 2WPMS 3SJKA 1TMBH 2OCVB 3O8RA 7GCHF 3A7VA 1DANH 1TQ0B 4X8UH 1A0HB 4GCHG 2P16A 1GG6C 3A8CA 2C90B 2CHAB 4NSYA 1O2RA 2UUKB 1F0UA 2TGDA 1YCPH 3T5FH 1DXPA 5FX5A 3T26A 5JBCS 1AKSB 1MCTA 1LVBA 4X1PU 4XFQA 3RXVA 1BTPA 1AQ7A 2ZPRA 3TLOA 1BCUH 3LJOA 2UWLA 4DGJA 4ESTE 1MBQA 1GGDB 1QL7A 3PO1C 1C1VH 4IS5A 1J8AA 3BEIB 1J9CH 3ZVAA 3U9AH 2PKAA 1LVMA 3UQOA 1MMJN 1O39A 1MTNB 4Y79A 1SQTA 5DP3A 1RIWC 2A4QA 2AMPA 1HXEH 1Y3UA 1PPEE 1O3GA 2ANYA 4JMYA 3D65E 2VVUA 1YCPM 2GCHF 3T25A 1VCQA 4INLA 3FAOA 1DOJA 1FY8E 4UDWH 2H5DA 1BTYA 3RXQA 1GBKA 1UTKA 2Y5FA 1GI3A 5T6GA 3W95A 1FDPA 2PFEA 1O2LA 5DP7A 2HVXA 1FY4A 2R0KA 3KQBA 2LPRA 1NRPH 4Y8YA 4B75A 2ALVA 1ZRBA 2PV9B 3DD2H 3A7ZA 3SJIA 2BLQA 4CR9A 1EJMA 1TPPA 2Y6TA 1EB2A 2SGFE 3GY7A 3V3MA 1W2KH 2HWLB 2ZZUH 3QWCH 1ELEE 1RXPA 1Z6JH 3MO3A 4SGAE 3RXRA 1K9OE 2XYAA 3GCHC 3PROA 5HMAA 2FYRA 3A7WA 1JIRA 1DY9A 4A5TS 3E0NB 2XTTB 1AKSA 1GBDA 4X8SH 3NXPA 2ZDAH 1ZPBA 3LGTA 1CT2E 1F0RA 2VVVA 1S82A 3QUMP 2K1QA 2ZCHP 2BLVA 4I8HA 3TGIE 3L33A 1WUNH 1YPEH 4CRCA 1O3IA 4TY6A 2GCTB 1TA2A 5C1UA 5DGJA 4Y7AA 2XXLA 3RLWH 1FNIA 1P8VC 1AIXH 1LQDB 5EGMA 4AYYB 3MWIU 3UREA 1P01A 4F49A 5EQRA 2VGCC 1ZZZA 1CGHA 4AG1A 1ZPZA 2ZGBH 1Z8GA 5IDKA 3JZ1B 1GBCA 3MH5A 3LDXH 3VEQB 1A5HA 1ACBE 1Q2WA 3TPIZ 1CBWB 1O2UA 2BQ7B 1NROH 3R3GB 1GBMA 2ZDVH 3NKKA 2SGDE 3S0NA 5GWZA 3E6PH 4UEHH 1QY6A 4R0IA 4D9RA 1G3EA 1O2MA 2A4RA 1C1RA 1CSOE 2GGVB 5T6FA 2Z9JA 1A46H 3ODFA 3FANA 1O30A 1K2I1 3PWCA 1NTPA 1ETRH 4I33A 1CHGA 4LXBH 7ESTE 1X7AC 3TK5A 6GCHG 2FMJA 2FDAA 1O3FA 1RJXB 2QY0B 1EXFA 2C8XB 2A31A 3MNBA 2KAIB 1QRXA 1EP6A 4AORA 4NFFA 2STAE 2LNCA 4FUIA 3LGVA 2FLBH 1C2FA 5F8TA 4CRFA 5DG6A 2BX4A 3M7UA 3P6ZB 1C1OA 3PYHA 1Z71A 1K1OA 2RDLA 1ID5H 3I77A 3GY4A 3E0PB 4ZROA 2R2WU 1E34B 3HGPA 1CHOF 2VH6A 1YBWA 2SGEE 2FESH 2FOGA 3SJ8A 1V2OT 3U1JB 3PLBA 2CF9H 4BANB 4DURA 1EZSC 1P57B 1SGYE 1UHBB 3SNCA 4A6LA 4AFUA 2QC2A 3RU4T 4CHAB 1O3JA 1GJAB 1DVAH 4AZ2B 3OX7U 2BY5X 3FFGA 4UFFH 2JETB 4CHAC 1DLEA 1CU1A 3M3VA 1F5RA 1VGCC 3BIVH 1FY3A 2EI7A 4Y76A 2CN0H 1MTVA 4Z6AH 1WTHD 2O8TA 2BQWB 1GI5A 2OQUA 2UUYA 3HGNA 1TBZH 3KL6A 1P2QA 1OWDA 1GCTB 3MU8A 2A0QB 2FOBA 1TIOA 5C3NA 3GYMA 1D3TB 1ELVA 2GT8A 5HM9A 4FXGH 3IWMA 2PLXA 1UVOA 2A4OA 1TE0A 1ELBA 1BIOA 3EAJA 4K2YA 3P92A 1GBFA 4GCHF 3EYDA 1GI7B 3W94A 1LCYA 3F1SB 1WOFA 2BY7X 1SC8U 1T8LA 1GBHA 1UTPA 2ZHDA 3UWJH 1P2JA 2VIPA 2BB4A 4HZHA 3AAUA 1UTLM 3NZIA 4SGBE 1UVSH 1P03A 1K1PA 3ZVBA 3N7OA 1NRSH 2FI5E 2ODQA 3TGKE 1ANCA 4KKDA 2FEQH 3PLKA 2W7SA 1UCYE 4D9QA 3ATKA 4FUFA 2ZP0H 3FVFB 4IN1A 1C1TA 4K3JA 3BTKE 4NFEA 5JB8S 2XBYA 3HPTB 2ZWLH 3GYLB 1CA0C 2NWNA 2FOEA 2V3HH 1Y5UT 1T4VH 1OKXA 4B2AA 2O9QA 2V6NA 2HOBA 2WV5A 1A4WH 3RXHA 2BM2A 2GDEH 2SNVA 2A1DB 1FAKH 1CA0B 1KTTB 1W10U 3A8DA 8ESTE 2BDBA 1THRH 5A0AE 1BQYA 1JIMA 2RA3A 1BMNH 1DLKB 1C5XB 1H4WA 1LPKB 1SHHB 3MU4A 1LVYA 2Y5HA 1GI6A 4CREA 1K28D 3QX5H 4MNVA 4YLQH 1UK4A 2OD3B 1C5MD 1XXFA 2RG3A 1V2PT 3F9HA 1O2PA 1ELFA 1O5GH 3M5MA 4QT8C 2OQ5A 2QN5T 2CMYA 1O2KA 1QL9A 4K1TA 1H9LB 2FS9A 1TX6A 1O3LA 3GISB 5T6DA 1MKXH 1QBVH 3VPKA 1K1JA 3RUOA 2CXVA 5A2MH 8KME2 1KDQB 4UFDH 1GHZA 3BTTE 5A8YA 2VIDA 4CBOA 4ABDA 1C2LA 4XBCA 4AG2A 1HUTH 1AY6H 3BTQE 1J17T 3MNXA 1HV7A 3QZRA 5HM2A 5K0HA 1MH0A 1L4DA 4DY7B 3GY5A 1Y3YA 1ELCA 2FI3E 3NK8A 3OY6U 1DUAA 2TPIZ 4CRGA 3TJNA 1AU8A 5HXFA 1A3BH 1K1NA 1MZDA 4ZHMU 1O3BA 1S0RA 3BN9A 2GX4A 5DPAA 2NU2E 2XBVA 3FZZA 1WTGH 1EATA 3QO6A 1GI4A 1K1LA 5C1YA 3SJOA 4ABBA 1ABJH 2F9NA 2A7CA 2BD4A 1ELAA 3BF6H 3F6UH 5DK1A 1TGSZ 4BAKB 4WXVA 1DT2A 1TAWA 2VU8E 1LHCH 1MQ5A 1MUEB 2IJOB 2ZKSA 3BTHE 5FHTA 3SBKA 3QZQA 5JYIA 2BVXH 4B2CA 1W13U 2D2DA 3K6YA 3P17H 2ZFFH 1XKAC 1C9PA 1SG8B 4KELA 3MMGA 4MPXA 2AMQA 2BD9A 2ZCLP 4Y6DA 1OP2A 1XVMA 1MD8A 1O5DH 4FUDA 2UUJB 1DITH 3UR6A 1CVWH 1S6FA 1BITA 1LMWB 3DHKH 4NZLA 1O34A 3T2NA 1O3OA 3PMAB 5H4IB 1RTKA 1QBNA 2C8YB 4FUBA 2ZO3H 2CGAA 2J34A 4HI3A 2PR3A 1FXYA 2BYAX 3SUGA 3A87A 1O2TA 2ZU5A 1CQQA 4U30A 4B1TA 4DW2U 1HAIH 1AD8H 3GCTG 1GJCB 1SI5H 3NPSA 3AASA 5K7RA 1O3HA 3WY8A 1DPOA 1SGDE 1WBGB 2JKHA 3OSYA 3HK6B 3LIWA 1SGIB 4JZ1A 1ZR0A 1EPTC 1HNEE 3A86A 5C2ZA 9LPRA 2BOKA 1QB9A 2ANMH 4BTTB 1G2LA 1XUJA 3M7TA 4JCNA 1TGNA 5DP5A 3TJUA 3KHVA 4HFPB 1TBRH 1TOCB 4FUHA 4AX9H 1XMNB 3EQ0H 3UR9A 6LPRA 2BOHB 2B0FA 1QGFA 1TBQH 2FYQA 1B0EA 4IC5A 2G5VA 4YLUA 1DWDH 3MTYA 4WH8A 1C2HA 2BTCE 2J95A 1D6RA 4XDEA 3ZZ8A 1LHEH 4NG9H 2FM2A 4KP0A 3B8JA 1AB9C 3RXIA 1V2ST 2FP7B 2ZTZA 1SVPA 1GPZA 3ZZ3A 1D3QB 2Y7ZA 3MU1A 3HKIB 3M35A 1AB9B 4DIIH 5FCRA 2DUCA 2ZFPH 1J16A 7LPRA 1GWAA 1TRYA 3P95A 3LU9B 1MU8B 3A7YA 3BV9B 3MO9A 5EPNA 3SU4A 1BRBE 1KXBA 1O2YA 1EOJA 1RTFB 1FZZA 2GV7A 1GI0A 1DS2E 3SGQE 1NY22 1SFQB 1GDUA 3CENA 4TPIZ 1ZGVA 1IOEA 4O97A 4OS7A 4Q7XA 3VGCB 3K2UA 1P11E 1GGDC 1W11U 2EI6A 1KXAA 4E7RG 4OGYA 1PPFE 3S9CA 1QQ4A 2NU1E 2WINI 1S83A 1HLTH 3ATLA 2Y7XA 5AFYH 3SI4H 2TGTA 1O5FH 3SORA 3EA7A 5DO4H 4B74A 1GBIA 4ABAA 3LGWA 4ISLA 1C5SA 1YYY1 2FWWA 4HTCH 1RIWB 3B9FH 1GMCF 1AWFH 4JYVH 1AFEH 1ANBA 1ANDA 5F03A 3F9GA 1L4ZA 3BG8A 1HXFH 2ZU2A 4NWKA 2V35A 2XBXA 4VGCC 2BDCA 1O5AB 5A0CA 1THPB 1GMDF 1Q31A 3D49H 1FPCH 4WH6A 4JZIA 7KMEH 2JH6D 1FONA 4CRAA 4IMZA 1QJ1B 1LKBA 1PPZA 4KTUA 4ZKRU 2Y81A 2O8MA 2F9PA 2BDAA 2F9BH 4CH2B 4Y71A 1GJ4H 2OC1A 3A82A 4INHA 1HYLA 1TNHA 1SLVB 1O3CA 1C1SA 1P0SH 4X2YA 2O8UA 4FUJA 1DE7H 4ABFA 4D8NA 4OS2A 1FI8A 3RXFA 4AGJA 4NIXA 4RN6A 2HALA 4BAMB 1YPHE 4Y0YE 1F7ZA 1ELGA 4ZKNU 4FUCA 2H9HA 2VB0A 2QXHA 4JYTA 2Y5GA 1B5GH 1CT0E 3TVJB 3ODDA 3VB5A 2ZF0H 2SFAA 1UCYH 4K8YA 1C5YB 2FO9A 5DP6A 2C8WB 5F8XA 1UTNA 4K5ZA 3HATH 4YO9A 1ZGIA 4X1RU 1TGCA 3CS7A 4X0WU 1D3DB 5HGGA 4F4OC 3RXGA 1VITH 1C2EA 2J4IA 4K60A 2FI4E 5JBBS 2A45B 3C1KA 3ATIA 4D76A 2QXJA 4LK4A 1IQHA 1YPMH 2G4UA 1A3EH 1O5EH 2ZHFH 3M61U 1MKXK 2ZDMA 3UOPA 1V3XA 1PPBH 1G3BA 1IAUA 1TPSA 1PQ5A 1VJAU 1TGTA 4MNXA 1ETTH 4Y8ZA 3BTWE 4YESB 1KIGH 1MTWA 4JK6A 3A8BA 3SU3A 1O2IA 3Q3KA 2Z3CA 1C5QA 2W3KA 2Z3EA 1RD3B 4I8GA 4ZKSU 1GHXH 2PWXA 1NPMA 1HAYB 2FXRA 2ZNKH 4MPWA 2XW9A 2PSYA 1F5KU 2ZU3A 1XUKA 4B73A 2H1UA 3MFJA 3CS0A 1W7GH 3ZZ6A 4D7FA 5DKMA 1GI1A 1GMHG 3DFLA 1O2SA 1EOLA 5LPEA 3VGCC 3UTUH 4GHTA 3H7OA 3URCA 1BZXE 2BVRH
chains in the Genus database with same CATH superfamily
1WDIA 3ELAH 2HRVA 2KR7A 1GJBB 1VITF 5EXNA 3TU7H 5DSFA 5L30H 1KYNA 2VH0A 1D3PB 3ATMA 1W7XH 4YOJA 4Q80A 4UE7H 1SQOA 1O2NA 1BHXF 3TITA 1JRTA 3SGAE 1TALA 1CT4E 1TB6H 3KYGA 5I25A 3I78A 4BXWA 1BTHH 2AS9A 1MTSA 1DICA 4CH8B 4TWYA 1BT7A 2AGGX 3F3BA 1ARCA 4JZDH 3LT3A 3G01A 1BOQA 1PPCE 5FXLA 4RSPA 1SGTA 5F53A 1BDAA 1G30B 2NU4E 4DIHH 1NM6A 1V2KT 4AB8A 2QXIA 1H1BA 1YLCA 1SQAA 1HJ9A 1S6LA 3O8CA 1YF4A 4XBDA 3SO3A 2H5CA 1C4Y2 1IQJA 3TJVA 1C1NA 2EY4C 2XRCA 1O3NA 4XBBA 1BBRK 3PTNA 4JYUH 5BPEA 1ZTKA 1GCTC 5CMXH 4ASUD 5JBTA 1AE5A 5FPYA 4ABGA 1OYQA 1WQVH 3OE7D 1ZPCA 1EQ9A 3KF2A 2D1JA 1BJVA 4OS6A 3ZV9A 3SHCH 3O8BA 1O2XA 1C2DA 4KTSA 5DP4A 2FLRH 3QK1A 2BY9X 2JH0D 5TCCA 3GDSA 3E3TA 1OX1A 4FU9A 4X6MA 1J14A 9ESTA 3M3TA 4NA7A 3FN8A 5EQSA 3VB7A 1S84A 3M3SA 1DSTA 4XD7D 1WQSA 3EGKH 1GMDG 5E0HA 3RXUA 4K69A 1F5LA 4ZMAH 2Y82A 1GBLA 1E38B 1GBTA 2EI8A 5FBIA 1T32A 5CE1A 2HVYB 1P04A 2GCTC 1QL8A 4WMEA 3LOXA 3D62A 3SOSA 2BXUH 4AFSA 3A7XA 5E2PA 1C2KA 1P09A 2BDGA 1ZMLA 2VVCA 3WW7A 4Q63A 3MHWU 1EZXC 3KN2A 1GDQA 4H6TA 1LTOA 1IQLA 3GOVB 4Q7ZA 2YMSC 4TYDA 3TK9A 1EX3A 3HKJB 4Q2KA 1UK3A 3ZV8A 1S0QA 1V2UT 1LPZB 2CF8H 2OBQA 3ZYDA 3VB6A 5J4SA 1NS3A 1FIWA 2A5IA 2PHBA 1Y59T 3GICB 1SLWB 4I86A 5C5OA 5ABWA 4CBNA 4DVAU 2ODPA 3P8NA 5JB9S 1H9IE 1JWTA 1ETSH 4IBLH 1L1JA 1NZQH 3RXAA 5BRRE 1IQEA 1KMHB 2QE7D 1FMGA 2V3OH 2ZTXA 1BUIA 2R3YA 1MBMA 3SQEE 1VR1H 2F91A 1HBTH 1O3AA 1KDQA 1T7CA 4YTAA 3RMOH 3S9BA 2Z9LA 4KGAA 1WXRA 1AVXA 1JXPA 1DUEA 3ZZDA 1HRTH 4MNWA 1D6WA 3RLYH 2LELA 1P2IA 5GCHF 1SFIA 2Z3DA 2Q1JA 5E2OA 3FP7E 2EC9H 1P02A 5L2YH 1L1NA 2AYWA 1MZAA 2R9PA 1BHXB 1HGTH 2BQ6B 4RT1A 3SU6A 1Q3XA 1N1LA 4I8LA 4JK5A 5C5NA 5EW1H 1PPHE 4LOYH 3FOAA 2ZDKA 3GCOA 5L6NH 4YXWD 4FVDA 1YPHC 2OXSA 1SOTA 1BJUA 1XVOA 2KAIA 1YP9A 5HIYA 8LPRA 1ELTA 4XOJA 1A61H 1P05A 2OINA 5ESTE 4ZKOU 3M7QA 3RXBA 4O9VA 5GNDA 3SU2A 3H5CB 1G3CA 1LHFH 4R8TB 2BD3A 4D7GA 3E90B 1GI9B 4OGXA 3I29A 1TONA 3ZZ4A 2TBSA 1C2IA 1SGNE 1AWHB 4GAWA 1FAXA 1ZMJA 3UUZA 4XRNA 1PYTD 5FAHA 2JETC 2CV3A 1CGIE 1A0LA 3QDZB 2GMTB 1VGCB 1WV7H 1C5NH 1ZMNA 1LVOA 2GMTC 4YM9A 1G9IE 1SGPE 1GL1A 2PUQH 4TWWA 5EQQA 4A1XA 4IMQA 3QTVH 1L1GA 1P3CA 1FV9A 2V0BA 1NU7B 1EZQA 5E0GA 3GY8A 2BHGA 3RC6A 4ABEA 3TH3H 3LJJA 3T62A 4LZ4B 3TIUA 4B6EA 4PROA 1OSSA 2F3CE 3ATWA 2BZ6H 4A7IB 2PGQB 1OP8A 1SBWA 1GHBF 4FVBA 2C93B 1E1QD 2SGPE 1WYKA 1XUIA 2A2QH 3W1EA 3V0XA 1AFQC 2WV4A 3PRDA 1VCPA 4P02A 3U8RH 4U2WA 2QXGA 4TPYA 4H4FA 2ZHWH 4CRBA 1GMCG 1NFUA 1HAPH 1OWEA 1A5IA 2WPJS 3GS9A 7GCHG 1G37A 1C4V2 1XM1A 4AFZA 2DE9A 4IC6A 3M36A 2PUXB 3PMBB 1QHRB 2GZ9A 3VB4A 1OHHD 3A89A 3Q3XA 2ZQ1A 3RU4D 1WCZA 3IITA 3SV8A 3AW1A 2BLOA 2WSSD 4AOQA 3RM0H 3SU5A 3AAVA 5ETXA 4I7YH 2PKAB 3D23A 1GJDB 2K0QA 1XX9A 3BEFB 4NCYA 5AHGH 1CA8B 1E0FD 1QB6A 1S85A 2HGTH 4FETA 5EOKA 2OK5A 4I8JA 2H6MA 1BMAA 4K8BA 3ITIA 1O32A 4Y10E 1OYTH 3TGJE 4TY7A 3SNEA 4TT3D 4Y0ZE 1YLDA 2QA9E 3F0PA 1LKAA 3U98H 4E7NA 3BTEE 5KECA 4TSFD 2ALPA 2ZDLA 3SHAH 3SN8A 2ZFTA 4ABIA 2C8ZB 1A2CH 1OWJA 4UD9H 1V6DA 1AZZA 4BOHA 1P2OA 2P93A 2AEIH 1LPGB 1A5GH 2ZGJA 2ZPSA 1PQ7A 3V12A 2QF4A 1RS0A 3UPEA 5DJ7A 4DT7B 2Z94A 3QGNB 1QIXB 4NWLA 1SR5C 2R2MB 1FUJA 2BD2A 1C5OH 1NT1A 5IYTA 2XCNA 1OWHA 1YWUA 5FL7D 5AF9H 3RDZA 3TNTA 1TYNA 1DWEH 1Z8IB 1H9HE 2F9OA 4I8KA 5A09A 1HAOH 1KSNA 3PWBA 4O3UA 1K1IA 2GZ7A 2WPLS 3VB3A 2XCFA 4K1EA 1C5VA 2OLGA 4M7GA 1BRAA 1Z1JA 1IQIA 4ISOA 1V2MT 4P00A 2AH4X 3BEUA 5F8ZA 1EASA 4RI0A 2GT7A 2PKSC 3LGYA 3RMMH 1O3PB 1C5UA 2VJ1A 4THNH 1RRKA 2YNAA 2PKSB 1FN8A 3KCGH 1VKYA 2PGBB 1YY3A 1Z7KA 3DUXH 1N8OB 3MYWA 2PSXA 1U6QA 5IK2D 1YCPK 3U8OH 2FS8A 4OS4A 1E35B 2A5KA 3SUEA 1TX7A 4I31A 3SQHE 1ZSLA 2A32A 1AMHA 3RXKA 3PTBA 1G36A 1UTOA 3S7HB 3QGJA 1JRSA 2BD7A 1EAWA 3SV7A 3ZVEA 4GUXA 1SPJA 2VBCA 2WPHS 3EDXB 5EXMA 1B0FA 4X6NA 4JZEH 1Z1IA 1P2KA 2P94A 3MNSA 3LGUA 1J15A 5KGOA 2C4FH 2QCYA 1TNIA 2EA3A 1M9UA 1BBRH 4AB9A 1QR3E 3FZDA 3JZ2B 1HAVA 1KXFA 1BTZA 1KY9A 1V2VT 4DCDA 5E8EH 2UUFB 5EIYA 3BTDE 3RXPA 1QNJA 1NRQH 8GCHG 4ZXYH 1T4UH 1IHTH 3AVZA 2HNTC 1UTMA 3KQ5A 3RC5A 1N6YA 3M37A 1T8MA 3M5NA 5B6LA 3SUFA 3LONA 1ZOMA 2TGAA 3GCTF 2G4TA 5AFZH 2P95A 2HLCA 4KTCA 1ZJDA 1F0TA 1PQAA 5CDFE 4XE4A 4X2XA 2XNIA 1BMMH 1AZ8A 1AGJA 1EB1H 2F83A 1ANEA 2BVSH 1ARBA 2O8LA 1Y3WA 4Q4LA 1IQFA 2QIQA 4MDSA 1MTNC 1EFRD 1NO9H 1VCWA 1HPGA 2Y80A 1P2MA 2ZIQH 1TFXA 3KQCA 1KXDA 2ULLA 1S6HA 3P70B 3GCNA 5LPRA 3Q76A 2OC7A 2FTLE 1NRNH 2GTBA 2FIRH 2IPQX 1D9IA 1Y5AT 3SZNA 1TMUH 3TH2H 5LPFA 1RTLA 3TJOA 3U28C 1OXGA 3R0FA 1TABE 4H6SB 1UTJA 4WMDA 3SNDA 1C2JA 3B23B 1ZTLA 5LGOA 3KEEA 5HIZA 3ZZ7A 2EQNA 2B9LA 2OTVA 2JIZD 4UFGH 5EODA 3ZVDA 4B76A 2P8OB 5A8ZA 3VFEA 1C5LH 1BRUP 2FX4A 2QGRA 4Y11E 1E36B 3BTME 1TNJA 5EJZA 1E37B 1AHTH 2H2ZA 3ZZ5A 3A81A 4MPUA 3E16B 1MKWH 2JH5D 2WUCA 2QAAA 5JPMH 1W3CA 2G55A 3EA8A 2UWOA 1AVWA 2CJIA 1QBOA 2VNTA 3PV4A 3URDA 2P3UB 4AN7A 1V2TT 4DOQA 5EPYA 5CHAB 2B5TB 5TCAA 1F92A 1MKWK 1UK2A 1ABIH 1C5WB 5CHAC 1TX8A 3SJ9A 1YPKH 3STIA 2J2UA 1BA8B 1NN6A 1C1MA 2O8WA 1N8OC 1BB0B 2RCEA 1GMHF 1GBJA 1G3DA 4GPGA 1TMTH 1JOUB 5EXLA 1HJ8A 1DX5M 2GDDA 1BTWA 1QTFA 4BAQB 2QF5A 2VGCB 2SGQE 1OPHB 4VGCB 2A7JA 4BNRA 3HK3B 3UQVA 2VWNA 2GZ8A 4UFEH 5GPIB 1W14U 4E06H 4WJG2 1HCGA 1QA0A 2AIQA 3GDUA 1N6XA 1CBWC 3BTGE 5GCHG 1ESTA 5SGAE 1BTXA 2B7DH 2ZEBA 4ZHLU 1P06A 1SGFA 1GHYH 2W5EA 4B71A 1SGRE 2FX6A 1UVUH 2FOFA 4FUGA 1P9UA 3E91A 1GDNA 2ZG0H 3Q77A 3SV2H 2LP6A 2QYIA 4X2VA 1GJ8B 5HYOA 2CHAC 3K65B 1Z6EA 1NESE 2WPIS 5GIBA 1SHYA 5FPTA 5FPSA 1O38A 1Y5BT 4YT6H 2BDHA 4GLYA 3KGPA 4BAHB 2HPPH 4J2YB 3A80A 4AFQA 1O5BB 2Q6DA 2GD4B 4AYVB 3MU5A 4RKOB 4ZAEA 1ORFA 1DSUA 2ZU1A 4NGAH 1O2ZA 1HB0B 1O36A 1HAHH 1GI8B 4MPVA 4NIWA 2W26A 4U01A 1GHAG 1QCPA 1YPJH 1LO6A 2OUAA 3PLPA 3SV6A 2H9EH 5PTPA 1MQ6A 1GJ7B 3ZIAD 4DJZB 1L2EA 1IQNA 1ZSJA 1BMLA 2G00A 4ZHAA 1W0YH 3NWUA 1W0JD 1CO7E 4ZCNA 2OC0A 3PMHB 3P8GA 3LGIA 1GHWH 2QV1A 5C17A 1UCYK 1PJPA 2W6ID 1TGBA 4BAOB 2DE8A 2TRMA 1KTSB 3SUDA 1O2HA 3ZZAA 4BXSA 3LKWA 4X1NU 5EG4A 2ZFSA 2ASUB 4NSVA 4ZUHA 3L6PA 3SI3H 3P8OA 1AO5A 2ZGCA 2VINA 1C5TA 1Y3XA 5C67A 1SOZA 3NRLA 4HGCA 2UWPA 3GY3A 4IN2A 4NIYA 3U69H 3ZZCA 3M5LA 2KM0A 3EA9A 4X1SU 1KXCA 2TIOA 4J1YA 1GL0E 1P12E 2GV6A 1JBUH 4X6OA 1MU6B 4NZQA 1FN6A 2ZU4A 4INKA 2J92A 4MNYA 1O2JA 1S5SA 4NA9H 1A0JA 1C9TA 1C5RA 1EP5A 1IQMA 3F9FA 5I46H 1INCA 1O3DA 4GHQA 5C94A 1K21H 2TGPZ 3GCHB 1UMAH 3A85A 5GDSH 1P10A 2ZDNA 3QN7A 1GCDA 1EAXA 2A2XH 2BD8A 3DT0H 4A1VA 3F9EA 1O37A 3PM3A 2Z9KA 1HAGE 1TQ7B 2FOCA 2BY6X 1W0KD 3Q00A 4X1QU 3PV5A 1O3EA 1O3MA 2ZGHA 2BXTH 2FPZA 3QLPH 1BTUA 1UO6A 2WYGA 1C5ZB 1Y8TA 4WF8A 4LZ1H 1OOKB 2JDID 2ZHEH 1SLUB 1NC6A 1DXWA 1C1WH 2J94A 2BD5A 1DDJA 3H7TA 3LC5A 3PV2A 2XC5A 5G4BA 3UIRA 1O35A 4CR5A 3RXLA 1VJ9U 1V2QT 4UONA 2YMSD 3VXEH 1TNLA 1P9SA 1FPHH 2AFQB 3SZEA 2R0LA 4ISNA 4A92A 2QF0A 1GHAF 1TLDA 1QA7A 1LHGH 2VIQA 3E1XB 2BMGB 1L0ZA 2I6QA 1SGFG 4ISHH 5EW2H 5T3HA 1V2LT 2M5TA 1WAYB 2ZECA 1UVTH 5LH8A 1HFDA 1Z8JB 1AUTC 4BTUB 1FIZA 3OU0A 2Z7FE 2ZGXH 1A1RA 1LDTT 2ZA5A 3LH1A 1MCVA 2WZQA 2XC0A 3BTFE 2YOLA 3STJA 2RA0A 2Q6GA 3M5OA 1YPLH 4GSOA 3RXJA 1VITG 2VIVA 4K1SA 1GJ9B 1TPOA 3DSOA 3GY6A 1AFQB 1GBBA 1T8OA 1ZLRA 1TA6A 3ESTA 5FBEA 2ZC9H 2A5AA 1BRCE 4E05H 4ABJA 2XWBI 3LH3A 2ANWA 1OP0A 5AVDA 1C2MA 1FQ3A 2G5NA 2FODA 3RMLH 2SGAA 1GVZA 2ZPQA 1SSXA 3ZZ9A 3RU4E 2G81E 2FOAA 1QQUA 3A83A 1EJNA 3MOCA 1TNGA 3MU0A 4X8VH 2ESTE 2AMDA 4X8TH 3RXEA 1ZHMA 1P2NA 1O31A 2A7HA 1PFXC 2XWAA 2V7QD 3GY2A 2PTCE 2ZI2H 4YT7H 4YOGA 3S9AA 4U32A 5JDUB 3RP2A 4B2BA 3OYPA 1QZ8A 1VZQH 1WU1A 1QB1A 3RMNH 1MD7A 3UFAA 1IHSH 2IPHA 3E8LA 1O33A 1GBAA 4MG3A 1GHVH 2GVFA 1SLXB 3A7TA 2WV9A 1C2GA 4DT4A 3IG6B 3A84A 1NFWA 4AGKA 2KCPA 2STBE 1THSH 1TRMA 3S7KB 1W8BH 5GJ4B 3RXOA 1SB1H 4Z0KA 1XUFA 1QFKH 4MVNA 3QTOH 1KLTA 1Y3VA 1H8DH 1UJ1A 3KQEA 1G2MA 2ZQ2A 1PPGE 4IW4E 2BLWA 4ACAA 4ISIH 2RFKC 2HNTF 4Q7YA 4XSKU 1FY1A 1V2RT 5E0JA 1DY8A 1D4PB 3MH4A 2W6JD 3SGBE 2HNTE 2GJGA 1Z8RA 3AW0A 1O2WA 2Z9IA 2IOTA 2IN2A 4JZFH 2XBWA 2R3UA 1KLJH 1H8IH 3CNRA 1PQ8A 2VIOA 2Q6FA 4ACBA 1LHDH 3BG4C 1O5CB 2VWMA 1TPAE 1K22H 1SGEE 1C4U2 1DM4B 1ESBA 1TNKA 3F0OA 3RXCA 1A7SA 1V2WT 1O2GH 5J4QA 3BG4B 1GJ6A 3UWIA 2BDYA 1QJ7B 3V13A 2AGEX 2P59A 2FOHA 2FZZA 4NA8A 2OP9A 5B6OA 1O2QA 3K6ZA 3OEHD 2WYJA 2G51A 3GDVA 1SGQE 5DP8A 4X6PA 5C0TA 1NFYA 1UTQA 1YM0A 1EPTB 1NU9A 1UVPA 4ASHA 3MI4A 1GVLA 1W12U 3PMJA 2YNBA 1ESAA 1GVKB 3RXTA 2I6SA 1CGJE 2D26C 3KIDU 1O0DH 4O03A 3RXSA 1GBEA 1MAYA 3SU0A 1HJAB 1KLIH 1EUFA 4YZUA 5DP9A 1F2SE 3MQKC 1AUJA 3LPRA 1IQKA 2W3IA 1EAIA 1HJAC 2H9TH 2JJ2D 1FY5A 3P8FA 1CE5A 3SYJA 1SQRA 1T8NA 5EU8A 1NRRH 5C1XA 4WXIA 1NFXA 2G52A 1H8ED 1FLEE 2ZCKP 3SNBA 3MNCA 1XUGA 1XUHA 3TH4H 3ZZBA 8GCHF 1DWCH 5L2ZH 4DG4A 3O8DA 1KXEA 4BTIB 2NU0E 4NIVA 1GHBG 1W0ZU 2VWLA 3WWBA 1GG6B 2ILNA 3RM2H 2F9UA 3DFJA 3Q3YA 1HIAA 3K9XB 4OS5A 1O3KA 3SV9A 1SMFE 4ZH8A 3UOUA 2FOMB 1G32B 1UHBA 5A0BA 2Z6BD 2OBOA 1RGQA 4O3TA 1AI8H 1O2OA 1ZSKA 3ZVFA 1WSSH 2QF3A 4M9FA 3U1IB 1EKBB 1B7XB 1DFPA 1HAVB 2XC4A 3SU1A 2AGIX 2ANKH 3KQDA 1FJSA 3BIUH 5HKKD 3FP6E 3TNSA 3PO1B 4H42U 1MAXA 1AN1E 1V2NT 5JBAS 3SW2B 4A1TA 3LC3A 1QRWA 2D8WA 6ESTA 1TWXB 1TRNA 2Z9GA 4CRDA 1NBMD 3DA9B 1EPTA 1QRZA 2GP9B 3CP7A 5FX6A 3ZVGA 2J9NA 1ELDE 2A4GA 1C1UH 3A88A 4WWYA 4F55A 1HAXB 5ESBA 2AIPA 4ABHA 1DWBH 2PP6A 2IJD1 2THFB 2BZAA 3L3TA 4FU8A 3BSQA 2C3SA 3RXMA 4FUEA 2W7UA 4WVPE 1C1PA 2P8OC 3EE0B 3OTJE 6GCHF 2NU3E 4WY3A 5DN6D 3DSGA 3NCLA 4OS1A 1IQGA 3RXDA 1EJAA 1GI2A 2WUBA 2BX3A 2VWOA 1SGCA 4IGDA 1QJ6B 2ZFQH 2F9VA 1YPGH 3NUMA 1K1MA 1S81A 3FP8E 3VXFH 4MQAA 5FCKA 2GCHG 1SL3A 3UNQA 1XXDA 2GKVE 3MO6A 1C5PA 3ENSB 3VG8A 1LQEA 1HAZB 1YKTA 2BDIA 3ZYEA 3V7TA 1T31A 3MH6A 3MH7A 1HIAB 4X2WA 1ZJKA 5A8XA 1HDTH 1BBRE 3PB1E 2SNWA 3T29A 3U8TH 1TOMH 1ZTJA 3OY5U 1CHOG 1XKBC 1ZRKA 1EAUA 4FU7A 4RKJB 1PYTC 6CHAB 1C1QA 1JMOH 2VIWA 1OWIA 1EZUC 1O2VA 1QURH 3ZVCA 2PTNA 1MTUA 2HPQH 2ZHQH 6CHAC 1P3EA 3S69A 2P3TB 1ZYOA 4YOIA 3TK6A 4GVUA 3UB0A 1YGCH 2BY8X 2WPKS 3T27A 3RC4A 2PW8H 2KX4A 3UNSA 3UY9A 1GJ5H 4ZXXH 3UNRA 3A8AA 4I32A 4WMFA 2P3FH 2AERH 2EEKA 2ZFRH 2OC8A 2J38A 3T28A 3KNXA 1ZHRA 4Y8XA 4HG6A 2G8TA 2ODYB 1ZHPA 4MLFB 5TJXA 1F0SA 5C20A 1OWKA 1YC0A 1AVGH 5T1VA 2B8OH 3F68H 5GXPA 3SNAA 5F6MA 3EE7A 2FTMA 4MTBA 1RFNA 1V2JT 3C27B 1OS8A 2ZTYA 1AE8H 4Y7BA 2WPMS 3SJKA 1TMBH 2OCVB 3N99A 3O8RA 2XNDD 7GCHF 3A7VA 3UAIC 1DANH 1TQ0B 4X8UH 2L74A 1A0HB 4GCHG 2P16A 1GG6C 3A8CA 2C90B 2CHAB 4NSYA 2KCAA 1O2RA 2UUKB 1F0UA 2TGDA 1YCPH 3T5FH 1DXPA 5FX5A 3T26A 5JBCS 1AKSB 1MCTA 1LVBA 4X1PU 4XFQA 3RXVA 1BTPA 3PRBA 1AQ7A 2ZPRA 3TLOA 1BCUH 3LJOA 2UWLA 4DGJA 2J97A 3OTPA 4ESTE 1MBQA 1GGDB 1QL7A 3PO1C 1C1VH 4IS5A 1J8AA 3BEIB 3N7DA 1J9CH 3ZVAA 3U9AH 2K8IA 2PKAA 1LVMA 3UQOA 1MMJN 1O39A 1MTNB 4Y79A 1SQTA 4AC9A 5DP3A 1RIWC 2A4QA 2AMPA 1HXEH 1Y3UA 1PPEE 1O3GA 2ANYA 4JMYA 3D65E 2VVUA 1YCPM 2GCHF 3T25A 1VCQA 4INLA 3FAOA 1DOJA 1FY8E 4UDWH 2H5DA 1BTYA 3RXQA 1GBKA 1UTKA 2Y5FA 1GI3A 2HLDD 5T6GA 3W95A 1FDPA 3WWFA 2PFEA 1O2LA 5DP7A 3F2HA 2HVXA 1FY4A 2R0KA 3KQBA 2LPRA 1NRPH 4Y8YA 4B75A 2ALVA 1ZRBA 2PV9B 3DD2H 3A7ZA 3SJIA 2BLQA 4CR9A 1EJMA 1TPPA 2Y6TA 1EB2A 2SGFE 3GY7A 3V3MA 1W2KH 2HWLB 2ZZUH 3QWCH 1ELEE 1RXPA 1Z6JH 3MO3A 4SGAE 3RXRA 1K9OE 2XYAA 3GCHC 3PROA 5HMAA 2FYRA 3A7WA 1JIRA 1DY9A 4A5TS 3E0NB 2XTTB 1AKSA 1GBDA 4X8SH 3NXPA 2ZDAH 1ZPBA 2KZ4A 3LGTA 2L6OA 1CT2E 1F0RA 2VVVA 1S82A 3QUMP 2K1QA 2ZCHP 2BLVA 4I8HA 3TGIE 3L33A 1WUNH 1YPEH 4CRCA 1O3IA 4TY6A 2GCTB 1TA2A 5C1UA 1YLNA 5DGJA 4Y7AA 2XXLA 3RLWH 1FNIA 1P8VC 1AIXH 1LQDB 5EGMA 1FX0B 4AYYB 3MWIU 3UREA 1P01A 2CK3D 4F49A 5EQRA 2VGCC 1ZZZA 1CGHA 4AG1A 1ZPZA 2ZGBH 1Z8GA 5IDKA 3JZ1B 1GBCA 3MH5A 3LDXH 3VEQB 1A5HA 1ACBE 1Q2WA 3TPIZ 1CBWB 1O2UA 2BQ7B 1NROH 3R3GB 4F48B 1GBMA 2ZDVH 3NKKA 2SGDE 3S0NA 3DSPA 5GWZA 3E6PH 4UEHH 1QY6A 4R0IA 4D9RA 1G3EA 1O2MA 2A4RA 1C1RA 1CSOE 2GGVB 5T6FA 2Z9JA 1A46H 3ODFA 3FANA 1O30A 1K2I1 3OFND 3PWCA 1NTPA 1ETRH 4I33A 1CHGA 4LXBH 7ESTE 1X7AC 3TK5A 6GCHG 2FMJA 2FDAA 1O3FA 1RJXB 2QY0B 1EXFA 2C8XB 2A31A 3MNBA 2KAIB 1QRXA 1EP6A 4AORA 4NFFA 2STAE 2LNCA 4FUIA 3LGVA 2FLBH 1C2FA 1E79D 5F8TA 2JJ1D 4CRFA 5DG6A 1K0HA 2BX4A 3M7UA 3P6ZB 1C1OA 3PYHA 1Z71A 1K1OA 1MABB 2RDLA 1ID5H 3I77A 3GY4A 3E0PB 4ZROA 3OAAD 2R2WU 1E34B 3HGPA 1CHOF 2VH6A 1YBWA 2SGEE 2FESH 2FOGA 3SJ8A 1V2OT 3U1JB 3PLBA 2CF9H 4BANB 4DURA 3DCLA 1EZSC 1P57B 1SGYE 1UHBB 3SNCA 4A6LA 4AFUA 2QC2A 3RU4T 4CHAB 1O3JA 1GJAB 1DVAH 4AZ2B 3OX7U 2BY5X 3FFGA 4UFFH 2JETB 4CHAC 1DLEA 1CU1A 3M3VA 1F5RA 1VGCC 3BIVH 1FY3A 2EI7A 4Y76A 2M2AA 2CN0H 1MTVA 5CHBA 4Z6AH 1WTHD 2O8TA 2BQWB 1GI5A 2OQUA 2UUYA 3HGNA 1TBZH 4FOUC 3KL6A 1H8HD 1P2QA 1OWDA 1GCTB 3MU8A 2A0QB 2FOBA 1TIOA 5C3NA 3GYMA 1D3TB 1ELVA 2GT8A 5HM9A 4FXGH 3IWMA 2PLXA 1UVOA 2A4OA 1TE0A 1ELBA 4B6FA 1BIOA 3EAJA 4K2YA 3P92A 1GBFA 4GCHF 3EYDA 1GI7B 3W94A 1LCYA 3F1SB 1WOFA 2BY7X 1SC8U 1T8LA 1GBHA 1UTPA 2ZHDA 3UWJH 1P2JA 2VIPA 2BB4A 4HZHA 3AAUA 1UTLM 3NZIA 4SGBE 1UVSH 1P03A 1K1PA 3F2FA 3ZVBA 3N7OA 1NRSH 2FI5E 2ODQA 3TGKE 1ANCA 4KKDA 3N7EA 2FEQH 3PLKA 2W7SA 1UCYE 4D9QA 3ATKA 4FUFA 2ZP0H 3FVFB 4IN1A 1C1TA 4K3JA 3BTKE 2WPDD 4NFEA 5JB8S 2XBYA 3HPTB 2ZWLH 3GYLB 1CA0C 2NWNA 2FOEA 2V3HH 1Y5UT 1T4VH 1OKXA 4B2AA 2O9QA 2V6NA 2HOBA 2WV5A 1A4WH 3RXHA 2BM2A 2GDEH 2SNVA 2A1DB 1FAKH 1CA0B 1KTTB 1W10U 3A8DA 8ESTE 2BDBA 1THRH 5A0AE 1BQYA 1JIMA 2RA3A 1BMNH 1DLKB 1C5XB 1H4WA 1LPKB 1SHHB 3MU4A 1LVYA 2Y5HA 1GI6A 4CREA 1K28D 3QX5H 4MNVA 4YLQH 1UK4A 2OD3B 1C5MD 1XXFA 2RG3A 1V2PT 3F9HA 2WHXA 1O2PA 1ELFA 1O5GH 3M5MA 4QT8C 1SKYE 2OQ5A 2QN5T 2XOKD 2CMYA 1O2KA 1QL9A 4K1TA 1H9LB 2FS9A 1TX6A 1O3LA 5KEDA 3GISB 5T6DA 1MKXH 1QBVH 3VPKA 1K1JA 3RUOA 2CXVA 5A2MH 8KME2 1KDQB 4UFDH 1GHZA 3BTTE 5A8YA 2VIDA 4CBOA 4ABDA 1C2LA 4XBCA 4AG2A 1HUTH 1AY6H 3BTQE 1J17T 3MNXA 1HV7A 3QZRA 5HM2A 5K0HA 1MH0A 1L4DA 4DY7B 3GY5A 1Y3YA 1ELCA 2FI3E 1COWD 3NK8A 3OY6U 1DUAA 2TPIZ 2RDEA 3TJNA 4CRGA 1AU8A 5HXFA 1A3BH 1K1NA 1MZDA 4ZHMU 1O3BA 1S0RA 3BN9A 2GX4A 5DPAA 2NU2E 2XBVA 3FZZA 1WTGH 1EATA 3QO6A 1GI4A 1K1LA 5C1YA 3SJOA 4ABBA 1ABJH 2F9NA 2A7CA 2BD4A 4RT0A 1ELAA 3BF6H 3F6UH 5DK1A 1TGSZ 4BAKB 4WXVA 1DT2A 1TAWA 2VU8E 1LHCH 1MQ5A 1MUEB 2IJOB 2ZKSA 3BTHE 5FHTA 3SBKA 3QZQA 5JYIA 2BVXH 4B2CA 2KCYA 1W13U 2D2DA 3K6YA 3P17H 2ZFFH 1XKAC 1C9PA 1SG8B 4KELA 3MMGA 1NBME 4MPXA 2AMQA 2BD9A 2ZCLP 4Y6DA 1OP2A 1XVMA 5EJ1A 5EJLA 1MD8A 1O5DH 4FUDA 2UUJB 1DITH 2J98B 1CVWH 3UR6A 1S6FA 1BITA 1LMWB 3DHKH 4NZLA 2KCOA 1O34A 3T2NA 1O3OA 3PMAB 5H4IB 1RTKA 1QBNA 2C8YB 4FUBA 2ZO3H 2CGAA 3FKSD 2J34A 4HI3A 2PR3A 1FXYA 2BYAX 2V3MA 3SUGA 3A87A 1O2TA 2ZU5A 1CQQA 4U30A 4B1TA 4DW2U 1HAIH 1AD8H 3GCTG 1GJCB 1SI5H 3NPSA 3AASA 5K7RA 1O3HA 3WY8A 1DPOA 1SGDE 1WBGB 2J5UA 2JKHA 3OSYA 3HK6B 3LIWA 1SGIB 4JZ1A 1ZR0A 1EPTC 1HNEE 3A86A 5C2ZA 9LPRA 2BOKA 1QB9A 2ANMH 4BTTB 1G2LA 1XUJA 3M7TA 4JCNA 2KFWA 1TGNA 5DP5A 3TJUA 3KHVA 4HFPB 1TBRH 1TOCB 4FUHA 4AX9H 1XMNB 3EQ0H 3UR9A 6LPRA 2BOHB 2B0FA 1QGFA 1TBQH 2FYQA 1B0EA 4IC5A 2G5VA 4YLUA 1DWDH 3MTYA 4WH8A 1C2HA 2BTCE 2J95A 1D6RA 4XDEA 3ZZ8A 1LHEH 4NG9H 2FM2A 4KP0A 3B8JA 1AB9C 3RXIA 1V2ST 2FP7B 2ZTZA 1SVPA 1GPZA 3ZZ3A 2AHME 1D3QB 2Y7ZA 3MU1A 3HKIB 3M35A 1AB9B 4DIIH 3KYFA 5FCRA 2DUCA 2ZFPH 1J16A 7LPRA 1GWAA 1TRYA 3P95A 3LU9B 1MU8B 3A7YA 3BV9B 3MO9A 5EPNA 3SU4A 1BRBE 1KXBA 1O2YA 1EOJA 1RTFB 1FZZA 2GV7A 3FO8D 1GI0A 1DS2E 3SGQE 1NY22 1SFQB 1GDUA 3CENA 5C0UA 4TPIZ 1ZGVA 1IOEA 1UW7A 4O97A 4OS7A 4Q7XA 3VGCB 3K2UA 1P11E 1GGDC 1W11U 2EI6A 1KXAA 4E7RG 4OGYA 1PPFE 3S9CA 1QQ4A 2NU1E 2WINI 1S83A 1HLTH 3ATLA 2Y7XA 5AFYH 3SI4H 2TGTA 1O5FH 3SORA 3EA7A 5DO4H 4B74A 1GBIA 4ABAA 3LGWA 4ISLA 1C5SA 1YYY1 2FWWA 4HTCH 1RIWB 3B9FH 1GMCF 1AWFH 4JYVH 1AFEH 1ANBA 1ANDA 4OM9A 5F03A 3H09A 3F9GA 1L4ZA 3BG8A 1HXFH 2ZU2A 4NWKA 2V35A 2XBXA 4VGCC 2BDCA 1O5AB 5A0CA 1THPB 1GMDF 1Q31A 3D49H 1FPCH 4WH6A 4JZIA 7KMEH 2JH6D 1FONA 4CRAA 4IMZA 1QJ1B 1LKBA 1PPZA 4KTUA 4ZKRU 2Y81A 2O8MA 2F9PA 2BDAA 2F9BH 4CH2B 4Y71A 1GJ4H 2OC1A 3A82A 4INHA 1HYLA 1TNHA 1SLVB 1O3CA 1C1SA 1P0SH 4X2YA 2O8UA 4FUJA 1DE7H 4ABFA 4D8NA 4OS2A 1FI8A 3AK5A 3RXFA 4AGJA 4NIXA 4RN6A 2HALA 4BAMB 1YPHE 4Y0YE 1F7ZA 1ELGA 4ZKNU 4FUCA 2H9HA 2VB0A 2QXHA 4JYTA 2Y5GA 1B5GH 1CT0E 3TVJB 3ODDA 3VB5A 2ZF0H 2SFAA 1UCYH 4K8YA 1C5YB 2FO9A 5DP6A 2J98A 2C8WB 5F8XA 1UTNA 4K5ZA 3HATH 4YO9A 1ZGIA 4X1RU 1TGCA 3CS7A 4X0WU 1D3DB 5HGGA 4F4OC 3RXGA 3F2GA 1VITH 1C2EA 2J4IA 4K60A 2FI4E 5JBBS 2YMSB 2A45B 3C1KA 3ATIA 4D76A 2QXJA 4LK4A 1IQHA 1YPMH 2G4UA 1A3EH 1O5EH 2ZHFH 3M61U 1MKXK 2ZDMA 2F4LA 2F43B 3UOPA 1E1RD 1V3XA 1PPBH 1G3BA 1IAUA 1TPSA 1PQ5A 1VJAU 1TGTA 4MNXA 1ETTH 4Y8ZA 3BTWE 4YESB 1KIGH 1MTWA 4JK6A 3A8BA 3SU3A 1BMFD 1O2IA 3Q3KA 2Z3CA 1C5QA 2W3KA 2Z3EA 1RD3B 3OEED 4I8GA 4ZKSU 1GHXH 2PWXA 1NPMA 1HAYB 2FXRA 2ZNKH 4MPWA 2PSYA 2XW9A 1F5KU 2ZU3A 1XUKA 4B73A 2H1UA 3MFJA 3CS0A 1W7GH 3ZZ6A 4D7FA 5DKMA 1GI1A 1GMHG 3DFLA 1O2SA 1EOLA 5LPEA 3VGCC 3UTUH 4GHTA 3H7OA 4Z1MD 3URCA 1BZXE 2BVRH
chains in the Genus database with same CATH topology
3ELAH 2HRVA 1GJBB 1VITF 5EXNA 3TU7H 5L30H 1KYNA 2VH0A 1D3PB 3ATMA 1W7XH 4YOJA 4Q80A 4UE7H 1SQOA 1O2NA 1BHXF 3TITA 1JRTA 3SGAE 1TALA 1CT4E 1TB6H 5I25A 3I78A 4BXWA 1BTHH 2AS9A 1MTSA 1DICA 4CH8B 4TWYA 1BT7A 2AGGX 1ARCA 4JZDH 3LT3A 3G01A 1BOQA 1PPCE 5FXLA 4RSPA 1SGTA 1BDAA 1G30B 2NU4E 4DIHH 1NM6A 1V2KT 4AB8A 2QXIA 1H1BA 1YLCA 1SQAA 1HJ9A 3O8CA 1YF4A 4XBDA 3SO3A 2H5CA 1C4Y2 1IQJA 3TJVA 1C1NA 2XRCA 1O3NA 4XBBA 1BBRK 3PTNA 4JYUH 5BPEA 1ZTKA 1GCTC 5CMXH 5JBTA 1AE5A 5FPYA 4ABGA 1OYQA 1WQVH 1ZPCA 1EQ9A 3KF2A 2D1JA 1BJVA 4OS6A 3ZV9A 3SHCH 3O8BA 1O2XA 1C2DA 4KTSA 5DP4A 2FLRH 3QK1A 2BY9X 2JH0D 5TCCA 3GDSA 3E3TA 1OX1A 4FU9A 4X6MA 1J14A 9ESTA 3M3TA 4NA7A 5EQSA 3VB7A 1S84A 3M3SA 1DSTA 1WQSA 3EGKH 1GMDG 5E0HA 3RXUA 4K69A 1F5LA 4ZMAH 2Y82A 1GBLA 1E38B 1GBTA 2EI8A 5FBIA 1T32A 5CE1A 1P04A 2GCTC 1QL8A 4WMEA 3LOXA 3D62A 3SOSA 2BXUH 4AFSA 3A7XA 5E2PA 1C2KA 1P09A 2BDGA 1ZMLA 2VVCA 3MHWU 1EZXC 3KN2A 1GDQA 4H6TA 1LTOA 1IQLA 3GOVB 4Q7ZA 4TYDA 3TK9A 1EX3A 3HKJB 4Q2KA 1UK3A 3ZV8A 1S0QA 1V2UT 1LPZB 2CF8H 2OBQA 3ZYDA 3VB6A 5J4SA 1NS3A 1FIWA 2A5IA 2PHBA 1Y59T 3GICB 1SLWB 5C5OA 5ABWA 4CBNA 4DVAU 2ODPA 3P8NA 5JB9S 1H9IE 1JWTA 1ETSH 4IBLH 1L1JA 1NZQH 3RXAA 5BRRE 1IQEA 1FMGA 2V3OH 2ZTXA 1BUIA 2R3YA 1MBMA 3SQEE 1VR1H 2F91A 1HBTH 1O3AA 1KDQA 1T7CA 4YTAA 3RMOH 3S9BA 2Z9LA 4KGAA 1AVXA 1JXPA 1DUEA 3ZZDA 1HRTH 4MNWA 1D6WA 3RLYH 1P2IA 5GCHF 1SFIA 2Z3DA 2Q1JA 5E2OA 3FP7E 2EC9H 1P02A 5L2YH 1L1NA 2AYWA 1MZAA 2R9PA 1BHXB 1HGTH 2BQ6B 3SU6A 1Q3XA 1N1LA 4I8LA 4JK5A 5C5NA 5EW1H 1PPHE 4LOYH 2ZDKA 3GCOA 5L6NH 4FVDA 1YPHC 2OXSA 1SOTA 1BJUA 1XVOA 2KAIA 1YP9A 8LPRA 1ELTA 4XOJA 1A61H 1P05A 2OINA 5ESTE 4ZKOU 3M7QA 3RXBA 4O9VA 3SU2A 3H5CB 1G3CA 1LHFH 4R8TB 2BD3A 4D7GA 3E90B 1GI9B 4OGXA 3I29A 1TONA 3ZZ4A 2TBSA 1C2IA 1SGNE 1AWHB 4GAWA 1FAXA 1ZMJA 3UUZA 5FAHA 1PYTD 2JETC 2CV3A 1CGIE 1A0LA 3QDZB 2GMTB 1VGCB 1WV7H 1C5NH 1ZMNA 1LVOA 2GMTC 4YM9A 1G9IE 1SGPE 1GL1A 2PUQH 4TWWA 5EQQA 4A1XA 4IMQA 3QTVH 1L1GA 1P3CA 1FV9A 2V0BA 1NU7B 1EZQA 5E0GA 3GY8A 2BHGA 3RC6A 4ABEA 3TH3H 3LJJA 3T62A 4LZ4B 3TIUA 4PROA 1OSSA 2F3CE 3ATWA 2BZ6H 4A7IB 2PGQB 1OP8A 1SBWA 1GHBF 4FVBA 2C93B 2SGPE 1WYKA 1XUIA 2A2QH 3V0XA 1AFQC 2WV4A 1VCPA 3U8RH 4U2WA 2QXGA 4TPYA 4H4FA 2ZHWH 4CRBA 1GMCG 1NFUA 1HAPH 1OWEA 1A5IA 2WPJS 7GCHG 1G37A 1C4V2 1XM1A 4AFZA 2DE9A 4IC6A 3M36A 2PUXB 3PMBB 1QHRB 2GZ9A 3VB4A 3A89A 3Q3XA 2ZQ1A 3RU4D 1WCZA 3IITA 3SV8A 3AW1A 2BLOA 4AOQA 3RM0H 3SU5A 3AAVA 5ETXA 4I7YH 2PKAB 3D23A 1GJDB 1XX9A 3BEFB 4NCYA 5AHGH 1CA8B 1E0FD 1QB6A 1S85A 2HGTH 5EOKA 4I8JA 2H6MA 1BMAA 4K8BA 3ITIA 1O32A 4Y10E 1OYTH 3TGJE 4TY7A 3SNEA 4Y0ZE 1YLDA 2QA9E 1LKAA 3U98H 4E7NA 3BTEE 2ALPA 2ZDLA 3SHAH 3SN8A 2ZFTA 4ABIA 2C8ZB 1A2CH 1OWJA 4UD9H 1V6DA 1AZZA 4BOHA 1P2OA 2P93A 2AEIH 1LPGB 1A5GH 2ZGJA 2ZPSA 1PQ7A 3V12A 1RS0A 3UPEA 5DJ7A 4DT7B 2Z94A 3QGNB 1QIXB 4NWLA 1SR5C 2R2MB 1FUJA 2BD2A 1C5OH 1NT1A 5IYTA 2XCNA 1OWHA 5AF9H 3RDZA 3TNTA 1TYNA 1DWEH 1Z8IB 1H9HE 2F9OA 4I8KA 5A09A 1HAOH 1KSNA 3PWBA 4O3UA 1K1IA 2GZ7A 2WPLS 3VB3A 2XCFA 4K1EA 1C5VA 2OLGA 4M7GA 1BRAA 1Z1JA 1IQIA 4ISOA 1V2MT 2AH4X 3BEUA 5F8ZA 1EASA 2GT7A 2PKSC 3LGYA 3RMMH 1O3PB 1C5UA 2VJ1A 4THNH 1RRKA 2YNAA 2PKSB 1FN8A 3KCGH 2PGBB 1Z7KA 3DUXH 1N8OB 3MYWA 2PSXA 1U6QA 1YCPK 3U8OH 2FS8A 4OS4A 1E35B 2A5KA 3SUEA 1TX7A 4I31A 3SQHE 1ZSLA 2A32A 1AMHA 3RXKA 3PTBA 1G36A 1UTOA 3S7HB 3QGJA 1JRSA 2BD7A 1EAWA 3SV7A 3ZVEA 4GUXA 1SPJA 3EDXB 2WPHS 5EXMA 1B0FA 4X6NA 4JZEH 1Z1IA 1P2KA 2P94A 3MNSA 3LGUA 1J15A 2C4FH 2QCYA 1TNIA 2EA3A 1M9UA 1BBRH 4AB9A 1QR3E 3FZDA 3JZ2B 1HAVA 1KXFA 1BTZA 1KY9A 1V2VT 4DCDA 5E8EH 2UUFB 3BTDE 3RXPA 1QNJA 1NRQH 8GCHG 4ZXYH 1T4UH 1IHTH 3AVZA 2HNTC 1UTMA 3RC5A 1N6YA 3M37A 1T8MA 3M5NA 3SUFA 3LONA 1ZOMA 2TGAA 3GCTF 2G4TA 5AFZH 2P95A 2HLCA 4KTCA 1ZJDA 1F0TA 1PQAA 4XE4A 4X2XA 2XNIA 1BMMH 1AZ8A 1AGJA 1EB1H 2F83A 1ANEA 2BVSH 1ARBA 2O8LA 1Y3WA 1IQFA 2QIQA 4MDSA 1MTNC 1NO9H 1VCWA 1HPGA 2Y80A 1P2MA 2ZIQH 1TFXA 3KQCA 1KXDA 2ULLA 1S6HA 3P70B 3GCNA 5LPRA 3Q76A 2OC7A 2FTLE 1NRNH 2GTBA 2FIRH 1D9IA 1Y5AT 3SZNA 1TMUH 3TH2H 5LPFA 1RTLA 3TJOA 1OXGA 3R0FA 1TABE 4H6SB 1UTJA 4WMDA 3SNDA 1C2JA 3B23B 1ZTLA 5LGOA 3KEEA 3ZZ7A 2B9LA 2OTVA 4UFGH 5EODA 3ZVDA 4B76A 2P8OB 5A8ZA 3VFEA 1C5LH 1BRUP 2FX4A 2QGRA 4Y11E 1E36B 3BTME 1TNJA 1E37B 1AHTH 2H2ZA 3ZZ5A 3A81A 4MPUA 3E16B 1MKWH 2JH5D 2WUCA 2QAAA 5JPMH 1W3CA 2G55A 3EA8A 2UWOA 1AVWA 2CJIA 1QBOA 2VNTA 3PV4A 3URDA 2P3UB 4AN7A 1V2TT 4DOQA 5EPYA 5CHAB 2B5TB 5TCAA 1F92A 1MKWK 1UK2A 1ABIH 1C5WB 5CHAC 1TX8A 3SJ9A 1YPKH 3STIA 2J2UA 1BA8B 1NN6A 1C1MA 2O8WA 1N8OC 1BB0B 2RCEA 1GMHF 1GBJA 1G3DA 4GPGA 1TMTH 1JOUB 5EXLA 1HJ8A 1DX5M 2GDDA 1BTWA 1QTFA 4BAQB 2VGCB 2SGQE 1OPHB 4VGCB 2A7JA 4BNRA 3HK3B 3UQVA 2VWNA 2GZ8A 4UFEH 5GPIB 1W14U 4E06H 4WJG2 1HCGA 1QA0A 2AIQA 3GDUA 1N6XA 1CBWC 3BTGE 5GCHG 1ESTA 5SGAE 1BTXA 2B7DH 2ZEBA 4ZHLU 1P06A 1SGFA 1GHYH 2W5EA 4B71A 1SGRE 2FX6A 1UVUH 2FOFA 4FUGA 1P9UA 3E91A 1GDNA 2ZG0H 3Q77A 3SV2H 2QYIA 4X2VA 1GJ8B 5HYOA 2CHAC 3K65B 1Z6EA 1NESE 2WPIS 5GIBA 1SHYA 5FPTA 5FPSA 1O38A 1Y5BT 4YT6H 2BDHA 4GLYA 3KGPA 4BAHB 2HPPH 4J2YB 3A80A 4AFQA 1O5BB 2Q6DA 2GD4B 4AYVB 3MU5A 4RKOB 4ZAEA 1ORFA 1DSUA 2ZU1A 4NGAH 1O2ZA 1HB0B 1O36A 1HAHH 1GI8B 4MPVA 4NIWA 2W26A 4U01A 1GHAG 1QCPA 1YPJH 1LO6A 2OUAA 3PLPA 3SV6A 2H9EH 5PTPA 1MQ6A 1GJ7B 4DJZB 1L2EA 1IQNA 1ZSJA 1BMLA 2G00A 4ZHAA 1W0YH 3NWUA 1CO7E 2OC0A 3PMHB 3P8GA 3LGIA 1GHWH 2QV1A 1UCYK 1PJPA 1TGBA 4BAOB 2DE8A 2TRMA 1KTSB 3SUDA 1O2HA 3ZZAA 4BXSA 3LKWA 4X1NU 5EG4A 2ZFSA 2ASUB 4NSVA 4ZUHA 3L6PA 3SI3H 3P8OA 1AO5A 2ZGCA 2VINA 1C5TA 1Y3XA 5C67A 1SOZA 4HGCA 2UWPA 3GY3A 4IN2A 4NIYA 3U69H 3ZZCA 3M5LA 3EA9A 4X1SU 1KXCA 2TIOA 4J1YA 1GL0E 1P12E 2GV6A 1JBUH 4X6OA 1MU6B 4NZQA 1FN6A 2ZU4A 4INKA 2J92A 4MNYA 1O2JA 1S5SA 4NA9H 1A0JA 1C9TA 1C5RA 1EP5A 1IQMA 3F9FA 5I46H 1INCA 1O3DA 4GHQA 1K21H 2TGPZ 3GCHB 1UMAH 3A85A 5GDSH 1P10A 2ZDNA 3QN7A 1GCDA 1EAXA 2A2XH 2BD8A 3DT0H 4A1VA 3F9EA 1O37A 3PM3A 2Z9KA 1HAGE 1TQ7B 2FOCA 2BY6X 3Q00A 4X1QU 1O3EA 1O3MA 2ZGHA 2BXTH 2FPZA 3QLPH 1BTUA 1UO6A 2WYGA 1C5ZB 1Y8TA 4WF8A 4LZ1H 1OOKB 2ZHEH 1SLUB 1NC6A 1DXWA 1C1WH 2J94A 2BD5A 1DDJA 3H7TA 3LC5A 4CR5A 2XC5A 5G4BA 3UIRA 1O35A 3RXLA 1VJ9U 1V2QT 4UONA 3VXEH 1TNLA 1P9SA 1FPHH 2AFQB 2R0LA 4ISNA 4A92A 2QF0A 2VIQA 1GHAF 1QA7A 1LHGH 1TLDA 3E1XB 2BMGB 1L0ZA 2I6QA 1SGFG 4ISHH 5EW2H 5T3HA 1V2LT 2M5TA 1WAYB 2ZECA 1UVTH 5LH8A 1HFDA 1Z8JB 1AUTC 4BTUB 1FIZA 3OU0A 2Z7FE 2ZGXH 1A1RA 1LDTT 2ZA5A 3LH1A 1MCVA 2XC0A 3BTFE 2YOLA 3STJA 2RA0A 2Q6GA 3M5OA 1YPLH 4GSOA 3RXJA 1VITG 2VIVA 4K1SA 1GJ9B 1TPOA 3GY6A 1AFQB 1GBBA 1T8OA 1ZLRA 1TA6A 3ESTA 5FBEA 2ZC9H 2A5AA 1BRCE 4E05H 4ABJA 2XWBI 3LH3A 2ANWA 1OP0A 5AVDA 1C2MA 1FQ3A 2G5NA 2FODA 3RMLH 2SGAA 1GVZA 2ZPQA 1SSXA 3ZZ9A 3RU4E 2G81E 2FOAA 1QQUA 3A83A 1EJNA 3MOCA 1TNGA 3MU0A 4X8VH 2ESTE 2AMDA 4X8TH 3RXEA 1ZHMA 1P2NA 1O31A 2A7HA 1PFXC 2XWAA 3GY2A 2PTCE 2ZI2H 4YT7H 4YOGA 3S9AA 4U32A 5JDUB 3RP2A 4B2BA 3OYPA 1VZQH 1WU1A 1QB1A 3RMNH 1MD7A 3UFAA 1IHSH 2IPHA 3E8LA 1O33A 1GBAA 4MG3A 1GHVH 2GVFA 1SLXB 3A7TA 1C2GA 3IG6B 3A84A 1NFWA 4AGKA 2STBE 1THSH 1TRMA 3S7KB 1W8BH 5GJ4B 3RXOA 1SB1H 4Z0KA 1XUFA 1QFKH 4MVNA 3QTOH 1KLTA 1Y3VA 1H8DH 1UJ1A 3KQEA 1G2MA 2ZQ2A 1PPGE 4IW4E 2BLWA 4ISIH 2HNTF 4Q7YA 4XSKU 1FY1A 1V2RT 5E0JA 1DY8A 1D4PB 3MH4A 3SGBE 2HNTE 1Z8RA 3AW0A 1O2WA 2Z9IA 2IOTA 2IN2A 4JZFH 2XBWA 2R3UA 1KLJH 1H8IH 1PQ8A 2VIOA 2Q6FA 1LHDH 3BG4C 1O5CB 2VWMA 1TPAE 1K22H 1SGEE 1C4U2 1DM4B 1ESBA 1TNKA 3RXCA 1A7SA 1V2WT 1O2GH 5J4QA 3BG4B 1GJ6A 3UWIA 2BDYA 1QJ7B 3V13A 2AGEX 2P59A 2FOHA 2FZZA 4NA8A 2OP9A 5B6OA 1O2QA 3K6ZA 2WYJA 2G51A 3GDVA 1SGQE 5DP8A 4X6PA 1NFYA 1UTQA 1YM0A 1EPTB 1NU9A 1UVPA 4ASHA 3MI4A 1GVLA 1W12U 3PMJA 2YNBA 1ESAA 1GVKB 3RXTA 2I6SA 1CGJE 2D26C 3KIDU 1O0DH 4O03A 3RXSA 1GBEA 1MAYA 3SU0A 1HJAB 1KLIH 1EUFA 4YZUA 5DP9A 1F2SE 1AUJA 3LPRA 1IQKA 2W3IA 1EAIA 1HJAC 2H9TH 1FY5A 3P8FA 1CE5A 1T8NA 5EU8A 1NRRH 5C1XA 4WXIA 1NFXA 2G52A 1FLEE 2ZCKP 3SNBA 3MNCA 1XUGA