2FS9A

Human beta tryptase ii with inhibitor cra-28427
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A01
1BTWA 3LJOA 1PQ8A 2D26C 3IWMA 1GMHG 5DP5A 3SNEA 4ZKNU 2BDYA 3A8DA 3M3TA 1OP2A 4ZHLU 1MD7A 1P12E 4NGAH 1O34A 3UR6A 4YTAA 4MPWA 2Z6BD 2SGEE 1DWDH 1BMNH 1L2EA 3RXMA 5A8XA 1ORFA 1C2KA 2VH6A 1OWJA 2Z9KA 1YM0A 1V2UT 4OGXA 1C5TA 2ZPQA 3BG8A 2PFEA 1S0RA 2ZZUH 3RMLH 3QWCH 2UUKB 1DXPA 3A8BA 1C5VA 2TBSA 2ZWLH 2PHBA 3BTDE 2FEQH 3QLPH 1HIAA 6CHAC 1NRQH 1QJ6B 2BY6X 2FOBA 3HK3B 3ZZ7A 5EXNA 1EB1H 4FUBA 2BM2A 1O2MA 1W10U 1V2OT 4NWKA 1OX1A 1WQVH 3UQVA 4JZEH 4ABHA 2ANYA 1QURH 1ZTKA 2XWAA 2BDAA 3MO6A 2G4TA 5L2ZH 3MFJA 1Y5BT 2YOLA 3FFGA 1HB0B 3UFAA 5E0GA 1UK2A 1BB0B 3GY7A 1H9IE 3A88A 4XBCA 1E37B 1JBUH 1KTSB 3QTOH 2SFAA 1ELVA 3A7ZA 3E8LA 2CHAC 2ZU5A 4YESB 4YM9A 2GCTC 3SUFA 1CGHA 3MOCA 1NC6A 1O2JA 1AVGH 3ATIA 3PV4A 4Y8YA 3HGPA 3GYMA 4XOJA 4YO9A 3SJ8A 4THNH 3P8OA 2PW8H 1MKWH 3A85A 5LH8A 3LOXA 4BNRA 4I8JA 3SNCA 1VITF 3GISB 1GCDA 1O5DH 3LC3A 1IQNA 3MHWU 2V3OH 1E35B 1D3TB 1F0RA 2B5TB 3UTUH 2XBXA 1OYTH 1Z6EA 4XBDA 4YOJA 2ZTYA 1TRMA 3QK1A 5JBCS 4OS2A 1NFXA 4BAHB 1GJ4H 3V12A 1DUAA 1N6XA 2ZFRH 4BAKB 1AFQC 4A1XA 3SV6A 2H5DA 1HNEE 5A0BA 1AVXA 4ISIH 3GY2A 2PGBB 1SMFE 4D9RA 1PPBH 2FS8A 1W0YH 3SBKA 4D8NA 3QZQA 3FP7E 4ISLA 3ZVDA 2ZA5A 1GJ7B 1HAGE 1WBGB 1BRCE 1SHYA 1P02A 2J95A 4XFQA 1LDTT 2BY9X 5DPAA 3RXRA 1V2MT 2SNWA 3NKKA 1FI8A 1PQ7A 1C5LH 4JZIA 5T3HA 2NU1E 4KP0A 1GMDF 1GJ5H 2UWLA 5E8EH 3LGYA 2BQ6B 1VJ9U 1PPFE 1IQJA 2P16A 1XUJA 4AYYB 3TH4H 1TYNA 1IHSH 1IQLA 5DP7A 1FIZA 4Y0ZE 3T25A 2ZDMA 3TGJE 1EKBB 1K9OE 3OSYA 3VB3A 4D9QA 1C2DA 4SGBE 3WY8A 1UCYH 2ZTZA 3SOSA 3D49H 2PSXA 1WAYB 3LGTA 4WY3A 4BAQB 4CR9A 2ZDNA 2UWOA 3O8RA 4RKJB 2FZZA 1H8IH 1P09A 4FU9A 2PV9B 2A32A 1O2YA 1C4V2 2VVVA 3M3SA 4NIVA 3LGWA 1CHOF 5FCKA 1LVOA 3ZVFA 1SGYE 2CGAA 2V3HH 4Q7YA 1UHBA 1HAZB 1IQHA 3K2UA 2BD2A 4NA8A 1KLJH 3MU8A 2XNIA 4FUJA 2BXTH 3TH2H 3TK6A 2FX6A 2AYWA 3GY5A 3HGNA 3PLKA 1C1RA 3A8CA 2FDAA 2GTBA 1S85A 2FP7B 2XCFA 3RXIA 1INCA 5JB8S 1ZR0A 1QGFA 6CHAB 1ZPZA 3SU4A 3RUOA 2ZGXH 3KQCA 3BTWE 1C5OH 3PTNA 1C5MD 3QUMP 2XC4A 2Z9LA 5EU8A 1YYY1 4K69A 2OLGA 4IGDA 1K1OA 1NRNH 1C2JA 2FOHA 4WMDA 3BTEE 1ZSJA 2UWPA 3PM3A 1WYKA 3FP6E 1MTNC 3KEEA 1IQMA 3KQDA 1P05A 1BQYA 1C5UA 2G52A 7GCHF 1L0ZA 1V2RT 4FUFA 2FYRA 4Y8XA 4AFZA 2G5NA 4MPUA 3UOPA 3BIVH 3HATH 1DLEA 3B9FH 1GHYH 1LKBA 2CHAB 5AHGH 1Y59T 3RXGA 2GCTB 1CU1A 1GI7B 1QQ4A 3KN2A 1TOCB 1L1GA 3S7KB 3GY3A 1KXDA 1WQSA 1NZQH 1XUIA 1GI9B 2AGIX 3SU5A 1YKTA 2GDDA 2FOEA 2BDBA 5DP8A 1A0LA 1OP8A 4JK6A 1TNIA 3T62A 3VXEH 2Y80A 1C1NA 1BITA 1KIGH 1ACBE 3A84A 1V2VT 2PWXA 1O5AB 1Z7KA 3VGCB 3RM0H 2ILNA 3ZVCA 4LZ1H 1MQ6A 2HLCA 1TB6H 2BQWB 1UTNA 4OS6A 2VU8E 3T29A 2B0FA 1G37A 1UJ1A 2ZHWH 1DWBH 3C1KA 1ZRKA 5FAHA 2FYQA 2WV5A 3U9AH 1FJSA 1K1PA 3KF2A 2J2UA 1YBWA 1GHWH 3TVJB 3ATKA 1ESTA 1AFQB 1BZXE 1ZTJA 1WCZA 1PPHE 1XUKA 1G3BA 2TGTA 1UHBB 1V2LT 1GJ8B 4U32A 4TPIZ 1FUJA 1GBJA 3RXJA 1HAOH 2AERH 2J94A 3AVZA 5J4SA 1DE7H 1QBVH 1IQGA 1RD3B 2BD7A 1C5SA 3TGIE 2QN5T 4MDSA 2PLXA 5C1UA 1O2TA 1CT2E 3RXCA 2BLVA 4X1RU 2QXJA 1FAXA 1BMLA 2TGDA 2ZU2A 2Y5FA 4X8UH 1YF4A 1SB1H 4IN2A 1GBHA 1L4ZA 4AG1A 4CH2B 1FMGA 1BBRK 1YCPH 1RTFB 2OINA 3V7TA 1O2KA 2UUJB 2FESH 1AUTC 3A7YA 1ANEA 2F9BH 3A81A 4INHA 1P10A 4BOHA 1OP0A 1DWCH 2QA9E 2OUAA 4ZKSU 5I46H 5EW1H 4TPYA 1ELCA 1B0EA 2BDCA 1D3QB 4I8GA 1B7XB 3SN8A 1QTFA 1C2EA 2FTMA 1O2RA 3P92A 1SGTA 2BYAX 2WYGA 2A7CA 3BTFE 1TNJA 6GCHG 2GCHF 3B8JA 5EXLA 4YLUA 4I8KA 1K22H 1PYTD 4JZDH 2WUBA 1GHZA 1ELGA 2NU0E 1BUIA 3ZZ4A 4Q7XA 3P17H 1MBQA 3A7TA 4FVBA 1LVYA 4BAMB 1FY1A 4MLFB 2J4IA 2VWLA 4U30A 2ZIQH 2GMTC 4OS7A 3GOVB 4NSYA 1AVWA 1XVMA 3SJOA 2A0QB 1LHEH 2GZ8A 1QB6A 5A0AE 1KXFA 1F5KU 3STJA 1N6YA 2BD5A 1DSTA 2BZ6H 1BIOA 1MTNB 1F0SA 1W8BH 3VEQB 3W95A 3F9FA 4K2YA 1P2KA 5C67A 5FX6A 1Z8GA 5CHAC 3TK5A 4DOQA 1UVPA 1C5RA 2G4UA 4DJZB 2J34A 4Y71A 1O2SA 1C5NH 2SNVA 2STBE 3E91A 1D6RA 3AW1A 2B7DH 2R3UA 5AFZH 1HAIH 1O3JA 2C8WB 4MPXA 2AFQB 1AB9C 2W26A 1HAPH 3RXUA 5GCHF 3FANA 2FWWA 2PTNA 1GBCA 1TPPA 3VB7A 1PQ5A 1Y3YA 3RLYH 3U1IB 2Y6TA 4CRAA 1SFIA 2FODA 2AIPA 1HAXB 4ABBA 2QXIA 1C5PA 4JZFH 1IAUA 3PWBA 3BTGE 1W7GH 2OQUA 4A7IB 3AASA 1D6WA 2IJOB 2O8TA 2PTCE 1Y5UT 4D7GA 1GBKA 1P2NA 3A7WA 3TH3H 1C1QA 1KTTB 3ATWA 2Q6FA 1C5XB 2Y7XA 3BSQA 1W14U 3UR9A 1Q31A 1IQKA 1ELFA 4Y79A 1SI5H 4YOIA 1P2JA 3RXEA 2XWBI 1EAUA 1B0FA 1UVTH 4BXWA 2C8XB 4ABJA 1FXYA 3RXOA 2FTLE 1QIXB 3VB4A 5B6OA 4FUEA 5C1XA 5EOKA 1F0UA 2O8LA 3T2NA 1AUJA 1YLCA 4AB8A 3E0PB 3PMAB 3ZV8A 4ZKOU 5FBEA 4X2YA 4A5TS 2EEKA 2WUCA 2C93B 4I33A 3BEUA 1YLDA 4MQAA 1W2KH 4BXSA 5F03A 2F9PA 4ABIA 1MTSA 3M5LA 3JZ1B 4IW4E 1O37A 3MU1A 1L1JA 3LJJA 1W13U 1AHTH 2P95A 2PR3A 1V6DA 3RXFA 1MUEB 2PSYA 2BXUH 2TIOA 4Q80A 2VWMA 1SFQB 3UIRA 4GPGA 1SQTA 1H1BA 6ESTA 2JH5D 4KTSA 1TNLA 1LPKB 2ODQA 3RM2H 2GKVE 3SU1A 3V3MA 1AMHA 1QB9A 2QCYA 1JXPA 2VWNA 4Y6DA 3SUEA 1RTLA 4I7YH 1Z8RA 4B74A 2HWLB 3SQHE 3TJOA 3D62A 1OWDA 4NIWA 1P04A 4FU8A 1SLVB 2ODYB 1AD8H 2ULLA 1EZXC 1O2PA 2EI6A 1LHFH 4GHQA 2CV3A 3BTHE 1HJAC 3U8OH 2XBWA 3H5CB 1TX7A 3SU6A 3MI4A 1BRUP 3PLBA 2GZ9A 1YPEH 1BTYA 3BEFB 4K1TA 5C5NA 3E90B 1QHRB 2V6NA 3A83A 1A0HB 1CBWB 1SGNE 1EAXA 1EAIA 1C4U2 2D8WA 3EE0B 2GV7A 1TA2A 1ESBA 1SGEE 2GMTB 7LPRA 1W7XH 4FU7A 3D23A 1BHXB 2A2QH 5DP3A 5EPYA 2FMJA 3P6ZB 1S0QA 2VIWA 2SGDE 1HGTH 1NESE 1T8MA 3EA7A 1SLUB 3SGAE 1DSUA 2OC7A 1DT2A 2XC0A 2ZDVH 3A80A 1HBTH 2QF3A 5CHAB 1V2JT 1JWTA 3UY9A 4ZAEA 3S9BA 1MCTA 3RXBA 1BTPA 1NTPA 2RCEA 3UNSA 2QIQA 3GY6A 2ZGJA 4AFSA 1J8AA 2ANKH 1CGIE 5JBBS 4CRDA 2WPIS 3LT3A 1AB9B 4KTCA 3MO9A 4YLQH 3MNXA 1WV7H 3OX7U 3SV9A 1A61H 3EQ0H 4GAWA 2NWNA 1GVZA 2A45B 1GHAF 9ESTA 2XC5A 1ZJDA 2C4FH 2NU2E 1FV9A 3GY8A 1KXAA 1P2OA 1C5ZB 1A3BH 1QL9A 2HRVA 1EAWA 4NWLA 1BMMH 1FY3A 1T32A 2C3SA 1ZTLA 3TNTA 2A2XH 4X1QU 1TGBA 1C5YB 2IPHA 5BPEA 3K9XB 1HJ9A 1GJCB 3A7XA 1DOJA 1ELAA 1GGDB 3RMOH 4E05H 1GG6C 4K60A 2OQ5A 1VCQA 3GYLB 1DX5M 3JZ2B 1VR1H 2OCVB 1DVAH 2BMGB 5TJXA 7ESTE 3RU4D 2FXRA 3MWIU 5JBTA 4H4FA 4ZH8A 5AF9H 1C2LA 1C1OA 5I25A 2C8ZB 3GDUA 2P8OC 1TNKA 3M37A 4M7GA 5JDUB 1ZJKA 4WWYA 3S9AA 4CRFA 1UTPA 3M7TA 4IMQA 1E36B 2ZDAH 3MH4A 1HV7A 1SSXA 3RXLA 3ITIA 1BTXA 2HGTH 5L2YH 1F5LA 1FAKH 1T4UH 5F8TA 3A8AA 1QY6A 3VGCC 5HMAA 2F9UA 1RIWC 2Z9JA 3M7QA 2BQ7B 1P11E 3DT0H 2FOAA 3STIA 1TABE 1C5WB 1KXBA 2FOMB 3SU3A 1DY9A 3UNRA 1H4WA 1HDTH 1LMWB 1VGCC 3ATLA 4K8YA 4FUHA 1VITH 2JKHA 1CHGA 2VJ1A 2ZF0H 3PMHB 2AMQA 2PKSC 1O2GH 4H6TA 3LU9B 5JB9S 2R0LA 2BD9A 1P01A 4WMEA 1O2UA 1HJAB 1AU8A 1V2TT 1G2LA 4NG9H 2FPZA 1BJVA 4AGJA 1YPLH 3BN9A 1J17T 1JOUB 1EB2A 2UUYA 1TX8A 4KTUA 5L6NH 2H2ZA 1BCUH 2K1QA 9LPRA 1SHHB 1G30B 1TX6A 1IQEA 3PB1E 1DDJA 3MMGA 1GBMA 2QC2A 3CS7A 5E2PA 3OY6U 2VH0A 3RXTA 5F8XA 3SU2A 4AOQA 1OSSA 3GDSA 1OXGA 2F9VA 2ZPRA 4JYUH 1HAYB 4ZHMU 1UK3A 1Z6JH 4B2BA 1ELDE 3E16B 3ENSB 4GCHF 1UCYK 3DD2H 3VFEA 1A5IA 4ASHA 3LDXH 3ESTA 2FLBH 1O5GH 1AZZA 1TBZH 2BLWA 3BTKE 2AGEX 1AE8H 3S9CA 4JMYA 4K1EA 5DK1A 1G2MA 1LO6A 1ANBA 3RXKA 3GCTG 2THFB 1BT7A 3I78A 1GI0A 1GJ6A 1C1VH 1CQQA 2EI7A 2CN0H 4O97A 3Q3YA 1GHXH 2EI8A 4FUDA 1AQ7A 1G3EA 1A5GH 1O3CA 2GDEH 2SGQE 4Y76A 2BDGA 4E7NA 1TBRH 3M35A 1ETSH 1DS2E 1O3DA 1O3HA 3GCNA 4ZXXH 1GVKB 2O9QA 3LONA 2XBVA 2C90B 1YPJH 4AFUA 1O3NA 3B23B 5HM9A 3NWUA 1GWAA 4GVUA 1CA8B 1KYNA 1J15A 4MG3A 5EPNA 2STAE 1EOJA 3H7TA 3SNBA 2RG3A 3ZVGA 1NPMA 3RDZA 1C5QA 2VB0A 1EASA 4ABEA 1S84A 2BX3A 2QYIA 2H9TH 5DG6A 1C9PA 3PMBB 1SGQE 1RXPA 1GG6B 4YOGA 3SHAH 5AVDA 1O33A 1SVPA 8GCHG 1Q2WA 3O8CA 1A4WH 4K1SA 5A8YA 2VIQA 4TWYA 1JRTA 4ISNA 3UUZA 5TCAA 2ZU3A 2XXLA 1AWHB 2BVSH 1O3OA 2F9OA 1T8LA 2P8OB 4IMZA 1AY6H 3RC5A 3BF6H 1O39A 2CF8H 1PPEE 1GDUA 1HAVA 4UFEH 1SGPE 1UVOA 5G4BA 1SGRE 1IOEA 1C2IA 1TNGA 1YPGH 2A4RA 1GJ9B 1O3BA 3M5OA 2P94A 1GCTC 1RIWB 3MNSA 1THSH 5ETXA 1IQIA 3EAJA 3TJVA 4Z6AH 4DIIH 3RXAA 5A09A 2PKAB 2A7HA 2KAIB 1C1SA 4FUGA 4LOYH 1UTJA 2FX4A 4Y11E 1TGTA 1O2WA 3E0NB 5FPSA 1VGCB 1GI8B 1O3KA 1P9SA 1VJAU 1BRBE 2PKSB 1G3CA 4CH8B 1GJAB 2BY7X 5C3NA 3GCHC 1PPZA 1HCGA 3SJ9A 3S69A 1OS8A 2A31A 2PUQH 1GDNA 2GV6A 3OYPA 1OWIA 3OY5U 3U8RH 2WPLS 1LHDH 1FLEE 1TPSA 5FXLA 1UTQA 5IYTA 1WTGH 2NU3E 1NFWA 3PO1C 1GHBG 2GGVB 2RDLA 2H9EH 2GT7A 2DUCA 3FAOA 3U8TH 4X6PA 1CO7E 1QL8A 2WINI 1EJMA 1THRH 4WH8A 1GMCF 2ALVA 3NXPA 3MH6A 1D4PB 4U01A 1GI2A 1N8OC 1VITG 4TY7A 1XXFA 1O2OA 5GDSH 3RXHA 2ZEBA 1HFDA 3LKWA 1BBRH 3TGKE 5FBIA 1ZHMA 1TQ7B 2P3FH 1ZMJA 1LKAA 3ZZCA 2ANMH 1HAHH 4TY6A 5AFYH 5C2ZA 2EC9H 4X6MA 2OXSA 3CENA 3OU0A 5LPRA 2B9LA 1F5RA 1V2QT 1QBNA 1C2MA 1UK4A 1GMHF 4AN7A 3MU0A 3F1SB 1MCVA 1EJAA 2W3IA 1TE0A 1O3EA 3QDZB 1DICA 4AZ2B 1K21H 2Z3DA 3ODDA 5IDKA 3PYHA 2Y5HA 1HAVB 3E1XB 2ALPA 3ZZDA 3GICB 2F91A 1IHTH 2DE9A 5HXFA 1QL7A 3LC5A 4NFEA 1HXEH 1CBWC 3Q3KA 1SQOA 2F9NA 1O5CB 1KDQA 2GT8A 1BA8B 1O32A 1YGCH 4IN1A 4K5ZA 3KHVA 1JIMA 1GI1A 2ZCLP 1MH0A 1GMDG 1GJDB 2OBOA 2P3TB 2C8YB 1A0JA 2BDHA 4O3UA 5DP6A 1MD8A 4XE4A 3AAUA 1CT0E 1BRAA 1ZHRA 1AIXH 4DURA 3RLWH 4ABFA 4AGKA 1O5EH 2HNTF 2O8WA 1UTKA 1ESAA 1BTZA 1EQ9A 1G9IE 3U98H 1MU8B 2OTVA 5GIBA 3SUGA 4KKDA 2CMYA 3P8NA 4HZHA 2BX4A 4ZHAA 3UWJH 1ZYOA 2BLOA 1CHOG 2W7SA 2OC8A 2CF9H 3M36A 2FIRH 4JYVH 1MTUA 1PPGE 3KNXA 3KQBA 3A7VA 1KXEA 1BDAA 4H6SB 1GJBB 1KLTA 2ZFPH 1SL3A 1PFXC 2ZGBH 2Y82A 1O36A 3SI4H 3Q00A 1GI4A 1TPOA 2AH4X 1ELEE 1GL0E 2XCNA 1H9LB 1MZDA 4AFQA 1MU6B 1K1NA 1GCTB 5T6FA 1O2VA 2OBQA 5GJ4B 4AB9A 4QT8C 4RN6A 2VGCB 3SGQE 1Y3UA 3C27B 5LPFA 1VCPA 2M5TA 3MH5A 4INLA 3LH1A 4Y8ZA 1MKXH 2ZCKP 3T27A 1O2LA 2ZHFH 4MNXA 4WVPE 2R9PA 1MTVA 1L4DA 5L30H 1G36A 1ETTH 2PUXB 2JH6D 1OPHB 2ZO3H 5FPYA 4A1TA 2FOFA 3FZZA 5K7RA 1Y3VA 5ESBA 4R0IA 1EZUC 3GCHB 4X1NU 5JPMH 1S81A 1GGDC 4ISHH 1ABIH 3CS0A 4IBLH 3PMJA 1BOQA 4AX9H 2A1DB 1D9IA 1O35A 3RMNH 1IQFA 1QJ1B 2ZGHA 2Q6DA 2ZU4A 3PO1B 1LPZB 1VZQH 5EQSA 4X6NA 1KDQB 1S83A 2PGQB 2V35A 2QGRA 5GPIB 3SJKA 1GVLA 4GSOA 1N8OB 5E2OA 3A82A 4ABDA 4A92A 2ZCHP 1SGIB 3H7OA 1GBIA 4WJG2 1QRZA 4CHAC 5LPEA 3DA9B 4J2YB 3ZV9A 1N1LA 3UNQA 1OWHA 4B71A 1QFKH 3TLOA 3LPRA 5F6MA 1RRKA 1LCYA 3MU4A 1NRPH 1UTMA 1DXWA 3HPTB 3SUDA 1NRSH 1UVSH 2V0BA 1ZOMA 1S5SA 4ZROA 4RSPA 1EXFA 1GBTA 3SORA 4WXVA 4Y7AA 1SGFG 3ZYEA 2F83A 2HALA 4CBNA 1K1IA 5DP9A 5FHTA 1XUFA 1CGJE 3UPEA 4UFGH 1TGNA 2A5AA 1EOLA 1O0DH 3I29A 4WH6A 3LH3A 4FXGH 4ZMAH 2ZKSA 1DWEH 2BVRH 1TGCA 2Z3CA 1T8NA 3BV9B 3K6YA 4UDWH 2EA3A 4CRGA 1JMOH 1H9HE 2ZGCA 5HM2A 4U2WA 4DW2U 1SOZA 3DFJA 1TFXA 2FLRH 2R3YA 1C2GA 3QGJA 2UUFB 1C9TA 3BG4B 2H1UA 1K1LA 3ELAH 1EUFA 3SJIA 1G32B 3RC6A 5A8ZA 2BLQA 3SV2H 1EZQA 1S82A 2P93A 1YCPM 3E3TA 4GLYA 1O30A 5C1YA 4NZLA 3AAVA 4D76A 1FPCH 3NPSA 3MTYA 1JRSA 1XMNB 2ZG0H 2GP9B 1AKSB 4X8SH 2GVFA 2G55A 4JCNA 4XBBA 1QRWA 1V2WT 2BVXH 3L6PA 2ZHDA 1HYLA 1FIWA 2CXVA 4ZXYH 1GBLA 2XRCA 4ZKRU 2GCHG 3ZYDA 2WPHS 3FZDA 1ELTA 3EA8A 1Y3WA 2W5EA 3URDA 1M9UA 1RS0A 1PYTC 8GCHF 2ZPSA 3ZZ5A 4MPVA 2GD4B 1NM6A 2R2WU 3DFLA 4AORA 1XXDA 3LGIA 1DITH 2QF0A 1O2XA 1SBWA 2VVCA 1TMTH 1TWXB 1OYQA 1FZZA 1OOKB 1V2NT 1XX9A 4LZ4B 5C20A 1GI3A 4NZQA 1ABJH 4X2XA 3M5MA 1BJUA 1ZSKA 2FI5E 3RXVA 3BTTE 4IC6A 1GBFA 1OWEA 5CE1A 3IG6B 1FN8A 1UTOA 3M3VA 1KLIH 2ZC9H 2G00A 4X2VA 1Z71A 1TOMH 3MNBA 3TNSA 1SLWB 3FP8E 5EODA 2XBYA 1LPGB 1BTUA 4OGYA 1ETRH 2G81E 4GUXA 3F68H 2CJIA 2TGPZ 2I6QA 5JYIA 1T31A 3NUMA 3SV7A 1F2SE 5H4IB 2VVUA 3TIUA 5E0JA 5BRRE 2LPRA 7KMEH 1C2HA 1OKXA 5DGJA 3SHCH 3L3TA 1X7AC 5GCHG 5HGGA 3PROA 3NCLA 3TJNA 3RXPA 2OC1A 3MYWA 1UTLM 2FO9A 1TALA 2ZECA 3T5FH 1MKWK 8ESTE 2VIVA 1GI6A 1BBRE 5LGOA 1P3CA 1O3AA 1GHBF 2Q1JA 4CHAB 1Z1IA 4VGCC 4DVAU 4FVDA 1EX3A 2XYAA 4UE7H 1J14A 5DJ7A 3A89A 4NIXA 3GY4A 3ZZ8A 1AN1E 1FNIA 4NA9H 2WPKS 1O5BB 2VIOA 2OC0A 1S6HA 2JETC 4I8LA 4TYDA 4XDEA 3T26A 1DY8A 3Q76A 2Y7ZA 1LQDB 3I77A 1XKBC 1ANCA 1ZRBA 4JZ1A 4CREA 2ZFQH 1T7CA 3DHKH 2O8MA 1P2QA 3S0NA 3E6PH 4XSKU 1XVOA 3ZVBA 4Z0KA 2Z7FE 2SGFE 3QZRA 1V3XA 5EXMA 3VXFH 3RU4E 3HKIB 1GI5A 1TLDA 2VNTA 4NA7A 1NS3A 1FY8E 4X1SU 1A3EH 4BTUB 1F7ZA 1O2ZA 6GCHF 1Y8TA 4UONA 1MQ5A 2G8TA 1TQ0B 1O3MA 4X8VH 4CR5A 1K28D 3F9EA 2LNCA 3URCA 3M61U 1Z8JB 1NY22 2A4QA 1CT4E 5EQQA 1HIAB 2VIDA 2AMDA 2P3UB 1G3DA 5ABWA 1BMAA 1GHVH 2HPQH 4O03A 3MNCA 2QV1A 3HK6B 3RC4A 3RMMH 2BY5X 4H42U 2PKAA 3TK9A 2KAIA 1FY4A 3CP7A 3T28A 2WPJS 1P8VC 1XKAC 1MAYA 2BD3A 2SGAA 3V0XA 2BD4A 2Z94A 5J4QA 1T8OA 1A2CH 2HNTE 1NU9A 3BTQE 1C2FA 2A4OA 3VB5A 1AI8H 3RP2A 3UREA 1TBQH 3BEIB 1AGJA 3P70B 2QXGA 2ASUB 5EG4A 3IITA 1HLTH 3UWIA 1V2ST 2FI4E 4Y10E 3RXQA 2ZU1A 1V2PT 2BY8X 3DUXH 5DO4H 1TRYA 1YPHE 4IC5A 4Q7ZA 2FI3E 1ZPCA 3L33A 2ZQ1A 4B73A 1EZSC 2A5IA 4WMFA 1RTKA 3KQEA 1YC0A 1ZHPA 1NO9H 6LPRA 2Y81A 4K3JA 4DT7B 3FVFB 1VCWA 2Z3EA 3ODFA 1Y5AT 3SGBE 1D3DB 3NZIA 4NFFA 4NSVA 2QAAA 1QRXA 4UEHH 4E7RG 1TONA 2TGAA 1W12U 2HPPH 1SLXB 4GHTA 4MNVA 1A1RA 1ZGVA 1F0TA 1QQUA 1O38A 3QGNB 1QR3E 3UOUA 1EPTC 3F9HA 1P2MA 4HTCH 3R0FA 1L1NA 2J9NA 2G5VA 1ARBA 4O9VA 1AFEH 1O3GA 2BB4A 1SGDE 3P95A 1P57B 5GWZA 4KGAA 3MH7A 2AIQA 1GHAG 2BD8A 4X6OA 1Y3XA 3QTVH 3VB6A 3R3GB 4Y0YE 3F9GA 1DLKB 4VGCB 3SU0A 1QA0A 4UFFH 2VGCC 1TA6A 1V2KT 3RXSA 2WYJA 4PROA 1SR5C 1QBOA 3M7UA 1EATA 1E38B 3K6ZA 1KY9A 1T4VH 4UFDH 2JETB 1Q3XA 1ZZZA 2O8UA 1AE5A 4X1PU 1YPKH 2YNBA 4DGJA 1P2IA 1CA0C 2H9HA 1NT1A 3SNDA 4BANB 4FUIA 1OWKA 2F3CE 4BTTB 2FS9A 1WTHD 5E0HA 1O5FH 3BTME 1P03A 5F8ZA 2ZDKA 5DP4A 3RXDA 1P0SH 1FONA 1EPTA 2OD3B 1KSNA 5TCCA 1HRTH 1SC8U 1CSOE 4DY7B 2VINA 1SGFA 1WUNH 2ZQ2A 4JK5A 3RU4T 5A0CA 2Y5GA 1O2IA 3Q3XA 3V13A 3QX5H 3NK8A 2WPMS 2OP9A 1A5HA 1RFNA 1YCPK 3O8BA 4OS4A 4BAOB 2J38A 3U1JB 1K2I1 2FM2A 2Z9GA 3EGKH 2W3KA 4O3TA 5EGMA 2RA3A 3SZNA 1LVBA 1YP9A 4B75A 2NU4E 5EQRA 4F4OC 1K1MA 1NFUA 1TIOA 3K65B 3PWCA 4MVNA 1O3PB 8LPRA 1C1MA 1KXCA 1UMAH 2HNTC 1C1PA 1RJXB 2J92A 4ABAA 1THPB 1SGCA 3ZZBA 4B2AA 5FCRA 4E06H 5PTPA 1FPHH 2B8OH 2ODPA 4MNYA 3SQEE 1DUEA 4LK4A 1DM4B 1W3CA 4DIHH 1TPAE 2ZFTA 2R0KA 4ESTE 4R8TB 3ZVEA 4I31A 4DG4A 4RKOB 1YPHC 4NIYA 3UQOA 4TWWA 2G51A 1QCPA 1CVWH 2HOBA 1C1WH 2ZHQH 2ZDLA 2ZP0H 3KGPA 1C1TA 1FY5A 1XUGA 2FOGA 2BOKA 2ESTE 3KCGH 1J9CH 3ATMA 1E0FD 1O2QA 3BG4C 4Q2KA 2TRMA 4A1VA 4B2CA 3QN7A 3LGUA 4Y7BA 4NCYA 1DANH 1NFYA 3EYDA 3GDVA 5ESTE 1BTHH 2H6MA 1TMBH 5JBAS 2BOHB 4GCHG 1O2HA 2WV4A 1LVMA 4B76A 4CRCA 4HGCA 4OS1A 5FPTA 4AYVB 1JIRA 5T6DA 3D65E 3PLPA 1EPTB 4SGAE 3SO3A 5DKMA 4J1YA 3EA9A 2BDIA 1FQ3A 4YT7H 3BIUH 1GDQA 3MO3A 1ELBA 1P9UA 4CBOA 3W94A 2YNAA 1ZLRA 2TPIZ 4JYTA 2DE8A 4I32A 3S7HB 1XUHA 1QB1A 1UO6A 3F6UH 4K8BA 4I8HA 1DPOA 2BTCE 1MTWA 3G01A 3MU5A 2HVXA 1NN6A 4OS5A 2A7JA 2QY0B 2ANWA 4KELA 1GBAA 1SPJA 1WOFA 2R2MB 1B5GH 3KL6A 1BHXF 1GBEA 4YZUA 1D3PB 5C5OA 2Q6GA 5T6GA 1NRRH 1MBMA 1MKXK 4HI3A 2BHGA 3QO6A 3P8GA 2VIPA 7GCHG 1ZPBA 1U6QA 1CA0B 1TNHA 1ZMLA 4X0WU 4A6LA 1MMJN 2AMPA 2SGPE 2RA0A 1W11U 3A87A 3GCOA 4INKA 2AEIH 3ZVAA 1LHCH 1AKSA 1UVUH 5K0HA 3TITA 4ABGA 3A86A 1HUTH 1A46H 1SQAA 2D2DA 5SGAE 3U69H 4YT6H 4WXIA 4AG2A 5EW2H 4D7FA 3M5NA 1TGSZ 4HFPB 4WF8A 3EDXB 4ZUHA 3SW2B 2FOCA 3ZZAA 1GBBA 4LXBH 1Z1JA 2D1JA 1O31A 1AWFH 1TMUH 1Z8IB 4BTIB 4F49A 1ZSLA 2GX4A 2A4GA 1HJ8A 2ZHEH 3VPKA 4UD9H 1DFPA 1ZMNA 3SNAA 3O8DA 3TU7H 1NU7B 1HPGA 2BZAA 1PQAA 3TPIZ 1HXFH 4FUCA 1A7SA 2Z9IA 1NROH 4MTBA 1FN6A 1ARCA 1TAWA 2QXHA 5HYOA 1QA7A 2JH0D 2XTTB 1QJ7B 2I6SA 3OTJE 1O3FA 1O3LA 1UCYE 3SV8A 1AO5A 1LHGH 4DCDA 4ISOA 1LTOA 3ZZ9A 4B1TA 2ZTXA 2ZNKH 1GL1A 3ZZ3A 3SI3H 1MZAA 1GPZA 1QNJA 4X2WA 3N7OA 2ZFSA 1XM1A 2AS9A 1O3IA 1C4Y2 2H5CA 1PJPA 1ANDA 3HKJB 5A2MH 3ZZ6A 1PPCE 5CMXH 2VWOA 2AGGX 2IOTA 1E34B 4IS5A 2ZFFH 4MNWA 2W7UA 3GCTF 5GXPA 3LIWA 1C1UH 5FX5A 1TRNA 1WU1A 3TJUA 1GMCG 1AZ8A 2P59A 1SOTA 2XW9A 3KIDU 1ID5H 1EP5A 4X8TH 2IN2A 1YPMH 1WSSH 2GZ7A 1P06A 3AW0A 1MAXA 1EP6A 1K1JA 1SG8B 3Q77A 2ZI2H 1W0ZU 1FDPA 1ZGIA 1GBDA 1EJNA 1RGQA 1F92A 3P8FA 4CRBA 1LQEA 3LGVA 1P3EA 1CE5A 1J16A 8KME2 1H8DH 1S6FA 2A5KA 1O2NA 3PTBA
chains in the Genus database with same CATH superfamily
1BTWA 3LJOA 1PQ8A 2D26C 3IWMA 1GMHG 5DP5A 3SNEA 4ZKNU 2BDYA 3A8DA 3M3TA 1OP2A 4ZHLU 1MD7A 1P12E 4NGAH 1O34A 3UR6A 4YTAA 4MPWA 2Z6BD 2SGEE 1DWDH 1BMNH 1L2EA 3RXMA 5A8XA 1ORFA 1C2KA 2VH6A 1OWJA 2Z9KA 1YM0A 1V2UT 5KGOA 4OGXA 1C5TA 2ZPQA 3BG8A 2PFEA 1S0RA 2ZZUH 3RMLH 3QWCH 2M2AA 1DXPA 2UUKB 3A8BA 1C5VA 2TBSA 2ZWLH 2PHBA 3BTDE 2FEQH 3QLPH 1HIAA 6CHAC 1NRQH 1QJ6B 2BY6X 2FOBA 3HK3B 3ZZ7A 5EXNA 1EB1H 4FUBA 2BM2A 1O2MA 1W10U 1V2OT 4NWKA 1OX1A 1WQVH 3UQVA 4I86A 4JZEH 4ABHA 2ANYA 1QURH 1ZTKA 2XWAA 2BDAA 3MO6A 2G4TA 3GS9A 5L2ZH 3N7EA 3MFJA 1Y5BT 2YOLA 3FFGA 1HB0B 3UFAA 3F0PA 5E0GA 3DSPA 1UK2A 1BB0B 3GY7A 1QZ8A 1H9IE 3A88A 5DN6D 4XBCA 1E37B 1JBUH 1KTSB 3QTOH 2SFAA 1ELVA 3A7ZA 3E8LA 2CHAC 2ZU5A 4YESB 4YM9A 2GCTC 3SUFA 1CGHA 3MOCA 1NC6A 1O2JA 1AVGH 3ATIA 3PV4A 4Y8YA 3HGPA 3GYMA 4XOJA 4YO9A 3SJ8A 4THNH 3P8OA 2PW8H 1MKWH 3A85A 5LH8A 3LOXA 4BNRA 4I8JA 3SNCA 5C94A 1VITF 1W0JD 2KR7A 1GCDA 1O5DH 3GISB 3LC3A 4XRNA 1IQNA 3MHWU 2V3OH 1E35B 1D3TB 1F0RA 2B5TB 3UTUH 2XBXA 1OYTH 1Z6EA 4XBDA 2YMSC 4YOJA 2ZTYA 1TRMA 3QK1A 5JBCS 4OS2A 4ACBA 1NFXA 4BAHB 1GJ4H 3V12A 1DUAA 1N6XA 2ZFRH 4BAKB 1AFQC 4A1XA 3SV6A 2H5DA 1HNEE 5A0BA 1AVXA 4ISIH 3GY2A 2PGBB 1SMFE 4D9RA 1PPBH 2FS8A 1W0YH 3SBKA 4D8NA 3QZQA 3FP7E 4ISLA 3ZVDA 2ZA5A 1GJ7B 1HAGE 1WBGB 1BRCE 4ASUD 1SHYA 2L74A 1P02A 2J95A 2LP6A 4XFQA 1LDTT 2BY9X 5DPAA 3RXRA 1V2MT 2SNWA 3NKKA 1FI8A 1PQ7A 1C5LH 4JZIA 5T3HA 2NU1E 4KP0A 1GMDF 1GJ5H 2UWLA 5E8EH 3LGYA 2CK3D 2BQ6B 1VJ9U 1PPFE 1IQJA 2P16A 1XUJA 4AYYB 3TH4H 1TYNA 1IHSH 1IQLA 5DP7A 1FIZA 4Y0ZE 3T25A 2ZDMA 3TGJE 1EKBB 1K9OE 3OSYA 3VB3A 4D9QA 1C2DA 4SGBE 3WY8A 1UCYH 3PRDA 2ZTZA 3SOSA 3D49H 2PSXA 1WAYB 3LGTA 4WY3A 4BAQB 4CR9A 2ZDNA 2UWOA 3O8RA 4RKJB 2FZZA 1H8IH 1P09A 4FU9A 2PV9B 2WPDD 2A32A 1O2YA 1C4V2 2VVVA 3M3SA 4NIVA 3LGWA 1CHOF 5FCKA 2W6ID 1LVOA 3ZVFA 1SGYE 2CGAA 2EY4C 1SQRA 2V3HH 4Q7YA 1UHBA 1HAZB 1IQHA 3K2UA 2BD2A 4NA8A 1KLJH 3MU8A 2XNIA 4FUJA 2BXTH 3TH2H 3TK6A 2FX6A 2AYWA 3GY5A 3HGNA 3PLKA 1C1RA 3A8CA 2FDAA 2GTBA 1S85A 2FP7B 2XCFA 3RXIA 1INCA 5JB8S 1ZR0A 1QGFA 6CHAB 1ZPZA 3SU4A 3RUOA 2ZGXH 3KQCA 3BTWE 1C5OH 3EE7A 3PTNA 1C5MD 3QUMP 2XC4A 2Z9LA 5EU8A 1YYY1 4K69A 2OLGA 4IGDA 1K1OA 1NRNH 1C2JA 2FOHA 3F2FA 4WMDA 3BTEE 1ZSJA 2UWPA 3SYJA 3PM3A 1WYKA 3FP6E 1MTNC 3KEEA 1IQMA 3KQDA 1P05A 1BQYA 1C5UA 2G52A 7GCHF 1L0ZA 1V2RT 4FUFA 2FYRA 4Y8XA 2KZ4A 3VG8A 3AK5A 4AFZA 2G5NA 4MPUA 3UOPA 3BIVH 3HATH 1DLEA 3B9FH 1GHYH 1LKBA 2CHAB 5AHGH 1Y59T 3RXGA 2GCTB 1CU1A 1GI7B 1QQ4A 3KN2A 1TOCB 1L1GA 3S7KB 3GY3A 1KXDA 1WQSA 2VBCA 1NZQH 1XUIA 1GI9B 2AGIX 3SU5A 4TT3D 1YKTA 2GDDA 2FOEA 2BDBA 5DP8A 1A0LA 1OP8A 4JK6A 1TNIA 3T62A 3VXEH 2Y80A 1C1NA 1BITA 1KIGH 1ACBE 3A84A 1V2VT 2PWXA 1O5AB 1Z7KA 3VGCB 3RM0H 2ILNA 3ZVCA 4LZ1H 1MQ6A 2HLCA 1K0HA 1TB6H 2BQWB 1UTNA 4OS6A 2VU8E 2YMSB 3T29A 2B0FA 1G37A 1UJ1A 2ZHWH 1DWBH 3C1KA 1ZRKA 5FAHA 2FYQA 2WV5A 3U9AH 1FJSA 1K1PA 3KF2A 2J2UA 1YBWA 1GHWH 3CNRA 3TVJB 3ATKA 1ESTA 1AFQB 1BZXE 1ZTJA 1WCZA 1PPHE 1XUKA 1G3BA 2TGTA 1UHBB 1V2LT 1GJ8B 4U32A 4TPIZ 1FUJA 1GBJA 3RXJA 1HAOH 2AERH 2J94A 3AVZA 5J4SA 3DCLA 1DE7H 1QBVH 1IQGA 1RD3B 2BD7A 1C5SA 3TGIE 2QN5T 4MDSA 2PLXA 5C1UA 1O2TA 1CT2E 3RXCA 2BLVA 4X1RU 2QXJA 1FAXA 1BMLA 2TGDA 2ZU2A 2Y5FA 4X8UH 1YF4A 1SB1H 4IN2A 1GBHA 1L4ZA 4AG1A 4CH2B 1FMGA 1BBRK 1YCPH 1RTFB 2OINA 3V7TA 1O2KA 2UUJB 2FESH 1AUTC 3A7YA 1ANEA 2F9BH 2KCPA 3A81A 4INHA 1P10A 4BOHA 1OP0A 1DWCH 2QA9E 2OUAA 4ZKSU 5I46H 5EW1H 4TPYA 1ELCA 3DSOA 1B0EA 2BDCA 1D3QB 4I8GA 1B7XB 3SN8A 1QTFA 1C2EA 2FTMA 1O2RA 3P92A 1SGTA 2BYAX 2WYGA 2A7CA 3BTFE 1TNJA 6GCHG 2GCHF 3B8JA 5EXLA 4YLUA 5EIYA 4I8KA 1K22H 1PYTD 4JZDH 2WUBA 1GHZA 1ELGA 2NU0E 1BUIA 3ZZ4A 4Q7XA 3P17H 1MBQA 3A7TA 4FVBA 1LVYA 4BAMB 5EJ1A 1FY1A 4MLFB 2J4IA 2VWLA 4U30A 2ZIQH 2GMTC 3FN8A 4OS7A 3GOVB 4NSYA 1AVWA 1XVMA 3SJOA 2A0QB 1LHEH 2GZ8A 1QB6A 5A0AE 1KXFA 1F5KU 3STJA 1N6YA 2BD5A 1DSTA 2BZ6H 1BIOA 1MTNB 1F0SA 1W8BH 3VEQB 3W95A 3F9FA 4K2YA 1P2KA 5T1VA 5C67A 5FX6A 1Z8GA 5CHAC 3TK5A 4DOQA 1UVPA 1C5RA 2G4UA 4DJZB 2J34A 4Y71A 1O2SA 1C5NH 1EFRD 2SNVA 5KEDA 2STBE 3E91A 1D6RA 3AW1A 2B7DH 2R3UA 5AFZH 1HAIH 1O3JA 2C8WB 4MPXA 2AFQB 1AB9C 2W26A 1HAPH 3RXUA 5GCHF 1S6LA 3FANA 2FWWA 2PTNA 1GBCA 1TPPA 2F4LA 3VB7A 1PQ5A 1Y3YA 5B6LA 3RLYH 3U1IB 2Y6TA 4CRAA 1SFIA 2FODA 2AIPA 1HAXB 4ABBA 2QXIA 1C5PA 4JZFH 1IAUA 3PWBA 3BTGE 1W7GH 2OQUA 4A7IB 3AASA 1D6WA 2IJOB 2O8TA 2PTCE 1Y5UT 4D7GA 1GBKA 1P2NA 3A7WA 3TH3H 1C1QA 1KTTB 3ATWA 2Q6FA 1C5XB 2Y7XA 3BSQA 1W14U 3UR9A 1Q31A 1IQKA 1ELFA 4Y79A 1SI5H 4YOIA 1P2JA 3RXEA 2XWBI 3F0OA 1EAUA 1B0FA 1UVTH 4BXWA 2C8XB 3N99A 4ABJA 1FXYA 3RXOA 2FTLE 1QIXB 3VB4A 5B6OA 4FUEA 5C1XA 5EOKA 1F0UA 2O8LA 3T2NA 1AUJA 1YLCA 4AB8A 3E0PB 3F3BA 3PMAB 3ZV8A 4ZKOU 1WXRA 5FBEA 3OEHD 4X2YA 4A5TS 2EEKA 2WUCA 2C93B 4I33A 3BEUA 1YLDA 4MQAA 1W2KH 4BXSA 5F03A 2F9PA 4ABIA 1MTSA 3M5LA 3JZ1B 4IW4E 1O37A 3MU1A 1L1JA 3LJJA 1W13U 1AHTH 2P95A 2PR3A 1V6DA 3RXFA 1MUEB 2PSYA 2BXUH 3OTPA 2TIOA 4Q80A 2VWMA 1SFQB 2J98A 4GPGA 1SQTA 3UIRA 2WSSD 1H1BA 6ESTA 2JH5D 4KTSA 1TNLA 1LPKB 2QF5A 2ODQA 3RM2H 2GKVE 3SU1A 3V3MA 1AMHA 1QB9A 2QCYA 1JXPA 2VWNA 4Y6DA 3SUEA 1RTLA 4I7YH 1Z8RA 4B74A 2HWLB 3SQHE 3TJOA 3D62A 4ACAA 3NRLA 1OWDA 4NIWA 1P04A 4FU8A 3KYFA 1SLVB 2ODYB 1AD8H 2JDID 2ULLA 1EZXC 1O2PA 2EI6A 1LHFH 4GHQA 2CV3A 3BTHE 1HJAC 3U8OH 2XBWA 3H5CB 1TX7A 3SU6A 3MI4A 1BRUP 3PLBA 2GZ9A 1YPEH 2QF4A 1BTYA 3BEFB 4K1TA 5C5NA 3E90B 1QHRB 2V6NA 3A83A 1A0HB 1CBWB 1SGNE 1EAXA 1EAIA 1C4U2 2D8WA 3EE0B 2GV7A 1TA2A 1ESBA 1SGEE 2GMTB 7LPRA 1W7XH 4FU7A 3D23A 1BHXB 2A2QH 5DP3A 5EPYA 5HIZA 2FMJA 3P6ZB 1S0QA 2VIWA 2SGDE 1HGTH 1NESE 1T8MA 3EA7A 3UAIC 1SLUB 3SGAE 1DSUA 2OC7A 1DT2A 2XC0A 2ZDVH 3A80A 1HBTH 2QF3A 1WDIA 5CHAB 1V2JT 1JWTA 3UY9A 4ZAEA 3S9BA 1MCTA 3RXBA 1BTPA 1NTPA 2RCEA 3UNSA 2QIQA 1VKYA 3GY6A 2ZGJA 4AFSA 1J8AA 2ANKH 1CGIE 5JBBS 4CRDA 2WPIS 3LT3A 1AB9B 4KTCA 3MO9A 4YLQH 4Q4LA 3MNXA 1WV7H 3OX7U 3SV9A 1A61H 3EQ0H 4GAWA 2NWNA 1GVZA 2IPQX 2A45B 1GHAF 9ESTA 2XC5A 2RFKC 2J98B 1ZJDA 2C4FH 2NU2E 1FV9A 3PRBA 3GY8A 1KXAA 1P2OA 1C5ZB 1A3BH 1QL9A 2HRVA 1EAWA 4NWLA 1BMMH 1FY3A 1T32A 2C3SA 1ZTLA 3TNTA 2A2XH 4X1QU 1TGBA 1C5YB 2IPHA 5BPEA 3K9XB 1HJ9A 1GJCB 3A7XA 1DOJA 1ELAA 1GGDB 3RMOH 4E05H 1GG6C 4K60A 2OQ5A 1VCQA 3GYLB 1DX5M 3ZIAD 3JZ2B 1SKYE 1VR1H 2OCVB 1DVAH 2BMGB 5TJXA 7ESTE 3RU4D 2FXRA 3MWIU 5JBTA 4H4FA 4ZH8A 5AF9H 1C2LA 1C1OA 5I25A 2C8ZB 3GDUA 2P8OC 1TNKA 3M37A 4M7GA 5JDUB 1ZJKA 4WWYA 3S9AA 4CRFA 1UTPA 3M7TA 4IMQA 1E36B 2ZDAH 3MH4A 3WW7A 1HV7A 1SSXA 3RXLA 2LELA 3ITIA 1BTXA 2HGTH 5L2YH 1F5LA 1FAKH 1T4UH 5F8TA 3A8AA 1QY6A 3VGCC 5HMAA 2F9UA 1RIWC 2Z9JA 3M7QA 2BQ7B 1P11E 3DT0H 2FOAA 3STIA 1TABE 1C5WB 1KXBA 2FOMB 3SU3A 1DY9A 3UNRA 1H4WA 1HDTH 1LMWB 1VGCC 3ATLA 4K8YA 4FUHA 1VITH 2JKHA 1CHGA 2VJ1A 2ZF0H 3PMHB 2AMQA 2PKSC 1O2GH 4H6TA 3LU9B 3OFND 5JB9S 2R0LA 2BD9A 1P01A 4WMEA 1O2UA 1HJAB 1AU8A 1V2TT 1G2LA 4NG9H 2FPZA 1BJVA 4AGJA 1YPLH 3BN9A 1J17T 1JOUB 1EB2A 2UUYA 1TX8A 4KTUA 5L6NH 2H2ZA 1BCUH 2K1QA 9LPRA 3FO8D 1SHHB 1G30B 1TX6A 1IQEA 3PB1E 1DDJA 3UB0A 3MMGA 1GBMA 2QC2A 3CS7A 5E2PA 3OY6U 2VH0A 3RXTA 5F8XA 3SU2A 4AOQA 1OSSA 3GDSA 1OXGA 2F9VA 2ZPRA 4JYUH 4M9FA 1HAYB 4ZHMU 1UK3A 1Z6JH 4B2BA 1ELDE 3E16B 3ENSB 1MABB 4GCHF 1UCYK 3DD2H 3VFEA 1A5IA 4ASHA 3LDXH 3ESTA 2FLBH 1O5GH 1AZZA 1TBZH 2BLWA 3BTKE 2AGEX 1AE8H 3S9CA 4JMYA 4K1EA 5DK1A 1G2MA 1LO6A 1ANBA 3RXKA 3GCTG 2THFB 1BT7A 3I78A 1GI0A 1GJ6A 1C1VH 4B6EA 1CQQA 2EI7A 2CN0H 2KX4A 4O97A 3Q3YA 1GHXH 2EI8A 4FUDA 1AQ7A 1G3EA 1A5GH 1O3CA 2GDEH 2SGQE 4Y76A 2BDGA 4E7NA 1TBRH 3M35A 1ETSH 1DS2E 1O3DA 1O3HA 3GCNA 4ZXXH 1GVKB 2O9QA 3LONA 2XBVA 2C90B 1YPJH 4AFUA 1O3NA 3B23B 5HM9A 3NWUA 1GWAA 4GVUA 1CA8B 1KYNA 1J15A 4MG3A 1YY3A 5EPNA 2STAE 1EOJA 3H7TA 3SNBA 2RG3A 3ZVGA 1NPMA 3RDZA 1C5QA 2AHME 2VB0A 1EASA 4ABEA 1S84A 2BX3A 2QYIA 2H9TH 5DG6A 1C9PA 3PMBB 1SGQE 1RXPA 1GG6B 4YOGA 3SHAH 5AVDA 1O33A 1SVPA 8GCHG 1Q2WA 3O8CA 1A4WH 4K1SA 5A8YA 2VIQA 4TWYA 1JRTA 4ISNA 3UUZA 5TCAA 2ZU3A 2XXLA 1AWHB 2BVSH 1O3OA 2F9OA 1T8LA 2P8OB 4IMZA 1AY6H 3RC5A 3BF6H 1O39A 2CF8H 1PPEE 1GDUA 1HAVA 4UFEH 1SGPE 1UVOA 5G4BA 1SGRE 1IOEA 1C2IA 1TNGA 1YPGH 2A4RA 1GJ9B 1O3BA 2KFWA 3M5OA 2P94A 1E1RD 1GCTC 1RIWB 2QE7D 3MNSA 1THSH 5ETXA 1IQIA 3EAJA 3TJVA 4Z6AH 4DIIH 1H8HD 3RXAA 5A09A 2PKAB 2A7HA 4P00A 2KAIB 4ZCNA 1C1SA 4FUGA 4LOYH 1UTJA 2FX4A 4Y11E 1TGTA 1O2WA 3E0NB 5FPSA 1VGCB 1GI8B 1O3KA 1P9SA 1VJAU 1BRBE 2PKSB 1G3CA 4CH8B 1GJAB 2BY7X 5C3NA 3GCHC 1PPZA 1HCGA 3SJ9A 3S69A 1OS8A 2A31A 2PUQH 1GDNA 2GV6A 3OYPA 1OWIA 3OY5U 3U8RH 2WPLS 1LHDH 1FLEE 1OHHD 1TPSA 3DSGA 5FXLA 1UTQA 5IYTA 1WTGH 2NU3E 1NFWA 3PO1C 1GHBG 2GGVB 2RDLA 2H9EH 2GT7A 2DUCA 3FAOA 3U8TH 4X6PA 1CO7E 1QL8A 5C0UA 3WWBA 2WINI 1EJMA 1THRH 4WH8A 1GMCF 2ALVA 3NXPA 3MH6A 1D4PB 4U01A 1GI2A 1N8OC 1VITG 4TY7A 1XXFA 5F53A 4XD7D 1O2OA 5GDSH 3RXHA 2ZEBA 1HFDA 3LKWA 1BBRH 3TGKE 5FBIA 1ZHMA 1TQ7B 2P3FH 1ZMJA 1LKAA 4B6FA 3ZZCA 2ANMH 1W0KD 1HAHH 4TY6A 5AFYH 5C2ZA 2EC9H 4X6MA 1NBME 2OXSA 3CENA 3OU0A 5LPRA 2B9LA 1F5RA 1V2QT 1QBNA 1C2MA 1UK4A 1GMHF 4AN7A 3MU0A 3F1SB 1MCVA 1EJAA 2W3IA 1TE0A 1O3EA 3QDZB 1DICA 4AZ2B 1K21H 2Z3DA 3ODDA 5IDKA 3PYHA 2Y5HA 1HAVB 3E1XB 2ALPA 3ZZDA 3GICB 2F91A 1IHTH 2DE9A 5HXFA 1QL7A 3LC5A 2HVYB 4NFEA 1HXEH 1CBWC 3Q3KA 2IJD1 1SQOA 2F9NA 1O5CB 1KDQA 2GT8A 1BA8B 1O32A 1YGCH 4IN1A 4K5ZA 3KHVA 1JIMA 1GI1A 2ZCLP 1MH0A 1GMDG 1GJDB 2OBOA 2P3TB 2C8YB 1A0JA 2BDHA 4O3UA 5DSFA 5DP6A 1MD8A 4XE4A 3AAUA 1CT0E 1BRAA 1ZHRA 3PV5A 1AIXH 4DURA 5GNDA 3RLWH 4ABFA 4AGKA 1O5EH 2HNTF 2O8WA 1UTKA 1ESAA 1BTZA 1EQ9A 1G9IE 3U98H 1MU8B 2OTVA 5GIBA 3SUGA 4KKDA 2CMYA 3P8NA 4HZHA 2BX4A 4ZHAA 3UWJH 1ZYOA 2BLOA 1CHOG 2W7SA 2OC8A 2CF9H 3M36A 2FIRH 4JYVH 1MTUA 1PPGE 3KNXA 4P02A 3KQBA 3A7VA 1KXEA 1BDAA 4H6SB 1GJBB 1KLTA 2ZFPH 1SL3A 5C0TA 1PFXC 2ZGBH 2Y82A 1O36A 3SI4H 3Q00A 1GI4A 1TPOA 2AH4X 1ELEE 1GL0E 2XCNA 1H9LB 1MZDA 4AFQA 1MU6B 1K1NA 1GCTB 5T6FA 1O2VA 2OBQA 5GJ4B 4AB9A 4QT8C 4RN6A 2VGCB 5CHBA 3SGQE 1Y3UA 3C27B 5LPFA 1VCPA 2M5TA 3MH5A 4INLA 3LH1A 4Y8ZA 1MKXH 2ZCKP 3T27A 1O2LA 2ZHFH 4MNXA 4WVPE 2R9PA 1MTVA 1L4DA 5L30H 1G36A 1ETTH 2PUXB 2JH6D 1OPHB 2ZO3H 5FPYA 4A1TA 2FOFA 3FZZA 5K7RA 1Y3VA 5ESBA 4R0IA 1EZUC 3GCHB 2YMSD 4X1NU 5JPMH 1S81A 1GGDC 4ISHH 1ABIH 3CS0A 4IBLH 5CDFE 3PMJA 1BOQA 4AX9H 2A1DB 1D9IA 5KECA 2KM0A 1O35A 3RMNH 1IQFA 1QJ1B 2ZGHA 2Q6DA 2ZU4A 3PO1B 1LPZB 1VZQH 5EQSA 2V3MA 4X6NA 1KDQB 1S83A 2PGQB 2V35A 2QGRA 5GPIB 3SJKA 1GVLA 4GSOA 1N8OB 5E2OA 3A82A 4ABDA 4A92A 2ZCHP 1SGIB 3H7OA 1GBIA 4WJG2 1QRZA 4CHAC 5LPEA 1KMHB 3DA9B 4J2YB 3ZV9A 1N1LA 3UNQA 1OWHA 4B71A 1QFKH 3TLOA 3LPRA 5F6MA 1RRKA 1LCYA 3PV2A 3MU4A 2JJ1D 1NRPH 1UTMA 1DXWA 3HPTB 3SUDA 1NRSH 1UVSH 4Z1MD 2V0BA 1ZOMA 1S5SA 4ZROA 4RSPA 1EXFA 1GBTA 3SORA 4WXVA 4Y7AA 1SGFG 3ZYEA 2F83A 2HALA 4CBNA 1K1IA 5DP9A 5FHTA 1XUFA 1CGJE 3UPEA 4UFGH 1TGNA 2A5AA 1EOLA 3U28C 1O0DH 3I29A 4WH6A 3LH3A 4FXGH 4AC9A 4ZMAH 2ZKSA 1DWEH 2BVRH 1TGCA 2Z3CA 1T8NA 3BV9B 3K6YA 4UDWH 2EA3A 4CRGA 1JMOH 2XNDD 1H9HE 2ZGCA 5HM2A 1E79D 4TSFD 4U2WA 2WHXA 4DW2U 1SOZA 3DFJA 1TFXA 2FLRH 2R3YA 1C2GA 2KCYA 3QGJA 2UUFB 1C9TA 3BG4B 2H1UA 1K1LA 3ELAH 1EUFA 3SJIA 1G32B 3RC6A 5A8ZA 2BLQA 3SV2H 1EZQA 1S82A 2P93A 1YCPM 3E3TA 4GLYA 1O30A 5C1YA 4NZLA 3AAVA 4D76A 1FPCH 3NPSA 3MTYA 1JRSA 1XMNB 2ZG0H 2GP9B 1AKSB 2K8IA 4X8SH 2GVFA 2G55A 4JCNA 4XBBA 1QRWA 1V2WT 2BVXH 3L6PA 2ZHDA 1HYLA 1FIWA 2CXVA 4ZXYH 1GBLA 2XRCA 4ZKRU 2GCHG 3ZYDA 2WPHS 3FZDA 1ELTA 3EA8A 1Y3WA 2W5EA 3URDA 1M9UA 1RS0A 1PYTC 8GCHF 2ZPSA 3ZZ5A 1E1QD 4MPVA 2GD4B 1NM6A 2R2WU 3DFLA 4AORA 1XXDA 3LGIA 1DITH 2QF0A 1O2XA 1SBWA 2VVCA 1TMTH 1TWXB 1OYQA 1FZZA 1OOKB 1V2NT 1XX9A 4LZ4B 5C20A 1GI3A 4NZQA 1ABJH 4X2XA 3M5MA 1BJUA 1ZSKA 2GJGA 2FI5E 3RXVA 3BTTE 4IC6A 1GBFA 1OWEA 5CE1A 3IG6B 1FN8A 1UTOA 3M3VA 1KLIH 2ZC9H 2G00A 4X2VA 1Z71A 1TOMH 3MNBA 3TNSA 1SLWB 3FP8E 5EODA 2XBYA 5FL7D 1LPGB 1BTUA 4OGYA 1ETRH 2G81E 4GUXA 3F68H 2CJIA 2TGPZ 2I6QA 5JYIA 1T31A 3NUMA 3SV7A 1F2SE 5H4IB 1H8ED 2VVUA 3TIUA 5E0JA 5BRRE 2LPRA 7KMEH 1C2HA 1OKXA 5DGJA 3SHCH 3L3TA 1X7AC 5GCHG 5HGGA 3PROA 3NCLA 3TJNA 2RDEA 3RXPA 2OC1A 3MYWA 1UTLM 2FO9A 1TALA 2ZECA 3T5FH 1MKWK 8ESTE 2VIVA 1GI6A 1BBRE 5LGOA 1P3CA 1YLNA 1O3AA 1GHBF 2Q1JA 4CHAB 1Z1IA 4VGCC 4DVAU 4FVDA 1EX3A 2XYAA 4UE7H 1J14A 5DJ7A 3A89A 4NIXA 3GY4A 3ZZ8A 1AN1E 1FNIA 4NA9H 2WPKS 3FOAA 1O5BB 2VIOA 2OC0A 1S6HA 2JETC 4I8LA 4TYDA 4XDEA 3T26A 1DY8A 3Q76A 2Y7ZA 1LQDB 3I77A 1XKBC 1ANCA 1ZRBA 1BMFD 4JZ1A 4CREA 2ZFQH 1T7CA 3DHKH 2O8MA 1P2QA 3S0NA 3E6PH 4XSKU 1XVOA 3ZVBA 4Z0KA 2W6JD 2Z7FE 2SGFE 3QZRA 1V3XA 5EJLA 5EXMA 3VXFH 3RU4E 3HKIB 1GI5A 1TLDA 2VNTA 4NA7A 1NS3A 1FY8E 4X1SU 1A3EH 4BTUB 1F7ZA 1O2ZA 6GCHF 1Y8TA 3FKSD 4UONA 1MQ5A 2G8TA 1TQ0B 1O3MA 4X8VH 4CR5A 1K28D 3F9EA 2LNCA 3URCA 3M61U 1UW7A 4HG6A 1Z8JB 1NY22 2A4QA 1CT4E 5EQQA 1HIAB 2VIDA 2AMDA 2P3UB 1G3DA 5ABWA 1BMAA 1GHVH 2HPQH 4O03A 3MNCA 2QV1A 3HK6B 3RC4A 3RMMH 2BY5X 4H42U 2PKAA 3TK9A 4F55A 2KAIA 5C17A 1FY4A 3CP7A 3T28A 2WPJS 1P8VC 1XKAC 1MAYA 2BD3A 2SGAA 3V0XA 2BD4A 2Z94A 5J4QA 1T8OA 1A2CH 2HNTE 1NU9A 3BTQE 1C2FA 2A4OA 2PP6A 3VB5A 1AI8H 3RP2A 2HLDD 5HKKD 3UREA 1TBQH 3BEIB 1AGJA 3P70B 2QXGA 2ASUB 5EG4A 3IITA 1HLTH 3UWIA 1V2ST 2FI4E 4Y10E 3RXQA 2ZU1A 1V2PT 2BY8X 2XOKD 3DUXH 5DO4H 2WZQA 1TRYA 1YPHE 4IC5A 4Q7ZA 2FI3E 1ZPCA 3L33A 2ZQ1A 4B73A 1EZSC 2A5IA 3F2HA 4WMFA 1RTKA 3OE7D 3KQEA 1YC0A 1ZHPA 1NO9H 6LPRA 3W1EA 2Y81A 4K3JA 4DT7B 3FVFB 1VCWA 2Z3EA 3ODFA 1Y5AT 3SGBE 1D3DB 1YWUA 3NZIA 4NFFA 4F48B 4NSVA 2QAAA 1QRXA 4UEHH 4E7RG 1TONA 2TGAA 1W12U 2HPPH 1SLXB 4GHTA 4MNVA 1A1RA 1ZGVA 1F0TA 1QQUA 1O38A 3QGNB 4Q63A 1QR3E 3UOUA 1EPTC 3F9HA 1P2MA 4HTCH 3R0FA 2WV9A 1L1NA 2J9NA 2G5VA 1ARBA 4O9VA 1AFEH 1O3GA 2BB4A 1SGDE 3P95A 1P57B 5GWZA 4KGAA 3MH7A 2AIQA 1GHAG 2BD8A 4X6OA 1Y3XA 3QTVH 1FX0B 3VB6A 3R3GB 4Y0YE 3F9GA 1DLKB 4VGCB 3SU0A 1QA0A 4UFFH 2VGCC 1TA6A 1V2KT 3RXSA 2WYJA 4PROA 1SR5C 1QBOA 3M7UA 1EATA 1E38B 3K6ZA 1KY9A 1T4VH 4UFDH 5IK2D 2JETB 1Q3XA 1ZZZA 2O8UA 1AE5A 4X1PU 4YXWD 1YPKH 2YNBA 4DGJA 1P2IA 1CA0C 2H9HA 1NT1A 3SNDA 4BANB 4FUIA 1OWKA 2F3CE 4BTTB 2FS9A 1WTHD 5E0HA 1O5FH 3BTME 1NBMD 1P03A 5F8ZA 2ZDKA 5DP4A 3RXDA 1P0SH 1FONA 1EPTA 2OD3B 1KSNA 3OEED 5TCCA 2OK5A 1HRTH 1SC8U 1CSOE 4DY7B 2VINA 1SGFA 1WUNH 2ZQ2A 4JK5A 3RU4T 5A0CA 2Y5GA 1O2IA 3Q3XA 5HIYA 3V13A 3QX5H 3F2GA 3NK8A 2WPMS 2OP9A 1A5HA 1RFNA 1YCPK 3O8BA 4OS4A 4BAOB 2J38A 3U1JB 1K2I1 2FM2A 2Z9GA 3EGKH 2W3KA 4O3TA 5EGMA 2RA3A 3SZNA 1LVBA 1YP9A 4B75A 2NU4E 5EQRA 4F4OC 1K1MA 1NFUA 1TIOA 3K65B 3PWCA 4MVNA 1O3PB 8LPRA 1C1MA 1KXCA 1UMAH 2HNTC 3KQ5A 1C1PA 1RJXB 3WWFA 2J92A 4ABAA 1THPB 1SGCA 3ZZBA 4B2AA 5FCRA 4E06H 5PTPA 1FPHH 2B8OH 2ODPA 4MNYA 3SQEE 1DUEA 4LK4A 1DM4B 1W3CA 4DIHH 1TPAE 2ZFTA 2R0KA 4ESTE 4R8TB 3ZVEA 4I31A 4DG4A 4RKOB 1YPHC 4NIYA 3UQOA 4TWWA 2G51A 1QCPA 1CVWH 2HOBA 1C1WH 2ZHQH 2ZDLA 2ZP0H 3KGPA 1C1TA 1FY5A 1XUGA 2FOGA 2BOKA 2ESTE 3KCGH 1J9CH 3ATMA 1E0FD 1O2QA 3H09A 3BG4C 3SZEA 4Q2KA 2TRMA 4A1VA 4B2CA 3QN7A 3LGUA 4Y7BA 4NCYA 1DANH 2JJ2D 1NFYA 3EYDA 2J5UA 3GDVA 5ESTE 1BTHH 2H6MA 1TMBH 5JBAS 2KCOA 2BOHB 4GCHG 1O2HA 2WV4A 1LVMA 2L6OA 4B76A 4HGCA 4CRCA 4OS1A 5FPTA 4AYVB 1JIRA 5T6DA 3D65E 3PLPA 1EPTB 4SGAE 3SO3A 5DKMA 4J1YA 3EA9A 2BDIA 1FQ3A 4YT7H 3BIUH 1GDQA 4OM9A 3MO3A 1ELBA 1P9UA 4CBOA 3W94A 2YNAA 1ZLRA 2TPIZ 4JYTA 4FETA 2JIZD 2DE8A 4I32A 3S7HB 1XUHA 1QB1A 1UO6A 3F6UH 4K8BA 4I8HA 1DPOA 2BTCE 1MTWA 3G01A 3MU5A 2HVXA 1NN6A 4OS5A 2A7JA 2QY0B 2ANWA 4KELA 1GBAA 1SPJA 1WOFA 2R2MB 1B5GH 3KL6A 1BHXF 1GBEA 4YZUA 1D3PB 5C5OA 2Q6GA 5T6GA 1NRRH 1MBMA 1MKXK 4HI3A 4RT0A 2BHGA 3QO6A 3P8GA 2VIPA 7GCHG 1ZPBA 4FOUC 1U6QA 4DT4A 1CA0B 1TNHA 1ZMLA 4X0WU 4A6LA 1MMJN 2AMPA 2SGPE 2RA0A 1W11U 3A87A 3GCOA 4INKA 2AEIH 3ZVAA 1LHCH 1AKSA 1UVUH 2J97A 5K0HA 3TITA 4ABGA 3A86A 1HUTH 1A46H 1SQAA 2D2DA 5SGAE 3U69H 4YT6H 4WXIA 4AG2A 2V7QD 5EW2H 4D7FA 3M5NA 1TGSZ 4HFPB 4WF8A 3EDXB 4ZUHA 3SW2B 2FOCA 3ZZAA 1GBBA 4LXBH 1Z1JA 2D1JA 1O31A 2F43B 1AWFH 1TMUH 1Z8IB 4BTIB 4F49A 1ZSLA 2GX4A 2A4GA 1HJ8A 2ZHEH 3VPKA 4UD9H 1DFPA 1ZMNA 3SNAA 3O8DA 3TU7H 1NU7B 1HPGA 2BZAA 1PQAA 3TPIZ 1HXFH 4FUCA 1A7SA 3KYGA 1COWD 2Z9IA 1NROH 4MTBA 1FN6A 1ARCA 1TAWA 2QXHA 5HYOA 1QA7A 2JH0D 2XTTB 1QJ7B 2I6SA 3OTJE 1O3FA 1O3LA 1UCYE 3SV8A 1AO5A 1LHGH 3OAAD 4DCDA 4ISOA 1LTOA 3ZZ9A 4B1TA 2ZTXA 2ZNKH 1GL1A 3ZZ3A 3SI3H 1MZAA 2K0QA 1GPZA 1QNJA 4X2WA 3N7OA 2ZFSA 1XM1A 2AS9A 1O3IA 1C4Y2 2H5CA 1PJPA 1ANDA 3HKJB 5A2MH 3ZZ6A 1PPCE 5CMXH 2VWOA 2AGGX 2IOTA 1E34B 4IS5A 2ZFFH 4MNWA 3MQKC 2W7UA 3GCTF 5EJZA 5GXPA 3LIWA 1C1UH 5FX5A 2KCAA 1TRNA 1WU1A 3TJUA 1GMCG 1AZ8A 2P59A 1SOTA 2XW9A 3KIDU 1ID5H 1EP5A 4X8TH 2IN2A 1YPMH 1WSSH 2GZ7A 1P06A 3N7DA 3AW0A 1MAXA 1EP6A 1K1JA 1SG8B 4RT1A 3Q77A 2ZI2H 1W0ZU 1FDPA 1ZGIA 1GBDA 1EJNA 1RGQA 1F92A 3P8FA 4CRBA 1LQEA 3LGVA 1P3EA 1CE5A 1J16A 8KME2 1H8DH 1S6FA 2A5KA 2EQNA 4RI0A 1O2NA 3PTBA
chains in the Genus database with same CATH topology
1BTWA 3LJOA 1PQ8A 2D26C 3IWMA 1GMHG 5DP5A 3SNEA 4ZKNU 2BDYA 3A8DA 3M3TA 1OP2A 4ZHLU 1MD7A 1P12E 4NGAH 1O34A 3UR6A 4YTAA 4MPWA 2Z6BD 2SGEE 1DWDH 1BMNH 1L2EA 3RXMA 5A8XA 1ORFA 1C2KA 2VH6A 1OWJA 2Z9KA 1YM0A 1V2UT 4OGXA 1C5TA 2ZPQA 3BG8A 2PFEA 1S0RA 2ZZUH 3RMLH 3QWCH 2UUKB 1DXPA 3A8BA 1C5VA 2TBSA 2ZWLH 2PHBA 3BTDE 2FEQH 3QLPH 1HIAA 6CHAC 1NRQH 1QJ6B 2BY6X 2FOBA 3HK3B 3ZZ7A 5EXNA 1EB1H 4FUBA 2BM2A 1O2MA 1W10U 1V2OT 4NWKA 1OX1A 1WQVH 3UQVA 4JZEH 4ABHA 2ANYA 1QURH 1ZTKA 2XWAA 2BDAA 3MO6A 2G4TA 5L2ZH 3MFJA 1Y5BT 2YOLA 3FFGA 1HB0B 3UFAA 5E0GA 1UK2A 1BB0B 3GY7A 1H9IE 3A88A 4XBCA 1E37B 1JBUH 1KTSB 3QTOH 2SFAA 1ELVA 3A7ZA 3E8LA 2CHAC 2ZU5A 4YESB 4YM9A 2GCTC 3SUFA 1CGHA 3MOCA 1NC6A 1O2JA 1AVGH 3ATIA 3PV4A 4Y8YA 3HGPA 3GYMA 4XOJA 4YO9A 3SJ8A 4THNH 3P8OA 2PW8H 1MKWH 3A85A 5LH8A 3LOXA 4BNRA 4I8JA 3SNCA 1VITF 3GISB 1GCDA 1O5DH 3LC3A 1IQNA 3MHWU 2V3OH 1E35B 1D3TB 1F0RA 2B5TB 3UTUH 2XBXA 1OYTH 1Z6EA 4XBDA 4YOJA 2ZTYA 1TRMA 3QK1A 5JBCS 4OS2A 1NFXA 4BAHB 1GJ4H 3V12A 1DUAA 1N6XA 2ZFRH 4BAKB 1AFQC 4A1XA 3SV6A 2H5DA 1HNEE 5A0BA 1AVXA 4ISIH 3GY2A 2PGBB 1SMFE 4D9RA 1PPBH 2FS8A 1W0YH 3SBKA 4D8NA 3QZQA 3FP7E 4ISLA 3ZVDA 2ZA5A 1GJ7B 1HAGE 1WBGB 1BRCE 1SHYA 1P02A 2J95A 4XFQA 1LDTT 2BY9X 5DPAA 3RXRA 1V2MT 2SNWA 3NKKA 1FI8A 1PQ7A 1C5LH 4JZIA 5T3HA 2NU1E 4KP0A 1GMDF 1GJ5H 2UWLA 5E8EH 3LGYA 2BQ6B 1VJ9U 1PPFE 1IQJA 2P16A 1XUJA 4AYYB 3TH4H 1TYNA 1IHSH 1IQLA 5DP7A 1FIZA 4Y0ZE 3T25A 2ZDMA 3TGJE 1EKBB 1K9OE 3OSYA 3VB3A 4D9QA 1C2DA 4SGBE 3WY8A 1UCYH 2ZTZA 3SOSA 3D49H 2PSXA 1WAYB 3LGTA 4WY3A 4BAQB 4CR9A 2ZDNA 2UWOA 3O8RA 4RKJB 2FZZA 1H8IH 1P09A 4FU9A 2PV9B 2A32A 1O2YA 1C4V2 2VVVA 3M3SA 4NIVA 3LGWA 1CHOF 5FCKA 1LVOA 3ZVFA 1SGYE 2CGAA 2V3HH 4Q7YA 1UHBA 1HAZB 1IQHA 3K2UA 2BD2A 4NA8A 1KLJH 3MU8A 2XNIA 4FUJA 2BXTH 3TH2H 3TK6A 2FX6A 2AYWA 3GY5A 3HGNA 3PLKA 1C1RA 3A8CA 2FDAA 2GTBA 1S85A 2FP7B 2XCFA 3RXIA 1INCA 5JB8S 1ZR0A 1QGFA 6CHAB 1ZPZA 3SU4A 3RUOA 2ZGXH 3KQCA 3BTWE 1C5OH 3PTNA 1C5MD 3QUMP 2XC4A 2Z9LA 5EU8A 1YYY1 4K69A 2OLGA 4IGDA 1K1OA 1NRNH 1C2JA 2FOHA 4WMDA 3BTEE 1ZSJA 2UWPA 3PM3A 1WYKA 3FP6E 1MTNC 3KEEA 1IQMA 3KQDA 1P05A 1BQYA 1C5UA 2G52A 7GCHF 1L0ZA 1V2RT 4FUFA 2FYRA 4Y8XA 4AFZA 2G5NA 4MPUA 3UOPA 3BIVH 3HATH 1DLEA 3B9FH 1GHYH 1LKBA 2CHAB 5AHGH 1Y59T 3RXGA 2GCTB 1CU1A 1GI7B 1QQ4A 3KN2A 1TOCB 1L1GA 3S7KB 3GY3A 1KXDA 1WQSA 1NZQH 1XUIA 1GI9B 2AGIX 3SU5A 1YKTA 2GDDA 2FOEA 2BDBA 5DP8A 1A0LA 1OP8A 4JK6A 1TNIA 3T62A 3VXEH 2Y80A 1C1NA 1BITA 1KIGH 1ACBE 3A84A 1V2VT 2PWXA 1O5AB 1Z7KA 3VGCB 3RM0H 2ILNA 3ZVCA 4LZ1H 1MQ6A 2HLCA 1TB6H 2BQWB 1UTNA 4OS6A 2VU8E 3T29A 2B0FA 1G37A 1UJ1A 2ZHWH 1DWBH 3C1KA 1ZRKA 5FAHA 2FYQA 2WV5A 3U9AH 1FJSA 1K1PA 3KF2A 2J2UA 1YBWA 1GHWH 3TVJB 3ATKA 1ESTA 1AFQB 1BZXE 1ZTJA 1WCZA 1PPHE 1XUKA 1G3BA 2TGTA 1UHBB 1V2LT 1GJ8B 4U32A 4TPIZ 1FUJA 1GBJA 3RXJA 1HAOH 2AERH 2J94A 3AVZA 5J4SA 1DE7H 1QBVH 1IQGA 1RD3B 2BD7A 1C5SA 3TGIE 2QN5T 4MDSA 2PLXA 5C1UA 1O2TA 1CT2E 3RXCA 2BLVA 4X1RU 2QXJA 1FAXA 1BMLA 2TGDA 2ZU2A 2Y5FA 4X8UH 1YF4A 1SB1H 4IN2A 1GBHA 1L4ZA 4AG1A 4CH2B 1FMGA 1BBRK 1YCPH 1RTFB 2OINA 3V7TA 1O2KA 2UUJB 2FESH 1AUTC 3A7YA 1ANEA 2F9BH 3A81A 4INHA 1P10A 4BOHA 1OP0A 1DWCH 2QA9E 2OUAA 4ZKSU 5I46H 5EW1H 4TPYA 1ELCA 1B0EA 2BDCA 1D3QB 4I8GA 1B7XB 3SN8A 1QTFA 1C2EA 2FTMA 1O2RA 3P92A 1SGTA 2BYAX 2WYGA 2A7CA 3BTFE 1TNJA 6GCHG 2GCHF 3B8JA 5EXLA 4YLUA 4I8KA 1K22H 1PYTD 4JZDH 2WUBA 1GHZA 1ELGA 2NU0E 1BUIA 3ZZ4A 4Q7XA 3P17H 1MBQA 3A7TA 4FVBA 1LVYA 4BAMB 1FY1A 4MLFB 2J4IA 2VWLA 4U30A 2ZIQH 2GMTC 4OS7A 3GOVB 4NSYA 1AVWA 1XVMA 3SJOA 2A0QB 1LHEH 2GZ8A 1QB6A 5A0AE 1KXFA 1F5KU 3STJA 1N6YA 2BD5A 1DSTA 2BZ6H 1BIOA 1MTNB 1F0SA 1W8BH 3VEQB 3W95A 3F9FA 4K2YA 1P2KA 5C67A 5FX6A 1Z8GA 5CHAC 3TK5A 4DOQA 1UVPA 1C5RA 2G4UA 4DJZB 2J34A 4Y71A 1O2SA 1C5NH 2SNVA 2STBE 3E91A 1D6RA 3AW1A 2B7DH 2R3UA 5AFZH 1HAIH 1O3JA 2C8WB 4MPXA 2AFQB 1AB9C 2W26A 1HAPH 3RXUA 5GCHF 3FANA 2FWWA 2PTNA 1GBCA 1TPPA 3VB7A 1PQ5A 1Y3YA 3RLYH 3U1IB 2Y6TA 4CRAA 1SFIA 2FODA 2AIPA 1HAXB 4ABBA 2QXIA 1C5PA 4JZFH 1IAUA 3PWBA 3BTGE 1W7GH 2OQUA 4A7IB 3AASA 1D6WA 2IJOB 2O8TA 2PTCE 1Y5UT 4D7GA 1GBKA 1P2NA 3A7WA 3TH3H 1C1QA 1KTTB 3ATWA 2Q6FA 1C5XB 2Y7XA 3BSQA 1W14U 3UR9A 1Q31A 1IQKA 1ELFA 4Y79A 1SI5H 4YOIA 1P2JA 3RXEA 2XWBI 1EAUA 1B0FA 1UVTH 4BXWA 2C8XB 4ABJA 1FXYA 3RXOA 2FTLE 1QIXB 3VB4A 5B6OA 4FUEA 5C1XA 5EOKA 1F0UA 2O8LA 3T2NA 1AUJA 1YLCA 4AB8A 3E0PB 3PMAB 3ZV8A 4ZKOU 5FBEA 4X2YA 4A5TS 2EEKA 2WUCA 2C93B 4I33A 3BEUA 1YLDA 4MQAA 1W2KH 4BXSA 5F03A 2F9PA 4ABIA 1MTSA 3M5LA 3JZ1B 4IW4E 1O37A 3MU1A 1L1JA 3LJJA 1W13U 1AHTH 2P95A 2PR3A 1V6DA 3RXFA 1MUEB 2PSYA 2BXUH 2TIOA 4Q80A 2VWMA 1SFQB 3UIRA 4GPGA 1SQTA 1H1BA 6ESTA 2JH5D 4KTSA 1TNLA 1LPKB 2ODQA 3RM2H 2GKVE 3SU1A 3V3MA 1AMHA 1QB9A 2QCYA 1JXPA 2VWNA 4Y6DA 3SUEA 1RTLA 4I7YH 1Z8RA 4B74A 2HWLB 3SQHE 3TJOA 3D62A 1OWDA 4NIWA 1P04A 4FU8A 1SLVB 2ODYB 1AD8H 2ULLA 1EZXC 1O2PA 2EI6A 1LHFH 4GHQA 2CV3A 3BTHE 1HJAC 3U8OH 2XBWA 3H5CB 1TX7A 3SU6A 3MI4A 1BRUP 3PLBA 2GZ9A 1YPEH 1BTYA 3BEFB 4K1TA 5C5NA 3E90B 1QHRB 2V6NA 3A83A 1A0HB 1CBWB 1SGNE 1EAXA 1EAIA 1C4U2 2D8WA 3EE0B 2GV7A 1TA2A 1ESBA 1SGEE 2GMTB 7LPRA 1W7XH 4FU7A 3D23A 1BHXB 2A2QH 5DP3A 5EPYA 2FMJA 3P6ZB 1S0QA 2VIWA 2SGDE 1HGTH 1NESE 1T8MA 3EA7A 1SLUB 3SGAE 1DSUA 2OC7A 1DT2A 2XC0A 2ZDVH 3A80A 1HBTH 2QF3A 5CHAB 1V2JT 1JWTA 3UY9A 4ZAEA 3S9BA 1MCTA 3RXBA 1BTPA 1NTPA 2RCEA 3UNSA 2QIQA 3GY6A 2ZGJA 4AFSA 1J8AA 2ANKH 1CGIE 5JBBS 4CRDA 2WPIS 3LT3A 1AB9B 4KTCA 3MO9A 4YLQH 3MNXA 1WV7H 3OX7U 3SV9A 1A61H 3EQ0H 4GAWA 2NWNA 1GVZA 2A45B 1GHAF 9ESTA 2XC5A 1ZJDA 2C4FH 2NU2E 1FV9A 3GY8A 1KXAA 1P2OA 1C5ZB 1A3BH 1QL9A 2HRVA 1EAWA 4NWLA 1BMMH 1FY3A 1T32A 2C3SA 1ZTLA 3TNTA 2A2XH 4X1QU 1TGBA 1C5YB 2IPHA 5BPEA 3K9XB 1HJ9A 1GJCB 3A7XA 1DOJA 1ELAA 1GGDB 3RMOH 4E05H 1GG6C 4K60A 2OQ5A 1VCQA 3GYLB 1DX5M 3JZ2B 1VR1H 2OCVB 1DVAH 2BMGB 5TJXA 7ESTE 3RU4D 2FXRA 3MWIU 5JBTA 4H4FA 4ZH8A 5AF9H 1C2LA 1C1OA 5I25A 2C8ZB 3GDUA 2P8OC 1TNKA 3M37A 4M7GA 5JDUB 1ZJKA 4WWYA 3S9AA 4CRFA 1UTPA 3M7TA 4IMQA 1E36B 2ZDAH 3MH4A 1HV7A 1SSXA 3RXLA 3ITIA 1BTXA 2HGTH 5L2YH 1F5LA 1FAKH 1T4UH 5F8TA 3A8AA 1QY6A 3VGCC 5HMAA 2F9UA 1RIWC 2Z9JA 3M7QA 2BQ7B 1P11E 3DT0H 2FOAA 3STIA 1TABE 1C5WB 1KXBA 2FOMB 3SU3A 1DY9A 3UNRA 1H4WA 1HDTH 1LMWB 1VGCC 3ATLA 4K8YA 4FUHA 1VITH 2JKHA 1CHGA 2VJ1A 2ZF0H 3PMHB 2AMQA 2PKSC 1O2GH 4H6TA 3LU9B 5JB9S 2R0LA 2BD9A 1P01A 4WMEA 1O2UA 1HJAB 1AU8A 1V2TT 1G2LA 4NG9H 2FPZA 1BJVA 4AGJA 1YPLH 3BN9A 1J17T 1JOUB 1EB2A 2UUYA 1TX8A 4KTUA 5L6NH 2H2ZA 1BCUH 2K1QA 9LPRA 1SHHB 1G30B 1TX6A 1IQEA 3PB1E 1DDJA 3MMGA 1GBMA 2QC2A 3CS7A 5E2PA 3OY6U 2VH0A 3RXTA 5F8XA 3SU2A 4AOQA 1OSSA 3GDSA 1OXGA 2F9VA 2ZPRA 4JYUH 1HAYB 4ZHMU 1UK3A 1Z6JH 4B2BA 1ELDE 3E16B 3ENSB 4GCHF 1UCYK 3DD2H 3VFEA 1A5IA 4ASHA 3LDXH 3ESTA 2FLBH 1O5GH 1AZZA 1TBZH 2BLWA 3BTKE 2AGEX 1AE8H 3S9CA 4JMYA 4K1EA 5DK1A 1G2MA 1LO6A 1ANBA 3RXKA 3GCTG 2THFB 1BT7A 3I78A 1GI0A 1GJ6A 1C1VH 1CQQA 2EI7A 2CN0H 4O97A 3Q3YA 1GHXH 2EI8A 4FUDA 1AQ7A 1G3EA 1A5GH 1O3CA 2GDEH 2SGQE 4Y76A 2BDGA 4E7NA 1TBRH 3M35A 1ETSH 1DS2E 1O3DA 1O3HA 3GCNA 4ZXXH 1GVKB 2O9QA 3LONA 2XBVA 2C90B 1YPJH 4AFUA 1O3NA 3B23B 5HM9A 3NWUA 1GWAA 4GVUA 1CA8B 1KYNA 1J15A 4MG3A 5EPNA 2STAE 1EOJA 3H7TA 3SNBA 2RG3A 3ZVGA 1NPMA 3RDZA 1C5QA 2VB0A 1EASA 4ABEA 1S84A 2BX3A 2QYIA 2H9TH 5DG6A 1C9PA 3PMBB 1SGQE 1RXPA 1GG6B 4YOGA 3SHAH 5AVDA 1O33A 1SVPA 8GCHG 1Q2WA 3O8CA 1A4WH 4K1SA 5A8YA 2VIQA 4TWYA 1JRTA 4ISNA 3UUZA 5TCAA 2ZU3A 2XXLA 1AWHB 2BVSH 1O3OA 2F9OA 1T8LA 2P8OB 4IMZA 1AY6H 3RC5A 3BF6H 1O39A 2CF8H 1PPEE 1GDUA 1HAVA 4UFEH 1SGPE 1UVOA 5G4BA 1SGRE 1IOEA 1C2IA 1TNGA 1YPGH 2A4RA 1GJ9B 1O3BA 3M5OA 2P94A 1GCTC 1RIWB 3MNSA 1THSH 5ETXA 1IQIA 3EAJA 3TJVA 4Z6AH 4DIIH 3RXAA 5A09A 2PKAB 2A7HA 2KAIB 1C1SA 4FUGA 4LOYH 1UTJA 2FX4A 4Y11E 1TGTA 1O2WA 3E0NB 5FPSA 1VGCB 1GI8B 1O3KA 1P9SA 1VJAU 1BRBE 2PKSB 1G3CA 4CH8B 1GJAB 2BY7X 5C3NA 3GCHC 1PPZA 1HCGA 3SJ9A 3S69A 1OS8A 2A31A 2PUQH 1GDNA 2GV6A 3OYPA 1OWIA 3OY5U 3U8RH