2FS9A

Human beta tryptase ii with inhibitor cra-28427
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A01
4BTIB 4CH8B 4NSYA 4I8LA 3P8NA 1DUEA 1NT1A 3GCTF 3P6ZB 3U9AH 1GL0E 2CGAA 1O31A 1Z8RA 3FP7E 1N6YA 2FOAA 2BLQA 1A2CH 3A8DA 4DURA 1C5TA 1ZR0A 1G3DA 4UE7H 4X8SH 3UQVA 1D9IA 1EB2A 2P3UB 1TMTH 2O9QA 3M5NA 1PPBH 1BIOA 1AE5A 2R3YA 1SLXB 2SGEE 4KTUA 1KYNA 3P8OA 5T6GA 4D7FA 1NFYA 1ZMJA 2Y81A 4E06H 4Z0KA 2QXIA 1YLDA 1O2NA 1TQ7B 1TOCB 1C9TA 1B5GH 4X1RU 4GUXA 3RU4D 5GXPA 4KKDA 1GJAB 1ZPZA 1HRTH 5ETXA 3D62A 3ZVBA 4HI3A 1C5SA 4LZ1H 1NZQH 5C5NA 1HAGE 1XMNB 1DLEA 3GY7A 1O3IA 4X8TH 2I6SA 3M3TA 1NN6A 1TIOA 1SFIA 2ZU1A 2OINA 1Z6JH 5F8XA 2UWPA 1C5MD 2BQ7B 3RXPA 4TPIZ 2FZZA 2IOTA 1TRYA 4NG9H 3ZVFA 5J4QA 3HPTB 2BDIA 1ZTJA 4Y7AA 1DFPA 1AB9B 1ZRBA 1UCYE 4AFZA 2PLXA 3P95A 4XOJA 1AZ8A 1A61H 1ZJKA 1W3CA 1F0TA 1PYTD 3MO6A 2Y80A 1O3MA 1THPB 1ELEE 1S81A 3NKKA 1S6HA 1O3EA 1SSXA 3DA9B 1GJ7B 1MD7A 3PTBA 1P01A 3C27B 1ZHPA 5GJ4B 2P3TB 1DDJA 4I32A 1P3CA 4MNXA 1YF4A 2O8UA 3R0FA 2G4TA 4ISLA 8GCHF 1BA8B 3SJOA 3MH7A 1ZMNA 2GCTB 1MKWH 1O33A 9LPRA 1EZQA 5A8ZA 1XUJA 2OQUA 1F5KU 3SU1A 1HCGA 4CHAB 3MFJA 1F5LA 2C93B 5FBEA 2FMJA 5ESTE 2YNAA 7ESTE 1IOEA 2W5EA 5LPRA 5AF9H 2VB0A 1AQ7A 4JZ1A 1SGTA 3RXGA 4YESB 3T5FH 4MPWA 1O3PB 2DUCA 3T26A 4AFUA 2AMDA 1FMGA 2Y7XA 2ZC9H 1VITG 2FO9A 1YP9A 2PUQH 5PTPA 2BDCA 1TB6H 1JRSA 3MO9A 3UIRA 1TGSZ 2AERH 1O2OA 5AFZH 1GI9B 3E0PB 4VGCB 4ABHA 4ZHLU 1RTFB 1TBQH 4XE4A 4CR5A 2HOBA 1GI7B 2AMQA 1GI2A 3GYMA 3E91A 3PROA 5EXLA 4TY6A 2G81E 1O36A 3L6PA 4NSVA 1D3QB 4OS6A 5F03A 1C5PA 1NFUA 1LHCH 5BRRE 3W94A 1HJAC 1O5BB 2EC9H 2ESTE 4J2YB 2WYJA 4WH6A 1TA6A 1W0YH 1J9CH 1EPTA 5A8XA 1AE8H 3UWJH 4MVNA 1GVLA 4JYTA 2Z9GA 4Q7ZA 3TPIZ 3WY8A 1SI5H 2TBSA 2GV6A 1DWBH 2BY9X 1C1WH 4DY7B 4K1EA 1O2KA 3ODFA 4CRGA 3KQDA 1CO7E 3T2NA 2PUXB 2ZPRA 1QR3E 3ZV9A 4YM9A 1C2GA 1N8OB 3EDXB 1DVAH 3ENSB 1O39A 3BG8A 1KXAA 2RDLA 1PFXC 1V6DA 1YLCA 2ZDNA 4BAOB 1V2JT 3GDVA 1FIZA 1AKSA 1UK2A 2XCNA 2EI7A 3GDSA 2BVXH 3TJVA 4XBBA 3KIDU 3TJUA 5FCRA 4JZEH 4NFEA 5K0HA 3LGIA 3SUGA 1T8NA 1QIXB 2THFB 1SL3A 3SNDA 3BIUH 1DX5M 2ASUB 3TU7H 1EZXC 2BHGA 1DS2E 3ZZ5A 5FCKA 3ZZBA 1Y5UT 2P95A 1AFQC 3RM2H 1TABE 2OP9A 3UTUH 2ZTZA 2XTTB 1WQVH 2RG3A 2AFQB 1C4V2 2PSXA 2ZGHA 4NIVA 1C5LH 2P8OC 2PGQB 1TPOA 1LO6A 2C8WB 1LHDH 1GMDF 5JDUB 5C3NA 2A5KA 2IJOB 5JB8S 1GDUA 5A0CA 3SHCH 2GV7A 4AFSA 1D3DB 4U32A 1GJ6A 1Y3WA 2SGQE 4E05H 1WSSH 3MNXA 1VZQH 3G01A 1TGNA 2A5IA 1Y59T 1EAXA 4D9QA 5E0HA 3QGNB 2HVXA 4AG2A 1C2IA 2BVSH 4Y79A 1SMFE 1OWJA 3FVFB 1LVYA 3RC4A 3VEQB 3GY6A 5HXFA 2LNCA 2BY5X 1K1PA 3QN7A 1XUKA 1GI5A 4ABAA 1DWCH 3S7HB 2VJ1A 2ZECA 1YYY1 1Z1JA 1C2KA 2V3OH 4GAWA 3S9CA 3GY5A 1CT2E 1F0SA 2EEKA 1ZGVA 3FP8E 1O2WA 3QTVH 1V2MT 3HATH 3KQBA 1O3OA 4DCDA 1GHVH 3UNRA 2ZGBH 4UFGH 2A4OA 4FUEA 2F3CE 2Z9KA 3QZQA 2C8YB 2CMYA 3SGQE 5A8YA 3ZZ6A 3QO6A 1GHAG 3TNSA 2FOFA 1TBZH 1FI8A 1C1PA 5GDSH 1SOZA 1O3LA 2BQWB 3ZZ8A 3P92A 3SUFA 1O5EH 1CU1A 3A88A 1YPJH 3GCOA 3RU4E 2ODQA 1GDQA 3RXQA 2ZO3H 3K65B 4HGCA 1XX9A 2H5CA 2FOEA 4IC6A 3M5MA 3A82A 1OP0A 2R2MB 4I7YH 1UHBA 2WUCA 1AFEH 4XBCA 1L4ZA 2UUKB 1FPHH 3KNXA 4JK5A 2FI5E 1QB1A 1GBMA 1P2QA 2H5DA 3JZ2B 3SN8A 1SHHB 2C8ZB 4AORA 2D1JA 1A46H 2BOHB 3AW0A 2G5NA 1GBKA 1KIGH 2A1DB 2H9TH 1OKXA 3PMAB 3LC5A 1AB9C 4YT6H 1UVTH 5GCHG 1TGBA 1V2LT 3KQEA 3EQ0H 4YO9A 3RXDA 3MU1A 3UWIA 1V2KT 1FV9A 3HKIB 4BAQB 1E0FD 2D8WA 1SGQE 3ZZAA 1H9IE 4H42U 1P2IA 2ANMH 1C5ZB 5JBCS 1BOQA 2BDAA 3SW2B 1OYTH 1D3PB 2F9VA 3MOCA 1P02A 1OP2A 1D6RA 1PPEE 4DG4A 4FUGA 3K6YA 1RRKA 2A31A 2W3IA 4MLFB 2OUAA 1T4UH 3V13A 1KLIH 2A2XH 5E2OA 1O5DH 4O9VA 3H5CB 4FUDA 2Z94A 4AN7A 3KL6A 1CHGA 1LHEH 4U01A 5T6FA 2WPLS 1HAVA 1FN6A 5EPNA 5DP3A 3VXFH 1XVOA 4MPXA 1GDNA 1HXEH 1OWIA 3E8LA 2GD4B 2GTBA 1F5RA 2QYIA 2TIOA 1AN1E 3Q00A 4Q7YA 2M5TA 4NA9H 4CHAC 3F9EA 3RXJA 4ABJA 1AUTC 3FFGA 2OC1A 2FP7B 1IQMA 1K1NA 2RA0A 1QURH 3KN2A 2ODPA 2QXGA 2Z3DA 3QX5H 1G3BA 2UUJB 1O3DA 3A7TA 3VXEH 3BTTE 4DVAU 3UNQA 3QUMP 2ZI2H 1LHFH 1NFXA 2J38A 1GHBG 2ZZUH 1ELGA 6CHAB 3P70B 4GCHG 3QDZB 1UO6A 4NWLA 1BJUA 2PW8H 3VB7A 3MU8A 1UTPA 2A4GA 1O2MA 1BRBE 3M61U 2J94A 1CHOF 3SNEA 1XKBC 4Y7BA 3ODDA 1TMUH 1K1LA 4CH2B 1G30B 1Z6EA 1GPZA 4PROA 2BD5A 1AHTH 4DIIH 2ZPSA 4OS2A 1XUHA 4Y10E 5E2PA 2H1UA 2ZDVH 3RLWH 3H7OA 3GISB 1GBIA 1Y3UA 4GSOA 4O3TA 4UFFH 1THSH 4IN1A 2FTLE 3MHWU 4K2YA 1N6XA 4Y6DA 1ANDA 1P12E 3HKJB 3PMBB 1QJ7B 3EA8A 1LPGB 1XKAC 2ZHFH 1SR5C 3NUMA 1GJCB 4TY7A 4NIWA 3PB1E 1EXFA 1ACBE 1H1BA 5HGGA 2FODA 1V2QT 2FWWA 2SNVA 2VIVA 5F8ZA 3SGBE 1KTTB 2OD3B 5DGJA 1E36B 3I77A 1UVSH 1AZZA 3ATMA 5B6OA 3GDUA 2FTMA 3SBKA 1N8OC 4I33A 1SC8U 4I8JA 4MDSA 2ZHEH 3GYLB 3SU6A 1GI8B 3ZVGA 4AZ2B 3A7YA 1BMAA 4FU9A 1NU9A 1IQKA 2JH5D 3A87A 1O3GA 4ZUHA 1WBGB 1BCUH 1RD3B 2SFAA 1MAYA 2HRVA 4A92A 1VITH 4ABGA 1K28D 3UR6A 1HAVB 1DY8A 1CGIE 1WUNH 2BQ6B 1ETTH 1A0HB 5H4IB 3Q76A 1BDAA 3GY8A 1UCYK 2LPRA 1YPHE 1GBAA 1MTUA 1ELCA 3MTYA 3F68H 1V2RT 2OXSA 4MPUA 1S0QA 3Q3KA 1QQUA 1NY22 3DT0H 1PJPA 1GMHF 3A8BA 3BTME 3S0NA 2QXJA 2PKAA 3RXTA 1H9HE 1GI0A 2VIOA 2ZU2A 1O2JA 4MPVA 1ZGIA 1O2TA 2FI3E 3U1JB 1UCYH 3U8RH 2R3UA 3BTEE 4J1YA 1EJMA 1QHRB 4X1PU 4I8KA 2W7UA 2HALA 1EB1H 1AWHB 1L0ZA 4XBDA 1MQ5A 1BUIA 1JRTA 1V2OT 2R2WU 1SGYE 1V2TT 3I29A 1MTSA 1ZLRA 3T62A 3SU2A 3RMOH 1FY8E 2F9UA 1M9UA 3URDA 1GG6B 1HLTH 5LPEA 2A7JA 1MU6B 2JETB 2BXTH 1CE5A 1C5NH 2AGGX 2DE8A 1O2IA 4ZKNU 3SO3A 2BX3A 3BTHE 1GI1A 5FHTA 1EPTC 3BIVH 1QY6A 3LGUA 1ANBA 1YPHC 3F9HA 1NPMA 1PPZA 1SQTA 1F92A 2ZFTA 4WWYA 4MNVA 2TGTA 1FDPA 4B73A 5DP5A 3SU4A 3S9BA 3LGVA 3UR9A 1E37B 2XRCA 3K2UA 3LDXH 3GY2A 1C5RA 1O0DH 3OY5U 3RXHA 1GWAA 2SNWA 3V12A 1E38B 2AGIX 1TX8A 1IQFA 4IC5A 3SV9A 2BD9A 1YPKH 2G00A 4CREA 4AG1A 3ELAH 1QJ1B 1BRCE 1C1VH 1P09A 4A1TA 5HM9A 1NRRH 3NCLA 3ATKA 1J17T 1BBRE 2BD8A 1Y3VA 2C4FH 5L30H 2Q1JA 3OTJE 1A3EH 4NA7A 2ZQ1A 4THNH 1MMJN 2NU0E 8ESTE 1QL7A 3UREA 4CBOA 3M3SA 1FY3A 2A0QB 4ISNA 1TNLA 3BSQA 3ZYDA 3BTDE 1C4Y2 3RMMH 1OXGA 3BTGE 1L4DA 2SGPE 2WV4A 3W95A 3BEUA 5L2ZH 4BNRA 2PFEA 3R3GB 2OLGA 4ABBA 2XBWA 3B23B 3F9GA 1QFKH 3PLPA 2VIPA 2FLRH 4H6TA 2FOCA 2QGRA 3E6PH 5I25A 1ZSKA 2PKAB 3SUDA 3V3MA 3SU5A 1DPOA 2BD4A 5C20A 1OYQA 3VB5A 1J16A 1BHXB 1MUEB 5ABWA 1P2MA 2ZU5A 3LGYA 2GMTB 3MU0A 3SZNA 1O2RA 3A80A 4UD9H 1YPMH 1H4WA 2CHAB 1ZPCA 2F9PA 4Y8XA 2QF3A 1LQEA 2FXRA 3E0NB 1SFQB 2ZGCA 1TQ0B 3URCA 4UFEH 1NU7B 1FJSA 1MZDA 1ZSLA 2Y7ZA 5TCAA 7KMEH 3LT3A 4FUCA 3BN9A 4ZROA 3MU5A 1AY6H 3ATWA 5EQRA 1G2LA 4YTAA 5DG6A 1P3EA 2Q6GA 4LOYH 1RGQA 2P59A 2FX4A 4B74A 3VPKA 2FOHA 2ZP0H 1HAZB 4HTCH 6CHAC 1L2EA 3SJKA 4K1SA 1TPPA 1NRPH 4KTSA 4AFQA 1QA7A 4Q80A 3STJA 1V2PT 4X2VA 2GZ8A 5L2YH 4TWYA 4HZHA 3SJ9A 4TWWA 1A7SA 2O8TA 1Z7KA 1JOUB 1O5GH 3RXVA 1W7GH 1K9OE 2HGTH 1HUTH 2HPPH 4TPYA 2EA3A 2AS9A 1L1GA 4X8VH 2VWLA 3NWUA 5F8TA 2ZDKA 3UFAA 1CSOE 1TNJA 3VFEA 4XSKU 1FZZA 2ZCLP 3OYPA 1GHZA 1O2GH 1LCYA 4MNYA 2BB4A 1PPFE 2WUBA 1W8BH 3AAUA 3O8RA 1O3FA 3BG4B 4B71A 1TAWA 1G9IE 1V3XA 3O8DA 4Y76A 4F4OC 5A0BA 1AI8H 1SLWB 4NFFA 5EPYA 1MH0A 4CR9A 3KHVA 3D65E 8GCHG 1QRXA 5FAHA 3T27A 5T3HA 2XBVA 1YCPM 1DWDH 4GLYA 3SV6A 2BY8X 1PQ8A 3NK8A 1P05A 3P8GA 3RXFA 5T6DA 3MH4A 3C1KA 2A4RA 5DP8A 5E0GA 1ZOMA 2G4UA 4A1XA 4D7GA 1O2ZA 2C90B 1YPEH 2R9PA 1BMNH 4FVBA 1PPGE 2VNTA 2ZEBA 1GGDB 3SJIA 1TBRH 1FAXA 1XM1A 4WY3A 1AMHA 1HAYB 4BANB 2WYGA 1UVPA 3MMGA 3PO1B 4I8GA 1O2HA 1P2NA 3CS0A 1ESTA 4CRCA 1C9PA 2VU8E 1EUFA 1FY4A 3RLYH 4CRFA 4B2BA 1E35B 2PKSC 1KTSB 2AH4X 4ZKOU 3HGPA 1ESBA 3ZZ3A 1QB6A 1D4PB 1OP8A 4KGAA 4WJG2 1O2UA 3A8AA 2V6NA 1VGCB 1TE0A 2VWOA 4X6PA 4AGKA 4LK4A 1MBQA 1AIXH 4FUFA 4WMEA 4YOJA 4JMYA 3AVZA 1IHTH 5GIBA 1Y5BT 5GWZA 1AGJA 2FYQA 4ABFA 2ZHWH 2V0BA 1A4WH 1FY1A 2VIQA 4KTCA 4MG3A 3EGKH 1AVGH 1BTYA 1PPCE 2PR3A 3M5LA 1JIMA 1VCPA 1LKBA 1P11E 4CRBA 4IS5A 3ZV8A 4TYDA 4YZUA 2QF0A 5C1XA 1OS8A 1C1OA 2F9BH 3FANA 3FAOA 3ZVEA 1GBJA 3JZ1B 6LPRA 1YC0A 1AVWA 1CA0B 1C2DA 1CA8B 3IWMA 1LMWB 1GL1A 1GHWH 1YKTA 2BM2A 1DSUA 1P57B 1EAWA 1GCDA 4D8NA 2AYWA 1HIAA 2D2DA 1ZJDA 1GG6C 3RXEA 2NU2E 3SORA 4B1TA 3LONA 1EX3A 1BQYA 1NRNH 2OBOA 3RXCA 1O3KA 1Q31A 1BTXA 1OWEA 2ZHQH 3A7XA 4K1TA 2JETC 2ALPA 3DHKH 1J14A 2QY0B 2ZQ2A 1C2FA 2KAIA 4DIHH 5F6MA 1WQSA 1VR1H 3KGPA 1H9LB 3Q3YA 4NCYA 2BLVA 4OS5A 8KME2 4NZLA 2GX4A 4I8HA 1G37A 4XFQA 4JZIA 1GI3A 2EI8A 3RC6A 3VB6A 2RA3A 2I6QA 2IPHA 2NWNA 3RC5A 3B8JA 3RUOA 5C2ZA 1SGIB 2BTCE 3GY4A 1LTOA 5GCHF 1GMCG 4WF8A 4OS7A 1GCTB 1GI6A 2ZNKH 5LH8A 3RXRA 2HWLB 4O03A 1QRZA 1SQOA 4X0WU 1MTNB 1O3JA 1TFXA 1IQHA 1FNIA 1ETRH 1LVOA 1RJXB 1AD8H 1GMDG 4JK6A 1FONA 4NGAH 4IGDA 2BMGB 2FOBA 1TNGA 1DWEH 1Z1IA 3A86A 3OY6U 3AW1A 1LPZB 2SGFE 3RXOA 3ZVAA 3TVJB 4YLQH 1T7CA 1A5IA 2VVCA 2GT8A 4AYVB 2OC0A 1BHXF 2B9LA 1U6QA 1TLDA 1C1NA 1NRQH 1AU8A 3QLPH 5DJ7A 2Q6DA 1UTNA 1DXPA 3F9FA 2NU4E 4A5TS 1TONA 1TNKA 4IN2A 4Y8YA 2B5TB 2BY7X 1EOLA 1MBMA 2GT7A 2Z9LA 1G3EA 1UTQA 1UVUH 2VIDA 1QL9A 3RXKA 3ZVDA 1Y8TA 1SQAA 2GMTC 1C4U2 1GJ8B 1Z8GA 2Y5GA 1X7AC 1IQLA 3SHAH 2CHAC 1GHBF 2SGAA 4UDWH 1FY5A 1ZPBA 4GCHF 4GHTA 2F9OA 1GBFA 3SUEA 2FI4E 2A2QH 1B0EA 3UY9A 1BRAA 3SI3H 3A8CA 2F83A 2K1QA 1C2HA 3BEFB 4A1VA 3GY3A 1O2LA 1MTVA 6GCHG 5EGMA 2ZTYA 1HIAB 2ODYB 2GCTC 4GHQA 3SNBA 1EZSC 4CBNA 2C3SA 3M7TA 1BTZA 2AIPA 2XC5A 1RIWB 1CGHA 1NO9H 2KAIB 2PV9B 4INLA 4WXIA 1MCVA 3M3VA 2ZFSA 1CBWB 2ZCHP 4BTUB 4YT7H 2BD7A 2ZIQH 1TA2A 3HGNA 1QTFA 3SI4H 2AEIH 1SLUB 1UVOA 4JYVH 1BTUA 3RXLA 2G8TA 3E1XB 1FPCH 1QQ4A 1VCWA 1D3TB 4WXVA 3TLOA 5C5OA 4A6LA 2BDGA 4YOIA 2NU1E 1ELVA 1GBHA 4SGBE 4QT8C 4X2YA 1AO5A 2XBYA 1ID5H 2H2ZA 3SV7A 4K8YA 2ANWA 2ZU4A 1NROH 3GCHB 2ANKH 1VCQA 1W11U 4IBLH 1SGEE 2A7HA 1CGJE 2TGDA 1A5GH 4K3JA 5EQQA 4VGCC 1JIRA 5EODA 2V35A 1O3BA 3KF2A 3BG4C 5JBAS 3O8CA 5J4SA 1NC6A 2BVRH 4O97A 1S84A 1KXBA 1BITA 1C1RA 2ZU3A 1DSTA 5CE1A 1PPHE 1CT4E 2QA9E 2UUFB 5HM2A 3SV8A 3UNSA 1F2SE 2JH6D 3E16B 1CQQA 2P16A 3SNAA 2ZA5A 3CENA 2FPZA 5AVDA 2IN2A 3T25A 3E90B 1LKAA 3Q77A 4X1QU 7GCHF 2Z9IA 3PTNA 3K6ZA 1DITH 1BJVA 1BBRK 1J8AA 1EASA 2FOMB 1P03A 3TH4H 1WCZA 2HPQH 3KQCA 1HV7A 2ZHDA 2VH6A 1Z8IB 3MWIU 1ZTKA 2D26C 2WPKS 2BX4A 2OQ5A 3KEEA 2ZCKP 3PLKA 5LPFA 1V2UT 4RKOB 1ZYOA 1HJ8A 3MNBA 2PSYA 1GVZA 2J34A 1TX7A 3PYHA 1O32A 1K22H 5JYIA 5K7RA 1C5YB 1O5AB 1NESE 2FEQH 2GVFA 3UUZA 5DP7A 1F0UA 4Y8ZA 4FU7A 2A32A 4U2WA 4BAHB 4R0IA 4IMZA 5DPAA 2ULLA 1SG8B 1BT7A 1YCPK 1ANEA 2ZF0H 4X2XA 1QNJA 1HAPH 2ZFPH 2WPJS 1NM6A 5A0AE 2G55A 2TGPZ 1HAOH 5I46H 1AVXA 1GJ4H 2YOLA 3A81A 1TNHA 1O2VA 2BLWA 3TJOA 5C1YA 2PWXA 1O3HA 1ZHRA 1GBBA 1O3NA 1MU8B 1P0SH 3GICB 1C5VA 1PQ5A 1G2MA 3MH6A 5ESBA 1YGCH 3FZZA 1YCPH 3SNCA 3TGKE 3MNCA 4FUJA 1Y3YA 1JMOH 1DXWA 1EP5A 5EQSA 3PM3A 2ZPQA 1C2LA 4RKJB 4FUIA 2ZDLA 1TPAE 1DM4B 1SGNE 4K5ZA 1FAKH 4NWKA 1TWXB 2CJIA 3RXUA 2G52A 2P8OB 3U8TH 1G32B 2J4IA 4KELA 2GCHG 3QZRA 1HJ9A 1GI4A 3QWCH 1LVMA 5IDKA 2W7SA 1BTPA 2FYRA 2QV1A 3V7TA 3UPEA 1HBTH 1QBVH 1EOJA 5FPTA 1YM0A 3ITIA 1O34A 2VINA 3TITA 5DP4A 4LXBH 1MTNC 1GMHG 3EYDA 4DGJA 4WMFA 2O8LA 4Y0YE 2Z3EA 1K1IA 3U98H 2ZGXH 2Y6TA 5BPEA 3AASA 5DP9A 2JKHA 1W2KH 3SU3A 1GHYH 2DE9A 2Z9JA 4A7IB 5DO4H 5EXNA 3B9FH 1S82A 1C1QA 2QIQA 1WV7H 2A45B 4OS1A 4IW4E 4H6SB 5FX6A 5EXMA 3RDZA 3RXIA 3DFLA 1HPGA 3EA7A 3LH1A 1MCTA 1QL8A 1OWHA 1FQ3A 3HK3B 4YLUA 1QBNA 1SOTA 1KSNA 3ESTA 2B8OH 1T8OA 5IYTA 2FM2A 1O30A 1C5QA 2P3FH 3AAVA 3LOXA 1GHXH 1MAXA 2V3HH 4X6MA 3MO3A 2VWMA 1TGTA 1NTPA 4ESTE 2XC4A 1SGRE 2CF8H 1D6WA 1UTLM 4CRAA 1RFNA 4Y71A 2PGBB 3CP7A 3GCTG 1INCA 4JCNA 1A1RA 1B0FA 1MQ6A 2BZ6H 5TCCA 4JZDH 2ZTXA 1HB0B 4I31A 4FUHA 4ABDA 1SGFG 1C2MA 5EW1H 1FLEE 1G36A 1V2VT 3PWBA 1HNEE 2STAE 2HLCA 2RCEA 2OC8A 2ZKSA 2WPIS 3VB4A 3ZZDA 4D76A 4CRDA 1RIWC 3GCNA 4MNWA 2VVVA 1GBLA 2A4QA 1CBWC 3LIWA 2CF9H 3P8FA 3A84A 5AHGH 1VITF 1ELFA 5G4BA 3FZDA 6ESTA 1GJBB 1MKWK 1PQ7A 3M7UA 2FDAA 3U1IB 2R0KA 3MI4A 1NFWA 3DFJA 2BDHA 1K1OA 1P2KA 3RM0H 1C5WB 1IQGA 2ZG0H 5FPSA 4RSPA 5HYOA 1RTLA 4X8UH 3SU0A 2OTVA 2B7DH 2O8WA 1JXPA 3GCHC 5DKMA 2HNTE 3MH5A 1C5XB 3LGWA 1YPLH 5CHAB 4ZHAA 4FUBA 2BDBA 1ABIH 2BOKA 4FXGH 1S83A 2VWNA 3QTOH 1O2PA 1AUJA 3TH3H 1MTWA 1P9SA 3TGJE 2ZFRH 4HFPB 4U30A 1XUGA 4ABEA 3TGIE 2FS9A 1BRUP 3A85A 1O2QA 4NIYA 3H7TA 4DOQA 4B2AA 1S6FA 1UK4A 1IAUA 1ELBA 1XXFA 2NU3E 4LZ4B 4XDEA 4AX9H 1C1MA 2EI6A 1W10U 3RP2A 1ESAA 1K1MA 3MNSA 3BTQE 3EAJA 1MD8A 2HNTF 2CV3A 9ESTA 1UTJA 2F9NA 1DE7H 1SLVB 4X1SU 4NZQA 1KDQA 4RN6A 2TRMA 4X2WA 2Y5HA 1T32A 2VGCB 4ZKRU 2UWOA 2HNTC 2TPIZ 2ALVA 2ZWLH 1XVMA 2Q6FA 3BF6H 2G51A 4B76A 1HFDA 2Y5FA 1L1NA 5L6NH 2FOGA 1ABJH 1BMMH 1VJ9U 3IITA 1TX6A 3F6UH 2C8XB 1SVPA 1TNIA 3OX7U 5EU8A 3N7OA 3U69H 1P10A 3O8BA 3ZYEA 3BTFE 2XXLA 1HAIH 5TJXA 4NA8A 3L3TA 4BTTB 1RTKA 1AWFH 4WH8A 3UOPA 1DT2A 3VGCB 1KLTA 3ZVCA 4K60A 1HXFH 2B0FA 5FX5A 1SGFA 1BTWA 1CVWH 4X6NA 5HMAA 3S9AA 1SBWA 1GBEA 2GGVB 2BDYA 2XC0A 4Y0ZE 2J95A 2W3KA 3M36A 2H9HA 1FIWA 1WAYB 2JH0D 1GBDA 1GMCF 1O5CB 1DY9A 1WOFA 3QGJA 2BLOA 4ZKSU 3TNTA 1GHAF 1P2OA 2QAAA 4K8BA 1OOKB 1TMBH 1XUFA 4M7GA 1OX1A 1QA0A 4AYYB 2A5AA 3RXSA 1ZTLA 1GVKB 1PQAA 2PHBA 4MTBA 5DP6A 3KCGH 1TALA 1H8DH 1UJ1A 2A7CA 3PV4A 4DJZB 2ANYA 4IMQA 1BB0B 4ZHMU 3RU4T 4F49A 2OBQA 2H9EH 1MKXK 1W0ZU 4R8TB 1IHSH 4MQAA 1S5SA 1ZRKA 8LPRA 1BTHH 1C5UA 2XWAA 1IQNA 1ETSH 1UTMA 3RXAA 5E0JA 2VVUA 1YBWA 1UK3A 5EOKA 4KP0A 4ZH8A 4E7NA 1B7XB 1P2JA 1K21H 5C67A 1C2EA 1LDTT 3BTKE 1KXDA 4BOHA 5CMXH 1KXFA 1KDQB 1HGTH 3EE0B 1W14U 3M7QA 1V2NT 3ZZCA 1ANCA 1ELTA 1BMLA 4X6OA 1C2JA 1KXCA 1MKXH 1MZAA 1O38A 2XBXA 1O35A 3I78A 1ZMLA 1OWKA 3TK6A 2ZGJA 5E8EH 2FIRH 1EPTB 1FXYA 4Y11E 1W13U 1IQEA 1XXDA 7LPRA 1WTHD 1KLJH 1HYLA 1V2WT 4JYUH 1A3BH 3HK6B 3PMHB 2QC2A 4GVUA 1TGCA 1G3CA 3TJNA 6GCHF 2J9NA 3BV9B 5A2MH 3DD2H 2UWLA 2R0LA 1K1JA 1LVBA 4B75A 3RMLH 1EAUA 1GJDB 4UONA 1W7XH 3QK1A 1EP6A 3GOVB 3SJ8A 2UUYA 1O2YA 3LU9B 1AKSB 4DW2U 4K69A 1DICA 3LKWA 3T28A 2GP9B 4ISOA 1L1JA 1T8MA 2XNIA 3SOSA 3TK5A 3U8OH 1THRH 3NZIA 2WPHS 1EJNA 5JB9S 1XUIA 4SGAE 2O8MA 5EW2H 1NRSH 3ZZ4A 1YPGH 5SGAE 2AIQA 4WMDA 3S69A 1Q2WA 4JZFH 3A83A 1NS3A 1QJ6B 2FS8A 1JWTA 3SQEE 1F0RA 2P94A 5JBTA 5FXLA 1TRMA 4FVDA 5EG4A 3LPRA 2STBE 1OPHB 1ZHMA 1HDTH 4ASHA 1DLKB 2H6MA 2WV5A 1DOJA 1SGPE 2FLBH 3RXBA 1RS0A 3TH2H 2Y82A 1BZXE 4Q2KA 3A7ZA 1KY9A 2VH0A 1HAHH 2GZ7A 1WTGH 1LPKB 4ISIH 1TPSA 1V2ST 4OS4A 5CHAC 1RXPA 2Z3CA 1ORFA 1CT0E 3PMJA 4Z6AH 1EATA 3D49H 4D9RA 1A5HA 1O3AA 1ELDE 1O2XA 1ELAA 1UTKA 1O3CA 1O37A 3LGTA 5FPYA 3TK9A 2BYAX 4E7RG 3OU0A 1J15A 1WYKA 1EAIA 2PTNA 1T31A 3LJOA 1S0RA 1C1UH 1VJAU 3IG6B 4INKA 3DUXH 2WINI 5DK1A 4ZXYH 1SHYA 2BD3A 2OCVB 2ZDMA 2SGDE 1W12U 1SGCA 2FESH 1SB1H 1EKBB 2QN5T 4INHA 3T29A 1N1LA 1C1TA 3D23A 3MU4A 1PYTC 2BD2A 3NPSA 2BY6X 4AGJA 3RMNH 1UTOA 3ZZ7A 1DANH 5GPIB 4ZAEA 4AOQA 1EQ9A 2GZ9A 2W26A 2OC7A 1UHBB 3LJJA 2F91A 1GGDC 1C1SA 1FN8A 2VGCC 1GJ9B 1P04A 4YOGA 1Z71A 1QBOA 4ISHH 2XWBI 3PO1C 1QCPA 1OSSA 2G5VA 2GDEH 2TGAA 2P93A 3RXMA 1EJAA 3ATIA 2QXHA 3SV2H 4AB8A 5A09A 3CS7A 4OGYA 3V0XA 1VGCC 1P8VC 3NXPA 4H4FA 1EZUC 2BZAA 1HJAB 3UQOA 3VB3A 1CHOG 5FBIA 1K2I1 3OSYA 2J2UA 2VIWA 4X1NU 3TIUA 3PLBA 1BBRH 1F7ZA 3M37A 3LC3A 1T4VH 1TYNA 2ZFQH 3VGCC 1QB9A 2ILNA 2CN0H 2XW9A 1SGDE 4FU8A 1ZSJA 1Y5AT 3A7WA 1T8LA 3STIA 1P06A 4Q7XA 3UOUA 5C1UA 4BAKB 3LH3A 1HAXB 1C5OH 1UMAH 2GCHF 2PTCE 3ATLA 2ZFFH 4GPGA 2PKSB 1CA0C 4BXSA 3K9XB 4B2CA 4AB9A 2GDDA 3L33A 1QGFA 1WU1A 1ZZZA 3BEIB 2WPMS 3M35A 4OGXA 1GBTA 4ABIA 3PWCA 4UEHH 3MYWA 2GKVE 7GCHG 4UFDH 3F1SB 1TOMH 3M5OA 1O2SA 3FP6E 5JBBS 1O5FH 2QCYA 1IQIA 1P9UA 1QRWA 1GBCA 4ZXXH 2Z6BD 1E34B 4WVPE 2ZDAH 4DT7B 2J92A 1OWDA 1S85A 1AFQB 2FX6A 3EA9A 5JPMH 1KXEA 2Z7FE 4NIXA 1H8IH 4O3UA 3P17H 1IQJA 2CXVA 2BXUH 4ZMAH 3SGAE 1FUJA 1GJ5H 1LQDB 5AFYH 5LGOA 1Y3XA 3ZZ9A 3SQHE 1SPJA 2YNBA 1A0JA 3Q3XA 2AMPA 1A0LA 1TRNA 1GCTC 3BTWE 4BAMB 1DUAA 1ARCA 2AGEX 2XYAA 3A89A 1ARBA 3E3TA 1JBUH 4BXWA 2XCFA 3A7VA 1Z8JB 1Q3XA 3S7KB 1LHGH
chains in the Genus database with same CATH superfamily
5KGOA 4BTIB 4CH8B 4NSYA 4I8LA 3P8NA 1DUEA 1NT1A 3GCTF 2J98B 3P6ZB 3U9AH 1GL0E 2CGAA 1O31A 1Z8RA 3FP7E 1N6YA 2FOAA 2BLQA 1A2CH 3A8DA 4DURA 1C5TA 1ZR0A 1G3DA 4UE7H 4X8SH 3UQVA 1D9IA 1EB2A 2P3UB 1TMTH 2O9QA 3M5NA 1PPBH 1BIOA 1AE5A 2R3YA 1SLXB 2F4LA 2SGEE 4KTUA 1KYNA 3P8OA 5T6GA 4D7FA 1NFYA 2EY4C 1ZMJA 2Y81A 4E06H 2JDID 2JIZD 4Z0KA 2QXIA 1YLDA 1O2NA 1TQ7B 1TOCB 1C9TA 1B5GH 4X1RU 4GUXA 3RU4D 2RDEA 5GXPA 4KKDA 1GJAB 1ZPZA 1HRTH 5ETXA 3D62A 3ZVBA 4HI3A 1C5SA 4LZ1H 1NZQH 5C5NA 1HAGE 5IK2D 1XMNB 1DLEA 3GY7A 1O3IA 4X8TH 2I6SA 3M3TA 1NN6A 1TIOA 1SFIA 2ZU1A 2OINA 1Z6JH 5F8XA 2UWPA 1C5MD 2BQ7B 3RXPA 4TPIZ 2FZZA 2IOTA 1TRYA 3F0OA 4NG9H 3ZVFA 5J4QA 3HPTB 2BDIA 1ZTJA 4Y7AA 1DFPA 1AB9B 1ZRBA 1UCYE 5C0UA 4AFZA 2PLXA 3P95A 4XOJA 1AZ8A 1A61H 1ZJKA 1W3CA 1F0TA 1PYTD 3MO6A 2Y80A 1O3MA 1THPB 1ELEE 1S81A 3NKKA 1S6HA 1O3EA 1SSXA 3DA9B 1GJ7B 1MD7A 3PTBA 1P01A 3C27B 1ZHPA 5GJ4B 2P3TB 1DDJA 4I32A 1P3CA 4MNXA 1YF4A 2O8UA 3R0FA 5HIZA 2G4TA 4ISLA 4F48B 8GCHF 1BA8B 3SJOA 3MH7A 1ZMNA 2GCTB 1MKWH 1O33A 9LPRA 1EZQA 5A8ZA 1XUJA 2OQUA 1F5KU 3SU1A 1HCGA 4CHAB 3MFJA 1F5LA 2C93B 5FBEA 2FMJA 5ESTE 3W1EA 2YNAA 7ESTE 1IOEA 2W5EA 5LPRA 5AF9H 2VB0A 1AQ7A 4JZ1A 1SGTA 3RXGA 4YESB 3T5FH 4MPWA 2YMSB 1O3PB 2DUCA 3T26A 4AFUA 2AMDA 1FMGA 2Y7XA 2ZC9H 1VITG 2FO9A 1YP9A 2PUQH 5PTPA 2BDCA 1TB6H 1JRSA 3MO9A 3UIRA 1TGSZ 2AERH 1O2OA 5AFZH 1GI9B 3E0PB 4VGCB 4ABHA 4ZHLU 1RTFB 1TBQH 4XE4A 5HKKD 4CR5A 2HOBA 1GI7B 2AMQA 1GI2A 3GYMA 3E91A 3PROA 5EXLA 4TY6A 2G81E 1O36A 3L6PA 4NSVA 1D3QB 4OS6A 5F03A 1C5PA 1NFUA 1LHCH 5BRRE 3W94A 1HJAC 1O5BB 2EC9H 2ESTE 4J2YB 2WYJA 4WH6A 1TA6A 1W0YH 1J9CH 3AK5A 1EPTA 5A8XA 1AE8H 3UWJH 4MVNA 1GVLA 1WDIA 4JYTA 2Z9GA 4Q7ZA 3TPIZ 3WY8A 1SI5H 2TBSA 2GV6A 1DWBH 2BY9X 1C1WH 4DY7B 4K1EA 1O2KA 3ODFA 4CRGA 3KQDA 1CO7E 3T2NA 2PUXB 2ZPRA 4RI0A 1QR3E 3ZV9A 4YM9A 1C2GA 1N8OB 3EDXB 1DVAH 3ENSB 1O39A 3BG8A 1KXAA 2RDLA 1PFXC 1V6DA 1YLCA 2ZDNA 4BAOB 1V2JT 3GDVA 1FIZA 1AKSA 1UK2A 2XCNA 2EI7A 3GDSA 2BVXH 3TJVA 4XBBA 4YXWD 3KIDU 3TJUA 5FCRA 4JZEH 4NFEA 5K0HA 3LGIA 3SUGA 1T8NA 5KEDA 1QIXB 2THFB 1SL3A 3SNDA 3BIUH 1DX5M 2ASUB 3TU7H 3MQKC 1EZXC 2BHGA 1DS2E 3ZZ5A 5FCKA 3ZZBA 1Y5UT 2P95A 1AFQC 3RM2H 1TABE 2OP9A 3UTUH 2ZTZA 2XTTB 1WQVH 2RG3A 2AFQB 1C4V2 2PSXA 2ZGHA 4NIVA 1C5LH 2P8OC 2PGQB 1NBME 1LO6A 1TPOA 2C8WB 1LHDH 1GMDF 5JDUB 5C3NA 2A5KA 2IJOB 5JB8S 5F53A 1GDUA 5A0CA 3SHCH 2GV7A 4AFSA 1D3DB 4U32A 1GJ6A 1Y3WA 2SGQE 4E05H 1WSSH 3MNXA 1VZQH 3G01A 1TGNA 2A5IA 1Y59T 1EAXA 4D9QA 5E0HA 3QGNB 2HVXA 4AG2A 1C2IA 2BVSH 4Y79A 1SMFE 1OWJA 3FVFB 1LVYA 3RC4A 3VEQB 3GY6A 5HXFA 2LNCA 2BY5X 1K1PA 3QN7A 1XUKA 1GI5A 4ABAA 1DWCH 3S7HB 2VJ1A 2ZECA 1YYY1 1Z1JA 1C2KA 2V3OH 2WV9A 4GAWA 3S9CA 3GY5A 1CT2E 1F0SA 2EEKA 1ZGVA 3FP8E 1O2WA 3QTVH 1V2MT 3HATH 3KQBA 1O3OA 4DCDA 1GHVH 1S6LA 2ZGBH 3UNRA 4UFGH 2A4OA 4FUEA 2F3CE 2Z9KA 3QZQA 2C8YB 2CMYA 3SGQE 5A8YA 3ZZ6A 3QO6A 1GHAG 3TNSA 2FOFA 1TBZH 1FI8A 1C1PA 5GDSH 1SOZA 1O3LA 2BQWB 3ZZ8A 3P92A 3SUFA 1O5EH 1CU1A 3A88A 1YPJH 3GCOA 3RU4E 2ODQA 1GDQA 3RXQA 2ZO3H 3K65B 4HGCA 1XX9A 2H5CA 2FOEA 4IC6A 3M5MA 3A82A 1OP0A 2R2MB 4I7YH 1UHBA 2WUCA 1AFEH 4XBCA 1L4ZA 2UUKB 1FPHH 3KNXA 4JK5A 2FI5E 1QB1A 1GBMA 1P2QA 2H5DA 3JZ2B 3SN8A 1SHHB 2C8ZB 4AORA 2D1JA 1A46H 2BOHB 3AW0A 2G5NA 1GBKA 1KIGH 2A1DB 2H9TH 1OKXA 3PMAB 3LC5A 1AB9C 4YT6H 1UVTH 5GCHG 1TGBA 1V2LT 3KQEA 3EQ0H 4YO9A 3RXDA 3MU1A 3UWIA 1V2KT 1FV9A 3HKIB 4BAQB 1E0FD 2D8WA 1SGQE 2HVYB 3ZZAA 1H9IE 4H42U 1P2IA 2ANMH 1C5ZB 5JBCS 1BOQA 2BDAA 3SW2B 1OYTH 1D3PB 2F9VA 3MOCA 1P02A 1OP2A 1D6RA 1PPEE 4DG4A 4FUGA 3K6YA 1RRKA 2A31A 2W3IA 4MLFB 2OUAA 1T4UH 3V13A 1KLIH 2A2XH 5E2OA 1O5DH 4O9VA 3H5CB 4FUDA 2Z94A 4AN7A 3KL6A 1CHGA 1LHEH 4U01A 5T6FA 2KCOA 2WPLS 1HAVA 1FN6A 3SYJA 5EPNA 5DP3A 3VXFH 1XVOA 4MPXA 1GDNA 1HXEH 1OWIA 3E8LA 2GD4B 2GTBA 1F5RA 1MABB 2QYIA 2TIOA 1AN1E 3Q00A 4Q7YA 2M5TA 4NA9H 4CHAC 3F9EA 3RXJA 4ABJA 1AUTC 3FFGA 2OC1A 5C17A 2FP7B 1IQMA 1K1NA 2RA0A 1QURH 3KN2A 2ODPA 2QXGA 2Z3DA 3QX5H 1G3BA 2UUJB 1O3DA 3A7TA 3VXEH 3BTTE 4DVAU 3UNQA 3QUMP 4Q4LA 2ZI2H 1LHFH 1NFXA 2J38A 1GHBG 2ZZUH 1ELGA 6CHAB 3P70B 4GCHG 3QDZB 1UO6A 4NWLA 1BJUA 2WSSD 2PW8H 3VB7A 3MU8A 1UTPA 2A4GA 1O2MA 1BRBE 5DSFA 3M61U 2JJ1D 2J94A 1CHOF 3OEHD 3SNEA 1XKBC 4Y7BA 3ODDA 1TMUH 1K1LA 4CH2B 1G30B 1Z6EA 1GPZA 4PROA 2BD5A 1AHTH 4DIIH 2ZPSA 4OS2A 1XUHA 4Y10E 5E2PA 2H1UA 2ZDVH 3RLWH 3H7OA 3GISB 1GBIA 1YY3A 1Y3UA 4GSOA 4O3TA 4UFFH 1THSH 4IN1A 2FTLE 3MHWU 2CK3D 1N6XA 4K2YA 4Y6DA 1ANDA 1P12E 3HKJB 3PMBB 1QJ7B 3EA8A 1LPGB 1XKAC 1VKYA 2ZHFH 1SR5C 3NUMA 1GJCB 4TY7A 4NIWA 3PB1E 1EXFA 1ACBE 1H1BA 3PV5A 5HGGA 2FODA 4OM9A 1V2QT 2FWWA 2SNVA 2VIVA 5F8ZA 3SGBE 1KTTB 2OD3B 4P02A 5DGJA 1E36B 3I77A 1UVSH 1AZZA 3ATMA 5B6OA 3GDUA 2FTMA 3SBKA 1N8OC 4I33A 1W0KD 1SC8U 4I8JA 4MDSA 2L6OA 2ZHEH 3GYLB 3SU6A 1GI8B 3ZVGA 4AZ2B 3A7YA 1BMAA 4FU9A 1NU9A 1IQKA 2JH5D 3A87A 1O3GA 4ZUHA 1WBGB 1BCUH 1RD3B 2SFAA 1MAYA 2HRVA 4A92A 1VITH 4ABGA 1K28D 3UR6A 1HAVB 1DY8A 1CGIE 1WUNH 2BQ6B 1ETTH 1A0HB 5H4IB 3Q76A 1BDAA 3GY8A 1UCYK 2LPRA 1YPHE 1GBAA 1MTUA 1ELCA 3MTYA 3F68H 1V2RT 2OXSA 2LELA 1S0QA 4MPUA 3Q3KA 1QQUA 1NY22 3DT0H 1PJPA 1GMHF 3A8BA 3BTME 3S0NA 2QXJA 2PKAA 3RXTA 1H9HE 1GI0A 2VIOA 2ZU2A 1O2JA 4MPVA 1ZGIA 1O2TA 2FI3E 3UB0A 3U1JB 1UCYH 3U8RH 2R3UA 3BTEE 4J1YA 1EJMA 1QHRB 4X1PU 4I8KA 2W7UA 2HALA 1EB1H 1AWHB 1L0ZA 4XBDA 1MQ5A 1BUIA 1JRTA 1V2OT 2R2WU 1SGYE 1V2TT 3I29A 1MTSA 1ZLRA 3T62A 5B6LA 3SU2A 3RMOH 1FY8E 2F9UA 1M9UA 3URDA 1GG6B 1HLTH 5LPEA 2A7JA 1MU6B 2JETB 2BXTH 1CE5A 1C5NH 2AGGX 2DE8A 1O2IA 4ZKNU 3SO3A 2BX3A 3BTHE 1GI1A 5FHTA 3DSPA 1EPTC 3BIVH 1QY6A 3LGUA 1ANBA 1YPHC 3F9HA 2VBCA 1NPMA 1PPZA 1SQTA 1F92A 2ZFTA 4WWYA 4MNVA 2TGTA 1FDPA 4B73A 5DP5A 2V3MA 3SU4A 1E1RD 3S9BA 3LGVA 3UR9A 2PP6A 1E37B 2XRCA 3K2UA 3LDXH 3GY2A 1C5RA 1O0DH 3OY5U 3RXHA 1GWAA 2SNWA 3V12A 1E38B 2AGIX 1TX8A 1IQFA 4IC5A 3SV9A 2BD9A 1YPKH 1E1QD 2G00A 4CREA 4AG1A 3ELAH 1QJ1B 1BRCE 1C1VH 1P09A 4A1TA 5HM9A 1NRRH 3NCLA 3ATKA 1J17T 1BBRE 2BD8A 1Y3VA 2W6JD 2C4FH 5L30H 2Q1JA 3OTJE 1A3EH 4NA7A 2ZQ1A 4THNH 1MMJN 2NU0E 8ESTE 1QL7A 3UREA 4CBOA 3M3SA 5C0TA 1FY3A 2A0QB 4ISNA 1TNLA 3BSQA 2EQNA 3ZYDA 3BTDE 1C4Y2 3PRBA 3RMMH 1OXGA 3BTGE 1L4DA 2SGPE 2WV4A 3W95A 3BEUA 5L2ZH 4BNRA 4ASUD 2PFEA 3R3GB 2OLGA 4ABBA 2XBWA 3B23B 2YMSD 3F9GA 1QFKH 3PLPA 2VIPA 2FLRH 4H6TA 2FOCA 2QGRA 3E6PH 5I25A 1ZSKA 2PKAB 3VG8A 3SUDA 3V3MA 3SU5A 1DPOA 2BD4A 5C20A 1OYQA 3VB5A 1J16A 1BHXB 2K8IA 1MUEB 5ABWA 1P2MA 2ZU5A 3LGYA 2GMTB 3MU0A 3SZNA 1O2RA 3A80A 4UD9H 1YPMH 1H4WA 2CHAB 1ZPCA 2F9PA 4Y8XA 2QF3A 1LQEA 2FXRA 3E0NB 1SFQB 2ZGCA 1TQ0B 3URCA 4UFEH 1NU7B 1FJSA 1MZDA 1ZSLA 2Y7ZA 5TCAA 7KMEH 3LT3A 4FUCA 3BN9A 4ZROA 3MU5A 1AY6H 3ATWA 5EQRA 1G2LA 4YTAA 5DG6A 1P3EA 2Q6GA 4LOYH 1RGQA 2P59A 2FX4A 4B74A 3VPKA 2FOHA 2ZP0H 3KQ5A 1HAZB 4HTCH 6CHAC 1L2EA 3SJKA 4K1SA 1TPPA 1NRPH 4KTSA 1SKYE 4AFQA 1QA7A 4Q80A 3STJA 1V2PT 3FO8D 4X2VA 2GZ8A 5L2YH 4TWYA 4HZHA 3SJ9A 4TWWA 1A7SA 2O8TA 1Z7KA 1JOUB 1O5GH 3RXVA 1W7GH 1K9OE 2HGTH 1HUTH 2HPPH 4TPYA 2EA3A 2AS9A 1L1GA 4X8VH 2VWLA 3NWUA 5F8TA 2ZDKA 3UFAA 1CSOE 1TNJA 3VFEA 4XSKU 4ACAA 1FZZA 2ZCLP 3OYPA 1GHZA 1O2GH 1LCYA 4RT1A 2OK5A 4MNYA 2BB4A 1PPFE 2WUBA 1W8BH 3AAUA 3O8RA 1O3FA 3BG4B 4B71A 1TAWA 1G9IE 1V3XA 3O8DA 4Y76A 4F4OC 5A0BA 1AI8H 1SLWB 4NFFA 5EPYA 4HG6A 1MH0A 4CR9A 3KHVA 3D65E 8GCHG 1QRXA 5FAHA 3T27A 5T3HA 2XBVA 1YCPM 1DWDH 4GLYA 3SV6A 2BY8X 1PQ8A 3NK8A 1P05A 3P8GA 3RXFA 5T6DA 3MH4A 3C1KA 2A4RA 5DP8A 5E0GA 1ZOMA 2G4UA 4A1XA 4D7GA 1O2ZA 2C90B 1YPEH 2R9PA 1BMNH 4FVBA 2KX4A 1PPGE 2VNTA 2ZEBA 1GGDB 3SJIA 1TBRH 1FAXA 1XM1A 4WY3A 4B6EA 1AMHA 1HAYB 4BANB 2WYGA 1UVPA 3MMGA 3PO1B 4I8GA 1O2HA 1P2NA 3CS0A 1ESTA 4CRCA 1C9PA 2VU8E 1EUFA 1FY4A 3RLYH 2KCYA 4CRFA 2J97A 4B2BA 1E35B 2PKSC 1KTSB 2AH4X 4ZKOU 3HGPA 1ESBA 3ZZ3A 1QB6A 1D4PB 1OP8A 4KGAA 4WJG2 1O2UA 3A8AA 2V6NA 1VGCB 1TE0A 2VWOA 4X6PA 4AGKA 4LK4A 1MBQA 1AIXH 4FUFA 4WMEA 4YOJA 4JMYA 4B6FA 3AVZA 1IHTH 5GIBA 1Y5BT 5GWZA 1AGJA 2FYQA 2KCPA 2ZHWH 4ABFA 2V0BA 1A4WH 1FY1A 2VIQA 4KTCA 4MG3A 3EGKH 1AVGH 1BTYA 3ZIAD 1PPCE 2PR3A 3M5LA 1JIMA 1VCPA 1W0JD 1LKBA 1P11E 4CRBA 4IS5A 5CDFE 3ZV8A 4TYDA 4YZUA 1H8ED 2QF0A 4FOUC 5C1XA 5HIYA 1OS8A 1C1OA 2F9BH 3FANA 3FAOA 3ZVEA 1GBJA 3JZ1B 6LPRA 1YC0A 3F0PA 1AVWA 1CA0B 1C2DA 1CA8B 2WHXA 3IWMA 2KFWA 1LMWB 1GL1A 1GHWH 1YKTA 2BM2A 1DSUA 1P57B 1EAWA 1GCDA 4D8NA 2AYWA 1HIAA 2D2DA 1ZJDA 1GG6C 3RXEA 2NU2E 3SORA 4B1TA 3LONA 1EX3A 1BQYA 1NRNH 2OBOA 3RXCA 1O3KA 1Q31A 1BTXA 1OWEA 2ZHQH 3A7XA 4K1TA 2JETC 2ALPA 3DHKH 1J14A 2QY0B 2ZQ2A 1C2FA 2KAIA 4DIHH 5F6MA 1WQSA 1VR1H 3KGPA 1H9LB 3Q3YA 4NCYA 2BLVA 4OS5A 3F2HA 8KME2 4NZLA 2GX4A 4I8HA 1G37A 4XFQA 4JZIA 1GI3A 2EI8A 3RC6A 3VB6A 2RA3A 2I6QA 2IPHA 2NWNA 3RC5A 3B8JA 3RUOA 5C2ZA 4Q63A 3OEED 1SGIB 2BTCE 2RFKC 3GY4A 1LTOA 5GCHF 1GMCG 4WF8A 4OS7A 1GCTB 1GI6A 2ZNKH 5LH8A 3RXRA 2HWLB 4O03A 1QRZA 1SQOA 4X0WU 1MTNB 1O3JA 1TFXA 1IQHA 1FNIA 1ETRH 1LVOA 1RJXB 1AD8H 1GMDG 4JK6A 1FONA 4NGAH 4IGDA 2BMGB 2FOBA 1TNGA 1DWEH 1Z1IA 3WW7A 3A86A 3OY6U 2QE7D 3AW1A 1LPZB 2SGFE 3RXOA 3ZVAA 3TVJB 2XOKD 4YLQH 1T7CA 1A5IA 2VVCA 2GT8A 4AYVB 2OC0A 1BHXF 2B9LA 1U6QA 1TLDA 1C1NA 1NRQH 1AU8A 3QLPH 5DJ7A 2Q6DA 1UTNA 1DXPA 2J5UA 3F9FA 2NU4E 4A5TS 1TONA 1TNKA 4IN2A 4Y8YA 2B5TB 2BY7X 1EOLA 1MBMA 2GT7A 2Z9LA 1G3EA 1UTQA 1UVUH 2VIDA 1QL9A 3RXKA 3ZVDA 1Y8TA 1SQAA 2GMTC 1C4U2 1GJ8B 1Z8GA 2Y5GA 1X7AC 1IQLA 2XNDD 3SHAH 2CHAC 1GHBF 2SGAA 4UDWH 1FY5A 1ZPBA 4GCHF 3DSGA 4GHTA 2F9OA 1GBFA 3SUEA 2FI4E 2A2QH 1B0EA 3UY9A 1BRAA 3SI3H 3A8CA 2F83A 2F43B 2IPQX 1C2HA 2K1QA 3BEFB 4A1VA 3GY3A 1O2LA 1MTVA 6GCHG 5EGMA 2ZTYA 1HIAB 2ODYB 1FX0B 2GCTC 4GHQA 3SNBA 2HLDD 1EZSC 4CBNA 2C3SA 3M7TA 1BTZA 2AIPA 4I86A 3FKSD 2XC5A 1RIWB 1CGHA 1NO9H 2KAIB 2PV9B 4INLA 4WXIA 1MCVA 3M3VA 2ZFSA 1CBWB 2ZCHP 4BTUB 4YT7H 2BD7A 2ZIQH 1TA2A 3HGNA 1QTFA 2WZQA 3SI4H 2AEIH 1SLUB 1UVOA 4JYVH 1BTUA 3RXLA 2G8TA 3E1XB 1FPCH 1QQ4A 1VCWA 1D3TB 4WXVA 3TLOA 5C5OA 3NRLA 4A6LA 2BDGA 4YOIA 2NU1E 1ELVA 1GBHA 4SGBE 5DN6D 4QT8C 2YMSC 4X2YA 1SQRA 1AO5A 2XBYA 1ID5H 2H2ZA 3SV7A 4K8YA 2ANWA 2ZU4A 1NROH 3GCHB 2ANKH 1VCQA 1W11U 4IBLH 1SGEE 2A7HA 1CGJE 2TGDA 1A5GH 4K3JA 5KECA 5EQQA 4VGCC 1JIRA 5EODA 2V35A 1O3BA 2KM0A 3KF2A 3BG4C 5JBAS 3O8CA 5EIYA 5J4SA 1NC6A 2BVRH 4O97A 1S84A 1KXBA 1BITA 1C1RA 2ZU3A 1DSTA 5CE1A 1PPHE 1CT4E 2QA9E 2UUFB 5HM2A 3SV8A 2IJD1 3UNSA 1F2SE 2JH6D 3E16B 1CQQA 2P16A 3SNAA 2ZA5A 2GJGA 3CENA 2FPZA 5AVDA 2IN2A 3T25A 3E90B 1LKAA 3N7EA 3Q77A 4X1QU 7GCHF 2Z9IA 3PTNA 3K6ZA 1DITH 1BJVA 2KR7A 1BBRK 1J8AA 1EASA 3H09A 2FOMB 1P03A 3CNRA 3TH4H 1WCZA 2HPQH 3KQCA 1HV7A 2ZHDA 2VH6A 1Z8IB 3MWIU 1ZTKA 2D26C 2WPKS 2BX4A 2OQ5A 3KEEA 2ZCKP 3PLKA 5LPFA 1V2UT 4RKOB 1ZYOA 1HJ8A 3MNBA 2PSYA 1GVZA 2J34A 1TX7A 3PYHA 1O32A 1K22H 5JYIA 5K7RA 1C5YB 1O5AB 1NESE 2FEQH 2GVFA 3UUZA 5DP7A 1F0UA 4Y8ZA 4XRNA 4FU7A 2A32A 4U2WA 4BAHB 4R0IA 4IMZA 5DPAA 2ULLA 1SG8B 1BT7A 1YCPK 1ANEA 2ZF0H 4X2XA 1QNJA 1HAPH 2ZFPH 2WPJS 1NM6A 5A0AE 2G55A 4TT3D 2TGPZ 1HAOH 5FL7D 2KZ4A 5I46H 1AVXA 1GJ4H 1KMHB 2YOLA 3A81A 1TNHA 1O2VA 2BLWA 3TJOA 5C1YA 2PWXA 1O3HA 1ZHRA 1GBBA 1O3NA 1MU8B 1P0SH 3GICB 1C5VA 1PQ5A 1G2MA 3MH6A 5ESBA 1YGCH 3FZZA 1YCPH 3SNCA 3TGKE 3MNCA 4FUJA 1Y3YA 4ZCNA 1JMOH 1DXWA 1EP5A 5EJLA 3WWBA 5EQSA 3PM3A 3OTPA 2ZPQA 1C2LA 1COWD 4RKJB 4FUIA 2ZDLA 1TPAE 1DM4B 1SGNE 4K5ZA 1FAKH 4NWKA 3UAIC 1TWXB 2CJIA 3RXUA 2G52A 2P8OB 3KYGA 3U8TH 1G32B 2J4IA 4KELA 2GCHG 3QZRA 1HJ9A 1GI4A 3QWCH 1LVMA 5IDKA 2W7SA 1BTPA 2FYRA 2QV1A 3KYFA 3V7TA 3UPEA 2LP6A 1HBTH 1QBVH 1EOJA 3OE7D 5FPTA 1YM0A 3ITIA 1O34A 2VINA 3TITA 5DP4A 4LXBH 1MTNC 1GMHG 3EYDA 4DGJA 4WMFA 2O8LA 4Y0YE 2Z3EA 1K1IA 3U98H 2ZGXH 2Y6TA 5BPEA 3AASA 5DP9A 2JKHA 1W2KH 3SU3A 1GHYH 2DE9A 3U28C 2Z9JA 4A7IB 5DO4H 5EXNA 3B9FH 1S82A 1C1QA 2QIQA 1WV7H 2A45B 4OS1A 4IW4E 4H6SB 5FX6A 5EXMA 3RDZA 3RXIA 3DFLA 1HPGA 3EA7A 3LH1A 1MCTA 1QL8A 1OWHA 1FQ3A 3HK3B 4YLUA 1QBNA 1SOTA 1KSNA 3ESTA 2B8OH 1T8OA 5IYTA 5C94A 2FM2A 1O30A 1C5QA 2P3FH 3AAVA 3LOXA 1GHXH 1H8HD 1MAXA 2V3HH 4RT0A 4X6MA 3MO3A 2VWMA 1TGTA 1YWUA 1NTPA 4ESTE 2XC4A 1SGRE 2CF8H 1D6WA 1UTLM 4CRAA 1RFNA 4Y71A 3PV2A 2PGBB 3CP7A 3GCTG 1INCA 4JCNA 1A1RA 1B0FA 1MQ6A 2BZ6H 5TCCA 3F3BA 4JZDH 2ZTXA 1HB0B 4I31A 4FUHA 4ABDA 1SGFG 1C2MA 5EW1H 1FLEE 1G36A 1V2VT 3PWBA 1HNEE 4P00A 2STAE 2HLCA 2RCEA 2OC8A 2ZKSA 2WPIS 3VB4A 3ZZDA 4D76A 4CRDA 3FN8A 1RIWC 3GCNA 4MNWA 2VVVA 1GBLA 2A4QA 1CBWC 3LIWA 2CF9H 3P8FA 3A84A 5AHGH 1VITF 1ELFA 5G4BA 3FZDA 6ESTA 1GJBB 1MKWK 1PQ7A 3M7UA 2FDAA 3U1IB 2R0KA 3MI4A 1NFWA 3DFJA 2BDHA 1K1OA 1P2KA 3RM0H 3F2FA 1C5WB 1IQGA 2ZG0H 5FPSA 4RSPA 5HYOA 1RTLA 4X8UH 3SU0A 2OTVA 2B7DH 2O8WA 1JXPA 3GCHC 5DKMA 2HNTE 3MH5A 1C5XB 3LGWA 1YPLH 5CHAB 4ZHAA 4TSFD 4FUBA 2BDBA 1ABIH 2BOKA 4FXGH 1S83A 2VWNA 3QTOH 3F2GA 5CHBA 1O2PA 1AUJA 3TH3H 1MTWA 1P9SA 3TGJE 2ZFRH 4HFPB 4U30A 1XUGA 4ABEA 3TGIE 2FS9A 1BRUP 3A85A 1O2QA 4NIYA 3H7TA 4DOQA 4B2AA 1S6FA 1UK4A 1IAUA 1ELBA 1XXFA 2NU3E 4LZ4B 4XDEA 4AX9H 1C1MA 3PRDA 2EI6A 1W10U 3RP2A 1ESAA 1K1MA 3MNSA 3BTQE 3EAJA 2QF4A 1MD8A 2HNTF 2CV3A 9ESTA 1UTJA 2F9NA 1DE7H 1SLVB 4X1SU 4NZQA 5EJ1A 1KDQA 4RN6A 2TRMA 4X2WA 2Y5HA 1T32A 1BMFD 2VGCB 4ZKRU 2UWOA 2HNTC 5EJZA 5T1VA 2TPIZ 2ALVA 2JJ2D 2ZWLH 1XVMA 2Q6FA 3BF6H 2G51A 4B76A 1HFDA 2Y5FA 1L1NA 5L6NH 2FOGA 3EE7A 1ABJH 1BMMH 1VJ9U 3IITA 1TX6A 3F6UH 3N7DA 2C8XB 1SVPA 1TNIA 3OX7U 5EU8A 3N7OA 3U69H 1P10A 3O8BA 3ZYEA 3BTFE 2XXLA 1HAIH 5TJXA 4NA8A 3L3TA 4BTTB 1RTKA 1AWFH 4WH8A 3UOPA 1DT2A 3VGCB 1KLTA 3ZVCA 4K60A 1HXFH 2B0FA 5FX5A 1SGFA 4F55A 1BTWA 1CVWH 4X6NA 5HMAA 2W6ID 1K0HA 3S9AA 1SBWA 1GBEA 2GGVB 4ACBA 2BDYA 2XC0A 4Y0ZE 2J95A 2W3KA 3M36A 2H9HA 1FIWA 1WAYB 2JH0D 1GBDA 1GMCF 1O5CB 1DY9A 1WOFA 3OAAD 3QGJA 2BLOA 4ZKSU 3TNTA 1GHAF 1P2OA 2QAAA 4K8BA 1OOKB 1TMBH 1XUFA 4M7GA 3GS9A 1OX1A 1QA0A 4AYYB 2A5AA 3RXSA 1ZTLA 1GVKB 1PQAA 2PHBA 4MTBA 3SZEA 5DP6A 3KCGH 1TALA 1H8DH 1UJ1A 2A7CA 3PV4A 1YLNA 4DJZB 2ANYA 4IMQA 1BB0B 4ZHMU 3RU4T 4F49A 2OBQA 2H9EH 1MKXK 1W0ZU 4R8TB 1IHSH 4MQAA 1S5SA 1ZRKA 8LPRA 1BTHH 1C5UA 2XWAA 1IQNA 3N99A 1ETSH 1UTMA 3RXAA 5E0JA 2VVUA 1YBWA 1UK3A 5EOKA 4KP0A 4ZH8A 4E7NA 1B7XB 1P2JA 1K21H 5C67A 1C2EA 1LDTT 3BTKE 1KXDA 3DSOA 4BOHA 5CMXH 1KXFA 1KDQB 1HGTH 3EE0B 1W14U 3M7QA 1V2NT 3ZZCA 1ANCA 1ELTA 1BMLA 4X6OA 1C2JA 1KXCA 1MKXH 1MZAA 1O38A 2XBXA 1O35A 3I78A 1ZMLA 1OWKA 3TK6A 2ZGJA 5E8EH 2FIRH 1EPTB 1FXYA 4Y11E 1W13U 1IQEA 1XXDA 7LPRA 1WTHD 1KLJH 1HYLA 1V2WT 4JYUH 1A3BH 3HK6B 3PMHB 2QC2A 4GVUA 1TGCA 1G3CA 3TJNA 6GCHF 2J9NA 3BV9B 5A2MH 3DD2H 2UWLA 2R0LA 1K1JA 1LVBA 4B75A 3RMLH 1EAUA 1GJDB 4UONA 1W7XH 3QK1A 1EP6A 3GOVB 3SJ8A 2UUYA 1O2YA 3LU9B 1AKSB 3OFND 4DW2U 4K69A 1DICA 3LKWA 3T28A 2GP9B 4ISOA 1L1JA 1T8MA 2XNIA 3SOSA 3TK5A 3U8OH 1THRH 3NZIA 2WPHS 1EJNA 5JB9S 1XUIA 4SGAE 2O8MA 5EW2H 1NRSH 3ZZ4A 1YPGH 5SGAE 2AIQA 4WMDA 3S69A 4XD7D 1Q2WA 4JZFH 3A83A 1NS3A 1QJ6B 2FS8A 1JWTA 3SQEE 1F0RA 2P94A 5JBTA 5FXLA 1TRMA 4FVDA 5EG4A 3LPRA 2STBE 1OPHB 1ZHMA 1HDTH 4ASHA 1DLKB 2H6MA 2WV5A 1DOJA 1SGPE 2FLBH 3RXBA 1RS0A 3TH2H 2Y82A 1BZXE 4Q2KA 3A7ZA 1KY9A 2VH0A 1HAHH 2GZ7A 1WTGH 1LPKB 4ISIH 1TPSA 1V2ST 4OS4A 5CHAC 1RXPA 2Z3CA 1ORFA 1CT0E 3PMJA 4Z6AH 1EATA 3D49H 4D9RA 1A5HA 1O3AA 1ELDE 1O2XA 2AHME 1ELAA 2V7QD 4DT4A 1UTKA 1O3CA 1O37A 3LGTA 5FPYA 4Z1MD 3TK9A 2BYAX 4E7RG 3OU0A 1J15A 1WYKA 1EAIA 2PTNA 1T31A 3LJOA 1S0RA 1C1UH 1VJAU 3IG6B 4INKA 3DUXH 2WINI 5DK1A 4ZXYH 1SHYA 2BD3A 2OCVB 2ZDMA 2SGDE 1W12U 4M9FA 1SGCA 2FESH 1SB1H 1EKBB 2QN5T 4INHA 3T29A 1N1LA 1C1TA 3D23A 3MU4A 1PYTC 2BD2A 3NPSA 2BY6X 4AGJA 3DCLA 3RMNH 1UTOA 3ZZ7A 1DANH 5GPIB 4ZAEA 4AOQA 1QZ8A 1EQ9A 2GZ9A 2W26A 2OC7A 1UHBB 3LJJA 2F91A 1GGDC 1C1SA 1FN8A 2VGCC 1GJ9B 1P04A 4YOGA 1Z71A 1QBOA 4ISHH 2XWBI 3PO1C 1QCPA 1OSSA 2G5VA 2J98A 2GDEH 2TGAA 2P93A 3RXMA 1EJAA 3ATIA 4AC9A 2QXHA 3SV2H 4AB8A 5A09A 2M2AA 3CS7A 1EFRD 4OGYA 3V0XA 1VGCC 1P8VC 3NXPA 4H4FA 1EZUC 2BZAA 1HJAB 3UQOA 3VB3A 1CHOG 5FBIA 1K2I1 3OSYA 2J2UA 1UW7A 2VIWA 4X1NU 3TIUA 2K0QA 3PLBA 1BBRH 1F7ZA 3M37A 3LC3A 1T4VH 1TYNA 2ZFQH 3VGCC 1QB9A 2ILNA 2CN0H 2XW9A 1SGDE 2WPDD 4FU8A 1OHHD 1ZSJA 1Y5AT 5GNDA 3A7WA 1T8LA 3STIA 1P06A 4Q7XA 3UOUA 5C1UA 4BAKB 3LH3A 1HAXB 1C5OH 1UMAH 2GCHF 2PTCE 3ATLA 2ZFFH 4GPGA 2PKSB 1CA0C 4BXSA 3K9XB 4B2CA 4AB9A 2GDDA 3L33A 1QGFA 1WU1A 1ZZZA 3BEIB 2WPMS 3M35A 4OGXA 1GBTA 4ABIA 3PWCA 4UEHH 3FOAA 3MYWA 2GKVE 7GCHG 4UFDH 3F1SB 1TOMH 3M5OA 3WWFA 1O2SA 3FP6E 5JBBS 1E79D 1O5FH 2QCYA 1IQIA 1P9UA 1QRWA 1GBCA 4ZXXH 2QF5A 2Z6BD 1E34B 4WVPE 2ZDAH 4DT7B 2J92A 1OWDA 1S85A 1AFQB 2FX6A 1WXRA 3EA9A 5JPMH 1KXEA 2Z7FE 4FETA 4NIXA 1H8IH 1NBMD 4O3UA 3P17H 1IQJA 2CXVA 2BXUH 4ZMAH 3SGAE 1FUJA 1GJ5H 1LQDB 5AFYH 5LGOA 1Y3XA 3ZZ9A 3SQHE 1SPJA 2YNBA 1A0JA 3Q3XA 2L74A 2AMPA 1A0LA 1TRNA 1GCTC 3BTWE 4BAMB 1DUAA 1ARCA 2AGEX 2XYAA 3A89A 1ARBA 3E3TA 1JBUH 4BXWA 2KCAA 2XCFA 3A7VA 1Z8JB 1Q3XA 3S7KB 1LHGH
chains in the Genus database with same CATH topology
4BTIB 4CH8B 4NSYA 4I8LA 3P8NA 1DUEA 1NT1A 3GCTF 3P6ZB 3U9AH 1GL0E 2CGAA 1O31A 1Z8RA 3FP7E 1N6YA 2FOAA 2BLQA 1A2CH 3A8DA 4DURA 1C5TA 1ZR0A 1G3DA 4UE7H 4X8SH 3UQVA 1D9IA 1EB2A 2P3UB 1TMTH 2O9QA 3M5NA 1PPBH 1BIOA 1AE5A 2R3YA 1SLXB 2SGEE 4KTUA 1KYNA 3P8OA 5T6GA 4D7FA 1NFYA 1ZMJA 2Y81A 4E06H 4Z0KA 2QXIA 1YLDA 1O2NA 1TQ7B 1TOCB 1C9TA 1B5GH 4X1RU 4GUXA 3RU4D 5GXPA 4KKDA 1GJAB 1ZPZA 1HRTH 5ETXA 3D62A 3ZVBA 4HI3A 1C5SA 4LZ1H 1NZQH 5C5NA 1HAGE 1XMNB 1DLEA 3GY7A 1O3IA 4X8TH 2I6SA 3M3TA 1NN6A 1TIOA 1SFIA 2ZU1A 2OINA 1Z6JH 5F8XA 2UWPA 1C5MD 2BQ7B 3RXPA 4TPIZ 2FZZA 2IOTA 1TRYA 4NG9H 3ZVFA 5J4QA 3HPTB 2BDIA 1ZTJA 4Y7AA 1DFPA 1AB9B 1ZRBA 1UCYE 4AFZA 2PLXA 3P95A 4XOJA 1AZ8A 1A61H 1ZJKA 1W3CA 1F0TA 1PYTD 3MO6A 2Y80A 1O3MA 1THPB 1ELEE 1S81A 3NKKA 1S6HA 1O3EA 1SSXA 3DA9B 1GJ7B 1MD7A 3PTBA 1P01A 3C27B 1ZHPA 5GJ4B 2P3TB 1DDJA 4I32A 1P3CA 4MNXA 1YF4A 2O8UA 3R0FA 2G4TA 4ISLA 8GCHF 1BA8B 3SJOA 3MH7A 1ZMNA 2GCTB 1MKWH 1O33A 9LPRA 1EZQA 5A8ZA 1XUJA 2OQUA 1F5KU 3SU1A 1HCGA 4CHAB 3MFJA 1F5LA 2C93B 5FBEA 2FMJA 5ESTE 2YNAA 7ESTE 1IOEA 2W5EA 5LPRA 5AF9H 2VB0A 1AQ7A 4JZ1A 1SGTA 3RXGA 4YESB 3T5FH 4MPWA 1O3PB 2DUCA 3T26A 4AFUA 2AMDA 1FMGA 2Y7XA 2ZC9H 1VITG 2FO9A 1YP9A 2PUQH 5PTPA 2BDCA 1TB6H 1JRSA 3MO9A 3UIRA 1TGSZ 2AERH 1O2OA 5AFZH 1GI9B 3E0PB 4VGCB 4ABHA 4ZHLU 1RTFB 1TBQH 4XE4A 4CR5A 2HOBA 1GI7B 2AMQA 1GI2A 3GYMA 3E91A 3PROA 5EXLA 4TY6A 2G81E 1O36A 3L6PA 4NSVA 1D3QB 4OS6A 5F03A 1C5PA 1NFUA 1LHCH 5BRRE 3W94A 1HJAC 1O5BB 2EC9H 2ESTE 4J2YB 2WYJA 4WH6A 1TA6A 1W0YH 1J9CH 1EPTA 5A8XA 1AE8H 3UWJH 4MVNA 1GVLA 4JYTA 2Z9GA 4Q7ZA 3TPIZ 3WY8A 1SI5H 2TBSA 2GV6A 1DWBH 2BY9X 1C1WH 4DY7B 4K1EA 1O2KA 3ODFA 4CRGA 3KQDA 1CO7E 3T2NA 2PUXB 2ZPRA 1QR3E 3ZV9A 4YM9A 1C2GA 1N8OB 3EDXB 1DVAH 3ENSB 1O39A 3BG8A 1KXAA 2RDLA 1PFXC 1V6DA 1YLCA 2ZDNA 4BAOB 1V2JT 3GDVA 1FIZA 1AKSA 1UK2A 2XCNA 2EI7A 3GDSA 2BVXH 3TJVA 4XBBA 3KIDU 3TJUA 5FCRA 4JZEH 4NFEA 5K0HA 3LGIA 3SUGA 1T8NA 1QIXB 2THFB 1SL3A 3SNDA 3BIUH 1DX5M 2ASUB 3TU7H 1EZXC 2BHGA 1DS2E 3ZZ5A 5FCKA 3ZZBA 1Y5UT 2P95A 1AFQC 3RM2H 1TABE 2OP9A 3UTUH 2ZTZA 2XTTB 1WQVH 2RG3A 2AFQB 1C4V2 2PSXA 2ZGHA 4NIVA 1C5LH 2P8OC 2PGQB 1TPOA 1LO6A 2C8WB 1LHDH 1GMDF 5JDUB 5C3NA 2A5KA 2IJOB 5JB8S 1GDUA 5A0CA 3SHCH 2GV7A 4AFSA 1D3DB 4U32A 1GJ6A 1Y3WA 2SGQE 4E05H 1WSSH 3MNXA 1VZQH 3G01A 1TGNA 2A5IA 1Y59T 1EAXA 4D9QA 5E0HA 3QGNB 2HVXA 4AG2A 1C2IA 2BVSH 4Y79A 1SMFE 1OWJA 3FVFB 1LVYA 3RC4A 3VEQB 3GY6A 5HXFA 2LNCA 2BY5X 1K1PA 3QN7A 1XUKA 1GI5A 4ABAA 1DWCH 3S7HB 2VJ1A 2ZECA 1YYY1 1Z1JA 1C2KA 2V3OH 4GAWA 3S9CA 3GY5A 1CT2E 1F0SA 2EEKA 1ZGVA 3FP8E 1O2WA 3QTVH 1V2MT 3HATH 3KQBA 1O3OA 4DCDA 1GHVH 3UNRA 2ZGBH 4UFGH 2A4OA 4FUEA 2F3CE 2Z9KA 3QZQA 2C8YB 2CMYA 3SGQE 5A8YA 3ZZ6A 3QO6A 1GHAG 3TNSA 2FOFA 1TBZH 1FI8A 1C1PA 5GDSH 1SOZA 1O3LA 2BQWB 3ZZ8A 3P92A 3SUFA 1O5EH 1CU1A 3A88A 1YPJH 3GCOA 3RU4E 2ODQA 1GDQA 3RXQA 2ZO3H 3K65B 4HGCA 1XX9A 2H5CA 2FOEA 4IC6A 3M5MA 3A82A 1OP0A 2R2MB 4I7YH 1UHBA 2WUCA 1AFEH 4XBCA 1L4ZA 2UUKB 1FPHH 3KNXA 4JK5A 2FI5E 1QB1A 1GBMA 1P2QA 2H5DA 3JZ2B 3SN8A 1SHHB 2C8ZB 4AORA 2D1JA 1A46H 2BOHB 3AW0A 2G5NA 1GBKA 1KIGH 2A1DB 2H9TH 1OKXA 3PMAB 3LC5A 1AB9C 4YT6H 1UVTH 5GCHG 1TGBA 1V2LT 3KQEA 3EQ0H 4YO9A 3RXDA 3MU1A 3UWIA 1V2KT 1FV9A 3HKIB 4BAQB 1E0FD 2D8WA 1SGQE 3ZZAA 1H9IE 4H42U 1P2IA 2ANMH 1C5ZB 5JBCS 1BOQA 2BDAA 3SW2B 1OYTH 1D3PB 2F9VA 3MOCA 1P02A 1OP2A 1D6RA 1PPEE 4DG4A 4FUGA 3K6YA 1RRKA 2A31A 2W3IA 4MLFB 2OUAA 1T4UH 3V13A 1KLIH 2A2XH 5E2OA 1O5DH 4O9VA 3H5CB 4FUDA 2Z94A 4AN7A 3KL6A 1CHGA 1LHEH 4U01A 5T6FA 2WPLS 1HAVA 1FN6A 5EPNA 5DP3A 3VXFH 1XVOA 4MPXA 1GDNA 1HXEH 1OWIA 3E8LA 2GD4B 2GTBA 1F5RA 2QYIA 2TIOA 1AN1E 3Q00A 4Q7YA 2M5TA 4NA9H 4CHAC 3F9EA 3RXJA 4ABJA 1AUTC 3FFGA 2OC1A 2FP7B 1IQMA 1K1NA 2RA0A 1QURH 3KN2A 2ODPA 2QXGA 2Z3DA 3QX5H 1G3BA 2UUJB 1O3DA 3A7TA 3VXEH 3BTTE 4DVAU 3UNQA 3QUMP 2ZI2H 1LHFH 1NFXA 2J38A 1GHBG 2ZZUH 1ELGA 6CHAB 3P70B 4GCHG 3QDZB 1UO6A 4NWLA 1BJUA 2PW8H 3VB7A 3MU8A 1UTPA 2A4GA 1O2MA 1BRBE 3M61U 2J94A 1CHOF 3SNEA 1XKBC 4Y7BA 3ODDA 1TMUH 1K1LA 4CH2B 1G30B 1Z6EA 1GPZA 4PROA 2BD5A 1AHTH 4DIIH 2ZPSA 4OS2A 1XUHA 4Y10E 5E2PA 2H1UA 2ZDVH 3RLWH 3H7OA 3GISB 1GBIA 1Y3UA 4GSOA 4O3TA 4UFFH 1THSH 4IN1A 2FTLE 3MHWU 4K2YA 1N6XA 4Y6DA 1ANDA 1P12E 3HKJB 3PMBB 1QJ7B 3EA8A 1LPGB 1XKAC 2ZHFH 1SR5C 3NUMA 1GJCB 4TY7A 4NIWA 3PB1E 1EXFA 1ACBE 1H1BA 5HGGA 2FODA 1V2QT 2FWWA 2SNVA 2VIVA 5F8ZA 3SGBE 1KTTB 2OD3B 5DGJA 1E36B 3I77A 1UVSH 1AZZA 3ATMA 5B6OA 3GDUA 2FTMA 3SBKA 1N8OC 4I33A 1SC8U 4I8JA 4MDSA 2ZHEH 3GYLB 3SU6A 1GI8B 3ZVGA 4AZ2B 3A7YA 1BMAA 4FU9A 1NU9A 1IQKA 2JH5D 3A87A 1O3GA 4ZUHA 1WBGB 1BCUH 1RD3B 2SFAA 1MAYA 2HRVA 4A92A 1VITH 4ABGA 1K28D 3UR6A 1HAVB 1DY8A 1CGIE 1WUNH 2BQ6B 1ETTH 1A0HB 5H4IB 3Q76A 1BDAA 3GY8A 1UCYK 2LPRA 1YPHE 1GBAA 1MTUA 1ELCA 3MTYA 3F68H 1V2RT 2OXSA 4MPUA 1S0QA 3Q3KA 1QQUA 1NY22 3DT0H 1PJPA 1GMHF 3A8BA 3BTME 3S0NA 2QXJA 2PKAA 3RXTA 1H9HE 1GI0A 2VIOA 2ZU2A 1O2JA 4MPVA 1ZGIA 1O2TA 2FI3E 3U1JB 1UCYH 3U8RH 2R3UA 3BTEE 4J1YA 1EJMA 1QHRB 4X1PU 4I8KA 2W7UA 2HALA 1EB1H 1AWHB 1L0ZA 4XBDA 1MQ5A 1BUIA 1JRTA 1V2OT 2R2WU 1SGYE 1V2TT 3I29A 1MTSA 1ZLRA 3T62A 3SU2A 3RMOH 1FY8E 2F9UA 1M9UA 3URDA 1GG6B 1HLTH 5LPEA 2A7JA 1MU6B 2JETB 2BXTH 1CE5A 1C5NH 2AGGX 2DE8A 1O2IA 4ZKNU 3SO3A 2BX3A 3BTHE 1GI1A 5FHTA 1EPTC 3BIVH 1QY6A 3LGUA 1ANBA 1YPHC 3F9HA 1NPMA 1PPZA 1SQTA 1F92A 2ZFTA 4WWYA 4MNVA 2TGTA 1FDPA 4B73A 5DP5A 3SU4A 3S9BA 3LGVA 3UR9A 1E37B 2XRCA 3K2UA 3LDXH 3GY2A 1C5RA 1O0DH 3OY5U 3RXHA 1GWAA 2SNWA 3V12A 1E38B 2AGIX 1TX8A 1IQFA 4IC5A 3SV9A 2BD9A 1YPKH 2G00A 4CREA 4AG1A 3ELAH 1QJ1B 1BRCE 1C1VH 1P09A 4A1TA 5HM9A 1NRRH 3NCLA 3ATKA 1J17T 1BBRE 2BD8A 1Y3VA 2C4FH 5L30H 2Q1JA 3OTJE 1A3EH 4NA7A 2ZQ1A 4THNH 1MMJN 2NU0E 8ESTE 1QL7A 3UREA 4CBOA 3M3SA 1FY3A 2A0QB 4ISNA 1TNLA 3BSQA 3ZYDA 3BTDE 1C4Y2 3RMMH 1OXGA 3BTGE 1L4DA 2SGPE 2WV4A 3W95A 3BEUA 5L2ZH 4BNRA 2PFEA 3R3GB 2OLGA 4ABBA 2XBWA 3B23B 3F9GA 1QFKH 3PLPA 2VIPA 2FLRH 4H6TA 2FOCA 2QGRA 3E6PH 5I25A 1ZSKA 2PKAB 3SUDA 3V3MA 3SU5A 1DPOA 2BD4A 5C20A 1OYQA 3VB5A 1J16A 1BHXB 1MUEB 5ABWA 1P2MA 2ZU5A 3LGYA 2GMTB 3MU0A 3SZNA 1O2RA 3A80A 4UD9H 1YPMH 1H4WA 2CHAB 1ZPCA 2F9PA 4Y8XA 2QF3A 1LQEA 2FXRA 3E0NB 1SFQB 2ZGCA 1TQ0B 3URCA 4UFEH 1NU7B 1FJSA 1MZDA 1ZSLA 2Y7ZA 5TCAA 7KMEH 3LT3A 4FUCA 3BN9A 4ZROA 3MU5A 1AY6H 3ATWA 5EQRA 1G2LA 4YTAA 5DG6A 1P3EA 2Q6GA 4LOYH 1RGQA 2P59A 2FX4A 4B74A 3VPKA 2FOHA 2ZP0H 1HAZB 4HTCH 6CHAC 1L2EA 3SJKA 4K1SA 1TPPA 1NRPH 4KTSA 4AFQA 1QA7A 4Q80A 3STJA 1V2PT 4X2VA 2GZ8A 5L2YH 4TWYA 4HZHA 3SJ9A 4TWWA 1A7SA 2O8TA 1Z7KA 1JOUB 1O5GH 3RXVA 1W7GH 1K9OE 2HGTH 1HUTH 2HPPH 4TPYA 2EA3A 2AS9A 1L1GA 4X8VH 2VWLA 3NWUA 5F8TA 2ZDKA 3UFAA 1CSOE 1TNJA 3VFEA 4XSKU 1FZZA 2ZCLP 3OYPA 1GHZA 1O2GH 1LCYA 4MNYA 2BB4A 1PPFE 2WUBA 1W8BH 3AAUA 3O8RA 1O3FA 3BG4B 4B71A 1TAWA 1G9IE 1V3XA 3O8DA 4Y76A 4F4OC 5A0BA 1AI8H 1SLWB 4NFFA 5EPYA 1MH0A 4CR9A 3KHVA 3D65E 8GCHG 1QRXA 5FAHA 3T27A 5T3HA 2XBVA 1YCPM 1DWDH 4GLYA 3SV6A 2BY8X 1PQ8A 3NK8A 1P05A 3P8GA 3RXFA 5T6DA 3MH4A 3C1KA 2A4RA 5DP8A 5E0GA 1ZOMA 2G4UA 4A1XA 4D7GA 1O2ZA 2C90B 1YPEH 2R9PA 1BMNH 4FVBA 1PPGE 2VNTA 2ZEBA 1GGDB 3SJIA 1TBRH 1FAXA 1XM1A 4WY3A 1AMHA 1HAYB 4BANB 2WYGA 1UVPA 3MMGA 3PO1B 4I8GA 1O2HA 1P2NA 3CS0A 1ESTA 4CRCA 1C9PA 2VU8E 1EUFA 1FY4A 3RLYH 4CRFA 4B2BA 1E35B 2PKSC 1KTSB 2AH4X 4ZKOU 3HGPA 1ESBA 3ZZ3A 1QB6A 1D4PB 1OP8A 4KGAA 4WJG2 1O2UA 3A8AA 2V6NA 1VGCB 1TE0A 2VWOA 4X6PA 4AGKA 4LK4A 1MBQA 1AIXH 4FUFA 4WMEA 4YOJA 4JMYA 3AVZA 1IHTH 5GIBA 1Y5BT 5GWZA 1AGJA 2FYQA 4ABFA 2ZHWH 2V0BA 1A4WH 1FY1A 2VIQA 4KTCA 4MG3A 3EGKH 1AVGH 1BTYA 1PPCE 2PR3A 3M5LA 1JIMA 1VCPA 1LKBA 1P11E 4CRBA 4IS5A 3ZV8A 4TYDA 4YZUA 2QF0A 5C1XA 1OS8A 1C1OA 2F9BH 3FANA 3FAOA 3ZVEA 1GBJA 3JZ1B 6LPRA 1YC0A 1AVWA 1CA0B 1C2DA 1CA8B 3IWMA 1LMWB 1GL1A 1GHWH 1YKTA 2BM2A 1DSUA 1P57B 1EAWA 1GCDA 4D8NA 2AYWA 1HIAA 2D2DA 1ZJDA 1GG6C 3RXEA 2NU2E 3SORA 4B1TA 3LONA 1EX3A 1BQYA 1NRNH 2OBOA 3RXCA 1O3KA 1Q31A 1BTXA 1OWEA 2ZHQH 3A7XA