2FS9A

Human beta tryptase ii with inhibitor cra-28427
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs9A01
4CHAC 4YTAA 1GWAA 1NFWA 2A4OA 4E7NA 1ZTLA 3FZZA 3Q3XA 5DP9A 3TVJB 5L2ZH 3S9AA 1P06A 1G2MA 2Z6BD 1C5YB 1DY9A 2IN2A 4X1SU 1C1OA 1V2KT 4D7GA 2GCHF 1BMAA 3CS7A 2Z3EA 1K1OA 5TCCA 3MO9A 1BUIA 1MQ6A 1SOTA 1G3CA 1ESTA 3SNEA 2P3TB 1C1VH 2VIPA 2VWMA 3OY6U 1GI3A 2UWLA 4FUHA 2WYJA 4YLQH 4A1XA 3M7UA 2FLRH 3A83A 3SU6A 1EAWA 4X8SH 2FOAA 3G01A 3F9EA 3M5OA 4FUBA 3RXAA 5A8ZA 2CV3A 1H4WA 7ESTE 1C5OH 3M3VA 1LVOA 1BRCE 1QL7A 2F9UA 1DSTA 1SL3A 2H6MA 1SMFE 2WV4A 2O8UA 3TJUA 1LVMA 2BDYA 1WOFA 1L4ZA 3KQBA 4J1YA 2C8XB 2QGRA 4I8LA 4ABAA 3A8CA 1QJ7B 8ESTE 1V2MT 2QF3A 3BIUH 3D23A 1GI5A 8GCHG 4XBCA 1V2ST 1FY5A 1UTNA 1GHWH 2V35A 2W3IA 1P02A 5C2ZA 4JYUH 3TIUA 5C5NA 1MCTA 4A92A 3AVZA 1LHFH 3VB6A 4I7YH 2F9VA 1O3NA 4I8GA 2PSXA 5EW1H 2OP9A 1P2QA 3U9AH 3SBKA 2SNVA 1AB9C 2RA3A 1F5KU 4ZH8A 1JBUH 3GCOA 3SGBE 5FCKA 1YM0A 1EAIA 2FPZA 2VWOA 1MCVA 3CENA 1KDQB 2O8MA 2VVUA 2PGBB 1FI8A 1J17T 3ZZ6A 3BN9A 1HAOH 2IOTA 5DGJA 5HXFA 2NU3E 4KTCA 3SORA 2BVXH 4AFSA 1BTHH 3MTYA 4GVUA 4H4FA 1DT2A 4FUGA 1O2ZA 1SB1H 2Y81A 4SGBE 1YCPM 1NY22 1C2MA 4DGJA 2WPJS 1CT0E 2AH4X 5HM9A 2CN0H 3GCHC 1TRYA 3RXCA 1DE7H 4AGKA 1AFQB 1E36B 1L4DA 4ZKRU 3A7ZA 1H9LB 1FUJA 2V3OH 4A5TS 1HB0B 3MU1A 1AO5A 2D2DA 3K65B 4AYYB 1C5QA 4ZHAA 2PV9B 1O2QA 1D3PB 1QRZA 1RJXB 1TOMH 3KCGH 1C2GA 2KAIB 2SGQE 2Z9KA 1P2NA 1K1JA 4JK6A 4B71A 3IG6B 2R9PA 4WY3A 4ABHA 4Y76A 1BITA 3RXHA 1HLTH 1UK2A 1GHYH 3GDSA 1O3CA 4NA7A 5CE1A 4WXVA 2BMGB 1GMHG 1Y5AT 1BRUP 4MNYA 3BTFE 4AOQA 2VB0A 4ISIH 1YPHE 1EPTC 2DUCA 1QURH 3UPEA 1O37A 1OOKB 2NWNA 5T6DA 1ZRKA 1O33A 3QUMP 2SGFE 3MNBA 4FVBA 1UVUH 4YZUA 1FY3A 1CGHA 1HAHH 1LPGB 1UK4A 4NA8A 2ZHWH 1B5GH 1SC8U 2ZDKA 1TX7A 1BBRH 2ZF0H 2I6SA 1QJ1B 3A88A 1IQNA 4WWYA 1ZTJA 1MAYA 4UEHH 1HAIH 5DKMA 2W7SA 3M36A 3ZVBA 1O39A 4OS5A 3F9FA 1EASA 2HGTH 4GPGA 3RXSA 1F5LA 4O9VA 5GJ4B 1GL0E 2UWOA 2W7UA 5EXMA 3OU0A 1C5PA 4NSVA 2GZ8A 2A4RA 3EYDA 4X1NU 1ANDA 5ESBA 1DLKB 2GZ7A 2IJOB 2WUBA 1C1WH 3QK1A 1MTVA 4ZKSU 3K2UA 3ATKA 3SJKA 1DPOA 4H6SB 9LPRA 3U8OH 1GI8B 5DP3A 1HRTH 4BANB 1BCUH 3NZIA 3LC3A 3EE0B 4YOJA 3UQVA 3A89A 5K0HA 1IQMA 1TBQH 2SGEE 3B9FH 3UREA 1S0RA 4I31A 2J34A 1NN6A 1Z71A 1GJ6A 2P3FH 1J14A 4NIYA 1UMAH 2PW8H 1AI8H 1C5LH 2C8ZB 5DP7A 3VGCC 1EOJA 2GZ9A 4XBBA 4Y7AA 1V2TT 1XUIA 1A2CH 5A2MH 1AGJA 1FONA 1HJAC 3LT3A 4INKA 4TWYA 1UHBA 2FOBA 1SFIA 1Z8GA 3PMJA 1PPEE 3UNRA 1YGCH 5CHAB 1LDTT 2ZHEH 2YNBA 1EUFA 1UCYK 1SLVB 2BZAA 2P95A 2CHAB 4MPVA 1L1NA 2J95A 2YOLA 1P2MA 3E16B 2SNWA 2BDGA 2GCTB 1W11U 2XBYA 3TGIE 4NWKA 4YOIA 3HK3B 1JOUB 1SLXB 1QBOA 4FU8A 2TGPZ 6ESTA 3QGNB 1Y3YA 4JMYA 2BY7X 1A3BH 2BLOA 2Z7FE 3FP7E 5I46H 3E90B 1KSNA 1N1LA 1GHBF 1K2I1 2OCVB 1F0UA 1FY1A 4FUIA 4XE4A 1SOZA 2ODPA 2QXGA 1KXDA 3BV9B 3KQEA 4BAHB 1S0QA 4Y0ZE 3SU2A 1XUHA 1GBBA 4X1RU 4B2CA 3RU4T 3A8AA 4A1TA 4I8KA 2ZNKH 4NGAH 2J9NA 1SQAA 4RKJB 5A09A 1ELBA 4MQAA 2ZCLP 1Q3XA 1DWEH 2VIVA 4BOHA 4FUFA 2HNTE 1EP6A 3TH3H 3Q00A 4UFGH 2ODYB 2Z94A 2THFB 1WBGB 2B7DH 4MNWA 1H9IE 4Q7YA 1S84A 1C4V2 2GP9B 2G8TA 1QB6A 1QA0A 2P8OB 1QCPA 3GDVA 4IS5A 1YYY1 1RS0A 1TA2A 4A7IB 1SQOA 1MKWK 4VGCC 1ZYOA 1NRSH 4FUJA 3GY8A 1ZRBA 1BJUA 4D9QA 4X6PA 5JBCS 3TH2H 3BG4C 1W3CA 1DOJA 1O35A 2FODA 3GYMA 5FPSA 1GG6B 3ENSB 1ANEA 2P94A 3HGNA 2SGPE 4NG9H 2O8WA 1BTWA 2TPIZ 1QRWA 2AGGX 3C1KA 4CR5A 2ALPA 1FY4A 1GCDA 4IC5A 3GCTG 3LJOA 1PPFE 4WMDA 3SU0A 4TY6A 3RP2A 3T25A 2GT7A 5LPFA 3UOUA 1D3QB 3MU8A 4FUDA 2XC4A 3BTKE 3UNSA 1LQDB 1HAGE 1XKAC 1ZMLA 6LPRA 4OS7A 2FTMA 1VITF 4JZEH 3O8CA 1TFXA 3U1JB 2XBWA 1SGNE 2WYGA 3A7VA 3I29A 1N8OC 2V3HH 4DVAU 3BTGE 1CSOE 1MAXA 2ZGJA 4MPWA 1GBMA 2XCNA 1O2XA 1AKSA 5EPNA 2ASUB 2ODQA 3QZQA 4OGYA 4XFQA 2G4TA 2FXRA 2UUYA 2F9PA 1NRRH 3TITA 1PYTD 1UTMA 2NU4E 2QN5T 3ZYDA 4KKDA 1XUGA 1PPHE 2Q1JA 1RIWB 2O8LA 1SVPA 5FX6A 1TAWA 1ZLRA 3RXMA 1KXCA 2GMTC 1C5NH 1RGQA 1OXGA 3AAUA 4FUEA 2PLXA 2VIQA 3A7XA 2F9OA 3SNDA 3STJA 1TBZH 3GICB 1O2UA 2JH5D 1CGIE 6GCHG 1ABIH 1UTLM 1EJAA 3B8JA 3V13A 2G81E 1O2VA 2GKVE 2ZU2A 1AD8H 3LDXH 3GCHB 3GDUA 4H6TA 1GMCG 3TNTA 1Y3VA 4FU7A 1TX8A 3ZVCA 4AZ2B 2BDAA 4CRGA 2ZQ2A 1W2KH 4O3UA 3RXVA 1XUKA 1RRKA 1HAVB 1SGCA 1TOCB 3P8GA 5ESTE 3BTME 4AG2A 1BDAA 1DITH 3UWIA 3LPRA 1O2JA 5C1UA 1AE5A 2ZDAH 2FDAA 1QBVH 8LPRA 1V2NT 1MTUA 5AVDA 2ZU5A 2ZPSA 4YESB 2H5DA 1Q31A 2ZPRA 4INLA 3LJJA 2VJ1A 1EZUC 2P3UB 2V6NA 1LVYA 1C1QA 2GCHG 3ATWA 1HAZB 1O3OA 2GX4A 1JRSA 1BJVA 4NCYA 1MMJN 2ILNA 1BTYA 3ZZ8A 3GCTF 1O3DA 1T8OA 1O3PB 3FZDA 1F7ZA 1A1RA 1ETRH 5JYIA 1PPCE 3SW2B 2A31A 3V0XA 3BEUA 1A4WH 2HLCA 3RXOA 1O3BA 5L30H 3SHCH 4DIIH 3M61U 1PQ5A 3PMAB 1V2OT 2CXVA 5FHTA 5SGAE 2I6QA 1TBRH 3BTEE 3QWCH 2P59A 4BXSA 1BT7A 1F2SE 3VB4A 3EQ0H 1P01A 2GT8A 1ORFA 2HALA 1TIOA 4M7GA 1P2OA 2TGDA 2G5NA 2FESH 1C5RA 5H4IB 3SU4A 3PLPA 2Q6FA 1FXYA 1BBRE 1YBWA 3EGKH 1W14U 1O5BB 3QN7A 5LPEA 3UTUH 3IWMA 4ABEA 4DURA 3P8OA 2XC5A 2ZI2H 3U8RH 1O2WA 2EI6A 4Y10E 3ZVGA 1O5GH 4LK4A 1C2IA 1CHGA 3E91A 2G52A 5AF9H 1CVWH 1EPTA 3STIA 1UTJA 3QGJA 2BY5X 1AN1E 1OYQA 2OC8A 3RXLA 3PWCA 1IOEA 1O2KA 3UNQA 1FLEE 2FI4E 1O36A 4I32A 1BHXB 3T62A 1EP5A 1ZHMA 1SGEE 2PKSC 3RXTA 5EGMA 4BAOB 1GMCF 5DPAA 3S0NA 1ZJKA 4WXIA 1SGIB 1A0JA 3P92A 4WH8A 5JBTA 2BD9A 1QRXA 3D65E 1EB1H 3RC6A 3ZZ5A 2GTBA 3SZNA 2XC0A 1CBWC 1ESBA 3T28A 1S82A 3SUFA 1EATA 3ZVDA 1FN8A 1QNJA 1HNEE 1O34A 3LH1A 1KY9A 3F1SB 1FAKH 5EU8A 3RU4D 3GY3A 2ZZUH 1GI2A 2AMDA 2ESTE 5FX5A 1P57B 4OGXA 1TPAE 3P8NA 2XW9A 3VGCB 1HXEH 3SV2H 4OS1A 4B2BA 1ELTA 3RUOA 3F9GA 1KTSB 1THPB 1SI5H 4CRFA 2BLQA 3FP6E 5E2PA 1DSUA 4DW2U 1A0LA 5FAHA 5C1YA 1C2JA 3O8DA 4K8BA 3M5MA 2QXHA 2Y7ZA 1RTKA 5K7RA 3SN8A 1FN6A 1BTUA 4CRDA 4AB8A 1Y59T 2LPRA 3RXRA 2BY8X 1YPGH 1OWJA 3AW1A 3V3MA 1ABJH 1LHDH 3AAVA 1V3XA 1MTNB 4MLFB 3TNSA 4ZHLU 2ZG0H 1TONA 1V2VT 1V2UT 1XVOA 3MH7A 5EW2H 3M3SA 3PYHA 1IQJA 1O3GA 1PQ8A 1D3TB 1J8AA 2P93A 2ZFQH 2BDHA 1O30A 2ANMH 4ZMAH 2QXIA 1A0HB 1XMNB 3ITIA 4Y8ZA 1THRH 3P6ZB 1SFQB 3KNXA 3SOSA 1GCTC 4MG3A 5FXLA 3Q3YA 1O5AB 3SGAE 3KL6A 4BAQB 3NUMA 1ZSJA 1EJMA 3LU9B 3ODFA 5E0JA 4FUCA 2FOHA 1DY8A 3S9CA 1P9UA 4BTUB 2CMYA 1C4U2 1MBQA 1NS3A 2NU1E 1IQKA 4MPXA 2FOEA 2W3KA 3MYWA 4B2AA 1CA0B 2GGVB 2TGTA 2BM2A 2VGCB 1S6FA 4X8TH 1INCA 1CT4E 4U01A 1P2KA 1UK3A 3JZ2B 4K60A 1E37B 1XKBC 3E8LA 5DO4H 4ESTE 3QLPH 1VCPA 1P12E 1W7GH 1LHCH 3MHWU 4SGAE 1O3EA 2OC7A 1K1LA 3D49H 5DP8A 4AYVB 3UR6A 2ZC9H 3CS0A 3P95A 1MUEB 3I77A 3A85A 2BDIA 1LTOA 3ZV8A 1YCPH 4AGJA 3HK6B 1NRQH 2XYAA 1TPSA 1O2IA 3PMBB 5HYOA 4A1VA 2C3SA 4DCDA 2A2XH 1H8DH 1MQ5A 4JK5A 1ARBA 1EAXA 5AHGH 3LC5A 3RXBA 4B74A 4UONA 1VJAU 1JMOH 4ASHA 4GHQA 1P05A 1XUJA 2ZGCA 1C9PA 1ELVA 2AMPA 1T8LA 2Y5GA 2VIOA 1DWBH 1DFPA 4J2YB 1DUAA 5EOKA 3VFEA 1JIMA 1O2GH 4YLUA 2FYQA 1DWDH 1P03A 1WV7H 1FPCH 5C1XA 3U98H 1THSH 3P70B 3DD2H 4XDEA 5FBIA 1OWEA 1AWFH 2EI8A 2J38A 5FCRA 4DG4A 4THNH 1F92A 2HRVA 2OC1A 4O3TA 1OPHB 3RXJA 3SGQE 1C5WB 1XVMA 4CH8B 3M3TA 3A8BA 4GHTA 2F83A 1FIZA 1O5DH 1SQTA 2VIDA 1GHBG 2AFQB 1ACBE 1F0TA 3QDZB 3RU4E 2IPHA 3MI4A 4D8NA 2JH0D 4UDWH 3BTWE 1IQEA 1HAXB 1TA6A 1Q2WA 1A5GH 3ZVEA 2BXTH 3PO1B 5JPMH 2FIRH 1BMNH 2BY6X 2FEQH 3VPKA 1P3CA 2TGAA 1Z1IA 1ZSKA 2JETC 3H7OA 4BAKB 2PTCE 5F03A 2H2ZA 3VXFH 5LH8A 5PTPA 2A7HA 4X2YA 3SV8A 1Z8RA 1WSSH 1JRTA 2BQ7B 5L6NH 1XXFA 1B7XB 1QBNA 4FVDA 1FV9A 1V2JT 3E6PH 1UHBB 2F91A 5GXPA 2DE8A 2GD4B 1VGCB 1AE8H 2PR3A 1SLUB 1UCYH 1IQFA 3E3TA 3P17H 4QT8C 1DXWA 2TBSA 4UFDH 1LQEA 2K1QA 1QL8A 1EX3A 2ZTYA 2WV5A 3UY9A 2ZGBH 3GY6A 1EKBB 1ZPZA 5FPYA 1NRNH 1YF4A 1V6DA 1DWCH 1S83A 1EB2A 1QGFA 1DDJA 1QHRB 1BRAA 1TWXB 3S69A 2VH6A 1D9IA 1ELGA 2WPMS 4YOGA 1QIXB 3PLBA 3FFGA 3OYPA 2VVVA 3RMOH 1B0FA 2BB4A 1VITG 1GHZA 1WQVH 5A0CA 2Y5FA 5IYTA 1CE5A 1ZHPA 3LH3A 4RN6A 3FAOA 1ANCA 1FIWA 1RD3B 1BTXA 1Y3XA 1HIAA 1AUJA 4O97A 1S6HA 1T7CA 3PTNA 1AUTC 4D7FA 1TMUH 2PKAA 4IBLH 3VXEH 1S81A 1Z6JH 5C20A 2PFEA 2D1JA 1P3EA 2Z9JA 1YLCA 3LIWA 1MU6B 3RC4A 3URDA 4NFFA 2A5AA 1A5HA 1KIGH 1OX1A 3A87A 1ID5H 1WUNH 4CRAA 3N7OA 3T29A 4UE7H 2ANYA 2C8YB 4OS6A 1DS2E 1E35B 4B1TA 3BTQE 1TNLA 1O38A 4XSKU 2ZHQH 4CHAB 1TNGA 4WMEA 1QQ4A 4E06H 3PM3A 3HGPA 1AZZA 2OINA 3L6PA 5JB9S 1QB9A 2XBXA 1BTZA 4MNVA 1MKXH 4TPIZ 1P0SH 4GUXA 1TNJA 3OTJE 4ZKOU 1PPGE 5F6MA 2QA9E 3UOPA 2Q6GA 1A61H 2Z9IA 4Y6DA 1QY6A 3U8TH 3MOCA 1P09A 1TYNA 2ZGXH 4Q7XA 1FMGA 1OKXA 2ZHDA 3BTDE 3SNCA 2B0FA 1K22H 3NPSA 1W12U 3QZRA 4CRBA 4IN1A 3W95A 1T8MA 4JCNA 2VNTA 3NXPA 1D3DB 1PPBH 4HI3A 4U32A 3HPTB 4BTIB 1AKSB 1KXEA 1GBFA 1GJ5H 2FOMB 3A7YA 2XBVA 2ZFRH 4IMZA 4RKOB 3LONA 2QAAA 4YT6H 2ZU1A 2FP7B 1L0ZA 3MFJA 1CHOG 2WINI 1WU1A 2G51A 1TE0A 3QX5H 5JB8S 2ANKH 3C27B 1J15A 2ZDVH 3SNAA 1Z8IB 3VEQB 4AFUA 3KQDA 5EQRA 2HPQH 3BTTE 1WCZA 4X8VH 3RMLH 1AZ8A 5TCAA 4D9RA 1AHTH 1KLJH 5GWZA 1YPLH 1YPHC 2BX4A 4X0WU 3GCNA 4Y8YA 5A0BA 1SSXA 2AS9A 4Y0YE 1P8VC 1AFQC 1ZTKA 3K9XB 4IC6A 5FBEA 2QF0A 2A32A 1AB9B 1VCWA 2BD8A 1GDQA 2BOKA 4MNXA 4X6MA 1V2RT 2H9TH 2STAE 3MNCA 1YPMH 4RSPA 1TQ0B 4GCHG 1G30B 1IHTH 3VB7A 3JZ1B 1NTPA 2XCFA 1A46H 1NU9A 1AVWA 3RXDA 3MWIU 1O2SA 1GI4A 1O3KA 2FWWA 1AVXA 3W94A 4ABGA 4AB9A 3MU0A 1F0SA 2ZWLH 2TRMA 3LGUA 2UUJB 1HPGA 3RXIA 3RXKA 1GJDB 1HXFH 4HGCA 3ATLA 1H1BA 4F4OC 1SG8B 2G55A 1TNKA 4JZ1A 3T5FH 1P11E 2WPHS 1JIRA 5DP5A 1SPJA 1SGRE 2M5TA 1GMDF 1Y3WA 2W26A 1Z1JA 4Y11E 1SGPE 2VINA 2BQ6B 1NROH 4NA9H 1GBEA 2PSYA 4JZIA 3QO6A 3LGVA 1V2QT 1ZPCA 4NWLA 2ANWA 2ZU3A 1MU8B 2J92A 1TPOA 3ATMA 2BXUH 5BPEA 1GVLA 2BYAX 2XNIA 1XXDA 1PFXC 2B5TB 1WTGH 3TGJE 3RMMH 3FANA 1Y5UT 3A81A 2OBOA 1CHOF 2QXJA 1GGDC 1GBIA 2RDLA 2FOGA 2B8OH 2OD3B 2PTNA 2PWXA 1HUTH 2BQWB 1C2EA 1AU8A 2GVFA 1WYKA 3ZZ9A 5ABWA 1EPTB 3BEFB 3M37A 4WVPE 5C5OA 3SI3H 1AMHA 3A8DA 1W10U 2F9NA 1SGFA 1C2DA 4LZ4B 2XWAA 1ZHRA 2SGAA 1P2JA 3LGIA 3KF2A 2Z3DA 3DA9B 3HKJB 4UFEH 2PUQH 4GAWA 5IDKA 1C5VA 2ZHFH 4FXGH 5AFZH 1EXFA 5C67A 2TIOA 3BSQA 4TWWA 1W7XH 1P10A 4TY7A 1GJCB 1FQ3A 5C3NA 4WMFA 2CF8H 3LOXA 4OS4A 2Y7XA 5EPYA 1BQYA 3TGKE 3SJ8A 2ZIQH 4GCHF 1ARCA 1TX6A 3TPIZ 2FI3E 2AIPA 5EODA 3EDXB 4I33A 1N6YA 2QYIA 1LPZB 3BIVH 1DANH 1D6WA 3KEEA 2QCYA 1GVKB 2BDBA 1DICA 4H42U 2AMQA 1QL9A 2FX4A 4Y7BA 1O2PA 1PQ7A 1RTFB 1ZOMA 2HNTC 5T3HA 1CO7E 5LGOA 1Z8JB 1D4PB 4ZAEA 1GJAB 4MTBA 4TYDA 4X2VA 2ZGHA 3T2NA 3A82A 1LKBA 5CHAC 3V12A 1TGBA 1UCYE 3GY4A 1K1MA 3M7TA 2CHAC 3AASA 3RMNH 1O5CB 3DT0H 1AFEH 3V7TA 3LGYA 3DFLA 5DK1A 4XOJA 1ZZZA 2GCTC 1ZR0A 3H7TA 1C1TA 1J9CH 1O5EH 3MU4A 1ZPBA 4Q2KA 1Y5BT 5DJ7A 3ZZ7A 1L1GA 4K5ZA 1G2LA 4NFEA 5F8TA 3O8RA 1G36A 1MTSA 2FOCA 1BMLA 1HJAB 5A0AE 4MVNA 4PROA 1C5UA 1GBCA 3ZZ3A 2GV7A 1ELFA 2J4IA 2AGEX 2G5VA 3ATIA 3A86A 1LPKB 4DT7B 5AFYH 4CBOA 1SGQE 2AIQA 2W5EA 1ZMNA 7GCHG 1NT1A 1HCGA 4ABJA 3RXGA 1CQQA 1L2EA 1C5MD 4NSYA 3SU1A 1G32B 1J16A 2UUFB 1K1IA 5L2YH 1WTHD 1KLTA 4GLYA 1NO9H 1VCQA 3SU3A 2NU0E 4BTTB 1AWHB 3LGTA 3A7WA 5JBAS 4IGDA 2BD7A 3FP8E 2FOFA 2OUAA 1C5ZB 2P8OC 2PUXB 1NU7B 1OWKA 4K8YA 3QTVH 1FNIA 2VIWA 2RCEA 1T4VH 1TGCA 5E0HA 3UFAA 2B9LA 2CF9H 1K28D 3E0PB 4AG1A 1GG6C 4A6LA 1FAXA 1TMBH 5I25A 1C9TA 1GBTA 1X7AC 1GJ7B 3Q3KA 5EXNA 3SI4H 3SU5A 2VWLA 1UTKA 4X1QU 4CREA 1YPJH 4DY7B 2ZP0H 4K1SA 1VJ9U 1OWIA 4YM9A 5EG4A 1K9OE 4O03A 4E05H 1EZSC 4I8HA 1GI7B 4VGCB 1AQ7A 2WPLS 3SO3A 1O2RA 3BG4B 2WPKS 1E0FD 3TJNA 1TPPA 2O8TA 5JBBS 4X2XA 5HMAA 1O2MA 3GY7A 1PPZA 1IQIA 3SQHE 1LHEH 1O3HA 1YPKH 1C4Y2 1FPHH 2QY0B 1GBDA 1WQSA 2QV1A 1G9IE 2ZA5A 2PGQB 4DJZB 2A4QA 2O9QA 1IAUA 3GOVB 4X6NA 1SGYE 4E7RG 3U69H 4INHA 1MBMA 4WF8A 1OYTH 3GY5A 4DOQA 1RIWC 3A84A 1GBHA 1DUEA 3PWBA 1HYLA 1TRMA 1F0RA 1K1NA 1OWDA 1YC0A 1BIOA 4Y8XA 2BD5A 1GHAG 1O2OA 1O3MA 1V2LT 2F9BH 2XTTB 1N8OB 1YP9A 2SGDE 4NIVA 1DLEA 2H1UA 7GCHF 2ZDNA 2P16A 4IMQA 2CGAA 3A7TA 3PB1E 4AFZA 1C1PA 1GI1A 4CH2B 3AW0A 1ELEE 4AORA 1H9HE 4ISNA 4R0IA 1QA7A 2XXLA 1IHSH 1C1UH 4YT7H 3ZVAA 1UJ1A 2Y6TA 4X1PU 2FYRA 1O3FA 2LNCA 2PHBA 1ZJDA 4B73A 5CMXH 1QR3E 2GMTB 1P04A 1ZGIA 2BLWA 1KDQA 2ZU4A 4B76A 3BG8A 1O3IA 1TNIA 7KMEH 3LGWA 3ESTA 4U2WA 5DP6A 3OSYA 1UVOA 1O2TA 2QIQA 1TABE 1C5TA 1A3EH 1TGSZ 4MDSA 4CBNA 4YO9A 2BX3A 3S9BA 2Y82A 1G3BA 3H5CB 3WY8A 4ZUHA 1YCPK 5E2OA 4ZKNU 3NCLA 3DHKH 1MZAA 1VITH 1RFNA 3ZZAA 2ZCKP 2BOHB 9ESTA 1ETSH 2OXSA 3T26A 2DE9A 3EA8A 2R0LA 1O3JA 4LOYH 4KGAA 5ETXA 2BLVA 8GCHF 4ISLA 3UIRA 5T6FA 2V0BA 1KYNA 1C1RA 1LO6A 2KAIA 4LXBH 1Z7KA 3L3TA 1D6RA 1O2HA 1UVPA 2WPIS 2J94A 2Q6DA 2RG3A 1SHYA 1GGDB 1BOQA 5B6OA 1UVTH 3SJIA 2HNTF 1QFKH 1JXPA 1MD7A 2JH6D 3MO3A 3PLKA 2OQUA 1T32A 2BVRH 4TPYA 3OX7U 1C2FA 3ZZBA 1SBWA 3EA9A 3M35A 3GY2A 5F8XA 1GHAF 1ESAA 1HIAB 3HATH 1GJBB 2BDCA 1HJ9A 3TH4H 1TLDA 2PKAB 4GSOA 1EQ9A 1PYTC 4K1EA 1F5RA 1GJ8B 2BHGA 1GJ9B 1E34B 3RXFA 1EJNA 4ZXYH 4D76A 5BRRE 1QTFA 2FX6A 1BBRK 3SUEA 1A5IA 1Y3UA 2ZFSA 4ZXXH 3VB3A 3A80A 6CHAC 3MO6A 4MPUA 3SHAH 3P8FA 3R0FA 4ISHH 1KXFA 4HTCH 3SJOA 3KQCA 3ZZ4A 3SQEE 1YPEH 4HFPB 3NWUA 1ZSLA 5F8ZA 3MH6A 1GJ4H 2ZQ1A 3KIDU 3RC5A 1U6QA 1OP8A 1HGTH 1SGFG 2R3YA 3S7KB 3NKKA 2VVCA 3GYLB 4XBDA 1GPZA 3CP7A 1N6XA 2PKSB 3L33A 1GHXH 5GDSH 2FS9A 1P9SA 3RM0H 3QTOH 3ZVFA 4ABFA 1UVSH 1C1NA 2Z3CA 3ZZDA 3I78A 1G37A 3R3GB 2BZ6H 2C8WB 1GMHF 3RLYH 1CBWB 1MKWH 1W0YH 2FZZA 5T6GA 1EZXC 2R2MB 1MH0A 4Z6AH 1GDUA 3SV7A 2OLGA 4NZQA 1CGJE 3RXQA 1NM6A 3T27A 3MH5A 4Q80A 5GCHG 4Y71A 1C1SA 1C2LA 2STBE 1LMWB 1HAYB 5E8EH 2HVXA 3O8BA 1MTNC 2AYWA 4FU9A 4CRCA 1O32A 1BMMH 1PQAA 4LZ1H 2RA0A 3K6YA 4Q7ZA 1T31A 1GMDG 1UTOA 2BD3A 2Y80A 2H9EH 1V2PT 2CJIA 2EEKA 1AY6H 4I8JA 1QB1A 1MTWA 4JZDH 3RM2H 3PROA 3F68H 4K69A 5G4BA 2ZO3H 4AFQA 3M7QA 1HAPH 3UUZA 1P2IA 3Q77A 2ZTXA 1GI9B 1NPMA 3RXEA 2XWBI 2OBQA 2A7JA 3VB5A 3MH4A 1RXPA 1Y8TA 1SLWB 5DP4A 1EAUA 2Z9LA 3SV6A 4NIXA 3URCA 1C2KA 1ZGVA 4K3JA 1CA0C 2Y5HA 4X8UH 1HDTH 1BA8B 2OQ5A 3MU5A 2VGCC 4K1TA 5FPTA 2ZECA 5GPIB 4ZHMU 3SJ9A 4BNRA 1H8IH 1S5SA 2A2QH 3RXPA 2AGIX 4ZROA 1TRNA 1FDPA 4IN2A 3RDZA 1GI6A 2D26C 3DFJA 1TGNA 3DUXH 1OS8A 2ZKSA 4X2WA 3M5LA 1GCTB 2A5IA 3TK6A 2AEIH 5LPRA 1NFUA 5J4QA 3D62A 4ABDA 2BD2A 3TJVA 1L1JA 4R8TB 3ODDA 3PV4A 3SUDA 2H9HA 1RTLA 4JYTA 1MKXK 1IQLA 1TB6H 1LCYA 3K6ZA 5EQQA 3ELAH 2A7CA 2G00A 1HFDA 1SHHB 3KHVA 4NZLA 1C1MA 1NC6A 2F3CE 3ZZCA 1CT2E 1VR1H 1LKAA 4B75A 1OWHA 1IQGA 3E1XB 4X6OA 1OP2A 3U1IB 1UTQA 3PMHB 2EA3A 7LPRA 1NFYA 1MZDA 4WJG2 1PJPA 3TK5A 4ABBA 1BZXE 3PTBA 1C5XB 1SR5C 1JWTA 5EQSA 8KME2 5GCHF 3BF6H 3BEIB 4JZFH 1QQUA 1BTPA 1KLIH 4F49A 1CU1A 1KTTB 1DX5M 4K2YA 2BVSH 1C2HA 1AIXH 2ZDMA 4KTUA 3M5NA 1S85A 3RLWH 3ZV9A 1G3EA 1HV7A 1NRPH 2H5CA 1W13U 1T8NA 2XRCA 3FVFB 1T4UH 2FO9A 3IITA 4IW4E 1O2NA 1K1PA 1O3LA 2UUKB 1XUFA 4WH6A 4BXWA 1ANBA 2FI5E 2FS8A 2C4FH 2VU8E 3UQOA 2G4UA 3GISB 2UWPA 2ZTZA 4ABIA 1UTPA 2BD4A 2R3UA 1YLDA 3LKWA 1A7SA 2FLBH 4ISOA 1ELDE 4NIWA 1GBKA 2VH0A 2QC2A 4KTSA 5DG6A 4DIHH 1B0EA 3SNBA 3MNSA 4BAMB 1ELAA 1GDNA 2Z9GA 1MD8A 2A4GA 1O2LA 1TNHA 2HWLB 3PO1C 3SV9A 3TLOA 2AERH 3KGPA 2C90B 1GI0A 1DVAH 3RXUA 3HKIB 2WUCA 4AN7A 1O31A 1GHVH 1AVGH 1SGDE 5HGGA 1TQ7B 4UFFH 1BHXF 1M9UA 3E0NB 3NK8A 1OP0A 3EAJA 1IQHA 1DM4B 1Z6EA 2ALVA 1FZZA 1VGCC 2ZCHP 2SFAA 1WAYB 4HZHA 1KXBA 1O2YA 2HPPH 2A45B 1V2WT 1HAVA 4Z0KA 1O3AA 1GBAA 2R2WU 1W0ZU 2JETB 4U30A 1KXAA 5GIBA 3BTHE 3MMGA 4OS2A 2A5KA 1NFXA 4AX9H 1ELCA 3F6UH 1FY8E 3KN2A 1XX9A 2ZFFH 3MNXA 2GV6A 5A8YA 1QJ6B 2ZDLA 3TU7H 1EOLA 2EC9H 1FJSA 4KELA 5HM2A 1TMTH 1YKTA 1UO6A 1TALA 2D8WA 2VWNA 3TJOA 1BRBE 1E38B 1GBLA 1TGTA 5JDUB 2J2UA 1GL1A 1W8BH 1NESE 1O5FH 2A1DB 2ZFTA 3Q76A 4UD9H 1DXPA 5A8XA 2EI7A 1GVZA 2FTLE 3B23B 6GCHF 5TJXA 3EA7A 1BB0B 1O0DH 2FM2A 1ETTH 1CA8B 2R0KA 3ZYEA 5EXLA 1VZQH 2BY9X 2C93B 4KP0A 1K21H 2ULLA 2GDEH 3F9HA 4CR9A 2OTVA 2OC0A 2HOBA 2A0QB 2JKHA 5J4SA 3UWJH 1LHGH 1C5SA 1OSSA 1ZMJA 1G3DA 6CHAB 3TK9A 1HBTH 2GDDA 2NU2E 3SUGA 1HJ8A 2ZPQA 3OY5U 2BTCE 3UR9A 3S7HB 1XM1A 1LVBA 2FMJA 1NZQH 1GBJA 1SGTA 2ZFPH 1EZQA 5E0GA 4Y79A 4JYVH 2YNAA 2ZEBA
chains in the Genus database with same CATH superfamily
4CHAC 4YTAA 1GWAA 1NFWA 2A4OA 4E7NA 2QF4A 1ZTLA 3FZZA 3Q3XA 5DP9A 3TVJB 5L2ZH 3S9AA 1P06A 1G2MA 2Z6BD 1C5YB 1DY9A 3CNRA 2IN2A 4X1SU 1C1OA 1V2KT 4D7GA 2GCHF 1BMAA 3CS7A 2Z3EA 1K1OA 5TCCA 3MO9A 1COWD 1BUIA 4DT4A 1MQ6A 1SOTA 1G3CA 1ESTA 3OEHD 3SNEA 2P3TB 1C1VH 2VIPA 2VWMA 3OY6U 1GI3A 2UWLA 4FUHA 2WYJA 4YLQH 4A1XA 5HIYA 3M7UA 2FLRH 3A83A 3SU6A 1EAWA 4X8SH 2FOAA 3G01A 3F9EA 3M5OA 4FUBA 3RXAA 5A8ZA 2CV3A 1H4WA 7ESTE 1C5OH 3M3VA 1LVOA 1BRCE 1QL7A 4RI0A 2F9UA 1DSTA 1SL3A 2H6MA 1SMFE 2WV4A 2O8UA 3TJUA 1LVMA 2BDYA 1WOFA 1L4ZA 3KQBA 4J1YA 2C8XB 2QGRA 5DN6D 4I8LA 4ABAA 3A8CA 1QJ7B 3OFND 8ESTE 1V2MT 2AHME 2QF3A 3BIUH 3D23A 4TSFD 1GI5A 8GCHG 4XBCA 1V2ST 1FY5A 1UTNA 1GHWH 2V35A 2W3IA 1P02A 5C2ZA 4JYUH 3TIUA 5C5NA 1H8ED 1MCTA 4A92A 2KM0A 3AVZA 1LHFH 3FO8D 3VB6A 4I7YH 2F9VA 1O3NA 4I8GA 2PSXA 5EW1H 2OP9A 1P2QA 3U9AH 3SBKA 2SNVA 1AB9C 2RA3A 1F5KU 4ZH8A 1JBUH 3GCOA 3SGBE 5FCKA 1YM0A 1EAIA 2FPZA 2VWOA 1MCVA 3CENA 1KDQB 2O8MA 2VVUA 2PGBB 1FI8A 1J17T 2HLDD 3ZZ6A 3BN9A 1HAOH 2IOTA 5DGJA 5HXFA 2NU3E 4KTCA 3SORA 2BVXH 4AFSA 1BTHH 3MTYA 4GVUA 4H4FA 1DT2A 4FUGA 1O2ZA 1SB1H 2Y81A 3N7DA 4SGBE 1YCPM 1NY22 2YMSC 1C2MA 4DGJA 2WPJS 1CT0E 2AH4X 5HM9A 2CN0H 3GCHC 1TRYA 3RXCA 1DE7H 4AGKA 1AFQB 1E36B 1L4DA 4ZKRU 3A7ZA 1H9LB 1FUJA 2V3OH 4A5TS 1HB0B 3MU1A 1AO5A 2D2DA 3K65B 4AYYB 1C5QA 4ZHAA 2PV9B 1O2QA 1D3PB 1QRZA 1RJXB 1TOMH 3KCGH 1C2GA 1H8HD 2KAIB 2SGQE 2Z9KA 1MABB 1P2NA 1K1JA 4JK6A 4B71A 3IG6B 2R9PA 4WY3A 4ABHA 4Y76A 1BITA 3RXHA 2L74A 1HLTH 1UK2A 1GHYH 3GDSA 1O3CA 4NA7A 5CE1A 4WXVA 2BMGB 1GMHG 1Y5AT 1BRUP 4MNYA 5FL7D 3BTFE 4AOQA 2VB0A 4ISIH 1YPHE 1EPTC 2DUCA 1QURH 3UPEA 1O37A 1OOKB 2NWNA 5T6DA 1ZRKA 1O33A 3QUMP 2SGFE 3MNBA 4FVBA 1UVUH 4YZUA 1FY3A 1CGHA 1HAHH 1LPGB 2KCPA 1UK4A 4NA8A 2ZHWH 1WXRA 1B5GH 1SC8U 2ZDKA 2M2AA 1TX7A 1BBRH 2ZF0H 2I6SA 1QJ1B 3A88A 1IQNA 4B6FA 4WWYA 1ZTJA 1MAYA 4UEHH 1HAIH 4XRNA 5DKMA 2W7SA 3M36A 3ZVBA 1O39A 4OS5A 3F9FA 2RFKC 1EASA 3GS9A 2HGTH 4GPGA 3RXSA 1F5LA 4O9VA 5GJ4B 1GL0E 2UWOA 2W7UA 1WDIA 5EXMA 3OU0A 1C5PA 4NSVA 2GZ8A 2A4RA 3EYDA 5EJ1A 4X1NU 1ANDA 5ESBA 1DLKB 2GZ7A 2IJOB 2WUBA 1C1WH 2V7QD 3QK1A 1MTVA 4ZKSU 3K2UA 3ATKA 3SJKA 1DPOA 4H6SB 9LPRA 3U8OH 1GI8B 5DP3A 1HRTH 3WWBA 4BANB 1BCUH 3NZIA 3LC3A 3EE0B 4YOJA 3UQVA 3A89A 5K0HA 1IQMA 1TBQH 2SGEE 3B9FH 3UREA 1S0RA 4I31A 2J34A 1NN6A 1Z71A 1GJ6A 2P3FH 1J14A 4NIYA 1UMAH 2PW8H 1AI8H 1C5LH 2C8ZB 1SQRA 5DP7A 3VGCC 1EOJA 2GZ9A 4XBBA 4Y7AA 1V2TT 1XUIA 1A2CH 5A2MH 1AGJA 1FONA 1HJAC 3LT3A 4INKA 4TWYA 1UHBA 2FOBA 1SFIA 1Z8GA 3PMJA 1PPEE 3UNRA 1YGCH 5CHAB 1LDTT 2ZHEH 2YNBA 1EUFA 1UCYK 1SLVB 2BZAA 2P95A 2CHAB 4MPVA 1L1NA 2J95A 2YOLA 1P2MA 3E16B 2SNWA 2BDGA 2GCTB 1W11U 2XBYA 3TGIE 4NWKA 4YOIA 3HK3B 1JOUB 1SLXB 1QBOA 4FU8A 2TGPZ 6ESTA 3QGNB 1Y3YA 4JMYA 2BY7X 1A3BH 2BLOA 2Z7FE 4OM9A 3FP7E 5I46H 3E90B 1KSNA 1N1LA 1GHBF 1K2I1 2OCVB 1F0UA 1FY1A 4FUIA 4XE4A 1SOZA 2ODPA 2QXGA 1KXDA 3BV9B 3KQEA 4BAHB 1S0QA 4Y0ZE 3SU2A 1XUHA 1GBBA 4X1RU 4B2CA 3RU4T 3A8AA 4A1TA 4I8KA 2ZNKH 4NGAH 2J9NA 1SQAA 4RKJB 5A09A 1ELBA 4MQAA 4RT1A 2ZCLP 1Q3XA 1DWEH 2VIVA 4BOHA 4FUFA 2HNTE 1EP6A 3TH3H 3Q00A 4UFGH 2ODYB 2Z94A 2THFB 1WBGB 2B7DH 4MNWA 1H9IE 4Q7YA 1S84A 1C4V2 2GP9B 2G8TA 1QB6A 1QA0A 2P8OB 1QCPA 3GDVA 4IS5A 1YYY1 1RS0A 1TA2A 4A7IB 1SQOA 1MKWK 4VGCC 1ZYOA 1NRSH 4FUJA 3GY8A 1ZRBA 1BJUA 4D9QA 4X6PA 5JBCS 3TH2H 3BG4C 1W3CA 3NRLA 1DOJA 1O35A 2FODA 3GYMA 5FPSA 1GG6B 3ENSB 1ANEA 2P94A 3HGNA 2SGPE 4NG9H 2O8WA 1BTWA 2TPIZ 1QRWA 2AGGX 3C1KA 4CR5A 1YWUA 2ALPA 1FY4A 1GCDA 4IC5A 3GCTG 3LJOA 1PPFE 4WMDA 3SU0A 4TY6A 3RP2A 3T25A 2GT7A 5LPFA 3UOUA 1D3QB 3MU8A 4FUDA 2XC4A 3BTKE 3UNSA 1LQDB 1HAGE 1XKAC 1ZMLA 6LPRA 4OS7A 2FTMA 1VITF 4JZEH 3O8CA 1TFXA 3U1JB 2XBWA 1SGNE 2WYGA 3A7VA 3I29A 1N8OC 2V3HH 4DVAU 3BTGE 1CSOE 1MAXA 2ZGJA 4MPWA 1GBMA 2XCNA 1O2XA 1AKSA 5EPNA 2ASUB 2ODQA 3QZQA 4OGYA 4XFQA 2G4TA 2FXRA 2UUYA 2F9PA 1NRRH 3TITA 1PYTD 1UTMA 2NU4E 2QN5T 3ZYDA 4KKDA 1XUGA 1PPHE 2Q1JA 1RIWB 2O8LA 1SVPA 5FX6A 1TAWA 1ZLRA 3RXMA 1KXCA 2GMTC 1C5NH 1RGQA 1OXGA 3AAUA 4FUEA 2PLXA 2VIQA 3N99A 3A7XA 2F9OA 3SNDA 3STJA 1TBZH 3GICB 1O2UA 2JH5D 1CGIE 6GCHG 1ABIH 1UTLM 4FETA 1EJAA 3B8JA 3V13A 2G81E 1O2VA 2GKVE 2YMSB 2ZU2A 1AD8H 3LDXH 3GCHB 3GDUA 4H6TA 1GMCG 3H09A 3TNTA 1Y3VA 4F48B 4FU7A 1TX8A 4YXWD 3ZVCA 4AZ2B 2BDAA 4CRGA 2ZQ2A 1W2KH 4O3UA 3RXVA 1W0JD 1XUKA 1RRKA 1HAVB 1SGCA 1TOCB 3P8GA 5ESTE 3BTME 4AG2A 1BDAA 1DITH 3UWIA 3LPRA 1O2JA 5C1UA 1AE5A 2ZDAH 2FDAA 1QBVH 8LPRA 1V2NT 1MTUA 5HIZA 5AVDA 2ZU5A 2ZPSA 4YESB 2H5DA 1Q31A 2ZPRA 4INLA 3LJJA 4I86A 2VJ1A 1EZUC 2P3UB 2V6NA 1LVYA 1C1QA 2GCHG 3ATWA 1HAZB 1O3OA 2GX4A 1JRSA 1BJVA 4NCYA 1MMJN 2ILNA 1BTYA 3ZZ8A 3GCTF 1O3DA 1T8OA 1O3PB 2XOKD 1F7ZA 1A1RA 1ETRH 3FZDA 5JYIA 1PPCE 3SW2B 2A31A 3V0XA 3BEUA 1A4WH 2HLCA 3RXOA 1O3BA 5L30H 3SHCH 4DIIH 3M61U 1PQ5A 3PMAB 1V2OT 2CXVA 5FHTA 5SGAE 2I6QA 1TBRH 3BTEE 3QWCH 3ZIAD 2P59A 4BXSA 1BT7A 1F2SE 3VB4A 3EQ0H 1P01A 2GT8A 1ORFA 2HALA 1TIOA 4M7GA 1P2OA 2TGDA 2G5NA 2FESH 1C5RA 5H4IB 3SU4A 3PLPA 2Q6FA 1FXYA 1BBRE 1YBWA 3OEED 3EGKH 1W14U 1O5BB 3QN7A 5LPEA 3UTUH 3IWMA 4ABEA 4DURA 3P8OA 2XC5A 2ZI2H 3U8RH 1O2WA 2EI6A 4Y10E 3ZVGA 1O5GH 4LK4A 1C2IA 1CHGA 3E91A 2G52A 5AF9H 1CVWH 1EPTA 3STIA 1UTJA 3QGJA 2BY5X 1AN1E 1OYQA 2OC8A 3RXLA 3PWCA 1IOEA 1O2KA 3UNQA 1FLEE 2FI4E 3FN8A 1O36A 4I32A 1BHXB 3T62A 1EP5A 1ZHMA 1SGEE 2PKSC 3RXTA 5EGMA 4BAOB 3VG8A 3PRBA 1GMCF 5DPAA 3S0NA 1ZJKA 4WXIA 1SGIB 1A0JA 3P92A 4WH8A 5JBTA 2BD9A 1QRXA 3D65E 1EB1H 3RC6A 3ZZ5A 2GTBA 3SZNA 2XC0A 1CBWC 1ESBA 3T28A 1S82A 3SUFA 1EATA 3ZVDA 1FN8A 1QNJA 1HNEE 2IPQX 1O34A 3LH1A 1KY9A 3F1SB 1FAKH 5EU8A 3RU4D 3GY3A 2ZZUH 1GI2A 2AMDA 2ESTE 5FX5A 1P57B 4OGXA 1TPAE 3P8NA 2XW9A 3VGCB 1HXEH 3SV2H 4OS1A 4B2BA 1ELTA 3RUOA 3F9GA 1KTSB 1THPB 1SI5H 4CRFA 2BLQA 3FP6E 5E2PA 1DSUA 4DW2U 1A0LA 2KX4A 5FAHA 5C1YA 1C2JA 3O8DA 4K8BA 5HKKD 3M5MA 2QXHA 2Y7ZA 1RTKA 5K7RA 3SN8A 1FN6A 1BTUA 2KCYA 4CRDA 4AB8A 1Y59T 2LPRA 3RXRA 2BY8X 1YPGH 1OWJA 3AW1A 3V3MA 1ABJH 1LHDH 3AAVA 1V3XA 1MTNB 4MLFB 3TNSA 4ZHLU 2ZG0H 1TONA 1V2VT 1V2UT 1XVOA 3MH7A 4B6EA 5EW2H 3M3SA 3PYHA 1IQJA 1O3GA 1PQ8A 1D3TB 1J8AA 2P93A 2ZFQH 2BDHA 1O30A 2ANMH 4ZMAH 2QXIA 1A0HB 1XMNB 3ITIA 4Y8ZA 1THRH 3P6ZB 1SFQB 3KNXA 3SOSA 1GCTC 3DSPA 4MG3A 5FXLA 3Q3YA 1O5AB 3SGAE 3KL6A 4BAQB 3NUMA 1ZSJA 1EJMA 3LU9B 3ODFA 5E0JA 4ASUD 5B6LA 4FUCA 2FOHA 1DY8A 3S9CA 1P9UA 4BTUB 2CMYA 1C4U2 1MBQA 1NS3A 1SKYE 2WSSD 2NU1E 1IQKA 4MPXA 2FOEA 2W3KA 3MYWA 4B2AA 1CA0B 2GGVB 2TGTA 2BM2A 2VGCB 1S6FA 4X8TH 1INCA 1CT4E 4U01A 1P2KA 1UK3A 3JZ2B 4K60A 1E37B 1XKBC 3E8LA 5DO4H 4M9FA 4ESTE 3QLPH 1VCPA 1P12E 1W7GH 1LHCH 3MHWU 4SGAE 1O3EA 2OC7A 1K1LA 3D49H 5DP8A 4AYVB 3UR6A 2ZC9H 3CS0A 3P95A 1MUEB 3I77A 3A85A 2BDIA 1LTOA 3ZV8A 2EQNA 2LELA 5C0TA 1YCPH 4AGJA 3HK6B 1E1RD 1NRQH 2XYAA 1TPSA 1O2IA 3PMBB 5HYOA 4A1VA 2C3SA 4DCDA 2A2XH 1H8DH 1MQ5A 2WV9A 4JK5A 1ARBA 1EAXA 5AHGH 3LC5A 3RXBA 4B74A 4UONA 1VJAU 1JMOH 4ASHA 4GHQA 1P05A 1XUJA 2ZGCA 4P02A 4HG6A 1C9PA 1ELVA 2AMPA 1T8LA 2Y5GA 2VIOA 1DWBH 1DFPA 4J2YB 1DUAA 5EOKA 3VFEA 1JIMA 1O2GH 4YLUA 2FYQA 2PP6A 1DWDH 1P03A 1WV7H 1FPCH 5C1XA 3U98H 1THSH 3P70B 3DD2H 4XDEA 5FBIA 1OWEA 1AWFH 2EI8A 2J38A 5FCRA 3U28C 4DG4A 4THNH 1F92A 2HRVA 2OC1A 4O3TA 1OPHB 3RXJA 3SGQE 1C5WB 1XVMA 4CH8B 3M3TA 3PRDA 3A8BA 4GHTA 2F83A 1FIZA 1O5DH 1SQTA 2VIDA 1GHBG 2AFQB 1ACBE 1F0TA 3QDZB 3RU4E 2IPHA 3MI4A 4D8NA 2JH0D 4UDWH 3OAAD 3BTWE 1IQEA 1HAXB 3KQ5A 1TA6A 1Q2WA 1A5GH 3ZVEA 2BXTH 3PO1B 5JPMH 2FIRH 1BMNH 2BY6X 2FEQH 5C0UA 3VPKA 1P3CA 2TGAA 1Z1IA 1ZSKA 2JETC 3H7OA 4BAKB 2PTCE 3N7EA 5F03A 2H2ZA 3VXFH 5LH8A 5PTPA 2OK5A 2A7HA 4X2YA 3SV8A 1Z8RA 1WSSH 1JRTA 2BQ7B 5L6NH 1XXFA 1B7XB 1QBNA 4FVDA 5EIYA 1FV9A 1V2JT 3E6PH 1UHBB 2F91A 5GXPA 2DE8A 2GD4B 1VGCB 1AE8H 2PR3A 1SLUB 1UCYH 1IQFA 3E3TA 3P17H 4QT8C 1DXWA 2TBSA 4UFDH 1LQEA 2K1QA 1QL8A 1EX3A 5DSFA 2ZTYA 2WV5A 3UY9A 2ZGBH 2KCOA 1EKBB 1ZPZA 3GY6A 5FPYA 1NRNH 1YF4A 1V6DA 3F2HA 1DWCH 1S83A 1EB2A 1QGFA 1DDJA 4P00A 1QHRB 2EY4C 1BRAA 1TWXB 3S69A 2VH6A 1D9IA 1ELGA 2WPMS 4YOGA 1QIXB 3PLBA 3FFGA 3OYPA 2VVVA 3RMOH 1B0FA 2BB4A 1VITG 1GHZA 1WQVH 5A0CA 2Y5FA 5IYTA 1CE5A 5KEDA 1ZHPA 3LH3A 4RN6A 3F0OA 3FAOA 1ANCA 1FIWA 1RD3B 1BTXA 1Y3XA 1HIAA 1AUJA 4O97A 1S6HA 1T7CA 3PTNA 1AUTC 4D7FA 1TMUH 2PKAA 2YMSD 4IBLH 1S81A 1Z6JH 3VXEH 5C20A 2PFEA 2D1JA 1P3EA 2Z9JA 1YLCA 3LIWA 1MU6B 3RC4A 3URDA 4NFFA 2A5AA 1A5HA 1KIGH 1OX1A 3A87A 1ID5H 1WUNH 4CRAA 3N7OA 3T29A 4UE7H 2ANYA 2C8YB 4OS6A 1DS2E 1E35B 4B1TA 2JIZD 3BTQE 1TNLA 5EJLA 1O38A 4XSKU 2ZHQH 4CHAB 1TNGA 4WMEA 1QQ4A 4E06H 3PM3A 3HGPA 1AZZA 2OINA 3L6PA 2QE7D 5JB9S 1QB9A 2XBXA 1BTZA 4MNVA 1MKXH 4TPIZ 1P0SH 4GUXA 1TNJA 3OTJE 4ZKOU 1PPGE 5F6MA 3SYJA 2QA9E 3UOPA 1FX0B 2Q6GA 1A61H 2Z9IA 4Y6DA 1QY6A 3U8TH 3MOCA 1P09A 1TYNA 2ZGXH 4Q7XA 1FMGA 1OKXA 2ZHDA 3BTDE 3SNCA 2B0FA 1K22H 3NPSA 1W12U 3WW7A 3QZRA 4CRBA 4IN1A 3W95A 1UW7A 1T8MA 4JCNA 2VNTA 3UAIC 3NXPA 1D3DB 1PPBH 4HI3A 4U32A 3HPTB 4BTIB 1AKSB 1KXEA 1GBFA 1GJ5H 2FOMB 3A7YA 2XBVA 2ZFRH 4IMZA 4RKOB 3LONA 2QAAA 4YT6H 2ZU1A 2FP7B 1L0ZA 3MFJA 1CHOG 2WINI 1WU1A 2G51A 1TE0A 3QX5H 5JB8S 2ANKH 3C27B 1J15A 2ZDVH 3SNAA 1Z8IB 3VEQB 2IJD1 4AFUA 3KQDA 5EQRA 2HPQH 3BTTE 1WCZA 4X8VH 3RMLH 1AZ8A 5TCAA 4D9RA 1AHTH 1KLJH 2CK3D 5GWZA 1YPLH 1YPHC 2BX4A 2JJ1D 4X0WU 3GCNA 4Y8YA 1OHHD 5A0BA 1SSXA 2AS9A 4Y0YE 2K0QA 1P8VC 1AFQC 1ZTKA 3K9XB 4IC6A 5FBEA 2QF0A 2A32A 1AB9B 1VCWA 1YY3A 2BD8A 1GDQA 2BOKA 2J5UA 4MNXA 4X6MA 1V2RT 2H9TH 2STAE 3MNCA 1YPMH 4RSPA 1TQ0B 4GCHG 2XNDD 1G30B 1IHTH 3VB7A 3JZ1B 1NTPA 2XCFA 1A46H 1NU9A 1AVWA 3RXDA 3MWIU 1O2SA 1GI4A 1O3KA 2FWWA 1AVXA 3W94A 4ABGA 4AB9A 3MU0A 1F0SA 2ZWLH 2TRMA 1YLNA 3LGUA 2UUJB 1HPGA 3RXIA 3RXKA 1GJDB 1HXFH 4HGCA 3ATLA 1H1BA 4F4OC 1SG8B 2G55A 1TNKA 4JZ1A 3T5FH 1P11E 4F55A 2WPHS 1JIRA 5DP5A 1SPJA 1SGRE 2M5TA 1GMDF 1Y3WA 2W26A 1Z1JA 4Y11E 1SGPE 2VINA 2BQ6B 1NROH 3PV5A 4NA9H 1GBEA 2PSYA 4JZIA 3QO6A 2J98A 3LGVA 1V2QT 1ZPCA 4NWLA 4AC9A 2ANWA 2ZU3A 1MU8B 2J92A 1TPOA 3ATMA 2BXUH 4ZCNA 5BPEA 1GVLA 2BYAX 2XNIA 1XXDA 5GNDA 1PFXC 3DSOA 2B5TB 1WTGH 3TGJE 3RMMH 3FANA 1Y5UT 5CDFE 3A81A 2OBOA 1CHOF 2QXJA 1GGDC 1GBIA 2RDLA 2FOGA 2B8OH 2OD3B 2PTNA 2PWXA 1HUTH 2BQWB 1C2EA 1AU8A 2GVFA 1WYKA 3ZZ9A 5ABWA 1EPTB 3BEFB 3M37A 2KFWA 4WVPE 5C5OA 3SI3H 1AMHA 3A8DA 1EFRD 1W10U 2F9NA 1SGFA 1C2DA 4LZ4B 2XWAA 1ZHRA 5C17A 2SGAA 1P2JA 3LGIA 3KF2A 2Z3DA 3DA9B 3HKJB 4UFEH 2PUQH 4GAWA 5IDKA 3KYFA 1C5VA 2ZHFH 4FXGH 5AFZH 1EXFA 5C67A 2TIOA 3BSQA 4TWWA 1W7XH 1P10A 4TY7A 1GJCB 1FQ3A 5C3NA 4WMFA 2CF8H 3LOXA 4OS4A 2Y7XA 5EPYA 1BQYA 3TGKE 3SJ8A 2ZIQH 4GCHF 1ARCA 1TX6A 3TPIZ 2FI3E 2JJ2D 2AIPA 5EODA 3EDXB 4I33A 4Z1MD 1N6YA 2QYIA 1LPZB 3BIVH 1DANH 1D6WA 3KEEA 5F53A 2QCYA 1GVKB 2BDBA 1DICA 4H42U 2AMQA 1QL9A 2FX4A 4Y7BA 1O2PA 1PQ7A 1RTFB 1ZOMA 2HNTC 5T3HA 1CO7E 5LGOA 1Z8JB 1D4PB 1W0KD 4ZAEA 1GJAB 4MTBA 4TYDA 4X2VA 2ZGHA 3T2NA 3A82A 1LKBA 5CHAC 3V12A 1TGBA 1UCYE 3GY4A 1K1MA 3M7TA 2CHAC 3DCLA 3AASA 3RMNH 1O5CB 3DT0H 1AFEH 3V7TA 3LGYA 3DFLA 5DK1A 4XOJA 1ZZZA 2GCTC 1ZR0A 3H7TA 1C1TA 1J9CH 1O5EH 3MU4A 1ZPBA 4Q2KA 1Y5BT 5DJ7A 3ZZ7A 1L1GA 4K5ZA 1G2LA 4NFEA 5F8TA 3O8RA 1G36A 1MTSA 2FOCA 1BMLA 1HJAB 5A0AE 4MVNA 4PROA 1C5UA 1GBCA 3ZZ3A 2GV7A 1ELFA 2J4IA 2AGEX 2G5VA 3ATIA 3A86A 1LPKB 4DT7B 5AFYH 4CBOA 1SGQE 2AIQA 2W5EA 1ZMNA 7GCHG 1NT1A 1HCGA 4ABJA 3RXGA 1CQQA 1L2EA 1C5MD 4NSYA 3SU1A 1G32B 1J16A 3MQKC 2UUFB 1K1IA 5L2YH 1WTHD 1KLTA 4GLYA 1NO9H 1KMHB 1VCQA 3SU3A 2NU0E 2K8IA 4BTTB 1AWHB 3LGTA 3A7WA 5JBAS 4IGDA 1S6LA 2BD7A 3FP8E 2FOFA 2OUAA 1C5ZB 2P8OC 2PUXB 1NU7B 2QF5A 1OWKA 4K8YA 3QTVH 1FNIA 2VIWA 2RCEA 1T4VH 1TGCA 5E0HA 3UFAA 2B9LA 2CF9H 1K28D 3E0PB 4AG1A 1GG6C 4A6LA 1E79D 1FAXA 1TMBH 5I25A 1C9TA 1GBTA 1X7AC 1GJ7B 3Q3KA 5EXNA 3SI4H 3SU5A 2VWLA 1UTKA 5CHBA 4X1QU 4CREA 1YPJH 4DY7B 2ZP0H 4K1SA 1VJ9U 1OWIA 4YM9A 5EG4A 2HVYB 1K9OE 4O03A 4E05H 1EZSC 3FKSD 2WZQA 4I8HA 1GI7B 4VGCB 1AQ7A 2WPLS 3SO3A 1O2RA 3BG4B 2WPKS 3PV2A 1E0FD 3TJNA 1TPPA 2O8TA 5JBBS 4X2XA 5HMAA 1O2MA 3GY7A 1PPZA 1IQIA 2L6OA 3SQHE 1LHEH 1O3HA 1YPKH 1C4Y2 1FPHH 2QY0B 1GBDA 1WQSA 2QV1A 1G9IE 2ZA5A 2PGQB 4DJZB 2A4QA 2O9QA 1IAUA 3GOVB 4X6NA 1SGYE 2W6JD 4E7RG 3U69H 4INHA 1MBMA 4WF8A 1OYTH 3GY5A 4DOQA 1RIWC 3A84A 1GBHA 1DUEA 3PWBA 1HYLA 1TRMA 1F0RA 1K1NA 1OWDA 1YC0A 1BIOA 4Y8XA 2BD5A 2KZ4A 1GHAG 1O2OA 1O3MA 1V2LT 2F9BH 2XTTB 1N8OB 1YP9A 2SGDE 4NIVA 2H1UA 1DLEA 7GCHF 2ZDNA 2P16A 4IMQA 5EJZA 1NBMD 2CGAA 3A7TA 2V3MA 3PB1E 4AFZA 1C1PA 1GI1A 4CH2B 3AW0A 1ELEE 4AORA 1H9HE 4ISNA 4R0IA 1QA7A 2XXLA 1IHSH 1C1UH 4YT7H 3ZVAA 1UJ1A 2Y6TA 4X1PU 2FYRA 1O3FA 2LNCA 2PHBA 1ZJDA 4B73A 5CMXH 1QR3E 2GMTB 1P04A 4Q63A 1ZGIA 2BLWA 1KDQA 2ZU4A 2W6ID 4B76A 3BG8A 1O3IA 1TNIA 7KMEH 3LGWA 3ESTA 4U2WA 5DP6A 3OSYA 1UVOA 1O2TA 2QIQA 1TABE 1C5TA 1A3EH 1TGSZ 4MDSA 4CBNA 4YO9A 3DSGA 2BX3A 3S9BA 2Y82A 1G3BA 3H5CB 3WY8A 5C94A 2WHXA 4ZUHA 1YCPK 5E2OA 4ZKNU 3NCLA 3DHKH 1MZAA 1VITH 1RFNA 3ZZAA 2ZCKP 2BOHB 3KYGA 4ACBA 9ESTA 1ETSH 2OXSA 3T26A 2DE9A 3EA8A 2R0LA 1O3JA 3OE7D 4LOYH 4KGAA 5ETXA 2BLVA 8GCHF 4ISLA 3UIRA 5T6FA 2V0BA 1KYNA 1C1RA 2J97A 1LO6A 2KAIA 4LXBH 1Z7KA 3L3TA 1D6RA 1O2HA 1UVPA 2WPIS 2J94A 2Q6DA 2RG3A 1SHYA 1GGDB 1BOQA 5B6OA 1UVTH 3SJIA 2HNTF 1QFKH 1JXPA 1MD7A 2JH6D 3MO3A 3PLKA 2OQUA 1T32A 2BVRH 4TPYA 3OX7U 1C2FA 3ZZBA 1SBWA 3EA9A 3M35A 3AK5A 3GY2A 5F8XA 1GHAF 1ESAA 1HIAB 3HATH 1GJBB 2BDCA 1HJ9A 3TH4H 1TLDA 2PKAB 4GSOA 1EQ9A 1PYTC 4K1EA 1F5RA 1GJ8B 2BHGA 1GJ9B 1QZ8A 1E34B 3RXFA 1EJNA 4ZXYH 4D76A 5BRRE 1QTFA 2FX6A 1BBRK 3SUEA 1A5IA 1Y3UA 2ZFSA 4ZXXH 3VB3A 3A80A 6CHAC 3MO6A 4MPUA 3SHAH 3P8FA 3R0FA 4ISHH 1KXFA 4HTCH 3SJOA 3KQCA 3ZZ4A 3SQEE 1YPEH 4HFPB 3NWUA 1ZSLA 5F8ZA 3MH6A 1GJ4H 2ZQ1A 3KIDU 3RC5A 1U6QA 1OP8A 1HGTH 1SGFG 2R3YA 3S7KB 3NKKA 2VVCA 3GYLB 4XBDA 1GPZA 3CP7A 1N6XA 2PKSB 3L33A 4TT3D 1GHXH 5GDSH 5IK2D 2FS9A 1P9SA 3RM0H 3QTOH 3ZVFA 4ABFA 1UVSH 1C1NA 2Z3CA 3ZZDA 3I78A 1G37A 3R3GB 2BZ6H 2C8WB 1GMHF 3RLYH 1CBWB 1MKWH 1W0YH 2FZZA 5T6GA 1EZXC 2R2MB 1MH0A 4Z6AH 1GDUA 3SV7A 2OLGA 4NZQA 5KECA 1CGJE 3RXQA 1NM6A 3T27A 3MH5A 4Q80A 5GCHG 4Y71A 1C1SA 1C2LA 2STBE 1LMWB 1E1QD 1HAYB 4FOUC 5E8EH 2HVXA 3O8BA 1MTNC 2AYWA 4FU9A 4CRCA 1O32A 2GJGA 2LP6A 1BMMH 1PQAA 4LZ1H 2RA0A 3K6YA 4Q7ZA 1T31A 1GMDG 1UTOA 2BD3A 2Y80A 2H9EH 1V2PT 2CJIA 2EEKA 1AY6H 4I8JA 1QB1A 1MTWA 4JZDH 3RM2H 3WWFA 3PROA 1NBME 3F68H 4K69A 5G4BA 3OTPA 2ZO3H 4AFQA 3M7QA 3EE7A 1HAPH 3UUZA 1P2IA 3Q77A 2ZTXA 1GI9B 1NPMA 3RXEA 2XWBI 2OBQA 2A7JA 3VB5A 3MH4A 1RXPA 1Y8TA 1SLWB 5DP4A 5T1VA 1EAUA 2Z9LA 3SV6A 4NIXA 1BMFD 3URCA 1C2KA 2F4LA 1ZGVA 4K3JA 1CA0C 2Y5HA 4X8UH 1HDTH 1BA8B 2OQ5A 3MU5A 2VGCC 4K1TA 5FPTA 2ZECA 5GPIB 4ZHMU 3SJ9A 4BNRA 1H8IH 1S5SA 2A2QH 3RXPA 2AGIX 4ZROA 1TRNA 1FDPA 4IN2A 3RDZA 1GI6A 2D26C 3DFJA 1TGNA 3DUXH 1OS8A 2ZKSA 4X2WA 3M5LA 1GCTB 2A5IA 3TK6A 2AEIH 5LPRA 1NFUA 5J4QA 3D62A 4ABDA 2BD2A 3TJVA 1L1JA 4R8TB 3ODDA 3PV4A 3SUDA 2H9HA 1RTLA 4JYTA 4XD7D 1MKXK 1IQLA 1TB6H 1LCYA 3K6ZA 5EQQA 3ELAH 2A7CA 2G00A 1HFDA 1SHHB 3KHVA 4NZLA 1C1MA 1NC6A 2F3CE 3ZZCA 3F3BA 1CT2E 1VR1H 1LKAA 4B75A 4Q4LA 1OWHA 2J98B 1IQGA 3E1XB 4X6OA 1OP2A 3U1IB 1UTQA 3PMHB 2EA3A 7LPRA 2KR7A 1NFYA 1MZDA 4WJG2 1PJPA 3TK5A 4ABBA 1BZXE 3PTBA 1C5XB 1SR5C 1JWTA 5EQSA 8KME2 5GCHF 3BF6H 3BEIB 4JZFH 1QQUA 1BTPA 1KLIH 4F49A 1CU1A 1KTTB 1DX5M 4K2YA 3F2GA 2BVSH 1C2HA 1AIXH 2ZDMA 3F2FA 4KTUA 3M5NA 1S85A 3RLWH 3ZV9A 1G3EA 1HV7A 1NRPH 2H5CA 1W13U 1T8NA 2XRCA 3FVFB 1T4UH 2FO9A 3IITA 4IW4E 1K0HA 1O2NA 1K1PA 1O3LA 3FOAA 2UUKB 1XUFA 4WH6A 4BXWA 3SZEA 1ANBA 2FI5E 2FS8A 2C4FH 2VU8E 3UQOA 2G4UA 3GISB 2UWPA 2ZTZA 4ABIA 1UTPA 2BD4A 2RDEA 2R3UA 1YLDA 3LKWA 1A7SA 2FLBH 4ISOA 1ELDE 4NIWA 1GBKA 2VH0A 2QC2A 4KTSA 5DG6A 4DIHH 1B0EA 5KGOA 3SNBA 3MNSA 4BAMB 1ELAA 1GDNA 2Z9GA 1MD8A 2A4GA 1O2LA 1TNHA 2HWLB 3PO1C 3SV9A 3TLOA 2AERH 3KGPA 2C90B 1GI0A 1DVAH 3RXUA 3HKIB 2WUCA 4AN7A 1O31A 1GHVH 1AVGH 1SGDE 5HGGA 1TQ7B 4UFFH 1BHXF 1M9UA 3E0NB 3NK8A 1OP0A 3EAJA 1IQHA 1DM4B 1Z6EA 2ALVA 1FZZA 1VGCC 2ZCHP 2SFAA 1WAYB 4HZHA 1KXBA 1O2YA 2HPPH 2VBCA 2A45B 1V2WT 1HAVA 2JDID 4Z0KA 1O3AA 1GBAA 2R2WU 1W0ZU 2JETB 4U30A 1KXAA 5GIBA 3BTHE 3MMGA 4OS2A 2A5KA 1NFXA 4AX9H 1ELCA 3F6UH 1FY8E 3F0PA 3KN2A 1XX9A 2ZFFH 3MNXA 2GV6A 5A8YA 3W1EA 1QJ6B 2ZDLA 3TU7H 1EOLA 2EC9H 1FJSA 4KELA 5HM2A 1TMTH 1YKTA 1UO6A 1TALA 2D8WA 2F43B 2VWNA 3TJOA 1BRBE 1E38B 1GBLA 1TGTA 5JDUB 2J2UA 1GL1A 2KCAA 1W8BH 1NESE 1O5FH 2A1DB 2ZFTA 3Q76A 4UD9H 1DXPA 5A8XA 2EI7A 1GVZA 2FTLE 3B23B 6GCHF 5TJXA 3EA7A 1VKYA 1BB0B 1O0DH 2FM2A 1ETTH 1CA8B 2R0KA 3ZYEA 5EXLA 1VZQH 2BY9X 2C93B 4KP0A 1K21H 2ULLA 2GDEH 3F9HA 4CR9A 2OTVA 2OC0A 2HOBA 2A0QB 2JKHA 4RT0A 5J4SA 2WPDD 1LHGH 3UWJH 1C5SA 1OSSA 1ZMJA 1G3DA 6CHAB 3TK9A 1HBTH 3UB0A 2GDDA 2NU2E 3SUGA 1HJ8A 2ZPQA 3OY5U 2BTCE 3UR9A 3S7HB 1XM1A 1LVBA 2FMJA 1NZQH 1GBJA 1SGTA 2ZFPH 1EZQA 5E0GA 4Y79A 4ACAA 4JYVH 2YNAA 2ZEBA
chains in the Genus database with same CATH topology
4CHAC 4YTAA 1GWAA 1NFWA 2A4OA 4E7NA 1ZTLA 3FZZA 3Q3XA 5DP9A 3TVJB 5L2ZH 3S9AA 1P06A 1G2MA 2Z6BD 1C5YB 1DY9A 2IN2A 4X1SU 1C1OA 1V2KT 4D7GA 2GCHF 1BMAA 3CS7A 2Z3EA 1K1OA 5TCCA 3MO9A 1BUIA 1MQ6A 1SOTA 1G3CA 1ESTA 3SNEA 2P3TB 1C1VH 2VIPA 2VWMA 3OY6U 1GI3A 2UWLA 4FUHA 2WYJA 4YLQH 4A1XA 3M7UA 2FLRH 3A83A 3SU6A 1EAWA 4X8SH 2FOAA 3G01A 3F9EA 3M5OA 4FUBA 3RXAA 5A8ZA 2CV3A 1H4WA 7ESTE 1C5OH 3M3VA 1LVOA 1BRCE 1QL7A 2F9UA 1DSTA 1SL3A 2H6MA 1SMFE 2WV4A 2O8UA 3TJUA 1LVMA 2BDYA 1WOFA 1L4ZA 3KQBA 4J1YA 2C8XB 2QGRA 4I8LA 4ABAA 3A8CA 1QJ7B 8ESTE 1V2MT 2QF3A 3BIUH 3D23A 1GI5A 8GCHG 4XBCA 1V2ST 1FY5A 1UTNA 1GHWH 2V35A 2W3IA 1P02A 5C2ZA 4JYUH 3TIUA 5C5NA 1MCTA 4A92A 3AVZA 1LHFH 3VB6A 4I7YH 2F9VA 1O3NA 4I8GA 2PSXA 5EW1H 2OP9A 1P2QA 3U9AH 3SBKA 2SNVA 1AB9C 2RA3A 1F5KU 4ZH8A 1JBUH 3GCOA 3SGBE 5FCKA 1YM0A 1EAIA 2FPZA 2VWOA 1MCVA 3CENA 1KDQB 2O8MA 2VVUA 2PGBB 1FI8A 1J17T 3ZZ6A 3BN9A 1HAOH 2IOTA 5DGJA 5HXFA 2NU3E 4KTCA 3SORA 2BVXH 4AFSA 1BTHH 3MTYA 4GVUA 4H4FA 1DT2A 4FUGA 1O2ZA 1SB1H 2Y81A 4SGBE 1YCPM 1NY22 1C2MA 4DGJA 2WPJS 1CT0E 2AH4X 5HM9A 2CN0H 3GCHC 1TRYA 3RXCA 1DE7H 4AGKA 1AFQB 1E36B 1L4DA 4ZKRU 3A7ZA 1H9LB 1FUJA 2V3OH 4A5TS 1HB0B 3MU1A 1AO5A 2D2DA 3K65B 4AYYB 1C5QA 4ZHAA 2PV9B 1O2QA 1D3PB 1QRZA 1RJXB 1TOMH 3KCGH 1C2GA 2KAIB 2SGQE 2Z9KA 1P2NA 1K1JA 4JK6A 4B71A 3IG6B 2R9PA 4WY3A 4ABHA 4Y76A 1BITA 3RXHA 1HLTH 1UK2A 1GHYH 3GDSA 1O3CA 4NA7A 5CE1A 4WXVA 2BMGB 1GMHG 1Y5AT 1BRUP 4MNYA 3BTFE 4AOQA 2VB0A 4ISIH 1YPHE 1EPTC 2DUCA 1QURH 3UPEA 1O37A 1OOKB 2NWNA 5T6DA 1ZRKA 1O33A 3QUMP 2SGFE 3MNBA 4FVBA 1UVUH 4YZUA 1FY3A 1CGHA 1HAHH 1LPGB 1UK4A 4NA8A 2ZHWH 1B5GH 1SC8U 2ZDKA 1TX7A 1BBRH 2ZF0H 2I6SA 1QJ1B 3A88A 1IQNA 4WWYA 1ZTJA 1MAYA 4UEHH 1HAIH 5DKMA 2W7SA 3M36A 3ZVBA 1O39A 4OS5A 3F9FA 1EASA 2HGTH 4GPGA 3RXSA 1F5LA 4O9VA 5GJ4B 1GL0E 2UWOA 2W7UA 5EXMA 3OU0A 1C5PA 4NSVA 2GZ8A 2A4RA 3EYDA 4X1NU 1ANDA 5ESBA 1DLKB 2GZ7A 2IJOB 2WUBA 1C1WH 3QK1A 1MTVA 4ZKSU 3K2UA 3ATKA 3SJKA 1DPOA 4H6SB 9LPRA 3U8OH 1GI8B 5DP3A 1HRTH 4BANB 1BCUH 3NZIA 3LC3A 3EE0B 4YOJA 3UQVA 3A89A 5K0HA 1IQMA 1TBQH 2SGEE 3B9FH 3UREA 1S0RA 4I31A 2J34A 1NN6A 1Z71A 1GJ6A 2P3FH 1J14A 4NIYA 1UMAH 2PW8H 1AI8H 1C5LH 2C8ZB 5DP7A 3VGCC 1EOJA 2GZ9A 4XBBA 4Y7AA 1V2TT 1XUIA 1A2CH 5A2MH 1AGJA 1FONA 1HJAC 3LT3A 4INKA 4TWYA 1UHBA 2FOBA 1SFIA 1Z8GA 3PMJA 1PPEE 3UNRA 1YGCH 5CHAB 1LDTT 2ZHEH 2YNBA 1EUFA 1UCYK 1SLVB 2BZAA 2P95A 2CHAB 4MPVA 1L1NA 2J95A 2YOLA 1P2MA 3E16B 2SNWA 2BDGA 2GCTB 1W11U 2XBYA 3TGIE 4NWKA 4YOIA 3HK3B 1JOUB 1SLXB 1QBOA 4FU8A 2TGPZ 6ESTA 3QGNB 1Y3YA 4JMYA 2BY7X 1A3BH 2BLOA 2Z7FE 3FP7E 5I46H 3E90B 1KSNA 1N1LA 1GHBF 1K2I1 2OCVB 1F0UA 1FY1A 4FUIA 4XE4A 1SOZA 2ODPA 2QXGA 1KXDA 3BV9B 3KQEA 4BAHB 1S0QA 4Y0ZE 3SU2A 1XUHA 1GBBA 4X1RU 4B2CA 3RU4T 3A8AA 4A1TA 4I8KA 2ZNKH 4NGAH 2J9NA 1SQAA 4RKJB 5A09A 1ELBA 4MQAA 2ZCLP 1Q3XA 1DWEH 2VIVA 4BOHA 4FUFA 2HNTE 1EP6A 3TH3H 3Q00A 4UFGH 2ODYB 2Z94A 2THFB 1WBGB 2B7DH 4MNWA 1H9IE 4Q7YA 1S84A 1C4V2 2GP9B 2G8TA 1QB6A 1QA0A 2P8OB 1QCPA 3GDVA 4IS5A 1YYY1 1RS0A 1TA2A 4A7IB 1SQOA 1MKWK 4VGCC 1ZYOA 1NRSH 4FUJA 3GY8A 1ZRBA 1BJUA 4D9QA 4X6PA 5JBCS 3TH2H 3BG4C 1W3CA 1DOJA 1O35A 2FODA 3GYMA 5FPSA 1GG6B 3ENSB 1ANEA 2P94A 3HGNA 2SGPE 4NG9H 2O8WA 1BTWA 2TPIZ 1QRWA 2AGGX 3C1KA 4CR5A 2ALPA 1FY4A 1GCDA 4IC5A 3GCTG 3LJOA 1PPFE 4WMDA 3SU0A 4TY6A 3RP2A 3T25A 2GT7A 5LPFA 3UOUA 1D3QB 3MU8A 4FUDA 2XC4A 3BTKE 3UNSA 1LQDB 1HAGE 1XKAC 1ZMLA 6LPRA 4OS7A 2FTMA 1VITF 4JZEH 3O8CA 1TFXA 3U1JB 2XBWA 1SGNE 2WYGA 3A7VA 3I29A 1N8OC 2V3HH 4DVAU 3BTGE 1CSOE 1MAXA 2ZGJA 4MPWA 1GBMA 2XCNA 1O2XA 1AKSA 5EPNA 2ASUB 2ODQA 3QZQA 4OGYA 4XFQA 2G4TA 2FXRA 2UUYA 2F9PA 1NRRH 3TITA 1PYTD 1UTMA 2NU4E 2QN5T 3ZYDA 4KKDA 1XUGA 1PPHE 2Q1JA 1RIWB 2O8LA 1SVPA 5FX6A 1TAWA 1ZLRA 3RXMA 1KXCA 2GMTC 1C5NH 1RGQA 1OXGA 3AAUA 4FUEA 2PLXA 2VIQA 3A7XA 2F9OA 3SNDA 3STJA 1TBZH 3GICB 1O2UA 2JH5D 1CGIE 6GCHG 1ABIH 1UTLM 1EJAA 3B8JA 3V13A 2G81E 1O2VA 2GKVE 2ZU2A 1AD8H 3LDXH 3GCHB 3GDUA 4H6TA 1GMCG 3TNTA 1Y3VA 4FU7A 1TX8A 3ZVCA 4AZ2B 2BDAA 4CRGA 2ZQ2A 1W2KH 4O3UA 3RXVA 1XUKA 1RRKA 1HAVB 1SGCA 1TOCB 3P8GA 5ESTE 3BTME 4AG2A 1BDAA 1DITH 3UWIA 3LPRA 1O2JA 5C1UA 1AE5A 2ZDAH 2FDAA 1QBVH 8LPRA 1V2NT 1MTUA 5AVDA 2ZU5A 2ZPSA 4YESB 2H5DA 1Q31A 2ZPRA 4INLA 3LJJA 2VJ1A 1EZUC 2P3UB 2V6NA 1LVYA 1C1QA 2GCHG 3ATWA 1HAZB 1O3OA 2GX4A 1JRSA 1BJVA 4NCYA 1MMJN 2ILNA 1BTYA 3ZZ8A 3GCTF 1O3DA 1T8OA 1O3PB 3FZDA 1F7ZA 1A1RA 1ETRH 5JYIA 1PPCE 3SW2B 2A31A 3V0XA 3BEUA 1A4WH 2HLCA 3RXOA 1O3BA 5L30H 3SHCH 4DIIH 3M61U 1PQ5A 3PMAB 1V2OT 2CXVA 5FHTA 5SGAE 2I6QA 1TBRH 3BTEE 3QWCH 2P59A 4BXSA 1BT7A 1F2SE 3VB4A 3EQ0H 1P01A 2GT8A 1ORFA 2HALA 1TIOA 4M7GA 1P2OA 2TGDA 2G5NA 2FESH 1C5RA 5H4IB 3SU4A 3PLPA 2Q6FA 1FXYA 1BBRE 1YBWA 3EGKH 1W14U 1O5BB 3QN7A 5LPEA 3UTUH 3IWMA 4ABEA 4DURA 3P8OA 2XC5A 2ZI2H 3U8RH 1O2WA 2EI6A 4Y10E 3ZVGA 1O5GH 4LK4A 1C2IA 1CHGA 3E91A 2G52A 5AF9H 1CVWH 1EPTA 3STIA 1UTJA 3QGJA 2BY5X 1AN1E 1OYQA 2OC8A 3RXLA 3PWCA 1IOEA 1O2KA 3UNQA 1FLEE 2FI4E 1O36A 4I32A 1BHXB 3T62A 1EP5A 1ZHMA 1SGEE 2PKSC 3RXTA 5EGMA 4BAOB 1GMCF 5DPAA 3S0NA 1ZJKA 4WXIA 1SGIB 1A0JA 3P92A 4WH8A 5JBTA 2BD9A 1QRXA 3D65E 1EB1H 3RC6A 3ZZ5A 2GTBA 3SZNA 2XC0A 1CBWC 1ESBA 3T28A 1S82A 3SUFA 1EATA 3ZVDA 1FN8A 1QNJA 1HNEE 1O34A 3LH1A 1KY9A 3F1SB 1FAKH 5EU8A 3RU4D 3GY3A 2ZZUH 1GI2A 2AMDA 2ESTE 5FX5A 1P57B 4OGXA 1TPAE 3P8NA 2XW9A 3VGCB 1HXEH 3SV2H 4OS1A 4B2BA 1ELTA 3RUOA 3F9GA 1KTSB 1THPB 1SI5H 4CRFA 2BLQA 3FP6E 5E2PA 1DSUA 4DW2U 1A0LA 5FAHA 5C1YA 1C2JA 3O8DA 4K8BA 3M5MA 2QXHA 2Y7ZA 1RTKA 5K7RA 3SN8A 1FN6A 1BTUA 4CRDA 4AB8A 1Y59T 2LPRA 3RXRA 2BY8X 1YPGH 1OWJA 3AW1A 3V3MA 1ABJH 1LHDH 3AAVA 1V3XA 1MTNB 4MLFB 3TNSA 4ZHLU 2ZG0H 1TONA 1V2VT 1V2UT 1XVOA 3MH7A 5EW2H 3M3SA 3PYHA 1IQJA 1O3GA 1PQ8A 1D3TB 1J8AA 2P93A 2ZFQH 2BDHA 1O30A 2ANMH 4ZMAH 2QXIA 1A0HB 1XMNB 3ITIA 4Y8ZA 1THRH 3P6ZB 1SFQB 3KNXA 3SOSA 1GCTC 4MG3A 5FXLA 3Q3YA 1O5AB 3SGAE 3KL6A 4BAQB 3NUMA 1ZSJA 1EJMA 3LU9B 3ODFA 5E0JA 4FUCA 2FOHA 1DY8A 3S9CA 1P9UA 4BTUB 2CMYA 1C4U2 1MBQA 1NS3A 2NU1E 1IQKA 4MPXA 2FOEA 2W3KA 3MYWA 4B2AA 1CA0B 2GGVB 2TGTA 2BM2A 2VGCB 1S6FA 4X8TH 1INCA 1CT4E 4U01A 1P2KA 1UK3A 3JZ2B 4K60A 1E37B 1XKBC 3E8LA 5DO4H 4ESTE 3QLPH 1VCPA 1P12E 1W7GH 1LHCH 3MHWU 4SGAE 1O3EA 2OC7A 1K1LA 3D49H 5DP8A 4AYVB 3UR6A 2ZC9H 3CS0A 3P95A 1MUEB 3I77A 3A85A 2BDIA 1LTOA 3ZV8A 1YCPH 4AGJA 3HK6B 1NRQH 2XYAA 1TPSA 1O2IA 3PMBB 5HYOA 4A1VA 2C3SA 4DCDA 2A2XH 1H8DH 1MQ5A 4JK5A 1ARBA 1EAXA 5AHGH 3LC5A 3RXBA 4B74A 4UONA 1VJAU 1JMOH 4ASHA 4GHQA 1P05A 1XUJA 2ZGCA 1C9PA 1ELVA 2AMPA 1T8LA 2Y5GA 2VIOA 1DWBH 1DFPA 4J2YB 1DUAA 5EOKA 3VFEA 1JIMA 1O2GH 4YLUA 2FYQA 1DWDH 1P03A 1WV7H 1FPCH 5C1XA 3U98H 1THSH 3P70B 3DD2H 4XDEA 5FBIA 1OWEA 1AWFH 2EI8A 2J38A 5FCRA 4DG4A 4THNH 1F92A 2HRVA 2OC1A 4O3TA 1OPHB 3RXJA 3SGQE 1C5WB 1XVMA 4CH8B 3M3TA 3A8BA 4GHTA 2F83A 1FIZA 1O5DH 1SQTA 2VIDA 1GHBG 2AFQB 1ACBE 1F0TA 3QDZB 3RU4E 2IPHA 3MI4A 4D8NA 2JH0D 4UDWH 3BTWE 1IQEA 1HAXB 1TA6A 1Q2WA 1A5GH 3ZVEA 2BXTH 3PO1B 5JPMH 2FIRH 1BMNH 2BY6X 2FEQH 3VPKA 1P3CA 2TGAA 1Z1IA 1ZSKA 2JETC 3H7OA 4BAKB 2PTCE 5F03A 2H2ZA 3VXFH 5LH8A 5PTPA 2A7HA 4X2YA 3SV8A 1Z8RA 1WSSH 1JRTA 2BQ7B 5L6NH 1XXFA 1B7XB 1QBNA 4FVDA 1FV9A 1V2JT 3E6PH 1UHBB 2F91A 5GXPA 2DE8A 2GD4B 1VGCB 1AE8H 2PR3A 1SLUB 1UCYH 1IQFA 3E3TA 3P17H 4QT8C 1DXWA 2TBSA 4UFDH 1LQEA 2K1QA 1QL8A 1EX3A 2ZTYA 2WV5A 3UY9A 2ZGBH 3GY6A 1EKBB 1ZPZA 5FPYA 1NRNH 1YF4A 1V6DA 1DWCH 1S83A 1EB2A 1QGFA 1DDJA 1QHRB 1BRAA 1TWXB 3S69A 2VH6A 1D9IA 1ELGA 2WPMS 4YOGA 1QIXB 3PLBA 3FFGA 3OYPA 2VVVA 3RMOH 1B0FA 2BB4A 1VITG 1GHZA 1WQVH 5A0CA 2Y5FA 5IYTA 1CE5A 1ZHPA 3LH3A 4RN6A 3FAOA 1ANCA 1FIWA 1RD3B 1BTXA 1Y3XA 1HIAA 1AUJA 4O97A 1S6HA 1T7CA 3PTNA 1AUTC 4D7FA 1TMUH 2PKAA 4IBLH 3VXEH 1S81A 1Z6JH 5C20A 2PFEA 2D1JA 1P3EA 2Z9JA 1YLCA 3LIWA 1MU6B 3RC4A 3URDA 4NFFA 2A5AA 1A5HA 1KIGH 1OX1A 3A87A 1ID5H 1WUNH 4CRAA 3N7OA 3T29A 4UE7H 2ANYA 2C8YB 4OS6A 1DS2E 1E35B 4B1TA 3BTQE 1TNLA 1O38A 4XSKU 2ZHQH 4CHAB