4WY3A

Structure of sars-3cl protease complex with a phenylbenzoyl (r,s)-n-decalin type inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Fused-ring structure of decahydroisoquinolin as a novel scaffold for SARS 3CL protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wy3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wy3A02
2Y81A 3ZZ3A 1YPJH 1RXPA 3HK3B 3C27B 1BBRH 1GHAG 3F6UH 5AHGH 4IS5A 5GIBA 1AZZA 1MKWH 1TX6A 5E8EH 1TBZH 3RXKA 5EQRA 1BTPA 1NO9H 1ELDE 5F8XA 2UWOA 4ISOA 2XW9A 1C2DA 2BVRH 3E8LA 2BD2A 3U8RH 5FCKA 1YKTA 3RLWH 1F7ZA 3PO1B 3GYLB 1HAIH 5T6FA 2XXLA 1O2HA 4JZIA 1HNEE 3ZVFA 4AN7A 2XWAA 3AW0A 2A1DB 1C5ZB 3U1IB 2W3IA 5DJ7A 1YCPH 1DOJA 3GY3A 3LH1A 2CGAA 2XBXA 1ANEA 1GHBF 3M5NA 4ABFA 1GMDG 1BOQA 1P2MA 1UTQA 1JOUB 4A1VA 3GCTF 3UPEA 2FOHA 4FU9A 1ANBA 1EJMA 3ATWA 1O5CB 3SUGA 3A84A 1QRXA 4R0IA 4YZUA 2A45B 4NIWA 3L33A 2PV9B 4X1NU 1TX8A 2A4GA 3LGWA 3EA9A 2UUJB 1AN1E 5JDUB 1EQ9A 1HAYB 2QA9E 3SGAE 4X1PU 2BLWA 2W26A 4H4FA 3FP8E 2KAIA 3TGIE 1GBKA 1TMUH 4GSOA 4BAHB 1OWDA 4IMZA 1O3JA 1WYKA 1O36A 1C2KA 4ABEA 2BLVA 3GYMA 1S82A 4D76A 1HB0B 3LONA 1HAVB 1TYNA 6CHAC 5L30H 2BZ6H 2VH0A 1N8OB 4THNH 1HIAA 1YPEH 2XNIA 3QN7A 2PTCE 2ZCKP 3A7TA 1CO7E 3GOVB 2SGQE 1BZXE 1NC6A 1AGJA 1K2I1 1Y8TA 2YNBA 2ILNA 1BTZA 1FPHH 2BDHA 3HGNA 1H9IE 3ZZ4A 1A5GH 3SNCA 1ETRH 5FX6A 3D23A 1SLWB 2Z9JA 1CE5A 4NA9H 3T2NA 3RM0H 2FEQH 2LIZA 2Z3EA 1RFNA 3A7ZA 3A7WA 3SJ9A 3QGJA 5A8YA 1HCGA 3QTVH 1LVMA 3QLPH 1P3EA 5HMAA 1AB9B 2C8ZB 2QXJA 3QZQA 3OY6U 3F9EA 1V2NT 2J9NA 1GDNA 1YGCH 2RDLA 4B76A 4I8HA 5AF9H 8ESTE 2ZU4A 1F5KU 1KTTB 3TNSA 1AKSA 1SHHB 2TGTA 1J16A 4ABJA 1GJDB 4X0WU 1GHVH 4AGKA 5K7RA 1AMHA 3MH7A 3SO3A 1TMBH 2FYRA 4IW4E 4AG2A 3ZZBA 2Q6FA 1ZYOA 4ZMAH 1CGHA 1QR3E 1MZDA 1FIWA 3RXPA 1ESTA 4SGAE 1AO5A 2OC0A 5HGGA 4ISIH 3BN9A 2B9LA 3TJOA 3ZZ7A 1K22H 1XVOA 4Y71A 3O8CA 2SFAA 2OBOA 1OOKB 2OC8A 3PLKA 3E1XB 3RXVA 3KEEA 2H9EH 2EA3A 1OPHB 3RXGA 1P2OA 4KKDA 1P01A 1CHOF 1D4PB 1F5LA 3BIUH 1FAXA 1TA2A 3TPIZ 2ODYB 3ODDA 1Z6EA 4TY7A 1TE0A 4ZH8A 1O3PB 4FUGA 1VCWA 5TCCA 3PO1C 3SOSA 1C5WB 1LMWB 1QHRB 3TK6A 3TH2H 2ALPA 4Q7YA 2ZECA 4JK5A 4KTCA 3N7OA 3AAUA 1CT2E 1MTVA 4GPGA 4YESB 5C67A 4M7GA 4Q7ZA 2THFB 1ZGVA 5DP4A 4NSYA 4K1SA 1KLJH 4TY6A 1G3BA 3OX7U 4ZHMU 1CVWH 3A89A 3EA8A 1K9OE 2F9BH 5ESBA 2G00A 5DGJA 3PV4A 1A7SA 1AWHB 3VB5A 2BZAA 1JBUH 4UFFH 3EAJA 2FX6A 4BAQB 4UFDH 1C1QA 5DP9A 5PTPA 1Z8IB 1O3HA 1W7XH 4UDWH 4TPYA 1D6RA 1YM0A 1B7XB 2F9UA 2ZQ2A 2CN0H 4Q7XA 1GMDF 1ACBE 3VGCB 1ELGA 1AFQB 1IQKA 2HOBA 3E6PH 1O3MA 1UK3A 3PLPA 1FY1A 5GWZA 1IOEA 4AOQA 2ZA5A 1NRRH 1TQ7B 1O3DA 1P2KA 3SNAA 1UTJA 2QYIA 3MNBA 1AU8A 3TLOA 2Y5HA 1CT4E 1P2IA 3A87A 1O38A 2G5VA 2VWMA 4IN2A 4Z0KA 1AD8H 1ZMLA 3QX5H 1BRBE 5ABWA 1PPEE 1LTOA 1IQNA 4CRAA 3VB7A 4D8NA 2R3YA 3MO3A 4AFZA 1AI8H 1K1NA 4LXBH 3UNQA 1L1JA 4U32A 1V2QT 4TPIZ 3TITA 1T4VH 1C5SA 1FY5A 2UUYA 2FLBH 1DXPA 2FX4A 3LJOA 3ZZAA 3UOUA 1YPKH 1DS2E 5JBTA 1AFEH 1P12E 1A0JA 3A86A 4AFSA 4F49A 1E37B 1V2PT 1DY8A 1O2UA 2AIQA 3GISB 2GZ8A 2PKSB 4X6OA 9ESTA 3S9CA 5GCHG 4K1TA 3OYPA 1TPSA 2UWPA 1GHYH 2ZDAH 1NY22 2CJIA 2H5DA 2FO9A 1IHTH 5IYTA 4X2WA 2NU0E 2FOGA 1QCPA 1YLCA 5CE1A 1TA6A 4Y8ZA 3M3TA 3T27A 3I77A 1UVPA 1ZGIA 1EPTC 3E0PB 2ZDKA 1OSSA 2V0BA 4UE7H 3QGNB 1EAUA 2WUCA 1DITH 1NRNH 1W8BH 1C2JA 4WH6A 2AGEX 5EW1H 2Z3DA 2GT7A 2VGCB 4K60A 1WBGB 1ELFA 2AFQB 3BIVH 3NZIA 1L0ZA 3ZVGA 3P8NA 1EJAA 2VIPA 3V13A 2BD8A 5BPEA 3ZV9A 1DM4B 3RU4D 1C1PA 1YC0A 4NWKA 2ZTXA 1WTGH 5LPFA 1SC8U 5F6MA 2OQ5A 4FUFA 3KQBA 1WUNH 3H7OA 1KXBA 1O2KA 2ZHQH 3RXRA 3MU5A 3B23B 2KAIB 2Y5GA 4JK6A 4WF8A 2C8YB 3L3TA 1D9IA 1EXFA 1KXAA 3MOCA 5K0HA 1SSXA 1HUTH 4ZKNU 2BD7A 2GV6A 1HAOH 2FI3E 3BG4B 2J95A 1XXFA 3ZVCA 1EAXA 1WSSH 1OWKA 1SG8B 3F1SB 2Y82A 1SGDE 5EOKA 5FHTA 5B6OA 2FOFA 1HIAB 3GY8A 1HAHH 1O5GH 4I8KA 5EG4A 2ZO3H 5C5NA 1SBWA 2LNCA 1TPOA 3E91A 3LIWA 1MKWK 1SGFG 1ARCA 1V2ST 3MYWA 1A0LA 4K5ZA 2Y5FA 2B0FA 2R0LA 1W0ZU 2EEKA 1ORFA 3LU9B 1BA8B 8GCHG 2ZFRH 1LKAA 1TOMH 2HALA 1EAIA 5FPTA 3LPRA 3IITA 4A1TA 2PKAA 3SU2A 4OS6A 1Z1JA 1K21H 1GCTC 4YOIA 3A7YA 3KN2A 3SHCH 1SGYE 3UY9A 4TYDA 4BXSA 2V3OH 2W5EA 5IDKA 4IN1A 4I33A 3AAVA 1HJAC 5A8ZA 1S84A 1AKSB 2Z7FE 2FOBA 4K1EA 3TNTA 1RTKA 4JZ1A 2ZF0H 2Z3CA 1O5BB 3ZYEA 1MZAA 2FDAA 4MNYA 4ABIA 1O2ZA 3A82A 4UD9H 1H9HE 3SI4H 1P9UA 1YLDA 1W11U 2ANWA 4I8JA 4MLFB 3U8OH 3BEIB 3SW2B 4CRDA 1EPTA 1F0UA 1C2IA 3P8OA 1TRMA 4I32A 4OS5A 1OP8A 4OS1A 1D6WA 2F83A 4Y0YE 1B0FA 1ZSLA 1FQ3A 1RJXB 3UFAA 1LVOA 2NWNA 1XUGA 1DICA 5EU8A 1Y5UT 1C2MA 2OCVB 2D2DA 4RSPA 1LCYA 1BHXB 3RXLA 1Y3WA 2PUXB 3M7QA 1GL0E 2UUFB 1JXPA 1GJ5H 2ODPA 3TGJE 1V2OT 2SGDE 4D7GA 2AGGX 1ZHPA 2GDDA 1EX3A 1IQJA 2ZFPH 4X8UH 2BDIA 1NRPH 4MPWA 5GCHF 1FV9A 1BTUA 4SGBE 3LOXA 1UO6A 3DA9B 2BD4A 4XOJA 1ZPZA 1BRUP 1D3PB 1HAPH 2VVCA 2F9NA 2BM2A 4FUBA 2GT8A 2J34A 2CV3A 6CHAB 1X7AC 2FI5E 3AW1A 4VGCC 3D65E 1RIWC 1WOFA 2R2WU 2WPHS 1S0QA 4WMDA 1SL3A 1GMCG 1NTPA 3P8FA 5C1UA 5DP6A 2J4IA 4NA8A 1Q31A 3E3TA 1AY6H 4Y0ZE 5LPRA 4X6NA 1C1NA 3URDA 7ESTE 2A7JA 2C8WB 3LC5A 3MU4A 4XFQA 1OWEA 2Q1JA 1SGPE 1Y59T 1QL8A 3K9XB 4NIVA 1THPB 4NZQA 1VCPA 4D9RA 4ISNA 1N1LA 2BDBA 1BTYA 4WXIA 5T3HA 1P8VC 1H1BA 1DPOA 3TGKE 1TRYA 1C9TA 2VWLA 3SQEE 2ZU1A 4MPUA 2F9VA 2PUQH 2K7XA 1ZLRA 1VJAU 2BDGA 2HPPH 2JH5D 5DG6A 4KP0A 2BVSH 1CGIE 1A5HA 3BTKE 2BY6X 2G8TA 3NKKA 1BDAA 4CRCA 1P9SA 1SGNE 1P2QA 3SHAH 2VH6A 3EGKH 3RXEA 3UR9A 1GPZA 1J8AA 4BTUB 1TOCB 3BV9B 1C4V2 3RMNH 2XC4A 2SGEE 2FESH 1DSTA 3W94A 1Q2WA 2WUBA 1UCYE 1NROH 1LHGH 4U2WA 2H2ZA 1LHEH 2Z9IA 1OP2A 2G55A 3GDSA 1XVMA 2A4QA 3U98H 4FUDA 5FAHA 1JWTA 1C1RA 4NFEA 1ZPCA 1MTSA 3K6ZA 1QJ7B 8GCHF 3KNXA 1HLTH 3EDXB 4NG9H 3Q00A 1ZHRA 2PHBA 3WY8A 1SGEE 1LQEA 1VGCC 4A5TS 1LVBA 1A46H 2WV5A 3ATKA 2ZGJA 1C5OH 1Y3XA 4YLUA 3SJ8A 2AYWA 1RTLA 2WYJA 1SI5H 2FPZA 3MMGA 5DPAA 1YPLH 3UOPA 1DANH 2RG3A 4D7FA 9LPRA 1U6QA 1S83A 3SU0A 1A5IA 3MNCA 3TU7H 1SHYA 1AQ7A 2ASUB 1NFXA 2CF9H 4GHTA 2P3FH 4WMEA 2O8LA 1T8OA 1TX7A 4QT8C 5CMXH 5DP5A 5FXLA 2I6QA 1ZSKA 1XXDA 3ZYDA 4UEHH 3BTQE 2C3SA 2FM2A 3A8BA 1KXCA 1EATA 4AFUA 1SGIB 4O9VA 2XRCA 1J17T 4J2YB 1EASA 3RUOA 3RMOH 2HNTF 1FLEE 4E05H 3DFJA 1Z71A 1DXWA 1UCYH 4CHAB 2IPHA 1LHCH 2ZFSA 2O8UA 1UTOA 2AMDA 3ZZ8A 4MQAA 1ELCA 4BAOB 1O2RA 1BTWA 3MNXA 3IWMA 1SPJA 3A83A 1HAXB 3SNBA 4DGJA 2GZ9A 1UMAH 2BXTH 1FIZA 1HJ9A 5T6GA 1E34B 3HPTB 2WYGA 4D9QA 1P3CA 1UTKA 1AUTC 3UQOA 2G52A 5ESTE 1QRZA 4MG3A 3HKIB 3MH6A 2BQ6B 3RMLH 5EPYA 4B2CA 2PKAB 4MNVA 5GDSH 1C2GA 1SFQB 2BLOA 2Z9LA 4CREA 2BXUH 3ESTA 4ABDA 6GCHG 3M5MA 1WAYB 1ZMNA 4Z6AH 1XUHA 4AYVB 1Z1IA 1AE8H 4INKA 2TIOA 1O3KA 3M61U 2GCHG 1EUFA 1DY9A 1AVXA 1GMCF 3ATIA 3H5CB 3MNSA 3M3SA 1MAYA 1Y3YA 3O8RA 1YP9A 4U01A 3CP7A 1O3BA 4INHA 3RXUA 3ZZ9A 3RXCA 1E38B 1HRTH 1GBEA 1H8IH 1EPTB 1GI8B 7KMEH 2ZNKH 5E0HA 1TALA 3KCGH 3T29A 1KYNA 2M5TA 3EA7A 1ZJDA 5FPSA 1TBQH 4DJZB 5E2OA 1HXEH 1GBCA 2GD4B 1NS3A 1C5RA 2GMTC 4A7IB 3TJNA 3ZVDA 1G30B 4B1TA 3M36A 1LQDB 1QIXB 1ZZZA 5GXPA 1TNJA 1PYTC 3PWBA 1E35B 1YPGH 1QJ6B 3RXBA 3BTTE 3K65B 4Y7BA 3MO9A 4CBNA 2ZDVH 3U1JB 1FXYA 3SU4A 1PQ5A 3ZZCA 3STIA 2VIWA 4K8YA 2VU8E 1F0RA 1C5VA 4Y79A 1KTSB 4MDSA 4JYTA 2FZZA 1Y5BT 1O2PA 3PLBA 3EQ0H 1HV7A 4RKJB 1GHAF 4X2XA 2G5NA 2PLXA 2VIDA 4OS2A 4FUJA 4ISLA 1Y3UA 4B73A 4H6TA 1EAWA 3GDUA 3SN8A 3SI3H 4AYYB 1YPMH 4IC6A 1MBQA 4NIXA 1O3EA 4E06H 2ZGCA 4E7RG 5J4QA 1O37A 3ODFA 1DT2A 4WH8A 3SJOA 5E2PA 2ZDNA 1XUJA 1GI0A 1SGRE 4YOJA 1ELEE 1TGCA 3S69A 1S5SA 1DWCH 3Q3YA 4NCYA 3STJA 1GJ4H 4JMYA 7GCHG 1QURH 5EXNA 1UVOA 1HAZB 1GCTB 3AASA 1QFKH 2H9TH 1FAKH 3SV8A 2FTLE 3ENSB 1PQ7A 2IN2A 5LPEA 4CHAC 1HJAB 2OC1A 1O2WA 3PWCA 1V2MT 1AVGH 3ELAH 4NA7A 1C5XB 1GI3A 1XM1A 1E0FD 2CMYA 1ELBA 3F68H 2B5TB 5L2ZH 2QY0B 3BTHE 2SGFE 3S9BA 1FDPA 1OWJA 1WV7H 2VWOA 3PTNA 4AZ2B 1CBWB 2ZPQA 4A92A 5ETXA 5A0CA 2RA0A 5A2MH 3E90B 1EB2A 3T25A 1ESAA 3DFLA 4ABBA 3ATMA 1YYY1 5EPNA 1Z8GA 1V2UT 4JYVH 1OP0A 3QWCH 4OS7A 5E0GA 3P95A 1K1LA 1QQUA 1BRCE 2STBE 2FOCA 1P05A 3F9GA 5I25A 2ZCHP 2ZCLP 2IOTA 4GCHG 1K1PA 1UVTH 1Z7KA 3DD2H 4O97A 1V6DA 2AERH 1W12U 1UVUH 2QCYA 4B74A 4LZ4B 6GCHF 1MCTA 4K3JA 4FVDA 2XBWA 2FS8A 4BXWA 3ZV8A 2GCHF 2Y80A 3BTFE 2BDAA 3E0NB 2GTBA 4OGYA 1NZQH 1UTNA 4GLYA 3S7HB 3SNDA 3GDVA 1ZOMA 4NFFA 1FMGA 3F9FA 1ZJKA 3GCHC 4ZXXH 3EBNA 4VGCB 1GBTA 1GBAA 3ZVBA 1RIWB 2NU4E 1SGQE 3VEQB 3BF6H 3T62A 1K1OA 3BTDE 3RXJA 5H4IB 1TPAE 1C2HA 1G3DA 3UTUH 1VZQH 1O0DH 1BB0B 1P02A 1JRSA 1DSUA 2OXSA 4O3UA 4XDEA 2ZGBH 4DIIH 1HBTH 1KXEA 2BD3A 2AS9A 1CGJE 4HZHA 1ZR0A 1LPKB 1O2OA 3MFJA 3W95A 2OLGA 1EKBB 1C1SA 5F8ZA 4MNXA 3UWJH 1GI2A 1SLXB 2BX3A 1L4DA 4DW2U 1GI7B 1GBLA 1MBMA 2HWLB 1BTHH 1XMNB 1MD7A 1TWXB 3LGIA 2BY8X 4WXVA 1G32B 5GPIB 3TJVA 1GDUA 1GHWH 5F03A 3RLYH 2CHAB 1THRH 3RXQA 2VIQA 5C20A 4LZ1H 1HJ8A 3Q77A 1GBDA 5LGOA 3UNSA 1GVKB 2BY5X 2RCEA 2ZGHA 1BBRK 3GY4A 4X2YA 1GCDA 1BCUH 1OYQA 5FBEA 3I29A 2ANKH 2EI8A 1DLEA 3UWIA 5J4SA 2C93B 1GI5A 1P04A 3BEUA 5FPYA 2DE8A 5AFZH 1NRSH 3K6YA 1GWAA 2QXIA 1EJNA 2XC5A 2ZEBA 3SU5A 1OYTH 4DG4A 1CA8B 1C1UH 1NT1A 3MTYA 2FXRA 1O2JA 3GY5A 5C1XA 5AFYH 1YCPK 1V3XA 1TONA 2B7DH 4XE4A 3LH3A 4BOHA 1DUAA 1UTPA 2BHGA 2Z94A 1ZTLA 4CH8B 4JZFH 2NU3E 3UR6A 2BQ7B 3C1KA 3MU0A 3QZRA 1XUKA 1MU8B 1FUJA 1KLTA 2F3CE 3TK9A 5JPMH 2BOHB 2R2MB 1VGCB 1HXFH 7GCHF 1O35A 3LGTA 2XBVA 3KHVA 1ARBA 1SR5C 1TQ0B 1CBWC 1O2NA 4Y8XA 2PSYA 1PPHE 2QIQA 4ASHA 1MUEB 2VWNA 3GY7A 3NCLA 1UTMA 3BG8A 1HPGA 4ZKSU 1DDJA 1E36B 1EB1H 2AH4X 3KQDA 1FI8A 2QXGA 5SGAE 3LDXH 1O5AB 1W14U 4ZHLU 2XCFA 4DT7B 1S0RA 4INLA 5FX5A 4CR5A 2P3TB 1LHFH 2J94A 4AGJA 2OUAA 2ZQ1A 1P03A 2VINA 1UK2A 1BMLA 3KL6A 4LK4A 1IQEA 4RN6A 3BTWE 3NK8A 3RMMH 1C9PA 1XUFA 4MTBA 1QBVH 1H4WA 3FFGA 1AVWA 1GGDC 3U69H 1OKXA 4X8TH 1A4WH 1TAWA 4GCHF 2AEIH 4XBCA 3DHKH 1HYLA 4XSKU 4Y11E 1ELVA 1IQFA 3RU4E 4X1SU 1FY4A 4GUXA 1NFWA 1O2TA 4X2VA 5F8TA 1VJ9U 3VFEA 1A3EH 1HGTH 4LOYH 1C5PA 4KGAA 3MH5A 1MQ5A 1BMMH 4GHQA 1V2VT 5I46H 2QF3A 2ZC9H 2ZZUH 1FZZA 1O2VA 3DT0H 4UFEH 3SNEA 2SGPE 1HFDA 4AFQA 1Z8RA 1W7GH 4I8GA 1C5LH 1QL7A 1P57B 3FZZA 1ABIH 4MPVA 2PFEA 1KLIH 1F92A 2GX4A 2A0QB 3BTEE 1K28D 1PQAA 3PMBB 3SGQE 3MU1A 1MTWA 3MHWU 3FANA 1NRQH 4X1RU 3M3VA 5L6NH 1VITG 1EP6A 5DP8A 1M9UA 1FJSA 4Y8YA 2AMPA 2BD5A 2QXHA 2F9PA 4OS4A 1NPMA 1SLUB 2ZHFH 2QGRA 1XKAC 2WV4A 2A32A 2P59A 3B8JA 1C5YB 1G9IE 2TPIZ 2LPRA 2CHAC 4UFGH 5EXLA 1GG6C 1D3TB 1ZRKA 2AIPA 1O3GA 3CENA 1V2TT 3Q3XA 1PYTD 2PW8H 3TIUA 3RP2A 3T26A 2BLQA 4FXGH 3T5FH 2F91A 3R3GB 3HKJB 1MKXH 2XTTB 3A8CA 2ZDLA 4ZKRU 1RRKA 4TWYA 1ESBA 2Q6DA 1D3QB 2GMTB 2OP9A 5A0BA 2EC9H 1AWFH 4ZXYH 1CSOE 2D26C 1F5RA 1C4U2 3KIDU 1OWIA 3BEFB 3I78A 5DK1A 2FMJA 1V2JT 3NUMA 2PSXA 2Z6BD 5FBIA 2V6NA 2SNWA 1FPCH 4BNRA 2JKHA 4RKOB 1XUIA 2CF8H 1ZHMA 2D1JA 5E0JA 1G36A 2ZHWH 3QO6A 4K69A 1TNIA 1GBMA 1O30A 2Z9KA 2GVFA 2NU2E 2QF0A 2TGDA 3CS0A 4DIHH 1ANDA 3MI4A 3JZ1B 2OC7A 1O5EH 1OS8A 4A1XA 2P8OC 1T32A 1EZSC 1BMNH 1TRNA 1W3CA 3TK5A 2GP9B 2H6MA 2ZIQH 1QRWA 5HYOA 1O2QA 1GI6A 8KME2 3M35A 3P92A 4AB9A 4MNWA 1ABJH 3RDZA 4KTSA 1SOZA 1CA0C 1JMOH 1RTFB 1OWHA 1GBFA 2BY9X 5TCAA 4JZEH 3VB6A 2NU1E 2FYQA 4IC5A 1T8NA 1EZUC 1O2YA 2F9OA 2HGTH 2W7SA 3SV9A 3KF2A 1H9LB 2ULLA 2OINA 1C2FA 4E7NA 1C1OA 1GJCB 1Q3XA 2JETC 2VVUA 3G01A 4O03A 1XKBC 3PMJA 4CRFA 1IAUA 1MMJN 5EXMA 4JCNA 1GJ6A 2Q6GA 3VB3A 4FUEA 4X8SH 1B5GH 2C4FH 1S6HA 1C1WH 1C1TA 1G37A 1LHDH 3NXPA 1MTNB 3RXOA 4H42U 2ZWLH 7LPRA 3PROA 1GBHA 3FZDA 4HFPB 3V7TA 3RXAA 1LPZB 3D62A 2QC2A 4I8LA 5EQQA 3A80A 4U30A 3MU8A 1XX9A 2P3UB 2YOLA 1GI1A 2FP7B 4B2BA 1BRAA 1TGSZ 3EYDA 8LPRA 1CQQA 1KIGH 2Z9GA 2SGAA 3PB1E 4ZAEA 3RXDA 4ABHA 1GJ7B 3ZZ6A 3MWIU 1F0TA 1G3CA 1SOTA 1A61H 1DX5M 2P94A 3GCNA 1CU1A 1RD3B 2TGAA 5C2ZA 1FN6A 1IQLA 3KQCA 1JIMA 4XBDA 2BDYA 5EGMA 3PM3A 4X8VH 1TNGA 4WMFA 4IBLH 4YT7H 3A81A 2Y6TA 3URCA 1SB1H 2HRVA 2J2UA 4NZLA 2FWWA 5JBCS 4AG1A 3VXEH 1L1NA 2ANYA 3UIRA 1BMAA 2IJOB 4F4OC 2XWBI 2BQWB 2VVVA 2D8WA 1GMHG 1N6YA 4H6SB 4Y76A 1O3AA 3V3MA 1O2XA 2P95A 1VITF 4ESTE 1KSNA 2V35A 2GCTC 2H5CA 3LJJA 3RC5A 2GZ7A 4Y7AA 1GVZA 3UUZA 2ALVA 1EOLA 1OX1A 3NWUA 1TGBA 4AORA 1AZ8A 1C2LA 2A7CA 5CHAC 1P11E 3GCHB 1P09A 3A8DA 1V2RT 2AMQA 3SV7A 3M7TA 1NN6A 3LT3A 1QA0A 2J92A 4I31A 2PGBB 3OSYA 1EP5A 2FS9A 2PWXA 2G4TA 1K1MA 2FOEA 3LC3A 1Y3VA 2TGPZ 1BIOA 1P06A 1NESE 1SQOA 1W13U 1O3NA 3RM2H 3SV6A 5JBBS 1WQVH 1FNIA 3CS7A 1KDQB 5DP3A 1C5UA 3VPKA 5A8XA 4BANB 1H8DH 1PPFE 1ETSH 1GVLA 1ZTJA 4DY7B 2W3KA 1YPHE 2ZTYA 1SMFE 4NGAH 4NWLA 2ZTZA 3RXTA 2ZFQH 3QTOH 5HXFA 1A1RA 1F2SE 1TNLA 1W2KH 4YM9A 1ZPBA 4HGCA 3GCOA 1FN8A 3Q3KA 4WJG2 3AVZA 4Y6DA 3HK6B 1MTUA 4WWYA 1A3BH 2BB4A 3FP7E 2GV7A 2A5KA 3TVJB 1UHBB 1O3FA 1ANCA 4CRGA 2OTVA 3A7VA 3B9FH 5C5OA 4WVPE 3PTBA 1WTHD 3P70B 4B2AA 2O8WA 1NU7B 2OD3B 2J38A 5EW2H 2PR3A 4YT6H 1ID5H 2XYAA 3P17H 2FOAA 4PROA 4DVAU 1YBWA 3QDZB 2HLCA 5BRRE 3SJKA 2A2QH 2UUKB 5JYIA 3GICB 1AIXH 1Z8JB 2CXVA 1PPCE 3SQHE 4FUHA 3L6PA 3M5OA 1BQYA 1MTNC 2VNTA 2K1QA 3A88A 1RGQA 3RXFA 1MAXA 1QBNA 4NIYA 2GGVB 1BITA 1DWBH 1P10A 1O3IA 3FVFB 4CH2B 5C1YA 2WPMS 4MPXA 3E16B 1YPHC 2VJ1A 2JH6D 1O33A 6LPRA 5DKMA 2UWLA 3SZNA 5AVDA 1BUIA 1O2IA 2A4OA 1GDQA 2ZPRA 1C1MA 1ETTH 3A85A 4MVNA 3KGPA 1P2NA 1QBOA 1PQ8A 4A6LA 2PTNA 2ZHDA 1EZXC 1T31A 3RXMA 3S9AA 1O5DH 1O2LA 4Q2KA 4CBOA 1QB1A 4FU8A 2ESTE 1V2WT 2QN5T 2FODA 4J1YA 2ZU5A 2FLRH 3TH3H 3M5LA 2FI4E 1N8OC 3F9HA 2P16A 2XBYA 3VB4A 1QA7A 1V2LT 3IG6B 3S7KB 1DLKB 1PPZA 4AX9H 5JB8S 4ZHAA 2ZG0H 4B75A 1WQSA 1QGFA 1TABE 3MH4A 4I7YH 1GJ8B 1GGDB 2ZDMA 4GAWA 1BT7A 1LVYA 1O3CA 1FY8E 1G2LA 2FTMA 2ZGXH 4FVBA 1ELTA 1BJVA 2ANMH 3O8BA 3LGUA 2GDEH 2VIOA 3PMHB 1AB9C 1KY9A 1O39A 5HM9A 2WPIS 1BHXF 2BDCA 3M7UA 2YNAA 1SFIA 3RXIA 2WPKS 5L2YH 1GMHF 1DUEA 1BTXA 2PGQB 1TB6H 2DUCA 4ABAA 1PJPA 1NFYA 4BTTB 1C1VH 2V3HH 2ZU3A 1N6XA 3FAOA 1B0EA 1P0SH 1GHXH 5LH8A 1SQTA 1A0HB 2DE9A 2HNTE 3BSQA 3T28A 1P2JA 5GJ4B 4BAMB 3K2UA 1SQAA 4JZDH 1GJ9B 1MQ6A 2R3UA 3S0NA 4R8TB 2B8OH 3SBKA 3ZVAA 3H7TA 4X6MA 4Q80A 1MKXK 4K2YA 5EODA 1T8MA 1QL9A 2A2XH 1G3EA 1SVPA 5DO4H 2XCNA 1PFXC 1DWEH 3HATH 1BJUA 3A8AA 1GG6B 4HI3A 1DE7H 1FY3A 2A31A 2Y7XA 4FUCA 1S6FA 1C5MD 1THSH 2P93A 1LO6A 2TRMA 4IGDA 1O31A 1TBRH 4X1QU 1NU9A 1UK4A 1AUJA 1DFPA 4AB8A 1UJ1A 3BTME 4TWWA 1QJ1B 1IQIA 3SUFA 2RA3A 1GI4A 4BAKB 4X6PA 3P8GA 2JH0D 4KELA 3RXHA 1T7CA 5T6DA 1YF4A 2BOKA 2HNTC 2R0KA 1GI9B 3RXSA 1G2MA 2ZKSA 1HAVA 1HDTH 2A5IA 3V0XA 5TJXA 4ZROA 1KXFA 3M37A 1GBJA 1K1JA 2I6SA 2R9PA 3ZZDA 1INCA 4UONA 1PPBH 1NFUA 1GL1A 4YO9A 2P8OB 4KTUA 2Y7ZA 1VR1H 3V12A 4WY3A 2O8MA 1GJBB 1PPGE 3VGCC 1AFQC 2ZFTA 3HGPA 5FCRA 1SLVB 3SU1A 1NM6A 2EI6A 2FIRH 4DOQA 1O3OA 2ZI2H 3DUXH 1CA0B 1GJAB 4CR9A 1TGNA 1AE5A 1GHBG 2G4UA 1TIOA 4ABGA 1O5FH 3FP6E 1UCYK 3RC6A 3GCTG 2AGIX 3O8DA 3VXFH 1C5TA 5JB9S 5A0AE 4FUIA 3PYHA 5DP7A 1TPPA 2C8XB 2JETB 2OBQA 3U9AH 4CRBA 5C3NA 1JRTA 1SGFA 1TNHA 1WU1A 1DVAH 2SNVA 1RS0A 3P6ZB 1V2KT 1QQ4A 2ZU2A 2BTCE 3GY2A 4XBBA 1QTFA 1MD8A 1ZSJA 3ATLA 2OQUA 1IQGA 4JYUH 3SJIA 3JZ2B 1UTLM 2ZHEH 3UNRA 1TNKA 1T8LA 1CHGA 1KDQA 3SGBE 3LGVA 1LDTT 4FU7A 2BMGB 5HM2A 2PKSC 1TLDA 1W0YH 2ZP0H 3GY6A 1LPGB 3UREA 1K1IA 3TH4H 1O32A 3A7XA 4OGXA 3LKWA 2FOMB 1QY6A 3SU6A 2XC0A 3UQVA 1WCZA 1VITH 2ZPSA 5JBAS 1TGTA 1L1GA 1C4Y2 3SUEA 3OTJE 1J9CH 2G51A 1O2MA 1YCPM 1QB9A 4O3TA 3OU0A 2STAE 1L4ZA 1O2GH 1VCQA 1C5QA 1C5NH 1TMTH 1KXDA 1OXGA 2WPLS 2VB0A 1UHBA 1W10U 1GBIA 1ZRBA 2EI7A 4ZUHA 3NPSA 1QNJA 1SGCA 1EZQA 2O9QA 2VGCC 2BD9A 2BYAX 1HAGE 1AHTH 3LGYA 1UVSH 2BY7X 2C90B 6ESTA 1BBRE 1CT0E 1L2EA 1MCVA 3MO6A 2ZFFH 2VIVA 3TJUA 1MH0A 3D49H 4YTAA 2HPQH 3SU3A 3R0FA 3ITIA 1S85A 4BTIB 1T4UH 4Y10E 3RU4T 1ZTKA 1ELAA 1A2CH 1S81A 1QB6A 4DURA 4GVUA 2ODQA 2H1UA 4IMQA 2GCTB 2O8TA 5G4BA 2TBSA 1Z6JH 1J15A 3KQEA 2BVXH 3RC4A 5EQSA 2WINI 3SUDA 3BG4C 4YLQH 2W7UA 5CHAB 1IQHA 1ZMJA 1J14A 1JIRA 2BX4A 2G81E 2A4RA 1O3LA 3QUMP 4HTCH 3SORA 4ISHH 1SGTA 1IQMA 3Q76A 2A5AA 1IHSH 1DWDH 1EOJA 1TFXA 3U8TH 2HVXA 2WPJS 2A7HA 2QAAA 1FONA 1D3DB 1GHZA 1C2EA 1O34A 4K8BA 3BTGE 4B71A 1CHOG 4ZKOU 3OY5U 3PMAB 3ZVEA 2QV1A 3ZZ5A 4YOGA 2GKVE 4DCDA 3QK1A 1GBBA 1F0SA 2H9HA 1O2SA 1MU6B 1LKBA 1Y5AT 4NSVA 3EE0B 5A09A 3SV2H
chains in the Genus database with same CATH superfamily
2Y81A 3ZZ3A 1YPJH 1RXPA 3HK3B 3C27B 1BBRH 1GHAG 3F6UH 5AHGH 4IS5A 5GIBA 1AZZA 1MKWH 1TX6A 5E8EH 1TBZH 3RXKA 5EQRA 1BTPA 1NO9H 1ELDE 5F8XA 2UWOA 4ISOA 2XW9A 1C2DA 2XOKD 2BVRH 3E8LA 2BD2A 3U8RH 5FCKA 1YKTA 3RLWH 1F7ZA 3PO1B 3GYLB 1HAIH 5T6FA 2XXLA 1O2HA 2JJ1D 4JZIA 1HNEE 3ZVFA 4AN7A 2XWAA 3AW0A 2A1DB 1C5ZB 3U1IB 2W3IA 5DJ7A 1YCPH 1DOJA 3GY3A 3LH1A 2CGAA 2XBXA 5B6LA 1ANEA 1GHBF 3SYJA 3M5NA 4ABFA 1GMDG 1BOQA 1P2MA 1UTQA 1JOUB 4A1VA 3GCTF 3UPEA 2FOHA 4FU9A 1ANBA 1EJMA 3ATWA 1O5CB 3SUGA 3A84A 1QRXA 4R0IA 4YZUA 2A45B 4NIWA 3L33A 2PV9B 4X1NU 1TX8A 2AHME 2A4GA 3LGWA 3EA9A 2UUJB 1AN1E 5JDUB 1EQ9A 1HAYB 2QA9E 3SGAE 4X1PU 2BLWA 2W26A 4H4FA 3FP8E 2KAIA 3TGIE 1GBKA 1TMUH 4GSOA 4BAHB 1OWDA 4IMZA 1O3JA 2VBCA 1WYKA 1O36A 5HIYA 1C2KA 4ABEA 2BLVA 3GYMA 1S82A 4D76A 1HB0B 3LONA 1HAVB 1TYNA 6CHAC 5L30H 2BZ6H 2VH0A 1N8OB 4THNH 1HIAA 1YPEH 2XNIA 3QN7A 2PTCE 2ZCKP 3A7TA 1CO7E 3GOVB 2SGQE 1BZXE 1NC6A 1AGJA 1K2I1 1Y8TA 3MQKC 2YNBA 2ILNA 1BTZA 1FPHH 2BDHA 3HGNA 1H9IE 3ZZ4A 1A5GH 3SNCA 1ETRH 4P02A 5FX6A 3D23A 3UB0A 3OE7D 1SLWB 2Z9JA 1CE5A 4NA9H 3T2NA 3RM0H 4B6FA 2FEQH 2LIZA 2Z3EA 1RFNA 3A7ZA 3A7WA 3SJ9A 3QGJA 5A8YA 1HCGA 3AK5A 3QTVH 1H8ED 1LVMA 3QLPH 1P3EA 5HMAA 1AB9B 2C8ZB 2QXJA 3QZQA 3OY6U 3F9EA 1V2NT 2J9NA 1GDNA 1YGCH 2RDLA 4B76A 4I8HA 5AF9H 8ESTE 2ZU4A 1F5KU 1KTTB 3TNSA 1AKSA 1SHHB 2TGTA 2K8IA 1J16A 4ABJA 1GJDB 4X0WU 1GHVH 4AGKA 5K7RA 3UAIC 1AMHA 3MH7A 3SO3A 1TMBH 2FYRA 4IW4E 4AG2A 3ZZBA 2Q6FA 1ZYOA 4ZMAH 1CGHA 1QR3E 1MZDA 1FIWA 3RXPA 1ESTA 4SGAE 1AO5A 1BMFD 2OC0A 5HGGA 4ISIH 2YMSD 3BN9A 2B9LA 3TJOA 3ZZ7A 1K22H 3OAAD 1XVOA 4Y71A 3O8CA 2SFAA 2OBOA 1OOKB 2OC8A 3PLKA 3E1XB 3RXVA 3KEEA 2H9EH 2EA3A 1OPHB 3RXGA 1P2OA 4KKDA 1P01A 1CHOF 1D4PB 1F5LA 3BIUH 1FAXA 3DCLA 1TA2A 3TPIZ 2ODYB 3ODDA 1Z6EA 4TY7A 1TE0A 4ZH8A 1O3PB 4FUGA 2YMSB 1VCWA 5TCCA 3PO1C 3SOSA 1C5WB 1LMWB 1QHRB 3TK6A 3TH2H 2ALPA 4Q7YA 2ZECA 4JK5A 4KTCA 3N7OA 3AAUA 1CT2E 1MTVA 4GPGA 4YESB 5C67A 4M7GA 4Q7ZA 2THFB 1ZGVA 5DP4A 4NSYA 4K1SA 1KLJH 3F3BA 4TY6A 1G3BA 3OX7U 4ZHMU 1CVWH 3A89A 3EA8A 1K9OE 2F9BH 5ESBA 3F0PA 2G00A 5DGJA 3PV4A 3F2FA 1A7SA 1AWHB 3VB5A 2BZAA 1JBUH 4UFFH 3W1EA 3EAJA 2FX6A 4BAQB 4UFDH 1C1QA 5DP9A 5PTPA 1Z8IB 1O3HA 1W7XH 4UDWH 4TPYA 1D6RA 1YM0A 1B7XB 2F9UA 2ZQ2A 2CN0H 4Q7XA 1GMDF 1ACBE 3VGCB 1ELGA 1AFQB 1IQKA 2J5UA 2HOBA 3E6PH 2IPQX 1O3MA 1UK3A 3PLPA 1FY1A 3KYFA 5GWZA 1IOEA 4AOQA 2ZA5A 1NRRH 1TQ7B 1O3DA 1P2KA 3SNAA 1UTJA 2QYIA 3MNBA 1AU8A 3TLOA 2Y5HA 1CT4E 1P2IA 3A87A 1O38A 2G5VA 2VWMA 4IN2A 4Z0KA 5C94A 1AD8H 5CDFE 1ZMLA 3QX5H 1BRBE 5ABWA 1PPEE 1LTOA 1IQNA 4CRAA 3VB7A 4D8NA 2R3YA 2J98B 3MO3A 4AFZA 1AI8H 1K1NA 4LXBH 3UNQA 1L1JA 4U32A 1V2QT 4TPIZ 3TITA 1T4VH 1C5SA 1FY5A 2UUYA 2FLBH 1DXPA 2FX4A 3LJOA 3ZZAA 3UOUA 1YPKH 1DS2E 5JBTA 1AFEH 1P12E 1A0JA 3A86A 3N7EA 4AFSA 4F49A 1E37B 1V2PT 1DY8A 1O2UA 2AIQA 3GISB 2GZ8A 2PKSB 4X6OA 9ESTA 3S9CA 5GCHG 4K1TA 3OYPA 1TPSA 2UWPA 4ASUD 1GHYH 2ZDAH 1NY22 2CJIA 2H5DA 1YLNA 2FO9A 1IHTH 5IYTA 4X2WA 2NU0E 2FOGA 1QCPA 1YLCA 5CE1A 1TA6A 4Y8ZA 3M3TA 3T27A 3I77A 1UVPA 2RFKC 5C0UA 1ZGIA 1EPTC 3E0PB 4FETA 2ZDKA 1OSSA 2V0BA 4UE7H 3QGNB 1EAUA 2WUCA 1DITH 1NRNH 1W8BH 1C2JA 4WH6A 2AGEX 4F48B 5EW1H 2Z3DA 2GT7A 2VGCB 4K60A 1WBGB 1ELFA 4RI0A 2AFQB 3BIVH 3NZIA 1L0ZA 3ZVGA 3P8NA 1EJAA 2VIPA 3V13A 2BD8A 5BPEA 5FL7D 3ZV9A 1DM4B 3RU4D 1C1PA 1YC0A 4NWKA 2ZTXA 1WTGH 5LPFA 1SC8U 5F6MA 2OQ5A 4FUFA 3KQBA 1WUNH 2JIZD 3H7OA 1KXBA 1O2KA 2ZHQH 3RXRA 3MU5A 2KZ4A 3B23B 2KAIB 2Y5GA 4JK6A 4WF8A 2C8YB 3L3TA 1D9IA 1EXFA 1KXAA 3MOCA 5K0HA 1SSXA 1HUTH 4ZKNU 2BD7A 2GV6A 1HAOH 2FI3E 3BG4B 2J95A 1XXFA 3ZVCA 1EAXA 1WSSH 1OWKA 1SG8B 3F1SB 2Y82A 1SGDE 5EOKA 5FHTA 5B6OA 2FOFA 1HIAB 3GY8A 1HAHH 1O5GH 4I8KA 5EG4A 2ZO3H 5C5NA 1SBWA 2LNCA 1TPOA 3E91A 3LIWA 1MKWK 1SGFG 1ARCA 1V2ST 3MYWA 1A0LA 4K5ZA 2Y5FA 2B0FA 2R0LA 1W0ZU 2EEKA 1ORFA 3LU9B 1BA8B 8GCHG 5KECA 2ZFRH 1LKAA 1TOMH 2HALA 1EAIA 5FPTA 3LPRA 3IITA 4A1TA 2PKAA 3SU2A 2PP6A 4OS6A 1Z1JA 1K21H 1GCTC 4YOIA 3A7YA 3KN2A 5EIYA 3SHCH 1SGYE 3UY9A 4TYDA 4BXSA 2W6JD 2V3OH 2W5EA 5IDKA 2QE7D 4IN1A 4I33A 3AAVA 1HJAC 5A8ZA 1S84A 1AKSB 2Z7FE 2FOBA 4K1EA 3TNTA 1RTKA 4JZ1A 2ZF0H 2Z3CA 1O5BB 3ZYEA 1MZAA 2FDAA 4MNYA 4ABIA 1O2ZA 3A82A 4UD9H 1H9HE 3SI4H 1P9UA 1YLDA 1W11U 2ANWA 4I8JA 4MLFB 3U8OH 3BEIB 3SW2B 4CRDA 1EPTA 1F0UA 1C2IA 3P8OA 4Q63A 1TRMA 4I32A 4OS5A 1OP8A 4OS1A 1D6WA 2F83A 4Y0YE 1B0FA 1ZSLA 1FQ3A 1RJXB 3UFAA 1LVOA 2NWNA 1XUGA 1DICA 5EU8A 1Y5UT 1C2MA 2OCVB 2D2DA 4RSPA 1LCYA 2JJ2D 1BHXB 3RXLA 1Y3WA 2PUXB 3M7QA 1GL0E 2UUFB 1JXPA 5F53A 1GJ5H 2ODPA 3TGJE 1V2OT 2SGDE 4D7GA 2AGGX 1ZHPA 5HIZA 2GDDA 1EX3A 1IQJA 2ZFPH 4X8UH 2BDIA 1NRPH 4MPWA 5GCHF 1FV9A 1BTUA 4SGBE 3LOXA 1UO6A 3DA9B 2BD4A 4XOJA 3FOAA 1ZPZA 1BRUP 1D3PB 1HAPH 2VVCA 2F9NA 2BM2A 4FUBA 2GT8A 2J34A 2CV3A 6CHAB 1X7AC 2FI5E 3AW1A 4VGCC 3D65E 1RIWC 1WOFA 2R2WU 2WPHS 1S0QA 4WMDA 1SL3A 1GMCG 1NTPA 3P8FA 5C1UA 5DP6A 4B6EA 2J4IA 4NA8A 1Q31A 1NBME 1AY6H 3E3TA 4Y0ZE 5LPRA 4X6NA 1C1NA 3URDA 7ESTE 2A7JA 2C8WB 3LC5A 3MU4A 4XFQA 1OWEA 2Q1JA 1SGPE 1Y59T 1QL8A 3K9XB 4NIVA 1THPB 4NZQA 1VCPA 4D9RA 4ISNA 1N1LA 2BDBA 1BTYA 4WXIA 5T3HA 1P8VC 1H1BA 1DPOA 3TGKE 1TRYA 1C9TA 2VWLA 3SQEE 2ZU1A 4MPUA 2F9VA 2PUQH 2K7XA 1ZLRA 1VJAU 2BDGA 2HPPH 2JH5D 5DG6A 4KP0A 2BVSH 1CGIE 1A5HA 3BTKE 2BY6X 2G8TA 3NKKA 1BDAA 4CRCA 1P9SA 1SGNE 1P2QA 3SHAH 2VH6A 3EGKH 3PV5A 3RXEA 3UR9A 1GPZA 1J8AA 4BTUB 1TOCB 3BV9B 1C4V2 3RMNH 2XC4A 2SGEE 2FESH 1DSTA 3W94A 5KGOA 1Q2WA 2WUBA 1UCYE 1NROH 1LHGH 4U2WA 2H2ZA 1LHEH 2Z9IA 1OP2A 2G55A 4Q4LA 3GDSA 1XVMA 2A4QA 3U98H 4FUDA 5FAHA 1JWTA 1C1RA 4NFEA 1ZPCA 1MTSA 3K6ZA 2JDID 1QJ7B 8GCHF 3FO8D 3KNXA 1HLTH 3EDXB 4NG9H 3Q00A 1ZHRA 2PHBA 3WY8A 1SGEE 1LQEA 1VGCC 4A5TS 1LVBA 1A46H 2WHXA 2WV5A 3ATKA 2ZGJA 1C5OH 1Y3XA 4M9FA 4YLUA 3SJ8A 2AYWA 1RTLA 4TSFD 4F55A 2WYJA 1SI5H 2WZQA 2FPZA 3MMGA 5DPAA 1YPLH 3UOPA 1DANH 5CHBA 2RG3A 4D7FA 9LPRA 1U6QA 1S83A 3SU0A 1A5IA 3MNCA 3TU7H 1SHYA 1AQ7A 2ASUB 1NFXA 2CF9H 4GHTA 2P3FH 4WMEA 2O8LA 1T8OA 1TX7A 4QT8C 5CMXH 5DP5A 5FXLA 2KX4A 2I6QA 1ZSKA 1XXDA 3ZYDA 4UEHH 3BTQE 2C3SA 2FM2A 3A8BA 1KXCA 1EATA 4AFUA 1SGIB 4O9VA 2XRCA 1J17T 4J2YB 1EASA 3RUOA 3RMOH 2HNTF 1FLEE 4E05H 3DFJA 1Z71A 1DXWA 1UCYH 4CHAB 2IPHA 1LHCH 2ZFSA 2O8UA 1UTOA 2AMDA 3ZZ8A 4MQAA 1ELCA 4BAOB 1KMHB 1BTWA 1O2RA 3MNXA 3IWMA 1SPJA 3A83A 1HAXB 3SNBA 4DGJA 2GZ9A 1UMAH 2BXTH 1FIZA 1HJ9A 5T6GA 1E34B 3HPTB 2WYGA 4D9QA 1P3CA 1UTKA 1AUTC 3UQOA 2G52A 5ESTE 1QRZA 4MG3A 3HKIB 3MH6A 2BQ6B 3RMLH 5EPYA 4B2CA 2PKAB 4MNVA 5GDSH 4RT0A 1C2GA 1SFQB 2BLOA 2Z9LA 4CREA 2BXUH 3ESTA 4ABDA 6GCHG 3M5MA 1WAYB 1ZMNA 4Z6AH 1XUHA 4AYVB 1Z1IA 1AE8H 4INKA 2TIOA 1O3KA 3M61U 2GCHG 1EUFA 1DY9A 1AVXA 1GMCF 3ATIA 3H5CB 3MNSA 3M3SA 1MAYA 1Y3YA 3WWFA 3O8RA 1YP9A 4U01A 3CP7A 1O3BA 4INHA 3RXUA 3ZZ9A 3RXCA 1E38B 1HRTH 1GBEA 1H8IH 1EPTB 1GI8B 7KMEH 2ZNKH 5E0HA 1TALA 2EY4C 3KCGH 3T29A 1KYNA 2M5TA 4TT3D 3EA7A 1ZJDA 2KCYA 5FPSA 4HG6A 1TBQH 4DJZB 5E2OA 1HXEH 1GBCA 2GD4B 1NS3A 4YXWD 1C5RA 2GMTC 4A7IB 1OHHD 3TJNA 3ZVDA 1G30B 4B1TA 5C0TA 3M36A 4XRNA 4XD7D 1LQDB 1QIXB 1ZZZA 5GXPA 1TNJA 1PYTC 3PWBA 1E35B 1YPGH 1QJ6B 3RXBA 3BTTE 3K65B 4Y7BA 3MO9A 4CBNA 2ZDVH 3U1JB 1FXYA 3SU4A 1PQ5A 3ZZCA 2KCPA 3STIA 4Z1MD 2VIWA 4K8YA 2VU8E 1F0RA 1C5VA 4Y79A 1KTSB 4MDSA 4JYTA 2FZZA 1Y5BT 1O2PA 3PLBA 3EQ0H 1HV7A 4RKJB 1GHAF 4X2XA 2G5NA 2PLXA 2VIDA 4OS2A 4FUJA 4ISLA 1Y3UA 4B73A 4H6TA 1EAWA 3GDUA 3SN8A 3SI3H 4AYYB 1YPMH 4IC6A 1MBQA 4NIXA 1O3EA 4E06H 2ZGCA 4E7RG 5J4QA 1O37A 3ZIAD 3ODFA 1DT2A 4WH8A 3SJOA 5E2PA 2ZDNA 1XUJA 1GI0A 1SGRE 4YOJA 1ELEE 1TGCA 3S69A 1S5SA 1DWCH 3Q3YA 4NCYA 3STJA 1GJ4H 4JMYA 7GCHG 1QURH 5EXNA 1UVOA 1HAZB 1GCTB 1VKYA 3AASA 1QFKH 2H9TH 4ZCNA 1FAKH 1COWD 3SV8A 2FTLE 3ENSB 1PQ7A 2IN2A 5LPEA 4CHAC 1E79D 1HJAB 2OC1A 1O2WA 3PWCA 1QZ8A 1V2MT 1AVGH 3ELAH 4NA7A 1C5XB 1GI3A 1XM1A 1E0FD 2CMYA 1ELBA 3F68H 2B5TB 5L2ZH 2QY0B 3BTHE 2SGFE 3S9BA 1FDPA 1OWJA 1WV7H 2VWOA 3PTNA 4AZ2B 3SZEA 1CBWB 2ZPQA 4A92A 5ETXA 5A0CA 2RA0A 5A2MH 3E90B 1EB2A 3T25A 1ESAA 3DFLA 4ABBA 4FOUC 3ATMA 1YYY1 5EPNA 1Z8GA 1V2UT 4JYVH 1OP0A 3QWCH 4OS7A 5E0GA 3P95A 1K1LA 1QQUA 1BRCE 2STBE 2FOCA 1P05A 3F9GA 5I25A 2ZCHP 2ZCLP 2IOTA 4GCHG 1K1PA 1UVTH 1Z7KA 3DD2H 3CNRA 4O97A 1V6DA 2AERH 1W12U 1UVUH 2QCYA 2LELA 4B74A 4LZ4B 1FX0B 6GCHF 1MCTA 4K3JA 4FVDA 2XBWA 2FS8A 4BXWA 3ZV8A 2GCHF 2Y80A 3BTFE 2BDAA 3E0NB 2GTBA 4OGYA 1NZQH 1UTNA 4GLYA 3S7HB 3SNDA 3GDVA 1ZOMA 4NFFA 1FMGA 3F9FA 1ZJKA 3GCHC 4ZXXH 3EBNA 3OFND 4VGCB 1GBTA 1GBAA 3ZVBA 1RIWB 3N7DA 2NU4E 1SGQE 3VEQB 3BF6H 3T62A 1K1OA 3BTDE 3RXJA 5H4IB 1TPAE 1C2HA 1G3DA 3UTUH 1VZQH 1O0DH 1BB0B 1P02A 1JRSA 1DSUA 2OXSA 4O3UA 3EE7A 4XDEA 2ZGBH 4DIIH 1HBTH 1KXEA 2BD3A 2AS9A 1CGJE 4HZHA 1ZR0A 1LPKB 1O2OA 3MFJA 3W95A 2OLGA 1EKBB 1C1SA 5F8ZA 4MNXA 3UWJH 1GI2A 1SLXB 2BX3A 1L4DA 4DW2U 1GI7B 1GBLA 1MBMA 2HWLB 1BTHH 1XMNB 2HLDD 1MD7A 1TWXB 3LGIA 2BY8X 4WXVA 1G32B 5GPIB 3TJVA 1GDUA 1GHWH 5F03A 3RLYH 2CHAB 1THRH 3RXQA 2VIQA 5C20A 4LZ1H 1HJ8A 3Q77A 1GBDA 5LGOA 3UNSA 5KEDA 1GVKB 2BY5X 2RCEA 2ZGHA 1BBRK 3GY4A 4X2YA 1GCDA 1BCUH 1OYQA 5FBEA 3I29A 4RT1A 2ANKH 2EI8A 1DLEA 3UWIA 5J4SA 2C93B 2EQNA 1GI5A 1P04A 3BEUA 5FPYA 2DE8A 5AFZH 5T1VA 1NRSH 3K6YA 1GWAA 2QXIA 1EJNA 2XC5A 2ZEBA 3SU5A 1OYTH 3H09A 4DG4A 1CA8B 1C1UH 1NT1A 3MTYA 2FXRA 1O2JA 3GY5A 5C1XA 5AFYH 1YCPK 1V3XA 1TONA 2B7DH 4XE4A 3LH3A 4BOHA 1DUAA 1UTPA 2BHGA 2Z94A 1ZTLA 4CH8B 4JZFH 2NU3E 3UR6A 2BQ7B 3C1KA 3MU0A 3QZRA 1XUKA 1MU8B 4AC9A 1FUJA 1KLTA 2F3CE 3TK9A 5JPMH 2BOHB 2R2MB 1VGCB 1HXFH 7GCHF 5HKKD 1O35A 3LGTA 2XBVA 3KHVA 1ARBA 1SR5C 1TQ0B 1CBWC 1O2NA 3OEED 3DSOA 4Y8XA 2PSYA 1PPHE 2QIQA 4ASHA 1MUEB 2VWNA 3GY7A 3NCLA 1UTMA 3BG8A 1HPGA 4ZKSU 1DDJA 1E36B 1EB1H 2AH4X 3KQDA 1FI8A 2CK3D 2QXGA 5SGAE 3LDXH 1O5AB 1W14U 4ZHLU 3PRBA 2XCFA 4DT7B 1S0RA 4INLA 5FX5A 4CR5A 2P3TB 1LHFH 2J94A 4AGJA 3PV2A 2OUAA 2ZQ1A 1P03A 2VINA 1UK2A 1BMLA 3KL6A 4LK4A 1IQEA 4RN6A 3BTWE 3NK8A 3RMMH 1C9PA 1XUFA 4MTBA 2QF5A 1QBVH 1H4WA 3FFGA 1AVWA 1GGDC 3U69H 1OKXA 4X8TH 1A4WH 1TAWA 4GCHF 2AEIH 5IK2D 4XBCA 3DHKH 1HYLA 4XSKU 4Y11E 1ELVA 1IQFA 3RU4E 4X1SU 1FY4A 4GUXA 1NFWA 1O2TA 4X2VA 5F8TA 1VJ9U 3VFEA 1A3EH 1HGTH 1EFRD 4LOYH 1C5PA 4KGAA 3MH5A 1MQ5A 1BMMH 4GHQA 1V2VT 5I46H 2QF3A 2ZC9H 2ZZUH 1FZZA 1O2VA 3DT0H 4UFEH 3SNEA 2SGPE 1HFDA 4AFQA 1Z8RA 1W7GH 4I8GA 1C5LH 1QL7A 1P57B 3FZZA 3NRLA 1ABIH 4MPVA 2PFEA 1KLIH 1F92A 2GX4A 2A0QB 3BTEE 1K28D 1PQAA 3PMBB 3SGQE 3MU1A 1MTWA 3MHWU 3FANA 2M2AA 1NRQH 4X1RU 3M3VA 2V3MA 1VITG 5EJLA 5L6NH 1EP6A 5DP8A 1M9UA 1FJSA 4Y8YA 2AMPA 2BD5A 2QXHA 2F9PA 4OS4A 1NPMA 1SLUB 2ZHFH 2QGRA 1XKAC 2WV4A 2A32A 2P59A 3B8JA 1C5YB 1G9IE 2TPIZ 2LPRA 2CHAC 2V7QD 2WSSD 4UFGH 3FKSD 5EXLA 1GG6C 1D3TB 1ZRKA 2AIPA 1O3GA 3CENA 1V2TT 3Q3XA 1PYTD 2PW8H 3TIUA 3RP2A 3T26A 2BLQA 4FXGH 1S6LA 3T5FH 2F91A 3R3GB 3HKJB 1MKXH 2XTTB 3A8CA 2ZDLA 3DSPA 4ZKRU 1RRKA 4TWYA 1ESBA 3OEHD 2Q6DA 1W0KD 1D3QB 2GMTB 2OP9A 5A0BA 2EC9H 2XNDD 1UW7A 1AWFH 4ZXYH 1H8HD 1CSOE 2D26C 1F5RA 1C4U2 3KIDU 1OWIA 3BEFB 3I78A 5DK1A 2FMJA 1V2JT 3NUMA 2PSXA 2Z6BD 5FBIA 2V6NA 2SNWA 4OM9A 1FPCH 4BNRA 2JKHA 3WW7A 4RKOB 1XUIA 2CF8H 1ZHMA 2D1JA 5E0JA 1G36A 2ZHWH 3QO6A 4K69A 1TNIA 1GBMA 1O30A 2Z9KA 2GVFA 2NU2E 2QF0A 2TGDA 3CS0A 2RDEA 3PRDA 4DIHH 1ANDA 1K0HA 3MI4A 3JZ1B 2OC7A 1O5EH 1OS8A 4A1XA 2P8OC 1T32A 1EZSC 4ACAA 1BMNH 1TRNA 1W3CA 3TK5A 2GP9B 2H6MA 2ZIQH 1QRWA 5HYOA 1O2QA 1GI6A 8KME2 3M35A 3P92A 4AB9A 4MNWA 1ABJH 3RDZA 4ACBA 4KTSA 1SOZA 1CA0C 1JMOH 1RTFB 1OWHA 1GBFA 2BY9X 5TCAA 4JZEH 3VB6A 2NU1E 2FYQA 4IC5A 1T8NA 1EZUC 1O2YA 2F9OA 2HGTH 2W7SA 3SV9A 2W6ID 3KF2A 1H9LB 2ULLA 2OINA 1C2FA 4E7NA 1C1OA 1GJCB 1Q3XA 2JETC 2VVUA 3G01A 4O03A 1XKBC 3PMJA 4CRFA 1IAUA 1MMJN 2GJGA 5EXMA 4JCNA 1GJ6A 2Q6GA 3VB3A 4FUEA 4X8SH 1B5GH 2C4FH 1S6HA 1WDIA 1C1WH 1C1TA 1G37A 1LHDH 3NXPA 1MTNB 3RXOA 4H42U 2F43B 2KFWA 2ZWLH 3PROA 7LPRA 1GBHA 3FZDA 4HFPB 3V7TA 3RXAA 1LPZB 3D62A 2QC2A 4I8LA 5EQQA 3A80A 4U30A 3MU8A 1XX9A 2P3UB 2YOLA 1GI1A 2FP7B 4B2BA 1BRAA 1TGSZ 3EYDA 8LPRA 1CQQA 1KIGH 2Z9GA 2SGAA 3PB1E 4ZAEA 3RXDA 4ABHA 1GJ7B 3ZZ6A 3MWIU 1F0TA 1G3CA 1SOTA 1A61H 1DX5M 2P94A 3GCNA 1CU1A 2L6OA 1RD3B 2TGAA 5C2ZA 1FN6A 1IQLA 3KQCA 1JIMA 4XBDA 2BDYA 5EGMA 3PM3A 2IJD1 4X8VH 1TNGA 4WMFA 4IBLH 4YT7H 3A81A 2Y6TA 3URCA 1SB1H 2HRVA 2J2UA 2HVYB 5EJ1A 4NZLA 2FWWA 5JBCS 4AG1A 3VXEH 1L1NA 2ANYA 3UIRA 3VG8A 1BMAA 2IJOB 4F4OC 2XWBI 2BQWB 2VVVA 2D8WA 1GMHG 1N6YA 4H6SB 4Y76A 1O3AA 3V3MA 1O2XA 2P95A 1VITF 4ESTE 1KSNA 2V35A 2QF4A 2GCTC 2H5CA 3LJJA 3RC5A 2GZ7A 4Y7AA 1GVZA 2J97A 3UUZA 2ALVA 1EOLA 1OX1A 3NWUA 1TGBA 4AORA 1AZ8A 1C2LA 2A7CA 5CHAC 1P11E 3GCHB 1P09A 3A8DA 1V2RT 3F2HA 2AMQA 3SV7A 1MABB 3M7TA 1NN6A 3LT3A 1QA0A 2J92A 4I31A 2PGBB 3OSYA 1EP5A 2FS9A 2PWXA 2G4TA 1K1MA 2FOEA 3LC3A 1Y3VA 2TGPZ 1BIOA 1P06A 1NESE 1SQOA 1W13U 1O3NA 3RM2H 3SV6A 5JBBS 1WQVH 1FNIA 3CS7A 2F4LA 1KDQB 5DP3A 1C5UA 3VPKA 5A8XA 4BANB 1H8DH 1PPFE 1ETSH 1GVLA 1ZTJA 4DY7B 2W3KA 1YPHE 2ZTYA 1SMFE 4NGAH 4NWLA 2ZTZA 3RXTA 2ZFQH 3QTOH 5HXFA 1A1RA 1F2SE 1TNLA 1W2KH 4YM9A 1ZPBA 4HGCA 3GCOA 1FN8A 3Q3KA 4WJG2 3AVZA 4Y6DA 3HK6B 1MTUA 4WWYA 1A3BH 2BB4A 3FP7E 1YY3A 2GV7A 2A5KA 3TVJB 1UHBB 1O3FA 1ANCA 1W0JD 4CRGA 2OTVA 3A7VA 3B9FH 1E1RD 5C5OA 3GS9A 3OTPA 4WVPE 3PTBA 1WTHD 3P70B 4B2AA 2O8WA 1NU7B 2OD3B 2J38A 5EW2H 2PR3A 4YT6H 3KYGA 1ID5H 1WXRA 2WPDD 2XYAA 3P17H 4DT4A 2FOAA 4PROA 4DVAU 1YBWA 2LP6A 3QDZB 2HLCA 5BRRE 3SJKA 2A2QH 2UUKB 5JYIA 3GICB 1AIXH 1Z8JB 2CXVA 1PPCE 3SQHE 4FUHA 3L6PA 3M5OA 1BQYA 1MTNC 2VNTA 2K1QA 3A88A 1RGQA 3RXFA 1MAXA 1QBNA 4NIYA 2GGVB 1BITA 1DWBH 1P10A 1O3IA 3FVFB 3U28C 4CH2B 5C1YA 2WPMS 4MPXA 3E16B 1YPHC 2VJ1A 2JH6D 1O33A 6LPRA 5DKMA 2UWLA 3SZNA 5AVDA 1BUIA 1O2IA 2A4OA 1GDQA 2ZPRA 1C1MA 1ETTH 3A85A 4MVNA 3KGPA 1P2NA 1QBOA 1PQ8A 4A6LA 2PTNA 2ZHDA 1EZXC 1T31A 3RXMA 3S9AA 2OK5A 1O5DH 2L74A 1O2LA 4Q2KA 4CBOA 1QB1A 4FU8A 2ESTE 1V2WT 2QN5T 2FODA 4J1YA 2ZU5A 2FLRH 3TH3H 3M5LA 2FI4E 1N8OC 3F9HA 2P16A 2XBYA 3VB4A 1QA7A 1V2LT 3IG6B 3S7KB 1DLKB 1PPZA 4AX9H 5JB8S 4ZHAA 1YWUA 2ZG0H 4B75A 1WQSA 1QGFA 1TABE 3MH4A 4I7YH 1GJ8B 1GGDB 2KCAA 2ZDMA 4GAWA 1BT7A 1LVYA 1O3CA 1FY8E 1G2LA 2FTMA 2ZGXH 4FVBA 1ELTA 1BJVA 2ANMH 3O8BA 3LGUA 2GDEH 2K0QA 4I86A 2VIOA 3PMHB 1AB9C 1KY9A 1O39A 5HM9A 2WPIS 1BHXF 2BDCA 3M7UA 2YNAA 1SFIA 3RXIA 2WPKS 5L2YH 1GMHF 1DUEA 1BTXA 2PGQB 1TB6H 2DUCA 4ABAA 1PJPA 1NFYA 4BTTB 1C1VH 2V3HH 2ZU3A 1N6XA 3FAOA 1B0EA 1P0SH 3F2GA 1GHXH 5LH8A 1SQTA 1A0HB 2DE9A 2HNTE 3BSQA 3T28A 1P2JA 5GJ4B 4BAMB 3K2UA 3WWBA 1SQAA 4JZDH 1GJ9B 1MQ6A 2R3UA 3S0NA 4R8TB 2B8OH 3SBKA 3ZVAA 3H7TA 4X6MA 4Q80A 1MKXK 4K2YA 5EODA 1T8MA 1QL9A 2A2XH 1G3EA 1SVPA 5DO4H 1SQRA 2XCNA 1PFXC 1DWEH 3HATH 1BJUA 3A8AA 1GG6B 4HI3A 1DE7H 1FY3A 2A31A 2Y7XA 4FUCA 1S6FA 1C5MD 1NBMD 1THSH 2KR7A 2P93A 1LO6A 2TRMA 4IGDA 2YMSC 1O31A 1TBRH 4X1QU 1NU9A 1UK4A 1AUJA 1DFPA 3N99A 4AB8A 3FN8A 1UJ1A 3BTME 4TWWA 1QJ1B 1IQIA 3SUFA 2RA3A 1GI4A 4BAKB 4X6PA 3P8GA 2JH0D 4KELA 3RXHA 1T7CA 5T6DA 4P00A 1YF4A 2BOKA 2HNTC 3F0OA 2R0KA 1GI9B 3RXSA 1G2MA 2ZKSA 1HAVA 1HDTH 2A5IA 3V0XA 5TJXA 4ZROA 1KXFA 3M37A 1GBJA 1K1JA 2I6SA 2R9PA 3ZZDA 1INCA 4UONA 1PPBH 1NFUA 1GL1A 4YO9A 2P8OB 4KTUA 2Y7ZA 1VR1H 3V12A 4WY3A 2O8MA 1GJBB 1PPGE 3VGCC 1AFQC 2ZFTA 3HGPA 5FCRA 1SLVB 3SU1A 1NM6A 2EI6A 2FIRH 4DOQA 1O3OA 2ZI2H 3DUXH 2KCOA 1CA0B 1GJAB 4CR9A 1TGNA 1AE5A 1GHBG 2G4UA 1TIOA 4ABGA 1E1QD 1O5FH 3FP6E 1UCYK 3RC6A 3GCTG 2AGIX 3O8DA 3VXFH 1C5TA 5JB9S 5EJZA 5A0AE 4FUIA 3PYHA 5DP7A 1TPPA 2C8XB 2JETB 2OBQA 3U9AH 4CRBA 5C3NA 1JRTA 1SGFA 1TNHA 1WU1A 1DVAH 2SNVA 1RS0A 3P6ZB 1V2KT 1QQ4A 2ZU2A 2BTCE 3GY2A 4XBBA 1QTFA 1MD8A 1ZSJA 3ATLA 1SKYE 2OQUA 1IQGA 4JYUH 3SJIA 3DSGA 3JZ2B 1UTLM 2ZHEH 5DN6D 3UNRA 1TNKA 1T8LA 1CHGA 1KDQA 3SGBE 3LGVA 1LDTT 4FU7A 2BMGB 5GNDA 5HM2A 2PKSC 1TLDA 1W0YH 2ZP0H 3GY6A 1LPGB 3UREA 1K1IA 3TH4H 1O32A 3A7XA 4OGXA 3LKWA 2FOMB 1QY6A 3SU6A 2XC0A 3UQVA 1WCZA 1VITH 2ZPSA 5JBAS 1TGTA 1L1GA 1C4Y2 3SUEA 3OTJE 1J9CH 2G51A 1O2MA 1YCPM 1QB9A 4O3TA 3OU0A 2STAE 1L4ZA 1O2GH 1VCQA 1C5QA 1C5NH 1TMTH 2WV9A 1KXDA 1OXGA 2WPLS 2VB0A 1UHBA 1W10U 1GBIA 1ZRBA 2EI7A 4ZUHA 3NPSA 1QNJA 1SGCA 1EZQA 2O9QA 2VGCC 2BD9A 2BYAX 1HAGE 1AHTH 3LGYA 1UVSH 2BY7X 2C90B 6ESTA 1BBRE 1CT0E 1L2EA 1MCVA 3MO6A 2ZFFH 2VIVA 3TJUA 1MH0A 3D49H 4YTAA 2HPQH 3SU3A 3R0FA 3ITIA 1S85A 4BTIB 1T4UH 4Y10E 3RU4T 1ZTKA 1ELAA 1A2CH 1S81A 1QB6A 4DURA 4GVUA 2ODQA 2H1UA 4IMQA 2GCTB 2O8TA 5G4BA 2TBSA 1Z6JH 1J15A 3KQEA 2BVXH 3RC4A 5DSFA 5EQSA 2WINI 3SUDA 3BG4C 4YLQH 2W7UA 5CHAB 1IQHA 1ZMJA 1J14A 1JIRA 2BX4A 2G81E 2A4RA 1O3LA 3QUMP 4HTCH 3SORA 4ISHH 1SGTA 1IQMA 3Q76A 2A5AA 1IHSH 1DWDH 1EOJA 1TFXA 3U8TH 2KM0A 2HVXA 2WPJS 2A7HA 2QAAA 1FONA 1D3DB 1GHZA 1C2EA 1O34A 4K8BA 3BTGE 2J98A 4B71A 1CHOG 4ZKOU 3OY5U 3PMAB 3ZVEA 5C17A 2QV1A 3ZZ5A 4YOGA 2GKVE 4DCDA 3QK1A 1GBBA 1F0SA 2H9HA 1O2SA 1MU6B 1LKBA 1Y5AT 3KQ5A 4NSVA 3EE0B 5A09A 3SV2H
chains in the Genus database with same CATH topology
2Y81A 3ZZ3A 1YPJH 1RXPA 3HK3B 3C27B 1BBRH 1GHAG 3F6UH 5AHGH 4IS5A 5GIBA 1AZZA 1MKWH 1TX6A 5E8EH 1TBZH 3RXKA 5EQRA 1BTPA 1NO9H 1ELDE 5F8XA 2UWOA 4ISOA 2XW9A 1C2DA 2BVRH 3E8LA 2BD2A 3U8RH 5FCKA 1YKTA 3RLWH 1F7ZA 3PO1B 3GYLB 1HAIH 5T6FA 2XXLA 1O2HA 4JZIA 1HNEE 3ZVFA 4AN7A 2XWAA 3AW0A 2A1DB 1C5ZB 3U1IB 2W3IA 5DJ7A 1YCPH 1DOJA 3GY3A 3LH1A 2CGAA 2XBXA 1ANEA 1GHBF 3M5NA 4ABFA 1GMDG 1BOQA 1P2MA 1UTQA 1JOUB 4A1VA 3GCTF 3UPEA 2FOHA 4FU9A 1ANBA 1EJMA 3ATWA 1O5CB 3SUGA 3A84A 1QRXA 4R0IA 4YZUA 2A45B 4NIWA 3L33A 2PV9B 4X1NU 1TX8A 2A4GA 3LGWA 3EA9A 2UUJB 1AN1E 5JDUB 1EQ9A 1HAYB 2QA9E 3SGAE 4X1PU 2BLWA 2W26A 4H4FA 3FP8E 2KAIA 3TGIE 1GBKA 1TMUH 4GSOA 4BAHB 1OWDA 4IMZA 1O3JA 1WYKA 1O36A 1C2KA 4ABEA 2BLVA 3GYMA 1S82A 4D76A 1HB0B 3LONA 1HAVB 1TYNA 6CHAC 5L30H 2BZ6H 2VH0A 1N8OB 4THNH 1HIAA 1YPEH 2XNIA 3QN7A 2PTCE 2ZCKP 3A7TA 1CO7E 3GOVB 2SGQE 1BZXE 1NC6A 1AGJA 1K2I1 1Y8TA 2YNBA 2ILNA 1BTZA 1FPHH 2BDHA 3HGNA 1H9IE 3ZZ4A 1A5GH 3SNCA 1ETRH 5FX6A 3D23A 1SLWB 2Z9JA 1CE5A 4NA9H 3T2NA 3RM0H 2FEQH 2LIZA 2Z3EA 1RFNA 3A7ZA 3A7WA 3SJ9A 3QGJA 5A8YA 1HCGA 3QTVH 1LVMA 3QLPH 1P3EA 5HMAA 1AB9B 2C8ZB 2QXJA 3QZQA 3OY6U 3F9EA 1V2NT 2J9NA 1GDNA 1YGCH 2RDLA 4B76A 4I8HA 5AF9H 8ESTE 2ZU4A 1F5KU 1KTTB 3TNSA 1AKSA 1SHHB 2TGTA 1J16A 4ABJA 1GJDB 4X0WU 1GHVH 4AGKA 5K7RA 1AMHA 3MH7A 3SO3A 1TMBH 2FYRA 4IW4E 4AG2A 3ZZBA 2Q6FA 1ZYOA 4ZMAH 1CGHA 1QR3E 1MZDA 1FIWA 3RXPA 1ESTA 4SGAE 1AO5A 2OC0A 5HGGA 4ISIH 3BN9A 2B9LA 3TJOA 3ZZ7A 1K22H 1XVOA 4Y71A 3O8CA 2SFAA 2OBOA 1OOKB 2OC8A 3PLKA 3E1XB 3RXVA 3KEEA 2H9EH 2EA3A 1OPHB 3RXGA 1P2OA 4KKDA 1P01A 1CHOF 1D4PB 1F5LA 3BIUH 1FAXA 1TA2A 3TPIZ 2ODYB 3ODDA 1Z6EA 4TY7A 1TE0A 4ZH8A 1O3PB 4FUGA 1VCWA 5TCCA 3PO1C 3SOSA 1C5WB 1LMWB 1QHRB 3TK6A 3TH2H 2ALPA 4Q7YA 2ZECA 4JK5A 4KTCA 3N7OA 3AAUA 1CT2E 1MTVA 4GPGA 4YESB 5C67A 4M7GA 4Q7ZA 2THFB 1ZGVA 5DP4A 4NSYA 4K1SA 1KLJH 4TY6A 1G3BA 3OX7U 4ZHMU 1CVWH 3A89A 3EA8A 1K9OE 2F9BH 5ESBA 2G00A 5DGJA 3PV4A 1A7SA 1AWHB 3VB5A 2BZAA 1JBUH 4UFFH 3EAJA 2FX6A 4BAQB 4UFDH 1C1QA 5DP9A 5PTPA 1Z8IB 1O3HA 1W7XH 4UDWH 4TPYA 1D6RA 1YM0A 1B7XB 2F9UA 2ZQ2A 2CN0H 4Q7XA 1GMDF 1ACBE 3VGCB 1ELGA 1AFQB 1IQKA 2HOBA 3E6PH 1O3MA 1UK3A 3PLPA 1FY1A 5GWZA 1IOEA 4AOQA 2ZA5A 1NRRH 1TQ7B 1O3DA 1P2KA 3SNAA 1UTJA 2QYIA 3MNBA 1AU8A 3TLOA 2Y5HA 1CT4E 1P2IA 3A87A 1O38A 2G5VA 2VWMA 4IN2A 4Z0KA 1AD8H 1ZMLA 3QX5H 1BRBE 5ABWA 1PPEE 1LTOA 1IQNA 4CRAA 3VB7A 4D8NA 2R3YA 3MO3A 4AFZA 1AI8H 1K1NA 4LXBH 3UNQA 1L1JA 4U32A 1V2QT 4TPIZ 3TITA 1T4VH 1C5SA 1FY5A 2UUYA 2FLBH 1DXPA 2FX4A 3LJOA 3ZZAA 3UOUA 1YPKH 1DS2E 5JBTA 1AFEH 1P12E 1A0JA 3A86A 4AFSA 4F49A 1E37B 1V2PT 1DY8A 1O2UA 2AIQA 3GISB 2GZ8A 2PKSB 4X6OA 9ESTA 3S9CA 5GCHG 4K1TA 3OYPA 1TPSA 2UWPA 1GHYH 2ZDAH 1NY22 2CJIA 2H5DA 2FO9A 1IHTH 5IYTA 4X2WA 2NU0E 2FOGA 1QCPA 1YLCA 5CE1A 1TA6A 4Y8ZA 3M3TA 3T27A 3I77A 1UVPA 1ZGIA 1EPTC 3E0PB 2ZDKA 1OSSA 2V0BA 4UE7H 3QGNB 1EAUA 2WUCA 1DITH 1NRNH 1W8BH 1C2JA 4WH6A 2AGEX 5EW1H 2Z3DA 2GT7A 2VGCB 4K60A 1WBGB 1ELFA 2AFQB 3BIVH 3NZIA 1L0ZA 3ZVGA 3P8NA 1EJAA 2VIPA 3V13A 2BD8A 5BPEA 3ZV9A 1DM4B 3RU4D 1C1PA 1YC0A 4NWKA 2ZTXA 1WTGH 5LPFA 1SC8U 5F6MA 2OQ5A 4FUFA 3KQBA 1WUNH 3H7OA 1KXBA 1O2KA 2ZHQH 3RXRA 3MU5A 3B23B 2KAIB 2Y5GA 4JK6A 4WF8A 2C8YB 3L3TA 1D9IA 1EXFA 1KXAA 3MOCA 5K0HA 1SSXA 1HUTH 4ZKNU 2BD7A 2GV6A 1HAOH 2FI3E 3BG4B 2J95A 1XXFA 3ZVCA 1EAXA 1WSSH 1OWKA 1SG8B 3F1SB 2Y82A 1SGDE 5EOKA 5FHTA 5B6OA 2FOFA 1HIAB 3GY8A 1HAHH 1O5GH 4I8KA 5EG4A 2ZO3H 5C5NA 1SBWA 2LNCA 1TPOA 3E91A 3LIWA 1MKWK 1SGFG 1ARCA 1V2ST 3MYWA 1A0LA 4K5ZA 2Y5FA 2B0FA 2R0LA 1W0ZU 2EEKA 1ORFA 3LU9B 1BA8B 8GCHG 2ZFRH 1LKAA 1TOMH 2HALA 1EAIA 5FPTA 3LPRA 3IITA 4A1TA 2PKAA 3SU2A 4OS6A 1Z1JA 1K21H 1GCTC 4YOIA 3A7YA 3KN2A 3SHCH 1SGYE 3UY9A 4TYDA 4BXSA 2V3OH 2W5EA 5IDKA 4IN1A 4I33A 3AAVA 1HJAC 5A8ZA 1S84A 1AKSB 2Z7FE 2FOBA 4K1EA 3TNTA 1RTKA 4JZ1A 2ZF0H 2Z3CA 1O5BB 3ZYEA 1MZAA 2FDAA 4MNYA 4ABIA 1O2ZA 3A82A 4UD9H 1H9HE 3SI4H 1P9UA 1YLDA 1W11U 2ANWA 4I8JA 4MLFB 3U8OH 3BEIB 3SW2B 4CRDA 1EPTA 1F0UA 1C2IA 3P8OA 1TRMA 4I32A 4OS5A 1OP8A 4OS1A 1D6WA 2F83A 4Y0YE 1B0FA 1ZSLA 1FQ3A 1RJXB 3UFAA 1LVOA 2NWNA 1XUGA 1DICA 5EU8A 1Y5UT 1C2MA 2OCVB 2D2DA 4RSPA 1LCYA 1BHXB 3RXLA 1Y3WA 2PUXB 3M7QA 1GL0E 2UUFB 1JXPA 1GJ5H 2ODPA 3TGJE 1V2OT 2SGDE 4D7GA 2AGGX 1ZHPA 2GDDA 1EX3A 1IQJA 2ZFPH 4X8UH 2BDIA 1NRPH 4MPWA 5GCHF 1FV9A 1BTUA 4SGBE 3LOXA 1UO6A 3DA9B 2BD4A 4XOJA 1ZPZA 1BRUP 1D3PB 1HAPH 2VVCA 2F9NA 2BM2A 4FUBA 2GT8A 2J34A 2CV3A 6CHAB 1X7AC 2FI5E 3AW1A 4VGCC 3D65E 1RIWC 1WOFA 2R2WU 2WPHS 1S0QA 4WMDA 1SL3A 1GMCG 1NTPA 3P8FA 5C1UA 5DP6A 2J4IA 4NA8A 1Q31A 3E3TA 1AY6H 4Y0ZE 5LPRA 4X6NA 1C1NA 3URDA 7ESTE 2A7JA 2C8WB 3LC5A 3MU4A 4XFQA 1OWEA 2Q1JA 1SGPE 1Y59T 1QL8A 3K9XB 4NIVA 1THPB 4NZQA 1VCPA 4D9RA 4ISNA 1N1LA 2BDBA 1BTYA 4WXIA 5T3HA 1P8VC 1H1BA 1DPOA 3TGKE 1TRYA 1C9TA 2VWLA 3SQEE 2ZU1A 4MPUA 2F9VA 2PUQH 2K7XA 1ZLRA 1VJAU 2BDGA 2HPPH 2JH5D 5DG6A 4KP0A 2BVSH 1CGIE 1A5HA 3BTKE 2BY6X 2G8TA 3NKKA 1BDAA 4CRCA 1P9SA 1SGNE 1P2QA 3SHAH 2VH6A 3EGKH 3RXEA 3UR9A 1GPZA 1J8AA 4BTUB 1TOCB 3BV9B 1C4V2 3RMNH 2XC4A 2SGEE 2FESH 1DSTA 3W94A 1Q2WA 2WUBA 1UCYE 1NROH 1LHGH 4U2WA 2H2ZA 1LHEH 2Z9IA 1OP2A 2G55A 3GDSA 1XVMA 2A4QA 3U98H 4FUDA 5FAHA 1JWTA 1C1RA 4NFEA 1ZPCA 1MTSA 3K6ZA 1QJ7B 8GCHF 3KNXA 1HLTH 3EDXB 4NG9H 3Q00A 1ZHRA 2PHBA 3WY8A 1SGEE 1LQEA 1VGCC 4A5TS 1LVBA 1A46H 2WV5A 3ATKA 2ZGJA 1C5OH 1Y3XA 4YLUA 3SJ8A 2AYWA 1RTLA 2WYJA 1SI5H 2FPZA 3MMGA 5DPAA 1YPLH 3UOPA 1DANH 2RG3A 4D7FA 9LPRA 1U6QA 1S83A 3SU0A 1A5IA 3MNCA 3TU7H 1SHYA 1AQ7A 2ASUB 1NFXA 2CF9H 4GHTA 2P3FH 4WMEA 2O8LA 1T8OA 1TX7A 4QT8C 5CMXH 5DP5A 5FXLA 2I6QA 1ZSKA 1XXDA 3ZYDA 4UEHH 3BTQE 2C3SA 2FM2A 3A8BA 1KXCA 1EATA 4AFUA 1SGIB 4O9VA 2XRCA 1J17T 4J2YB 1EASA 3RUOA 3RMOH 2HNTF 1FLEE 4E05H 3DFJA 1Z71A 1DXWA 1UCYH 4CHAB 2IPHA 1LHCH 2ZFSA 2O8UA 1UTOA 2AMDA 3ZZ8A 4MQAA 1ELCA 4BAOB 1O2RA 1BTWA 3MNXA 3IWMA 1SPJA 3A83A 1HAXB 3SNBA 4DGJA 2GZ9A 1UMAH 2BXTH 1FIZA 1HJ9A 5T6GA 1E34B 3HPTB 2WYGA 4D9QA 1P3CA 1UTKA 1AUTC 3UQOA 2G52A 5ESTE 1QRZA 4MG3A 3HKIB 3MH6A 2BQ6B 3RMLH 5EPYA 4B2CA 2PKAB 4MNVA 5GDSH 1C2GA 1SFQB 2BLOA 2Z9LA 4CREA 2BXUH 3ESTA 4ABDA 6GCHG 3M5MA 1WAYB 1ZMNA 4Z6AH 1XUHA 4AYVB 1Z1IA 1AE8H 4INKA 2TIOA 1O3KA 3M61U 2GCHG 1EUFA 1DY9A 1AVXA 1GMCF 3ATIA 3H5CB 3MNSA 3M3SA 1MAYA 1Y3YA 3O8RA 1YP9A 4U01A 3CP7A 1O3BA 4INHA 3RXUA 3ZZ9A 3RXCA 1E38B 1HRTH 1GBEA 1H8IH 1EPTB 1GI8B 7KMEH 2ZNKH 5E0HA 1TALA 3KCGH 3T29A 1KYNA 2M5TA 3EA7A 1ZJDA 5FPSA 1TBQH 4DJZB 5E2OA 1HXEH 1GBCA 2GD4B 1NS3A 1C5RA 2GMTC 4A7IB 3TJNA 3ZVDA 1G30B 4B1TA 3M36A 1LQDB 1QIXB 1ZZZA 5GXPA 1TNJA 1PYTC 3PWBA 1E35B 1YPGH 1QJ6B 3RXBA 3BTTE 3K65B 4Y7BA 3MO9A 4CBNA 2ZDVH 3U1JB 1FXYA 3SU4A 1PQ5A 3ZZCA 3STIA 2VIWA 4K8YA 2VU8E 1F0RA 1C5VA 4Y79A 1KTSB 4MDSA 4JYTA 2FZZA 1Y5BT 1O2PA 3PLBA 3EQ0H 1HV7A 4RKJB 1GHAF 4X2XA 2G5NA 2PLXA 2VIDA 4OS2A 4FUJA 4ISLA 1Y3UA 4B73A 4H6TA 1EAWA 3GDUA 3SN8A 3SI3H 4AYYB 1YPMH 4IC6A 1MBQA 4NIXA 1O3EA 4E06H 2ZGCA 4E7RG 5J4QA 1O37A 3ODFA 1DT2A 4WH8A 3SJOA 5E2PA 2ZDNA 1XUJA 1GI0A 1SGRE 4YOJA 1ELEE 1TGCA 3S69A 1S5SA 1DWCH 3Q3YA 4NCYA 3STJA 1GJ4H 4JMYA 7GCHG 1QURH 5EXNA 1UVOA 1HAZB 1GCTB 3AASA 1QFKH 2H9TH 1FAKH 3SV8A 2FTLE 3ENSB 1PQ7A 2IN2A 5LPEA 4CHAC 1HJAB 2OC1A 1O2WA 3PWCA 1V2MT 1AVGH 3ELAH 4NA7A 1C5XB 1GI3A 1XM1A 1E0FD 2CMYA 1ELBA 3F68H 2B5TB 5L2ZH 2QY0B 3BTHE 2SGFE 3S9BA 1FDPA 1OWJA 1WV7H 2VWOA 3PTNA 4AZ2B 1CBWB 2ZPQA 4A92A 5ETXA 5A0CA 2RA0A 5A2MH 3E90B 1EB2A 3T25A 1ESAA 3DFLA 4ABBA 3ATMA 1YYY1 5EPNA 1Z8GA 1V2UT 4JYVH 1OP0A 3QWCH 4OS7A 5E0GA 3P95A 1K1LA 1QQUA 1BRCE 2STBE 2FOCA 1P05A 3F9GA 5I25A 2ZCHP 2ZCLP 2IOTA 4GCHG 1K1PA 1UVTH 1Z7KA 3DD2H 4O97A 1V6DA 2AERH 1W12U 1UVUH 2QCYA 4B74A 4LZ4B 6GCHF 1MCTA 4K3JA 4FVDA 2XBWA 2FS8A 4BXWA 3ZV8A 2GCHF 2Y80A 3BTFE 2BDAA 3E0NB 2GTBA 4OGYA 1NZQH 1UTNA 4GLYA 3S7HB 3SNDA 3GDVA 1ZOMA 4NFFA 1FMGA 3F9FA 1ZJKA 3GCHC 4ZXXH 3EBNA 4VGCB 1GBTA 1GBAA 3ZVBA 1RIWB 2NU4E 1SGQE 3VEQB 3BF6H 3T62A 1K1OA