4WY3A

Structure of sars-3cl protease complex with a phenylbenzoyl (r,s)-n-decalin type inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Fused-ring structure of decahydroisoquinolin as a novel scaffold for SARS 3CL protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 81
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4wy3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wy3A02
4FVBA 3UIRA 4Z0KA 2G8TA 1AIXH 1ETSH 3F9HA 1TQ0B 3SQEE 3OTJE 1P2QA 1EOLA 1ORFA 4BNRA 3M7TA 2C8YB 3AAVA 1PJPA 1KYNA 2M5TA 2ZHEH 2PKAB 1KTSB 3QUMP 4NSYA 5K7RA 5FBIA 2FM2A 3M5MA 3S0NA 1C1UH 2B9LA 2QYIA 1EPTA 3ZZBA 3SHAH 1CT2E 1HJ8A 1NESE 3L6PA 2B8OH 3TJUA 3M36A 1QB1A 1THPB 3RXIA 2BHGA 4ABFA 1WTHD 3RXVA 3U9AH 1TAWA 1NY22 3P8NA 5GJ4B 1GBEA 1OWEA 1TA2A 1A3BH 4GLYA 2GGVB 4UD9H 3T5FH 1V2WT 1B0EA 1W10U 2F9VA 4O97A 1GBBA 3MO6A 1GBCA 1P0SH 2HNTE 1QB9A 2PGQB 1NC6A 4BTIB 1Y3UA 1GI0A 4CH2B 1TPOA 2O8WA 1SFIA 2FS9A 4JZFH 1INCA 3GDVA 4INKA 2FTLE 3BTQE 1GBDA 2ZFSA 3OY5U 5FPTA 2A7CA 1FY4A 3ZZAA 1LQEA 2R3YA 3LOXA 3P8FA 1OWKA 1YPMH 2Y6TA 1RTLA 5HM9A 4IGDA 1YC0A 2FOMB 1MTVA 1P3EA 1V6DA 1HUTH 1YKTA 4DOQA 2BD9A 1NROH 3QZQA 1FI8A 1TGSZ 5F8TA 2ZQ1A 4B73A 1GMHF 3ZV9A 2ZU5A 2G52A 3SV9A 5EOKA 1ESAA 1P06A 4FUBA 1C5SA 3MU4A 3U8RH 2HVXA 3QTVH 1MTSA 4TPYA 1RIWB 2KAIB 3BTWE 1Y3YA 3SI4H 4TPIZ 1V2RT 1DXPA 5J4SA 1GL0E 1SLXB 2FZZA 1GBFA 4WWYA 5E0GA 3BF6H 1VJAU 1GBMA 1K9OE 1WQVH 4XDEA 1O3EA 1BTUA 1HCGA 4X8TH 1GWAA 1XKAC 1P11E 1KY9A 3RC6A 5GCHG 3SNBA 2G00A 4XE4A 4A6LA 4FUCA 2IN2A 3ELAH 1UK3A 1ETTH 1VCQA 4UFGH 1WTGH 2STBE 4XOJA 4ZKRU 4DW2U 3ITIA 4JYUH 4YESB 1VITF 4JMYA 1AZZA 3PLBA 3A85A 1GVLA 1BQYA 2VVCA 3UPEA 2FX4A 3SU1A 2J94A 2ZCHP 3MH5A 3F68H 1O2UA 1K1OA 2VWNA 2Q6DA 1G32B 1MCVA 3PLPA 4UFFH 3ATWA 1NZQH 1MQ6A 2BQ7B 4PROA 4X0WU 5L2YH 1O39A 2YOLA 2BVRH 2F83A 5FPSA 1O3IA 1TGTA 4I33A 1K1IA 2G4TA 1CA8B 1DSUA 3PMBB 1KLJH 2W3IA 4J2YB 4B75A 2OC0A 3SNAA 3TNSA 3ZZ6A 2FDAA 2WV4A 3WY8A 6ESTA 3M37A 2Y5HA 1NN6A 3GY3A 1CU1A 1CO7E 2D26C 1GL1A 4WXVA 3SV8A 3ATKA 1TMTH 5B6OA 1DICA 3ENSB 4BAKB 3FZDA 3SO3A 1W8BH 3VFEA 1KLTA 2I6SA 4B1TA 4TY6A 1UTPA 2K1QA 3LC5A 2VIVA 1ETRH 2GV7A 4Y10E 2AMQA 3C27B 1DM4B 4CRFA 3VB7A 3EE0B 1PQ8A 2R0LA 2VU8E 4KTUA 1TGBA 3LKWA 2ZKSA 5A8YA 1LPZB 1O5GH 4U2WA 2BY9X 1UVPA 3CENA 5C1XA 3GY4A 3S7HB 3UNQA 4K1EA 3H7TA 1BRCE 3DT0H 3ZZ9A 1C1VH 4GPGA 3QWCH 5ABWA 3BEFB 3MU8A 1CGIE 5JB8S 1QY6A 1XUKA 5HYOA 1O3HA 1UVOA 4X6NA 4X2XA 1A3EH 3SU2A 3NUMA 3EA8A 2SGFE 3LH3A 1AFQC 2DE9A 4OS4A 4E05H 2C8XB 4IS5A 1C1WH 3K9XB 2XWBI 2Y80A 4CRDA 1IQEA 1EATA 1P57B 4TY7A 2FOGA 5DP5A 2AGEX 1XUFA 4R0IA 3BN9A 4OGYA 3SGQE 2GMTC 4KELA 1PQAA 2FESH 1EKBB 3GCOA 4UFDH 3VEQB 2PFEA 1TBQH 1NRNH 2VH0A 1AMHA 3A7XA 4LK4A 4OGXA 1HAOH 1LVMA 1QJ7B 2JH6D 1GJCB 4TYDA 4Q7YA 1RFNA 5JDUB 3BG4C 4MTBA 2FX6A 2Q6GA 3HGNA 1IOEA 1HIAB 4O03A 4NIWA 2UUFB 3STIA 2Q6FA 3SUEA 5CHAC 1P9SA 2TRMA 1MTNC 3MOCA 2QXHA 3SI3H 1O37A 3KQBA 2A4OA 2ZTXA 4X6MA 2BZ6H 5HM2A 3GY2A 2LIZA 4A7IB 5EW2H 5FBEA 2GVFA 3AVZA 3ATMA 3F1SB 5DJ7A 4XBDA 2FO9A 1L2EA 1FXYA 1LHFH 3SU4A 3I77A 2V0BA 1YPJH 1DANH 2XBWA 1UTOA 1ZHMA 1AE8H 1GBJA 1E38B 1C1TA 2F9BH 1G37A 1O3PB 1O2GH 5EW1H 1GMDG 2JKHA 3O8BA 4I8GA 3RXMA 3ZZDA 4K5ZA 1CSOE 2C90B 3RMMH 2QXGA 4Y7BA 1KXDA 1JIRA 1KDQB 1OXGA 2XXLA 2F3CE 1GJ5H 2PUQH 1FY8E 1SHHB 3KEEA 2A5KA 2TBSA 1W12U 4WH6A 1C2GA 1LMWB 1NPMA 5JB9S 2LNCA 3MWIU 1WAYB 5DPAA 2ZFPH 1O31A 3UQOA 1IQKA 2PHBA 3VB6A 3ODFA 2QY0B 1CQQA 1Y5UT 2WYJA 3IITA 1IQLA 1GHAF 1FPHH 1XXDA 1AVXA 3RXHA 1C5ZB 1BMNH 4YTAA 4LZ1H 1G3BA 1YM0A 2ANMH 2P59A 1BRBE 2QAAA 1W0ZU 2C93B 3KQEA 1QURH 1GHYH 1P2IA 2ZZUH 4MPXA 5GIBA 2ZDLA 1W14U 1BDAA 2XC0A 5PTPA 1C5OH 1LDTT 1FONA 3FFGA 1BCUH 1HAXB 2HNTC 3BTTE 1FZZA 1NRSH 1SHYA 1HNEE 1VCPA 2XBXA 1AFQB 1S6HA 2CJIA 2TGPZ 3SBKA 4IN2A 2OBQA 1JMOH 3ZZ7A 4IW4E 3ZZ8A 1C5TA 2UWOA 4OS2A 4BAHB 1NS3A 1EUFA 3NKKA 3E1XB 1LCYA 5EU8A 3RP2A 1WCZA 4Y7AA 3CS7A 1TPSA 3SU6A 1QR3E 4AGKA 5A0CA 2GMTB 2ZA5A 2GZ7A 1ZMJA 3T26A 3RXQA 1BRUP 1EAXA 3A7VA 4KKDA 2PTNA 1F0SA 2FOAA 3PO1C 3LT3A 5F8ZA 1HXEH 2ZPSA 2SFAA 1ZHPA 3V12A 3QZRA 1ZLRA 2SGQE 1TYNA 2Z3CA 4TWWA 3BG4B 3RXBA 6GCHG 1EOJA 3TH3H 5JBAS 4Y76A 4D7FA 1OP2A 2ULLA 2ZDAH 1S0RA 5C3NA 1TWXB 3RUOA 1KSNA 4Y71A 2HPPH 5CHAB 3MU5A 1MTNB 2WUCA 4INLA 2EC9H 1C1OA 1O2JA 1AD8H 2FOHA 4AFQA 4KGAA 4MPUA 2ODPA 2XTTB 3FANA 2ZC9H 1V2PT 3P8GA 5ESTE 2WPHS 1C2LA 3K6YA 1DFPA 3ZZ3A 2HALA 1P2MA 1OPHB 2BD3A 1ABJH 1H9HE 3AW1A 1VITG 1O36A 4X2VA 1WSSH 2SGAA 4AFSA 1NRRH 4ISLA 4ABEA 1DLKB 1WU1A 2OC1A 4CRBA 1LTOA 2NWNA 1DWDH 2UUKB 3TU7H 2UUYA 1MAYA 2THFB 1O3BA 3SQHE 5DP6A 1V3XA 1C5XB 1T4UH 4I8KA 1TPAE 2R2WU 4HTCH 3UOPA 2VINA 1UK4A 1A46H 3U69H 1DWBH 2FI4E 1RGQA 3VB3A 1ARBA 5SGAE 2O8LA 3ESTA 1HAHH 1P3CA 1PYTD 2VIPA 1ANEA 2Z9GA 5AFZH 1Z1JA 1S84A 3GY7A 5T6DA 1ZPBA 1VJ9U 1BMMH 2BOHB 2V6NA 2ZG0H 1O2QA 5EQQA 1OX1A 3T25A 3RXJA 4WH8A 2GDDA 4MNVA 4MPVA 4B76A 2I6QA 1SC8U 2XWAA 1SR5C 1BTYA 1FIZA 2BLWA 1V2VT 1QB6A 2SNWA 4FUIA 2ZECA 1PPFE 4KTCA 1O0DH 2OINA 1K1PA 3ZVDA 3RMNH 2A45B 1T7CA 3VB5A 2IPHA 5F03A 3M61U 4I31A 3D49H 1BOQA 3V7TA 1C5VA 1E34B 1JBUH 1SI5H 1ZSLA 2HLCA 4AG2A 2Z7FE 2FYQA 2ZPRA 1A5GH 1XUHA 1NO9H 2ZFQH 1O3OA 1G30B 1Q2WA 3EA7A 1GHZA 4KTSA 2Y5GA 1LKBA 4X2YA 1A2CH 5H4IB 1UMAH 1LHCH 3RXFA 1LPGB 3A87A 1V2MT 4UEHH 2VNTA 3RXAA 3PO1B 1D4PB 3IG6B 3NPSA 2Z3DA 4ZAEA 3SNEA 2VWLA 2C3SA 2TIOA 2A5IA 4ABDA 1ZSJA 3TIUA 3V0XA 1W0YH 5FPYA 1BUIA 2G51A 3RXOA 1OWDA 2YNAA 3P70B 1BIOA 1DLEA 5C1YA 1IQGA 1WUNH 2BY8X 2WUBA 2OXSA 2BQ6B 1GMDF 1IQMA 2GP9B 2Z9LA 3FAOA 1TX8A 1HXFH 1J8AA 1ZSKA 5EQSA 2D8WA 5DK1A 2NU0E 1QA0A 2G81E 4XSKU 1XMNB 2PSXA 3LGIA 3M3TA 1ELDE 3M5OA 1OYTH 1SGIB 4GCHG 2F91A 4CBNA 2BB4A 3EGKH 1P2OA 3JZ1B 2Y7ZA 4WMDA 3M3VA 3SJ9A 1EXFA 5E2OA 4ZXYH 1JRSA 1QBOA 2Y81A 2V35A 4SGBE 3MI4A 1GDUA 2ZCLP 3BTKE 1G3EA 3RU4T 5A0AE 2BDIA 2RCEA 4ZMAH 1O5EH 1O2PA 1MTWA 1A1RA 1C1SA 1S6FA 4WJG2 1ELVA 1YPEH 4FU9A 3VXFH 1LHDH 5A0BA 3PTNA 2A7JA 3T27A 8LPRA 5CE1A 1DE7H 2OP9A 1C2FA 3BTGE 3RXDA 1AUJA 3TITA 5C5OA 1QBVH 1HAVB 4OS5A 1DOJA 2CF8H 2F9NA 4A1XA 2P93A 2R0KA 3E90B 1DDJA 4FUGA 2F9PA 2EI8A 2ZDNA 2RDLA 1TA6A 3MH6A 3TK6A 4ISHH 1GHAG 2H2ZA 1KXFA 3BTME 1TE0A 1NU9A 1EQ9A 1TRYA 3N7OA 4E06H 2D2DA 2ESTE 1A5IA 1GDQA 4WY3A 1UHBB 1V2NT 2FI3E 3T2NA 1TOMH 1DS2E 4K69A 6GCHF 4NIYA 2ZEBA 2BDCA 1S85A 1P01A 2CHAC 5FCRA 3IWMA 1DT2A 3LONA 7GCHF 2FTMA 1PQ5A 3A84A 3S7KB 8GCHG 3UR6A 1ZR0A 1VR1H 2AFQB 1YCPM 2ZPQA 3DFJA 3SW2B 1LHGH 1X7AC 1AGJA 4YOGA 4X1QU 2FPZA 1OSSA 1Y59T 1O38A 2PKAA 4AG1A 1DPOA 2AS9A 1C5UA 1V2ST 3TLOA 1GDNA 5EXLA 1ZGIA 3DUXH 1CE5A 1FY3A 4SGAE 3Q76A 4YOJA 2ZFFH 1O2NA 1SOZA 3RLWH 5LGOA 2WINI 1A0LA 1O30A 2V3OH 1AE5A 1C2EA 1D3DB 3PB1E 1WQSA 5BPEA 4KP0A 1Z8JB 1ZMNA 2FMJA 5FAHA 1Y3XA 1ZZZA 4Q80A 3A8AA 2BLVA 1TALA 3QTOH 4QT8C 3KCGH 2GCHF 1GBLA 1C4V2 3A7TA 1HDTH 7LPRA 1GMCF 1SPJA 1QJ6B 1F0RA 4H6TA 3KGPA 2HPQH 2A4GA 1SB1H 2ZQ2A 4Q7ZA 1GHWH 3B23B 2OC8A 4CHAC 3HATH 4GHQA 3RMLH 2ANWA 1EAUA 1AUTC 2WPJS 4MNXA 1YLDA 3MNXA 2BD5A 2ZU2A 1L1NA 3L3TA 2H9HA 2GZ9A 2Y82A 5DKMA 1ELBA 2J92A 5I25A 1XUIA 2ZNKH 3MO3A 2FXRA 1WOFA 1C1PA 5EODA 1IQIA 4F4OC 3F6UH 2R2MB 3PMHB 1JIMA 2HWLB 2WV5A 2PLXA 1GI5A 4U32A 2ZHFH 2ZGXH 1UTLM 1G3DA 3F9EA 3PV4A 2BLOA 2FOCA 2PKSC 1AKSB 1QL7A 2Z3EA 1DVAH 4X8SH 5JBCS 3SHCH 3T29A 3KL6A 1FV9A 2CGAA 1QL8A 2XC4A 2Z6BD 3SUDA 3VPKA 1HB0B 1S0QA 5EQRA 3UREA 2PWXA 3KIDU 1J14A 1HAZB 1J15A 3JZ2B 2AYWA 3RXKA 1XVMA 4NA8A 2PV9B 4MLFB 3NZIA 1EB2A 4ZXXH 2H6MA 1B5GH 2CHAB 1FY5A 1D3PB 2HNTF 3PLKA 1ESBA 2A4QA 4NG9H 3VB4A 4ISOA 5E8EH 1A61H 3BG8A 2ZU4A 2F9OA 1SBWA 1PPZA 2BXTH 4MVNA 5F8XA 3T28A 1MBMA 2BDYA 3A8BA 3ZV8A 3GY6A 3KNXA 1QRZA 4ABJA 4FU7A 3RDZA 1QBNA 5ESBA 2ILNA 4GHTA 1K28D 1OWIA 4MNYA 3U1IB 4AB8A 1TOCB 2ZGHA 1O2MA 1GJ4H 5F6MA 1MH0A 1KLIH 4O9VA 3C1KA 1GJDB 1KIGH 1UVSH 4GCHF 2B0FA 3PYHA 1NRPH 4ZKSU 1OWJA 2ZO3H 4A92A 2C8WB 2FLBH 4U30A 4YOIA 4I8LA 1O2IA 2O8TA 1TIOA 3I29A 2BMGB 1GI9B 1MU8B 1J16A 1UTNA 3ZZCA 3U98H 4ZKNU 1ZOMA 1F0TA 1YP9A 3ZVGA 5LH8A 4LXBH 2Z9KA 4IC5A 1ZPZA 1N6XA 3PTBA 1Y5BT 1V2KT 4GAWA 1O2XA 1HV7A 1MZDA 1SGDE 2W7UA 1TFXA 4H4FA 1GI8B 3U8OH 2J34A 1DSTA 2ZDMA 4B74A 1O3LA 1ELCA 1TONA 1GJ9B 2TGDA 4DURA 4LZ4B 4I8JA 2H5DA 4CHAB 1BTXA 3O8DA 2VVVA 1GI6A 3QK1A 1HJAC 4H42U 5A2MH 1SLVB 3MNBA 2AEIH 3RXLA 5L6NH 4X1RU 1ESTA 1ID5H 2J38A 1GHBG 1CT4E 2Z9JA 1K1LA 2XYAA 3P6ZB 3FZZA 2QA9E 4JYVH 4BXSA 4X8UH 2QGRA 1W3CA 3AW0A 2Y7XA 1CGJE 1WYKA 2VIDA 2BX4A 2XNIA 1EP5A 1T32A 1AQ7A 3H5CB 1RXPA 1Z8RA 3EQ0H 1L1JA 4FVDA 1O2RA 1C5WB 1ZGVA 2PKSB 5C1UA 1PPBH 1O3CA 1S81A 3S9CA 5DP7A 3A88A 2G55A 2CMYA 1EP6A 3LGWA 5HMAA 2ZHWH 1GJAB 1DY9A 8ESTE 2P95A 1GI3A 3E3TA 4IBLH 4I7YH 1IQNA 1SGNE 1FUJA 8GCHF 3SUGA 4A5TS 4AORA 1EPTC 4DG4A 1RD3B 1PQ7A 1GBIA 3TGKE 1EJMA 1UTQA 2VIOA 8KME2 2SGDE 1G2LA 2A7HA 3P92A 2C4FH 3ZZ4A 4ZHLU 3UTUH 1ZRKA 3LC3A 4D9QA 1TRMA 2A2XH 3Q3XA 2VGCC 1KXBA 1ZJDA 1HIAA 1GVZA 1A4WH 3A7YA 2NU3E 5IYTA 3SGAE 1C4Y2 4XFQA 2W7SA 1L4DA 2XBVA 1O3MA 1V2QT 1H8IH 3M7UA 2J2UA 4ZHAA 1FMGA 1VGCB 4NGAH 3QO6A 1BBRH 3RM0H 4HI3A 2QCYA 1UVUH 1TBZH 4K1TA 1V2LT 1VITH 3GYLB 3R3GB 2AGGX 2GT8A 3RXRA 1NU7B 2OUAA 3P95A 3DFLA 1DWCH 4JCNA 4RKJB 1ELFA 1SQAA 2QIQA 2VIQA 7GCHG 1EZXC 1GI4A 3UY9A 3B9FH 1Z71A 3STJA 1FAXA 1QRWA 1SGQE 1UTJA 3LPRA 5AHGH 1YLCA 2R3UA 2IJOB 4BAMB 5IDKA 5G4BA 2ZHQH 3R0FA 3RXTA 2ZGBH 1KDQA 3ODDA 5T3HA 1C5PA 1RTKA 5EXNA 3E0PB 2FIRH 2OC7A 1O3AA 3F9FA 2EI7A 1AB9C 1YGCH 4D76A 4ISIH 4A1VA 4H6SB 3LGTA 2CF9H 2ZTYA 3S9AA 1AU8A 3BTHE 3I78A 4U01A 4NSVA 3SJ8A 1HJAB 4MDSA 2EA3A 4DGJA 4X1SU 1BTZA 1AY6H 3PM3A 1A5HA 3A8CA 3PROA 1U6QA 1OP8A 1XX9A 2HGTH 1S83A 4BTUB 5C5NA 2P3UB 4Y11E 2GCHG 1SG8B 3EAJA 3BIUH 2VB0A 1QJ1B 3A8DA 1GMCG 1ZPCA 1FY1A 1QIXB 3A7WA 1P05A 1H8DH 1Z7KA 2XRCA 4E7NA 4X2WA 5ETXA 1TNKA 3TJVA 2H9EH 4K60A 1MUEB 3CS0A 5TCCA 1O2TA 1ELTA 3ZVCA 2O9QA 4B2BA 3GICB 5FXLA 1BB0B 1QGFA 3B8JA 4VGCC 4IMQA 1E35B 2QXIA 1FDPA 3UNRA 2ZTZA 3SOSA 2VH6A 1EZUC 3NXPA 3M7QA 4OS7A 1YPLH 1C5QA 1O5DH 2SGPE 2XC5A 1CHOF 4XBCA 3MNSA 3A82A 5AVDA 1EZQA 1AHTH 3BEUA 3E0NB 4IC6A 1OKXA 1QQ4A 1EPTB 1J9CH 3UWJH 1AWHB 1T8OA 1QA7A 3SORA 1DXWA 1B7XB 1Z6EA 5A8XA 1UK2A 1C2IA 1W7XH 4AGJA 2ZGCA 1O3DA 3AASA 1S5SA 1W2KH 1ZTJA 2GCTC 1Y5AT 2VGCB 1BBRE 4YLQH 2Y5FA 2A1DB 2D1JA 1SGFG 4K8YA 2QF3A 3TGJE 1MBQA 1THRH 1K22H 1GBTA 3LGVA 4AYVB 3SNDA 1CA0C 1MTUA 2VVUA 1YPGH 1AO5A 4UDWH 1ELEE 1FN6A 3T62A 5T6GA 1RTFB 4B2CA 1IAUA 4FU8A 1H9LB 3RXSA 3NWUA 1O2YA 1LHEH 4CRGA 2ZWLH 1EZSC 1TPPA 3S69A 3OSYA 1BTPA 1F5KU 2Q1JA 1SOTA 2ODQA 4AOQA 1NTPA 1O33A 2OCVB 3LIWA 9ESTA 1ZRBA 4Q7XA 4X1NU 1AVWA 2ZF0H 2A32A 1E36B 1TGNA 3NK8A 4MG3A 1AB9B 3E16B 4K1SA 2WPLS 2BDAA 1SMFE 2GT7A 1GHBF 4JZ1A 3W94A 3SU5A 2NU2E 5JBTA 1PPCE 2PR3A 1TNHA 1C1QA 3GCNA 1C5RA 3A86A 3UQVA 1O5BB 1N8OC 4ABIA 1C5YB 1K1MA 1SQTA 3MNCA 3GY5A 2ANKH 1BMLA 1D6WA 1TNGA 4WMFA 3TPIZ 3QLPH 2ZIQH 2AERH 3MH4A 4NIXA 2BYAX 3HPTB 2W5EA 2OLGA 1TGCA 1W7GH 1ZJKA 1TLDA 5DG6A 1GI1A 1PFXC 3K2UA 1MQ5A 1JXPA 2BDBA 1LO6A 4AN7A 1MKWK 1T31A 1F2SE 4YO9A 3S9BA 2BXUH 1GPZA 3VGCB 2ODYB 3U8TH 4FUHA 3RXGA 3SNCA 2IOTA 4B2AA 1C9PA 4NA7A 4VGCB 5BRRE 1C4U2 4FXGH 4UFEH 5DP3A 1V2UT 1Y3VA 4JYTA 4E7RG 5A09A 2NU1E 2TPIZ 3SU0A 1SFQB 1BBRK 3OX7U 1AZ8A 4NCYA 1AFEH 4HGCA 3SGBE 1P2KA 2LPRA 2UWLA 2F9UA 1P12E 3SU3A 2FWWA 3LH1A 5FCKA 3BV9B 2ZHDA 1E0FD 4JK5A 3TVJB 4CREA 1GCDA 4Y8XA 3UNSA 3AAUA 3U1JB 2GCTB 3RM2H 1RS0A 1MMJN 2K7XA 1YCPH 3Q3YA 3DD2H 3O8RA 1CBWC 1IQJA 2AH4X 1TNJA 3UFAA 4JZIA 1CA0B 3SV6A 1Q3XA 1OWHA 3PMJA 1HLTH 2B5TB 1TMBH 1MKXH 2QN5T 3TK5A 1EJAA 4NFEA 9LPRA 1O2WA 5C20A 1LVYA 4CH8B 1CGHA 3A7ZA 2DUCA 4AZ2B 3RXPA 1CVWH 2BLQA 3TJOA 1AVGH 2FI5E 1F7ZA 1Y8TA 2OQ5A 3GDSA 1VCWA 3Q77A 3L33A 1BTWA 3BSQA 3OY6U 2P8OC 1ELGA 3HK6B 1SGPE 4X1PU 4MQAA 1ANBA 1EX3A 1SLWB 3SN8A 1G3CA 1FNIA 1V2OT 3A89A 3UOUA 5J4QA 1TNLA 2BDHA 3DA9B 1GG6C 5GDSH 2ZDKA 5EXMA 1K1JA 1UO6A 1O35A 4ABGA 3FVFB 7KMEH 3MTYA 1YYY1 2RG3A 3TJNA 3P8OA 5AFYH 3LJJA 1Z6JH 1IQFA 2J9NA 1FQ3A 3M5LA 2A5AA 1NFYA 2V3HH 1QHRB 1N8OB 3DHKH 1O3FA 3OU0A 3UUZA 1HAPH 2P16A 4DY7B 4M7GA 1TMUH 2BX3A 1P2JA 3UR9A 2J4IA 4ZH8A 1G2MA 1JRTA 4O3UA 1HAVA 2HRVA 2J95A 3SJOA 1TABE 2CV3A 1KXEA 1AN1E 1O32A 2WYGA 3BEIB 3GISB 1N6YA 1EB1H 1UVTH 5JPMH 1GBHA 4Q2KA 1O2HA 1HPGA 2BZAA 4MPWA 5E0JA 1C9TA 1BT7A 4INHA 1F5LA 1BTHH 4YT7H 2GX4A 4HZHA 2G5VA 2PUXB 2EEKA 2RA0A 1D6RA 1A0HB 2BTCE 2VWOA 1L0ZA 1ZTKA 1F92A 2O8UA 2BD7A 1UHBA 5DP4A 1O34A 1KXCA 1O2OA 2DE8A 1FAKH 1GHVH 1DUAA 3BTFE 4Y79A 3EA9A 2GZ8A 4K2YA 3GCTF 2KAIA 3V13A 4BOHA 3MMGA 4DIIH 4K8BA 4D9RA 3MHWU 1ABIH 1P8VC 1ANCA 5FX5A 1EJNA 1HFDA 3TNTA 5DP8A 2A31A 1LQDB 3ZZ5A 5EGMA 2WPKS 2QXJA 1C5NH 1CBWB 3D62A 1AI8H 2H1UA 1ACBE 1FIWA 4IN1A 3EYDA 3RU4D 5E0HA 2ZFTA 3P17H 3PWCA 1GJ7B 4XBBA 3HGPA 5A8ZA 1CHOG 1BHXB 1J17T 1H9IE 1DITH 1O5FH 2CN0H 2FS8A 7ESTE 3ZVBA 4ESTE 1C2MA 1QFKH 1PYTC 4RKOB 1BMAA 2GKVE 1YPHE 1O3JA 1PPHE 1HYLA 4UONA 1QCPA 2FOEA 1SVPA 1Z8GA 3UWIA 1VGCC 1EAIA 1F5RA 2BVXH 2P8OB 3LDXH 3Q00A 3W95A 3RU4E 3LJOA 2SNVA 3M35A 3GCHC 1UCYH 2ZU1A 2SGEE 4Y8YA 3TH4H 2BD4A 4YZUA 3KQDA 4ZUHA 3E8LA 1GG6B 1W11U 2XBYA 4WF8A 2JH0D 4FUJA 1DX5M 3LU9B 4MNWA 2BQWB 4FUDA 5EPNA 4B71A 4I32A 1O5AB 3TK9A 3LGYA 1XXFA 1HRTH 2FLRH 1MZAA 4AX9H 1E37B 1T8MA 1HAYB 1GCTC 5JYIA 4AYYB 1BJUA 1K2I1 2BVSH 4ABBA 1FN8A 2EI6A 5DGJA 1LVBA 4JZDH 2BY5X 4NZQA 2YNBA 4GVUA 3KN2A 1C1RA 1SGRE 1O2VA 2P3TB 2FOBA 5LPEA 3GY8A 2ZU3A 3MH7A 2OTVA 4X6PA 2O8MA 4ZHMU 2UUJB 1C2HA 1V2TT 4NIVA 2W26A 3SV7A 4D8NA 5C67A 4RN6A 1C5MD 1THSH 3A83A 4BANB 2P94A 1FPCH 1BITA 1SGCA 3D23A 1FJSA 1ZHRA 3FP7E 3FP8E 2AIQA 1Z1IA 1AKSA 1TNIA 3RC5A 4I8HA 1LPKB 1YCPK 4DIHH 3ZYEA 2AMPA 5LPRA 1GJBB 1NFWA 1M9UA 1P2NA 1H4WA 1UJ1A 3ZYDA 3EBNA 1A7SA 3RMOH 2ZCKP 2Z94A 3TH2H 1MD7A 2G5NA 1MKXK 1BZXE 1O5CB 1QNJA 2JETC 3KQCA 4UE7H 2ZI2H 1HJ9A 1CT0E 3K65B 4OS6A 2H9TH 2PTCE 1ARCA 4THNH 5CMXH 4TWYA 1C2KA 1O3GA 1O2LA 1FLEE 1RJXB 5EG4A 4CRAA 1C5LH 1P10A 2CXVA 4BTTB 1XVOA 3G01A 1C1MA 1BRAA 1XM1A 1O2KA 3F9GA 1T4VH 3HKIB 2ALPA 3RLYH 2NU4E 1QL9A 3SZNA 4BAQB 2VWMA 5HXFA 1MKWH 3A80A 3RXEA 3MU1A 5L2ZH 1MD8A 2B7DH 1GBKA 3E6PH 1KXAA 3GOVB 5EPYA 1SGYE 5DP9A 1D9IA 1YBWA 4ZKOU 2W3KA 1Q31A 1T8NA 3PMAB 1GBAA 4JK6A 4X8VH 3D65E 2BY7X 5GWZA 1OOKB 4WVPE 1IHSH 1UCYE 5DO4H 2BD2A 3LGUA 3GCHB 1G9IE 5GCHF 3BTEE 1KTTB 4O3TA 1GGDC 2A2QH 1B0FA 4D7GA 5L30H 1RRKA 1XKBC 3MYWA 4ASHA 4X6OA 3EDXB 3SUFA 2JH5D 3M5NA 1UTKA 2QC2A 1ANDA 3URDA 2XCNA 2VJ1A 1BJVA 4IMZA 1EAWA 1HBTH 1GMHG 4YT6H 5C2ZA 1P03A 2OBOA 3RXCA 3ATLA 1ELAA 1GCTB 2BM2A 3K6ZA 4Z6AH 4BAOB 1SSXA 1MCTA 4ABHA 3KF2A 4F49A 1L1GA 4FUEA 6CHAC 1YF4A 1F0UA 1TX7A 1SGEE 4J1YA 3MU0A 2XW9A 4ABAA 4NZLA 4JZEH 5GPIB 1LKAA 1NM6A 2QF0A 4NA9H 1DWEH 1O3NA 2PSYA 1GJ6A 2BDGA 1SLUB 3QX5H 1QTFA 1T8LA 1ZTLA 2C8ZB 2GTBA 2FOFA 3BTDE 2GD4B 1NFUA 1V2JT 2AIPA 3OYPA 4YM9A 1GVKB 1GI2A 2ZDVH 4Y6DA 1GI7B 4DJZB 1TRNA 5E2PA 1P9UA 2ALVA 2TGTA 1OS8A 1TQ7B 3URCA 1IQHA 3O8CA 4GSOA 2FEQH 3TGIE 1YPKH 1XUGA 2WPMS 3Q3KA 1TB6H 3V3MA 4LOYH 5TCAA 1K21H 1EASA 2JETB 2ANYA 1DY8A 1SQOA 3VGCC 1C2DA 2ZFRH 1LVOA 4NWKA 3HK3B 1BA8B 3E91A 1MU6B 1CHGA 2QV1A 4Y0ZE 4CR9A 1ZMLA 4Y0YE 2FYRA 3BIVH 3SJKA 3ZVFA 1DUEA 3ZVEA 3GDUA 1UCYK 1P04A 3H7OA 5GXPA 1OP0A 4GUXA 3RXUA 1AWFH 1ZYOA 2BOKA 2Z9IA 1PPEE 5FHTA 2UWPA 1O3KA 4RSPA 2A0QB 2BY6X 4WXIA 1NFXA 2P3FH 4A1TA 1Z8IB 3SJIA 3QGJA 1P09A 2OD3B 2ZGJA 5HGGA 5AF9H 4WMEA 1JWTA 1MAXA 1S82A 1XUJA 3GCTG 4CRCA 1NRQH 3QGNB 2A4RA 1O2ZA 1G36A 3CP7A 1O2SA 4YLUA 2STAE 1NT1A 4HFPB 1UTMA 2FODA 3MO9A 3QDZB 4ISNA 6LPRA 2R9PA 3NCLA 2AMDA 2AGIX 2XCFA 4R8TB 2FP7B 1TX6A 2G4UA 4Y8ZA 1GGDB 1K1NA 3M3SA 1Y3WA 2GV6A 4CR5A 2WPIS 5TJXA 1A0JA 1QQUA 1GHXH 1TBRH 2RA3A 3A81A 1H1BA 1P02A 4DT7B 1HAGE 4NWLA 4ZROA 1PPGE 2PGBB 2VIWA 2H5CA 1C1NA 1HAIH 4BXWA 1GJ8B 3VXEH 4K3JA 1BHXF 4DCDA 1N1LA 1RIWC 1JOUB 3SV2H 4AFUA 4AFZA 3RC4A 1SGTA 1YPHC 2BD8A 3GYMA 3ZVAA 2PW8H 3ATIA 1HGTH 5I46H 1WBGB 3HKJB 1W13U 3KHVA 5T6FA 1VZQH 2HOBA 5JBBS 1C2JA 1OYQA 1SL3A 6CHAB 1QRXA 4NFFA 2TGAA 5LPFA 1WV7H 4CBOA 4FUFA 2ASUB 1D3TB 2ZP0H 3PWBA 5FX6A 4AB9A 1L4ZA 1IHTH 5K0HA 3MFJA 1SGFA 4OS1A 3QN7A 1D3QB 4DVAU 2GDEH 2OQUA 3FP6E
chains in the Genus database with same CATH superfamily
4FVBA 5C0TA 3UIRA 4Z0KA 5GNDA 2G8TA 1AIXH 1ETSH 2AHME 3F9HA 1TQ0B 3SQEE 3OTJE 1P2QA 1EOLA 1ORFA 4BNRA 3M7TA 2C8YB 4F48B 3AAVA 1PJPA 1KYNA 2M5TA 2ZHEH 2PKAB 1KTSB 3QUMP 4NSYA 5K7RA 5FBIA 2FM2A 4XRNA 3M5MA 3S0NA 1C1UH 2B9LA 2QYIA 1EPTA 3ZZBA 3SHAH 1CT2E 1HJ8A 1NESE 3L6PA 2B8OH 3TJUA 3M36A 1QB1A 1THPB 3RXIA 2BHGA 4ABFA 1WTHD 2YMSC 3RXVA 1TAWA 1NY22 3U9AH 3P8NA 5GJ4B 1GBEA 1OWEA 1TA2A 1A3BH 4GLYA 2GGVB 4UD9H 3T5FH 1V2WT 1B0EA 1W10U 2F9VA 4O97A 1GBBA 3MO6A 1GBCA 1P0SH 2HNTE 1QB9A 2PGQB 1NC6A 4BTIB 1Y3UA 1GI0A 4CH2B 1TPOA 2O8WA 1SFIA 2FS9A 4JZFH 1INCA 3GDVA 4INKA 2FTLE 3BTQE 1GBDA 2ZFSA 3OY5U 5FPTA 2A7CA 2F4LA 1FY4A 3ZZAA 1LQEA 2R3YA 3LOXA 3P8FA 1OWKA 1YPMH 2Y6TA 1RTLA 5HM9A 4IGDA 1YC0A 2FOMB 1MTVA 1P3EA 1V6DA 1HUTH 1YKTA 4DOQA 2BD9A 1NROH 3QZQA 1FI8A 1TGSZ 5F8TA 2ZQ1A 4B73A 1GMHF 3ZV9A 2ZU5A 2G52A 3SV9A 5EOKA 1ESAA 1P06A 4FUBA 1C5SA 3MU4A 3U8RH 2HVXA 3QTVH 1MTSA 4TPYA 1H8HD 1RIWB 2KAIB 3BTWE 1Y3YA 3SI4H 2GJGA 4TPIZ 1V2RT 1DXPA 5J4SA 1GL0E 1SLXB 2FZZA 1GBFA 4WWYA 5E0GA 3BF6H 1VJAU 1GBMA 1K9OE 1WQVH 4XDEA 1O3EA 1BTUA 1HCGA 4X8TH 1GWAA 1XKAC 1P11E 1KY9A 3RC6A 5GCHG 3SNBA 2G00A 4XE4A 4A6LA 4FUCA 2IN2A 3ELAH 1KMHB 1UK3A 1ETTH 1VCQA 4UFGH 1WTGH 2STBE 4XOJA 4ZKRU 4DW2U 3ITIA 4JYUH 4YESB 1VITF 4JMYA 1AZZA 3PLBA 3A85A 1GVLA 1BQYA 2VVCA 3UPEA 2FX4A 3SU1A 2J94A 2ZCHP 3MH5A 3F68H 1O2UA 1K1OA 2VWNA 2Q6DA 1G32B 1MCVA 3PLPA 4UFFH 3ATWA 4F55A 1NZQH 1MQ6A 2BQ7B 4PROA 4X0WU 5L2YH 1O39A 2YOLA 2BVRH 2F83A 5FPSA 1O3IA 1TGTA 4I33A 1K1IA 2G4TA 1CA8B 1DSUA 3SZEA 2YMSB 5KEDA 3PMBB 1KLJH 2W3IA 4J2YB 4B75A 2OC0A 3SNAA 1SKYE 3TNSA 3ZZ6A 2FDAA 2WV4A 3WY8A 6ESTA 3M37A 2Y5HA 1NN6A 3GY3A 1CU1A 1CO7E 2D26C 1GL1A 4WXVA 3SV8A 3ATKA 1TMTH 5B6OA 1DICA 3ENSB 4BAKB 3FZDA 3SO3A 1W8BH 3VFEA 1KLTA 2I6SA 3F2FA 4B1TA 4TY6A 1UTPA 2K1QA 3LC5A 2VIVA 1ETRH 2GV7A 5DN6D 4Y10E 2AMQA 3C27B 1DM4B 1QZ8A 4CRFA 3VB7A 3EE0B 4YXWD 1PQ8A 2QE7D 2R0LA 2VU8E 4Z1MD 4KTUA 1TGBA 3LKWA 2ZKSA 5A8YA 1LPZB 1O5GH 1W0JD 4U2WA 2BY9X 1UVPA 3CENA 4ZCNA 5C1XA 5T1VA 3GY4A 3S7HB 3UNQA 4K1EA 3H7TA 1BRCE 3DT0H 3ZZ9A 1C1VH 4GPGA 3QWCH 5ABWA 3BEFB 3MU8A 1CGIE 5JB8S 1QY6A 1XUKA 5HYOA 1O3HA 1UVOA 4X6NA 4X2XA 1A3EH 3SU2A 3NUMA 3EA8A 2SGFE 3LH3A 1AFQC 2DE9A 2J5UA 4OS4A 4E05H 2C8XB 4IS5A 1C1WH 3K9XB 2XWBI 2Y80A 4CRDA 1IQEA 1EATA 1P57B 4TY7A 2FOGA 5DP5A 2AGEX 1XUFA 4R0IA 3BN9A 4OGYA 3SGQE 4ASUD 2GMTC 4KELA 1PQAA 2FESH 1EKBB 3GCOA 2KCYA 4UFDH 3VEQB 2PFEA 1TBQH 5HIZA 1NRNH 2VH0A 1AMHA 3A7XA 4LK4A 3AK5A 4OGXA 1HAOH 1LVMA 5HKKD 1QJ7B 2JH6D 1GJCB 4TYDA 4Q7YA 1RFNA 5JDUB 3BG4C 4MTBA 2FX6A 2Q6GA 3HGNA 1IOEA 1HIAB 4O03A 4NIWA 2UUFB 3STIA 2IJD1 2Q6FA 3SUEA 5CHAC 1P9SA 2TRMA 1MTNC 3MOCA 2QXHA 3SI3H 1O37A 3KQBA 2A4OA 2ZTXA 4X6MA 2BZ6H 5HM2A 3GY2A 2LIZA 4A7IB 5EW2H 5FBEA 2GVFA 3AVZA 3ATMA 3F1SB 5DJ7A 4XBDA 2FO9A 1L2EA 1FXYA 1LHFH 3SU4A 3I77A 3GS9A 2V0BA 1YPJH 1DANH 2XBWA 1UTOA 1ZHMA 1AE8H 1GBJA 1E38B 1C1TA 2F9BH 4ACAA 1G37A 2W6JD 1EFRD 1O3PB 1O2GH 1YLNA 1GMDG 2JKHA 5EW1H 2WPDD 2WSSD 3O8BA 4I8GA 3RXMA 3ZZDA 4K5ZA 1CSOE 2C90B 3N7EA 3RMMH 2QXGA 4Y7BA 1KXDA 1JIRA 1KDQB 1OXGA 2XXLA 2F3CE 1GJ5H 2PUQH 1FY8E 1SHHB 3KEEA 2A5KA 2TBSA 1W12U 4WH6A 1C2GA 1LMWB 1NPMA 5JB9S 2LNCA 3MWIU 1WAYB 5DPAA 5DSFA 2ZFPH 1O31A 3UQOA 1IQKA 2PHBA 3VB6A 3ODFA 2QY0B 1CQQA 1Y5UT 2WYJA 3IITA 1IQLA 1GHAF 1FPHH 1XXDA 1AVXA 3RXHA 1C5ZB 1BMNH 4YTAA 4LZ1H 1G3BA 1YM0A 2ANMH 2P59A 1BRBE 2QAAA 1W0ZU 2C93B 3KQEA 1QURH 1GHYH 1P2IA 2ZZUH 4MPXA 5GIBA 2ZDLA 1W14U 1BDAA 2XC0A 5PTPA 1C5OH 1LDTT 1FONA 3FFGA 2KX4A 1BCUH 1HAXB 2JJ1D 2HNTC 3BTTE 1FZZA 1NRSH 1SHYA 1HNEE 4FOUC 1VCPA 2XBXA 1AFQB 1S6HA 2CJIA 2TGPZ 3SBKA 3OTPA 4IN2A 2OBQA 1JMOH 3ZZ7A 4IW4E 3ZZ8A 1C5TA 2UWOA 4OS2A 4BAHB 1NS3A 1EUFA 3NKKA 3E1XB 1LCYA 5EU8A 3RP2A 1WCZA 4Y7AA 3CS7A 1TPSA 3SU6A 4B6EA 1QR3E 4AGKA 5A0CA 2GMTB 2ZA5A 1COWD 2GZ7A 1ZMJA 3T26A 3RXQA 1BRUP 1EAXA 3A7VA 4KKDA 2PTNA 2XOKD 1F0SA 2FOAA 3PO1C 3LT3A 5F8ZA 1HXEH 2ZPSA 2SFAA 1ZHPA 3V12A 3QZRA 1ZLRA 2SGQE 1TYNA 2Z3CA 4TWWA 3BG4B 3RXBA 6GCHG 1EOJA 3TH3H 5JBAS 4Y76A 4D7FA 1OP2A 2ULLA 2ZDAH 1S0RA 5C3NA 1TWXB 3RUOA 4P00A 1KSNA 4Y71A 2HPPH 5CHAB 3MU5A 1MTNB 2WUCA 2LP6A 2EC9H 4INLA 1C1OA 1O2JA 1AD8H 2FOHA 4AFQA 4KGAA 4MPUA 2ODPA 2XTTB 3FANA 2ZC9H 1V2PT 3P8GA 5ESTE 2WPHS 1C2LA 3K6YA 1DFPA 3ZZ3A 5CDFE 2HALA 1P2MA 1OPHB 2BD3A 1ABJH 1H9HE 3AW1A 1VITG 1O36A 4X2VA 1WSSH 2SGAA 4AFSA 1NRRH 4ISLA 4ABEA 1DLKB 1WU1A 2OC1A 4CRBA 1LTOA 2NWNA 1DWDH 2UUKB 3TU7H 2UUYA 1MAYA 2THFB 1O3BA 3SQHE 5DP6A 1V3XA 1C5XB 1T4UH 4I8KA 1YY3A 1TPAE 2R2WU 4HTCH 3UOPA 2VINA 1UK4A 1A46H 3U69H 1DWBH 2FI4E 1RGQA 3VB3A 1ARBA 5SGAE 2O8LA 3ESTA 1HAHH 1P3CA 1PYTD 2VIPA 1ANEA 2Z9GA 5AFZH 1Z1JA 1S84A 3GY7A 5T6DA 1ZPBA 1VJ9U 1BMMH 2BOHB 2V6NA 5C94A 2ZG0H 2KFWA 1O2QA 5EQQA 1OX1A 3T25A 3RXJA 4WH8A 2GDDA 4MNVA 4MPVA 4B76A 2I6QA 1SC8U 2XWAA 1SR5C 1BTYA 1FIZA 2BLWA 1V2VT 1QB6A 2SNWA 4FUIA 2ZECA 1PPFE 4KTCA 1O0DH 2OINA 1K1PA 3ZVDA 3RMNH 2A45B 1T7CA 3VB5A 2IPHA 5F03A 3M61U 4I31A 3D49H 1BOQA 1YWUA 3V7TA 1C5VA 1E34B 1JBUH 1SI5H 1ZSLA 2HLCA 4AG2A 2Z7FE 2FYQA 2ZPRA 1A5GH 1XUHA 3FKSD 1NO9H 2ZFQH 1O3OA 1G30B 1Q2WA 3EA7A 1GHZA 4KTSA 2Y5GA 1LKBA 4X2YA 1A2CH 5H4IB 1UMAH 1LHCH 3RXFA 1LPGB 3A87A 1V2MT 4UEHH 2VNTA 3RXAA 3PO1B 1D4PB 3IG6B 1H8ED 3NPSA 2Z3DA 4ZAEA 3SNEA 2VWLA 2C3SA 2TIOA 2A5IA 4ABDA 1ZSJA 3TIUA 3V0XA 1W0YH 5FPYA 1BUIA 2G51A 3RXOA 1OWDA 2YNAA 3P70B 1BIOA 1DLEA 5C1YA 1IQGA 1WUNH 2BY8X 2WUBA 2OXSA 2BQ6B 1GMDF 1IQMA 2GP9B 2Z9LA 5CHBA 3FAOA 1TX8A 1HXFH 1J8AA 1ZSKA 5EQSA 2D8WA 5DK1A 2NU0E 1QA0A 2G81E 4XSKU 1XMNB 2PSXA 3LGIA 3M3TA 1ELDE 3M5OA 1OYTH 1SGIB 4GCHG 2F91A 4CBNA 2BB4A 3EGKH 1P2OA 3JZ1B 2Y7ZA 4WMDA 3M3VA 3SJ9A 1EXFA 5E2OA 4ZXYH 1JRSA 1QBOA 2Y81A 2V35A 3OFND 4SGBE 3MI4A 1GDUA 2ZCLP 3BTKE 1G3EA 3RU4T 5A0AE 2BDIA 2RCEA 4ZMAH 1O5EH 1O2PA 1MTWA 1A1RA 1C1SA 1S6FA 4WJG2 1ELVA 1YPEH 4OM9A 4FU9A 3VXFH 1LHDH 5A0BA 3PTNA 2A7JA 3T27A 3WWFA 8LPRA 5CE1A 1DE7H 2OP9A 1C2FA 3BTGE 3RXDA 2RFKC 3KQ5A 1AUJA 3TITA 5C5OA 1QBVH 1HAVB 4OS5A 1DOJA 2CF8H 2F9NA 4A1XA 2P93A 2R0KA 3E90B 1DDJA 4FUGA 2F9PA 2EI8A 2ZDNA 2RDLA 1TA6A 3MH6A 3TK6A 4ISHH 1GHAG 2H2ZA 1KXFA 3BTME 1TE0A 1NU9A 1EQ9A 2CK3D 1TRYA 3N7OA 2J98A 4E06H 2D2DA 2ESTE 1A5IA 1GDQA 4WY3A 1UHBB 1V2NT 2FI3E 3T2NA 1TOMH 1DS2E 4K69A 6GCHF 4NIYA 2ZEBA 2BDCA 1S85A 1P01A 2CHAC 5FCRA 3IWMA 1DT2A 3LONA 7GCHF 2FTMA 1PQ5A 3A84A 3S7KB 8GCHG 3UR6A 1ZR0A 1VR1H 2AFQB 1YCPM 2ZPQA 3DFJA 3SW2B 1LHGH 2KZ4A 1X7AC 1AGJA 4YOGA 4X1QU 2FPZA 1OSSA 1Y59T 1O38A 2PKAA 4AG1A 1DPOA 2AS9A 1C5UA 1V2ST 3TLOA 3PRDA 1GDNA 5EXLA 1ZGIA 3DUXH 1CE5A 1FY3A 4SGAE 3Q76A 4YOJA 2ZFFH 1O2NA 1SOZA 3RLWH 5LGOA 2WINI 1A0LA 1O30A 2V3OH 1AE5A 1C2EA 1D3DB 3PB1E 1WQSA 5BPEA 4KP0A 1Z8JB 1ZMNA 2FMJA 5FAHA 1Y3XA 1ZZZA 4Q80A 3A8AA 4I86A 2BLVA 1TALA 3QTOH 4QT8C 3KCGH 2GCHF 1GBLA 1C4V2 3A7TA 1HDTH 7LPRA 1WXRA 1GMCF 1SPJA 1QJ6B 1F0RA 3F3BA 4H6TA 3KGPA 2HPQH 2A4GA 1SB1H 2ZQ2A 4Q7ZA 1GHWH 3B23B 2OC8A 4RT1A 4CHAC 3HATH 4GHQA 3RMLH 2ANWA 1EAUA 1AUTC 2WPJS 4MNXA 1YLDA 3MNXA 2BD5A 2ZU2A 1L1NA 3L3TA 2H9HA 3FO8D 2LELA 2GZ9A 2Y82A 5DKMA 1ELBA 2J92A 5I25A 1XUIA 2ZNKH 3MO3A 2FXRA 1WOFA 3WWBA 1C1PA 5EODA 1IQIA 4F4OC 2K0QA 3F6UH 2R2MB 3PMHB 1JIMA 2HWLB 2WV5A 2PLXA 1GI5A 4U32A 2ZHFH 2ZGXH 1UTLM 1G3DA 3F9EA 3PV4A 5B6LA 2BLOA 2FOCA 2PKSC 1AKSB 1QL7A 2Z3EA 1DVAH 4X8SH 5JBCS 3SHCH 3T29A 3KL6A 1FV9A 2CGAA 1QL8A 2XC4A 2Z6BD 4RI0A 3SUDA 3VPKA 1HB0B 1S0QA 1WDIA 5EQRA 2PWXA 3UREA 3KIDU 1J14A 3NRLA 1HAZB 1J15A 2KM0A 3JZ2B 2AYWA 2RDEA 3RXKA 1XVMA 3DSPA 4NA8A 2PV9B 4MLFB 3NZIA 1EB2A 4ZXXH 2H6MA 1B5GH 2CHAB 1FY5A 1D3PB 2HNTF 3PLKA 1ESBA 2A4QA 4NG9H 3VB4A 4ISOA 5E8EH 1A61H 3BG8A 2ZU4A 1BMFD 2F9OA 1SBWA 1PPZA 2BXTH 4MVNA 5F8XA 3T28A 1MBMA 2BDYA 3A8BA 3ZV8A 3GY6A 3KNXA 1QRZA 4ABJA 4FU7A 3RDZA 1QBNA 5ESBA 2ILNA 4GHTA 1K28D 1OWIA 4MNYA 3U1IB 4AB8A 1TOCB 2ZGHA 1O2MA 1GJ4H 5F6MA 1MH0A 1KLIH 4O9VA 1E79D 3C1KA 1GJDB 1KIGH 1UVSH 4GCHF 2B0FA 3PYHA 1NRPH 4ZKSU 1OWJA 2ZO3H 4A92A 2C8WB 2FLBH 2YMSD 4U30A 4YOIA 4I8LA 1O2IA 2O8TA 1TIOA 3I29A 2BMGB 1GI9B 1MU8B 1J16A 1UTNA 3ZZCA 3U98H 4ZKNU 1ZOMA 1F0TA 1YP9A 3ZVGA 5LH8A 4LXBH 2Z9KA 4IC5A 1ZPZA 1N6XA 3PTBA 1Y5BT 1V2KT 4GAWA 1O2XA 1HV7A 1MZDA 1SGDE 2W7UA 1TFXA 4H4FA 1GI8B 3U8OH 2J34A 1DSTA 2ZDMA 4B74A 1O3LA 1ELCA 1TONA 1GJ9B 2TGDA 4DURA 4LZ4B 4I8JA 2H5DA 4CHAB 1BTXA 3O8DA 2VVVA 4Q63A 1GI6A 3QK1A 5EJZA 1HJAC 4H42U 5A2MH 1SLVB 3MNBA 2AEIH 3RXLA 5L6NH 4X1RU 1ESTA 1ID5H 2J38A 1GHBG 1CT4E 2Z9JA 1K1LA 2XYAA 3P6ZB 3FZZA 2QA9E 4JYVH 4BXSA 4X8UH 2QGRA 1W3CA 2WHXA 3AW0A 2Y7XA 1CGJE 1WYKA 2VIDA 2BX4A 2XNIA 1EP5A 1T32A 1AQ7A 3H5CB 1RXPA 1Z8RA 3EQ0H 1L1JA 4FVDA 1O2RA 1C5WB 1ZGVA 2PKSB 5C1UA 5EJLA 1PPBH 1O3CA 1S81A 3S9CA 5DP7A 3A88A 2G55A 2CMYA 1EP6A 3LGWA 5HMAA 3F2GA 2ZHWH 1GJAB 3OEED 1DY9A 8ESTE 2P95A 1GI3A 2V3MA 3E3TA 4IBLH 4I7YH 1IQNA 1SGNE 1FUJA 8GCHF 3SUGA 4A5TS 4AORA 1EPTC 4DG4A 1RD3B 1PQ7A 1GBIA 3TGKE 1EJMA 1UTQA 2VIOA 8KME2 2SGDE 1G2LA 2A7HA 3P92A 2C4FH 3ZZ4A 4ZHLU 3UTUH 1ZRKA 3LC3A 4D9QA 1TRMA 2A2XH 3Q3XA 2VGCC 1KXBA 1ZJDA 1HIAA 1GVZA 1A4WH 3A7YA 4TSFD 2NU3E 5IYTA 3SGAE 1C4Y2 4XFQA 2W7SA 1L4DA 2XBVA 1O3MA 1V2QT 1H8IH 3M7UA 2J2UA 4ZHAA 1FMGA 1VGCB 4NGAH 3QO6A 1BBRH 3RM0H 4HI3A 2QCYA 1UVUH 1TBZH 4K1TA 1V2LT 1VITH 3GYLB 3R3GB 2AGGX 2GT8A 3RXRA 1NU7B 2OUAA 3P95A 3DFLA 1DWCH 1VKYA 4JCNA 4RKJB 1E1RD 1ELFA 1SQAA 2QIQA 2VIQA 7GCHG 1EZXC 3CNRA 1GI4A 3UY9A 3B9FH 1Z71A 3STJA 1FAXA 1QRWA 1SGQE 1UTJA 2WV9A 3LPRA 5AHGH 1YLCA 2R3UA 2IJOB 4BAMB 5IDKA 5G4BA 3OE7D 2ZHQH 3R0FA 3RXTA 2ZGBH 1KDQA 3ODDA 5T3HA 1C5PA 1RTKA 5EXNA 3E0PB 2FIRH 2OC7A 5F53A 1O3AA 3F9FA 2EI7A 1AB9C 1YGCH 4D76A 4ISIH 4A1VA 4H6SB 3LGTA 1NBMD 2CF9H 2ZTYA 3S9AA 1AU8A 3BTHE 3I78A 4U01A 4NSVA 3SJ8A 1HJAB 4MDSA 2EA3A 3PRBA 4DGJA 4X1SU 1BTZA 1AY6H 3PM3A 1A5HA 3A8CA 4ACBA 3PROA 1U6QA 1OP8A 1XX9A 2HGTH 1S83A 4BTUB 5C5NA 2P3UB 4Y11E 3KYGA 2GCHG 1SG8B 3EAJA 3BIUH 2VB0A 1QJ1B 3A8DA 1GMCG 1ZPCA 1FY1A 1QIXB 3A7WA 2JJ2D 1P05A 1H8DH 1Z7KA 2XRCA 4E7NA 4X2WA 5ETXA 1TNKA 2IPQX 3TJVA 2H9EH 4K60A 1MUEB 3CS0A 5TCCA 2KCPA 1O2TA 1ELTA 3ZVCA 2O9QA 4B2BA 1MABB 3GICB 1BB0B 1QGFA 5FXLA 3B8JA 4VGCC 4IMQA 1E35B 2QXIA 1E1QD 1FDPA 3UNRA 2ZTZA 3SOSA 2VH6A 1EZUC 3NXPA 3M7QA 4OS7A 1YPLH 1C5QA 1O5DH 2SGPE 2XC5A 1CHOF 4Q4LA 3MNSA 4XBCA 3A82A 5AVDA 1EZQA 1AHTH 3BEUA 3E0NB 4IC6A 1OKXA 1QQ4A 1EPTB 1J9CH 3UWJH 1AWHB 1T8OA 1QA7A 3SORA 5KGOA 1DXWA 1B7XB 1Z6EA 5A8XA 1UK2A 1C2IA 1W7XH 3WW7A 4AGJA 2ZGCA 1O3DA 3AASA 1S5SA 1W2KH 1ZTJA 2GCTC 1Y5AT 2VGCB 1BBRE 4YLQH 2Y5FA 2A1DB 2D1JA 1SGFG 4K8YA 2QF3A 3TGJE 1MBQA 1THRH 1K22H 1GBTA 3LGVA 4AYVB 3SNDA 1CA0C 1MTUA 2VVUA 4XD7D 1YPGH 1AO5A 2XNDD 4UDWH 1ELEE 1FN6A 3T62A 5T6GA 1RTFB 4B2CA 1IAUA 4FU8A 1H9LB 3RXSA 3NWUA 1O2YA 1LHEH 4CRGA 2ZWLH 1EZSC 1TPPA 3S69A 3OSYA 1BTPA 1F5KU 2Q1JA 1SOTA 2ODQA 4AOQA 1NTPA 1O33A 2OCVB 3LIWA 9ESTA 1ZRBA 4Q7XA 4X1NU 1AVWA 2JIZD 2ZF0H 2A32A 1E36B 1TGNA 3NK8A 4MG3A 1AB9B 3E16B 4K1SA 2WPLS 2BDAA 1SMFE 2GT7A 1GHBF 3N99A 4JZ1A 3W94A 3SU5A 2NU2E 5JBTA 1PPCE 2PR3A 1TNHA 1C1QA 3GCNA 1C5RA 3A86A 3UQVA 1O5BB 1N8OC 4ABIA 1C5YB 1K1MA 1SQTA 3MNCA 3GY5A 2ANKH 1BMLA 2J97A 1D6WA 1TNGA 3F2HA 4WMFA 3TPIZ 3QLPH 2ZIQH 2AERH 3KYFA 3MH4A 1W0KD 4NIXA 2BYAX 3HPTB 2W5EA 4DT4A 2OLGA 1TGCA 1W7GH 1ZJKA 2KCAA 1TLDA 5DG6A 1GI1A 1PFXC 3K2UA 1MQ5A 1JXPA 2BDBA 1LO6A 4AN7A 1MKWK 1T31A 1F2SE 4YO9A 3S9BA 2BXUH 1GPZA 3VGCB 2ODYB 3U8TH 4FUHA 3MQKC 3RXGA 3SNCA 2IOTA 4B2AA 1C9PA 4NA7A 4VGCB 5BRRE 1C4U2 4FXGH 4UFEH 5DP3A 1V2UT 2V7QD 1Y3VA 4JYTA 4E7RG 5A09A 2NU1E 2TPIZ 3SU0A 1SFQB 1BBRK 3OX7U 1AZ8A 4NCYA 3EE7A 1AFEH 4HGCA 3SGBE 1P2KA 2LPRA 2UWLA 2F9UA 1P12E 3SU3A 2FWWA 3LH1A 5FCKA 3BV9B 2ZHDA 1E0FD 4JK5A 3TVJB 4CREA 1GCDA 4Y8XA 3UNSA 3AAUA 3U1JB 2GCTB 3RM2H 1RS0A 1MMJN 2K7XA 1YCPH 3Q3YA 3DD2H 3O8RA 1CBWC 1IQJA 2AH4X 1TNJA 3UFAA 4JZIA 1CA0B 3SV6A 1Q3XA 1OWHA 3PMJA 1HLTH 2B5TB 1TMBH 1MKXH 2QN5T 3TK5A 3DCLA 1EJAA 4NFEA 9LPRA 1O2WA 5C20A 1LVYA 4CH8B 1CGHA 3A7ZA 2DUCA 4AZ2B 3RXPA 1CVWH 2BLQA 3TJOA 1AVGH 2FI5E 1F7ZA 1Y8TA 2OQ5A 3GDSA 1VCWA 3Q77A 3L33A 1BTWA 3BSQA 3OY6U 2P8OC 1ELGA 3HK6B 1SGPE 4X1PU 4MQAA 1ANBA 1EX3A 1SLWB 3SN8A 1G3CA 1FNIA 1V2OT 3A89A 3UOUA 5J4QA 1TNLA 2BDHA 3DA9B 1GG6C 5GDSH 2ZDKA 5EXMA 1K1JA 1UO6A 1O35A 4ABGA 3FVFB 7KMEH 2K8IA 3MTYA 1YYY1 2RG3A 3TJNA 3P8OA 5AFYH 3LJJA 2HVYB 1Z6JH 1IQFA 2J9NA 1FQ3A 3M5LA 2A5AA 3W1EA 1NFYA 2V3HH 1QHRB 1N8OB 3DHKH 1O3FA 3OU0A 3UUZA 1HAPH 2P16A 4DY7B 4M7GA 1TMUH 2BX3A 1P2JA 3UR9A 2J4IA 4ZH8A 1G2MA 1JRTA 4O3UA 1HAVA 2HRVA 3UAIC 2J95A 3DSOA 3SJOA 1TABE 2CV3A 1KXEA 1AN1E 1O32A 2WYGA 3BEIB 3GISB 1N6YA 1EB1H 1UVTH 5JPMH 1GBHA 4AC9A 4Q2KA 1O2HA 1HPGA 2BZAA 4MPWA 5E0JA 1C9TA 1BT7A 4INHA 1F5LA 1BTHH 4YT7H 2GX4A 4HZHA 2G5VA 2PUXB 2EEKA 2RA0A 1D6RA 1A0HB 2BTCE 2VWOA 1L0ZA 1ZTKA 1F92A 2O8UA 2BD7A 1UHBA 5DP4A 1O34A 1KXCA 1O2OA 2DE8A 1FAKH 1GHVH 1DUAA 3BTFE 4Y79A 3EA9A 2GZ8A 4K2YA 3GCTF 2KAIA 3V13A 3ZIAD 4BOHA 3MMGA 4DIIH 4K8BA 4D9RA 3MHWU 1ABIH 1SQRA 1P8VC 1ANCA 5FX5A 1EJNA 1HFDA 3TNTA 5DP8A 2A31A 1LQDB 3ZZ5A 5EGMA 2WPKS 2QXJA 1C5NH 3VG8A 1CBWB 3D62A 1AI8H 2H1UA 1ACBE 1FIWA 4IN1A 3EYDA 3RU4D 5E0HA 2ZFTA 3P17H 3PWCA 1GJ7B 4XBBA 3HGPA 5A8ZA 1CHOG 1BHXB 1J17T 2QF4A 1H9IE 1DITH 1O5FH 2CN0H 4M9FA 2FS8A 7ESTE 3ZVBA 4ESTE 2QF5A 1C2MA 1QFKH 1PYTC 4RKOB 1BMAA 2GKVE 1YPHE 4HG6A 1O3JA 5EIYA 1PPHE 1HYLA 4UONA 1QCPA 3SYJA 2FOEA 1SVPA 1Z8GA 3UWIA 1VGCC 1EAIA 1F5RA 2BVXH 2P8OB 3LDXH 3Q00A 3W95A 3RU4E 3LJOA 2SNVA 3M35A 3GCHC 1UCYH 2ZU1A 2SGEE 4Y8YA 3TH4H 2BD4A 4YZUA 3KQDA 4ZUHA 3E8LA 1GG6B 1W11U 2XBYA 4WF8A 2JH0D 4FUJA 1DX5M 3LU9B 4MNWA 2BQWB 4FUDA 5EPNA 4B71A 4I32A 1O5AB 2L74A 3LGYA 3TK9A 1XXFA 1HRTH 2FLRH 1UW7A 1MZAA 4AX9H 1E37B 2VBCA 1T8MA 1HAYB 1GCTC 5FL7D 4AYYB 5JYIA 1BJUA 1K2I1 2BVSH 4ABBA 1FN8A 2EI6A 3DSGA 5DGJA 1LVBA 4JZDH 2BY5X 3OEHD 2YNBA 4GVUA 4NZQA 4P02A 3KN2A 1C1RA 1SGRE 1O2VA 2P3TB 2FOBA 5LPEA 3GY8A 2ZU3A 3MH7A 2OTVA 4X6PA 2L6OA 2O8MA 3H09A 4ZHMU 2UUJB 1C2HA 1V2TT 4NIVA 2W26A 3SV7A 4D8NA 5C67A 2F43B 4RN6A 1C5MD 1THSH 3A83A 4BANB 2P94A 1FPCH 1BITA 1SGCA 3D23A 1FJSA 1ZHRA 3FP7E 3FP8E 2KR7A 2AIQA 1Z1IA 1AKSA 1TNIA 3RC5A 4I8HA 1LPKB 1YCPK 4DIHH 3ZYEA 2AMPA 5LPRA 1GJBB 1NFWA 1M9UA 1P2NA 1H4WA 1UJ1A 3ZYDA 3EBNA 1A7SA 3F0OA 3RMOH 2ZCKP 2Z94A 3TH2H 1MD7A 2G5NA 1MKXK 1BZXE 1O5CB 1QNJA 2JETC 3KQCA 4UE7H 2ZI2H 1HJ9A 1OHHD 1CT0E 3K65B 4OS6A 2H9TH 2PTCE 1ARCA 4THNH 5CMXH 4TWYA 1C2KA 1O3GA 1O2LA 1FLEE 1RJXB 5EG4A 4CRAA 1C5LH 1P10A 2CXVA 4BTTB 1XVOA 3G01A 1C1MA 1BRAA 1XM1A 1O2KA 3F9GA 1T4VH 1FX0B 3FN8A 3HKIB 2ALPA 4FETA 3RLYH 2NU4E 1QL9A 1S6LA 3SZNA 4BAQB 2VWMA 5HXFA 1MKWH 3A80A 2JDID 2W6ID 3RXEA 3MU1A 5L2ZH 1MD8A 2B7DH 1GBKA 3F0PA 3E6PH 1KXAA 3GOVB 5EPYA 1SGYE 5DP9A 1D9IA 1YBWA 4ZKOU 2W3KA 1Q31A 5EJ1A 1T8NA 3PMAB 1GBAA 4JK6A 4X8VH 3D65E 2BY7X 5GWZA 1OOKB 2KCOA 4WVPE 1IHSH 1UCYE 5DO4H 2BD2A 3LGUA 3GCHB 3N7DA 1G9IE 5GCHF 3BTEE 1KTTB 4O3TA 1GGDC 2A2QH 1B0FA 4D7GA 5L30H 1RRKA 1XKBC 3MYWA 4ASHA 4X6OA 3EDXB 3SUFA 2JH5D 3M5NA 1UTKA 2QC2A 1ANDA 3URDA 2XCNA 2VJ1A 1BJVA 4IMZA 1EAWA 1HBTH 1GMHG 4YT6H 5C2ZA 1P03A 2HLDD 2OBOA 3RXCA 3ATLA 1ELAA 1GCTB 2BM2A 3K6ZA 4Z6AH 4BAOB 1SSXA 1MCTA 4ABHA 3KF2A 4F49A 1L1GA 4FUEA 6CHAC 1YF4A 1F0UA 1TX7A 1SGEE 4J1YA 3MU0A 2XW9A 4ABAA 4NZLA 4JZEH 5GPIB 1LKAA 1NM6A 2QF0A 5C17A 4NA9H 1DWEH 1O3NA 2PSYA 1GJ6A 2BDGA 1SLUB 3QX5H 1QTFA 1T8LA 1ZTLA 2C8ZB 2GTBA 2FOFA 3BTDE 4TT3D 2GD4B 1NFUA 1V2JT 2AIPA 3OYPA 3PV2A 4YM9A 1GVKB 1GI2A 2ZDVH 4Y6DA 1GI7B 4DJZB 1TRNA 5E2PA 1P9UA 2ALVA 2TGTA 1OS8A 1TQ7B 3URCA 1IQHA 3O8CA 1NBME 2EY4C 2FEQH 4GSOA 3TGIE 1YPKH 1XUGA 2WPMS 3Q3KA 1TB6H 3V3MA 4LOYH 5TCAA 1K21H 1EASA 2JETB 2ANYA 1DY8A 1SQOA 3VGCC 1C2DA 2ZFRH 3UB0A 3FOAA 4B6FA 1K0HA 1LVOA 4NWKA 3HK3B 1BA8B 3E91A 1MU6B 1CHGA 2QV1A 4Y0ZE 4CR9A 1ZMLA 4Y0YE 2FYRA 3BIVH 3SJKA 3ZVFA 3OAAD 1DUEA 3ZVEA 3GDUA 1UCYK 1P04A 3H7OA 5GXPA 1OP0A 4GUXA 3RXUA 1AWFH 1ZYOA 2BOKA 2Z9IA 1PPEE 5FHTA 2UWPA 1O3KA 4RSPA 2A0QB 2BY6X 4WXIA 1NFXA 2P3FH 4A1TA 1Z8IB 3SJIA 3QGJA 1P09A 2OD3B 2ZGJA 5HGGA 5AF9H 4WMEA 2M2AA 5KECA 1JWTA 1MAXA 1S82A 1XUJA 3GCTG 4CRCA 1NRQH 3QGNB 2A4RA 1O2ZA 1G36A 3CP7A 1O2SA 4YLUA 2STAE 1NT1A 4HFPB 1UTMA 2FODA 3MO9A 3QDZB 4ISNA 6LPRA 2R9PA 3NCLA 2AMDA 2AGIX 2XCFA 4R8TB 2FP7B 1TX6A 2G4UA 4Y8ZA 1GGDB 1K1NA 3M3SA 1Y3WA 2GV6A 4CR5A 2WPIS 5TJXA 1A0JA 1QQUA 1GHXH 5IK2D 1TBRH 2RA3A 3A81A 1H1BA 1P02A 4DT7B 1HAGE 4NWLA 4ZROA 1PPGE 2PGBB 2VIWA 2H5CA 1C1NA 1HAIH 4BXWA 1GJ8B 3VXEH 2WZQA 4K3JA 1BHXF 4DCDA 1N1LA 1RIWC 1JOUB 2OK5A 3SV2H 4AFUA 4AFZA 5C0UA 3RC4A 1SGTA 1YPHC 2BD8A 5HIYA 3GYMA 3ZVAA 2EQNA 2PW8H 3ATIA 4RT0A 1HGTH 5I46H 1WBGB 3HKJB 1W13U 3KHVA 5T6FA 1VZQH 2HOBA 2J98B 5JBBS 1C2JA 1OYQA 1SL3A 6CHAB 1QRXA 4NFFA 2TGAA 5LPFA 1WV7H 4CBOA 4FUFA 2ASUB 1D3TB 2ZP0H 3PV5A 3PWBA 5FX6A 3U28C 4AB9A 1L4ZA 1IHTH 5K0HA 3MFJA 1SGFA 4OS1A 3QN7A 1D3QB 4DVAU 2GDEH 2OQUA 2PP6A 3FP6E
chains in the Genus database with same CATH topology
4FVBA 3UIRA 4Z0KA 2G8TA 1AIXH 1ETSH 3F9HA 1TQ0B 3SQEE 3OTJE 1P2QA 1EOLA 1ORFA 4BNRA 3M7TA 2C8YB 3AAVA 1PJPA 1KYNA 2M5TA 2ZHEH 2PKAB 1KTSB 3QUMP 4NSYA 5K7RA 5FBIA 2FM2A 3M5MA 3S0NA 1C1UH 2B9LA 2QYIA 1EPTA 3ZZBA 3SHAH 1CT2E 1HJ8A 1NESE 3L6PA 2B8OH 3TJUA 3M36A 1QB1A 1THPB 3RXIA 2BHGA 4ABFA 1WTHD 3RXVA 3U9AH 1TAWA 1NY22 3P8NA 5GJ4B 1GBEA 1OWEA 1TA2A 1A3BH 4GLYA 2GGVB 4UD9H 3T5FH 1V2WT 1B0EA 1W10U 2F9VA 4O97A 1GBBA 3MO6A 1GBCA 1P0SH 2HNTE 1QB9A 2PGQB 1NC6A 4BTIB 1Y3UA 1GI0A 4CH2B 1TPOA 2O8WA 1SFIA 2FS9A 4JZFH 1INCA 3GDVA 4INKA 2FTLE 3BTQE 1GBDA 2ZFSA 3OY5U 5FPTA 2A7CA 1FY4A 3ZZAA 1LQEA 2R3YA 3LOXA 3P8FA 1OWKA 1YPMH 2Y6TA 1RTLA 5HM9A 4IGDA 1YC0A 2FOMB 1MTVA 1P3EA 1V6DA 1HUTH 1YKTA 4DOQA 2BD9A 1NROH 3QZQA 1FI8A 1TGSZ 5F8TA 2ZQ1A 4B73A 1GMHF 3ZV9A 2ZU5A 2G52A 3SV9A 5EOKA 1ESAA 1P06A 4FUBA 1C5SA 3MU4A 3U8RH 2HVXA 3QTVH 1MTSA 4TPYA 1RIWB 2KAIB 3BTWE 1Y3YA 3SI4H 4TPIZ 1V2RT 1DXPA 5J4SA 1GL0E 1SLXB 2FZZA 1GBFA 4WWYA 5E0GA 3BF6H 1VJAU 1GBMA 1K9OE 1WQVH 4XDEA 1O3EA 1BTUA 1HCGA 4X8TH 1GWAA 1XKAC 1P11E 1KY9A 3RC6A 5GCHG 3SNBA 2G00A 4XE4A 4A6LA 4FUCA 2IN2A 3ELAH 1UK3A 1ETTH 1VCQA 4UFGH 1WTGH 2STBE 4XOJA 4ZKRU 4DW2U 3ITIA 4JYUH 4YESB 1VITF 4JMYA 1AZZA 3PLBA 3A85A 1GVLA 1BQYA 2VVCA 3UPEA 2FX4A 3SU1A 2J94A 2ZCHP 3MH5A 3F68H 1O2UA 1K1OA 2VWNA 2Q6DA 1G32B 1MCVA 3PLPA 4UFFH 3ATWA 1NZQH 1MQ6A 2BQ7B 4PROA 4X0WU 5L2YH 1O39A 2YOLA 2BVRH 2F83A 5FPSA 1O3IA 1TGTA 4I33A 1K1IA 2G4TA 1CA8B 1DSUA 3PMBB 1KLJH 2W3IA 4J2YB 4B75A 2OC0A 3SNAA 3TNSA 3ZZ6A 2FDAA 2WV4A 3WY8A 6ESTA 3M37A 2Y5HA 1NN6A 3GY3A 1CU1A 1CO7E 2D26C 1GL1A 4WXVA 3SV8A 3ATKA 1TMTH 5B6OA 1DICA 3ENSB 4BAKB 3FZDA 3SO3A 1W8BH 3VFEA 1KLTA 2I6SA 4B1TA 4TY6A 1UTPA 2K1QA 3LC5A 2VIVA 1ETRH 2GV7A 4Y10E 2AMQA 3C27B 1DM4B 4CRFA 3VB7A 3EE0B 1PQ8A 2R0LA 2VU8E 4KTUA 1TGBA 3LKWA 2ZKSA 5A8YA 1LPZB 1O5GH 4U2WA 2BY9X 1UVPA 3CENA 5C1XA 3GY4A 3S7HB 3UNQA 4K1EA 3H7TA 1BRCE 3DT0H 3ZZ9A 1C1VH 4GPGA 3QWCH 5ABWA 3BEFB 3MU8A 1CGIE 5JB8S 1QY6A 1XUKA 5HYOA 1O3HA 1UVOA 4X6NA 4X2XA 1A3EH 3SU2A 3NUMA 3EA8A 2SGFE 3LH3A 1AFQC 2DE9A 4OS4A 4E05H 2C8XB 4IS5A 1C1WH 3K9XB 2XWBI 2Y80A 4CRDA 1IQEA 1EATA 1P57B 4TY7A 2FOGA 5DP5A 2AGEX 1XUFA 4R0IA 3BN9A 4OGYA 3SGQE 2GMTC 4KELA 1PQAA 2FESH 1EKBB 3GCOA 4UFDH 3VEQB 2PFEA 1TBQH 1NRNH 2VH0A 1AMHA 3A7XA 4LK4A 4OGXA 1HAOH 1LVMA 1QJ7B 2JH6D 1GJCB 4TYDA 4Q7YA 1RFNA 5JDUB 3BG4C 4MTBA 2FX6A 2Q6GA 3HGNA 1IOEA 1HIAB 4O03A 4NIWA 2UUFB 3STIA 2Q6FA 3SUEA 5CHAC 1P9SA 2TRMA 1MTNC 3MOCA 2QXHA 3SI3H 1O37A 3KQBA 2A4OA 2ZTXA 4X6MA 2BZ6H 5HM2A 3GY2A 2LIZA 4A7IB 5EW2H 5FBEA 2GVFA 3AVZA 3ATMA 3F1SB 5DJ7A 4XBDA 2FO9A 1L2EA 1FXYA 1LHFH 3SU4A 3I77A 2V0BA 1YPJH 1DANH 2XBWA 1UTOA 1ZHMA 1AE8H 1GBJA 1E38B 1C1TA 2F9BH 1G37A 1O3PB 1O2GH 5EW1H 1GMDG 2JKHA 3O8BA 4I8GA 3RXMA 3ZZDA 4K5ZA 1CSOE 2C90B 3RMMH 2QXGA 4Y7BA 1KXDA 1JIRA 1KDQB 1OXGA 2XXLA 2F3CE 1GJ5H 2PUQH 1FY8E 1SHHB 3KEEA 2A5KA 2TBSA 1W12U 4WH6A 1C2GA 1LMWB 1NPMA 5JB9S 2LNCA 3MWIU 1WAYB 5DPAA 2ZFPH 1O31A 3UQOA 1IQKA 2PHBA 3VB6A 3ODFA 2QY0B 1CQQA 1Y5UT 2WYJA 3IITA 1IQLA 1GHAF 1FPHH 1XXDA 1AVXA 3RXHA 1C5ZB 1BMNH 4YTAA 4LZ1H 1G3BA 1YM0A 2ANMH 2P59A 1BRBE 2QAAA 1W0ZU 2C93B 3KQEA 1QURH 1GHYH 1P2IA 2ZZUH 4MPXA 5GIBA 2ZDLA 1W14U 1BDAA 2XC0A 5PTPA 1C5OH 1LDTT 1FONA 3FFGA 1BCUH 1HAXB 2HNTC 3BTTE 1FZZA 1NRSH 1SHYA 1HNEE 1VCPA 2XBXA 1AFQB 1S6HA 2CJIA 2TGPZ 3SBKA 4IN2A 2OBQA 1JMOH 3ZZ7A 4IW4E 3ZZ8A 1C5TA 2UWOA 4OS2A 4BAHB 1NS3A 1EUFA 3NKKA 3E1XB 1LCYA 5EU8A 3RP2A 1WCZA 4Y7AA 3CS7A 1TPSA 3SU6A 1QR3E 4AGKA 5A0CA 2GMTB 2ZA5A 2GZ7A 1ZMJA 3T26A 3RXQA 1BRUP 1EAXA 3A7VA 4KKDA 2PTNA 1F0SA 2FOAA 3PO1C 3LT3A 5F8ZA 1HXEH 2ZPSA 2SFAA 1ZHPA 3V12A 3QZRA 1ZLRA 2SGQE 1TYNA 2Z3CA 4TWWA 3BG4B 3RXBA 6GCHG 1EOJA 3TH3H 5JBAS 4Y76A 4D7FA 1OP2A 2ULLA 2ZDAH 1S0RA 5C3NA 1TWXB 3RUOA 1KSNA 4Y71A 2HPPH 5CHAB 3MU5A 1MTNB 2WUCA 4INLA 2EC9H 1C1OA 1O2JA 1AD8H 2FOHA 4AFQA 4KGAA 4MPUA 2ODPA 2XTTB 3FANA 2ZC9H 1V2PT 3P8GA 5ESTE 2WPHS 1C2LA 3K6YA 1DFPA 3ZZ3A 2HALA 1P2MA 1OPHB 2BD3A 1ABJH 1H9HE 3AW1A 1VITG 1O36A 4X2VA 1WSSH 2SGAA 4AFSA 1NRRH 4ISLA 4ABEA 1DLKB 1WU1A 2OC1A 4CRBA 1LTOA 2NWNA 1DWDH 2UUKB 3TU7H 2UUYA 1MAYA 2THFB 1O3BA 3SQHE 5DP6A 1V3XA 1C5XB 1T4UH 4I8KA 1TPAE 2R2WU 4HTCH 3UOPA 2VINA 1UK4A 1A46H 3U69H 1DWBH 2FI4E 1RGQA 3VB3A 1ARBA 5SGAE 2O8LA 3ESTA 1HAHH 1P3CA 1PYTD 2VIPA 1ANEA 2Z9GA 5AFZH 1Z1JA 1S84A 3GY7A 5T6DA 1ZPBA 1VJ9U 1BMMH 2BOHB 2V6NA 2ZG0H 1O2QA 5EQQA 1OX1A 3T25A 3RXJA 4WH8A 2GDDA 4MNVA 4MPVA 4B76A 2I6QA 1SC8U 2XWAA 1SR5C 1BTYA 1FIZA 2BLWA 1V2VT 1QB6A 2SNWA 4FUIA 2ZECA 1PPFE 4KTCA 1O0DH 2OINA 1K1PA 3ZVDA 3RMNH 2A45B 1T7CA 3VB5A 2IPHA 5F03A 3M61U 4I31A 3D49H 1BOQA 3V7TA 1C5VA 1E34B 1JBUH 1SI5H 1ZSLA 2HLCA 4AG2A 2Z7FE 2FYQA 2ZPRA 1A5GH 1XUHA 1NO9H 2ZFQH 1O3OA 1G30B 1Q2WA 3EA7A 1GHZA 4KTSA 2Y5GA 1LKBA 4X2YA 1A2CH 5H4IB 1UMAH 1LHCH 3RXFA 1LPGB 3A87A 1V2MT 4UEHH 2VNTA 3RXAA 3PO1B 1D4PB 3IG6B 3NPSA 2Z3DA 4ZAEA 3SNEA 2VWLA 2C3SA 2TIOA 2A5IA 4ABDA 1ZSJA 3TIUA 3V0XA 1W0YH 5FPYA 1BUIA 2G51A 3RXOA 1OWDA 2YNAA 3P70B 1BIOA 1DLEA 5C1YA 1IQGA 1WUNH 2BY8X 2WUBA 2OXSA 2BQ6B 1GMDF 1IQMA 2GP9B 2Z9LA 3FAOA 1TX8A 1HXFH 1J8AA 1ZSKA 5EQSA 2D8WA 5DK1A 2NU0E 1QA0A 2G81E 4XSKU 1XMNB 2PSXA 3LGIA 3M3TA 1ELDE 3M5OA 1OYTH 1SGIB 4GCHG 2F91A 4CBNA 2BB4A 3EGKH 1P2OA 3JZ1B 2Y7ZA 4WMDA 3M3VA 3SJ9A 1EXFA 5E2OA 4ZXYH 1JRSA 1QBOA 2Y81A 2V35A 4SGBE 3MI4A 1GDUA 2ZCLP 3BTKE 1G3EA 3RU4T 5A0AE 2BDIA 2RCEA 4ZMAH 1O5EH 1O2PA 1MTWA 1A1RA 1C1SA 1S6FA 4WJG2 1ELVA 1YPEH 4FU9A 3VXFH 1LHDH 5A0BA 3PTNA 2A7JA 3T27A 8LPRA 5CE1A 1DE7H 2OP9A 1C2FA 3BTGE 3RXDA 1AUJA 3TITA 5C5OA 1QBVH 1HAVB 4OS5A 1DOJA 2CF8H 2F9NA 4A1XA 2P93A 2R0KA 3E90B 1DDJA 4FUGA 2F9PA 2EI8A 2ZDNA 2RDLA 1TA6A 3MH6A 3TK6A 4ISHH 1GHAG 2H2ZA 1KXFA 3BTME 1TE0A 1NU9A 1EQ9A 1TRYA 3N7OA 4E06H 2D2DA 2ESTE 1A5IA 1GDQA 4WY3A 1UHBB 1V2NT 2FI3E 3T2NA 1TOMH 1DS2E 4K69A 6GCHF 4NIYA 2ZEBA 2BDCA 1S85A 1P01A 2CHAC 5FCRA 3IWMA 1DT2A 3LONA 7GCHF 2FTMA 1PQ5A 3A84A 3S7KB 8GCHG 3UR6A 1ZR0A 1VR1H 2AFQB 1YCPM 2ZPQA 3DFJA 3SW2B 1LHGH 1X7AC 1AGJA 4YOGA 4X1QU 2FPZA 1OSSA 1Y59T 1O38A 2PKAA 4AG1A 1DPOA 2AS9A 1C5UA 1V2ST 3TLOA 1GDNA 5EXLA 1ZGIA 3DUXH 1CE5A 1FY3A 4SGAE 3Q76A 4YOJA 2ZFFH 1O2NA 1SOZA 3RLWH 5LGOA 2WINI 1A0LA 1O30A 2V3OH 1AE5A 1C2EA 1D3DB 3PB1E 1WQSA 5BPEA 4KP0A 1Z8JB 1ZMNA 2FMJA 5FAHA 1Y3XA 1ZZZA 4Q80A 3A8AA 2BLVA 1TALA 3QTOH 4QT8C 3KCGH 2GCHF 1GBLA 1C4V2 3A7TA 1HDTH 7LPRA 1GMCF 1SPJA 1QJ6B 1F0RA 4H6TA 3KGPA 2HPQH 2A4GA 1SB1H 2ZQ2A 4Q7ZA 1GHWH 3B23B 2OC8A 4CHAC 3HATH 4GHQA 3RMLH 2ANWA 1EAUA 1AUTC 2WPJS 4MNXA 1YLDA 3MNXA 2BD5A 2ZU2A 1L1NA 3L3TA 2H9HA 2GZ9A 2Y82A 5DKMA 1ELBA 2J92A 5I25A 1XUIA 2ZNKH 3MO3A 2FXRA 1WOFA 1C1PA 5EODA 1IQIA 4F4OC 3F6UH 2R2MB 3PMHB 1JIMA 2HWLB 2WV5A 2PLXA 1GI5A 4U32A 2ZHFH 2ZGXH 1UTLM 1G3DA 3F9EA 3PV4A 2BLOA 2FOCA 2PKSC 1AKSB 1QL7A 2Z3EA 1DVAH 4X8SH 5JBCS 3SHCH 3T29A 3KL6A 1FV9A 2CGAA 1QL8A 2XC4A 2Z6BD 3SUDA 3VPKA 1HB0B 1S0QA 5EQRA 3UREA 2PWXA 3KIDU 1J14A 1HAZB 1J15A 3JZ2B 2AYWA 3RXKA 1XVMA 4NA8A 2PV9B 4MLFB 3NZIA 1EB2A 4ZXXH 2H6MA 1B5GH 2CHAB 1FY5A 1D3PB 2HNTF 3PLKA 1ESBA 2A4QA 4NG9H 3VB4A 4ISOA 5E8EH 1A61H 3BG8A 2ZU4A 2F9OA 1SBWA 1PPZA 2BXTH 4MVNA 5F8XA 3T28A 1MBMA 2BDYA 3A8BA 3ZV8A 3GY6A 3KNXA 1QRZA 4ABJA 4FU7A 3RDZA 1QBNA 5ESBA 2ILNA 4GHTA 1K28D 1OWIA 4MNYA 3U1IB 4AB8A 1TOCB 2ZGHA 1O2MA 1GJ4H 5F6MA 1MH0A 1KLIH 4O9VA 3C1KA 1GJDB 1KIGH 1UVSH 4GCHF 2B0FA 3PYHA 1NRPH 4ZKSU 1OWJA 2ZO3H 4A92A 2C8WB 2FLBH 4U30A 4YOIA 4I8LA 1O2IA 2O8TA 1TIOA 3I29A 2BMGB 1GI9B 1MU8B 1J16A 1UTNA 3ZZCA 3U98H 4ZKNU 1ZOMA 1F0TA 1YP9A 3ZVGA 5LH8A 4LXBH 2Z9KA 4IC5A 1ZPZA 1N6XA 3PTBA 1Y5BT 1V2KT 4GAWA 1O2XA 1HV7A 1MZDA 1SGDE 2W7UA 1TFXA 4H4FA 1GI8B 3U8OH 2J34A 1DSTA 2ZDMA 4B74A 1O3LA 1ELCA 1TONA 1GJ9B 2TGDA 4DURA 4LZ4B 4I8JA 2H5DA 4CHAB 1BTXA 3O8DA 2VVVA 1GI6A 3QK1A 1HJAC 4H42U 5A2MH 1SLVB 3MNBA 2AEIH 3RXLA 5L6NH 4X1RU 1ESTA 1ID5H 2J38A 1GHBG 1CT4E 2Z9JA 1K1LA 2XYAA 3P6ZB 3FZZA 2QA9E 4JYVH 4BXSA