3UY9A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A02
2EA3A 2GV7A 4NIXA 3PLBA 1NU9A 2PKSC 2QA9E 1P9UA 3QTOH 3BTGE 2V0BA 2WYJA 1SMFE 3E0NB 5DP6A 1B0FA 2Z9LA 2ZGHA 1SGQE 2VWOA 4BAQB 3MO9A 4CRBA 3V0XA 4B2CA 1TNJA 1CT0E 1MH0A 2BVRH 2QCYA 3OY6U 3QO6A 3ZZ6A 4CR9A 3OU0A 3KN2A 4JK6A 1A0HB 3RDZA 2SFAA 3RM0H 1AO5A 4Y11E 1CA8B 3AAVA 3MH6A 3P8GA 2BDIA 4BNRA 2GT7A 1O2XA 2ODYB 1GGDB 2BD7A 1WOFA 2WPMS 3U8OH 1O3BA 2FDAA 3GCNA 4JMYA 1D6RA 1KIGH 4ZROA 2XWAA 3K65B 3BTME 3SU0A 1G30B 3V13A 1C5PA 1HGTH 1O35A 4FUEA 1W11U 1K1OA 2H9HA 3VXFH 1DWBH 4BXWA 3BTTE 4JYVH 1PQ7A 1HAOH 3UY9A 4D8NA 3RXJA 1OS8A 3SJ8A 1LMWB 1J15A 4NGAH 2XRCA 1EB2A 2BLOA 1ESTA 1NO9H 2YNAA 2VIDA 2EI6A 1PYTC 4VGCC 2ZTYA 4RKOB 1ETRH 4YOGA 4J2YB 4BTTB 1XMNB 3HK3B 2FWWA 1TLDA 1JRTA 4MPVA 1NFXA 1EKBB 1TMTH 2ZPSA 1AZZA 1ZHMA 1Z6EA 2M5TA 1AIXH 1MTWA 5C5NA 1KLTA 5I46H 3LC5A 1SFIA 1L1JA 1IQFA 2VWMA 3D62A 1UCYH 4AOQA 1GBBA 1K1NA 3BTDE 3I78A 2FI5E 2VIWA 1GBFA 1OP2A 2ZTXA 1KXEA 4GSOA 4THNH 4DGJA 4F49A 4KGAA 4WF8A 1GI8B 4NZQA 3U69H 2AYWA 1O2QA 1O2YA 1SG8B 1MD8A 1Y3UA 4B2BA 4DG4A 2C93B 3VGCC 4I31A 3QWCH 3KQBA 1XUGA 1EPTC 1CHOF 1IQNA 1O2JA 1KTTB 1AHTH 1S6FA 4KTCA 4FUDA 3U1JB 2THFB 2RDLA 1C1SA 1AE5A 1GHBF 1TWXB 1HAGE 4INLA 4X1NU 3TK9A 1T8MA 2H9TH 3K6YA 1OPHB 1J17T 1F5LA 1W7XH 3PMBB 3H7TA 1TQ7B 7LPRA 5JB9S 1P2MA 3KIDU 1ZSLA 3ZZ3A 4E7NA 4XSKU 3A89A 1K28D 1HNEE 1SI5H 3GCTF 4B76A 1PPGE 2A0QB 1UK2A 2GDEH 4A1XA 2OC1A 3WY8A 2TPIZ 1DLKB 1UMAH 4GCHF 1YP9A 3TH4H 1W2KH 3TJNA 1QHRB 4O9VA 5GDSH 3ATLA 1BITA 3TH3H 2CV3A 2PFEA 2GZ7A 2F9VA 3OTJE 3SJIA 4I33A 4KP0A 1FJSA 1JIMA 1GJ4H 2ASUB 2G81E 3P6ZB 1ZHPA 3NZIA 5A0AE 1BRUP 1SL3A 1GCTB 1THRH 2ZEBA 3SU4A 2XBWA 3TPIZ 2BD4A 2DUCA 2GX4A 3TNSA 1GVLA 1TALA 1DDJA 2ZA5A 3P8FA 2AH4X 5EXMA 1LPGB 4DCDA 3GY7A 1DXPA 2IOTA 5EQQA 3MMGA 1NRNH 1O3GA 1KLIH 3LGUA 4ISIH 4SGBE 5EXNA 1BA8B 1BTYA 1GDUA 1DITH 2PKAA 3GOVB 2FOAA 1LQDB 4Y8ZA 5JYIA 3FP7E 5A8YA 1VGCC 1VITF 4AFZA 1MMJN 3JZ1B 4GVUA 3DT0H 4U2WA 4Y10E 3BIVH 2VH6A 4YZUA 5B6OA 3SNAA 1T4VH 3AW0A 1YPHE 1LHGH 1XUFA 2FESH 6CHAC 2ZU4A 1V2OT 3A83A 1K2I1 1FY4A 1PQ5A 2VJ1A 3HPTB 3KQEA 1GI0A 3UFAA 3MTYA 5DP7A 3OX7U 4IMZA 2UUYA 4JCNA 2BZAA 2QXJA 1DOJA 5DPAA 2Z3CA 1BBRE 1CVWH 4MNXA 2AFQB 1VCQA 1KXDA 2CHAB 3BEIB 4J1YA 1MQ5A 1EZSC 1YCPH 3LGWA 1V3XA 3VB6A 1DSUA 1CT2E 2NU0E 2UUJB 1UK3A 3RXLA 3FZZA 1TABE 3D23A 3SO3A 3SUFA 3SHAH 3E6PH 1K1MA 4FU9A 3GDVA 1Y3YA 4OS1A 2QY0B 3RMMH 1GI2A 1PPCE 2H2ZA 3BEUA 3KF2A 4X8SH 1YPEH 2CF9H 1ACBE 4ZKSU 1C1OA 1RRKA 1XKBC 1G3DA 1SC8U 3GCHB 3V12A 2VVVA 3GY8A 1TPAE 1UTMA 1ETSH 2VWNA 3QTVH 1G36A 2UWLA 4U01A 3E0PB 2HNTE 2BVXH 2ZECA 1CA0B 3A85A 1G3EA 2O8LA 2G4UA 2GZ8A 3S9BA 4XBCA 1P2KA 2FOBA 1ANBA 3ATMA 3TU7H 1CGJE 4WVPE 3A86A 3ITIA 1EQ9A 5L2ZH 2DE9A 1TPPA 1L1NA 3OY5U 1BHXB 2A4QA 2V3OH 1K21H 1DLEA 2HRVA 1TNKA 1P02A 3O8BA 4Y0ZE 2Y5GA 5HM9A 2ZU5A 1DWDH 3BG8A 4B75A 1GBJA 4UONA 2OBQA 2NWNA 6CHAB 3VB3A 2J34A 5L2YH 3M5NA 3UOPA 1MBMA 1C5LH 1O34A 3NCLA 3S0NA 3SV7A 1AB9B 1O3IA 1XXDA 4GAWA 3SUEA 5JBTA 4NIVA 3TIUA 4K1EA 4OGXA 3MNSA 5TCCA 1AI8H 1O5FH 1W0ZU 2P95A 1DY9A 1KSNA 2UWOA 2HPPH 3D49H 3E1XB 1P9SA 3GY4A 4DW2U 1C2MA 4YT7H 1AQ7A 1O2UA 3RXUA 1OSSA 1FIZA 3FFGA 1S0QA 1DY8A 1E36B 1MTSA 3NWUA 5G4BA 1F0TA 2ZFTA 3LOXA 3SJOA 2SNVA 1MCTA 2ZIQH 3PO1C 1O2PA 3URCA 1G2LA 4DOQA 2ZTZA 3O8RA 2BDHA 1C5YB 1HAVA 3LIWA 1JXPA 2PHBA 5LPRA 3MU4A 1J14A 3U8TH 3UOUA 1SGYE 3PV4A 1F0RA 3M7QA 3H7OA 3S7KB 1V2VT 3T26A 3RLYH 1O3FA 4ABAA 2BLQA 1Y3XA 1O31A 4FUGA 3JZ2B 3KGPA 2VIOA 1C2DA 4ESTE 3E3TA 2C8ZB 1BBRK 1K1IA 1KXAA 3RXMA 1O2KA 2F9BH 4DJZB 1KDQA 2A5KA 3DFLA 4Y76A 2BB4A 4Q80A 1WTHD 1ZPZA 1FY5A 1V2RT 4VGCB 2Y5HA 4K1TA 3W95A 3TGKE 1FI8A 2Y5FA 1HBTH 2EI7A 6GCHG 2CN0H 1T7CA 1NROH 2G8TA 2OQUA 2VIQA 1BT7A 1KYNA 5FBEA 1HLTH 5DP3A 2KAIB 2VIVA 1ZPBA 3RU4D 3EA9A 1B0EA 1HDTH 1O2NA 2R2WU 1UTJA 1JRSA 2BQ6B 1OWHA 1O2TA 1D3QB 1V2QT 4B74A 2AERH 1V2TT 1W8BH 3A7WA 3P17H 1T4UH 1GWAA 4X2XA 4D9QA 4GUXA 2BM2A 1PPFE 1GCTC 4TY6A 1O5DH 3NK8A 3TLOA 2GCHG 1GHYH 1AUTC 2GT8A 4X2WA 2OP9A 3SU3A 5FPYA 3KCGH 4RN6A 3B9FH 3OYPA 1Y8TA 1DFPA 2ZGBH 3I29A 2J4IA 1Z8RA 3M3TA 1RTFB 3LGVA 5GCHF 3QGJA 3T29A 2CHAC 3SV8A 1Z8IB 1AKSB 1Z8GA 2BOHB 1W7GH 2B7DH 2D26C 4XE4A 1HJ9A 3Q77A 4Y7AA 1Q31A 2PW8H 1O3JA 1O38A 3A81A 4FUJA 3SU6A 1HJAB 1GMDF 1ZLRA 3GCOA 2NU3E 3IG6B 7GCHF 2P59A 3RC4A 5GIBA 1ZSKA 1IQHA 1WBGB 3QK1A 3SU2A 1SQAA 1NFWA 3S9AA 1LVYA 1UK4A 4O03A 1QQUA 2A7CA 3PROA 1TA6A 2TGTA 1ZTLA 3MNXA 1AZ8A 1C1WH 4IW4E 4AB9A 1F92A 1QGFA 5EXLA 1HJ8A 2QAAA 4H42U 1TB6H 2GKVE 4ISNA 4BAHB 3RUOA 3GICB 3O8DA 3RXVA 3Q3KA 3LKWA 2VGCC 1GPZA 3BTHE 4SGAE 1TAWA 4BANB 4K60A 1S85A 1LQEA 3ELAH 4NG9H 5FX6A 1QBOA 1BRCE 1UVPA 1DXWA 4UE7H 4RSPA 1O3DA 3RC6A 2V3HH 3RXIA 1C2FA 1P06A 4R0IA 2ALPA 1TX7A 2XYAA 2Y7ZA 1FDPA 1HAHH 2F9NA 5A0CA 4IMQA 5AFZH 2R9PA 5T6GA 1LHFH 2PV9B 1MUEB 2ANMH 3RXSA 1O37A 3FAOA 5C1XA 3L3TA 4GHQA 3A8AA 3UQOA 2C8WB 1EJMA 2XCFA 3PLPA 2JETC 2ALVA 1C4U2 2FPZA 2R2MB 4AFQA 2RG3A 1QR3E 3M37A 4IBLH 4NSYA 4GPGA 4UFGH 1HIAB 2I6QA 1ORFA 2Z94A 1C5QA 1C5RA 4HZHA 3FZDA 3T28A 1XUJA 2ZDLA 2BY9X 4OS5A 3VB4A 4K8YA 4MTBA 1ELEE 2FEQH 1TMBH 1QA0A 4D7GA 3BTFE 3KL6A 3LDXH 1OWEA 4OS2A 5A8XA 1A46H 4ZKRU 4UD9H 2HNTC 2JH5D 1H9LB 1XUKA 4DURA 2FX4A 1T8NA 1SGRE 4GCHG 1S84A 1E0FD 1F2SE 1NPMA 3SW2B 1GMHF 4YTAA 1O3KA 2A5AA 5EW1H 2G5NA 3EYDA 4FUHA 5E2PA 3SJ9A 4ISOA 4I8JA 2V35A 1DWCH 1N6YA 1O2LA 1P11E 1QB1A 3UPEA 3SV2H 2WV5A 3RP2A 2VVCA 1A3EH 1GJCB 2ZHQH 2Z9IA 3PLKA 2Z9JA 1O33A 1F5KU 1IQLA 2FOMB 2J95A 1IQJA 1YCPK 4TYDA 1TOMH 1NN6A 1Z71A 1QQ4A 2AMPA 1M9UA 1RTKA 1RJXB 3A8BA 3PMHB 1ZGVA 1CHOG 1EP5A 1HAIH 1UVOA 4X6PA 1EPTA 3A87A 1EX3A 1C9PA 5DP9A 3HKJB 1SB1H 1WQSA 1MTUA 4A5TS 4AYVB 1ABIH 3LC3A 3RXOA 2FIRH 1OKXA 4I8GA 2PSXA 3ZZ7A 4UFFH 1EP6A 3AW1A 2XW9A 2FI4E 1VZQH 2W5EA 5LH8A 1AFQB 4JZIA 4AN7A 1WU1A 1QFKH 4WMDA 3RC5A 2QXGA 3IWMA 4XDEA 4AG2A 1N8OC 1JWTA 2Z3EA 4ZH8A 1S5SA 1OP0A 1MKXK 1L2EA 3CENA 1HAYB 4LZ4B 1A5IA 1T8LA 5JBBS 2R0KA 1F7ZA 3ATIA 5E8EH 3SJKA 3SV6A 4AG1A 1A61H 1HJAC 1NESE 1YPGH 2G00A 4MLFB 9ESTA 4K1SA 3ESTA 3DFJA 4AORA 2Q6FA 1MTNB 1GVZA 1A1RA 2F9OA 1D4PB 1ZHRA 5E0HA 2ANYA 5ESBA 5C5OA 1D9IA 3RXRA 1UVTH 4NA7A 1A4WH 1ZSJA 1C5MD 1PYTD 2ZDNA 4Q7YA 1XUIA 4R8TB 5K7RA 2ZQ2A 2QC2A 1K1LA 2Z6BD 4MDSA 4ASHA 3ZYEA 3BN9A 2FYRA 5T3HA 5A0BA 1V2LT 3CP7A 1UVSH 2AIPA 1B7XB 3TK6A 1GDNA 3SGBE 1RFNA 1O2IA 2R3UA 4I8HA 4E05H 5PTPA 1CHGA 5LPFA 2SGAA 5DJ7A 1P2JA 1QL8A 1XXFA 1GGDC 2BX4A 3PYHA 4FUFA 1C5VA 2RA3A 1T32A 2XBVA 4JZDH 4NIWA 2WPIS 1TRNA 3B8JA 4XBBA 2ZFPH 2B8OH 1QJ1B 3ZZ5A 4A6LA 2ZC9H 2AMDA 4RKJB 1V2NT 4Y0YE 4CRFA 1YC0A 3GCTG 2P8OC 1TBRH 1MD7A 3F9GA 2XC0A 5FBIA 3S7HB 3TGIE 1INCA 4YO9A 3GYMA 3MWIU 3ZVEA 1LCYA 5EPYA 4WJG2 1GI3A 4A1TA 5AFYH 1K9OE 2BY7X 3SGQE 1ZMJA 2WPLS 1O3PB 3A88A 4CRAA 5GWZA 1PJPA 4UFDH 3QUMP 1ELVA 1P2QA 5F6MA 3FANA 1EZUC 2H5CA 2WINI 2A4GA 1CT4E 2GGVB 2UWPA 3RLWH 2I6SA 1GBEA 3UUZA 1AFEH 2ZFQH 1V2MT 3LONA 3SI3H 5EGMA 1Y59T 1AWHB 1UTPA 2XC4A 1A2CH 1O3CA 4JYUH 4U32A 1N6XA 1DT2A 4Q7XA 1S6HA 3K6ZA 1VJAU 1QJ7B 1SR5C 2BLWA 2PWXA 3SBKA 1GHBG 4CRDA 5JB8S 1RXPA 2FYQA 1CBWC 3MOCA 1SOTA 2B5TB 4I8LA 4OGYA 3VXEH 4Y7BA 1SGCA 1E38B 1D6WA 4Z0KA 5GPIB 2AIQA 2WYGA 1TNIA 4LXBH 2VINA 3V3MA 2NU1E 1TGBA 1C1NA 2C4FH 4KTSA 4E06H 5A09A 1PPHE 1P2NA 2XBYA 3BEFB 3ZV9A 2C3SA 2OC8A 2GDDA 3R3GB 4AX9H 4Q7ZA 1DWEH 5HGGA 1H9IE 4YOJA 1G9IE 1NM6A 6GCHF 1BTUA 1TRMA 1BRBE 5GXPA 3S69A 3EA7A 1GMCF 3PMAB 1FAKH 1DANH 1NT1A 1NRRH 1C2GA 1HV7A 3C1KA 1CQQA 2D8WA 2J38A 4K8BA 1GL0E 3GYLB 1SQTA 3LJJA 1P03A 1MAXA 1GI7B 3RMNH 2VB0A 1GHVH 3P8NA 1GJDB 1OXGA 1BTPA 2ZHEH 1EJAA 2SGQE 1O2SA 3KQDA 3RU4T 5FAHA 1SBWA 3MFJA 2P3UB 5EOKA 4UFEH 3SHCH 3ZZBA 1UTOA 1HAXB 4FUBA 3RXKA 3AAUA 3RMLH 3SQEE 3LPRA 1HYLA 1OYQA 1P3CA 1ZZZA 2ZDKA 1GHXH 4ZHMU 3NUMA 1ID5H 2BDYA 1QL9A 1HPGA 3QLPH 1GJ8B 1UTNA 3RXTA 2RCEA 4AZ2B 1FONA 1DSTA 1C1PA 5LGOA 3ODFA 2FI3E 4MG3A 2CXVA 4WY3A 1EAXA 3EA8A 2OC7A 3V7TA 4O3UA 2ZKSA 2FP7B 4WXIA 1F0UA 3RXPA 2AGEX 1C5ZB 5AHGH 1CBWB 2TBSA 5EW2H 2VWLA 4JZFH 1C5OH 1SLWB 3VGCB 2ZP0H 3P8OA 3ZV8A 4MPWA 1O2WA 2ZG0H 4OS4A 2HVXA 2CF8H 1L0ZA 2H5DA 5T6FA 3F1SB 2W3KA 5L30H 3UIRA 4WMFA 1OWKA 2VIPA 1TMUH 2PGBB 6LPRA 4WH8A 2TGAA 1O2RA 1TONA 4E7RG 1ELCA 1VCWA 2OUAA 3PTNA 3O8CA 5T6DA 3EQ0H 1P2IA 1O3MA 3E90B 3N7OA 1Y3VA 3GDUA 3MU5A 1GBHA 1P3EA 4X8TH 1QA7A 1ELDE 2GCHF 2PLXA 2PTCE 4D76A 1IQGA 8KME2 1RTLA 4BAOB 1P8VC 1GJ5H 7GCHG 3RXQA 4NA8A 1H1BA 1C2LA 2FMJA 8GCHF 1WCZA 4H6SB 2CJIA 1IQEA 2GV6A 4B1TA 1Y5UT 1VJ9U 1ARCA 2AGGX 4YM9A 3QGNB 2H6MA 2BXUH 1T31A 1MZDA 2LNCA 3K2UA 6ESTA 3BTQE 1BCUH 2W26A 5DP8A 4BTUB 1C2JA 1ZR0A 3F9EA 4HI3A 3LT3A 3SV9A 1EASA 3FVFB 2IJOB 1OP8A 3TJOA 1OOKB 2G5VA 2BY6X 2GVFA 5FCRA 1O2VA 2TGDA 1BTHH 3TH2H 1E34B 2BVSH 3Q3YA 2EC9H 1ARBA 4I8KA 4MPUA 4WXVA 4ZMAH 8GCHG 1S82A 1YKTA 2OQ5A 2P93A 3M5LA 1GVKB 1H9HE 1C5TA 4YT6H 1TNLA 1KXBA 3A7XA 4BTIB 3F9HA 4K5ZA 1EZXC 2JKHA 2Y6TA 2OC0A 1ABJH 1EJNA 1ZPCA 3UWJH 1LVOA 2RA0A 3HGNA 1KY9A 4O97A 4DIHH 2A2XH 3BV9B 3SU1A 1LDTT 1A5GH 3ZZAA 3M61U 1C2EA 3BTEE 1IAUA 3GY5A 1SHYA 1MKXH 4JZEH 1LPKB 1P05A 3UQVA 1YPHC 1KDQB 1IQKA 3VB5A 1O2HA 1V2PT 1V2KT 1QB6A 1Y5BT 2R0LA 1NTPA 2PUQH 4IS5A 1JMOH 5J4SA 3CS0A 4MNYA 1C5WB 3SQHE 2Z7FE 1FQ3A 5EPNA 1SGNE 1QL7A 3LGTA 2BOKA 2CGAA 1DICA 1GBIA 2FS9A 2FOFA 1D3PB 3ZVBA 2CMYA 4CBNA 1Y3WA 4A92A 1ELGA 5K0HA 1A5HA 1GJBB 3ZZ8A 1TA2A 4IN2A 1C1UH 3MO3A 3GDSA 1GHZA 2UUFB 2P8OB 5H4IB 1FN8A 5C2ZA 3A82A 1VGCB 1EAIA 3RXFA 1DS2E 2Y7XA 1GBTA 4XFQA 2HGTH 3MHWU 4NCYA 2BD2A 3UWIA 1O3LA 2HWLB 3Q76A 3T5FH 3QZRA 4NIYA 2QF0A 8LPRA 1BJVA 1EAWA 2GD4B 1NC6A 3ZZ4A 1YLDA 5IYTA 4M7GA 2F91A 5C1UA 4X6OA 1FPHH 1XVMA 4WWYA 3DUXH 5GJ4B 3QZQA 4LK4A 2EI8A 2XTTB 4X6MA 5F03A 3PO1B 5GCHG 4X2YA 5DP4A 1A7SA 1SOZA 2IPHA 2A32A 5CHAC 3UR9A 1GI1A 3M5MA 1D3DB 1P04A 3STJA 2PKSB 3A7ZA 2W3IA 4X1SU 1OYTH 1L4ZA 1UHBB 4ABDA 3STIA 1S83A 1DX5M 1UHBA 4FVDA 4YLUA 4D9RA 4ZUHA 2AGIX 4BAKB 3M5OA 1BTWA 5HXFA 1C5XB 2ANWA 5DP5A 2GCTB 2YNBA 2VH0A 2C90B 2HOBA 1MU6B 5ABWA 1C5UA 1XX9A 3SNCA 1BMLA 2VNTA 1TQ0B 4Y71A 2BX3A 4TPIZ 1ELAA 1YPLH 4ABBA 2FXRA 5CMXH 4ZHLU 1P12E 2ZWLH 1SGFG 1XUHA 3KQCA 1YPJH 1TX8A 5DGJA 2YOLA 2ZGCA 2A2QH 1THPB 1G32B 4FU7A 2D1JA 1BRAA 3GY2A 2Q1JA 3RM2H 4ABEA 1P10A 4CRGA 1DM4B 2Y82A 3QX5H 1FXYA 4ZKNU 2BY5X 1GI5A 1QB9A 2TGPZ 4ABHA 1SLUB 2VGCB 5DG6A 1K1PA 2SGFE 1TFXA 3LGIA 3M7TA 2XWBI 3QDZB 4CRCA 1C5SA 1AB9C 2J2UA 1EXFA 1O5GH 4ABFA 2BHGA 2BD9A 3TGJE 1NY22 1NFYA 5IDKA 1LKBA 2W7SA 2OXSA 2R3YA 1HXEH 3M36A 4FUIA 1C1RA 2A4RA 1SPJA 2FTMA 2O8UA 1C4V2 1SLXB 1P01A 1UVUH 1WQVH 2F83A 1BTZA 2Q6GA 1HAZB 2ZFSA 2FLBH 2BQWB 3ZVFA 3LJOA 4CR5A 3BTKE 3PTBA 3L33A 4ZHAA 1WUNH 1F0SA 1GHAG 1NRPH 1QURH 3ODDA 5JDUB 2VU8E 3ZVGA 2ZU3A 5AF9H 1SGPE 4Q2KA 1V2WT 3W94A 2Q6DA 5A8ZA 1AKSA 5FCKA 5JPMH 1BB0B 1OWIA 7ESTE 2WPHS 5C20A 3DD2H 3VB7A 3SNDA 5CHAB 3GISB 3SZNA 1BOQA 1YPMH 1EUFA 1FLEE 3R0FA 3HK6B 4LOYH 1C2KA 1GHWH 1YGCH 3RXBA 5F8ZA 2ZO3H 3UNQA 4X1QU 1TIOA 1QTFA 3ENSB 1EATA 2HPQH 1V2UT 5HMAA 5TJXA 5JBCS 3T25A 2WUCA 3B23B 1TGCA 1IHTH 5C3NA 1H4WA 1CO7E 1AFQC 3BTWE 2P3TB 2P3FH 3HGPA 4ABJA 5EQRA 2STBE 4MVNA 2PTNA 1HFDA 1P09A 3MU1A 3FP8E 2P94A 4ZAEA 3T2NA 3URDA 2ULLA 1DUAA 2LPRA 1HUTH 4YOIA 1GCDA 5FX5A 1HRTH 3RXAA 1S81A 2J92A 1FV9A 1TGSZ 2ZFRH 1O3HA 1B5GH 1QBNA 2F9UA 1O0DH 1DVAH 1GI9B 2AEIH 5FXLA 1GBAA 1LKAA 2FOGA 1ZJKA 1QY6A 4QT8C 1GJ9B 1V2ST 3M3SA 1O2ZA 3NXPA 1FZZA 1MTNC 3RXGA 2Z9GA 5EG4A 1NU7B 1AVWA 1Z6JH 2F3CE 2WPJS 2BDAA 2ZFFH 3T27A 3A80A 1BJUA 4DVAU 2FM2A 1VITG 2ZU2A 1C9TA 4AGKA 1AGJA 3KEEA 4X6NA 3SU5A 1E37B 3I77A 2PSYA 8ESTE 1BZXE 1OWJA 1TPSA 1LO6A 1CGHA 1H8IH 7KMEH 3M3VA 1SGIB 5F8TA 2V6NA 1AN1E 2A7HA 3F6UH 1ZRBA 4IC6A 3ZVCA 1V6DA 1O36A 4XBDA 1J9CH 1O3OA 1J8AA 1GMDG 4FXGH 2A1DB 2BD5A 4X1RU 4YLQH 1J16A 1GBCA 1GHAF 1MCVA 1IHSH 5A2MH 1C1TA 2A4OA 4UDWH 2OBOA 2FS8A 1ELFA 3ZZDA 1JIRA 2G52A 4CHAC 1Y5AT 1MZAA 1NFUA 2EEKA 5BRRE 1THSH 3ZVDA 2ZQ1A 2PR3A 3AASA 1F5RA 1FY3A 4TWWA 4Y8XA 4B2AA 1LHEH 3KHVA 2Z9KA 1AD8H 2BD8A 4NFEA 4Y79A 1HAPH 1EPTB 1LVMA 3A84A 2QYIA 3A7VA 4K2YA 2PKAB 4WMEA 1RD3B 2GP9B 1WYKA 2ZHWH 4ABGA 1RIWB 1AVGH 1Z7KA 3VEQB 4MNWA 2ZGJA 1BHXF 4ZXYH 1YLCA 4OS6A 2XCNA 3Q00A 1N1LA 3KNXA 2QF3A 2ILNA 1BIOA 1SGDE 1K1JA 3EE0B 4TY7A 2HLCA 1V2JT 3U98H 4JZ1A 1TGNA 1HAVB 2BZ6H 2O9QA 1YCPM 1BDAA 3FP6E 1ZTKA 1CSOE 1MTVA 1LHDH 2J94A 1O2MA 3D65E 2SGPE 1MAYA 2ZHDA 1QRZA 1BTXA 4AFSA 3SI4H 2FOEA 1YPKH 1AE8H 4HTCH 5AVDA 1O3EA 2GTBA 2QXHA 3CS7A 3BIUH 3GCHC 1GJ7B 1K22H 1P57B 2QIQA 4NWKA 5E0JA 3UR6A 3C27B 2GCTC 1TGTA 1YYY1 2QV1A 2BTCE 2OCVB 2ODPA 4FUCA 3TK5A 1GJAB 1MKWK 2UUKB 2K1QA 2HNTF 1PQAA 3MH4A 2ZDMA 1Z8JB 4AFUA 3MNBA 3BG4B 4B71A 1WSSH 3TJUA 4KTUA 5ESTE 2BXTH 1SQOA 3MO6A 2O8MA 1TYNA 1TNHA 2G51A 3AVZA 5HM2A 1W12U 3SGAE 5LPEA 1NRSH 3ZZCA 2PGQB 1ZYOA 1HB0B 2KAIA 1A0LA 4MQAA 2ZPQA 4DT7B 3MI4A 2PUXB 1LHCH 4AYYB 3IITA 4X2VA 4CREA 1C4Y2 2FX6A 4NSVA 1QNJA 1ZJDA 3A7YA 3H5CB 4BOHA 1UO6A 4H6TA 1X7AC 4IGDA 2Y80A 1WTGH 1ETTH 1O2OA 1VCPA 2G55A 3U8RH 1G3BA 3A7TA 5F8XA 4DIIH 3U9AH 1RIWC 4TPYA 1MU8B 1ZOMA 1T8OA 1ZGIA 1PQ8A 3P95A 3MU8A 3MYWA 3LU9B 1GBKA 1TNGA 1SGTA 5C1YA 3RXCA 2OLGA 2P16A 3F68H 4JYTA 2FO9A 5FPTA 4D7FA 5J4QA 1QBVH 1P2OA 2J9NA 1LVBA 4OS7A 1JOUB 1E35B 2F9PA 1O5AB 4B73A 1KTSB 3ZVAA 1BUIA 1XVOA 2ZCKP 4O3TA 1EOLA 2H1UA 1GMCG 1FAXA 5EODA 1TPOA 2WV4A 2GMTB 1C1MA 1P0SH 3PWBA 1QRXA 3HKIB 3LH3A 3G01A 3SNBA 3PWCA 1ESBA 1W14U 1DUEA 1H8DH 1A3BH 1FIWA 1TE0A 1Z1IA 3T62A 1FY1A 3SN8A 4XOJA 5SGAE 1GJ6A 1IOEA 1YBWA 3RU4E 1YM0A 2ZU1A 5L6NH 2C8YB 1KLJH 2TIOA 3GY6A 3SNEA 1CA0C 4INKA 1CE5A 3S9CA 5I25A 3P92A 4IC5A 1GL1A 3OSYA 5EU8A 3L6PA 1C1VH 1NS3A 1RGQA 5DKMA 1ESAA 1G3CA 2ZDAH 3PB1E 1UCYK 1UTKA 2BD3A 1QIXB 3F9FA 2O8TA 1AVXA 2SGDE 3EAJA 5E0GA 3RXHA 1L1GA 4TWYA 1GBMA 2SNWA 1GG6C 1PPEE 3P70B 1ZMLA 3BG4C 1WAYB 1MKWH 1UTLM 4LZ1H 3NKKA 1G37A 2FOHA 5DO4H 1W13U 1BMMH 2AS9A 4Y6DA 2QXIA 3PMJA 3MH7A 2XNIA 2ESTE 2FLRH 4KELA 3TITA 2ZHFH 4ABIA 1CGIE 1VITH 2OINA 4BXSA 2OD3B 2ZI2H 3K9XB 1EB1H 1O3AA 1TX6A 5C67A 1AWFH 1O5BB 1O5CB 4X1PU 5TCAA 1GMHG 1QJ6B 4FVBA 4GHTA 4FU8A 1O32A 2A45B 2JETB 1OX1A 1SHHB 1PPBH 2G4TA 2D2DA 1O2GH 2ODQA 1C2HA 1Z1JA 2BY8X 4WH6A 3BF6H 4PROA 2FZZA 2H9EH 1LPZB 2ZNKH 3UTUH 1AY6H 2JH6D 2ZCLP 1JBUH 4NA9H 1XM1A 3E16B 2O8WA 3RXEA 1ZRKA 1GI6A 1FUJA 1QCPA 1PFXC 3E91A 1IQMA 1BMAA 1FY8E 4NFFA 3DA9B 3M35A 1CU1A 3EGKH 3BSQA 2BLVA 1RS0A 2XBXA 4AGJA 4JK5A 2Z3DA 5E2OA 5BPEA 4CHAB 1ZTJA 3PM3A 4CH8B 1XKAC 5EQSA 2BQ7B 1G2MA 1EOJA 3SUGA 1O5EH 2TRMA 4F4OC 3TJVA 4INHA 4CBOA 4I32A 1FMGA 1O39A 1BBRH 3ZZ9A 1TRYA 1MQ6A 3LH1A 2ZDVH 4I7YH 4ISLA 3TVJB 1EAUA 2VVUA 2A5IA 1KXFA 1SGEE 4ZXXH 2IN2A 4Y8YA 1ANCA 1C1QA 3NPSA 1Q3XA 1A0JA 1ANEA 4NZLA 3A8CA 2FODA 2Y81A 2ZGXH 1SVPA 1ANDA 5DK1A 1QRWA 4MNVA 3RXDA 1UCYE 2FTLE 2HALA 2NU4E 2ZZUH 4X0WU 2GZ9A 3MU0A 1GDQA 3SORA 4H4FA 2GMTC 1W0YH 1TOCB 1DE7H 3LGYA 1ELTA 4YESB 3SUDA 1WV7H 2NU2E 2JH0D 1AU8A 2XXLA 1AUJA 3DHKH 3U1IB 1SFQB 3UREA 2BYAX 3ATWA 5ETXA 4K3JA 1HIAA 4CH2B 5FPSA 2SGEE 1D3TB 1TBQH 2AMQA 3A8DA 3VPKA 3VFEA 2XC5A 1MBQA 4X8UH 1GBDA 1ZMNA 1U6QA 4A7IB 1N8OB 1VR1H 3RMOH 1BQYA 3HATH 1LTOA 4GLYA 1W10U 5HYOA 1EZQA 1IQIA 3TNTA 2A31A 1DPOA 1ELBA 3E8LA 2BDCA 1O3NA 1NZQH 1OWDA 1AMHA 1SGFA 2ZCHP 2WUBA 1C2IA 2STAE 4Z6AH 1W3CA 1UTQA 4HFPB 1TBZH 3UNSA 1L4DA 1PPZA 2W7UA 5JBAS 1FN6A 4U30A 3MNCA 4UEHH 4KKDA 3UNRA 2OTVA 2ZF0H 1GBLA 4ZKOU 1HXFH 3Q3XA 1GG6B 4IN1A 2B0FA 2QN5T 2FOCA 2ZPRA 4AB8A 2BDBA 3QN7A 4DY7B 5CE1A 1KXCA 1NRQH 1YF4A 9LPRA 1O30A 2DE8A 2BMGB 3MH5A 4HGCA 3ATKA 1SSXA 2WPKS 2C8XB 2B9LA 3ZYDA 4A1VA 1Q2WA 4MPXA 1SLVB 1BMNH 2A7JA 2BDGA 4K69A 3M7UA 1C5NH 1UJ1A 4BAMB 5FHTA 2ANKH 3SOSA 4ISHH 1GI4A 1FNIA 1HCGA 1S0RA 3GY3A 4X8VH 3EDXB 2QGRA 4NWLA 1FPCH
chains in the Genus database with same CATH superfamily
2EA3A 2GV7A 4NIXA 3PLBA 1NU9A 2PKSC 2QA9E 1P9UA 3QTOH 3BTGE 2V0BA 2WYJA 1SMFE 3E0NB 5DP6A 1B0FA 2Z9LA 2ZGHA 3DCLA 1SGQE 2VWOA 4BAQB 3MO9A 4CRBA 3V0XA 4B2CA 1TNJA 1CT0E 1MH0A 2BVRH 2QCYA 3OY6U 3QO6A 3ZZ6A 4CR9A 3OU0A 3KN2A 4JK6A 1A0HB 3RDZA 2SFAA 2YMSC 3OEED 3RM0H 1AO5A 4Y11E 1CA8B 3AAVA 3MH6A 3P8GA 2BDIA 4BNRA 2GT7A 1O2XA 2ODYB 1GGDB 2BD7A 1WOFA 2WPMS 3U8OH 1O3BA 2FDAA 3GCNA 4JMYA 1D6RA 1KIGH 4ZROA 2XWAA 3F2GA 3BTME 3K65B 3SU0A 1G30B 3V13A 1C5PA 1HGTH 1O35A 4FUEA 1W11U 1K1OA 2H9HA 3VXFH 1DWBH 4BXWA 3BTTE 4JYVH 1PQ7A 1HAOH 3UY9A 4D8NA 3RXJA 1OS8A 3NRLA 3SJ8A 1LMWB 1J15A 4NGAH 2XRCA 1EB2A 2BLOA 1ESTA 1NO9H 2YNAA 2VIDA 2EI6A 4ZCNA 1PYTC 4VGCC 2ZTYA 4RKOB 1ETRH 4YOGA 3F2HA 4J2YB 4BTTB 1XMNB 3HK3B 2FWWA 1TLDA 1JRTA 4MPVA 2J98B 1NFXA 1EKBB 1TMTH 2ZPSA 1AZZA 1ZHMA 1Z6EA 2M5TA 1AIXH 1MTWA 5F53A 5C5NA 1KLTA 5I46H 3LC5A 1SFIA 3SYJA 1L1JA 1IQFA 2VWMA 3D62A 1UCYH 4AOQA 1GBBA 1K1NA 3BTDE 3I78A 2FI5E 2VIWA 1GBFA 1OP2A 2ZTXA 1KXEA 4GSOA 4THNH 4DGJA 4F49A 4KGAA 4WF8A 1GI8B 4NZQA 3U69H 2AYWA 1O2QA 1O2YA 1SG8B 1MD8A 1Y3UA 2K8IA 4B2BA 2C93B 4DG4A 3VGCC 4I31A 3QWCH 3KQBA 1XUGA 1EPTC 1CHOF 1IQNA 1O2JA 1KTTB 1AHTH 1S6FA 4KTCA 4FUDA 3U1JB 2THFB 2RDLA 1C1SA 1AE5A 1GHBF 1TWXB 1HAGE 4INLA 4X1NU 3TK9A 1T8MA 2H9TH 3K6YA 1OPHB 1J17T 1F5LA 1W7XH 3PMBB 3H7TA 1TQ7B 7LPRA 5JB9S 1QZ8A 1P2MA 3KIDU 1ZSLA 3ZZ3A 4E7NA 4XSKU 3A89A 1K28D 1HNEE 1SI5H 3GCTF 4B76A 1PPGE 2A0QB 1UK2A 3KYGA 2GDEH 4A1XA 2OC1A 3WY8A 2V3MA 2TPIZ 1DLKB 1UMAH 4GCHF 1YP9A 3TH4H 1W2KH 3TJNA 1QHRB 4O9VA 5GDSH 3ATLA 1BITA 3SZEA 3TH3H 2CV3A 2PFEA 2GZ7A 2YMSD 3F2FA 2F9VA 3OTJE 3SJIA 4I33A 4KP0A 1FJSA 1JIMA 1GJ4H 2ASUB 2G81E 3P6ZB 1ZHPA 3NZIA 5A0AE 1BRUP 1SL3A 1GCTB 1THRH 2ZEBA 3SU4A 2XBWA 3TPIZ 2BD4A 2DUCA 2GX4A 3TNSA 1GVLA 1TALA 1DDJA 2ZA5A 3P8FA 2AH4X 5EXMA 1LPGB 4DCDA 3GY7A 1DXPA 2IOTA 5EQQA 3MMGA 1NRNH 1O3GA 1KLIH 3LGUA 4ISIH 4SGBE 5EXNA 1BA8B 1BTYA 1GDUA 1DITH 2PKAA 3GOVB 2FOAA 1LQDB 4FETA 4Y8ZA 5JYIA 3FP7E 5A8YA 2WHXA 1VGCC 1VITF 4AFZA 1MMJN 3JZ1B 4GVUA 3DT0H 4U2WA 4Y10E 3BIVH 2VH6A 4YZUA 2QF5A 5B6OA 2WZQA 3SNAA 1T4VH 3AW0A 1YPHE 1LHGH 1XUFA 2FESH 6CHAC 2ZU4A 1V2OT 3A83A 1K2I1 1FY4A 1PQ5A 2VJ1A 3HPTB 3KQEA 1GI0A 3UFAA 2RDEA 3MTYA 5DP7A 3OX7U 4IMZA 2UUYA 4JCNA 2BZAA 2QXJA 3OFND 1DOJA 5DPAA 2Z3CA 4AC9A 1BBRE 1KMHB 1CVWH 4MNXA 2AFQB 1VCQA 1KXDA 2CHAB 3BEIB 4J1YA 1MQ5A 1EZSC 1YCPH 3LGWA 1V3XA 3VB6A 1DSUA 1CT2E 2NU0E 2UUJB 1UK3A 3RXLA 3FZZA 1TABE 3D23A 3SO3A 3SUFA 1WDIA 3SHAH 3E6PH 1K1MA 4FU9A 3GDVA 1Y3YA 4OS1A 2QY0B 3RMMH 1GI2A 1PPCE 2H2ZA 3BEUA 3KF2A 4X8SH 1YPEH 2CF9H 1ACBE 4HG6A 4ZKSU 1C1OA 1RRKA 1XKBC 1K0HA 1G3DA 1SC8U 3GCHB 3V12A 2VVVA 3GY8A 1TPAE 1UTMA 1ETSH 2VWNA 3QTVH 1G36A 2UWLA 4U01A 3E0PB 2HNTE 2BVXH 2ZECA 1CA0B 3A85A 1G3EA 2O8LA 2G4UA 2GZ8A 4F55A 3S9BA 4XBCA 1P2KA 2FOBA 1ANBA 1NBMD 3ATMA 1CGJE 4WVPE 3TU7H 3A86A 3ITIA 1EQ9A 5L2ZH 2DE9A 1TPPA 1L1NA 3OY5U 1BHXB 2A4QA 2V3OH 1K21H 1DLEA 2HRVA 1TNKA 1P02A 3O8BA 2W6JD 4Y0ZE 2Y5GA 5HM9A 2ZU5A 1DWDH 3BG8A 4B75A 1GBJA 4UONA 2OBQA 2NWNA 6CHAB 3VB3A 2J34A 5L2YH 3M5NA 3UOPA 3N7DA 1MBMA 1C5LH 1O34A 3NCLA 3S0NA 3SV7A 1AB9B 1O3IA 1XXDA 4GAWA 3SUEA 5JBTA 4NIVA 3TIUA 4K1EA 4OGXA 3MNSA 5TCCA 1AI8H 1O5FH 1W0ZU 2P95A 1DY9A 1KSNA 2UWOA 2HPPH 3D49H 3E1XB 1P9SA 3GY4A 4DW2U 1C2MA 4YT7H 1AQ7A 1O2UA 3RXUA 1OSSA 1FIZA 3FFGA 1S0QA 1DY8A 1E36B 1MTSA 3NWUA 5G4BA 1F0TA 2ZFTA 3LOXA 3SJOA 4Q63A 2SNVA 1MCTA 2ZIQH 3PO1C 1O2PA 5EJZA 3URCA 1G2LA 4DOQA 2ZTZA 3O8RA 2BDHA 1C5YB 1HAVA 3LIWA 1JXPA 2PHBA 5LPRA 3MU4A 1J14A 3U8TH 3UOUA 1SGYE 3PV4A 1F0RA 3M7QA 3H7OA 3S7KB 1V2VT 3T26A 3RLYH 1O3FA 4ABAA 2BLQA 1Y3XA 1O31A 4FUGA 3JZ2B 3KGPA 2VIOA 1C2DA 4ESTE 5EIYA 3E3TA 2C8ZB 1BBRK 1K1IA 1KXAA 1SQRA 3RXMA 1O2KA 2F9BH 4DJZB 1KDQA 2A5KA 5HKKD 3DFLA 4Y76A 2BB4A 4Q80A 1WTHD 2RFKC 1ZPZA 1FY5A 1V2RT 4VGCB 2Y5HA 4K1TA 3W95A 3TGKE 1FI8A 1HBTH 2EI7A 2Y5FA 6GCHG 2CN0H 1T7CA 1NROH 2G8TA 2OQUA 2VIQA 1BT7A 1KYNA 5FBEA 1HLTH 5DP3A 2KAIB 2VIVA 1ZPBA 3RU4D 3EA9A 1B0EA 1HDTH 2IPQX 1O2NA 3UB0A 2R2WU 1UTJA 4RI0A 1JRSA 2BQ6B 1OWHA 1O2TA 1D3QB 1V2QT 1UW7A 4B74A 2AERH 1V2TT 1W8BH 3A7WA 3P17H 1T4UH 1GWAA 4X2XA 4D9QA 4GUXA 2BM2A 1PPFE 1GCTC 2LELA 4TY6A 1O5DH 3NK8A 3TLOA 3VG8A 2GCHG 1GHYH 1AUTC 2GT8A 4X2WA 2LP6A 2OP9A 3SU3A 5FPYA 3KCGH 4RN6A 3B9FH 3OYPA 1Y8TA 1DFPA 2ZGBH 3I29A 2J4IA 1Z8RA 3M3TA 1RTFB 3LGVA 5GCHF 4DT4A 3QGJA 3T29A 2CHAC 3SV8A 1Z8IB 1AKSB 1Z8GA 2BOHB 1W7GH 2B7DH 2D26C 4XE4A 1HJ9A 3Q77A 4Y7AA 1Q31A 2PW8H 1O3JA 1O38A 3A81A 4FUJA 3SU6A 1HJAB 1GMDF 1ZLRA 3GCOA 2NU3E 3IG6B 7GCHF 2P59A 3RC4A 5GIBA 1ZSKA 1IQHA 1WBGB 3QK1A 4B6EA 3SU2A 1SQAA 1NFWA 3S9AA 1LVYA 1UK4A 4O03A 1QQUA 2A7CA 3PROA 1TA6A 2TGTA 1ZTLA 3MNXA 1AZ8A 1C1WH 4IW4E 4AB9A 5B6LA 1F92A 1QGFA 5EXLA 1HJ8A 2QAAA 4H42U 1TB6H 2GKVE 4ISNA 4BAHB 3RUOA 3GICB 3O8DA 3RXVA 3Q3KA 3LKWA 2VGCC 1GPZA 3BTHE 4SGAE 1TAWA 4BANB 4K60A 1S85A 1LQEA 3ELAH 4NG9H 5FX6A 1QBOA 1BRCE 1UVPA 1DXWA 4UE7H 4RSPA 1O3DA 3RC6A 2V3HH 3RXIA 2KZ4A 1C2FA 1P06A 4R0IA 2KM0A 2ALPA 1TX7A 2XYAA 2Y7ZA 1FDPA 1HAHH 2F9NA 5A0CA 4IMQA 5AFZH 2R9PA 5T6GA 1LHFH 2PV9B 1MUEB 2ANMH 3RXSA 1O37A 3FAOA 5C1XA 3L3TA 4GHQA 3A8AA 1S6LA 3UQOA 2C8WB 1EJMA 2XCFA 3PLPA 2JETC 2ALVA 1C4U2 2FPZA 2R2MB 4AFQA 2RG3A 1QR3E 3M37A 2CK3D 4IBLH 4NSYA 4GPGA 4UFGH 1HIAB 2I6QA 1ORFA 4P02A 2Z94A 1C5QA 1C5RA 4M9FA 4HZHA 3FZDA 3T28A 1XUJA 1MABB 2ZDLA 4I86A 2BY9X 4OS5A 3VB4A 4K8YA 4MTBA 1ELEE 2FEQH 1TMBH 1QA0A 4D7GA 3BTFE 3KL6A 3LDXH 1OWEA 4OS2A 5A8XA 1A46H 4ZKRU 4UD9H 2HNTC 2JH5D 1H9LB 1XUKA 4DURA 2FX4A 1T8NA 1SGRE 4GCHG 1S84A 1E0FD 1F2SE 1NPMA 3SW2B 1GMHF 4YTAA 1O3KA 2A5AA 5EW1H 2G5NA 3EYDA 4FUHA 5E2PA 3SJ9A 4ISOA 4I8JA 2V35A 1DWCH 1N6YA 1O2LA 1P11E 1QB1A 3UPEA 3SV2H 2WV5A 3RP2A 2VVCA 1A3EH 1GJCB 2F43B 2Z9IA 2ZHQH 3PLKA 2Z9JA 1O33A 1F5KU 1IQLA 2FOMB 2J95A 1IQJA 1YCPK 4TYDA 1TOMH 1NN6A 1Z71A 1QQ4A 2AMPA 1M9UA 1RTKA 5IK2D 1RJXB 3A8BA 3PMHB 1ZGVA 1CHOG 1EP5A 1HAIH 1UVOA 4X6PA 1EPTA 3A87A 1EX3A 1E79D 1C9PA 5DP9A 3HKJB 1SB1H 1WQSA 1MTUA 4A5TS 4AYVB 1ABIH 3LC3A 3RXOA 2FIRH 1OKXA 4I8GA 2PSXA 3KYFA 3ZZ7A 4UFFH 1EP6A 3AW1A 2XW9A 2FI4E 1VZQH 2W5EA 5LH8A 1AFQB 4JZIA 4AN7A 4ACAA 1WU1A 1QFKH 4WMDA 3RC5A 2QXGA 3IWMA 5GNDA 4XDEA 4TSFD 4AG2A 1N8OC 1JWTA 2Z3EA 4ZH8A 1S5SA 1OP0A 1MKXK 1L2EA 3CENA 1HAYB 5KECA 4LZ4B 1A5IA 1T8LA 5JBBS 2R0KA 1F7ZA 3ATIA 5E8EH 3SJKA 3SV6A 4AG1A 1A61H 1HJAC 3KQ5A 1NESE 1YPGH 2G00A 3OAAD 4MLFB 4K1SA 9ESTA 3ESTA 3DFJA 4AORA 2Q6FA 1MTNB 1GVZA 1A1RA 2F9OA 1D4PB 1ZHRA 5E0HA 2ANYA 5ESBA 5C5OA 1D9IA 3RXRA 1UVTH 4NA7A 1A4WH 1ZSJA 1C5MD 1PYTD 2ZDNA 4Q7YA 1XUIA 4R8TB 5K7RA 2ZQ2A 2QC2A 1K1LA 2Z6BD 4MDSA 4ASHA 3ZYEA 3BN9A 2FYRA 5T3HA 5A0BA 1V2LT 3CP7A 1UVSH 2AIPA 1B7XB 3TK6A 1GDNA 3SGBE 1RFNA 1O2IA 2R3UA 4I8HA 4E05H 5PTPA 4YXWD 1CHGA 5LPFA 2SGAA 5DJ7A 1P2JA 1QL8A 1XXFA 1GGDC 2BX4A 3PYHA 4FUFA 1C5VA 2RA3A 1T32A 2XBVA 4JZDH 4NIWA 2WPIS 1TRNA 3B8JA 4XBBA 2ZFPH 2B8OH 1QJ1B 3ZZ5A 4A6LA 2ZC9H 1W0JD 2AMDA 4RKJB 1V2NT 4Y0YE 3F3BA 4CRFA 1YC0A 4B6FA 3GCTG 2P8OC 1TBRH 1MD7A 3AK5A 3F9GA 2XC0A 5FBIA 3S7HB 3TGIE 1INCA 4YO9A 3GYMA 5EJLA 3MWIU 3ZVEA 1LCYA 5EPYA 4WJG2 1GI3A 4A1TA 5AFYH 1K9OE 2BY7X 3SGQE 1ZMJA 2WPLS 1O3PB 3A88A 4CRAA 5GWZA 1PJPA 4UFDH 3QUMP 1ELVA 1P2QA 5F6MA 3FANA 1EZUC 2H5CA 2WINI 2A4GA 1CT4E 2GGVB 2UWPA 3RLWH 2I6SA 1GBEA 5FL7D 3UUZA 1AFEH 2ZFQH 1V2MT 3LONA 3SI3H 5EGMA 1Y59T 1AWHB 1UTPA 2XC4A 1A2CH 1COWD 1O3CA 4JYUH 4TT3D 1N6XA 4U32A 1DT2A 4Q7XA 1S6HA 3K6ZA 1VJAU 1QJ7B 1SR5C 2BLWA 2PWXA 3SBKA 1GHBG 4CRDA 5JB8S 1RXPA 2FYQA 1CBWC 3MOCA 1SOTA 2B5TB 4I8LA 4OGYA 3VXEH 4Y7BA 1SGCA 1E38B 1D6WA 4Z0KA 5GPIB 2AIQA 2WYGA 1TNIA 4LXBH 2VINA 3V3MA 2NU1E 1TGBA 1C1NA 2C4FH 4KTSA 4E06H 5A09A 1PPHE 1P2NA 2XBYA 3BEFB 3ZV9A 2C3SA 2OC8A 2GDDA 3R3GB 4AX9H 4Q7ZA 1DWEH 5HGGA 1H9IE 5KEDA 4YOJA 1G9IE 1NM6A 6GCHF 1BTUA 2L74A 1TRMA 1BRBE 5GXPA 3S69A 3EA7A 1GMCF 3PMAB 1E1QD 1FAKH 1DANH 1NT1A 1NRRH 3OE7D 1C2GA 1HV7A 3C1KA 1CQQA 2XOKD 2D8WA 2J38A 4K8BA 1GL0E 2JIZD 3GYLB 1SQTA 3LJJA 1P03A 1MAXA 1GI7B 3RMNH 2VB0A 1GHVH 3P8NA 1GJDB 1OXGA 1BTPA 2ZHEH 2WV9A 1EJAA 2SGQE 1O2SA 3KQDA 3RU4T 5FAHA 1SBWA 3MFJA 2P3UB 5EOKA 4UFEH 3SHCH 3ZZBA 1UTOA 1HAXB 4FUBA 3RXKA 3AAUA 3RMLH 3SQEE 3LPRA 1HYLA 1OYQA 1P3CA 1ZZZA 2ZDKA 1GHXH 4ZHMU 3NUMA 1ID5H 2BDYA 1QL9A 1HPGA 3QLPH 1GJ8B 1UTNA 3RXTA 2RCEA 4AZ2B 1FONA 1DSTA 1C1PA 5LGOA 3ODFA 2FI3E 4MG3A 2CXVA 4WY3A 1EAXA 2J97A 3EA8A 2QF4A 2OC7A 3V7TA 5T1VA 4O3UA 2ZKSA 2FP7B 4WXIA 1F0UA 3RXPA 2AGEX 1C5ZB 5AHGH 1CBWB 2TBSA 5EW2H 2VWLA 4JZFH 1C5OH 1SLWB 3VGCB 2ZP0H 3P8OA 3ZV8A 4MPWA 1O2WA 2ZG0H 4OS4A 2HVXA 2CF8H 1L0ZA 2H5DA 5T6FA 3F1SB 2W3KA 5L30H 3UIRA 4WMFA 1OWKA 2VIPA 1TMUH 2PGBB 6LPRA 4WH8A 2TGAA 1O2RA 1TONA 4E7RG 1ELCA 1VCWA 2OUAA 3PTNA 3O8CA 5T6DA 3EQ0H 1P2IA 1O3MA 3ZIAD 5EJ1A 3E90B 3N7OA 1Y3VA 3GDUA 3MU5A 1GBHA 1P3EA 4X8TH 1QA7A 1ELDE 2GCHF 2PLXA 2PTCE 4D76A 1IQGA 8KME2 1RTLA 4BAOB 1P8VC 1GJ5H 7GCHG 3RXQA 4NA8A 1H1BA 1C2LA 2FMJA 3OEHD 8GCHF 2EQNA 3N7EA 1WCZA 4H6SB 2CJIA 1IQEA 2GV6A 4B1TA 2J98A 1Y5UT 1VJ9U 1ARCA 2AGGX 4YM9A 3QGNB 2H6MA 2BXUH 1T31A 1MZDA 2LNCA 3K2UA 6ESTA 3BTQE 1BCUH 2W26A 5DP8A 4BTUB 1C2JA 1ZR0A 3F9EA 4HI3A 3LT3A 3SV9A 1EASA 3FVFB 2IJOB 1OP8A 3TJOA 1OOKB 2G5VA 2BY6X 2GVFA 5FCRA 1O2VA 2TGDA 1BTHH 3TH2H 1E34B 2BVSH 3Q3YA 2EC9H 1ARBA 4I8KA 4MPUA 4WXVA 3N99A 4ZMAH 8GCHG 1S82A 1YKTA 2OQ5A 2P93A 3M5LA 1GVKB 1H9HE 1C5TA 4YT6H 4Z1MD 1TNLA 1KXBA 3A7XA 4BTIB 3F9HA 4K5ZA 1EZXC 2JKHA 2Y6TA 2OC0A 1ABJH 1EJNA 1ZPCA 3UWJH 1LVOA 2RA0A 3HGNA 1KY9A 4O97A 4DIHH 2KFWA 2A2XH 3BV9B 3H09A 3SU1A 1LDTT 3UAIC 1A5GH 3ZZAA 3M61U 2F4LA 1C2EA 3BTEE 2VBCA 1H8ED 1IAUA 3GY5A 1SHYA 1MKXH 4JZEH 1LPKB 1P05A 3UQVA 1YPHC 1KDQB 1IQKA 3VB5A 5C94A 1O2HA 1V2PT 1V2KT 1QB6A 1Y5BT 2R0LA 2WSSD 1NTPA 2PUQH 4IS5A 1JMOH 5J4SA 3CS0A 3WWBA 4MNYA 1C5WB 3SQHE 2Z7FE 1FQ3A 5EPNA 1SGNE 1QL7A 3LGTA 2BOKA 2CGAA 1DICA 1GBIA 2FS9A 2FOFA 1D3PB 3ZVBA 2CMYA 4CBNA 1Y3WA 4A92A 1ELGA 5K0HA 1A5HA 1GJBB 3ZZ8A 1TA2A 4IN2A 1C1UH 3MO3A 3GDSA 1GHZA 2UUFB 2P8OB 5H4IB 2KCPA 1FN8A 5C2ZA 3A82A 1VGCB 1EAIA 3RXFA 1DS2E 2Y7XA 1GBTA 4XFQA 2HGTH 3MHWU 3FO8D 4NCYA 2BD2A 3UWIA 1O3LA 2YMSB 2HWLB 3Q76A 3T5FH 3QZRA 4NIYA 2QF0A 8LPRA 1BJVA 3DSPA 1EAWA 2GD4B 1NC6A 3ZZ4A 1YLDA 5IYTA 4M7GA 2F91A 5C1UA 4X6OA 1FPHH 3DSOA 1XVMA 4WWYA 3DUXH 3FKSD 5GJ4B 3QZQA 4LK4A 2EI8A 2XTTB 4X6MA 2KR7A 5F03A 3GS9A 3PO1B 5GCHG 4X2YA 5DP4A 1A7SA 1SOZA 2IPHA 2A32A 5CHAC 3UR9A 1GI1A 3M5MA 1D3DB 1P04A 3STJA 2PKSB 3A7ZA 2W3IA 4X1SU 1OYTH 1L4ZA 1UHBB 4ABDA 3STIA 1S83A 1DX5M 1UHBA 4FVDA 4YLUA 4D9RA 2AHME 4ZUHA 2AGIX 4BAKB 3M5OA 1BTWA 5HXFA 1C5XB 2ANWA 4RT1A 5DP5A 2GCTB 2YNBA 2QE7D 2VH0A 2C90B 2HOBA 1MU6B 5ABWA 1C5UA 1XX9A 3SNCA 1BMLA 2VNTA 2HVYB 4ASUD 1TQ0B 4Y71A 2BX3A 4TPIZ 1ELAA 1YPLH 4ABBA 2PP6A 2FXRA 3W1EA 5CMXH 4ZHLU 1P12E 2ZWLH 1SGFG 1XUHA 3KQCA 1YPJH 1TX8A 2WPDD 5DGJA 2YOLA 2ZGCA 2A2QH 1THPB 1G32B 4FU7A 2D1JA 1BRAA 3GY2A 2Q1JA 3RM2H 4ABEA 1P10A 4CRGA 1DM4B 2Y82A 3QX5H 1E1RD 1FXYA 2BY5X 4ZKNU 1GI5A 1QB9A 2TGPZ 4ABHA 1SLUB 2VGCB 1BMFD 5DG6A 2IJD1 1K1PA 2SGFE 1TFXA 3LGIA 3M7TA 2XWBI 3QDZB 4CRCA 1C5SA 1AB9C 1SKYE 2J2UA 1EXFA 1O5GH 4ABFA 2BHGA 2BD9A 3TGJE 1NY22 1NFYA 5IDKA 1LKBA 2W7SA 2OXSA 2R3YA 1HXEH 3CNRA 3M36A 4FUIA 1C1RA 2A4RA 1SPJA 2FTMA 2O8UA 1C4V2 1SLXB 4FOUC 4OM9A 3WWFA 1P01A 1UVUH 1WQVH 2F83A 1BTZA 2Q6GA 1HAZB 5C17A 2ZFSA 3FN8A 2FLBH 2BQWB 3ZVFA 5C0UA 3LJOA 4CR5A 3U28C 3BTKE 3PTBA 3L33A 4ZHAA 1WUNH 1F0SA 1GHAG 1NRPH 1QURH 3ODDA 5JDUB 5CHBA 2VU8E 3ZVGA 2ZU3A 5AF9H 1SGPE 4Q2KA 1V2WT 3W94A 2Q6DA 5A8ZA 1AKSA 5FCKA 5JPMH 1BB0B 1OWIA 7ESTE 2WPHS 2KCOA 5C20A 4ACBA 3VB7A 3DD2H 3SNDA 5CHAB 3GISB 3SZNA 1BOQA 1YPMH 1EUFA 1FLEE 3R0FA 3HK6B 4LOYH 1C2KA 1GHWH 1YGCH 3RXBA 5F8ZA 2ZO3H 3UNQA 4X1QU 1TIOA 1QTFA 3ENSB 1EATA 3EE7A 2HPQH 1V2UT 3MQKC 5HMAA 5TJXA 5JBCS 3T25A 2WUCA 3B23B 1TGCA 1IHTH 5C3NA 1H4WA 1CO7E 2W6ID 1AFQC 3BTWE 2P3TB 2P3FH 2L6OA 3HGPA 5HIYA 4ABJA 5EQRA 2STBE 4MVNA 2PTNA 1HFDA 1P09A 3MU1A 3FP8E 2P94A 4ZAEA 3T2NA 3URDA 2ULLA 1DUAA 2LPRA 1HUTH 4YOIA 1GCDA 5FX5A 1HRTH 3RXAA 1S81A 2J92A 1FV9A 1TGSZ 2ZFRH 1O3HA 1B5GH 1QBNA 2F9UA 1O0DH 1DVAH 1GI9B 2AEIH 5FXLA 1GBAA 1LKAA 2FOGA 1ZJKA 1QY6A 4QT8C 2XNDD 1GJ9B 1V2ST 3M3SA 2JJ1D 1O2ZA 3NXPA 1FZZA 1MTNC 3RXGA 1NBME 5DSFA 2Z9GA 5EG4A 1NU7B 1AVWA 1Z6JH 2F3CE 2WPJS 2BDAA 2ZFFH 3T27A 3A80A 1BJUA 4DVAU 2FM2A 1VITG 2ZU2A 1C9TA 4AGKA 1AGJA 3KEEA 4X6NA 3SU5A 1E37B 3I77A 2PSYA 8ESTE 1BZXE 1OWJA 1TPSA 1LO6A 1CGHA 1H8IH 1YWUA 7KMEH 3M3VA 1SGIB 5F8TA 2V6NA 1AN1E 2A7HA 3F6UH 1ZRBA 4IC6A 3ZVCA 1V6DA 1O36A 4XBDA 1J9CH 1O3OA 1J8AA 1GMDG 4FXGH 2A1DB 2BD5A 4X1RU 4YLQH 5KGOA 2KCYA 1J16A 1GBCA 1GHAF 1MCVA 1IHSH 5A2MH 1C1TA 2A4OA 4UDWH 2OBOA 2FS8A 1ELFA 3ZZDA 1JIRA 2G52A 4CHAC 2J5UA 1Y5AT 1MZAA 1NFUA 2EEKA 5BRRE 1THSH 3ZVDA 2ZQ1A 2PR3A 3AASA 1F5RA 1FY3A 4TWWA 4Y8XA 4B2AA 1LHEH 3KHVA 2Z9KA 3PV5A 1AD8H 2BD8A 4NFEA 4Y79A 1HAPH 1EPTB 1LVMA 3A84A 2QYIA 3OTPA 3A7VA 4K2YA 2PKAB 4WMEA 3PV2A 1RD3B 2GP9B 1WYKA 2ZHWH 4ABGA 1RIWB 1AVGH 1Z7KA 3VEQB 4MNWA 2ZGJA 1BHXF 4ZXYH 1YLCA 4OS6A 2XCNA 3Q00A 1N1LA 3KNXA 2QF3A 2ILNA 1BIOA 1SGDE 1K1JA 3EE0B 4TY7A 2HLCA 1V2JT 3U98H 4JZ1A 1TGNA 1HAVB 2BZ6H 2O9QA 1YCPM 1BDAA 3FP6E 1ZTKA 1CSOE 1MTVA 1LHDH 2J94A 1O2MA 3D65E 2SGPE 1MAYA 2ZHDA 1QRZA 1BTXA 4AFSA 3SI4H 2FOEA 1YPKH 1AE8H 4HTCH 5AVDA 1O3EA 2GTBA 2QXHA 3CS7A 3BIUH 3GCHC 1GJ7B 1K22H 1P57B 2QIQA 4NWKA 5E0JA 3UR6A 3C27B 2GCTC 1TGTA 1YYY1 2QV1A 2BTCE 2OCVB 2ODPA 2EY4C 4FUCA 1FX0B 1GJAB 3TK5A 4XRNA 1MKWK 2UUKB 2K1QA 2HNTF 1PQAA 3MH4A 2ZDMA 3WW7A 1Z8JB 4AFUA 3MNBA 3BG4B 1VKYA 4B71A 1WSSH 3TJUA 4KTUA 5ESTE 2BXTH 1SQOA 3MO6A 2O8MA 1TYNA 1TNHA 2G51A 3AVZA 5HM2A 1W12U 3SGAE 5LPEA 1NRSH 3ZZCA 2PGQB 1ZYOA 1HB0B 2KAIA 1A0LA 4MQAA 2ZPQA 4DT7B 3MI4A 2PUXB 1LHCH 2KX4A 4AYYB 3IITA 4X2VA 4CREA 1C4Y2 2FX6A 4NSVA 1QNJA 1ZJDA 3A7YA 3H5CB 4BOHA 1UO6A 4H6TA 1X7AC 4IGDA 2Y80A 1WTGH 1ETTH 1O2OA 1VCPA 2G55A 3U8RH 1G3BA 3A7TA 5F8XA 4DIIH 3U9AH 1RIWC 4TPYA 1MU8B 1ZOMA 1T8OA 1YLNA 1ZGIA 1PQ8A 3P95A 3MU8A 3MYWA 3LU9B 1W0KD 1GBKA 1TNGA 1SGTA 5C1YA 3RXCA 2OLGA 3F0OA 2P16A 3F68H 4JYTA 2FO9A 5FPTA 4D7FA 5J4QA 1QBVH 1P2OA 2J9NA 5C0TA 1LVBA 4OS7A 1EFRD 1JOUB 1E35B 2F9PA 1O5AB 4B73A 1KTSB 2K0QA 3ZVAA 1BUIA 1XVOA 2ZCKP 4O3TA 1EOLA 2H1UA 1GMCG 1FAXA 5EODA 1TPOA 4XD7D 2WV4A 2GMTB 1C1MA 1P0SH 3PWBA 1QRXA 3HKIB 3LH3A 3G01A 1H8HD 3SNBA 3PWCA 1ESBA 1W14U 1DUEA 3FOAA 1H8DH 1A3BH 1FIWA 1TE0A 1Z1IA 3T62A 1FY1A 3SN8A 2JDID 4XOJA 5SGAE 1GJ6A 1IOEA 1YBWA 3RU4E 1YM0A 2ZU1A 5L6NH 2C8YB 1KLJH 2TIOA 3GY6A 3SNEA 1CA0C 4INKA 1CE5A 3S9CA 5I25A 3P92A 4IC5A 1GL1A 3OSYA 5EU8A 3L6PA 1C1VH 3PRDA 1NS3A 1RGQA 5DKMA 1ESAA 1G3CA 2ZDAH 3PB1E 1UCYK 1UTKA 2BD3A 2OK5A 1QIXB 3F9FA 1OHHD 2O8TA 1AVXA 2SGDE 3EAJA 5E0GA 3RXHA 1L1GA 4TWYA 1GBMA 2SNWA 1GG6C 1PPEE 3P70B 1ZMLA 3BG4C 1WAYB 1MKWH 1UTLM 5HIZA 4LZ1H 3NKKA 1G37A 2FOHA 5DO4H 1W13U 1BMMH 2AS9A 4Y6DA 2QXIA 3PMJA 3MH7A 2XNIA 2ESTE 2FLRH 4KELA 3TITA 2ZHFH 4ABIA 1CGIE 1VITH 2OINA 4BXSA 2OD3B 2ZI2H 3K9XB 1EB1H 1O3AA 1TX6A 5C67A 1AWFH 1O5BB 1O5CB 4X1PU 5TCAA 1GMHG 1QJ6B 4FVBA 4GHTA 4FU8A 1O32A 4Q4LA 2A45B 2JETB 1OX1A 1SHHB 1PPBH 2G4TA 2D2DA 2M2AA 1O2GH 2ODQA 3PRBA 1C2HA 1Z1JA 4F48B 2BY8X 4WH6A 3BF6H 4PROA 2FZZA 2H9EH 1LPZB 2ZNKH 3UTUH 1AY6H 2JH6D 2ZCLP 1JBUH 4NA9H 1XM1A 3E16B 2O8WA 3RXEA 1ZRKA 1GI6A 1FUJA 1QCPA 1PFXC 2V7QD 1IQMA 1BMAA 1FY8E 3E91A 4NFFA 3DA9B 3M35A 1CU1A 3EGKH 5CDFE 3BSQA 2BLVA 4RT0A 1RS0A 2XBXA 4AGJA 4JK5A 2Z3DA 5E2OA 5BPEA 4CHAB 1ZTJA 3PM3A 4CH8B 1XKAC 5EQSA 3DSGA 2BQ7B 1G2MA 1EOJA 3SUGA 1O5EH 2TRMA 4F4OC 1WXRA 3TJVA 4INHA 4CBOA 4I32A 1FMGA 1O39A 1BBRH 2HLDD 3ZZ9A 1TRYA 1MQ6A 3LH1A 2ZDVH 4I7YH 4ISLA 3TVJB 1EAUA 2VVUA 2A5IA 1KXFA 1SGEE 4ZXXH 2IN2A 4Y8YA 1ANCA 1C1QA 3NPSA 1Q3XA 1A0JA 1ANEA 4NZLA 3A8CA 2FODA 2Y81A 2ZGXH 2GJGA 1SVPA 1ANDA 5DK1A 1QRWA 4MNVA 3RXDA 1UCYE 2FTLE 2HALA 2NU4E 2ZZUH 3F0PA 4X0WU 2GZ9A 1YY3A 3MU0A 1GDQA 3SORA 4H4FA 2GMTC 1W0YH 1TOCB 1DE7H 3LGYA 1ELTA 4YESB 3SUDA 1WV7H 2NU2E 2JH0D 1AU8A 2XXLA 1AUJA 3DHKH 3U1IB 1SFQB 3UREA 2BYAX 3ATWA 5ETXA 4K3JA 1HIAA 4CH2B 5FPSA 2SGEE 1D3TB 1TBQH 2AMQA 3A8DA 3VPKA 3VFEA 2XC5A 1MBQA 4X8UH 1GBDA 1ZMNA 1U6QA 4A7IB 1N8OB 1VR1H 3RMOH 1BQYA 3HATH 1LTOA 4GLYA 1W10U 5HYOA 1EZQA 1IQIA 3TNTA 2A31A 1DPOA 1ELBA 3E8LA 4P00A 2BDCA 1O3NA 1NZQH 1OWDA 1AMHA 1SGFA 2ZCHP 2WUBA 1C2IA 2STAE 4Z6AH 1W3CA 1UTQA 4HFPB 1TBZH 3UNSA 1L4DA 1PPZA 2W7UA 5JBAS 1FN6A 4U30A 3MNCA 4UEHH 4KKDA 3UNRA 2OTVA 2ZF0H 1GBLA 4ZKOU 1HXFH 3Q3XA 1GG6B 4IN1A 2QN5T 2B0FA 2FOCA 2ZPRA 4AB8A 2BDBA 3QN7A 4DY7B 5CE1A 1KXCA 1NRQH 1YF4A 9LPRA 1O30A 2DE8A 2BMGB 3MH5A 4HGCA 3ATKA 1SSXA 5DN6D 2WPKS 2C8XB 2B9LA 3ZYDA 4A1VA 1Q2WA 4MPXA 1SLVB 1BMNH 2A7JA 2BDGA 4K69A 3M7UA 1C5NH 1UJ1A 2JJ2D 4BAMB 5FHTA 2ANKH 3SOSA 4ISHH 2KCAA 1GI4A 1FNIA 1HCGA 1S0RA 3GY3A 4X8VH 3EDXB 2QGRA 4NWLA 1FPCH
chains in the Genus database with same CATH topology
2EA3A 2GV7A 4NIXA 3PLBA 1NU9A 2PKSC 2QA9E 1P9UA 3QTOH 3BTGE 2V0BA 2WYJA 1SMFE 3E0NB 5DP6A 1B0FA 2Z9LA 2ZGHA 1SGQE 2VWOA 4BAQB 3MO9A 4CRBA 3V0XA 4B2CA 1TNJA 1CT0E 1MH0A 2BVRH 2QCYA 3OY6U 3QO6A 3ZZ6A 4CR9A 3OU0A 3KN2A 4JK6A 1A0HB 3RDZA 2SFAA 3RM0H 1AO5A 4Y11E 1CA8B 3AAVA 3MH6A 3P8GA 2BDIA 4BNRA 2GT7A 1O2XA 2ODYB 1GGDB 2BD7A 1WOFA 2WPMS 3U8OH 1O3BA 2FDAA 3GCNA 4JMYA 1D6RA 1KIGH 4ZROA 2XWAA 3K65B 3BTME 3SU0A 1G30B 3V13A 1C5PA 1HGTH 1O35A 4FUEA 1W11U 1K1OA 2H9HA 3VXFH 1DWBH 4BXWA 3BTTE 4JYVH 1PQ7A 1HAOH 3UY9A 4D8NA 3RXJA 1OS8A 3SJ8A 1LMWB 1J15A 4NGAH 2XRCA 1EB2A 2BLOA 1ESTA 1NO9H 2YNAA 2VIDA 2EI6A 1PYTC 4VGCC 2ZTYA 4RKOB 1ETRH 4YOGA 4J2YB 4BTTB 1XMNB 3HK3B 2FWWA 1TLDA 1JRTA 4MPVA 1NFXA 1EKBB 1TMTH 2ZPSA 1AZZA 1ZHMA 1Z6EA 2M5TA 1AIXH 1MTWA 5C5NA 1KLTA 5I46H 3LC5A 1SFIA 1L1JA 1IQFA 2VWMA 3D62A 1UCYH 4AOQA 1GBBA 1K1NA 3BTDE 3I78A 2FI5E 2VIWA 1GBFA 1OP2A 2ZTXA 1KXEA 4GSOA 4THNH 4DGJA 4F49A 4KGAA 4WF8A 1GI8B 4NZQA 3U69H 2AYWA 1O2QA 1O2YA 1SG8B 1MD8A 1Y3UA 4B2BA 4DG4A 2C93B 3VGCC 4I31A 3QWCH 3KQBA 1XUGA 1EPTC 1CHOF 1IQNA 1O2JA 1KTTB 1AHTH 1S6FA 4KTCA 4FUDA 3U1JB 2THFB 2RDLA 1C1SA 1AE5A 1GHBF 1TWXB 1HAGE 4INLA 4X1NU 3TK9A 1T8MA 2H9TH 3K6YA 1OPHB 1J17T 1F5LA 1W7XH 3PMBB 3H7TA 1TQ7B 7LPRA 5JB9S 1P2MA 3KIDU 1ZSLA 3ZZ3A 4E7NA 4XSKU 3A89A 1K28D 1HNEE 1SI5H 3GCTF 4B76A 1PPGE 2A0QB 1UK2A 2GDEH 4A1XA 2OC1A 3WY8A 2TPIZ 1DLKB 1UMAH 4GCHF 1YP9A 3TH4H 1W2KH 3TJNA 1QHRB 4O9VA 5GDSH 3ATLA 1BITA 3TH3H 2CV3A 2PFEA 2GZ7A 2F9VA 3OTJE 3SJIA 4I33A 4KP0A 1FJSA 1JIMA 1GJ4H 2ASUB 2G81E 3P6ZB 1ZHPA 3NZIA 5A0AE 1BRUP 1SL3A 1GCTB 1THRH 2ZEBA 3SU4A 2XBWA 3TPIZ 2BD4A 2DUCA 2GX4A 3TNSA 1GVLA 1TALA 1DDJA 2ZA5A 3P8FA 2AH4X 5EXMA 1LPGB 4DCDA 3GY7A 1DXPA 2IOTA 5EQQA 3MMGA 1NRNH 1O3GA 1KLIH 3LGUA 4ISIH 4SGBE 5EXNA 1BA8B 1BTYA 1GDUA 1DITH 2PKAA 3GOVB 2FOAA 1LQDB 4Y8ZA 5JYIA 3FP7E 5A8YA 1VGCC 1VITF 4AFZA 1MMJN 3JZ1B 4GVUA 3DT0H 4U2WA 4Y10E 3BIVH 2VH6A 4YZUA 5B6OA 3SNAA 1T4VH 3AW0A 1YPHE 1LHGH 1XUFA 2FESH 6CHAC 2ZU4A 1V2OT 3A83A 1K2I1 1FY4A 1PQ5A 2VJ1A 3HPTB 3KQEA 1GI0A 3UFAA 3MTYA 5DP7A 3OX7U 4IMZA 2UUYA 4JCNA 2BZAA 2QXJA 1DOJA 5DPAA 2Z3CA 1BBRE 1CVWH 4MNXA 2AFQB 1VCQA 1KXDA 2CHAB 3BEIB 4J1YA 1MQ5A 1EZSC 1YCPH 3LGWA 1V3XA 3VB6A 1DSUA 1CT2E 2NU0E 2UUJB 1UK3A 3RXLA 3FZZA 1TABE 3D23A 3SO3A 3SUFA 3SHAH 3E6PH 1K1MA 4FU9A 3GDVA 1Y3YA 4OS1A 2QY0B 3RMMH 1GI2A 1PPCE 2H2ZA 3BEUA 3KF2A 4X8SH 1YPEH 2CF9H 1ACBE 4ZKSU 1C1OA 1RRKA 1XKBC 1G3DA 1SC8U 3GCHB 3V12A 2VVVA 3GY8A 1TPAE 1UTMA 1ETSH 2VWNA 3QTVH 1G36A 2UWLA 4U01A 3E0PB 2HNTE 2BVXH 2ZECA 1CA0B 3A85A 1G3EA 2O8LA 2G4UA 2GZ8A 3S9BA 4XBCA 1P2KA 2FOBA 1ANBA 3ATMA 3TU7H 1CGJE 4WVPE 3A86A 3ITIA 1EQ9A 5L2ZH 2DE9A 1TPPA 1L1NA 3OY5U 1BHXB 2A4QA 2V3OH 1K21H 1DLEA 2HRVA 1TNKA 1P02A 3O8BA 4Y0ZE 2Y5GA 5HM9A 2ZU5A 1DWDH 3BG8A 4B75A 1GBJA 4UONA 2OBQA 2NWNA 6CHAB 3VB3A 2J34A 5L2YH 3M5NA 3UOPA 1MBMA 1C5LH 1O34A 3NCLA 3S0NA 3SV7A 1AB9B 1O3IA 1XXDA 4GAWA 3SUEA 5JBTA 4NIVA 3TIUA 4K1EA 4OGXA 3MNSA 5TCCA 1AI8H 1O5FH 1W0ZU 2P95A 1DY9A 1KSNA 2UWOA 2HPPH 3D49H 3E1XB 1P9SA 3GY4A 4DW2U 1C2MA 4YT7H 1AQ7A 1O2UA 3RXUA 1OSSA 1FIZA 3FFGA 1S0QA 1DY8A 1E36B 1MTSA 3NWUA 5G4BA 1F0TA 2ZFTA 3LOXA 3SJOA 2SNVA 1MCTA 2ZIQH 3PO1C 1O2PA 3URCA 1G2LA 4DOQA 2ZTZA 3O8RA 2BDHA 1C5YB 1HAVA 3LIWA 1JXPA 2PHBA 5LPRA 3MU4A 1J14A 3U8TH 3UOUA 1SGYE 3PV4A 1F0RA 3M7QA 3H7OA 3S7KB 1V2VT 3T26A 3RLYH 1O3FA 4ABAA 2BLQA 1Y3XA 1O31A 4FUGA 3JZ2B 3KGPA 2VIOA 1C2DA 4ESTE 3E3TA 2C8ZB 1BBRK 1K1IA 1KXAA 3RXMA 1O2KA 2F9BH 4DJZB 1KDQA 2A5KA 3DFLA 4Y76A 2BB4A 4Q80A 1WTHD 1ZPZA 1FY5A 1V2RT 4VGCB 2Y5HA 4K1TA 3W95A 3TGKE 1FI8A 2Y5FA 1HBTH 2EI7A 6GCHG 2CN0H 1T7CA 1NROH 2G8TA 2OQUA 2VIQA 1BT7A 1KYNA 5FBEA 1HLTH 5DP3A 2KAIB 2VIVA 1ZPBA 3RU4D 3EA9A 1B0EA 1HDTH 1O2NA 2R2WU 1UTJA 1JRSA 2BQ6B 1OWHA 1O2TA 1D3QB 1V2QT 4B74A 2AERH 1V2TT 1W8BH 3A7WA 3P17H 1T4UH 1GWAA 4X2XA 4D9QA 4GUXA 2BM2A 1PPFE 1GCTC 4TY6A 1O5DH 3NK8A 3TLOA 2GCHG 1GHYH 1AUTC 2GT8A 4X2WA 2OP9A 3SU3A 5FPYA 3KCGH 4RN6A 3B9FH 3OYPA 1Y8TA 1DFPA 2ZGBH 3I29A 2J4IA 1Z8RA 3M3TA 1RTFB 3LGVA 5GCHF 3QGJA 3T29A 2CHAC 3SV8A 1Z8IB 1AKSB 1Z8GA 2BOHB 1W7GH 2B7DH 2D26C 4XE4A 1HJ9A 3Q77A 4Y7AA 1Q31A 2PW8H 1O3JA 1O38A 3A81A 4FUJA 3SU6A 1HJAB 1GMDF 1ZLRA 3GCOA 2NU3E 3IG6B 7GCHF 2P59A 3RC4A 5GIBA 1ZSKA 1IQHA 1WBGB 3QK1A 3SU2A 1SQAA 1NFWA 3S9AA 1LVYA 1UK4A 4O03A 1QQUA 2A7CA 3PROA 1TA6A 2TGTA 1ZTLA 3MNXA 1AZ8A 1C1WH 4IW4E 4AB9A 1F92A 1QGFA 5EXLA 1HJ8A 2QAAA 4H42U 1TB6H 2GKVE 4ISNA 4BAHB 3RUOA 3GICB 3O8DA 3RXVA 3Q3KA 3LKWA 2VGCC 1GPZA 3BTHE 4SGAE 1TAWA 4BANB 4K60A 1S85A 1LQEA 3ELAH 4NG9H 5FX6A 1QBOA 1BRCE 1UVPA 1DXWA 4UE7H 4RSPA 1O3DA 3RC6A 2V3HH 3RXIA 1C2FA 1P06A 4R0IA 2ALPA 1TX7A 2XYAA 2Y7ZA 1FDPA 1HAHH 2F9NA 5A0CA 4IMQA 5AFZH 2R9PA 5T6GA 1LHFH 2PV9B 1MUEB 2ANMH 3RXSA 1O37A 3FAOA 5C1XA 3L3TA 4GHQA 3A8AA 3UQOA 2C8WB 1EJMA 2XCFA 3PLPA 2JETC 2ALVA 1C4U2 2FPZA 2R2MB 4AFQA 2RG3A 1QR3E 3M37A 4IBLH 4NSYA 4GPGA 4UFGH 1HIAB 2I6QA 1ORFA 2Z94A 1C5QA 1C5RA 4HZHA 3FZDA 3T28A 1XUJA 2ZDLA 2BY9X 4OS5A 3VB4A 4K8YA 4MTBA 1ELEE 2FEQH 1TMBH 1QA0A 4D7GA 3BTFE 3KL6A 3LDXH 1OWEA 4OS2A 5A8XA 1A46H 4ZKRU 4UD9H 2HNTC 2JH5D 1H9LB 1XUKA 4DURA 2FX4A 1T8NA 1SGRE 4GCHG 1S84A 1E0FD 1F2SE 1NPMA 3SW2B 1GMHF 4YTAA 1O3KA 2A5AA 5EW1H 2G5NA 3EYDA 4FUHA 5E2PA 3SJ9A 4ISOA 4I8JA 2V35A 1DWCH 1N6YA 1O2LA 1P11E 1QB1A 3UPEA 3SV2H 2WV5A 3RP2A 2VVCA 1A3EH 1GJCB 2ZHQH 2Z9IA 3PLKA 2Z9JA 1O33A 1F5KU 1IQLA 2FOMB 2J95A 1IQJA 1YCPK 4TYDA 1TOMH 1NN6A 1Z71A 1QQ4A 2AMPA 1M9UA 1RTKA 1RJXB 3A8BA 3PMHB 1ZGVA 1CHOG 1EP5A 1HAIH 1UVOA 4X6PA 1EPTA 3A87A 1EX3A 1C9PA 5DP9A 3HKJB 1SB1H 1WQSA 1MTUA 4A5TS 4AYVB 1ABIH 3LC3A 3RXOA 2FIRH 1OKXA 4I8GA 2PSXA 3ZZ7A 4UFFH 1EP6A 3AW1A 2XW9A 2FI4E 1VZQH 2W5EA 5LH8A 1AFQB 4JZIA 4AN7A 1WU1A 1QFKH 4WMDA 3RC5A 2QXGA 3IWMA 4XDEA 4AG2A 1N8OC 1JWTA 2Z3EA 4ZH8A 1S5SA 1OP0A 1MKXK 1L2EA 3CENA 1HAYB 4LZ4B 1A5IA 1T8LA 5JBBS 2R0KA 1F7ZA 3ATIA 5E8EH 3SJKA 3SV6A 4AG1A 1A61H 1HJAC 1NESE 1YPGH 2G00A 4MLFB 9ESTA 4K1SA 3ESTA 3DFJA 4AORA 2Q6FA 1MTNB 1GVZA 1A1RA 2F9OA 1D4PB 1ZHRA 5E0HA 2ANYA 5ESBA 5C5OA 1D9IA 3RXRA 1UVTH 4NA7A 1A4WH 1ZSJA 1C5MD 1PYTD 2ZDNA 4Q7YA 1XUIA 4R8TB 5K7RA 2ZQ2A 2QC2A 1K1LA 2Z6BD 4MDSA 4ASHA 3ZYEA 3BN9A 2FYRA 5T3HA 5A0BA 1V2LT 3CP7A 1UVSH 2AIPA 1B7XB 3TK6A 1GDNA 3SGBE 1RFNA 1O2IA 2R3UA 4I8HA 4E05H 5PTPA 1CHGA 5LPFA 2SGAA 5DJ7A 1P2JA 1QL8A 1XXFA 1GGDC 2BX4A 3PYHA 4FUFA 1C5VA 2RA3A 1T32A 2XBVA 4JZDH 4NIWA 2WPIS 1TRNA 3B8JA 4XBBA 2ZFPH 2B8OH 1QJ1B 3ZZ5A 4A6LA 2ZC9H 2AMDA 4RKJB 1V2NT 4Y0YE 4CRFA 1YC0A 3GCTG 2P8OC 1TBRH 1MD7A 3F9GA 2XC0A 5FBIA 3S7HB 3TGIE 1INCA 4YO9A 3GYMA 3MWIU 3ZVEA 1LCYA 5EPYA 4WJG2 1GI3A 4A1TA 5AFYH 1K9OE 2BY7X 3SGQE 1ZMJA 2WPLS 1O3PB 3A88A 4CRAA 5GWZA 1PJPA 4UFDH 3QUMP 1ELVA 1P2QA 5F6MA 3FANA 1EZUC 2H5CA 2WINI 2A4GA 1CT4E 2GGVB 2UWPA 3RLWH 2I6SA 1GBEA 3UUZA 1AFEH 2ZFQH 1V2MT 3LONA 3SI3H 5EGMA 1Y59T 1AWHB 1UTPA 2XC4A 1A2CH 1O3CA 4JYUH 4U32A 1N6XA 1DT2A 4Q7XA 1S6HA 3K6ZA 1VJAU 1QJ7B 1SR5C 2BLWA 2PWXA 3SBKA 1GHBG 4CRDA 5JB8S 1RXPA 2FYQA 1CBWC 3MOCA 1SOTA 2B5TB 4I8LA 4OGYA 3VXEH 4Y7BA 1SGCA 1E38B 1D6WA 4Z0KA 5GPIB 2AIQA 2WYGA 1TNIA 4LXBH 2VINA 3V3MA 2NU1E 1TGBA 1C1NA 2C4FH 4KTSA 4E06H 5A09A 1PPHE 1P2NA 2XBYA 3BEFB 3ZV9A 2C3SA 2OC8A 2GDDA 3R3GB 4AX9H 4Q7ZA 1DWEH 5HGGA 1H9IE 4YOJA 1G9IE 1NM6A 6GCHF 1BTUA 1TRMA 1BRBE 5GXPA 3S69A 3EA7A 1GMCF 3PMAB 1FAKH 1DANH 1NT1A 1NRRH 1C2GA 1HV7A 3C1KA 1CQQA 2D8WA 2J38A 4K8BA 1GL0E 3GYLB 1SQTA 3LJJA 1P03A 1MAXA 1GI7B 3RMNH 2VB0A 1GHVH 3P8NA 1GJDB 1OXGA 1BTPA 2ZHEH 1EJAA 2SGQE 1O2SA 3KQDA 3RU4T 5FAHA 1SBWA 3MFJA 2P3UB 5EOKA 4UFEH 3SHCH 3ZZBA 1UTOA 1HAXB 4FUBA 3RXKA 3AAUA 3RMLH 3SQEE 3LPRA 1HYLA 1OYQA 1P3CA 1ZZZA 2ZDKA 1GHXH 4ZHMU 3NUMA 1ID5H 2BDYA 1QL9A 1HPGA 3QLPH 1GJ8B 1UTNA 3RXTA 2RCEA 4AZ2B 1FONA 1DSTA 1C1PA 5LGOA 3ODFA 2FI3E 4MG3A 2CXVA 4WY3A 1EAXA 3EA8A 2OC7A 3V7TA 4O3UA 2ZKSA 2FP7B 4WXIA 1F0UA 3RXPA 2AGEX 1C5ZB 5AHGH 1CBWB 2TBSA 5EW2H 2VWLA 4JZFH