3UY9A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A02
8GCHG 5E2PA 4ZUHA 1CSOE 1BTZA 3H7TA 4XBCA 4JZDH 4DCDA 3BTEE 5DP5A 4ISNA 1QQ4A 4GCHG 2LPRA 4AORA 2HNTF 2FOEA 1GI1A 3VEQB 1GGDB 2G5VA 4FU9A 2P95A 3RMMH 2ZHEH 4B74A 1HIAB 1WYKA 2BZAA 2ZEBA 1KXAA 2QF0A 3MO3A 2OC1A 1GBIA 1V2VT 3NZIA 2CF8H 5F8TA 2XC4A 3RXPA 4NG9H 1HAVA 1XXDA 3CP7A 4BNRA 3M5OA 3MFJA 3SNAA 1TNHA 4AOQA 1T32A 2BHGA 5JBCS 1EZUC 1UHBB 1LVYA 1WU1A 1Y3YA 3EA9A 2VH0A 2SGPE 1ZLRA 3RXCA 1AFEH 3LGUA 3ODDA 4J2YB 1G3DA 2CGAA 1LVMA 5E0JA 1GHAF 1QB9A 1O2TA 4U2WA 1CGHA 3D62A 2G51A 2M5TA 3U1IB 3U69H 4AFZA 2H6MA 1L1GA 1QQUA 1GPZA 1LCYA 3OU0A 4A92A 2QCYA 2P8OC 3GY2A 2B9LA 1H9LB 3E6PH 1TNIA 1MBMA 2O8WA 3RC6A 4I8GA 3TH3H 1O2OA 2PKAB 3S0NA 2AMQA 5LPEA 4X8VH 4U01A 3RXJA 1ELVA 1JRSA 3L33A 2XBWA 1TOCB 1B0FA 3SHCH 3NK8A 3AAUA 5BRRE 1HAZB 2R3YA 3BTQE 2Q6GA 2W3IA 4WH6A 1FY4A 2FMJA 1GHBF 2TGPZ 3UFAA 2GP9B 4O03A 5EODA 2BXUH 4IN2A 1VR1H 1O37A 1J9CH 2VIWA 2Z9KA 4X2VA 1O2NA 2HPQH 1K1IA 1SGTA 2AS9A 3SGAE 3ZZDA 3RUOA 1C1WH 2QN5T 1O2IA 2B8OH 2ESTE 5E0GA 5AF9H 5GXPA 2ZFRH 1Y8TA 3GCHB 4D9QA 1WOFA 4Q2KA 1QBVH 1ZTKA 1VJAU 1NO9H 1WSSH 5L2YH 1OWKA 4ISHH 4XOJA 3P8NA 2ZFQH 5C3NA 2Q6DA 3O8BA 1AVXA 3STIA 5AFYH 3RU4D 2JKHA 1SGNE 4X1NU 4JZIA 4X6NA 2GMTB 1OYTH 1PPBH 1P09A 1NRPH 5EXMA 3Q00A 1S83A 1HAVB 1LHGH 1FONA 1GL1A 1SOZA 3HKIB 4FUBA 1E36B 1G3CA 1NFWA 4DURA 2O8UA 1IQJA 1LVOA 3NCLA 4FU7A 4AG1A 3M7UA 1YKTA 1CO7E 1O2ZA 1ELCA 2IOTA 1T7CA 3U98H 3ZVDA 1HJ8A 1TPOA 1W10U 1BTWA 1IHSH 1HDTH 1KDQB 1GI8B 2ZDMA 1GI6A 1MTWA 2Q6FA 1HUTH 3A7VA 3U8RH 2CN0H 1O2MA 4CRDA 4NIWA 2Z94A 4DGJA 5A0CA 2ILNA 1PPEE 2GD4B 1O3OA 3BF6H 4X8SH 4YZUA 3QUMP 1MKWH 5C20A 1QTFA 2BM2A 5AFZH 1GHAG 1J16A 2DUCA 3TK6A 2VINA 3A82A 1MQ6A 1LQEA 4LK4A 3SO3A 4I8JA 1GVZA 3BTDE 5JPMH 3VXFH 1G37A 3DFJA 3ZZ7A 2Y6TA 2KAIA 5GCHG 2GZ9A 3PLKA 1AZZA 1GG6C 1O2XA 1BTPA 2A4QA 2V6NA 3AASA 4OS1A 1EOJA 2BD4A 1OOKB 1QY6A 5DP3A 1V2PT 2AYWA 4FUGA 3GCNA 1GHBG 3GYLB 3CENA 4ABBA 2XBYA 2AGGX 2ODPA 4FXGH 1XKBC 3P6ZB 4ISLA 3RXOA 5IDKA 2AERH 2B7DH 1HB0B 3P8GA 1OXGA 2H5DA 4NZLA 4NA7A 2W7UA 2C90B 2R0KA 4E05H 3OY5U 5GWZA 1NT1A 1NZQH 1GJ8B 3QLPH 2VVVA 3E0NB 1N8OB 2STBE 2STAE 1F0UA 2Z9LA 1LDTT 1GJDB 2A5AA 5F8XA 4NSYA 1QHRB 4UDWH 1ZHRA 3ZZ4A 4I8HA 1T31A 3A7WA 4CBOA 1AGJA 3LU9B 4E7RG 3FP6E 3LKWA 3VXEH 3MH7A 5FCRA 5EPNA 6LPRA 1IQFA 1ZYOA 3RXBA 3MU4A 1PPZA 4B2AA 3SU0A 2F9BH 3A7YA 1DUAA 1TMUH 4X6MA 5AVDA 5A09A 1ZMLA 3MU5A 1BRAA 2V35A 2HWLB 1Z8IB 4O97A 3O8RA 4XE4A 2TGTA 4Y8YA 1ANBA 2PKSB 1DWCH 3SGBE 3E1XB 2WUCA 6GCHF 1ELFA 1C1SA 1S82A 1YPLH 4YM9A 1O3AA 1V2JT 1OWJA 2XC5A 4H6SB 2ZCLP 1P9UA 1O2VA 2KAIB 1DWEH 1BHXB 3SU6A 1P3CA 4OS6A 1Y5BT 4WMDA 3M5NA 1SVPA 2R0LA 3U1JB 4DY7B 5CHAC 5DP6A 1MKXH 1A5HA 3P8FA 4BAKB 3EGKH 1RIWB 3I29A 4Y7AA 4RKOB 5DKMA 1CGIE 1MAXA 3SQHE 2Y80A 1DM4B 2BLOA 4MPUA 3M61U 2W26A 2OQUA 3PMAB 1QJ1B 3SUGA 2GT7A 5T6DA 1BHXF 1SLXB 4ZHLU 5EW2H 3RXGA 5C1XA 3LH1A 3RXMA 3LC5A 4WJG2 2ZWLH 2ANWA 2SGQE 3OYPA 1YCPM 2HPPH 3E90B 1H9IE 4HGCA 4KKDA 2C4FH 1BZXE 3RXDA 1O38A 3KN2A 1NFUA 3QTVH 4KP0A 3TIUA 2UWPA 1VITF 1AE8H 5DJ7A 1O30A 5DO4H 2RG3A 1EP5A 4J1YA 1YPKH 2WPHS 3BTHE 2ZHDA 3MYWA 2A2XH 1J15A 4JZEH 2FX6A 1VITH 1CBWB 1AMHA 1XVOA 3RU4T 3RXFA 3VPKA 1MKWK 5F8ZA 1JBUH 4TWWA 1RFNA 1YPHC 3HGNA 1UCYH 1BMNH 1JIMA 1YF4A 2P94A 4XFQA 3ZVFA 4K2YA 1O5FH 3SV8A 1ZZZA 3TITA 1SLWB 2ZGHA 1XUHA 1SGDE 1TX6A 1MTUA 1TX8A 1HFDA 2TRMA 1UK2A 2G00A 1YPGH 1O2QA 1RXPA 1LHCH 1QCPA 1LTOA 5PTPA 1Z8GA 3LONA 3EDXB 3KGPA 1RRKA 3ODFA 5AHGH 2VJ1A 4X1SU 1FY8E 1O3IA 2XYAA 2ZC9H 4JYVH 4YOGA 5A8XA 1UTNA 1MTNB 1BBRK 1S84A 4MNVA 1VGCB 3A88A 7GCHG 1Z6EA 2Y5FA 3M37A 4ZHAA 4Y11E 1GGDC 1HJ9A 4INLA 2ZU3A 1YPEH 6GCHG 3RDZA 2ZU5A 4Q7XA 3LOXA 4U30A 2BD7A 2F83A 4XSKU 2A0QB 3RMOH 3EA8A 1AD8H 1XVMA 2PR3A 2XRCA 3KQBA 3T28A 4NIVA 3QGNB 5EOKA 1GI9B 2EI6A 1BIOA 3M36A 1UK4A 3SU4A 1CT0E 1TRMA 1TPPA 1P11E 1GBMA 1O3EA 2ZU4A 3SJKA 1GBAA 1XX9A 3HATH 1TMTH 2F9NA 2ANYA 1P2NA 1EATA 2RA0A 1YGCH 1F0SA 1HAXB 1NY22 4RN6A 1KXBA 1O2JA 1TLDA 3PMHB 3SW2B 1P2IA 4MDSA 1GBFA 1BJVA 3P17H 3SNCA 1ELAA 2V3OH 1K1MA 3MH5A 3ZVAA 1SB1H 4Q7ZA 4OGYA 1DWDH 1QRZA 2BDYA 2XC0A 1TGNA 1JWTA 1HLTH 2H2ZA 1VITG 1P01A 1QL8A 1BUIA 1YPHE 1C1TA 1GDNA 2A32A 2QC2A 1DLEA 1UVOA 1Y3VA 2VB0A 3SZNA 1MZDA 4MTBA 3GY8A 2VWMA 3RM0H 2P16A 2BD9A 1FN8A 1ORFA 1IQLA 1S6HA 3TPIZ 1FPCH 1CHOF 1UVPA 3HKJB 1EZXC 3TGKE 1T8MA 2YOLA 1OS8A 1PPHE 3OY6U 1FDPA 1WV7H 3GCHC 2VNTA 1K21H 1LQDB 5I25A 1MKXK 1G32B 1SQOA 3MU1A 2BD3A 1CE5A 1O5AB 3LC3A 1C2EA 1Z71A 1AZ8A 1VJ9U 3LT3A 3MNBA 4GLYA 3L3TA 4GSOA 1TNJA 1A7SA 3AW1A 1GMHG 3BEUA 3B23B 2GMTC 1F5LA 3C1KA 2ZDAH 1YYY1 2RDLA 1ESAA 1GBLA 1SSXA 1OP2A 2K1QA 2J95A 2BLQA 2ZHFH 4D7FA 4BAOB 3SGQE 5J4QA 1AHTH 1C1VH 5EGMA 1AKSA 1AO5A 1O3MA 3GY4A 5EXNA 1YPMH 1C5RA 1TRNA 2HVXA 2XNIA 2TBSA 4UE7H 2OC7A 3RC4A 5EQQA 1ZMNA 4ZH8A 1DANH 1K1JA 2BY8X 1E38B 2BDHA 1O2WA 2G55A 3RXLA 1INCA 2VIDA 1QRWA 2V3HH 1KTSB 2FS8A 4NSVA 3V3MA 2A1DB 3TH4H 5FHTA 3IWMA 3EE0B 1GBCA 3SN8A 2VIPA 1KY9A 2ZTXA 5A0AE 1O3JA 2Z3DA 2ZFFH 5DP7A 2ZGCA 2A4OA 3VB4A 2H1UA 3SJOA 3SU5A 1Z7KA 1AY6H 1GI2A 8LPRA 4I31A 2ZP0H 3I78A 2FPZA 2FZZA 1UCYK 4ABAA 2TGDA 5TJXA 8ESTE 3ATMA 1T8NA 1WBGB 1TALA 3U8TH 4E06H 3M3VA 2D26C 1ETTH 4FUHA 5E0HA 3LDXH 2W7SA 2GZ7A 4KGAA 2A7HA 1QGFA 1ETSH 3KNXA 1WAYB 1GBHA 1Y3WA 1SQAA 1BMLA 4BXSA 1ANCA 3UNRA 1GMDF 1A3EH 1O5GH 5FPYA 1DXWA 1AI8H 2GCTB 3DFLA 5A0BA 3T27A 5GPIB 3ZZAA 3G01A 5IYTA 1KDQA 1BCUH 1O3CA 1GJ6A 2ANKH 5H4IB 5FX5A 1JMOH 1NM6A 1C5XB 1ESTA 2QXGA 1SGRE 1RS0A 4B71A 1EXFA 1LHEH 1S81A 1TRYA 1ZSLA 2GVFA 3W95A 3F9FA 1C2KA 4CBNA 1SMFE 1H8IH 3S69A 1BTUA 7ESTE 2ZTZA 1QL7A 3MU0A 3A7ZA 1FY3A 1CHOG 3GOVB 4GHQA 1C2IA 3RXQA 1C5WB 2FWWA 4BXWA 1SFQB 3ITIA 1V2QT 1EJNA 2AGEX 2ZIQH 1BTHH 1GJ5H 4IC6A 6CHAB 4D9RA 3IG6B 1UK3A 3OX7U 4Z6AH 1N8OC 1AKSB 1HJAB 1K1PA 1GDUA 1QR3E 3MH4A 4WMFA 1P3EA 4YOJA 1Z1IA 4X2YA 4O9VA 4OGXA 3S9AA 1HCGA 2Q1JA 4ZXXH 2ZFPH 3SV6A 1HXFH 4TY6A 1SGFA 5FAHA 3UREA 1A2CH 1TGTA 4DVAU 3E8LA 4TPIZ 3MTYA 1F5KU 4D7GA 1XUKA 4IGDA 5EU8A 2VIOA 1HAIH 1KLJH 3UUZA 1A0LA 1W2KH 1YPJH 3QWCH 4DIIH 3SJ9A 1LO6A 1DS2E 1PYTD 4ESTE 5CMXH 1DPOA 2BD8A 5HMAA 4K1EA 1BBRE 3C27B 1K22H 4H4FA 1GHZA 1NRNH 1ARCA 2ZECA 1ABJH 2J38A 1Y3UA 3ZV8A 3M35A 2D8WA 4O3UA 4DG4A 1OSSA 1C5VA 2PKSC 2XXLA 1P04A 2IPHA 2O8MA 2NU4E 2C8YB 4ABJA 2HGTH 2BQWB 3KL6A 1RGQA 4AX9H 1V2UT 1QBNA 2Z7FE 1FN6A 1AUTC 2ZQ2A 4IMZA 4X2XA 2J34A 1VCQA 4ABIA 1S0QA 5DG6A 9LPRA 2ZO3H 5FPTA 4UFDH 3T26A 2WYGA 4AFSA 5HXFA 1HXEH 3PLPA 3SV2H 2PSXA 1C5LH 2G8TA 1RIWC 2P59A 2BY9X 2GV7A 1UTMA 2LNCA 2ZHWH 4X2WA 1PQ5A 5DK1A 1P02A 3SNEA 1TQ0B 3FFGA 1GMDG 3Q3XA 2A5KA 1C5YB 3HPTB 2GCHF 2OC0A 4I7YH 1O3NA 2ZDNA 2VIVA 1C5TA 2C3SA 1A4WH 1DSTA 1EB1H 4MNYA 2Y5GA 1A5GH 2RCEA 3A89A 3GISB 2BYAX 2CHAB 4H42U 2PHBA 2BTCE 3URCA 1AB9B 2WPJS 4FUEA 4IC5A 3A83A 4X1QU 3TLOA 4ABHA 1WQVH 3Q3YA 2CJIA 1C4V2 1KSNA 3D23A 2FX4A 3MI4A 3ZZ9A 4HFPB 3A80A 1FQ3A 1KLIH 3PYHA 4ZXYH 2A7CA 5JBTA 1BTXA 1P9SA 1O5CB 2VWOA 3PROA 3AVZA 3QK1A 1Z8JB 1HAHH 1G36A 3TJVA 1W0YH 5C2ZA 2XCFA 4F4OC 3A8AA 5GIBA 5C5NA 1RTLA 2FESH 3DA9B 1CBWC 1NU9A 3RXUA 1BQYA 4IMQA 4UEHH 3R3GB 1EAIA 1S5SA 4ABEA 1PQ7A 1F5RA 3GY5A 4AYVB 1RTKA 1THPB 5T3HA 1GI4A 1A3BH 1E35B 2GZ8A 3RXHA 3GDUA 2DE8A 3BN9A 4KELA 3ZZ3A 3ENSB 2F9VA 2VIQA 2ZDLA 3ELAH 2J2UA 1IQGA 2FP7B 3SUFA 2HALA 1NTPA 1C2GA 1D3DB 2BDAA 3RXAA 4DJZB 3ESTA 1GL0E 4ZKSU 3MOCA 2FS9A 4ZKRU 1MTNC 1X7AC 1O5EH 4BOHA 1RTFB 1VGCC 1TBQH 1O3PB 2FI5E 2VU8E 3UQOA 5EW1H 4DIHH 2WV5A 3SORA 1F7ZA 4K69A 3ZVBA 1ZTJA 4K3JA 5FX6A 2QXJA 3A8BA 1UMAH 2BMGB 2XBVA 4FUCA 5ETXA 2J92A 1C9PA 3SV9A 2BXTH 4CR9A 1T8LA 1XXFA 5K7RA 1SI5H 3UY9A 1E37B 1O35A 1K2I1 2I6SA 2ZFTA 3BTTE 4TY7A 2BD2A 1W13U 2FXRA 1ZMJA 2FLRH 1WUNH 1UCYE 3K65B 3LGTA 2H5CA 1VCPA 2BDBA 3QZQA 5EG4A 1QRXA 1P2QA 3BIUH 4AFQA 1SC8U 1P12E 3HGPA 3VB6A 5FPSA 1TQ7B 4AFUA 1B7XB 1AQ7A 2FODA 3ATIA 2BVSH 4JMYA 1NRSH 1TNGA 3KEEA 1GCDA 3PLBA 1O3FA 3D49H 2OTVA 2BX4A 3IITA 4OS2A 3MO9A 5E2OA 1IOEA 3SUEA 2XTTB 1TONA 5L30H 3PO1B 3HK3B 1N1LA 1HAOH 1GBKA 2OQ5A 3URDA 1ZRKA 1V2OT 2FYQA 3BTME 4B75A 3TJNA 2FEQH 4TWYA 4UFFH 1OWHA 1L2EA 2FOBA 1JIRA 1ZPZA 3QDZB 2AIPA 5F6MA 1DY8A 1AWHB 1SLVB 3LPRA 1GVKB 1KXCA 3QGJA 3U8OH 5J4SA 1EOLA 1MTSA 1SL3A 5HM2A 3ATLA 1C1RA 1O3KA 3A84A 5ESTE 1P57B 3VB3A 1B0EA 1GBDA 4MG3A 1H9HE 1NS3A 1DX5M 1QL9A 1YLCA 3SBKA 2VVCA 2SGFE 1GI3A 4U32A 1C5UA 1K28D 1EQ9A 1SGQE 2ZDKA 5DPAA 1HAYB 4B76A 4FUFA 2AMPA 4JK5A 1GI7B 2ZPQA 3TJOA 1C5SA 2F3CE 1SGFG 1PJPA 1FAXA 4ZAEA 3SHAH 1O2LA 3A85A 3GICB 1P2KA 1MZAA 2BQ6B 4ZMAH 3ZYEA 5C1UA 4AYYB 1V2NT 1C1QA 2ZGXH 1EASA 1GBEA 1LPKB 4MVNA 3DD2H 4HTCH 4O3TA 1ELTA 1UTPA 1C2DA 1MCTA 5GJ4B 3RC5A 3EYDA 1O5BB 1GMCF 1ELEE 1V2TT 1A0HB 3GCOA 4F49A 2PUQH 3VFEA 4X0WU 1KIGH 2HNTC 1GHXH 1OWDA 5L2ZH 1THRH 1EAXA 1P8VC 4UD9H 4UFGH 4D76A 1NRQH 2UUKB 2FOCA 1O31A 1MD7A 1SGPE 1OP8A 2ZCHP 1JOUB 2WPIS 3NUMA 1CHGA 1C1PA 2B5TB 1DY9A 1GJ9B 2ZPRA 1TWXB 2WYJA 1FMGA 1LPZB 1EZQA 1D9IA 1TPAE 3RXKA 3PTBA 1GJ7B 1N6YA 3BG4B 4NA9H 4LZ4B 4JYUH 2P3FH 1EX3A 1O34A 1UTLM 2ULLA 4Y0ZE 2JH6D 3UIRA 4B1TA 1KXDA 1QIXB 2QXIA 1LMWB 4RKJB 3RU4E 1V2WT 4Y0YE 1V2ST 3T29A 2BVRH 2OUAA 4YT6H 3T62A 1AVGH 1BRUP 1P2JA 1GBJA 5FCKA 1CA0B 3LGYA 1RJXB 1IQEA 1C5QA 3NKKA 4K60A 4BANB 1O39A 2CMYA 1NROH 2GCTC 1T8OA 2Y82A 4INKA 3KCGH 1TOMH 5FBIA 1SR5C 7KMEH 3B9FH 1B5GH 3F68H 2UWOA 1AU8A 3UQVA 1S85A 3F1SB 2ZGBH 2SGDE 1DDJA 2A4GA 2ZDVH 1NPMA 1AIXH 1VZQH 1EB2A 3F9HA 1ZJDA 1HYLA 5K0HA 2PV9B 2B0FA 1KXFA 4GCHF 1NC6A 4MPVA 4CRBA 3K2UA 5C67A 2FLBH 3SU1A 3MU8A 1BITA 1MQ5A 4WXIA 5GDSH 5SGAE 5FXLA 2GDEH 5G4BA 1S0RA 2BD5A 2XW9A 3LJJA 6CHAC 1SGCA 1A0JA 1ZHMA 1V2LT 2OC8A 4Q80A 4A6LA 3LJOA 2J94A 1G2MA 1HJAC 1DICA 2BDCA 4HI3A 2H9EH 4Y7BA 1T4VH 1WTHD 2QGRA 2BLWA 1EP6A 4MPXA 5EXLA 1P0SH 3HK6B 3OSYA 1GHYH 5TCCA 2PLXA 1EPTB 2CXVA 2HNTE 1TYNA 4ABGA 2FOFA 1C2JA 1ZSJA 2G4TA 3K6ZA 2VH6A 4B2CA 1MTVA 3GY7A 5FBEA 4A1TA 2TPIZ 4NWLA 3PM3A 1UTJA 1O36A 5L6NH 2ZKSA 1PPCE 2C8ZB 4YO9A 5JB8S 2J9NA 5HM9A 1W14U 3FANA 2TIOA 3PWBA 1P10A 3BEFB 1Q31A 4A1VA 5HYOA 3GY3A 4JYTA 4ZKOU 4D8NA 2UUFB 3A8DA 1AFQB 1G3BA 2TGAA 1O2YA 1O0DH 2QIQA 1A5IA 1BT7A 1GBTA 4JCNA 1V2RT 4OS7A 1MUEB 1FY1A 1D4PB 2F9UA 3FP7E 9ESTA 3FZZA 1Y5UT 1XUJA 3TK9A 3KF2A 1BDAA 1FAKH 4CHAB 1XMNB 2VGCB 1J8AA 4ISIH 1FJSA 3SU2A 2ODQA 3R0FA 1K1NA 1FLEE 1A1RA 1MMJN 3STJA 4YLUA 4I32A 2H9HA 1CVWH 4PROA 2UWLA 2Z9JA 3DHKH 3A8CA 1DT2A 1TIOA 4X8TH 2BY7X 2Y81A 2A2QH 1EJMA 1SBWA 2OD3B 3F9EA 3SOSA 5JBBS 1KXEA 1KTTB 4A5TS 4IW4E 4TYDA 1NESE 1ZR0A 1AE5A 2R2WU 4WMEA 4AB8A 1O33A 2OINA 3M3SA 2G4UA 1DE7H 3TU7H 4DT7B 2CHAC 1PPFE 1TPSA 2A7JA 2O8TA 1K9OE 2ZA5A 1AB9C 3T25A 1BMAA 1L1NA 1QBOA 3M7TA 3KIDU 4WH8A 3GCTF 2PGBB 3S9CA 4Y76A 4I8KA 1O3LA 2QA9E 1SG8B 1HAPH 1C9TA 2R3UA 2IN2A 1CGJE 1QFKH 3FP8E 2EA3A 4MPWA 1OP0A 2QXHA 1LHFH 3PV4A 1Y5AT 2G81E 2XWBI 3LGIA 4VGCB 3TK5A 2GX4A 5HGGA 2Z3CA 3EAJA 2XCNA 1TA2A 3PMBB 1IAUA 3MHWU 8KME2 2OP9A 1TNLA 3GY6A 4CH2B 4ZHMU 1F0RA 2SGAA 1A61H 5LGOA 1TGSZ 3A86A 1O3DA 4CRAA 2C8WB 3KQEA 1HV7A 1ARBA 3P95A 2G52A 2UUYA 3RXVA 1ANEA 2AH4X 1Z6JH 2GT8A 1QA7A 2BLVA 4UFEH 4WF8A 4X1RU 2BDIA 4BAQB 3UNSA 2F9PA 1FI8A 3P92A 4X6OA 1TFXA 3TGIE 3B8JA 2GDDA 4XDEA 3Q3KA 1G9IE 3RXSA 3ZZCA 4BAMB 1EKBB 2ZU1A 3SU3A 2CF9H 2O8LA 3ATWA 3SV7A 5I46H 4HZHA 3SNDA 3MWIU 2FI4E 2BZ6H 1P2OA 3LIWA 1LVBA 2FDAA 1IQHA 2C93B 3ZV9A 3ZZ8A 1HPGA 3ZVEA 1HNEE 1GHVH 3UOUA 2ZF0H 4CREA 4YT7H 3UTUH 3RP2A 4BAHB 1DOJA 1FV9A 1RD3B 2C8XB 4FUJA 1QJ7B 3E16B 5GCHF 1AUJA 3QN7A 1JXPA 1MBQA 1Q3XA 4LOYH 5DP9A 1C1NA 3O8DA 2ZPSA 3E0PB 2SNVA 1TAWA 3JZ2B 4BTTB 1D3TB 3OTJE 2BB4A 3GDVA 2PSYA 3RXTA 1ZTLA 3CS7A 3TNSA 3BTKE 1HBTH 1O3BA 4CRCA 1IQIA 4LXBH 1DXPA 1HRTH 3UPEA 2ZHQH 4NFFA 3QX5H 4CR5A 1XUIA 3VGCB 2HRVA 4DW2U 2D1JA 1FUJA 1SLUB 1C5MD 2ASUB 5DP8A 1BMMH 2ZG0H 2ZZUH 3PO1C 3GCTG 4K1TA 1C4U2 1TB6H 4YLQH 2FI3E 3UNQA 1IQKA 3UOPA 3UWJH 4OS5A 4UONA 4KTSA 2FTLE 5JBAS 3EA7A 4AGKA 1J17T 2JETB 1BOQA 1QB1A 2Z6BD 2QY0B 3RM2H 1C2HA 1ZJKA 2BDGA 2EC9H 3A81A 4NZQA 2A45B 1SHHB 3SI4H 2Y7ZA 4JZ1A 1TBZH 4Y6DA 2W3KA 1GCTB 5ESBA 3MO6A 2OCVB 1CT2E 3RMLH 3MH6A 3AW0A 4MLFB 1FPHH 1SFIA 4Y71A 3NPSA 1SOTA 2W5EA 4SGAE 4B73A 4IBLH 2AGIX 4I33A 4X8UH 4FVDA 4GUXA 5LPFA 3WY8A 3TVJB 5LPRA 1GBBA 5BPEA 1BTYA 2ZU2A 1TE0A 4AGJA 1D6RA 1CT4E 3S9BA 4IN1A 1YBWA 4Y8ZA 1V2MT 2XWAA 1D6WA 2OLGA 4A7IB 2WINI 1ELDE 1UTKA 1O3HA 4CH8B 3UR9A 2PWXA 1MCVA 4DOQA 4INHA 4YOIA 3MNSA 3A7XA 1W7XH 2FO9A 1AN1E 4BTUB 1O3GA 3SQEE 4Z0KA 2VWLA 2FTMA 1O2UA 2CV3A 4A1XA 7LPRA 5C5OA 3FVFB 5T6FA 1C1OA 2V0BA 4GHTA 4B2BA 1NU7B 4WY3A 1LKBA 1BBRH 2AEIH 1DITH 2FOMB 3FZDA 3KHVA 1L4DA 1H1BA 1IQNA 3A87A 3W94A 1OKXA 2GKVE 1YLDA 1QURH 1FNIA 1NRRH 3PTNA 1SQTA 3NXPA 2PFEA 1V6DA 1Q2WA 1PPGE 3BTFE 1MU8B 3BG4C 2YNAA 1C1MA 3E3TA 1D3PB 1EJAA 2HLCA 2ZCKP 3SUDA 1VCWA 1C4Y2 2P8OB 2UUJB 4NIXA 3SJ8A 3CS0A 4NWKA 1W8BH 5ABWA 1EAWA 4X1PU 1JRTA 1C5PA 3TGJE 4R8TB 2QF3A 4GAWA 3BV9B 1ZPCA 4FVBA 1UO6A 1GVLA 1GDQA 4KTUA 4XBBA 2XBXA 1CA0C 1C5ZB 1AWFH 2WPMS 4MQAA 5E8EH 1UTOA 1OX1A 4ZKNU 4JZFH 3ZZ6A 1FIWA 1CQQA 1TBRH 2ALPA 1C5NH 4THNH 3U9AH 2WPKS 1GWAA 3M5MA 2FOHA 2GCHG 1P05A 1EUFA 1O2KA 3GYMA 3KQCA 3PMJA 1OPHB 5EQRA 3N7OA 1ETRH 1O2SA 4FUDA 1PYTC 2DE9A 3Q77A 2QV1A 3M7QA 2D2DA 1MU6B 2F9OA 1C2FA 1T4UH 2BY5X 1YCPH 1TABE 2RA3A 1IQMA 1W3CA 2PGQB 3F6UH 7GCHF 5A2MH 1LPGB 1CU1A 1ELBA 2HOBA 2PTCE 3QZRA 1FZZA 1L1JA 2ALVA 1BJUA 3DT0H 4ABDA 3SJIA 3ZYDA 1C2MA 4MNXA 1H4WA 3H7OA 4OS4A 1XUFA 2ZTYA 2H9TH 1O2RA 4WXVA 1BRCE 1THSH 5TCAA 3AAVA 1N6XA 2JH0D 1EPTC 5T6GA 2R9PA 3V0XA 1SPJA 1GJ4H 4FU8A 2QAAA 2NU0E 1YP9A 2FM2A 1ANDA 1O32A 1S6FA 1GHWH 4KTCA 1TGBA 1BRBE 2OBOA 1L4ZA 4TPYA 3V12A 3K6YA 3K9XB 4K5ZA 1ZRBA 3ZVGA 4NIYA 1FXYA 2JH5D 1W0ZU 1E0FD 2AIQA 2BOKA 4ASHA 1KYNA 1G3EA 1NFXA 1E34B 3DUXH 1ELGA 4ISOA 1U6QA 3EQ0H 2Y5HA 2G5NA 1AFQC 1QB6A 1WCZA 1W12U 3MNCA 4AG2A 3BG8A 1O5DH 1NN6A 3BSQA 4FUIA 1DWBH 2P93A 5EQSA 4CRFA 1Z1JA 3S7KB 4JK6A 2BOHB 1ZPBA 3ZZ5A 3TH2H 2FIRH 3V7TA 2ZGJA 4CHAC 2Z9GA 2VGCC 2OXSA 4WVPE 1C2LA 1Y3XA 4K8YA 1V3XA 1GG6B 4M7GA 1EPTA 2PW8H 2FOAA 3ZZBA 1OWIA 1TMBH 4AB9A 2NU2E 5B6OA 5JDUB 1WQSA 3PB1E 5F03A 2GGVB 2A5IA 1H8DH 1L0ZA 1O2HA 2A31A 1ZGVA 4ZROA 3D65E 5DP4A 1LHDH 4ABFA 3PWCA 5LH8A 2OBQA 4K8BA 1YM0A 2F91A 3L6PA 2NU3E 1PQ8A 1J14A 1XKAC 2BQ7B 1NFYA 3T2NA 1TNKA 3LH3A 3F9GA 3KQDA 4AN7A 4E7NA 2EEKA 4NA8A 3SI3H 3H5CB 2GTBA 4GPGA 3O8CA 1GMHF 4BTIB 1FIZA 3S7HB 5CE1A 2SFAA 2FYRA 2R2MB 1PQAA 4VGCC 1CA8B 3MNXA 1ZSKA 3MMGA 4Y10E 5JYIA 3QO6A 1PFXC 4YESB 1V2KT 1EZSC 2P3UB 3P70B 2Z3EA 2FOGA 1W7GH 2YNBA 2O9QA 3E91A 1SHYA 6ESTA 1ZGIA 4GVUA 1F92A 4WWYA 2BX3A 2NWNA 2AFQB 1AVWA 8GCHF 2GV6A 4XBDA 4H6TA 2P3TB 2WUBA 1BA8B 4RSPA 5DGJA 2ZNKH 4Q7YA 2VWNA 2EI8A 2ZI2H 3RXEA 2BVXH 3BIVH 3ATKA 4Y8XA 1ESBA 1MH0A 1SGIB 4QT8C 4K1SA 1D3QB 1GI0A 1XUGA 5EPYA 3RMNH 2BY6X 4NGAH 3JZ1B 3BTGE 3GDSA 3NWUA 1DLKB 1UJ1A 1UTQA 5C1YA 2J4IA 4IS5A 1TA6A 1YC0A 1DUEA 2SNWA 3P8OA 1XM1A 4CRGA 1HIAA 1DSUA 3BEIB 5CHAB 1GJAB 4SGBE 1YCPK 5A8YA 3TNTA 1GMCG 5JB9S 1ABIH 2QYIA 4AZ2B 3VB7A 2PUXB 3I77A 4MNWA 1DFPA 2WPLS 3Q76A 1P2MA 1M9UA 1GJCB 3SNBA 1O2GH 1UVSH 1C1UH 3M3TA 1ACBE 2THFB 2Z9IA 1UHBA 1HAGE 2ODYB 4R0IA 1Z8RA 1LKAA 1UVTH 1W11U 2I6QA 3UWIA 3T5FH 3UR6A 1SGEE 1GJBB 1K1LA 1WTGH 1K1OA 1ID5H 1GI5A 3LGVA 2PTNA 3TJUA 4Y79A 1ZHPA 4I8LA 3VB5A 3VGCC 1TX7A 3RLWH 1UVUH 2Y7XA 1MAYA 1DVAH 1OYQA 2AMDA 4NFEA 1C5OH 1EAUA 1Y59T 1P03A 2ZFSA 1G30B 3QTOH 2SGEE 3LGWA 1A46H 1IHTH 1F2SE 4LZ1H 2PKAA 1SGYE 1OWEA 1QNJA 3A7TA 3RXIA 3BTWE 1KLTA 3M5LA 1FY5A 2JETC 4NCYA 3RXRA 1F0TA 1MD8A 1TGCA 1G2LA 1BB0B 2ANMH 2EI7A 1QA0A 5A8ZA 3ZVCA 2IJOB 3FAOA 3RLYH 1ZOMA 4YTAA 1GCTC 4X6PA 1O2PA 2A4RA 2ZQ1A 3V13A 2WV4A 1QJ6B 2NU1E 2VVUA 1P06A 1HGTH
chains in the Genus database with same CATH superfamily
8GCHG 5E2PA 4ZUHA 1CSOE 1BTZA 3H7TA 4XBCA 4JZDH 4DCDA 3BTEE 5DP5A 4ISNA 1QQ4A 4GCHG 2LPRA 4AORA 2HNTF 2FOEA 1GI1A 3VEQB 1GGDB 2G5VA 4FU9A 2P95A 3RMMH 2ZHEH 4B74A 1HIAB 1WYKA 2BZAA 2KM0A 2ZEBA 1KXAA 2QF0A 3MO3A 2OC1A 1GBIA 1V2VT 3NZIA 2CF8H 5F8TA 2XC4A 5KEDA 3RXPA 4NG9H 1HAVA 1XXDA 3CP7A 4BNRA 3M5OA 3MFJA 3SNAA 1TNHA 4AOQA 1T32A 2BHGA 2F4LA 5JBCS 1EZUC 1UHBB 1LVYA 1WU1A 1Y3YA 3EA9A 2VH0A 2SGPE 1ZLRA 3RXCA 1AFEH 3LGUA 3ODDA 1W0KD 4J2YB 1G3DA 2CGAA 1LVMA 5E0JA 1GHAF 1QB9A 1O2TA 4U2WA 1CGHA 3D62A 2G51A 2M5TA 3U1IB 3U69H 4AFZA 2WSSD 2H6MA 1L1GA 1QQUA 1GPZA 1LCYA 3OU0A 4A92A 2QCYA 2P8OC 3GY2A 2B9LA 1H9LB 3E6PH 1TNIA 1MBMA 2O8WA 3RC6A 4I8GA 3TH3H 1O2OA 2PKAB 3S0NA 2AMQA 5LPEA 4X8VH 4U01A 3RXJA 1ELVA 1JRSA 3L33A 2XBWA 1TOCB 1B0FA 2K8IA 3NK8A 3SHCH 2PP6A 3AAUA 5BRRE 1HAZB 2R3YA 3BTQE 2Q6GA 2W3IA 4WH6A 1FY4A 2FMJA 1GHBF 2TGPZ 3UFAA 2GP9B 4O03A 5EODA 2BXUH 4IN2A 1VR1H 1O37A 1J9CH 2VIWA 2Z9KA 4X2VA 1O2NA 2HPQH 1K1IA 1SGTA 4P00A 2AS9A 3SGAE 3ZZDA 3RUOA 1C1WH 2QN5T 1O2IA 2B8OH 2ESTE 5E0GA 5AF9H 5GXPA 2ZFRH 1Y8TA 3GCHB 4D9QA 1WOFA 4Q2KA 1QBVH 1ZTKA 1VJAU 1NO9H 1WSSH 5L2YH 1OWKA 4ISHH 4XOJA 3P8NA 2ZFQH 5C3NA 2Q6DA 3O8BA 1AVXA 3STIA 5AFYH 3RU4D 2JKHA 1SGNE 4X1NU 4JZIA 4X6NA 2GMTB 1OYTH 4ACBA 1PPBH 1P09A 1NRPH 1MABB 5EXMA 3Q00A 1S83A 1HAVB 1LHGH 1FONA 1GL1A 1SOZA 3HKIB 4FUBA 1E36B 1G3CA 1NFWA 4DURA 2O8UA 3WWFA 1IQJA 1LVOA 3NCLA 4FU7A 4AG1A 3M7UA 1YKTA 1CO7E 1O2ZA 3NRLA 1ELCA 2IOTA 1T7CA 3U98H 3ZVDA 1HJ8A 1TPOA 1W10U 1BTWA 1IHSH 1HDTH 1KDQB 1GI8B 2KFWA 2ZDMA 1GI6A 1MTWA 2Q6FA 1HUTH 3A7VA 3U8RH 2CN0H 1O2MA 4CRDA 3OAAD 4NIWA 2Z94A 4DGJA 5A0CA 2ILNA 1PPEE 2GD4B 1O3OA 3BF6H 4X8SH 4YZUA 3QUMP 1MKWH 5C20A 1QTFA 2BM2A 5AFZH 1GHAG 1J16A 2DUCA 1YLNA 5GNDA 3TK6A 2VINA 3A82A 1MQ6A 1LQEA 4LK4A 3SO3A 4I8JA 1GVZA 5C0TA 3BTDE 5JPMH 5C94A 3VXFH 1G37A 3DFJA 3ZZ7A 3UAIC 2Y6TA 2KAIA 2YMSB 5GCHG 2GZ9A 3PLKA 1AZZA 1GG6C 1O2XA 1BTPA 2A4QA 2V6NA 3AASA 4OS1A 1EOJA 2BD4A 1OOKB 1QY6A 5DP3A 4B6FA 1V2PT 2AYWA 4FUGA 3GCNA 1GHBG 3GYLB 3CENA 4ABBA 2XBYA 2XOKD 2AGGX 3WWBA 2ODPA 4FXGH 1XKBC 3P6ZB 4ISLA 3RXOA 5IDKA 2AERH 2B7DH 1HB0B 3CNRA 3P8GA 1OXGA 2H5DA 4NZLA 4NA7A 2W7UA 2C90B 2R0KA 4E05H 3OY5U 5GWZA 1NT1A 1NBMD 1NZQH 1GJ8B 3QLPH 2VVVA 3E0NB 1N8OB 2STBE 2STAE 4DT4A 1F0UA 2Z9LA 1LDTT 1GJDB 2A5AA 5F8XA 4NSYA 1QHRB 4UDWH 1ZHRA 3ZZ4A 4I8HA 5CHBA 1T31A 3A7WA 4CBOA 1AGJA 3LU9B 5KECA 4E7RG 3FP6E 3LKWA 3VXEH 3MH7A 5FCRA 5EPNA 6LPRA 2EQNA 1IQFA 1ZYOA 3RXBA 3MU4A 1PPZA 4B2AA 3SU0A 2F9BH 3A7YA 5CDFE 1DUAA 1TMUH 4X6MA 5AVDA 5A09A 1ZMLA 3MU5A 1BRAA 2V35A 2HWLB 1Z8IB 4O97A 3O8RA 4XE4A 2TGTA 4Y8YA 1ANBA 2PKSB 1DWCH 3SGBE 3E1XB 2WUCA 6GCHF 1ELFA 1C1SA 1S82A 1YPLH 4YM9A 1O3AA 1V2JT 1OWJA 2XC5A 4H6SB 1WXRA 2ZCLP 1BMFD 1P9UA 1O2VA 2KAIB 1DWEH 1BHXB 3SU6A 1P3CA 4OS6A 1Y5BT 4WMDA 3M5NA 1SVPA 2R0LA 3U1JB 4DY7B 5CHAC 5DP6A 1MKXH 1A5HA 3P8FA 4BAKB 3EGKH 2HLDD 1RIWB 3I29A 4Y7AA 4RKOB 5DKMA 1CGIE 1MAXA 3SQHE 2Y80A 1DM4B 2BLOA 4MPUA 1QZ8A 3M61U 2W26A 2OQUA 3PMAB 1QJ1B 3SUGA 2GT7A 2F43B 5T6DA 1BHXF 1SLXB 4ZHLU 5EW2H 3RXGA 5C1XA 3LH1A 3RXMA 3LC5A 4WJG2 2ZWLH 2ANWA 2SGQE 3OYPA 1YCPM 2HPPH 3E90B 1H9IE 4HGCA 4KKDA 2C4FH 4HG6A 1BZXE 3RXDA 1O38A 3KN2A 1NFUA 3QTVH 4KP0A 3TIUA 2UWPA 1VITF 1AE8H 5DJ7A 1O30A 5DO4H 2RG3A 1EP5A 4J1YA 1YPKH 2WPHS 3BTHE 2ZHDA 3MYWA 2A2XH 1J15A 4JZEH 2FX6A 1VITH 1CBWB 1AMHA 1XVOA 3RU4T 3RXFA 3VPKA 1MKWK 5F8ZA 1JBUH 4TWWA 1RFNA 1YPHC 3HGNA 1UCYH 1BMNH 1JIMA 1YF4A 2P94A 4XFQA 3ZVFA 4K2YA 1O5FH 3SV8A 1ZZZA 3TITA 1SLWB 2ZGHA 1XUHA 1SGDE 2L6OA 1TX6A 1MTUA 1TX8A 1HFDA 2TRMA 1UK2A 3UB0A 2G00A 1YPGH 1O2QA 1RXPA 1LHCH 1QCPA 1LTOA 5PTPA 1Z8GA 3LONA 3EDXB 3KGPA 1RRKA 3ODFA 5AHGH 2VJ1A 4X1SU 1FY8E 1O3IA 2XYAA 2ZC9H 4JYVH 4YOGA 5A8XA 1UTNA 1MTNB 1BBRK 1S84A 4MNVA 3W1EA 1VGCB 3A88A 7GCHG 1Z6EA 5EIYA 2Y5FA 3M37A 4ZHAA 4Y11E 1GGDC 1HJ9A 4INLA 2ZU3A 1YPEH 6GCHG 3RDZA 2ZU5A 4Q7XA 3LOXA 4OM9A 4U30A 2J5UA 2BD7A 2F83A 4XSKU 2A0QB 3RMOH 3EA8A 1AD8H 1XVMA 2PR3A 2XRCA 3KQBA 3T28A 4NIVA 3QGNB 5EOKA 1GI9B 2EI6A 1BIOA 3M36A 1UK4A 3SU4A 1CT0E 1TRMA 1TPPA 1P11E 1GBMA 1O3EA 2ZU4A 3SJKA 1GBAA 1XX9A 3HATH 1TMTH 2F9NA 2ANYA 1P2NA 1EATA 2RA0A 1YGCH 1F0SA 1HAXB 1NY22 4RN6A 1KXBA 1O2JA 1TLDA 3PMHB 3SW2B 1P2IA 4MDSA 1GBFA 1BJVA 3P17H 3SNCA 1ELAA 2V3OH 1K1MA 3MH5A 3ZVAA 1SB1H 4Q63A 4Q7ZA 4OGYA 1DWDH 1QRZA 2BDYA 2XC0A 1TGNA 1JWTA 1HLTH 2H2ZA 1VITG 1P01A 1QL8A 1BUIA 1YPHE 1C1TA 1GDNA 2A32A 2IJD1 2QC2A 1DLEA 1UVOA 2QF4A 1Y3VA 2VB0A 3SZNA 1MZDA 4MTBA 3GY8A 2VWMA 3RM0H 2P16A 2BD9A 1FN8A 1ORFA 1IQLA 1S6HA 3TPIZ 1FPCH 4RI0A 1CHOF 1UVPA 3HKJB 1EZXC 3TGKE 1T8MA 2YOLA 1OS8A 1PPHE 2QE7D 3OY6U 4Z1MD 1FDPA 1WV7H 3GCHC 2VNTA 1K21H 1LQDB 5I25A 1MKXK 1G32B 1SQOA 3MU1A 2BD3A 1CE5A 1O5AB 3LC3A 1C2EA 1Z71A 1AZ8A 1VJ9U 3LT3A 3MNBA 4GLYA 3L3TA 4GSOA 1TNJA 1A7SA 3AW1A 1GMHG 3BEUA 3B23B 2GMTC 1F5LA 3C1KA 2ZDAH 1YYY1 2RDLA 1ESAA 1GBLA 1SSXA 1OP2A 2K1QA 2J95A 2BLQA 2ZHFH 4D7FA 3FOAA 4BAOB 3SGQE 5J4QA 1AHTH 1C1VH 5EGMA 1AKSA 1AO5A 1O3MA 3GY4A 5EXNA 1YPMH 1C5RA 1TRNA 2HVXA 2XNIA 2TBSA 5DSFA 4UE7H 2OC7A 3RC4A 5EQQA 1ZMNA 4ZH8A 1DANH 1K1JA 2BY8X 1E38B 2BDHA 1O2WA 2G55A 3RXLA 1INCA 2VIDA 1QRWA 2V3HH 1KTSB 2FS8A 4NSVA 3V3MA 2A1DB 3TH4H 5FHTA 3IWMA 3EE0B 1GBCA 3SN8A 2VIPA 1KY9A 2ZTXA 5A0AE 1O3JA 2Z3DA 2ZFFH 3F2GA 5DP7A 2ZGCA 2A4OA 3VB4A 2H1UA 3SJOA 3SU5A 1Z7KA 1AY6H 1GI2A 8LPRA 4I31A 2ZP0H 2K0QA 3I78A 2FPZA 2FZZA 1UCYK 4ABAA 2TGDA 5TJXA 8ESTE 4M9FA 3ATMA 2LP6A 1T8NA 1WBGB 1TALA 3U8TH 4E06H 2JJ2D 3M3VA 1WDIA 2D26C 1ETTH 4FUHA 5E0HA 3LDXH 2W7SA 2GZ7A 4KGAA 4XRNA 2A7HA 1QGFA 1ETSH 3KNXA 1WAYB 5HKKD 1GBHA 1Y3WA 1SQAA 1BMLA 4BXSA 1ANCA 3UNRA 2YMSC 1GMDF 1A3EH 4F48B 1O5GH 5FPYA 4F55A 1DXWA 1AI8H 2GCTB 3DFLA 5A0BA 3T27A 5GPIB 3ZZAA 3G01A 5IYTA 1KDQA 1BCUH 1O3CA 1GJ6A 2ANKH 5H4IB 5FX5A 1JMOH 1NM6A 1C5XB 1ESTA 2QXGA 1SGRE 1RS0A 4B71A 1EXFA 1LHEH 1S81A 1TRYA 1ZSLA 2GVFA 3W95A 3F9FA 1C2KA 4CBNA 3OEED 1SMFE 1H8IH 3S69A 1BTUA 7ESTE 3VG8A 2ZTZA 1QL7A 3MU0A 3A7ZA 1FY3A 1CHOG 3GOVB 4GHQA 1C2IA 3RXQA 1C5WB 2FWWA 4BXWA 1SFQB 3ITIA 1V2QT 1EJNA 2AGEX 2ZIQH 1BTHH 1GJ5H 4IC6A 6CHAB 2M2AA 4D9RA 3IG6B 1UK3A 3OX7U 2HVYB 4Z6AH 1N8OC 1AKSB 1HJAB 1K1PA 1GDUA 1QR3E 3MH4A 4WMFA 1P3EA 4YOJA 1Z1IA 4X2YA 4O9VA 4OGXA 3S9AA 1HCGA 2Q1JA 4ZXXH 2ZFPH 3SV6A 1HXFH 4TY6A 1SGFA 2QF5A 5FAHA 3UREA 1A2CH 1TGTA 4DVAU 3E8LA 4TPIZ 3MTYA 1F5KU 4D7GA 1XUKA 4IGDA 5EU8A 2VIOA 1HAIH 1KLJH 1S6LA 4XD7D 3UUZA 1A0LA 1W2KH 1YPJH 3QWCH 4DIIH 3SJ9A 1LO6A 1DS2E 1PYTD 4ESTE 5CMXH 1DPOA 2BD8A 5HMAA 3PRDA 4K1EA 1BBRE 3C27B 1K22H 4H4FA 1GHZA 1NRNH 1ARCA 2ZECA 1ABJH 2KX4A 2J38A 1Y3UA 3ZV8A 3M35A 2D8WA 4O3UA 4DG4A 1OSSA 4I86A 1C5VA 2PKSC 2XNDD 2XXLA 1P04A 2IPHA 2O8MA 3PV2A 2NU4E 2C8YB 4ABJA 2HGTH 2BQWB 3KL6A 1RGQA 4AX9H 3N7EA 1V2UT 1QBNA 2Z7FE 1FN6A 1AUTC 2ZQ2A 4IMZA 4X2XA 2J34A 1VCQA 5F53A 4ABIA 1S0QA 5DG6A 9LPRA 2ZO3H 5FPTA 4UFDH 3T26A 2WYGA 4AFSA 5HXFA 1HXEH 3PLPA 3SV2H 2PSXA 1C5LH 2G8TA 1RIWC 4FOUC 2P59A 2BY9X 2GV7A 1UTMA 2LNCA 2ZHWH 4X2WA 1PQ5A 5DK1A 1P02A 3SNEA 1TQ0B 3FFGA 1GMDG 2AHME 3Q3XA 2A5KA 1C5YB 3HPTB 2GCHF 2OC0A 4I7YH 1O3NA 2ZDNA 2VIVA 3FKSD 1C5TA 2C3SA 1A4WH 1DSTA 1EB1H 4MNYA 2Y5GA 1A5GH 2RCEA 3A89A 3GISB 2BYAX 2CHAB 4H42U 2PHBA 1OHHD 2BTCE 3URCA 1AB9B 2WPJS 4FUEA 4IC5A 3A83A 4X1QU 3TLOA 4ABHA 1WQVH 3Q3YA 2CJIA 1C4V2 2JDID 1KSNA 3D23A 2FX4A 3MI4A 3ZZ9A 1COWD 4HFPB 3F0OA 3A80A 1FQ3A 1KLIH 3PYHA 4ZXYH 2A7CA 5JBTA 1BTXA 1P9SA 1O5CB 2VWOA 3PROA 3AVZA 3QK1A 1Z8JB 1HAHH 1G36A 3TJVA 1W0YH 5C2ZA 2XCFA 4F4OC 3A8AA 5GIBA 5C5NA 1RTLA 2FESH 3DA9B 2W6ID 1CBWC 1NU9A 3RXUA 1BQYA 4IMQA 4UEHH 1UW7A 3R3GB 1EAIA 1S5SA 4ABEA 1PQ7A 1F5RA 3GY5A 5EJZA 1RTKA 1KMHB 1THPB 5T3HA 3U28C 1GI4A 4AYVB 1A3BH 1E35B 2GZ8A 3RXHA 3GDUA 2DE8A 3BN9A 4KELA 3ZZ3A 3ENSB 2F9VA 2VIQA 2ZDLA 3ELAH 2J2UA 1IQGA 2FP7B 3SUFA 2HALA 1NTPA 1C2GA 1D3DB 2BDAA 3RXAA 4DJZB 3ESTA 1GL0E 4ZKSU 3MOCA 2FS9A 4ZKRU 1MTNC 1X7AC 1O5EH 4BOHA 1RTFB 1VGCC 1TBQH 1O3PB 2FI5E 2VU8E 3UQOA 5EW1H 4DIHH 2WV5A 3SORA 1F7ZA 4K69A 3ZVBA 1ZTJA 4K3JA 5FX6A 2QXJA 3A8BA 1UMAH 2BMGB 2XBVA 4FUCA 5ETXA 2J92A 1C9PA 3SV9A 2BXTH 4CR9A 1T8LA 1XXFA 5K7RA 3DSGA 1SI5H 3UY9A 1E37B 1O35A 1K2I1 2I6SA 2ZFTA 3BTTE 4TY7A 2BD2A 1W13U 2FXRA 1ZMJA 2FLRH 1WUNH 1UCYE 3K65B 3LGTA 2H5CA 1VCPA 2BDBA 3QZQA 5EG4A 1QRXA 1P2QA 3BIUH 4AFQA 1SC8U 1P12E 3HGPA 4Q4LA 3VB6A 5FPSA 1TQ7B 4AFUA 2KCPA 3WW7A 1B7XB 1AQ7A 2FODA 3ATIA 2BVSH 4JMYA 1NRSH 1TNGA 3KEEA 1GCDA 3PLBA 1O3FA 3D49H 2OTVA 2BX4A 5C17A 3IITA 4OS2A 3MO9A 5E2OA 1IOEA 3SUEA 2XTTB 1TONA 5L30H 3PO1B 3HK3B 1N1LA 1HAOH 1GBKA 2OQ5A 3URDA 1ZRKA 1V2OT 2FYQA 3BTME 4B75A 4P02A 3TJNA 2FEQH 4TWYA 4UFFH 1OWHA 1L2EA 2FOBA 1JIRA 1ZPZA 3GS9A 3QDZB 2AIPA 5F6MA 1DY8A 1AWHB 1SLVB 3LPRA 1GVKB 1KXCA 3QGJA 3U8OH 5J4SA 1EOLA 1MTSA 1SL3A 5HM2A 3ATLA 1C1RA 1O3KA 3A84A 5ESTE 1P57B 3VB3A 1B0EA 1GBDA 4MG3A 1H9HE 1NS3A 1DX5M 1QL9A 1YLCA 3SBKA 2VVCA 2SGFE 1GI3A 4U32A 1C5UA 1K28D 1EQ9A 1SGQE 2ZDKA 5DPAA 1HAYB 4B76A 4FUFA 2AMPA 4JK5A 1GI7B 2ZPQA 3TJOA 1C5SA 2F3CE 1SGFG 1PJPA 1FAXA 4ZAEA 3SHAH 1O2LA 3A85A 3GICB 2WHXA 1P2KA 1EFRD 1MZAA 2BQ6B 4ZMAH 3ZYEA 5C1UA 1E79D 4AYYB 1V2NT 1C1QA 2ZGXH 1EASA 1GBEA 1LPKB 1SQRA 4MVNA 3DD2H 4HTCH 4O3TA 5HIZA 1ELTA 1UTPA 1C2DA 1MCTA 5GJ4B 3RC5A 3EYDA 1O5BB 1GMCF 1ELEE 1V2TT 1A0HB 3GCOA 4F49A 2PUQH 3VFEA 4X0WU 1KIGH 5FL7D 2HNTC 1GHXH 1OWDA 5L2ZH 1THRH 1EAXA 1P8VC 4UD9H 4UFGH 4D76A 4YXWD 1NRQH 2UUKB 2FOCA 1O31A 1MD7A 1SGPE 1OP8A 2ZCHP 1JOUB 2WPIS 3NUMA 1CHGA 1C1PA 2B5TB 1DY9A 3DSOA 3FO8D 5DN6D 1GJ9B 2ZPRA 1TWXB 2WYJA 1FMGA 1LPZB 1EZQA 1D9IA 1TPAE 3RXKA 3KYGA 3PTBA 1GJ7B 1N6YA 3BG4B 4NA9H 1YY3A 4LZ4B 1W0JD 4JYUH 2P3FH 1EX3A 1O34A 1UTLM 2ULLA 4Y0ZE 2JH6D 3UIRA 4B1TA 1KXDA 1QIXB 2QXIA 1LMWB 4RKJB 3RU4E 1V2WT 4Y0YE 1V2ST 3T29A 2BVRH 2OUAA 4YT6H 3T62A 1AVGH 1BRUP 1P2JA 1GBJA 5FCKA 1CA0B 3LGYA 1RJXB 1IQEA 1C5QA 3NKKA 4K60A 4BANB 1O39A 3ZIAD 2CMYA 1NROH 2GCTC 1T8OA 2Y82A 4INKA 3KCGH 1TOMH 5FBIA 1SR5C 7KMEH 3B9FH 1B5GH 3F68H 2UWOA 1AU8A 3UQVA 1S85A 3F1SB 2ZGBH 2SGDE 1DDJA 2A4GA 2ZDVH 1NPMA 3H09A 1AIXH 2LELA 1VZQH 1EB2A 3F9HA 1ZJDA 1HYLA 5K0HA 2PV9B 2B0FA 1KXFA 4GCHF 1NC6A 4MPVA 4CRBA 3K2UA 5C67A 2FLBH 3SU1A 3MU8A 1BITA 1MQ5A 4WXIA 5GDSH 5SGAE 5FXLA 2GDEH 5G4BA 1S0RA 2BD5A 2XW9A 3LJJA 5KGOA 6CHAC 1SGCA 1A0JA 1ZHMA 1V2LT 2OC8A 4Q80A 4A6LA 3LJOA 2J94A 1G2MA 1HJAC 1DICA 2BDCA 4HI3A 2H9EH 4Y7BA 1T4VH 1WTHD 2QGRA 2BLWA 1EP6A 4MPXA 5EXLA 1P0SH 3HK6B 3OSYA 1GHYH 5TCCA 2PLXA 1EPTB 2CXVA 2HNTE 1TYNA 4ABGA 2FOFA 1C2JA 1ZSJA 2G4TA 3K6ZA 2VH6A 2WZQA 4B2CA 1MTVA 3GY7A 5FBEA 4A1TA 3N99A 2TPIZ 4NWLA 3PM3A 1UTJA 1O36A 5L6NH 2ZKSA 1PPCE 2C8ZB 3PRBA 4YO9A 5JB8S 2J9NA 5HM9A 1W14U 3FANA 2TIOA 3PWBA 1P10A 3BEFB 1Q31A 4A1VA 5HYOA 3GY3A 4JYTA 4ZKOU 2V7QD 4D8NA 3OE7D 2UUFB 3A8DA 1AFQB 1G3BA 2TGAA 1O2YA 1O0DH 2QIQA 1A5IA 1BT7A 1GBTA 4JCNA 1V2RT 4OS7A 1MUEB 1FY1A 1D4PB 3F2HA 2F9UA 3FP7E 9ESTA 3FZZA 1Y5UT 1XUJA 3TK9A 3KF2A 1NBME 1BDAA 1FAKH 4CHAB 1XMNB 2CK3D 2VGCB 1J8AA 4ISIH 1FJSA 1VKYA 2ODQA 3R0FA 3SU2A 1K1NA 1FLEE 1A1RA 1MMJN 3STJA 4YLUA 4I32A 2H9HA 1CVWH 4PROA 2UWLA 2Z9JA 3DHKH 3A8CA 1DT2A 1TIOA 4X8TH 2BY7X 2Y81A 2A2QH 1EJMA 1SBWA 4ACAA 2OD3B 2EY4C 3F9EA 3N7DA 5JBBS 3SOSA 1KXEA 1KTTB 4A5TS 4IW4E 4TYDA 1NESE 1ZR0A 1AE5A 2R2WU 4WMEA 4AB8A 1O33A 2OINA 3M3SA 2G4UA 1DE7H 3TU7H 4DT7B 2CHAC 1PPFE 1TPSA 2A7JA 2O8TA 1K9OE 2ZA5A 1AB9C 3T25A 1BMAA 1L1NA 2JJ1D 1QBOA 3M7TA 3KIDU 4WH8A 3GCTF 2PGBB 3S9CA 4Y76A 4I8KA 1O3LA 2QA9E 1SG8B 1HAPH 1C9TA 2R3UA 2IN2A 1CGJE 1QFKH 3FP8E 2EA3A 4MPWA 1OP0A 2QXHA 1LHFH 3PV4A 1Y5AT 2G81E 2XWBI 3LGIA 4VGCB 3TK5A 2GX4A 5HGGA 2Z3CA 3EAJA 2RFKC 2XCNA 1TA2A 3PMBB 1IAUA 3MHWU 8KME2 3KQ5A 2OP9A 1TNLA 3GY6A 4FETA 4CH2B 4ZHMU 1F0RA 2SGAA 1A61H 4TSFD 5LGOA 1TGSZ 3A86A 1O3DA 4CRAA 2C8WB 3KQEA 1HV7A 1ARBA 3P95A 2G52A 2UUYA 3RXVA 1ANEA 2AH4X 3SZEA 1Z6JH 2GT8A 1QA7A 2BLVA 4UFEH 4WF8A 4X1RU 2BDIA 4BAQB 3UNSA 2F9PA 1FI8A 3P92A 4X6OA 1H8HD 1TFXA 3TGIE 3B8JA 2GDDA 4XDEA 3Q3KA 1G9IE 3RXSA 3ZZCA 4BAMB 1EKBB 2ZU1A 3SU3A 2CF9H 2O8LA 3ATWA 4ZCNA 3SV7A 5I46H 4HZHA 3SNDA 3MWIU 2FI4E 2BZ6H 1P2OA 3LIWA 1LVBA 2FDAA 1IQHA 2C93B 3ZV9A 3ZZ8A 1HPGA 3ZVEA 1HNEE 1GHVH 3UOUA 2ZF0H 4CREA 4YT7H 3UTUH 3RP2A 4BAHB 1DOJA 1FV9A 1RD3B 2C8XB 4FUJA 1QJ7B 3E16B 5GCHF 1AUJA 3QN7A 1JXPA 1MBQA 1Q3XA 4LOYH 5DP9A 1C1NA 3O8DA 2ZPSA 3E0PB 2SNVA 1TAWA 3JZ2B 4BTTB 1D3TB 3OTJE 2BB4A 3GDVA 2PSYA 3RXTA 1ZTLA 3CS7A 3TNSA 3BTKE 1HBTH 1O3BA 4CRCA 1IQIA 4LXBH 1DXPA 1HRTH 3UPEA 2ZHQH 4NFFA 3QX5H 4CR5A 1XUIA 3VGCB 2HRVA 4DW2U 2D1JA 1FUJA 1SLUB 1C5MD 2ASUB 5DP8A 1BMMH 2ZG0H 2VBCA 2KCOA 2ZZUH 3PO1C 3GCTG 5B6LA 4K1TA 1C4U2 1TB6H 4YLQH 2FI3E 3UNQA 1IQKA 3UOPA 3UWJH 4OS5A 4UONA 4KTSA 2FTLE 5JBAS 1YWUA 3EA7A 4AGKA 1J17T 2JETB 1BOQA 1QB1A 2Z6BD 2QY0B 3RM2H 1C2HA 1ZJKA 2BDGA 2EC9H 3A81A 4NZQA 2A45B 1SHHB 3SI4H 2Y7ZA 4JZ1A 1TBZH 3OFND 4Y6DA 2W3KA 1GCTB 5ESBA 3MO6A 2OCVB 1CT2E 3RMLH 3MH6A 3AW0A 4MLFB 1FPHH 1SFIA 4Y71A 3NPSA 1SOTA 2W5EA 4SGAE 4B73A 4IBLH 2AGIX 4I33A 3SYJA 4X8UH 4FVDA 4GUXA 5LPFA 3WY8A 3TVJB 5LPRA 1GBBA 5BPEA 1BTYA 2ZU2A 1TE0A 4AGJA 1D6RA 1CT4E 3S9BA 4IN1A 1YBWA 4Y8ZA 1V2MT 2XWAA 1D6WA 2OLGA 4A7IB 3DSPA 2KCAA 2WINI 1ELDE 1UTKA 1O3HA 4CH8B 3UR9A 2PWXA 1MCVA 4DOQA 4INHA 4YOIA 3MNSA 3A7XA 1W7XH 1FX0B 2FO9A 1AN1E 4BTUB 1O3GA 3SQEE 4Z0KA 2VWLA 2FTMA 1O2UA 2KR7A 2CV3A 4A1XA 7LPRA 5C5OA 3FVFB 5T6FA 1C1OA 2V0BA 4GHTA 3F0PA 4B2BA 1NU7B 4WY3A 1LKBA 1BBRH 2AEIH 1DITH 2FOMB 3FZDA 3KHVA 1L4DA 1H1BA 1IQNA 3A87A 3W94A 1OKXA 1E1RD 2GKVE 1YLDA 2WPDD 1QURH 1FNIA 1NRRH 3PTNA 1SQTA 3NXPA 2PFEA 1V6DA 1Q2WA 1PPGE 3BTFE 1MU8B 3BG4C 2YNAA 1C1MA 3E3TA 2GJGA 1D3PB 1EJAA 2HLCA 2ZCKP 2L74A 3SUDA 1VCWA 1C4Y2 2P8OB 2UUJB 4NIXA 3SJ8A 3DCLA 3CS0A 4NWKA 1W8BH 5ABWA 1EAWA 4X1PU 1JRTA 1C5PA 3TGJE 4R8TB 2QF3A 4GAWA 3BV9B 1ZPCA 4FVBA 1UO6A 1GVLA 1GDQA 4KTUA 3FN8A 4XBBA 2XBXA 1CA0C 1C5ZB 2RDEA 1AWFH 2WPMS 4MQAA 2OK5A 5E8EH 1UTOA 1OX1A 4ZKNU 4JZFH 3ZZ6A 1FIWA 1CQQA 1TBRH 2ALPA 1C5NH 4THNH 3U9AH 2WPKS 1GWAA 2J98A 2V3MA 3M5MA 2FOHA 2GCHG 1P05A 1EUFA 1O2KA 3GYMA 3KQCA 3PMJA 1OPHB 5EQRA 3N7OA 1ETRH 1O2SA 3PV5A 3MQKC 4FUDA 1PYTC 2DE9A 3Q77A 2QV1A 3M7QA 2D2DA 1MU6B 2F9OA 1C2FA 1T4UH 2BY5X 1YCPH 1TABE 2RA3A 1IQMA 1W3CA 2PGQB 3F6UH 7GCHF 5A2MH 1LPGB 1CU1A 1ELBA 2HOBA 2PTCE 3QZRA 1FZZA 1L1JA 2ALVA 1BJUA 3DT0H 4ABDA 3SJIA 3ZYDA 1C2MA 4MNXA 1H4WA 3H7OA 4OS4A 1XUFA 2ZTYA 2H9TH 1O2RA 4WXVA 1BRCE 1THSH 5TCAA 3AAVA 5EJ1A 1N6XA 2JH0D 1EPTC 5T6GA 2R9PA 3V0XA 1SPJA 1GJ4H 4FU8A 2QAAA 2NU0E 1YP9A 2FM2A 1ANDA 1O32A 1S6FA 1GHWH 2WV9A 4KTCA 1TGBA 1BRBE 2OBOA 1L4ZA 4TPYA 3V12A 3K6YA 3K9XB 4K5ZA 1ZRBA 3OEHD 3ZVGA 4NIYA 1FXYA 2JH5D 1W0ZU 1E0FD 2AIQA 2BOKA 4ASHA 1KYNA 1G3EA 1NFXA 1E34B 3DUXH 1ELGA 4ISOA 1U6QA 3EQ0H 5IK2D 2Y5HA 2G5NA 1AFQC 2W6JD 1QB6A 1WCZA 1W12U 3EE7A 3MNCA 4AG2A 3BG8A 1O5DH 1NN6A 3BSQA 4FUIA 1DWBH 5C0UA 2P93A 5EQSA 4CRFA 1Z1JA 3S7KB 4JK6A 3OTPA 2BOHB 1ZPBA 3ZZ5A 3TH2H 2FIRH 3V7TA 2ZGJA 4CHAC 2Z9GA 2VGCC 2OXSA 4WVPE 1C2LA 1Y3XA 4K8YA 1V3XA 1GG6B 4M7GA 1E1QD 1EPTA 2PW8H 2FOAA 5T1VA 2J98B 3ZZBA 1OWIA 1TMBH 4AB9A 2NU2E 5B6OA 5JDUB 1WQSA 3PB1E 5F03A 2GGVB 2A5IA 1H8DH 1L0ZA 2IPQX 1O2HA 2A31A 1ZGVA 4ZROA 3D65E 5DP4A 1LHDH 4ABFA 3PWCA 5LH8A 2OBQA 4K8BA 1YM0A 2F91A 3L6PA 2NU3E 1PQ8A 1J14A 1XKAC 2BQ7B 1NFYA 3T2NA 1TNKA 3LH3A 3F9GA 3KQDA 1H8ED 4RT1A 4AN7A 4E7NA 2EEKA 4NA8A 3SI3H 3H5CB 2GTBA 4GPGA 3O8CA 1GMHF 4BTIB 1FIZA 3S7HB 5CE1A 2SFAA 2FYRA 2KZ4A 2R2MB 1PQAA 4VGCC 2YMSD 1CA8B 3MNXA 1ZSKA 3MMGA 4Y10E 5JYIA 3QO6A 1PFXC 4YESB 1V2KT 1EZSC 2P3UB 3P70B 2Z3EA 2FOGA 1W7GH 2YNBA 2KCYA 2O9QA 3E91A 1SHYA 4B6EA 6ESTA 1ZGIA 4GVUA 1F92A 4WWYA 2BX3A 2NWNA 2AFQB 1AVWA 8GCHF 2GV6A 4XBDA 4H6TA 2P3TB 2WUBA 1BA8B 4RSPA 5DGJA 2ZNKH 4Q7YA 2VWNA 2EI8A 2ZI2H 3RXEA 2BVXH 3BIVH 3ATKA 1SKYE 4Y8XA 1ESBA 1MH0A 1SGIB 4QT8C 4K1SA 1D3QB 1GI0A 1XUGA 5EPYA 3RMNH 2BY6X 4NGAH 3JZ1B 3BTGE 3GDSA 3NWUA 1DLKB 1UJ1A 1UTQA 5C1YA 2J4IA 4IS5A 1TA6A 3KYFA 1YC0A 1DUEA 2SNWA 3P8OA 1XM1A 4CRGA 1HIAA 1DSUA 3BEIB 5CHAB 1GJAB 4SGBE 1YCPK 5A8YA 2J97A 3TNTA 1GMCG 4ASUD 5JB9S 1ABIH 2QYIA 4AZ2B 5EJLA 3VB7A 2PUXB 3I77A 4MNWA 1DFPA 2WPLS 3Q76A 1P2MA 1M9UA 1GJCB 3SNBA 1O2GH 1UVSH 1C1UH 3M3TA 1ACBE 2THFB 2Z9IA 1UHBA 1HAGE 2ODYB 4R0IA 1Z8RA 4RT0A 1LKAA 1UVTH 1W11U 2I6QA 3F3BA 3UWIA 3T5FH 3UR6A 1SGEE 1GJBB 1K1LA 1WTGH 1K1OA 4TT3D 1ID5H 1GI5A 3F2FA 3LGVA 2PTNA 3TJUA 4Y79A 1ZHPA 4I8LA 3VB5A 3VGCC 1TX7A 3RLWH 1UVUH 2Y7XA 5HIYA 1MAYA 3AK5A 1DVAH 1OYQA 2AMDA 4NFEA 1C5OH 1EAUA 1Y59T 1P03A 2ZFSA 1G30B 1K0HA 3QTOH 2SGEE 3LGWA 1A46H 4AC9A 2JIZD 1IHTH 1F2SE 4LZ1H 2PKAA 1SGYE 1OWEA 1QNJA 3A7TA 3RXIA 3BTWE 1KLTA 3M5LA 1FY5A 2JETC 4NCYA 3RXRA 1F0TA 1MD8A 1TGCA 1G2LA 1BB0B 2ANMH 2EI7A 1QA0A 5A8ZA 3ZVCA 2IJOB 3FAOA 3RLYH 1ZOMA 4YTAA 1GCTC 4X6PA 1O2PA 2A4RA 2ZQ1A 3V13A 2WV4A 1QJ6B 2NU1E 2VVUA 1P06A 1HGTH
chains in the Genus database with same CATH topology
8GCHG 5E2PA 4ZUHA 1CSOE 1BTZA 3H7TA 4XBCA 4JZDH 4DCDA 3BTEE 5DP5A 4ISNA 1QQ4A 4GCHG 2LPRA 4AORA 2HNTF 2FOEA 1GI1A 3VEQB 1GGDB 2G5VA 4FU9A 2P95A 3RMMH 2ZHEH 4B74A 1HIAB 1WYKA 2BZAA 2ZEBA 1KXAA 2QF0A 3MO3A 2OC1A 1GBIA 1V2VT 3NZIA 2CF8H 5F8TA 2XC4A 3RXPA 4NG9H 1HAVA 1XXDA 3CP7A 4BNRA 3M5OA 3MFJA 3SNAA 1TNHA 4AOQA 1T32A 2BHGA 5JBCS 1EZUC 1UHBB 1LVYA 1WU1A 1Y3YA 3EA9A 2VH0A 2SGPE 1ZLRA 3RXCA 1AFEH 3LGUA 3ODDA 4J2YB 1G3DA 2CGAA 1LVMA 5E0JA 1GHAF 1QB9A 1O2TA 4U2WA 1CGHA 3D62A 2G51A 2M5TA 3U1IB 3U69H 4AFZA 2H6MA 1L1GA 1QQUA 1GPZA 1LCYA 3OU0A 4A92A 2QCYA 2P8OC 3GY2A 2B9LA 1H9LB 3E6PH 1TNIA 1MBMA 2O8WA 3RC6A 4I8GA 3TH3H 1O2OA 2PKAB 3S0NA 2AMQA 5LPEA 4X8VH 4U01A 3RXJA 1ELVA 1JRSA 3L33A 2XBWA 1TOCB 1B0FA 3SHCH 3NK8A 3AAUA 5BRRE 1HAZB 2R3YA 3BTQE 2Q6GA 2W3IA 4WH6A 1FY4A 2FMJA 1GHBF 2TGPZ 3UFAA 2GP9B 4O03A 5EODA 2BXUH 4IN2A 1VR1H 1O37A 1J9CH 2VIWA 2Z9KA 4X2VA 1O2NA 2HPQH 1K1IA 1SGTA 2AS9A 3SGAE 3ZZDA 3RUOA 1C1WH 2QN5T 1O2IA 2B8OH 2ESTE 5E0GA 5AF9H 5GXPA 2ZFRH 1Y8TA 3GCHB 4D9QA 1WOFA 4Q2KA 1QBVH 1ZTKA 1VJAU 1NO9H 1WSSH 5L2YH 1OWKA 4ISHH 4XOJA 3P8NA 2ZFQH 5C3NA 2Q6DA 3O8BA 1AVXA 3STIA 5AFYH 3RU4D 2JKHA 1SGNE 4X1NU 4JZIA 4X6NA 2GMTB 1OYTH 1PPBH 1P09A 1NRPH 5EXMA 3Q00A 1S83A 1HAVB 1LHGH 1FONA 1GL1A 1SOZA 3HKIB 4FUBA 1E36B 1G3CA 1NFWA 4DURA 2O8UA 1IQJA 1LVOA 3NCLA 4FU7A 4AG1A 3M7UA 1YKTA 1CO7E 1O2ZA 1ELCA 2IOTA 1T7CA 3U98H 3ZVDA 1HJ8A 1TPOA 1W10U 1BTWA 1IHSH 1HDTH 1KDQB 1GI8B 2ZDMA 1GI6A 1MTWA 2Q6FA 1HUTH 3A7VA 3U8RH 2CN0H 1O2MA 4CRDA 4NIWA 2Z94A 4DGJA 5A0CA 2ILNA 1PPEE 2GD4B 1O3OA 3BF6H 4X8SH 4YZUA 3QUMP 1MKWH 5C20A 1QTFA 2BM2A 5AFZH 1GHAG 1J16A 2DUCA 3TK6A 2VINA 3A82A 1MQ6A 1LQEA 4LK4A 3SO3A 4I8JA 1GVZA 3BTDE 5JPMH 3VXFH 1G37A 3DFJA 3ZZ7A 2Y6TA 2KAIA 5GCHG 2GZ9A 3PLKA 1AZZA 1GG6C 1O2XA 1BTPA 2A4QA 2V6NA 3AASA 4OS1A 1EOJA 2BD4A 1OOKB 1QY6A 5DP3A 1V2PT 2AYWA 4FUGA 3GCNA 1GHBG 3GYLB 3CENA 4ABBA 2XBYA 2AGGX 2ODPA 4FXGH 1XKBC 3P6ZB 4ISLA 3RXOA 5IDKA 2AERH 2B7DH 1HB0B 3P8GA 1OXGA 2H5DA 4NZLA 4NA7A 2W7UA 2C90B 2R0KA 4E05H 3OY5U 5GWZA 1NT1A 1NZQH 1GJ8B 3QLPH 2VVVA 3E0NB 1N8OB 2STBE 2STAE 1F0UA 2Z9LA 1LDTT 1GJDB 2A5AA 5F8XA 4NSYA 1QHRB 4UDWH 1ZHRA 3ZZ4A 4I8HA 1T31A 3A7WA 4CBOA 1AGJA 3LU9B 4E7RG 3FP6E 3LKWA 3VXEH 3MH7A 5FCRA 5EPNA 6LPRA 1IQFA 1ZYOA 3RXBA 3MU4A 1PPZA 4B2AA 3SU0A 2F9BH 3A7YA 1DUAA 1TMUH 4X6MA 5AVDA 5A09A 1ZMLA 3MU5A 1BRAA 2V35A 2HWLB 1Z8IB 4O97A 3O8RA 4XE4A 2TGTA 4Y8YA 1ANBA 2PKSB 1DWCH 3SGBE 3E1XB 2WUCA 6GCHF 1ELFA 1C1SA 1S82A 1YPLH 4YM9A 1O3AA 1V2JT 1OWJA 2XC5A 4H6SB 2ZCLP 1P9UA 1O2VA 2KAIB 1DWEH 1BHXB 3SU6A 1P3CA 4OS6A 1Y5BT 4WMDA 3M5NA 1SVPA 2R0LA 3U1JB 4DY7B 5CHAC 5DP6A 1MKXH 1A5HA 3P8FA 4BAKB 3EGKH 1RIWB 3I29A 4Y7AA 4RKOB 5DKMA 1CGIE 1MAXA 3SQHE 2Y80A 1DM4B 2BLOA 4MPUA 3M61U 2W26A 2OQUA 3PMAB 1QJ1B 3SUGA 2GT7A 5T6DA 1BHXF 1SLXB 4ZHLU 5EW2H 3RXGA 5C1XA 3LH1A 3RXMA 3LC5A 4WJG2 2ZWLH 2ANWA 2SGQE 3OYPA 1YCPM 2HPPH 3E90B 1H9IE 4HGCA 4KKDA 2C4FH 1BZXE 3RXDA 1O38A 3KN2A 1NFUA 3QTVH 4KP0A 3TIUA 2UWPA 1VITF 1AE8H 5DJ7A 1O30A 5DO4H 2RG3A 1EP5A 4J1YA 1YPKH 2WPHS 3BTHE 2ZHDA 3MYWA 2A2XH 1J15A 4JZEH 2FX6A 1VITH 1CBWB 1AMHA 1XVOA 3RU4T 3RXFA 3VPKA 1MKWK 5F8ZA 1JBUH 4TWWA 1RFNA 1YPHC 3HGNA 1UCYH 1BMNH 1JIMA 1YF4A 2P94A 4XFQA 3ZVFA 4K2YA 1O5FH 3SV8A 1ZZZA 3TITA 1SLWB 2ZGHA 1XUHA 1SGDE 1TX6A 1MTUA 1TX8A 1HFDA 2TRMA 1UK2A 2G00A 1YPGH 1O2QA 1RXPA 1LHCH 1QCPA 1LTOA 5PTPA 1Z8GA 3LONA 3EDXB 3KGPA 1RRKA 3ODFA 5AHGH 2VJ1A 4X1SU 1FY8E 1O3IA 2XYAA 2ZC9H 4JYVH 4YOGA 5A8XA 1UTNA 1MTNB 1BBRK 1S84A 4MNVA 1VGCB 3A88A 7GCHG 1Z6EA 2Y5FA 3M37A 4ZHAA 4Y11E 1GGDC 1HJ9A 4INLA 2ZU3A 1YPEH 6GCHG 3RDZA 2ZU5A 4Q7XA 3LOXA 4U30A 2BD7A 2F83A 4XSKU 2A0QB 3RMOH 3EA8A 1AD8H 1XVMA 2PR3A 2XRCA 3KQBA 3T28A 4NIVA 3QGNB 5EOKA 1GI9B 2EI6A 1BIOA 3M36A 1UK4A 3SU4A 1CT0E 1TRMA 1TPPA 1P11E 1GBMA 1O3EA 2ZU4A 3SJKA 1GBAA 1XX9A 3HATH 1TMTH 2F9NA 2ANYA 1P2NA 1EATA 2RA0A 1YGCH 1F0SA 1HAXB 1NY22 4RN6A 1KXBA 1O2JA 1TLDA 3PMHB 3SW2B 1P2IA 4MDSA 1GBFA 1BJVA 3P17H 3SNCA 1ELAA 2V3OH 1K1MA 3MH5A 3ZVAA 1SB1H 4Q7ZA 4OGYA 1DWDH 1QRZA 2BDYA 2XC0A 1TGNA 1JWTA 1HLTH 2H2ZA 1VITG 1P01A 1QL8A 1BUIA 1YPHE 1C1TA 1GDNA 2A32A 2QC2A 1DLEA 1UVOA 1Y3VA 2VB0A 3SZNA 1MZDA 4MTBA 3GY8A 2VWMA 3RM0H 2P16A 2BD9A 1FN8A 1ORFA 1IQLA 1S6HA 3TPIZ 1FPCH 1CHOF 1UVPA 3HKJB 1EZXC 3TGKE 1T8MA 2YOLA 1OS8A 1PPHE 3OY6U 1FDPA 1WV7H 3GCHC 2VNTA 1K21H 1LQDB 5I25A 1MKXK 1G32B 1SQOA 3MU1A 2BD3A 1CE5A 1O5AB 3LC3A 1C2EA 1Z71A 1AZ8A 1VJ9U 3LT3A 3MNBA 4GLYA 3L3TA 4GSOA 1TNJA 1A7SA 3AW1A 1GMHG 3BEUA 3B23B 2GMTC 1F5LA 3C1KA 2ZDAH 1YYY1 2RDLA 1ESAA 1GBLA 1SSXA 1OP2A 2K1QA 2J95A 2BLQA 2ZHFH 4D7FA 4BAOB 3SGQE 5J4QA 1AHTH 1C1VH 5EGMA 1AKSA 1AO5A 1O3MA 3GY4A 5EXNA 1YPMH 1C5RA 1TRNA 2HVXA 2XNIA 2TBSA 4UE7H 2OC7A 3RC4A 5EQQA 1ZMNA 4ZH8A 1DANH 1K1JA 2BY8X 1E38B 2BDHA 1O2WA 2G55A 3RXLA 1INCA 2VIDA 1QRWA 2V3HH 1KTSB 2FS8A 4NSVA 3V3MA 2A1DB 3TH4H 5FHTA 3IWMA 3EE0B 1GBCA 3SN8A 2VIPA 1KY9A 2ZTXA 5A0AE 1O3JA 2Z3DA 2ZFFH 5DP7A 2ZGCA 2A4OA 3VB4A 2H1UA 3SJOA 3SU5A 1Z7KA 1AY6H 1GI2A 8LPRA 4I31A 2ZP0H 3I78A 2FPZA 2FZZA 1UCYK 4ABAA 2TGDA 5TJXA 8ESTE 3ATMA 1T8NA 1WBGB 1TALA 3U8TH 4E06H 3M3VA 2D26C 1ETTH 4FUHA 5E0HA 3LDXH 2W7SA 2GZ7A 4KGAA 2A7HA 1QGFA 1ETSH 3KNXA 1WAYB 1GBHA 1Y3WA 1SQAA 1BMLA 4BXSA 1ANCA 3UNRA 1GMDF 1A3EH 1O5GH 5FPYA 1DXWA 1AI8H 2GCTB 3DFLA 5A0BA 3T27A 5GPIB 3ZZAA 3G01A 5IYTA 1KDQA 1BCUH 1O3CA 1GJ6A 2ANKH 5H4IB 5FX5A 1JMOH 1NM6A 1C5XB 1ESTA 2QXGA 1SGRE 1RS0A 4B71A 1EXFA 1LHEH 1S81A 1TRYA 1ZSLA 2GVFA 3W95A 3F9FA 1C2KA 4CBNA 1SMFE 1H8IH 3S69A 1BTUA 7ESTE 2ZTZA 1QL7A 3MU0A 3A7ZA 1FY3A 1CHOG 3GOVB 4GHQA 1C2IA 3RXQA 1C5WB 2FWWA 4BXWA 1SFQB 3ITIA 1V2QT 1EJNA 2AGEX 2ZIQH 1BTHH 1GJ5H 4IC6A 6CHAB 4D9RA 3IG6B 1UK3A 3OX7U 4Z6AH 1N8OC 1AKSB 1HJAB 1K1PA 1GDUA 1QR3E 3MH4A 4WMFA 1P3EA 4YOJA 1Z1IA 4X2YA 4O9VA 4OGXA 3S9AA 1HCGA 2Q1JA 4ZXXH 2ZFPH 3SV6A 1HXFH 4TY6A 1SGFA 5FAHA 3UREA 1A2CH 1TGTA 4DVAU 3E8LA 4TPIZ 3MTYA 1F5KU 4D7GA 1XUKA 4IGDA 5EU8A 2VIOA 1HAIH 1KLJH 3UUZA 1A0LA 1W2KH 1YPJH 3QWCH 4DIIH 3SJ9A 1LO6A 1DS2E 1PYTD 4ESTE 5CMXH 1DPOA 2BD8A 5HMAA 4K1EA 1BBRE 3C27B 1K22H 4H4FA 1GHZA 1NRNH 1ARCA 2ZECA 1ABJH 2J38A 1Y3UA 3ZV8A 3M35A 2D8WA 4O3UA 4DG4A 1OSSA 1C5VA 2PKSC 2XXLA 1P04A 2IPHA 2O8MA 2NU4E 2C8YB 4ABJA 2HGTH 2BQWB 3KL6A 1RGQA 4AX9H 1V2UT 1QBNA 2Z7FE 1FN6A 1AUTC 2ZQ2A 4IMZA 4X2XA 2J34A 1VCQA 4ABIA 1S0QA 5DG6A 9LPRA 2ZO3H 5FPTA 4UFDH 3T26A 2WYGA 4AFSA 5HXFA 1HXEH 3PLPA 3SV2H 2PSXA 1C5LH 2G8TA 1RIWC 2P59A 2BY9X 2GV7A 1UTMA 2LNCA 2ZHWH 4X2WA 1PQ5A 5DK1A 1P02A 3SNEA 1TQ0B 3FFGA 1GMDG 3Q3XA 2A5KA 1C5YB 3HPTB 2GCHF 2OC0A 4I7YH 1O3NA 2ZDNA 2VIVA 1C5TA 2C3SA 1A4WH 1DSTA 1EB1H 4MNYA 2Y5GA 1A5GH 2RCEA 3A89A 3GISB 2BYAX 2CHAB 4H42U 2PHBA 2BTCE 3URCA 1AB9B 2WPJS 4FUEA 4IC5A 3A83A 4X1QU 3TLOA 4ABHA 1WQVH 3Q3YA 2CJIA 1C4V2 1KSNA 3D23A 2FX4A 3MI4A 3ZZ9A 4HFPB 3A80A 1FQ3A 1KLIH 3PYHA 4ZXYH 2A7CA 5JBTA 1BTXA 1P9SA 1O5CB 2VWOA 3PROA 3AVZA 3QK1A 1Z8JB 1HAHH 1G36A 3TJVA 1W0YH 5C2ZA 2XCFA 4F4OC 3A8AA 5GIBA 5C5NA 1RTLA 2FESH 3DA9B 1CBWC 1NU9A 3RXUA 1BQYA 4IMQA 4UEHH 3R3GB 1EAIA 1S5SA 4ABEA 1PQ7A 1F5RA 3GY5A 4AYVB 1RTKA 1THPB 5T3HA 1GI4A 1A3BH 1E35B 2GZ8A 3RXHA 3GDUA 2DE8A 3BN9A 4KELA 3ZZ3A 3ENSB 2F9VA 2VIQA 2ZDLA 3ELAH 2J2UA 1IQGA 2FP7B 3SUFA 2HALA 1NTPA 1C2GA 1D3DB 2BDAA 3RXAA 4DJZB 3ESTA 1GL0E 4ZKSU 3MOCA 2FS9A 4ZKRU 1MTNC 1X7AC 1O5EH 4BOHA 1RTFB 1VGCC 1TBQH 1O3PB 2FI5E 2VU8E 3UQOA 5EW1H 4DIHH 2WV5A 3SORA 1F7ZA 4K69A 3ZVBA 1ZTJA 4K3JA 5FX6A 2QXJA 3A8BA 1UMAH 2BMGB 2XBVA 4FUCA 5ETXA 2J92A 1C9PA 3SV9A 2BXTH 4CR9A 1T8LA 1XXFA 5K7RA 1SI5H 3UY9A 1E37B 1O35A 1K2I1 2I6SA 2ZFTA 3BTTE 4TY7A 2BD2A 1W13U 2FXRA 1ZMJA 2FLRH 1WUNH 1UCYE 3K65B 3LGTA 2H5CA 1VCPA 2BDBA 3QZQA 5EG4A 1QRXA 1P2QA 3BIUH 4AFQA 1SC8U 1P12E 3HGPA 3VB6A 5FPSA 1TQ7B 4AFUA 1B7XB 1AQ7A 2FODA 3ATIA 2BVSH 4JMYA 1NRSH 1TNGA 3KEEA 1GCDA 3PLBA 1O3FA 3D49H 2OTVA 2BX4A 3IITA 4OS2A 3MO9A 5E2OA 1IOEA 3SUEA 2XTTB 1TONA 5L30H 3PO1B 3HK3B