3UY9A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uy9A02
2FESH 4AB9A 1DY8A 2HGTH 4OGYA 2BD5A 1V2NT 1TNKA 3RLWH 7ESTE 2PTCE 3LH3A 3VB4A 4FUCA 1F5RA 1O2QA 2BLWA 1A7SA 1YKTA 1ZLRA 4AFZA 2BZ6H 1O2XA 3SGAE 5AFYH 2NU0E 1LVMA 2V3OH 2C3SA 1ZMLA 1SBWA 2C8ZB 1A3EH 4NGAH 4X0WU 1KLJH 2FTLE 2ZTXA 1S84A 1O2NA 1HAVB 3V3MA 2AIQA 1AIXH 1F5KU 2DE9A 1O31A 3DD2H 3PM3A 1CU1A 1FAKH 1TGSZ 1E0FD 1TGNA 1LTOA 2ZIQH 5I46H 4FU9A 5FHTA 5E0GA 3AVZA 2ZHEH 1TGTA 1YGCH 1GI9B 3I77A 1TOCB 3TJVA 3TLOA 1J9CH 1BB0B 1HDTH 1AUTC 4VGCC 1BTZA 1JRTA 2AGGX 1DFPA 1UTJA 3FVFB 1SVPA 1JXPA 1NRPH 3MU5A 1Q31A 2A4QA 4HTCH 2O8LA 1ZJKA 1MTUA 2BOKA 1PPHE 4U2WA 2NU2E 4FUEA 1F5LA 4BTIB 1QBVH 2Q1JA 1GMCF 2D26C 1HJAC 2R0LA 4YESB 1C1MA 2D1JA 2UWPA 5FBIA 1L1JA 2SGDE 2ZDAH 4CHAB 2ZKSA 3S7KB 2CF9H 2YNBA 3A85A 4Q7ZA 1BCUH 2ZHFH 1C5MD 3MH7A 4Z0KA 3ZZAA 4A1TA 1OP8A 5AHGH 4IC5A 4NIVA 1CT0E 4Y76A 3B23B 2HLCA 1AFEH 3CS0A 1J8AA 1TMTH 1Z6EA 1UTQA 3QK1A 4X8UH 1A2CH 2AGIX 3RXPA 2O8TA 4ABEA 1BA8B 5FPYA 3F68H 1VCQA 1DSUA 1HAGE 3A86A 1HIAA 2C8XB 1IQIA 1YPKH 4YT6H 3MH6A 3PV4A 1KXCA 4Y8ZA 1O2HA 4MNXA 1EASA 4X1PU 3SI3H 1TNJA 1S85A 2ZTYA 2YNAA 1ANEA 1FMGA 1JMOH 3FFGA 4Z6AH 2WPIS 2SGEE 2UUKB 2DUCA 1FLEE 2GCHF 2OBOA 1SI5H 1BTPA 1NS3A 1K28D 3BG4C 1BMMH 1G3EA 2BY6X 2GV7A 4UFEH 3ZZDA 4A1VA 3SJ8A 2J38A 3QZQA 3TK6A 1KSNA 1O5CB 4PROA 2Y7ZA 4KP0A 1W12U 2P3FH 1UVSH 1HXFH 1V2WT 3GICB 4E06H 4THNH 2TGPZ 1TFXA 2C8WB 3SBKA 2OINA 3SZNA 2A5KA 1G36A 3M7TA 2JH5D 1SOZA 2XC5A 1TGBA 1AKSA 2BTCE 4AZ2B 3QUMP 3MI4A 2Y82A 1P9UA 2NU3E 4BNRA 3RUOA 2W7SA 1C1RA 4E7NA 1FY3A 1H8DH 2CJIA 5E0HA 1Z6JH 2A32A 3KIDU 4MNVA 4YM9A 2VGCB 1A5IA 1K1LA 3MHWU 5EG4A 4UEHH 5F8ZA 2EI8A 1ZOMA 1AB9B 1HXEH 2ALPA 4UE7H 4K69A 2FIRH 1QHRB 1LHFH 4D7FA 2ZGHA 4BAKB 1QNJA 1IQEA 1Z8IB 2FMJA 3BG4B 3E90B 1O3LA 1YLDA 3SU2A 1BBRE 1BRBE 2D2DA 1TMBH 1V2PT 3L33A 4X2YA 1MU8B 3SNCA 4SGBE 1O39A 4ZXXH 3P6ZB 1B7XB 2OC0A 1GJDB 8ESTE 2GV6A 1SGNE 3LJJA 3PLPA 2P93A 3ZV9A 3B8JA 2Z3CA 1GBFA 1HAVA 3A7ZA 1FDPA 1TAWA 1QBOA 1ZR0A 3E8LA 2JETC 5E8EH 1W13U 2XBWA 4Y71A 8GCHF 2QCYA 1P2JA 3PO1C 4ZHLU 3BTME 5AF9H 1GI0A 2HOBA 1EAXA 4JZDH 2O8UA 1WAYB 3UNQA 1G32B 1O2YA 2V0BA 1KXBA 2PKAB 3VEQB 1G3DA 2BXTH 1AHTH 1O3IA 4X1NU 3RXFA 1Z1IA 1O5GH 3VB5A 1TPAE 2PKSC 1A0HB 2VWMA 1MTNB 5GCHF 2QV1A 1O30A 2ANKH 1FAXA 1GBMA 2G81E 2ZTZA 4ESTE 1EQ9A 1GMHG 1PPBH 4B71A 3F9HA 4XSKU 1P2NA 4MLFB 4FU7A 1HJ8A 2GMTB 2VWOA 4KELA 1SQAA 5A0CA 2CHAB 3V12A 5TCAA 1O35A 1V2JT 1K9OE 1C5OH 1V2TT 1HNEE 1CGIE 2Q6DA 1CE5A 1SHHB 1GVZA 2WPHS 1O3GA 2IPHA 1ANCA 4IN1A 4K1EA 3TNSA 1Y5UT 1ABJH 4ABDA 1ZRKA 1D6RA 1GBKA 2AIPA 1ELBA 1RJXB 4ISOA 1P01A 5C5OA 2OBQA 3D49H 3PWBA 5FX5A 1WTHD 2ZHQH 3P95A 3E6PH 1UTOA 3MMGA 3TJOA 3MFJA 3ZZBA 1QTFA 4AFSA 5IDKA 1C1TA 2PUQH 1GJ4H 3GDUA 3O8BA 1F0UA 2GT7A 1SC8U 1GGDB 1TBRH 2ZGBH 4MPXA 1RTLA 5F6MA 1MBMA 2ZCKP 3QZRA 1SGYE 4LZ4B 3PLBA 5EXMA 2ZPSA 2Y81A 3FP8E 4IGDA 1MU6B 1QRZA 4DOQA 1THPB 1LQEA 1CBWC 1C5UA 4ISHH 4DCDA 1HB0B 1T31A 1IQFA 2R2WU 1C2GA 3ZZ8A 3LGIA 3OYPA 2BLQA 3UWIA 2OC1A 3VGCB 1O37A 1O5DH 4FXGH 1SGTA 2H9EH 3E0NB 1O36A 2ZDVH 4NSVA 1BRAA 3SV6A 2Q6FA 2WPLS 3EE0B 3Q00A 1O3EA 2FZZA 4D9QA 4OS1A 2O9QA 1OXGA 3BEIB 1AE5A 4ZH8A 1YPMH 2WYGA 1GJ7B 1ANBA 1F0SA 3RXGA 1SGRE 1K1JA 4TPYA 4CRAA 1D6WA 3R3GB 1GI4A 1MCTA 4OGXA 1AFQB 1KXDA 1GBHA 3CENA 2GT8A 1A61H 2BD3A 5C1XA 2QAAA 2ANWA 3A83A 1CA0B 2BM2A 1GHAG 5GWZA 2HNTE 1Q3XA 2B9LA 5DO4H 1GJBB 6LPRA 1VITH 1YP9A 2ZCLP 1C1SA 1NU7B 1GI1A 2ZU4A 3ZVAA 1QB9A 2FOEA 2FXRA 3EA7A 3O8RA 1ABIH 4OS4A 5F8XA 1ELTA 1J17T 1SL3A 1E35B 2OTVA 3F9FA 4GHTA 1ZGIA 2ZEBA 2HPQH 3ZVGA 3HK3B 4KTCA 1P8VC 3QX5H 1ELCA 4DGJA 1IQJA 3SJOA 1AWFH 5J4QA 4JYUH 4BTUB 1IQKA 3ZVDA 4LOYH 1DPOA 2XWBI 3SORA 1EATA 5EOKA 4AOQA 1DUAA 5F03A 1HRTH 1O3FA 2FOAA 3JZ2B 1AGJA 1PPZA 1UVPA 5GIBA 2BDIA 2R3YA 3ATLA 1FZZA 3LT3A 2F83A 1XUHA 5EGMA 1PQ8A 2Y5FA 1PPGE 4NA8A 1MD7A 1AVWA 3RXEA 2CXVA 1ELDE 4Y0YE 1IQNA 3M3VA 4TY6A 1H9IE 1PQ5A 3PMJA 4ZAEA 1NY22 2WV4A 1NN6A 3RXIA 1DLEA 2EA3A 3RLYH 1TPOA 3F9GA 3PTBA 2VWNA 4JZEH 1DITH 5JBTA 5JDUB 2Z9IA 3ATWA 2ZFFH 1W0YH 2HNTC 1P3EA 4IW4E 1LCYA 4MQAA 2ZG0H 1O3PB 1GBEA 1P09A 3E16B 3JZ1B 3ZVFA 5J4SA 1HAHH 1LHDH 2VIQA 1B0EA 1GMCG 1EZSC 2GDDA 4NSYA 1EJNA 3KF2A 2EI7A 3ATIA 1TPPA 1N8OB 3MYWA 4INHA 2LNCA 4YOGA 1SR5C 5GXPA 2BDHA 3CS7A 2OXSA 5HMAA 1FIWA 2WUCA 1QRXA 4TYDA 3UY9A 2UUJB 4ZROA 2F91A 1C1QA 1SGEE 1V2LT 3P8OA 1XKBC 1ZRBA 2ALVA 3ZVEA 1B0FA 1HV7A 2V3HH 3I29A 2WPJS 2GZ9A 3RXJA 4K3JA 1JIRA 1NO9H 1C5RA 3B9FH 5FXLA 1GCTB 1TA2A 3E91A 5E2OA 4A1XA 3IG6B 1DY9A 1OP0A 1RGQA 3HGPA 1BIOA 2RCEA 4B2AA 1ESTA 1C2FA 4I33A 2OCVB 2GCHG 3GY6A 3SNBA 1O2JA 5JB9S 5L6NH 4CRGA 2I6QA 3BTKE 3H7TA 2HWLB 4ABGA 4AGKA 1XVOA 3QWCH 1JBUH 7GCHF 1GI3A 1C2JA 1V2OT 2A31A 3PMAB 1V2RT 4I8HA 3M36A 1G3BA 1HAYB 3UOUA 5K7RA 2PHBA 3A80A 3IWMA 4LK4A 3SUGA 3TU7H 4O9VA 2C93B 1QR3E 1O3NA 3ZZ4A 1SGPE 1IQHA 1S5SA 2JKHA 1VJAU 2ZFPH 4O97A 5CE1A 2PLXA 1EXFA 3UR6A 3LJOA 2ZGJA 4X6NA 4XBCA 1VJ9U 3RXBA 4DVAU 1SGQE 3EQ0H 2SGPE 3PTNA 1EZUC 3UPEA 1AI8H 5L2YH 1DXPA 4AGJA 2G4UA 1IAUA 4FUBA 5H4IB 4D8NA 2J2UA 2OUAA 3TGJE 3GYLB 1FY1A 1BMAA 2VH0A 3SUDA 1LPGB 5T3HA 1VCWA 2FYRA 4B73A 3S9AA 1NC6A 2FO9A 2VVUA 1QL9A 1O3MA 1G3CA 2ZC9H 3V7TA 1T8NA 1EOJA 1BQYA 5EW2H 2A2XH 1ELGA 1ESAA 2NU1E 3K2UA 1NFYA 3KQCA 1MZDA 1L4DA 1GBTA 3UIRA 1QQUA 2YOLA 4WMFA 2C8YB 3KGPA 1P02A 1HAIH 4CHAC 2GX4A 1Y3XA 1YBWA 1QURH 2BDCA 1GJ9B 5C5NA 3A7WA 1NRNH 2QY0B 2PV9B 5IYTA 3MNBA 2J4IA 5FCRA 1ZPBA 4RN6A 1HAPH 4O03A 1C1VH 1LVYA 2THFB 1ESBA 2PR3A 1TRYA 4I7YH 1C1OA 1TNGA 2P8OB 1C2EA 1O3HA 1TA6A 1MKXK 8GCHG 2BB4A 3OTJE 4NFEA 1TX6A 1J14A 4LZ1H 2WUBA 1GVKB 1WUNH 1YF4A 4UFDH 4KGAA 3RXSA 1DX5M 9ESTA 4I8LA 2G5VA 3SQEE 3FANA 4U01A 2AMPA 2FYQA 2R9PA 2GKVE 1S0QA 2R3UA 1P0SH 2XBYA 2HPPH 4F49A 1W7GH 4FVDA 1J16A 3QN7A 5L30H 1C5PA 3T25A 1PJPA 3VB3A 2UUYA 1SOTA 1W10U 3SO3A 1XUIA 2NWNA 1K1PA 1TE0A 1N6XA 1U6QA 1P2OA 1KYNA 1Y59T 3N7OA 2QN5T 5DGJA 4WXIA 2Z7FE 2ANMH 5FX6A 1AD8H 3SW2B 3RXQA 4BOHA 1AU8A 1K22H 1SFIA 4IMZA 5DP6A 5FPTA 2BD7A 1ELAA 4MDSA 1MH0A 4BAQB 1Z8GA 1NRRH 1S82A 1AVGH 3GY8A 2ZFTA 5JBBS 3UTUH 2CGAA 2VGCC 1TQ0B 2TGAA 3GY3A 1ARCA 1HLTH 4H6SB 2GGVB 1FN8A 1AB9C 1O5BB 3ZZ7A 2ZA5A 3DFLA 3GCNA 1QCPA 4TPIZ 4ISLA 4BXSA 2A4GA 3U8OH 1NFXA 3ATMA 1RD3B 2TPIZ 4DIIH 3SJIA 1SGCA 1O2MA 1C4U2 1UCYK 3A89A 4BAMB 1V2KT 1G30B 3M5OA 5TJXA 3C27B 2ZPRA 1GHZA 1Z1JA 4NA9H 5C3NA 3TIUA 1C5XB 4ABIA 2VVCA 4DIHH 3QTOH 1O3DA 3ELAH 1C2KA 2KAIB 1OWIA 2QXJA 3FP6E 1EZQA 1UVOA 1L0ZA 4NIYA 1UCYH 3GCTG 1DWEH 1UK3A 1Y3UA 1MAXA 1H9HE 1QA0A 2V6NA 1O3KA 2BYAX 1KY9A 3RXCA 1YPGH 2ODQA 5GDSH 5JB8S 2BD8A 2ZHDA 3U1IB 4NG9H 2ZHWH 3LIWA 1BZXE 2IJOB 5ESBA 3MU4A 1A46H 1KXFA 2C4FH 1BJVA 4WWYA 4NIWA 3ZVCA 1TWXB 4E05H 4K5ZA 3MO6A 1AUJA 4X8VH 3SU1A 3M5NA 3HPTB 3VPKA 1TOMH 2QC2A 3MNSA 1F92A 1EAWA 2OLGA 3SI4H 2Z9JA 2B5TB 1AWHB 2CMYA 1MTNC 1SQOA 3GY5A 3LONA 4KTUA 4ZUHA 6CHAB 1ELFA 1BJUA 3TGKE 3MU1A 3BTWE 5JPMH 4JK6A 3NKKA 1O2UA 1NPMA 2H1UA 1P04A 2ZPQA 4GCHF 1GHYH 4B74A 2GMTC 4RKJB 3S9BA 1DLKB 3RC6A 1ORFA 1W2KH 2CHAC 5LPEA 4K2YA 2ZDMA 3FP7E 2G55A 3AASA 2FEQH 1QL8A 1IOEA 1EPTB 3A8BA 1TBQH 1C9TA 1H1BA 3RMMH 1GBCA 1L2EA 3QTVH 2Y6TA 1K1MA 2XNIA 1J15A 2CV3A 4Y10E 4J2YB 3SU4A 1LMWB 4CBOA 4OS7A 2FS8A 1V2VT 3A7YA 4I31A 4BANB 1MTSA 3STJA 3DHKH 3ZVBA 4ABBA 1HAZB 1GGDC 2FLRH 3SNAA 1SGIB 4A5TS 1EJMA 4JK5A 4X6PA 4R0IA 3RU4T 1VZQH 3VFEA 3BN9A 1MZAA 2FM2A 1C5LH 3STIA 2EEKA 3ZV8A 3QDZB 4BAOB 2AEIH 3LPRA 1WTGH 1P05A 4AN7A 4UFFH 1ZJDA 3ZZ5A 3VGCC 4AFUA 4SGAE 4I8KA 1C2DA 2ZU3A 3UFAA 3SNEA 3U8RH 3KN2A 1DE7H 5JBAS 2Y5GA 3RXLA 4ZMAH 3M61U 1VGCB 1O3CA 5F8TA 4WVPE 2G52A 1ARBA 1UMAH 1JRSA 3UNSA 3E1XB 2H5CA 2VNTA 4Y8YA 4CRDA 2K1QA 3H5CB 3BTHE 3NPSA 3SUEA 5PTPA 2QF0A 3M3TA 1EZXC 2BY5X 2A4RA 2QXIA 3A81A 1DWCH 3SU5A 1CGJE 3EA8A 1FJSA 3QGNB 4WH6A 3URCA 1AFQC 2F9VA 6ESTA 1XUJA 4GPGA 4HGCA 2XCNA 2ZDNA 3D23A 2P3UB 3SHAH 1A4WH 1CA0C 3T27A 2Z3DA 1DWBH 1XM1A 2AH4X 4UDWH 1NFWA 1T4UH 1THSH 2VB0A 2ZU2A 4MVNA 1TALA 1P9SA 3RU4D 1O2RA 5HGGA 4Y79A 3SV7A 1MKWK 3SHCH 2BLOA 3PMHB 2KAIA 1WQVH 2BLVA 2BD9A 1BTHH 3DA9B 4RSPA 1ZTKA 3TITA 4AFQA 1GHVH 1S0RA 3BTQE 1F2SE 3KQBA 4WY3A 4CH2B 2WINI 1XMNB 1TONA 3P8NA 1VITF 1ZHPA 3TPIZ 1CHOF 4H4FA 1GI5A 1MKWH 1MQ5A 3SU0A 5EXLA 4CRFA 2W26A 4K60A 1ZPCA 1V2MT 7GCHG 1IHSH 5CHAB 4Y6DA 3RXAA 3HKJB 3M5MA 1V2ST 2VIVA 4NFFA 1ZGVA 3HKIB 4HI3A 2JH0D 4UONA 1E36B 4DJZB 1NRSH 1KXAA 1UVUH 1W8BH 2BD4A 1MTWA 1KDQB 2HALA 1EB1H 1OWDA 1UHBB 2SGFE 1C4V2 4JCNA 4ZKOU 4NCYA 2VU8E 2AMQA 2J95A 2VIOA 3EDXB 2BY9X 3V0XA 1A0LA 3DFJA 2FOFA 1DICA 3DUXH 1GG6B 1C1UH 1AY6H 1TRNA 1DOJA 1P2KA 4BAHB 4X1QU 1Y3WA 1CHGA 2P94A 2BY7X 3GCHB 4M7GA 3MWIU 1OWEA 1EPTA 2XYAA 4INLA 1ZTLA 1SG8B 2PW8H 3FZZA 1ZSJA 1TYNA 1MMJN 1FY8E 1MBQA 5T6FA 3I78A 3OY5U 5C2ZA 3UQOA 3ATKA 1QIXB 3PWCA 2QF3A 1IQGA 2W7UA 3NWUA 1N8OC 1O5AB 4X2WA 3TH2H 1HGTH 1N6YA 2EC9H 4XBDA 1C5VA 2P16A 1GMDF 4BTTB 4ABFA 3ODDA 4NZLA 5CMXH 1C9PA 3LU9B 1RIWB 4I8JA 3BTDE 1INCA 3P17H 5EQRA 2FI4E 1H8IH 4X2XA 2AS9A 2H6MA 1D3QB 1OWJA 2H5DA 3Q77A 3UNRA 4ZKNU 1ELEE 1GDQA 3RDZA 3SGQE 2BOHB 1C1NA 4GVUA 1GHXH 1ETTH 4ZKSU 3SV9A 5AFZH 4F4OC 3K65B 2OC7A 1AVXA 1EJAA 4Y0ZE 1GCTC 2AERH 4X8SH 1GVLA 2CN0H 1PFXC 3KEEA 5HM2A 1O2LA 2QYIA 1FONA 1G37A 2Z94A 3KNXA 3L3TA 1Z71A 1G9IE 2BXUH 5A2MH 3LC5A 1E34B 1O2PA 2HRVA 1GL1A 1JWTA 4TWWA 1LHEH 2D8WA 1BITA 1CSOE 1KIGH 2QGRA 3SOSA 3U8TH 1W3CA 3VXFH 4FUGA 1P2IA 3RXRA 2FI5E 2RA0A 3URDA 3W95A 1UTPA 5ABWA 2A0QB 2FX6A 1NESE 4DW2U 1QBNA 1P06A 1EUFA 1PPEE 1F0RA 4GUXA 5DP4A 1C5SA 2A4OA 2AYWA 5A0BA 4X6MA 1ETSH 1BMLA 1ANDA 2J92A 3VB6A 3SUFA 2TBSA 1GBBA 4AG2A 2XW9A 1AO5A 1MQ6A 1C5TA 2BVXH 6GCHF 3BEFB 1DXWA 3GYMA 1YPJH 2Z9GA 2FPZA 2WPKS 3WY8A 4NWLA 1QJ1B 5ESTE 1HAOH 1TABE 4LXBH 3UUZA 3GCOA 1AZ8A 1VR1H 1DM4B 1NROH 2ZZUH 3AW1A 1QQ4A 5FBEA 4ISIH 4Q7XA 1HJ9A 2Z9LA 1G2LA 3TH4H 4MPUA 4NIXA 1ETRH 1TQ7B 4Q2KA 4X6OA 1W7XH 4Q80A 5FAHA 2Z3EA 4O3TA 2STBE 1OWHA 1Z7KA 5DPAA 5T6GA 1ZHMA 3SV8A 1C2MA 1ZPZA 1KDQA 1AZZA 1MCVA 3P8FA 3T28A 3Q3YA 2F9NA 2XBVA 3BTEE 1UHBA 3PMBB 2FOCA 1EKBB 1ID5H 2VWLA 5DP5A 4ABAA 2BMGB 1XUFA 5DP8A 2P8OC 1O33A 1C5QA 5A09A 1D3DB 4IN2A 3A84A 1GDUA 5G4BA 1O3JA 1T4VH 1XXDA 5ETXA 1E38B 2G51A 2PTNA 2C90B 3RXDA 1O2TA 5FPSA 2ZWLH 2BY8X 2PGBB 1W0ZU 1TNIA 5LPFA 1BDAA 5C20A 4Q7YA 1SPJA 3K9XB 4AG1A 3A88A 4FVBA 2XCFA 1TX7A 1O0DH 1LHGH 5JYIA 2A5AA 1HBTH 1O2IA 1SQTA 3K6ZA 3M3SA 2GP9B 1KTSB 3O8DA 3E0PB 1Q2WA 1O3OA 1RS0A 4X2VA 1TRMA 2FLBH 2Q6GA 4GCHG 5I25A 1O2GH 5AVDA 2Z6BD 4WF8A 1GJAB 1V3XA 1MTVA 1QJ7B 3PLKA 1RFNA 3S7HB 1P03A 3RM0H 3E3TA 4Y7BA 1L1GA 2ZP0H 1L4ZA 2Z9KA 3KQDA 2BD2A 2FX4A 2ZI2H 1K1NA 5JBCS 3U69H 4D7GA 1Z8RA 1V2QT 1CO7E 2NU4E 2QXHA 3P70B 4BXWA 1JOUB 3DT0H 3BTGE 3R0FA 4TY7A 1MD8A 1P12E 4XFQA 3A82A 4YO9A 1SGFA 1FPHH 1DSTA 1SGFG 1D9IA 4MPVA 4OS2A 2AMDA 1CQQA 3SNDA 4MG3A 1MKXH 1GI7B 4A6LA 1KLTA 1YCPK 3MH5A 1NM6A 3RC4A 3LOXA 3O8CA 3FZDA 5GCHG 3SJ9A 3M7QA 4MNWA 4WXVA 1BHXF 1PQ7A 4IC6A 3QGJA 3RMLH 2GCTB 3OSYA 3H7OA 1A1RA 3L6PA 1KLIH 4U30A 4CR9A 3GISB 2Y7XA 1OSSA 1YCPH 3SQHE 3ITIA 1TB6H 4J1YA 1PYTC 3M37A 4JZFH 1X7AC 3ZZ9A 1SB1H 3ODFA 2OQUA 5A0AE 2VIWA 1YC0A 1O5FH 1ZTJA 1QB6A 4UFGH 1FI8A 3RP2A 1BMNH 3MTYA 3M35A 1A3BH 1S81A 4WH8A 1TMUH 5GPIB 1ZZZA 1O32A 1T32A 2QXGA 1XVMA 5DKMA 2OP9A 3SV2H 4GSOA 3LH1A 1GBJA 3RXKA 1GHBF 2WYJA 1LDTT 1OS8A 1TNHA 2BVRH 1Y8TA 4IMQA 1M9UA 3KCGH 2RA3A 1IHTH 1FXYA 4GAWA 1DDJA 3TJNA 3BTTE 1GI6A 1K1IA 3LGWA 1THRH 3BG8A 4VGCB 2H9HA 5EQSA 3GDVA 3BTFE 1TPSA 3MOCA 1QGFA 1DVAH 3EAJA 5HM9A 1O2KA 1P3CA 3Q3XA 2F3CE 4AYYB 1UO6A 4YT7H 2QA9E 5C1UA 3RXMA 6CHAC 4B1TA 1LQDB 1T8OA 3RM2H 3UWJH 1GJ6A 4ZXYH 1HJAB 1BBRK 4RKOB 4YLUA 2PSYA 3UREA 1FY4A 2BDYA 3GY7A 2BX4A 2ZO3H 1D4PB 4ISNA 2ASUB 4Y7AA 3GDSA 2XWAA 1PYTD 1UTNA 4B2CA 2A7HA 1YPLH 1NRQH 2VH6A 1VITG 4DY7B 4FU8A 1EPTC 1CHOG 4YZUA 2PFEA 2PUXB 1BBRH 1O2SA 3AAUA 5C67A 3TK9A 2G8TA 4QT8C 4X8TH 4KKDA 4HZHA 1OYQA 1LPZB 4K8BA 2A45B 1YYY1 1F0TA 1OYTH 1UTLM 1MUEB 1YLCA 1WBGB 1AMHA 2A1DB 2G5NA 2OQ5A 4FUJA 4YTAA 1ZMNA 3NUMA 1Z8JB 1WSSH 4YLQH 3PYHA 1GL0E 2RG3A 1GHWH 3W94A 1FV9A 3QLPH 1FIZA 3A7VA 1UCYE 1GBDA 5FCKA 2BZAA 3SU6A 3ZYEA 4JZIA 1V2UT 2FDAA 4ABHA 3LGYA 3ZZ6A 3D62A 3RMOH 3RU4E 1O2ZA 1GJCB 1OX1A 3U98H 1GJ5H 1WYKA 3SU3A 5T6DA 4U32A 1QY6A 1Y3YA 1YPEH 2W3KA 2ZFQH 2J94A 3A8CA 2FODA 3U9AH 1GBAA 5L2ZH 1XKAC 1QRWA 4D9RA 3F9EA 1GBIA 3A7TA 3CP7A 1OWKA 3OY6U 1ELVA 3BSQA 2F9BH 3TK5A 1BOQA 1HPGA 1VGCC 3RXVA 3OU0A 5DJ7A 1ZMJA 1BTUA 2A5IA 1TGCA 5A8YA 1O3BA 1QFKH 3SN8A 8KME2 3LDXH 1BT7A 1P57B 2ESTE 3GY4A 1BTXA 2FOMB 2GZ7A 5A8ZA 1GMDG 4GLYA 1HCGA 1TIOA 2ZDLA 2V35A 5BRRE 3F1SB 5DP3A 2A2QH 3RXOA 3LC3A 1SGDE 2O8MA 2UWLA 3LGUA 4H6TA 1AQ7A 5EPYA 1NZQH 1QA7A 4WMDA 2FOGA 1CVWH 1RXPA 1NT1A 1A0JA 1FPCH 1P2QA 4CH8B 4DT7B 2BQWB 7KMEH 2AFQB 2BDBA 2ZGXH 2ZFSA 4FUIA 3MNXA 1RTKA 2VJ1A 5C1YA 1EB2A 2ZF0H 1BHXB 3MO3A 4GHQA 3OX7U 4B76A 4K8YA 4ASHA 1B5GH 3UQVA 2OD3B 1D3TB 1O2VA 1SLXB 3TGIE 4NA7A 5CHAC 1C5YB 3NXPA 2XC0A 1C5WB 1EAIA 1P11E 1LKBA 1RRKA 3TH3H 2UWOA 3MH4A 2JETB 3LKWA 2GVFA 3PO1B 1W11U 5E0JA 1P10A 1S6FA 3P92A 4HFPB 2BX3A 1GI8B 1QL7A 3TJUA 1WOFA 2HNTF 1NFUA 1K2I1 1T7CA 1N1LA 1H9LB 3KHVA 5LGOA 4XOJA 2A7CA 5GJ4B 1PPFE 1WCZA 2FI3E 3P8GA 1GJ8B 4JYTA 1RTFB 3AW0A 1FQ3A 1L1NA 2R0KA 5HXFA 1SLVB 1NU9A 3GY2A 3EYDA 4I32A 1WV7H 2BVSH 4WJG2 2PGQB 1A5HA 2PKSB 1H4WA 6GCHG 2GZ8A 2FP7B 4AB8A 1JIMA 1GG6C 2XXLA 2Y80A 2ZECA 1GDNA 1Y5BT 5EU8A 1YCPM 4NWKA 3GCHC 2WV5A 5K0HA 1C5ZB 3RC5A 2H2ZA 2XBXA 2XTTB 1BRCE 1PPCE 3GOVB 5EQQA 2B7DH 1AN1E 2ZGCA 1NTPA 1ZHRA 1WU1A 3GCTF 4A92A 1DWDH 4UD9H 1A5GH 3UOPA 1WQSA 4CBNA 1GBLA 4B75A 1XUGA 2ZNKH 4YOJA 4R8TB 4IS5A 3SJKA 5EXNA 2H9TH 2EI6A 4ZHAA 3RMNH 1TX8A 4CREA 1C2LA 1IQLA 5SGAE 2AGEX 2ZFRH 9LPRA 1RIWC 2ILNA 2TIOA 3T26A 4D76A 3NZIA 5HYOA 4XBBA 1O2OA 2ZDKA 3BEUA 1O38A 1SFQB 2TGTA 1S83A 1EOLA 3MU0A 3ZZ3A 1FNIA 3SGBE 5B6OA 1GWAA 2BQ6B 4A7IB 3M7UA 1C4Y2 1HUTH 1C5NH 2SFAA 3T62A 1CBWB 2BHGA 5DG6A 5BPEA 1SMFE 2PSXA 5E2PA 4CRCA 2HVXA 5DP9A 2UUFB 4AYVB 1ZSKA 3TNTA 1LPKB 4IBLH 1HYLA 4MNYA 2W5EA 1SLWB 2DE8A 2G4TA 4B2BA 3VB7A 5A8XA 2GTBA 3RXUA 2VVVA 2P95A 1CA8B 2ZQ1A 1MAYA 1C2HA 2ANYA 3S69A 2PWXA 4ZHMU 1EP5A 1YM0A 4DG4A 4X1RU 4CR5A 2FOHA 2STAE 3BIUH 1O34A 1SHYA 4DURA 3T29A 1AE8H 5DP7A 3C1KA 3G01A 2SGQE 1DUEA 1CT2E 1BUIA 3AAVA 1K1OA 3RXHA 2ULLA 3BF6H 2VIDA 1C2IA 4O3UA 3S9CA 2PKAA 1ACBE 1CGHA 7LPRA 4Y11E 1QJ6B 1DS2E 2FWWA 4XDEA 1O2WA 3PROA 2WPMS 2B8OH 4YOIA 3D65E 1V6DA 3MO9A 4AORA 4CRBA 2F9OA 4ABJA 3HGNA 3Q3KA 1GMHF 3A8DA 1UTMA 2GDEH 3T2NA 2FOBA 2QIQA 3A8AA 2ZQ2A 2LPRA 2JH6D 2W3IA 2XRCA 1LKAA 3ESTA 4I8GA 4FUDA 3TVJB 2P3TB 2A7JA 2RDLA 1LO6A 1TNLA 1C1PA 1EP6A 1W14U 1D3PB 2P59A 3KL6A 1EAUA 1BTWA 1VCPA 3EGKH 3ZYDA 5TCCA 2ZU5A 1BRUP 4KTSA 4INKA 2F9PA 3LGTA 1OKXA 3MNCA 1XX9A 1BTYA 2FS9A 1UTKA 4TWYA 3BIVH 2ODPA 4K1SA 1YPHE 2BDAA 4JMYA 4H42U 2FTMA 2IOTA 2ODYB 1UVTH 5LH8A 1GHBG 4XE4A 2GD4B 1GPZA 3NK8A 1HIAB 1CT4E 2VINA 2R2MB 1SSXA 1TLDA 5EODA 2BDGA 5LPRA 2F9UA 5EPNA 4WMEA 1F7ZA 2B0FA 3PB1E 3T5FH 2XC4A 3LGVA 8LPRA 1E37B 1UK4A 2Y5HA 3K6YA 4MPWA 5EW1H 3HK6B 1OP2A 1KXEA 3NCLA 3RXTA 4K1TA 1FY5A 5DK1A 1HFDA 1UJ1A 3BV9B 3ZZCA 3IITA 2J9NA 1GCDA 1EX3A 1GI2A 4MTBA 4E7RG 2J34A 3MU8A 1O3AA 3F6UH 1FUJA 1T8MA 1S6HA 4NZQA 3HATH 1Y3VA 3EA9A 2O8WA 4ZKRU 1PQAA 4JYVH 3Q76A 1XUKA 1QB1A 3A87A 2ZU1A 1LVOA 4FUFA 3FAOA 3V13A 1T8LA 3U1JB 2IN2A 3UR9A 1AKSB 3M5LA 4OS6A 3ENSB 1HAXB 1Y5AT 2M5TA 1C1WH 1GHAF 1FN6A 2OC8A 4OS5A 1SLUB 3S0NA 4FUHA 3A7XA 1P2MA 2TGDA 1LVBA 2G00A 3QO6A 4JZ1A 3VXEH 2TRMA 2SNVA 1KTTB 1G2MA 1ZSLA 1YPHC 3KQEA 2SNWA 1DANH 4AX9H 2CF8H 1XXFA 1DT2A 1OPHB 1OOKB 2I6SA 4X1SU 2VIPA 1LHCH 2SGAA 1UK2A 1IQMA 4Y8XA 2BQ7B 2GCTC 2ZCHP 1O5EH 1ZYOA 1TBZH 1K21H
chains in the Genus database with same CATH superfamily
2FESH 4AB9A 1DY8A 2J97A 2HGTH 4OGYA 2BD5A 1V2NT 1TNKA 3RLWH 7ESTE 2PTCE 3LH3A 3VB4A 4FUCA 1F5RA 1O2QA 2BLWA 1A7SA 1YKTA 1ZLRA 4AFZA 2BZ6H 1O2XA 3SGAE 5AFYH 2NU0E 5DSFA 1LVMA 2V3OH 2C3SA 1ZMLA 1SBWA 2C8ZB 1A3EH 4NGAH 4X0WU 1KLJH 2FTLE 2ZTXA 1S84A 1O2NA 1HAVB 3V3MA 2AIQA 1AIXH 1F5KU 2DE9A 1O31A 3DD2H 3PM3A 1CU1A 3VG8A 1FAKH 1TGSZ 1E0FD 1TGNA 1LTOA 2ZIQH 5I46H 4FU9A 5FHTA 5E0GA 3AVZA 2ZHEH 1TGTA 1YGCH 1MABB 1GI9B 3I77A 1TOCB 3TJVA 3TLOA 1J9CH 1BB0B 1HDTH 1AUTC 2XNDD 1BTZA 1JRTA 2AGGX 1DFPA 1UTJA 3FVFB 4VGCC 1SVPA 1JXPA 1NRPH 2YMSC 3MU5A 1Q31A 2A4QA 3N99A 4HTCH 2O8LA 1ZJKA 1MTUA 2BOKA 1PPHE 4U2WA 2EY4C 2NU2E 4FUEA 1F5LA 4XD7D 4BTIB 1QBVH 2Q1JA 1GMCF 2D26C 1HJAC 2R0LA 4YESB 1C1MA 2D1JA 2UWPA 5FBIA 1L1JA 2SGDE 2ZDAH 4CHAB 2ZKSA 3S7KB 2CF9H 2CK3D 2YNBA 3A85A 4Q7ZA 1BCUH 5F53A 2ZHFH 1C5MD 3MH7A 4Z0KA 3ZZAA 4A1TA 1OP8A 5AHGH 4IC5A 4NIVA 1CT0E 4Y76A 3B23B 2HLCA 1AFEH 3CS0A 1J8AA 1TMTH 1Z6EA 1UTQA 3QK1A 4X8UH 1A2CH 2AGIX 3RXPA 2O8TA 4ABEA 1BA8B 5FPYA 3F68H 1VCQA 1DSUA 1HAGE 3A86A 1HIAA 2C8XB 1IQIA 1YPKH 4YT6H 3MH6A 3PV4A 1KXCA 4Y8ZA 1O2HA 4MNXA 1EASA 2WPDD 4X1PU 3SI3H 1TNJA 1S85A 2ZTYA 2YNAA 1ANEA 1FMGA 4YXWD 1JMOH 3FFGA 4Z6AH 2WPIS 2SGEE 2UUKB 2DUCA 1FLEE 2GCHF 2JIZD 2OBOA 3DSOA 1SI5H 1H8HD 1BTPA 1NS3A 1K28D 3BG4C 1BMMH 1G3EA 2BY6X 2GV7A 4UFEH 3ZZDA 4A1VA 3SJ8A 2J38A 1EFRD 3QZQA 3TK6A 1KSNA 1O5CB 4PROA 2Y7ZA 4KP0A 1W12U 2P3FH 1UVSH 1HXFH 1V2WT 3GICB 4E06H 4THNH 2TGPZ 1TFXA 2C8WB 3SBKA 2OINA 3SZNA 2A5KA 1G36A 3M7TA 2JH5D 1SOZA 2XC5A 2J5UA 1TGBA 1AKSA 2BTCE 4AZ2B 3QUMP 3MI4A 2Y82A 1P9UA 2NU3E 4BNRA 1NBME 3RUOA 2W7SA 1C1RA 4E7NA 1FY3A 1H8DH 2CJIA 5E0HA 4P02A 1Z6JH 2L74A 2A32A 3KIDU 4MNVA 4YM9A 2VGCB 1A5IA 1K1LA 3MHWU 5EG4A 3FN8A 4UEHH 5F8ZA 2EI8A 1ZOMA 1AB9B 1HXEH 2ALPA 4UE7H 1WDIA 4K69A 2FIRH 1QHRB 1LHFH 4D7FA 2ZGHA 1E1RD 4BAKB 1QNJA 1IQEA 1Z8IB 2FMJA 3BG4B 1E1QD 3E90B 1O3LA 1YLDA 3SU2A 1BBRE 1BRBE 2D2DA 1TMBH 1V2PT 3L33A 4X2YA 1MU8B 3SNCA 4SGBE 1O39A 4ZXXH 3P6ZB 1B7XB 2OC0A 1GJDB 8ESTE 2GV6A 1SGNE 3LJJA 3PLPA 2P93A 3ZV9A 3B8JA 2Z3CA 1GBFA 1HAVA 3A7ZA 1FDPA 1TAWA 5C94A 1QBOA 1ZR0A 3E8LA 2JETC 5E8EH 1YLNA 1W13U 2XBWA 4Y71A 8GCHF 2QCYA 1P2JA 2HVYB 3PO1C 4ZHLU 3BTME 5AF9H 1GI0A 2HOBA 1EAXA 4JZDH 2O8UA 1WAYB 3UNQA 1G32B 1O2YA 2V0BA 1KXBA 2PKAB 3VEQB 1G3DA 2BXTH 1AHTH 1O3IA 4X1NU 3RXFA 1Z1IA 1O5GH 4Q4LA 3VB5A 1TPAE 2PKSC 1A0HB 2VWMA 1MTNB 5GCHF 2QV1A 1O30A 2ANKH 1FAXA 1GBMA 2G81E 2ZTZA 4ESTE 1EQ9A 1GMHG 1PPBH 2VBCA 4B71A 3F9HA 4XSKU 1P2NA 4MLFB 4FU7A 1HJ8A 2GMTB 2VWOA 4KELA 1SQAA 5A0CA 2CHAB 3V12A 5TCAA 1O35A 2J98B 1V2JT 1K9OE 1C5OH 1V2TT 1HNEE 1CGIE 2Q6DA 1CE5A 1SHHB 1GVZA 2WPHS 1O3GA 2IPHA 1ANCA 4IN1A 4K1EA 3TNSA 1Y5UT 1ABJH 4ABDA 1ZRKA 5EJLA 1D6RA 1GBKA 2AIPA 1ELBA 1RJXB 4ISOA 1P01A 5C5OA 2OBQA 3D49H 3PWBA 5FX5A 1WTHD 2ZHQH 3P95A 3E6PH 1UTOA 3MMGA 3TJOA 3MFJA 3ZZBA 1QTFA 4AFSA 5IDKA 1C1TA 2PUQH 4I86A 1GJ4H 3GDUA 3O8BA 1F0UA 2GT7A 1SC8U 1GGDB 1TBRH 2ZGBH 4MPXA 1RTLA 5F6MA 1MBMA 2ZCKP 3QZRA 1SGYE 4LZ4B 3PLBA 5EXMA 2ZPSA 2Y81A 3FP8E 4IGDA 1MU6B 1QRZA 4DOQA 1THPB 1LQEA 1CBWC 1C5UA 4ISHH 4DCDA 1HB0B 1T31A 1IQFA 2R2WU 1C2GA 3ZZ8A 3LGIA 3OYPA 2BLQA 3UWIA 2OC1A 3VGCB 1O37A 1O5DH 4FXGH 1SGTA 2H9EH 3E0NB 1O36A 2W6JD 2ZDVH 4NSVA 1BRAA 2JDID 3SV6A 2Q6FA 2WPLS 3EE0B 3Q00A 1O3EA 2FZZA 4D9QA 4OS1A 2O9QA 1OXGA 3BEIB 1AE5A 4ZH8A 1YPMH 2WYGA 1GJ7B 1ANBA 1F0SA 3RXGA 1SGRE 1K1JA 4TPYA 4CRAA 1D6WA 3R3GB 1GI4A 1MCTA 4OGXA 1AFQB 1KXDA 1GBHA 3CENA 2GT8A 1A61H 2BD3A 5C1XA 2QAAA 2ANWA 2IPQX 3A83A 1CA0B 2BM2A 1GHAG 5GWZA 2HNTE 1Q3XA 2B9LA 5DO4H 1GJBB 6LPRA 1VITH 1YP9A 2ZCLP 1C1SA 1NU7B 1GI1A 2ZU4A 3ZVAA 4RT1A 1QB9A 2FOEA 2FXRA 3EA7A 3O8RA 1ABIH 4OS4A 5F8XA 1ELTA 1J17T 1SL3A 1E35B 2OTVA 3F9FA 4GHTA 1ZGIA 2ZEBA 2HPQH 3ZVGA 3HK3B 4KTCA 1P8VC 3QX5H 1ELCA 4DGJA 1IQJA 3SJOA 1AWFH 5J4QA 4JYUH 4BTUB 1IQKA 5FL7D 3ZVDA 4LOYH 1DPOA 2XWBI 3SORA 1EATA 5EOKA 4AOQA 3F2HA 1DUAA 5F03A 1HRTH 1YWUA 1O3FA 2FOAA 3JZ2B 1AGJA 1PPZA 1UVPA 5GIBA 3F2FA 2BDIA 2R3YA 3ATLA 1FZZA 3LT3A 2F83A 1XUHA 5EGMA 1PQ8A 2Y5FA 1PPGE 4NA8A 2EQNA 1MD7A 3FKSD 1AVWA 3RXEA 2CXVA 1ELDE 4Y0YE 1IQNA 3M3VA 4TY6A 1H9IE 1PQ5A 3PMJA 4ZAEA 1NY22 2WV4A 1NN6A 3RXIA 1DLEA 2EA3A 3RLYH 1TPOA 3F9GA 3PTBA 2VWNA 4JZEH 1DITH 5JBTA 5JDUB 2Z9IA 3ATWA 2ZFFH 1W0YH 2HNTC 1P3EA 4IW4E 1LCYA 4MQAA 2ZG0H 1O3PB 1GBEA 1P09A 3E16B 2J98A 3JZ1B 3ZVFA 5J4SA 1HAHH 1LHDH 2VIQA 1B0EA 1GMCG 1EZSC 2GDDA 4NSYA 1EJNA 3KF2A 2EI7A 3ATIA 1TPPA 1N8OB 3MYWA 4INHA 2LNCA 4YOGA 4TSFD 1SR5C 5GXPA 2BDHA 3CS7A 3FO8D 2OXSA 5HMAA 1FIWA 2WUCA 1QRXA 4TYDA 1H8ED 3UY9A 2UUJB 4ZROA 2KFWA 2F91A 1C1QA 1SGEE 1V2LT 3P8OA 1XKBC 1ZRBA 2ALVA 3ZVEA 1B0FA 1HV7A 2V3HH 3I29A 2WPJS 2GZ9A 3AK5A 3RXJA 3DSPA 4K3JA 1JIRA 1NO9H 1C5RA 2K0QA 3B9FH 5FXLA 1GCTB 1TA2A 3E91A 5E2OA 4A1XA 3IG6B 1DY9A 1OP0A 2PP6A 1RGQA 3PRBA 3HGPA 1BIOA 2RCEA 4XRNA 4B2AA 1ESTA 1C2FA 4I33A 2OCVB 2GCHG 3GY6A 3SNBA 1O2JA 5JB9S 5L6NH 4CRGA 2I6QA 3BTKE 3H7TA 2HWLB 4ABGA 4AGKA 1XVOA 2KR7A 3ZIAD 3QWCH 1JBUH 7GCHF 1GI3A 1C2JA 1V2OT 2A31A 3PMAB 1V2RT 4I8HA 3M36A 1G3BA 1HAYB 3UOUA 5K7RA 2PHBA 3A80A 3IWMA 4LK4A 3SUGA 3TU7H 4O9VA 2C93B 1QR3E 1O3NA 3ZZ4A 1SGPE 1IQHA 1S5SA 3FOAA 2JKHA 1VJAU 2ZFPH 4O97A 5CE1A 2PLXA 1EXFA 3UR6A 3LJOA 2ZGJA 4X6NA 3PV5A 1VJ9U 4XBCA 3RXBA 4DVAU 1SGQE 3EQ0H 2SGPE 3PTNA 1EZUC 3UPEA 1AI8H 5L2YH 1DXPA 4AGJA 2G4UA 1IAUA 4FUBA 5H4IB 4D8NA 2J2UA 2OUAA 3TGJE 3GYLB 1FY1A 1BMAA 2VH0A 3SUDA 1LPGB 2KCAA 5T3HA 1VCWA 2FYRA 3W1EA 4B73A 3S9AA 1NC6A 2FO9A 2VVUA 1QL9A 1O3MA 1G3CA 2ZC9H 3V7TA 1T8NA 1EOJA 4DT4A 1BQYA 5EW2H 2A2XH 1ELGA 1ESAA 2NU1E 3K2UA 1NFYA 3KQCA 1MZDA 2KM0A 1L4DA 1GBTA 3UIRA 1QQUA 2YOLA 4WMFA 2C8YB 3KGPA 1P02A 1HAIH 4CHAC 2GX4A 1Y3XA 1YBWA 2JJ2D 1QURH 2BDCA 1GJ9B 5C5NA 3A7WA 1NRNH 2QY0B 2PV9B 5IYTA 3MNBA 2J4IA 5FCRA 1ZPBA 4RN6A 1HAPH 4O03A 2WV9A 1C1VH 1LVYA 2KCYA 2THFB 1ESBA 2PR3A 1TRYA 4I7YH 1C1OA 1TNGA 2P8OB 1C2EA 1O3HA 1TA6A 5EIYA 1MKXK 8GCHG 2BB4A 3OTJE 4NFEA 1TX6A 3KYFA 1J14A 4LZ1H 2WUBA 1GVKB 1WUNH 1YF4A 4UFDH 4KGAA 3RXSA 1DX5M 9ESTA 4I8LA 2G5VA 3SQEE 3FANA 4U01A 2AMPA 3F0OA 2FYQA 2R9PA 2GKVE 1S0QA 2R3UA 1P0SH 2XBYA 2HPPH 4F49A 1W7GH 4FVDA 1J16A 3QN7A 5L30H 1C5PA 3T25A 1PJPA 3VB3A 2UUYA 1SOTA 1W10U 3SO3A 1XUIA 2NWNA 1K1PA 1TE0A 1N6XA 1U6QA 1P2OA 1KYNA 1Y59T 3N7OA 2QN5T 5DGJA 4WXIA 5CHBA 2Z7FE 2ANMH 5FX6A 1AD8H 3SW2B 3GS9A 3RXQA 4BOHA 1AU8A 1K22H 1SFIA 4IMZA 5DP6A 5FPTA 2BD7A 3UB0A 4Z1MD 1ELAA 4MDSA 1MH0A 3WWBA 4BAQB 1Z8GA 1NRRH 1S82A 1AVGH 3GY8A 2ZFTA 5JBBS 3UTUH 2CGAA 2GJGA 2VGCC 3CNRA 1TQ0B 5B6LA 2TGAA 3GY3A 1ARCA 1HLTH 4H6SB 2GGVB 1FN8A 1AB9C 1O5BB 3ZZ7A 2ZA5A 3DFLA 2YMSD 3GCNA 1QCPA 4TPIZ 4ISLA 4BXSA 2A4GA 3U8OH 1NFXA 3ATMA 1RD3B 2TPIZ 4DIIH 4Q63A 3SJIA 1SGCA 1O2MA 5KGOA 1C4U2 1UCYK 3A89A 4BAMB 1V2KT 1G30B 3M5OA 5TJXA 3C27B 2ZPRA 1GHZA 1Z1JA 4NA9H 5C3NA 3TIUA 1C5XB 4ABIA 2VVCA 4DIHH 4AC9A 3QTOH 1O3DA 3ELAH 1C2KA 2KAIB 1OWIA 2QXJA 3FP6E 1EZQA 1UVOA 1L0ZA 4NIYA 5DN6D 1UCYH 3GCTG 1DWEH 1UK3A 1Y3UA 2QF5A 1MAXA 1H9HE 1QA0A 2V6NA 1O3KA 2BYAX 1KY9A 3RXCA 1YPGH 2ODQA 5GDSH 5JB8S 2BD8A 2ZHDA 3U1IB 4NG9H 2ZHWH 3LIWA 1BZXE 2IJOB 5ESBA 3MU4A 1A46H 1KXFA 2C4FH 1BJVA 4WWYA 4NIWA 3ZVCA 1TWXB 4E05H 4K5ZA 3MO6A 1AUJA 4X8VH 3SU1A 3M5NA 3HPTB 3VPKA 3DCLA 1TOMH 2QC2A 3MNSA 1F92A 1EAWA 2OLGA 3SI4H 2LELA 2Z9JA 2B5TB 1AWHB 2CMYA 1MTNC 1SQOA 3GY5A 3LONA 4KTUA 4ZUHA 6CHAB 1ELFA 1BJUA 3TGKE 3MU1A 3BTWE 5JPMH 4JK6A 3NKKA 1O2UA 1NPMA 2H1UA 1P04A 2ZPQA 4GCHF 1GHYH 1SKYE 4B74A 2GMTC 4RKJB 3S9BA 1DLKB 3RC6A 1ORFA 1W2KH 2CHAC 5LPEA 4K2YA 2ZDMA 1QZ8A 3FP7E 2G55A 3AASA 2FEQH 1QL8A 1IOEA 1EPTB 3A8BA 1TBQH 1C9TA 1H1BA 3RMMH 1GBCA 1L2EA 3QTVH 2Y6TA 1K1MA 2XNIA 1J15A 2CV3A 4Y10E 4J2YB 3SU4A 1LMWB 4CBOA 4OS7A 2FS8A 1V2VT 3A7YA 4I31A 4BANB 1MTSA 3STJA 3DHKH 3ZVBA 4ABBA 1HAZB 1GGDC 2FLRH 3SNAA 1SGIB 4A5TS 1EJMA 4JK5A 4X6PA 4R0IA 3RU4T 1VZQH 3VFEA 3BN9A 1MZAA 2FM2A 1C5LH 3STIA 2EEKA 3ZV8A 3QDZB 4BAOB 2AEIH 3LPRA 1WTGH 1P05A 5C17A 4AN7A 4UFFH 1ZJDA 3ZZ5A 3VGCC 4AFUA 4SGAE 4I8KA 1C2DA 2ZU3A 3UFAA 1COWD 3SNEA 3U8RH 3KN2A 1DE7H 5JBAS 2Y5GA 3RXLA 4ZMAH 3M61U 1VGCB 1O3CA 5F8TA 3F2GA 4WVPE 2G52A 1ARBA 1UMAH 1JRSA 3UNSA 3E1XB 2H5CA 2VNTA 4Y8YA 4CRDA 2K1QA 3H5CB 3BTHE 3NPSA 3SUEA 5PTPA 2QF0A 3M3TA 1EZXC 2BY5X 2A4RA 2QXIA 3A81A 1DWCH 3SU5A 1CGJE 3EA8A 1FJSA 3QGNB 4WH6A 3URCA 1AFQC 2F9VA 6ESTA 1XUJA 4GPGA 4HGCA 2XCNA 2ZDNA 3D23A 2KX4A 3NRLA 3WW7A 4FOUC 2P3UB 3SHAH 1A4WH 1CA0C 3T27A 2Z3DA 1DWBH 1XM1A 2AH4X 4UDWH 4HG6A 1NFWA 1T4UH 1THSH 2VB0A 2ZU2A 4MVNA 1TALA 1P9SA 3RU4D 1O2RA 5HGGA 3SYJA 4Y79A 3SV7A 1MKWK 3SHCH 2BLOA 3PMHB 2XOKD 2KAIA 4OM9A 1WQVH 2BLVA 2BD9A 1BTHH 3DA9B 4RSPA 1ZTKA 3TITA 5KECA 4AFQA 1GHVH 1S0RA 3BTQE 1F2SE 3KQBA 4WY3A 4CH2B 2WINI 1XMNB 1TONA 3P8NA 1VITF 1ZHPA 3TPIZ 1CHOF 4H4FA 1GI5A 1MKWH 1MQ5A 3SU0A 5EXLA 4F48B 4CRFA 2W26A 4K60A 1ZPCA 1V2MT 7GCHG 1IHSH 2KCOA 5CHAB 4Y6DA 3RXAA 3HKJB 3M5MA 2RDEA 1V2ST 2VIVA 4NFFA 1W0JD 1ZGVA 3HKIB 4HI3A 2JH0D 4UONA 1E36B 4DJZB 1NRSH 1KXAA 1UVUH 1W8BH 2BD4A 1MTWA 1KDQB 2HALA 1EB1H 1OWDA 5EJ1A 1UHBB 2SGFE 1C4V2 4JCNA 4ZKOU 1KMHB 4NCYA 3OEED 2VU8E 4F55A 2AMQA 2J95A 2VIOA 3EDXB 2BY9X 3OEHD 3V0XA 1A0LA 3DFJA 2FOFA 1DICA 3DUXH 1GG6B 1C1UH 1AY6H 1TRNA 1DOJA 1P2KA 4BAHB 4X1QU 5HIZA 1Y3WA 1CHGA 2P94A 2BY7X 3GCHB 4M7GA 3MWIU 1OWEA 1EPTA 2XYAA 4INLA 1ZTLA 1SG8B 2PW8H 3FZZA 1ZSJA 1TYNA 1MMJN 1FY8E 1MBQA 5T6FA 2WZQA 3I78A 3OY5U 5C2ZA 3PV2A 3UQOA 3ATKA 1QIXB 3PWCA 2QF3A 1IQGA 2W7UA 3DSGA 3NWUA 1N8OC 1O5AB 4X2WA 3TH2H 1HGTH 1N6YA 2EC9H 4XBDA 1C5VA 2P16A 1GMDF 4BTTB 4ABFA 3ODDA 4NZLA 5CMXH 1C9PA 3LU9B 1RIWB 4I8JA 3BTDE 1INCA 3P17H 5EQRA 2FI4E 1H8IH 4X2XA 2AS9A 2F4LA 2H6MA 1D3QB 1OWJA 2H5DA 3Q77A 3UNRA 4ZKNU 1ELEE 1GDQA 3RDZA 3SGQE 2BOHB 1C1NA 4GVUA 1GHXH 1ETTH 4ZKSU 3SV9A 5AFZH 4F4OC 3K65B 2OC7A 1AVXA 1EJAA 4Y0ZE 1GCTC 2AERH 4X8SH 1GVLA 2CN0H 1PFXC 3KEEA 5HM2A 1O2LA 2QYIA 4ASUD 1FONA 1G37A 2Z94A 3KNXA 3L3TA 1Z71A 1G9IE 2BXUH 5A2MH 3LC5A 1E34B 1O2PA 2HRVA 1GL1A 1JWTA 4TWWA 1LHEH 2D8WA 1BITA 1CSOE 1KIGH 2QGRA 3SOSA 3U8TH 1W3CA 3VXFH 4FUGA 1P2IA 3RXRA 2FI5E 2RA0A 3URDA 3W95A 1UTPA 5ABWA 2A0QB 2FX6A 1NESE 4DW2U 1QBNA 1P06A 1EUFA 1PPEE 1F0RA 4GUXA 5DP4A 1S6LA 1C5SA 2A4OA 2AYWA 5A0BA 4X6MA 4M9FA 1ETSH 1BMLA 1ANDA 2J92A 3VB6A 3SUFA 2TBSA 1GBBA 4AG2A 2XW9A 1AO5A 1MQ6A 1C5TA 2BVXH 6GCHF 3BEFB 1DXWA 3GYMA 1YPJH 2Z9GA 2FPZA 2WPKS 3WY8A 4NWLA 3H09A 1QJ1B 5ESTE 1HAOH 1TABE 4LXBH 3UUZA 3GCOA 1AZ8A 1VR1H 1DM4B 1NROH 2ZZUH 3AW1A 1QQ4A 5FBEA 4ISIH 4Q7XA 1HJ9A 2Z9LA 1G2LA 3TH4H 4MPUA 2M2AA 4NIXA 1ETRH 1TQ7B 4Q2KA 4X6OA 1W7XH 4Q80A 5FAHA 2Z3EA 4O3TA 2STBE 1OWHA 1Z7KA 5DPAA 5T6GA 1ZHMA 2WSSD 3SV8A 1C2MA 1ZPZA 1KDQA 1AZZA 1MCVA 3P8FA 3T28A 3Q3YA 2F9NA 2XBVA 3BTEE 1UHBA 4P00A 3PMBB 2FOCA 1EKBB 1ID5H 2VWLA 5DP5A 4ABAA 2BMGB 1XUFA 5DP8A 2P8OC 1O33A 1C5QA 5A09A 1D3DB 4IN2A 3A84A 1GDUA 3OE7D 5G4BA 1O3JA 1T4VH 1XXDA 5ETXA 1E38B 2G51A 2PTNA 2C90B 3RXDA 1O2TA 5FPSA 2ZWLH 2BY8X 2PGBB 1W0ZU 1TNIA 5LPFA 2AHME 1BDAA 5C20A 4Q7YA 1SPJA 2LP6A 3K9XB 4AG1A 3A88A 4FVBA 2XCFA 1TX7A 1O0DH 1LHGH 5JYIA 2A5AA 1HBTH 1O2IA 1SQTA 3K6ZA 3M3SA 2GP9B 1KTSB 3O8DA 3E0PB 1Q2WA 1O3OA 1RS0A 4X2VA 5GNDA 1TRMA 2FLBH 2Q6GA 4GCHG 5I25A 1O2GH 5AVDA 2Z6BD 4WF8A 1GJAB 1V3XA 1MTVA 1QJ7B 3PLKA 1RFNA 3S7HB 1P03A 3RM0H 3E3TA 4Y7BA 1L1GA 2ZP0H 1L4ZA 2Z9KA 2RFKC 3KQDA 2BD2A 2FX4A 2ZI2H 1K1NA 5JBCS 3U69H 4D7GA 1Z8RA 1V2QT 1CO7E 2NU4E 2QXHA 3P70B 4BXWA 1JOUB 3DT0H 3BTGE 3R0FA 4TY7A 3PRDA 1MD8A 1P12E 4XFQA 3A82A 4YO9A 1SGFA 1FPHH 1DSTA 1SGFG 1D9IA 4MPVA 4OS2A 2AMDA 1CQQA 3SNDA 4MG3A 1MKXH 1GI7B 4A6LA 1KLTA 1YCPK 3MH5A 3WWFA 1NM6A 3RC4A 3LOXA 3O8CA 3FZDA 5GCHG 3SJ9A 3M7QA 4MNWA 4WXVA 1E79D 1BHXF 1PQ7A 4IC6A 3QGJA 3RMLH 2GCTB 3OSYA 3H7OA 1A1RA 3L6PA 1KLIH 1SQRA 4U30A 1VKYA 4CR9A 3GISB 2KCPA 2Y7XA 1OSSA 1YCPH 3SQHE 3ITIA 1TB6H 4J1YA 1PYTC 3M37A 4JZFH 1X7AC 3ZZ9A 1SB1H 3ODFA 2OQUA 5A0AE 2VIWA 1YC0A 1O5FH 1ZTJA 1QB6A 4UFGH 1FI8A 3RP2A 1BMNH 3MTYA 3M35A 1A3BH 2W6ID 1FX0B 1S81A 4WH8A 1TMUH 5GPIB 1ZZZA 1O32A 5T1VA 4ZCNA 1T32A 2QXGA 1XVMA 5DKMA 2OP9A 3SV2H 4GSOA 3LH1A 1GBJA 3RXKA 5HKKD 1GHBF 2WYJA 1LDTT 1OS8A 1TNHA 2BVRH 1Y8TA 4IMQA 1M9UA 3KCGH 2RA3A 1IHTH 1FXYA 3OFND 4GAWA 1DDJA 3TJNA 3BTTE 1GI6A 1K1IA 3LGWA 1THRH 3BG8A 4VGCB 2H9HA 5EQSA 3GDVA 3BTFE 1TPSA 3MOCA 1QGFA 2YMSB 1DVAH 3EAJA 5HM9A 1O2KA 1P3CA 3Q3XA 2F3CE 4AYYB 1UO6A 4YT7H 2QA9E 5C1UA 3RXMA 6CHAC 4B1TA 1LQDB 1T8OA 3RM2H 3UWJH 1GJ6A 4ZXYH 1HJAB 1BBRK 4RKOB 4YLUA 2PSYA 3UREA 1FY4A 2BDYA 3GY7A 2BX4A 2ZO3H 1D4PB 4ISNA 2ASUB 4Y7AA 3GDSA 2XWAA 1PYTD 1UTNA 4B2CA 2A7HA 1YPLH 1NRQH 2VH6A 1VITG 4DY7B 4FU8A 1EPTC 1CHOG 4YZUA 2PFEA 2PUXB 1BBRH 1O2SA 3AAUA 5C67A 3TK9A 2G8TA 4QT8C 1OHHD 4X8TH 4KKDA 5C0UA 4HZHA 1OYQA 1LPZB 4K8BA 2A45B 1YYY1 1F0TA 1OYTH 1UTLM 1MUEB 1YLCA 1WBGB 1AMHA 2A1DB 2G5NA 2OQ5A 4FUJA 4YTAA 1ZMNA 3NUMA 1Z8JB 1WSSH 4YLQH 3PYHA 2IJD1 1GL0E 2RG3A 1GHWH 3W94A 1FV9A 3QLPH 1FIZA 3A7VA 1UCYE 1GBDA 5FCKA 2BZAA 3SU6A 3ZYEA 4JZIA 1V2UT 2FDAA 4ABHA 3LGYA 3ZZ6A 3D62A 3RMOH 3RU4E 1O2ZA 1GJCB 1OX1A 3U98H 1GJ5H 1WYKA 3SU3A 5T6DA 4U32A 1QY6A 1Y3YA 1YPEH 2W3KA 2ZFQH 4FETA 2J94A 3A8CA 2FODA 3U9AH 1GBAA 5L2ZH 1XKAC 1QRWA 4D9RA 3F9EA 1GBIA 3A7TA 3CP7A 1OWKA 4B6EA 3OY6U 1ELVA 3BSQA 2F9BH 3TK5A 1BOQA 1HPGA 1VGCC 3RXVA 3OU0A 5DJ7A 1ZMJA 1BTUA 2A5IA 1TGCA 5A8YA 1O3BA 1QFKH 3SN8A 2QE7D 8KME2 3LDXH 1BT7A 1P57B 2ESTE 3GY4A 1BTXA 2FOMB 2GZ7A 5A8ZA 1GMDG 4GLYA 1HCGA 1TIOA 2ZDLA 2V35A 5BRRE 3F1SB 5DP3A 2A2QH 3RXOA 3LC3A 1SGDE 2O8MA 2UWLA 3LGUA 4H6TA 1AQ7A 5EPYA 1NZQH 1QA7A 4WMDA 5IK2D 2FOGA 1CVWH 1RXPA 1NT1A 1A0JA 1FPCH 1P2QA 4CH8B 4DT7B 2BQWB 7KMEH 2AFQB 2BDBA 2ZGXH 2ZFSA 4FUIA 3MNXA 1RTKA 2VJ1A 5C1YA 1EB2A 2ZF0H 1BHXB 3MO3A 4GHQA 3OX7U 4B76A 3EE7A 4K8YA 4ASHA 1B5GH 1BMFD 3UQVA 2OD3B 1D3TB 1O2VA 1NBMD 1SLXB 3TGIE 4NA7A 5CHAC 1C5YB 3NXPA 2XC0A 1C5WB 1EAIA 1P11E 1LKBA 1RRKA 3TH3H 2UWOA 3MH4A 2JETB 3LKWA 2GVFA 2L6OA 3PO1B 1W11U 5E0JA 1P10A 1S6FA 3P92A 4HFPB 2BX3A 1GI8B 1QL7A 2OK5A 1WOFA 2HNTF 1NFUA 3TJUA 1K2I1 1T7CA 1N1LA 1H9LB 3KHVA 5LGOA 4XOJA 2A7CA 5GJ4B 1WXRA 1PPFE 1WCZA 2FI3E 3P8GA 1GJ8B 4JYTA 1RTFB 3AW0A 1FQ3A 1L1NA 2R0KA 5HXFA 1SLVB 1YY3A 2HLDD 1NU9A 3GY2A 2JJ1D 3EYDA 4I32A 3UAIC 1WV7H 2BVSH 4WJG2 2PGQB 4TT3D 1A5HA 2PKSB 1H4WA 6GCHG 2GZ8A 2FP7B 4AB8A 4RT0A 1JIMA 1GG6C 2XXLA 2Y80A 2ZECA 1GDNA 1Y5BT 5EU8A 1YCPM 4NWKA 3GCHC 2WV5A 5K0HA 1C5ZB 3RC5A 2H2ZA 2XBXA 2XTTB 1BRCE 1PPCE 3GOVB 5EQQA 2B7DH 1AN1E 2ZGCA 1NTPA 1ZHRA 1WU1A 3GCTF 4A92A 1DWDH 4UD9H 1A5GH 3UOPA 1WQSA 4CBNA 1GBLA 4B75A 1XUGA 2ZNKH 4YOJA 4R8TB 4IS5A 3SJKA 5EXNA 2H9TH 2EI6A 4ZHAA 3RMNH 1TX8A 4CREA 3U28C 1C2LA 3OTPA 3SZEA 1IQLA 5SGAE 2AGEX 2ZFRH 9LPRA 1RIWC 2ILNA 2TIOA 3T26A 4D76A 3NZIA 5HYOA 4XBBA 1O2OA 2ZDKA 3BEUA 1UW7A 1O38A 1SFQB 2TGTA 1S83A 1EOLA 3MU0A 3ZZ3A 1FNIA 3SGBE 5B6OA 1GWAA 2BQ6B 4A7IB 3M7UA 1C4Y2 1HUTH 1C5NH 2SFAA 3T62A 1CBWB 2BHGA 5DG6A 5BPEA 1SMFE 2PSXA 5E2PA 4CRCA 2HVXA 2QF4A 5DP9A 2UUFB 4AYVB 1ZSKA 3TNTA 1LPKB 4IBLH 4ACAA 1HYLA 4MNYA 5EJZA 2W5EA 1SLWB 2DE8A 2G4TA 4B2BA 3VB7A 5A8XA 2GTBA 3RXUA 2VVVA 2P95A 1CA8B 2ZQ1A 1MAYA 1C2HA 2ANYA 4RI0A 3S69A 2PWXA 4ZHMU 1EP5A 1YM0A 4DG4A 4X1RU 4CR5A 2FOHA 2STAE 3BIUH 2V7QD 1O34A 1SHYA 4DURA 3T29A 1AE8H 5DP7A 3C1KA 3G01A 2SGQE 1DUEA 1CT2E 1BUIA 3AAVA 5C0TA 1K1OA 3RXHA 2ULLA 3BF6H 3KQ5A 2VIDA 1C2IA 4O3UA 3S9CA 2PKAA 1ACBE 1CGHA 7LPRA 4Y11E 1QJ6B 4ACBA 1DS2E 2FWWA 4XDEA 1W0KD 1O2WA 3PROA 1K0HA 2WPMS 2B8OH 4YOIA 3D65E 1V6DA 3MO9A 4AORA 4CRBA 3MQKC 4B6FA 2F9OA 4ABJA 3HGNA 3Q3KA 1GMHF 3A8DA 1UTMA 2GDEH 3T2NA 2FOBA 2QIQA 3A8AA 2ZQ2A 2LPRA 2JH6D 2W3IA 2XRCA 1LKAA 3ESTA 4I8GA 3KYGA 4FUDA 3TVJB 3F3BA 2P3TB 2A7JA 2RDLA 1LO6A 1TNLA 1C1PA 1EP6A 1W14U 1D3PB 2P59A 3KL6A 1EAUA 1BTWA 1VCPA 3EGKH 3ZYDA 5TCCA 2ZU5A 1BRUP 4KTSA 4INKA 2F9PA 3LGTA 1OKXA 3MNCA 1XX9A 1BTYA 3OAAD 2FS9A 1UTKA 4TWYA 3BIVH 2ODPA 2F43B 4K1SA 1YPHE 2BDAA 2KZ4A 4H42U 4JMYA 2FTMA 2IOTA 2ODYB 1UVTH 5LH8A 1GHBG 4XE4A 2GD4B 1GPZA 3NK8A 1HIAB 1CT4E 2VINA 2R2MB 5CDFE 1SSXA 1TLDA 5EODA 2BDGA 5LPRA 2F9UA 5KEDA 5EPNA 4WMEA 3F0PA 1F7ZA 2B0FA 3PB1E 3T5FH 2XC4A 3LGVA 8LPRA 1E37B 1UK4A 2Y5HA 3K6YA 4MPWA 5EW1H 3HK6B 1OP2A 1KXEA 3NCLA 3RXTA 4K1TA 1FY5A 5DK1A 1HFDA 1UJ1A 3BV9B 3ZZCA 3IITA 2K8IA 2J9NA 2WHXA 1GCDA 1EX3A 1GI2A 4MTBA 4E7RG 2J34A 2V3MA 1O3AA 3MU8A 3F6UH 1FUJA 1T8MA 1S6HA 4NZQA 3HATH 1Y3VA 3EA9A 2O8WA 4ZKRU 1PQAA 4JYVH 3Q76A 1XUKA 1QB1A 3A87A 2ZU1A 1LVOA 4FUFA 3FAOA 3V13A 1T8LA 3U1JB 2IN2A 3UR9A 1AKSB 3M5LA 4OS6A 3ENSB 1HAXB 3N7DA 1Y5AT 2M5TA 1C1WH 1GHAF 1FN6A 2OC8A 4OS5A 1SLUB 3S0NA 4FUHA 3A7XA 1P2MA 2TGDA 1LVBA 2G00A 3QO6A 4JZ1A 3VXEH 2TRMA 2SNVA 3N7EA 1KTTB 1G2MA 1ZSLA 1YPHC 3KQEA 2SNWA 1DANH 4AX9H 2CF8H 1XXFA 1DT2A 1OPHB 1OOKB 2I6SA 5HIYA 4X1SU 2VIPA 1LHCH 2SGAA 1UK2A 1IQMA 4Y8XA 2BQ7B 2GCTC 2ZCHP 1O5EH 1ZYOA 1TBZH 1K21H
chains in the Genus database with same CATH topology
2FESH 4AB9A 1DY8A 2HGTH 4OGYA 2BD5A 1V2NT 1TNKA 3RLWH 7ESTE 2PTCE 3LH3A 3VB4A 4FUCA 1F5RA 1O2QA 2BLWA 1A7SA 1YKTA 1ZLRA 4AFZA 2BZ6H 1O2XA 3SGAE 5AFYH 2NU0E 1LVMA 2V3OH 2C3SA 1ZMLA 1SBWA 2C8ZB 1A3EH 4NGAH 4X0WU 1KLJH 2FTLE 2ZTXA 1S84A 1O2NA 1HAVB 3V3MA 2AIQA 1AIXH 1F5KU 2DE9A 1O31A 3DD2H 3PM3A 1CU1A 1FAKH 1TGSZ 1E0FD 1TGNA 1LTOA 2ZIQH 5I46H 4FU9A 5FHTA 5E0GA 3AVZA 2ZHEH 1TGTA 1YGCH 1GI9B 3I77A 1TOCB 3TJVA 3TLOA 1J9CH 1BB0B 1HDTH 1AUTC 4VGCC 1BTZA 1JRTA 2AGGX 1DFPA 1UTJA 3FVFB 1SVPA 1JXPA 1NRPH 3MU5A 1Q31A 2A4QA 4HTCH 2O8LA 1ZJKA 1MTUA 2BOKA 1PPHE 4U2WA 2NU2E 4FUEA 1F5LA 4BTIB 1QBVH 2Q1JA 1GMCF 2D26C 1HJAC 2R0LA 4YESB 1C1MA 2D1JA 2UWPA 5FBIA 1L1JA 2SGDE 2ZDAH 4CHAB 2ZKSA 3S7KB 2CF9H 2YNBA 3A85A 4Q7ZA 1BCUH 2ZHFH 1C5MD 3MH7A 4Z0KA 3ZZAA 4A1TA 1OP8A 5AHGH 4IC5A 4NIVA 1CT0E 4Y76A 3B23B 2HLCA 1AFEH 3CS0A 1J8AA 1TMTH 1Z6EA 1UTQA 3QK1A 4X8UH 1A2CH 2AGIX 3RXPA 2O8TA 4ABEA 1BA8B 5FPYA 3F68H 1VCQA 1DSUA 1HAGE 3A86A 1HIAA 2C8XB 1IQIA 1YPKH 4YT6H 3MH6A 3PV4A 1KXCA 4Y8ZA 1O2HA 4MNXA 1EASA 4X1PU 3SI3H 1TNJA 1S85A 2ZTYA 2YNAA 1ANEA 1FMGA 1JMOH 3FFGA 4Z6AH 2WPIS 2SGEE 2UUKB 2DUCA 1FLEE 2GCHF 2OBOA 1SI5H 1BTPA 1NS3A 1K28D 3BG4C 1BMMH 1G3EA 2BY6X 2GV7A 4UFEH 3ZZDA 4A1VA 3SJ8A 2J38A 3QZQA 3TK6A 1KSNA 1O5CB 4PROA 2Y7ZA 4KP0A 1W12U 2P3FH 1UVSH 1HXFH 1V2WT 3GICB 4E06H 4THNH 2TGPZ 1TFXA 2C8WB 3SBKA 2OINA 3SZNA 2A5KA 1G36A 3M7TA 2JH5D 1SOZA 2XC5A 1TGBA 1AKSA 2BTCE 4AZ2B 3QUMP 3MI4A 2Y82A 1P9UA 2NU3E 4BNRA 3RUOA 2W7SA 1C1RA 4E7NA 1FY3A 1H8DH 2CJIA 5E0HA 1Z6JH 2A32A 3KIDU 4MNVA 4YM9A 2VGCB 1A5IA 1K1LA 3MHWU 5EG4A 4UEHH 5F8ZA 2EI8A 1ZOMA 1AB9B 1HXEH 2ALPA 4UE7H 4K69A 2FIRH 1QHRB 1LHFH 4D7FA 2ZGHA 4BAKB 1QNJA 1IQEA 1Z8IB 2FMJA 3BG4B 3E90B 1O3LA 1YLDA 3SU2A 1BBRE 1BRBE 2D2DA 1TMBH 1V2PT 3L33A 4X2YA 1MU8B 3SNCA 4SGBE 1O39A 4ZXXH 3P6ZB 1B7XB 2OC0A 1GJDB 8ESTE 2GV6A 1SGNE 3LJJA 3PLPA 2P93A 3ZV9A 3B8JA 2Z3CA 1GBFA 1HAVA 3A7ZA 1FDPA 1TAWA 1QBOA 1ZR0A 3E8LA 2JETC 5E8EH 1W13U 2XBWA 4Y71A 8GCHF 2QCYA 1P2JA 3PO1C 4ZHLU 3BTME 5AF9H 1GI0A 2HOBA 1EAXA 4JZDH 2O8UA 1WAYB 3UNQA 1G32B 1O2YA 2V0BA 1KXBA 2PKAB 3VEQB 1G3DA 2BXTH 1AHTH 1O3IA 4X1NU 3RXFA 1Z1IA 1O5GH 3VB5A 1TPAE 2PKSC 1A0HB 2VWMA 1MTNB 5GCHF 2QV1A 1O30A 2ANKH 1FAXA 1GBMA 2G81E 2ZTZA 4ESTE 1EQ9A 1GMHG 1PPBH 4B71A 3F9HA 4XSKU 1P2NA 4MLFB 4FU7A 1HJ8A 2GMTB 2VWOA 4KELA 1SQAA 5A0CA 2CHAB 3V12A 5TCAA 1O35A 1V2JT 1K9OE 1C5OH 1V2TT 1HNEE 1CGIE 2Q6DA 1CE5A 1SHHB 1GVZA 2WPHS 1O3GA 2IPHA 1ANCA 4IN1A 4K1EA 3TNSA 1Y5UT 1ABJH 4ABDA 1ZRKA 1D6RA 1GBKA 2AIPA 1ELBA 1RJXB 4ISOA 1P01A 5C5OA 2OBQA 3D49H 3PWBA 5FX5A 1WTHD 2ZHQH 3P95A 3E6PH 1UTOA 3MMGA 3TJOA 3MFJA 3ZZBA 1QTFA 4AFSA 5IDKA 1C1TA 2PUQH 1GJ4H 3GDUA 3O8BA 1F0UA 2GT7A 1SC8U 1GGDB 1TBRH 2ZGBH 4MPXA 1RTLA 5F6MA 1MBMA 2ZCKP 3QZRA 1SGYE 4LZ4B 3PLBA 5EXMA 2ZPSA 2Y81A 3FP8E 4IGDA 1MU6B 1QRZA 4DOQA 1THPB 1LQEA 1CBWC 1C5UA 4ISHH 4DCDA 1HB0B 1T31A 1IQFA 2R2WU 1C2GA 3ZZ8A 3LGIA 3OYPA 2BLQA 3UWIA 2OC1A 3VGCB 1O37A 1O5DH 4FXGH 1SGTA 2H9EH 3E0NB 1O36A 2ZDVH 4NSVA 1BRAA 3SV6A 2Q6FA 2WPLS 3EE0B 3Q00A 1O3EA 2FZZA 4D9QA 4OS1A 2O9QA 1OXGA 3BEIB 1AE5A 4ZH8A 1YPMH 2WYGA 1GJ7B 1ANBA 1F0SA 3RXGA 1SGRE 1K1JA 4TPYA 4CRAA 1D6WA 3R3GB 1GI4A 1MCTA 4OGXA 1AFQB 1KXDA 1GBHA 3CENA 2GT8A 1A61H 2BD3A 5C1XA 2QAAA 2ANWA 3A83A 1CA0B 2BM2A 1GHAG 5GWZA 2HNTE 1Q3XA 2B9LA 5DO4H 1GJBB 6LPRA 1VITH 1YP9A 2ZCLP 1C1SA 1NU7B 1GI1A 2ZU4A 3ZVAA 1QB9A 2FOEA 2FXRA 3EA7A 3O8RA 1ABIH 4OS4A 5F8XA 1ELTA 1J17T 1SL3A 1E35B 2OTVA 3F9FA 4GHTA 1ZGIA 2ZEBA 2HPQH 3ZVGA 3HK3B 4KTCA 1P8VC 3QX5H 1ELCA 4DGJA 1IQJA 3SJOA 1AWFH 5J4QA 4JYUH 4BTUB 1IQKA 3ZVDA 4LOYH 1DPOA 2XWBI 3SORA 1EATA 5EOKA 4AOQA 1DUAA 5F03A 1HRTH 1O3FA 2FOAA 3JZ2B 1AGJA 1PPZA 1UVPA 5GIBA 2BDIA 2R3YA 3ATLA 1FZZA 3LT3A 2F83A 1XUHA 5EGMA 1PQ8A 2Y5FA 1PPGE 4NA8A 1MD7A 1AVWA 3RXEA 2CXVA 1ELDE 4Y0YE 1IQNA 3M3VA 4TY6A 1H9IE 1PQ5A 3PMJA 4ZAEA 1NY22 2WV4A 1NN6A 3RXIA 1DLEA 2EA3A 3RLYH 1TPOA 3F9GA 3PTBA 2VWNA 4JZEH 1DITH 5JBTA 5JDUB 2Z9IA 3ATWA 2ZFFH 1W0YH 2HNTC 1P3EA 4IW4E 1LCYA 4MQAA 2ZG0H 1O3PB 1GBEA 1P09A 3E16B 3JZ1B 3ZVFA 5J4SA 1HAHH 1LHDH 2VIQA 1B0EA 1GMCG 1EZSC 2GDDA 4NSYA 1EJNA 3KF2A 2EI7A 3ATIA 1TPPA 1N8OB 3MYWA 4INHA 2LNCA 4YOGA 1SR5C 5GXPA 2BDHA 3CS7A 2OXSA 5HMAA 1FIWA 2WUCA 1QRXA 4TYDA 3UY9A 2UUJB 4ZROA 2F91A 1C1QA 1SGEE 1V2LT 3P8OA 1XKBC 1ZRBA 2ALVA 3ZVEA 1B0FA 1HV7A 2V3HH 3I29A 2WPJS 2GZ9A 3RXJA 4K3JA 1JIRA 1NO9H 1C5RA 3B9FH 5FXLA 1GCTB 1TA2A 3E91A 5E2OA 4A1XA 3IG6B 1DY9A 1OP0A 1RGQA 3HGPA 1BIOA 2RCEA 4B2AA 1ESTA 1C2FA 4I33A 2OCVB 2GCHG 3GY6A 3SNBA 1O2JA 5JB9S 5L6NH 4CRGA 2I6QA 3BTKE 3H7TA 2HWLB 4ABGA 4AGKA 1XVOA 3QWCH 1JBUH 7GCHF 1GI3A 1C2JA 1V2OT 2A31A 3PMAB 1V2RT 4I8HA 3M36A 1G3BA 1HAYB 3UOUA 5K7RA 2PHBA 3A80A 3IWMA 4LK4A 3SUGA 3TU7H 4O9VA 2C93B 1QR3E 1O3NA 3ZZ4A 1SGPE 1IQHA 1S5SA 2JKHA 1VJAU 2ZFPH 4O97A 5CE1A 2PLXA 1EXFA 3UR6A 3LJOA 2ZGJA 4X6NA 4XBCA 1VJ9U 3RXBA 4DVAU 1SGQE 3EQ0H 2SGPE 3PTNA 1EZUC 3UPEA 1AI8H 5L2YH 1DXPA 4AGJA 2G4UA 1IAUA 4FUBA 5H4IB 4D8NA 2J2UA 2OUAA 3TGJE 3GYLB 1FY1A 1BMAA 2VH0A 3SUDA 1LPGB 5T3HA 1VCWA 2FYRA 4B73A 3S9AA 1NC6A 2FO9A 2VVUA 1QL9A 1O3MA 1G3CA 2ZC9H 3V7TA 1T8NA 1EOJA 1BQYA 5EW2H 2A2XH 1ELGA 1ESAA 2NU1E 3K2UA 1NFYA 3KQCA 1MZDA 1L4DA 1GBTA 3UIRA 1QQUA 2YOLA 4WMFA 2C8YB 3KGPA 1P02A 1HAIH 4CHAC 2GX4A 1Y3XA 1YBWA 1QURH 2BDCA 1GJ9B 5C5NA 3A7WA 1NRNH 2QY0B 2PV9B 5IYTA 3MNBA 2J4IA 5FCRA 1ZPBA 4RN6A 1HAPH 4O03A 1C1VH 1LVYA 2THFB 1ESBA 2PR3A 1TRYA 4I7YH 1C1OA 1TNGA 2P8OB 1C2EA 1O3HA 1TA6A 1MKXK 8GCHG 2BB4A 3OTJE 4NFEA 1TX6A 1J14A 4LZ1H 2WUBA 1GVKB 1WUNH 1YF4A 4UFDH 4KGAA 3RXSA 1DX5M 9ESTA 4I8LA 2G5VA 3SQEE 3FANA 4U01A 2AMPA 2FYQA 2R9PA 2GKVE 1S0QA 2R3UA 1P0SH 2XBYA 2HPPH 4F49A 1W7GH 4FVDA 1J16A 3QN7A 5L30H 1C5PA 3T25A 1PJPA 3VB3A 2UUYA 1SOTA 1W10U 3SO3A 1XUIA 2NWNA 1K1PA 1TE0A 1N6XA 1U6QA 1P2OA 1KYNA 1Y59T 3N7OA 2QN5T 5DGJA 4WXIA 2Z7FE 2ANMH 5FX6A 1AD8H 3SW2B 3RXQA 4BOHA 1AU8A 1K22H 1SFIA 4IMZA 5DP6A 5FPTA 2BD7A 1ELAA 4MDSA 1MH0A 4BAQB 1Z8GA 1NRRH 1S82A 1AVGH 3GY8A 2ZFTA 5JBBS 3UTUH 2CGAA 2VGCC 1TQ0B 2TGAA 3GY3A 1ARCA 1HLTH 4H6SB 2GGVB 1FN8A 1AB9C 1O5BB 3ZZ7A 2ZA5A 3DFLA 3GCNA 1QCPA 4TPIZ 4ISLA 4BXSA 2A4GA 3U8OH 1NFXA 3ATMA 1RD3B 2TPIZ 4DIIH 3SJIA 1SGCA 1O2MA 1C4U2 1UCYK 3A89A 4BAMB 1V2KT 1G30B 3M5OA 5TJXA 3C27B 2ZPRA 1GHZA 1Z1JA 4NA9H 5C3NA 3TIUA 1C5XB 4ABIA 2VVCA 4DIHH 3QTOH 1O3DA 3ELAH 1C2KA 2KAIB 1OWIA 2QXJA 3FP6E 1EZQA 1UVOA 1L0ZA 4NIYA 1UCYH 3GCTG 1DWEH 1UK3A 1Y3UA 1MAXA 1H9HE 1QA0A 2V6NA 1O3KA 2BYAX 1KY9A 3RXCA 1YPGH 2ODQA 5GDSH 5JB8S 2BD8A 2ZHDA 3U1IB 4NG9H 2ZHWH 3LIWA 1BZXE 2IJOB 5ESBA 3MU4A 1A46H 1KXFA 2C4FH 1BJVA 4WWYA 4NIWA 3ZVCA 1TWXB 4E05H 4K5ZA 3MO6A 1AUJA 4X8VH 3SU1A 3M5NA 3HPTB 3VPKA 1TOMH 2QC2A 3MNSA 1F92A 1EAWA 2OLGA 3SI4H 2Z9JA 2B5TB 1AWHB 2CMYA 1MTNC 1SQOA 3GY5A 3LONA 4KTUA 4ZUHA 6CHAB 1ELFA 1BJUA 3TGKE 3MU1A 3BTWE 5JPMH 4JK6A 3NKKA 1O2UA 1NPMA 2H1UA 1P04A 2ZPQA 4GCHF 1GHYH 4B74A 2GMTC 4RKJB 3S9BA 1DLKB 3RC6A 1ORFA 1W2KH 2CHAC 5LPEA 4K2YA 2ZDMA 3FP7E 2G55A 3AASA 2FEQH 1QL8A 1IOEA 1EPTB 3A8BA 1TBQH 1C9TA 1H1BA 3RMMH 1GBCA 1L2EA 3QTVH 2Y6TA 1K1MA 2XNIA 1J15A 2CV3A 4Y10E 4J2YB 3SU4A 1LMWB 4CBOA 4OS7A 2FS8A 1V2VT 3A7YA 4I31A 4BANB 1MTSA 3STJA 3DHKH 3ZVBA 4ABBA 1HAZB 1GGDC 2FLRH 3SNAA 1SGIB 4A5TS 1EJMA 4JK5A 4X6PA 4R0IA 3RU4T 1VZQH 3VFEA 3BN9A 1MZAA 2FM2A 1C5LH 3STIA 2EEKA 3ZV8A 3QDZB 4BAOB 2AEIH 3LPRA 1WTGH 1P05A 4AN7A 4UFFH 1ZJDA 3ZZ5A 3VGCC 4AFUA 4SGAE 4I8KA 1C2DA 2ZU3A 3UFAA 3SNEA 3U8RH 3KN2A 1DE7H 5JBAS 2Y5GA 3RXLA 4ZMAH 3M61U 1VGCB 1O3CA 5F8TA 4WVPE 2G52A 1ARBA 1UMAH 1JRSA 3UNSA 3E1XB 2H5CA 2VNTA 4Y8YA 4CRDA 2K1QA 3H5CB 3BTHE 3NPSA 3SUEA 5PTPA 2QF0A 3M3TA 1EZXC 2BY5X 2A4RA 2QXIA 3A81A 1DWCH 3SU5A 1CGJE 3EA8A 1FJSA 3QGNB 4WH6A 3URCA 1AFQC 2F9VA 6ESTA 1XUJA 4GPGA 4HGCA 2XCNA 2ZDNA 3D23A 2P3UB 3SHAH 1A4WH 1CA0C 3T27A 2Z3DA 1DWBH 1XM1A 2AH4X 4UDWH 1NFWA 1T4UH 1THSH 2VB0A 2ZU2A 4MVNA 1TALA 1P9SA 3RU4D 1O2RA 5HGGA 4Y79A 3SV7A