1V2PT

Trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.a4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSYIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2pT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2pT02
2FS9A 4X2WA 5FBIA 1QL8A 1L4DA 1O2NA 3KHVA 2XC0A 3TK9A 3I29A 5ABWA 1GHBG 1O2ZA 3TJNA 4YT6H 2ZFRH 3BV9B 1EB2A 2B9LA 3TH3H 3A7YA 1ZGVA 2WYGA 3DD2H 5J4QA 2JH6D 2M5TA 4WJG2 3D49H 2PSYA 4AYYB 1YPEH 4GHTA 1BDAA 3F9HA 1FY4A 2BDIA 2A2XH 3ZVFA 1GBHA 3SGAE 1PPZA 1AFQB 8GCHF 1MZAA 9LPRA 3EDXB 2D2DA 5JDUB 3JZ1B 1P2KA 1PYTD 1ZPZA 1ZYOA 3BSQA 3URDA 5I46H 2JH0D 1FIWA 2QA9E 1IHTH 5C5OA 1GBLA 2GZ7A 2VIOA 1F92A 2Q6GA 3T28A 3SU5A 3DUXH 3VB6A 3TJUA 3FVFB 3VB5A 4JYUH 1DVAH 4GLYA 1C5QA 1QQUA 1TWXB 1KXDA 1GI7B 2V3OH 3EA7A 1W12U 5EG4A 1GGDB 2ZU2A 1BTWA 1MU8B 1YPLH 1XUGA 4BXSA 1TNIA 2GTBA 1ZTJA 1GDUA 1W3CA 2BXTH 2BQ6B 2BY8X 2FZZA 4INKA 3U8RH 2FOHA 4TPIZ 3V13A 3ZZDA 2ILNA 2FEQH 4I8KA 2BVXH 1DS2E 4ZXYH 4FUGA 1GBAA 5DP4A 1H8DH 2I6QA 3GY5A 1BMMH 1BMLA 4ZUHA 1VCPA 1ZHMA 3NZIA 3LGWA 1DICA 1EZXC 3A7WA 3QTOH 1HAXB 4TWWA 4AFUA 1O2PA 2B0FA 1GI0A 1LHFH 2ZHWH 4BANB 4O97A 4Y6DA 4CHAB 3QGJA 5K0HA 1O2OA 4GHQA 1RFNA 2A5IA 2ZDNA 1F0TA 1GI9B 4AB9A 4ABFA 1UHBA 2XWBI 1VITF 2BD7A 1N1LA 1GCDA 1F5LA 1CBWB 1V2ST 4LOYH 1AKSB 1LVBA 2BQ7B 3ITIA 1UTQA 7GCHG 1S0QA 5PTPA 3UY9A 1CSOE 4ISNA 1LHCH 4H4FA 4H42U 1Z7KA 3GY4A 2P3UB 3A86A 4HFPB 1SGPE 5DO4H 1T7CA 5ESTE 1P02A 1TX8A 4NIXA 2VIQA 1O2UA 4Y71A 3U9AH 4F4OC 3C1KA 1AB9B 5EW2H 3IITA 1RGQA 1H9LB 1AVGH 1O38A 1GBFA 2R9PA 4XOJA 1KDQB 3SUFA 1TYNA 3M35A 2TBSA 1ANCA 1BRUP 2Z9LA 1BRCE 3BTME 1KXBA 4LZ4B 3STIA 1UK4A 1K1LA 1WCZA 3PLBA 2WV4A 4IMZA 5T6DA 2HNTF 2UUYA 4BTTB 2XCNA 3GYLB 2P8OC 3TLOA 4UD9H 2OBOA 1KIGH 3A82A 1GMCF 1YPMH 1BTXA 1HDTH 1HYLA 4U30A 4Y7AA 1GHAF 4MNWA 5E0HA 3RXKA 1P04A 4WY3A 2Z6BD 2ZHEH 3RP2A 1WTHD 2QIQA 4D8NA 3LGTA 3GISB 3LKWA 4X2YA 1J9CH 3EAJA 4AOQA 3S7HB 3M5MA 2J9NA 2YOLA 1O2LA 1O2SA 4UDWH 2FOFA 6CHAB 2BOHB 3QWCH 1MAXA 2GZ8A 7GCHF 3KGPA 1ELAA 1CE5A 3KCGH 2OTVA 4INHA 2GT7A 3TU7H 5E2OA 3E16B 2CF9H 1S6HA 2Z3DA 1GJAB 2XRCA 1MMJN 1PPBH 1V2NT 1DM4B 4K8BA 1HJAC 1O3HA 1HAHH 2EI8A 1S83A 2PHBA 1O30A 2ZECA 1DLKB 2GMTB 1D3QB 2BD9A 1EJAA 1UTJA 5C1YA 2BB4A 1A3BH 1J8AA 4B71A 3E3TA 2PGQB 1O3EA 1AWFH 1S82A 2F91A 2G8TA 3B8JA 1D6WA 2EC9H 1O2JA 1DUEA 1UTLM 1LO6A 3BTEE 4J1YA 3SN8A 3KQCA 4BTIB 1BTPA 2W7SA 2A31A 4KTSA 2HRVA 1O2HA 4FUBA 4FUFA 1BJVA 1C9TA 1CA0B 5A8ZA 3ATWA 1ZHPA 3RM0H 3LGYA 3FAOA 4JYTA 1ANEA 2VIWA 1ACBE 3SO3A 1PPFE 5F03A 3A89A 4IGDA 3KIDU 2RA0A 4UFFH 2OC1A 1O37A 3RXVA 2ZGCA 1W2KH 1TX7A 1AI8H 1C2FA 5DK1A 4LZ1H 5A0AE 3O8RA 5EXMA 1NFWA 2VIPA 4ZKOU 1TMUH 3UWJH 1JBUH 3BEFB 1NROH 5EXLA 1KSNA 3UNSA 1TE0A 1P06A 1HAZB 1SLWB 3IG6B 1P11E 1GVKB 2F9NA 3RXBA 4XBBA 4Y8ZA 1LHGH 4I31A 4AN7A 2PLXA 1XXDA 1MBMA 3A8CA 2A7JA 3S7KB 1P8VC 1GDQA 3D23A 5GXPA 4ISHH 3UR6A 3T27A 2C4FH 1LKBA 2EEKA 3MHWU 2ZNKH 5A0BA 1OX1A 1AZZA 1K21H 1RTKA 1CGIE 4WMDA 5EQQA 3UUZA 4AG2A 1CGJE 2ESTE 2C8ZB 2HNTC 3C27B 1OWJA 2Y7XA 2OINA 1SHHB 1AU8A 2XC5A 1ZLRA 1CHOG 1QHRB 2A4QA 1PPGE 4XDEA 1SI5H 2G81E 3M3SA 1ZPCA 1A5IA 3NWUA 1VGCC 2PFEA 3AW1A 4BAQB 1OS8A 1AZ8A 3RXLA 2FOMB 4QT8C 2PWXA 3VGCB 1AFQC 3PMJA 3JZ2B 1K1OA 2VGCC 2GZ9A 3GDUA 1S6FA 4X6OA 1AVWA 1FN6A 2PW8H 5HM2A 1L0ZA 1MZDA 4GCHG 2AEIH 3RLYH 2BDBA 2BMGB 4I8JA 5IYTA 3SUGA 4BNRA 1V6DA 1HAVB 2D8WA 3SJ8A 2ODYB 3VB3A 1DUAA 1P01A 1BOQA 3SU2A 1T8OA 3E0PB 3MO6A 3TPIZ 3BTDE 5DP9A 1AY6H 2XBVA 5EXNA 1ZTLA 5LPRA 3K2UA 3E0NB 5GWZA 1ELTA 1JRSA 2YNAA 2TPIZ 1ELVA 1BBRK 1EZUC 3M37A 3E6PH 4HGCA 1D9IA 2W3IA 3SORA 1ZMLA 2PR3A 1XUFA 2AGIX 1OP8A 1D3DB 5CHAB 1C1OA 2ASUB 4ZHAA 3MU5A 5DGJA 2UWPA 1TBRH 4NSYA 4OGYA 1GJ8B 1A46H 1MUEB 1P2IA 1W7GH 1GVLA 5LGOA 5HMAA 3UOPA 1FI8A 1LPGB 1MKXH 2V3HH 2ZCLP 5FHTA 4ZHLU 3LPRA 1NN6A 5HXFA 2ZHFH 1V2OT 1QL7A 1A3EH 3PMBB 3H5CB 4ABHA 1TMBH 2VJ1A 2KAIB 1O2KA 2XXLA 1DSUA 5JBAS 4MNVA 2FLBH 2OD3B 1SFIA 3KN2A 1TAWA 1QR3E 1PPCE 3NPSA 1H4WA 2AH4X 3GCHC 3TGKE 4A1TA 1DWBH 3OU0A 1EOJA 1GHXH 2OBQA 3RDZA 3RXRA 4FUJA 2BDGA 2H9TH 3U98H 1C5YB 3PROA 6CHAC 3RXPA 2CN0H 1XVMA 1VR1H 4MPXA 1SQOA 2EI7A 4X6MA 1EPTB 1K1MA 2SGDE 4CRFA 3GY6A 1O5BB 4RN6A 4X6NA 3A8BA 3EYDA 4NG9H 3HKJB 1P3CA 1W11U 4AFSA 1AIXH 3VB4A 2BLWA 3TJOA 2VIDA 3RM2H 4B73A 2Z3CA 3QK1A 4AZ2B 1PFXC 4Q7XA 4XBCA 1FZZA 1WYKA 4WVPE 3RC6A 1V2TT 1VGCB 2RCEA 2ZEBA 1O2XA 1TB6H 1P10A 2HWLB 2UWLA 3NXPA 1O32A 3BEUA 4Y79A 1QQ4A 1RD3B 4R0IA 5BPEA 3SOSA 1W13U 2J92A 1O3KA 2PUQH 4MNYA 1GI1A 5JBTA 1T8MA 2FI3E 2D26C 3OTJE 3SNEA 1S84A 4I7YH 1XUJA 3KQDA 4I33A 1ZRKA 1Y3XA 1EASA 1K9OE 1TGNA 2AS9A 4A92A 4CH2B 2K1QA 2HNTE 3P70B 2PUXB 2ZFQH 4BAMB 5EOKA 2D1JA 1ZZZA 4X1NU 3P92A 2O8LA 5JYIA 4D7FA 2A4GA 3QZRA 1QIXB 1TBZH 1L1NA 1OYTH 1NS3A 2P94A 1TIOA 1SOTA 4Y76A 2W7UA 3ZZAA 1AE5A 2GCHF 1P09A 2C8XB 2WPJS 1MTWA 3F6UH 3RMNH 1OPHB 2HVXA 3RXAA 1FONA 5EQRA 4B75A 1THRH 1TNLA 1C1UH 2ALVA 2R0KA 2Y81A 2ZPSA 4MDSA 5FCRA 1Y5AT 4Y8XA 3MYWA 3A84A 3MU0A 6GCHF 5SGAE 3OX7U 1DY8A 2HOBA 3SV2H 2BTCE 1SGTA 3M7TA 1GBKA 1WQVH 1ZOMA 1SGRE 3UQVA 1TGBA 2HPQH 3A7ZA 1Q2WA 2HALA 4KELA 2R3YA 1V2KT 1TOCB 4KTUA 4X2VA 5A8XA 1AUJA 3RXSA 1N8OB 2ANWA 2RDLA 1BRAA 3K65B 1GGDC 1K2I1 4ZAEA 1ZRBA 5DP8A 2FOEA 4JK5A 1HAGE 1MD7A 2FO9A 2G4UA 3HATH 1EZQA 1MQ6A 3BTTE 3CENA 3SNAA 1RIWB 4NCYA 2FI4E 3UOUA 3ENSB 1EP6A 1YF4A 3UTUH 1F5RA 1INCA 1WTGH 1ZJKA 5TCCA 4NA9H 4FVDA 1C1SA 1SGNE 3KQBA 1VCQA 1N6XA 1YBWA 1SHYA 3ZVDA 2PKAA 4ZH8A 1C1NA 7LPRA 4XBDA 8ESTE 3LC3A 3LT3A 3U8OH 4BAHB 4B74A 2A45B 3FZZA 1ELGA 1C4V2 2VGCB 4DCDA 1GBJA 1O3GA 4OS2A 2AMQA 1FMGA 4WH6A 2BVSH 1S0RA 4UONA 3S9CA 1MQ5A 2ZFFH 3G01A 3MH4A 3PO1C 3U69H 2BY7X 2FOCA 2FX6A 2Q6FA 3RU4E 2QXJA 4O9VA 2DE8A 3GDVA 1TBQH 2AGEX 1G9IE 3DFLA 2Z7FE 3SU3A 2OC0A 3T2NA 2CV3A 2Z9JA 1PQ8A 1GI3A 1V2WT 1ZPBA 1G3CA 2F9OA 2P16A 2WINI 3BF6H 4ABJA 1UVSH 1CQQA 5JB8S 2A7HA 3BTGE 5JBBS 1VITH 2F9BH 4ZHMU 3P8OA 1AD8H 1BIOA 3A87A 2NU2E 1ARCA 1A0LA 1PYTC 2ANKH 4AFZA 1DY9A 3PV4A 5C20A 3LH3A 4NFFA 3HKIB 1KYNA 1QGFA 1SMFE 2BD2A 3PMHB 4VGCB 1LVMA 3K6YA 3SV8A 3UPEA 2C8YB 3GICB 4I32A 1HIAA 2A2QH 3RMLH 4B2CA 1NFYA 5F8ZA 5HM9A 2QN5T 1C2HA 1QB6A 1C2MA 2QCYA 1D3TB 2ZG0H 3UR9A 1DWCH 3MNCA 1ELDE 1Z6JH 1OWKA 1UJ1A 4VGCC 3V3MA 1UK2A 3LGIA 1NRRH 1XM1A 1C2DA 1O35A 4ZKSU 1C1TA 2F9VA 4IC5A 2FESH 4BTUB 1IQJA 2G5NA 1SQAA 1TNGA 1LHEH 5GCHF 3RMMH 4INLA 4RKJB 1G3EA 8GCHG 2Y5FA 2Z3EA 1ABIH 4AGJA 3BEIB 4MPWA 1P2OA 2ZCKP 1OWIA 3DFJA 1P2NA 1BTUA 3SU0A 2ODPA 4X6PA 1SSXA 3TK5A 3SV7A 3SNBA 8KME2 4IMQA 3P95A 1JIRA 3CP7A 1EX3A 4ISOA 1VJ9U 4CR9A 4NA8A 1LDTT 4D9QA 4X8TH 4CBOA 1C1QA 4FUIA 3RXGA 1GBEA 4FU9A 4X1RU 2WUCA 1GCTC 1Y5BT 3PTBA 4ABAA 2H5DA 4FXGH 3NCLA 3NKKA 3TGJE 1BBRE 1MAYA 1CT0E 4NFEA 4A6LA 1QB9A 2PV9B 1IHSH 3LGVA 3RXTA 3A85A 4ZKNU 3ZZ7A 1O2WA 1YP9A 1NRPH 1C2GA 2EI6A 1MTUA 2F9PA 2FDAA 5A2MH 1EP5A 1ZJDA 3SU6A 1MCTA 2PKSC 4X8UH 1O2VA 1GJ9B 2NU0E 4O3UA 1KTSB 5FX6A 4CRAA 2BX3A 1HAPH 3W94A 1KLIH 1ZR0A 5L2YH 2G51A 2HLCA 2ZGHA 1GJ7B 4K5ZA 1BCUH 3SI3H 3TH4H 1O5DH 3VXEH 2SGFE 2J2UA 4NIWA 5TCAA 2CMYA 1UTNA 2ZA5A 5GIBA 4DIIH 1IQMA 1BTHH 3PWCA 2FI5E 2ZI2H 4U01A 3PLKA 4WMEA 4Y8YA 1C2EA 1FY1A 3PMAB 4MTBA 1ANBA 3RUOA 1FY5A 1MKWK 1KLJH 1TABE 4IC6A 3QN7A 4NWKA 1P0SH 5F6MA 3SI4H 1FQ3A 1Y3VA 2FS8A 2VB0A 3Q3KA 2QV1A 4MQAA 4JZFH 1OWEA 3FZDA 2JETB 4NIYA 1GL0E 5FPSA 5L6NH 1LQEA 1LKAA 3SW2B 1O2QA 3TK6A 1DPOA 5A09A 3LJJA 4Z0KA 3MO9A 3SGBE 4Q7YA 1YCPM 1ABJH 2VU8E 2SGPE 1F0SA 2ZFSA 1PQ5A 3FFGA 3P8GA 4AGKA 1GI6A 1QBNA 3ZVCA 3SQHE 2GD4B 2BHGA 2BLQA 2ZTYA 1QJ6B 1ELEE 2G55A 1K1NA 1UTOA 2ZF0H 4MG3A 5ETXA 4AB8A 1EJMA 3FP7E 3M5NA 3SJ9A 3ZZ9A 1TPPA 1UK3A 5F8TA 2UWOA 1G2LA 2V0BA 1HCGA 2A4RA 3SUEA 3T62A 2ZHDA 1O3OA 1GG6C 1MH0A 1C5UA 4UFGH 2FTLE 4OGXA 2NWNA 1P12E 3ZZ6A 1NY22 2BY5X 3OY6U 1GHYH 3ZZ5A 3S0NA 2UUJB 5FPTA 1HNEE 5DG6A 1GMDF 1GI5A 2OC8A 3H7TA 1O34A 1GHZA 2BD4A 2BDHA 1WAYB 2H9EH 2UUKB 2Y5GA 3RXCA 1BUIA 3MU1A 1LTOA 2FLRH 1A7SA 2Q1JA 4CRGA 4FU8A 1HJ9A 3SNCA 4AYVB 1PPHE 1C1MA 1P3EA 1DLEA 4WXIA 2ZO3H 2NU3E 3P8FA 5DP7A 1HAOH 2SNWA 1IQEA 3S9BA 1RIWC 2WUBA 1CA8B 3UQOA 3QGNB 2OQ5A 3UFAA 2GMTC 2C3SA 3U1IB 3MOCA 2BDCA 4JZIA 1GWAA 2XW9A 4GSOA 5ESBA 1C2IA 1M9UA 4WF8A 2ZWLH 5C1XA 1ETRH 4YM9A 5TJXA 1AQ7A 3SUDA 1D6RA 1KXCA 1GI2A 3UIRA 1RXPA 2FTMA 4KGAA 1SVPA 2C93B 3LOXA 1UHBB 3B23B 2FXRA 1IOEA 1AKSA 2TGDA 5C1UA 4FVBA 2P59A 3SBKA 4OS7A 1SL3A 2FP7B 1O3JA 3ODDA 1O3MA 1V2MT 2DUCA 1F7ZA 2OQUA 1F0UA 4D7GA 5L2ZH 3CS7A 1GI4A 1AO5A 3RMOH 4X1PU 4AORA 2A1DB 4I8LA 1C1PA 1IQLA 2STBE 4DY7B 1AUTC 1QFKH 1TLDA 3MWIU 1TA2A 3AVZA 1RS0A 4JCNA 2XC4A 1SPJA 1FLEE 1SOZA 4OS4A 4YOIA 4ZROA 4Y0ZE 2P3FH 3SJOA 1BMAA 4F49A 1V2JT 2ZU4A 5CHAC 1P05A 1IQGA 3R0FA 2BY9X 2ZDLA 1BJUA 4BAOB 3BIUH 3QDZB 3TITA 5EW1H 2XBXA 1TRNA 1MKXK 5FPYA 5CE1A 2XBYA 2ZPRA 1ZSKA 4TYDA 4AX9H 3V7TA 1TPAE 3HGPA 4HI3A 2HPPH 3GY3A 2TGAA 1NRQH 4NWLA 4ZKRU 4TPYA 1CGHA 2ULLA 3UWIA 1HBTH 2C8WB 2ANYA 3I77A 4O03A 5EGMA 4YLQH 1Z8JB 3T25A 3ZVBA 1A2CH 2CF8H 1FIZA 1E38B 2BYAX 6ESTA 4SGAE 1P2JA 1KY9A 1P2QA 5LPFA 2P8OB 1W10U 2FM2A 1KLTA 1IQHA 1O5FH 2O8MA 1H9HE 6LPRA 2SFAA 1THSH 5GDSH 1SBWA 3R3GB 3VGCC 2NU4E 3GYMA 2UUFB 3LIWA 1YGCH 1AWHB 3VXFH 4M7GA 2TRMA 1YC0A 1P9SA 4Q7ZA 1YM0A 5G4BA 1N8OC 1Z8GA 5C3NA 3EA8A 1ZSJA 2BD3A 3IWMA 1JOUB 4DW2U 4GPGA 3MI4A 1E34B 1GJ5H 1C5OH 4H6TA 1GCTB 1C2LA 2PTCE 1F0RA 1BITA 4WWYA 1SG8B 3MO3A 1WU1A 4D76A 2BQWB 5GJ4B 2GGVB 1BT7A 3K6ZA 4X2XA 4SGBE 1J14A 2QYIA 1CO7E 2WPHS 1PPEE 1EPTC 3U8TH 2ZQ1A 3HK3B 1FUJA 2J94A 3M36A 4ABIA 2EA3A 4UE7H 3RU4T 2BLVA 1E36B 1QY6A 2BY6X 4NGAH 3SQEE 4ABGA 3KNXA 2IN2A 3SU1A 4NZLA 4THNH 1LQDB 1NU9A 1QNJA 1FY8E 1O2GH 2PKAB 5C67A 1SLUB 1MBQA 4CR5A 2FX4A 1BHXF 1GJ6A 1H8IH 1HGTH 1Z8RA 7ESTE 2R3UA 2O9QA 1JWTA 3B9FH 5FXLA 2VH0A 4IN1A 1YLDA 1GG6B 2FODA 1IQFA 2JKHA 1UVUH 4JMYA 1O0DH 1WQSA 3Q76A 1DWEH 2XBWA 5EODA 4XE4A 1SGDE 2SNVA 3ZVEA 3L6PA 2PTNA 1DWDH 3MH7A 1S81A 2GKVE 1TPSA 3F9GA 4I8GA 1SQTA 1QJ7B 3RC4A 4BOHA 1V2PT 1EJNA 3ZV8A 3GDSA 2F9UA 1Z8IB 4WH8A 3ZZ8A 4ZXXH 2VWNA 3WY8A 3PM3A 1DFPA 4X8SH 4E05H 2ZP0H 1O31A 1B5GH 1BMNH 3ZZCA 2QGRA 4WMFA 3ATIA 3PB1E 1ESAA 5A0CA 1G30B 3RU4D 1Y8TA 2G52A 2QXHA 2GVFA 1TALA 2BDYA 3RLWH 4U2WA 1EZSC 1EUFA 2TGTA 4OS5A 1JIMA 3ZZBA 1L1GA 1P03A 3ATKA 2VNTA 1YPHC 1YCPK 2V35A 4MNXA 5T3HA 1P9UA 2AFQB 5DKMA 4GUXA 3VPKA 5JB9S 3M3TA 3GCTF 4DJZB 2ZU1A 1ELBA 1D3PB 1GBBA 1KDQA 1RRKA 4Y7BA 1UCYE 1PJPA 1UCYK 1TNKA 2LNCA 1YPHE 1OP2A 1YPGH 3GY8A 1TQ0B 1O5AB 2GCHG 3TIUA 2P3TB 2Y6TA 2AERH 1TRMA 5JPMH 4UFEH 1FN8A 5CMXH 3LGUA 1DITH 2DE9A 2G5VA 1HFDA 1B7XB 1OXGA 1E37B 1UTMA 1F2SE 3VEQB 7KMEH 2XWAA 4CRDA 3ZVGA 2WPIS 4E7RG 1SGFA 2Y7ZA 1HAVA 2FWWA 3LDXH 1K1JA 2Z9IA 5DP5A 4Z6AH 3E90B 1IQNA 2BD8A 3TNSA 2BX4A 1THPB 4B2AA 1KXAA 1ORFA 4DURA 2O8WA 3GY2A 1GPZA 2AIPA 3ZVAA 5DJ7A 3KF2A 2O8TA 2ZU3A 3S69A 1EAXA 4ISLA 4YT7H 3UREA 1QB1A 4ABEA 1E35B 2OC7A 3RXMA 4BAKB 4Y11E 3GCNA 3F68H 5IDKA 3QO6A 3A81A 2BD5A 3V0XA 2VWOA 1O5GH 2OXSA 1K1IA 2B5TB 1PQ7A 1G36A 3BTFE 2OCVB 1LMWB 1O2TA 3GCTG 2STAE 1DDJA 5J4SA 1ETTH 3RC5A 1EKBB 3RXHA 2NU1E 2BOKA 3AAVA 3M5LA 1XMNB 4NA7A 2W26A 2F83A 4MPUA 5GPIB 5JBCS 2CHAC 3Q00A 4A5TS 2H6MA 1FAKH 3E91A 3O8CA 4FUHA 4ISIH 4TY6A 4YLUA 1EOLA 1XKBC 2ZIQH 2AGGX 5L30H 2BXUH 1Y59T 9ESTA 1O2MA 1GVZA 1CBWC 2IPHA 1A61H 1BTZA 3TGIE 5K7RA 1E0FD 1Y5UT 5E0GA 2PKSB 4B76A 4DIHH 1GMDG 2WV5A 1FPCH 1OSSA 2AYWA 2OUAA 1A5GH 2H5CA 2QF0A 1LHDH 1XVOA 1YKTA 5H4IB 1T4UH 1IQIA 1P2MA 2RA3A 2ALPA 4U32A 1HXFH 1AB9C 4FUDA 1V2QT 3FP6E 1HB0B 3ATLA 2ODQA 3A88A 3LC5A 3TJVA 3QX5H 2V6NA 1DE7H 1A0JA 2ZTXA 1A4WH 1EAIA 1Y3WA 4A7IB 2XTTB 1WSSH 3OSYA 1BRBE 3BN9A 1C1VH 1BTYA 2VIVA 1L2EA 1QRWA 4K1EA 4K2YA 1NM6A 3BG4C 1MTNB 1GI8B 1P57B 4B1TA 3K9XB 1C2JA 4YZUA 3F1SB 1TONA 2SGQE 3EE0B 1L1JA 1ZMJA 3P8NA 3A8DA 2A32A 3EA9A 2GCTB 1CVWH 2FYQA 4KTCA 1VJAU 3ZYEA 3N7OA 1O3NA 3LONA 4K60A 3RXDA 4AFQA 2R2WU 1O3IA 3AAUA 1A1RA 2WPLS 3P6ZB 2ZDMA 1MTNC 4HZHA 2VH6A 2FPZA 4YTAA 4GCHF 4FU7A 3URCA 2GDDA 1QTFA 1BBRH 2FOGA 1YPKH 1SR5C 3E1XB 4OS6A 3MNBA 3M3VA 3MMGA 1DX5M 1EAUA 1WOFA 4NIVA 1QA7A 8LPRA 3U1JB 1C1WH 1DXWA 1C1RA 2ZU5A 4JYVH 2Y5HA 3MH6A 4OS1A 3LH1A 3D65E 3W95A 2Z9GA 1HJAB 4YOJA 4GAWA 1J17T 1T32A 1O3BA 1LPZB 5LPEA 4TY7A 1NTPA 2FOAA 1ZSLA 1BA8B 3RXQA 3BTWE 1NESE 1GJBB 4BXWA 3PLPA 2BZAA 1EAWA 1ETSH 4ABDA 4K3JA 4PROA 1TX6A 1JXPA 3TH2H 1GMHG 3RXUA 4DVAU 1UVTH 1YYY1 1V2RT 1XUHA 2R2MB 2A7CA 2VINA 4IN2A 4GVUA 5EQSA 3SU4A 1CHGA 1ELFA 2ZPQA 1A5HA 3DHKH 1T4VH 3KQEA 2QC2A 1SGQE 4ZMAH 3QZQA 2Z9KA 3OY5U 2BVRH 5F8XA 1G3BA 4RKOB 3M7UA 3NK8A 1FAXA 2P93A 5E8EH 1HAYB 1GBCA 2WPMS 2FOBA 1ID5H 5DP6A 2GX4A 5AVDA 1QJ1B 2JH5D 1GL1A 1GHBF 2ZGJA 1SGFG 1B0EA 2Y82A 3FANA 3SNDA 1C5LH 1OKXA 1GBTA 1A0HB 1ZGIA 2ZZUH 4NZQA 4E7NA 5FBEA 4JK6A 3O8BA 5T6GA 1MU6B 2VVUA 3S9AA 2XCFA 2QXGA 1BB0B 1XKAC 4FUCA 1IQKA 1ESBA 1GBDA 4YESB 1O3AA 2KAIA 3RXOA 1SB1H 1QBOA 1W0ZU 3A80A 3TNTA 4DOQA 1O3LA 2IOTA 3ESTA 4YO9A 1JMOH 1CT2E 1WV7H 1DT2A 3ZZ3A 2CGAA 4ABBA 2H1UA 3ELAH 1NRSH 2CJIA 3SGQE 3Q3YA 1JRTA 2OP9A 1HLTH 5LH8A 1KXEA 1O2RA 2ZDVH 5GCHG 1WBGB 1Y3UA 3T26A 1GMHF 3Q77A 2Q6DA 1FNIA 1HRTH 5E0JA 1SGEE 1SC8U 1FJSA 1TQ7B 4B2BA 2ANMH 1Z1IA 3HPTB 5T6FA 1C2KA 1V3XA 1TGCA 1LVOA 3SJIA 4K69A 2ZC9H 1L4ZA 1T31A 2BZ6H 2A0QB 1NC6A 2ZTZA 4Q2KA 1HUTH 3PO1B 1AGJA 1C5PA 1XUIA 2RG3A 1O5EH 1OP0A 1QA0A 1NT1A 2VVCA 1Z1JA 4KKDA 3STJA 4JZDH 3T29A 1K1PA 4UFDH 3RXIA 2QY0B 1T8NA 4DGJA 3H7OA 3GOVB 2JETC 1GBIA 2BM2A 2GT8A 1DOJA 1CA0C 1S85A 5FAHA 1O3FA 2AMPA 2OLGA 1QCPA 2QF3A 2ZGXH 4IBLH 3ZYDA 1GHAG 1Z6EA 4IW4E 1J15A 3NUMA 4K1TA 2AIQA 3MH5A 4MPVA 4ESTE 1HAIH 2VWMA 1G37A 2A5AA 2FIRH 4Y0YE 1UMAH 2ZDAH 4A1VA 4O3TA 3SHCH 1LVYA 1U6QA 1TNHA 2B7DH 3MNSA 1V2VT 4XSKU 1K22H 3BG4B 1GBMA 2ZHQH 3BTHE 2J38A 2ZKSA 1DXPA 5C5NA 2BDAA 2ZCHP 1CHOF 1UO6A 4Y10E 4RSPA 4Q80A 2AMDA 2XYAA 1LPKB 2BLOA 4IS5A 4DT7B 3HK6B 1XX9A 1OWDA 3OYPA 3VB7A 3Q3XA 5FX5A 1O36A 4E06H 1G2MA 6GCHG 1YLCA 1LCYA 3L33A 3EGKH 3A7XA 3F9FA 3M7QA 1DANH 3O8DA 1O3CA 1CT4E 1Z71A 3VFEA 3T5FH 2GCTC 2HGTH 1O5CB 1EATA 4A1XA 1ARBA 2YNBA 4LK4A 1B0FA 1Q31A 2O8UA 1O2YA 3PYHA 1UTPA 3MFJA 1J16A 4ASHA 1V2UT 1SFQB 1SGYE 1NO9H 1T8LA 1S5SA 1OWHA 3GY7A 1GHVH 4D9RA 2Y80A 1CU1A 1FV9A 4K1SA 2WYJA 2PGBB 3FP8E 1C5MD 4X0WU 1HV7A 2J95A 1NZQH 4MLFB 2IJOB 2J4IA 2G00A 2THFB 3UNQA 1C5RA 1TMTH 3QTVH 5I25A 3SHAH 2GDEH 2GV7A 4DG4A 2GP9B 2SGAA 1GJ4H 4CH8B 1C4Y2 3ODFA 2G4TA 2I6SA 4NSVA 1F5KU 3SV9A 3A7VA 2TIOA 4H6SB 1HJ8A 5DP3A 2SGEE 1Y3YA 1C5NH 1ELCA 2FMJA 1IAUA 1DSTA 1RTLA 2J34A 1QBVH 4CBNA 1AN1E 4JZEH 2ZGBH 2Z94A 1X7AC 4UEHH 5EPNA 4AG1A 1VCWA 1FXYA 4FUEA 1O2IA 1TGSZ 3AASA 3BG8A 1ANDA 3BTKE 1H9IE 2ZFPH 1QRXA 1C9PA 1EQ9A 1ESTA 1TPOA 4CHAC 1HIAB 3RXJA 1NRNH 4KP0A 1MKWH 1TOMH 1H1BA 1W0YH 1UVPA 1RTFB 1XUKA 3DA9B 1AVXA 1MTVA 3ZZ4A 5FCKA 1Q3XA 2ZDKA 1QRZA 1BZXE 3AW0A 2H2ZA 3TVJB 3SJKA 1G3DA 1WUNH 1AHTH 1FDPA 1SLVB 1MTSA 3A83A 1SGCA 5E2PA 1AE8H 3M61U 2R0LA 4I8HA 5A8YA 1AMHA 1SGIB 1GMCG 1K28D 1O39A 1ZTKA 2XNIA 1VZQH 1HPGA 2QXIA 3M5OA 3ZV9A 3A7TA 3RXFA 1ZHRA 1AFEH 2TGPZ 5AFYH 4X8VH 3A8AA 4CREA 1PQAA 2H9HA 3MTYA 1C5TA 1N6YA 4WXVA 3QUMP 1OOKB 1GDNA 3DT0H 1O33A 2P95A 1C5XB 1C5ZB 3GCOA 4HTCH 1GHWH 4K8YA 2CHAB 1TFXA 1BQYA 1TNJA 2QAAA 1O3DA 2A4OA 2A5KA 4MVNA 5HYOA 1C4U2 1D4PB 5BRRE 3RXEA 3F9EA 1BHXB 1MCVA 1YPJH 2VVVA 4J2YB 2B8OH 1KXFA 1QURH 5EU8A 3SZNA 5B6OA 3LJOA 3P17H 4X1QU 2LPRA 4R8TB 1UVOA 3D62A 1GJDB 2ZQ2A 1W8BH 1OYQA 5AF9H 2FYRA 1FPHH 1VITG 5EPYA 1TRYA 3GCHB 2W5EA 1SLXB 3L3TA 3BTQE 2VWLA 3SV6A 3UNRA 1NFXA 1KTTB 1C5WB 3E8LA 1GJCB 4XFQA 3CS0A 1ZMNA 2W3KA 3KEEA 3I78A 2PSXA 2C90B 1TA6A 3LU9B 1XXFA 4TWYA 1TGTA 1NFUA 3QLPH 1EXFA 1RJXB 3EQ0H 1NU7B 3MU8A 1O3PB 1V2LT 3KL6A 1MD8A 5C2ZA 4CRCA 4LXBH 1C5VA 3PTNA 1G32B 2ZFTA 1YCPH 1EB1H 3V12A 2CXVA 2GV6A 1HXEH 5HGGA 4X1SU 1W14U 4CRBA 1NPMA 2WPKS 5DPAA 1EPTA 5AHGH 3HGNA 1C5SA 1UCYH 2F3CE 1FY3A 5AFZH 3MNXA 3ATMA 4JZ1A 3MU4A 4YOGA 1QL9A 3PWBA 1UTKA 1W7XH 3BIVH
chains in the Genus database with same CATH superfamily
2FS9A 4X2WA 5FBIA 1OHHD 2LP6A 1QL8A 1L4DA 1O2NA 3N99A 3KHVA 2XC0A 3TK9A 3I29A 5ABWA 1GHBG 1O2ZA 2K0QA 3TJNA 4YT6H 2ZFRH 3BV9B 1EB2A 2B9LA 3TH3H 3A7YA 1ZGVA 2WYGA 3DD2H 5J4QA 2JH6D 2M5TA 4WJG2 3D49H 2M2AA 2PSYA 4AYYB 3DSGA 1YPEH 4GHTA 1BDAA 3F9HA 1FY4A 2BDIA 2A2XH 3ZVFA 1GBHA 5C0UA 3SGAE 1PPZA 1AFQB 8GCHF 1MZAA 9LPRA 3EDXB 2D2DA 5JDUB 3JZ1B 1P2KA 1PYTD 1ZPZA 1ZYOA 3BSQA 2J5UA 3URDA 5I46H 2JH0D 1FIWA 2QA9E 1IHTH 5C5OA 1GBLA 2GZ7A 2VIOA 1F92A 2Q6GA 3T28A 3SU5A 3DUXH 3VB6A 3TJUA 3FVFB 3VB5A 4DT4A 4JYUH 1DVAH 5KECA 4GLYA 2EY4C 3WWBA 1C5QA 1QQUA 1TWXB 4B6FA 1KXDA 1GI7B 2V3OH 3EA7A 1W12U 3PRDA 5EG4A 1GGDB 2ZU2A 1BTWA 1MU8B 1YPLH 1XUGA 4BXSA 1TNIA 2GTBA 1ZTJA 1GDUA 1W3CA 2BXTH 2BQ6B 2KZ4A 2BY8X 2FZZA 4INKA 3U8RH 2FOHA 4TPIZ 3V13A 3ZZDA 2ILNA 2FEQH 4I8KA 3F2HA 2BVXH 1DS2E 2L74A 4ZXYH 4FUGA 1GBAA 5DP4A 3NRLA 1H8DH 2I6QA 3GY5A 1BMMH 1BMLA 4ZUHA 1VCPA 1ZHMA 3NZIA 3LGWA 1DICA 1EZXC 3A7WA 3QTOH 1HAXB 4TWWA 4AFUA 1O2PA 2B0FA 1GI0A 1LHFH 2ZHWH 4BANB 4O97A 4Y6DA 4CHAB 3QGJA 5K0HA 1O2OA 4GHQA 1RFNA 2A5IA 2ZDNA 1F0TA 1GI9B 4AB9A 4ABFA 1UHBA 2XWBI 1VITF 2BD7A 1N1LA 1GCDA 1F5LA 1CBWB 1V2ST 4LOYH 1AKSB 5EJLA 1LVBA 2BQ7B 3ITIA 1UTQA 7GCHG 1S0QA 5PTPA 3UY9A 1CSOE 4ISNA 1LHCH 4H4FA 4H42U 1Z7KA 3GY4A 2P3UB 3A86A 4HFPB 1SGPE 5DO4H 1T7CA 5ESTE 1P02A 1TX8A 4NIXA 2VIQA 1O2UA 4XD7D 4Y71A 3U9AH 4F4OC 3C1KA 1AB9B 5EW2H 3IITA 1RGQA 1H9LB 2KCAA 1AVGH 1O38A 1GBFA 2R9PA 4XOJA 1KDQB 3SUFA 1TYNA 3M35A 2JIZD 2TBSA 1ANCA 1BRUP 2Z9LA 1BRCE 3BTME 1KXBA 4LZ4B 3STIA 1UK4A 1K1LA 1WCZA 3PLBA 2WV4A 4IMZA 5T6DA 2HNTF 2UUYA 4BTTB 2XCNA 3GYLB 2P8OC 3TLOA 4UD9H 2OBOA 1KIGH 3A82A 1GMCF 1YPMH 1BTXA 1HDTH 1HYLA 4U30A 4Y7AA 1GHAF 4MNWA 5E0HA 3RXKA 1P04A 4WY3A 2Z6BD 2ZHEH 3RP2A 1WTHD 2QIQA 4D8NA 3LGTA 3GISB 3LKWA 4X2YA 1J9CH 3EAJA 4AOQA 3S7HB 3M5MA 2J9NA 2YOLA 1O2LA 1O2SA 4UDWH 2FOFA 6CHAB 2BOHB 2JJ2D 4HG6A 3QWCH 1MAXA 2GZ8A 7GCHF 3KGPA 1ELAA 2W6ID 1CE5A 3KCGH 2OTVA 4INHA 2GT7A 3TU7H 5E2OA 3E16B 2CF9H 4Q4LA 1S6HA 2Z3DA 1NBMD 1GJAB 2XRCA 1MMJN 1PPBH 1V2NT 1DM4B 4K8BA 1HJAC 1O3HA 1HAHH 2EI8A 1K0HA 1S83A 2PHBA 1O30A 2ZECA 1DLKB 2GMTB 1D3QB 1FX0B 2BD9A 1EJAA 1UTJA 5C1YA 2BB4A 2CK3D 1A3BH 1J8AA 4B71A 3E3TA 2PGQB 1O3EA 1AWFH 1S82A 2F91A 2G8TA 3B8JA 1D6WA 2EC9H 1O2JA 1DUEA 1UTLM 1LO6A 3BTEE 4J1YA 3SN8A 3KQCA 4BTIB 1BTPA 2W7SA 2A31A 2RFKC 2JDID 4KTSA 2HRVA 1O2HA 4FUBA 4FUFA 1BJVA 1C9TA 1CA0B 4Q63A 5A8ZA 3ATWA 1ZHPA 3RM0H 3LGYA 3FAOA 4JYTA 1ANEA 2VIWA 1ACBE 3SO3A 1PPFE 5F03A 3A89A 4IGDA 3KIDU 2RA0A 4UFFH 2KM0A 2OC1A 1O37A 3RXVA 2ZGCA 1W2KH 1TX7A 1AI8H 1C2FA 5DK1A 5EJ1A 4LZ1H 5A0AE 3O8RA 5EXMA 1NFWA 2VIPA 4ZKOU 1TMUH 3UWJH 1JBUH 3BEFB 1NROH 5EXLA 1KSNA 3UNSA 1TE0A 1P06A 1HAZB 1SLWB 3IG6B 1P11E 1GVKB 2F9NA 3RXBA 4XBBA 4Y8ZA 1LHGH 4I31A 4AN7A 2PLXA 1XXDA 1MBMA 3A8CA 2A7JA 3S7KB 1P8VC 1GDQA 3D23A 5GXPA 4ISHH 3UR6A 3T27A 2C4FH 1LKBA 2EEKA 3MHWU 2ZNKH 5A0BA 1OX1A 1AZZA 1K21H 1RTKA 1CGIE 4WMDA 5EQQA 3UUZA 4AG2A 1CGJE 2ESTE 2C8ZB 2J98B 2HNTC 3C27B 1OWJA 2Y7XA 2OINA 1SHHB 1AU8A 2XC5A 1ZLRA 1CHOG 1QHRB 2A4QA 1PPGE 4XDEA 1SI5H 2G81E 3M3SA 1ZPCA 1A5IA 3NWUA 3UAIC 2WZQA 4M9FA 1VGCC 2PFEA 3AW1A 4BAQB 1OS8A 1AZ8A 3RXLA 2FOMB 4QT8C 2PWXA 3VGCB 1MABB 1AFQC 3PMJA 3JZ2B 1K1OA 2VGCC 2GZ9A 3GDUA 1S6FA 4X6OA 1AVWA 1FN6A 2PW8H 5HM2A 1L0ZA 1MZDA 4GCHG 2AEIH 3RLYH 2BDBA 2BMGB 4I8JA 5IYTA 3SUGA 4BNRA 1V6DA 1HAVB 2D8WA 3SJ8A 2ODYB 3VB3A 1DUAA 1P01A 1BOQA 1KMHB 3SU2A 1T8OA 3E0PB 3MO6A 3TPIZ 3BTDE 5DP9A 1AY6H 2XBVA 5EXNA 1ZTLA 5LPRA 3K2UA 3E0NB 5GWZA 1ELTA 1JRSA 2YNAA 2TPIZ 1ELVA 1BBRK 1EZUC 3M37A 3E6PH 4HGCA 1D9IA 2W3IA 3SORA 1ZMLA 2PR3A 1XUFA 2AGIX 1OP8A 1D3DB 5CHAB 1C1OA 2ASUB 4ZHAA 3MU5A 5DGJA 2UWPA 1TBRH 4NSYA 4OGYA 1GJ8B 1A46H 1MUEB 1P2IA 1W7GH 1GVLA 5LGOA 5HMAA 3UOPA 1FI8A 1LPGB 1MKXH 2V3HH 2ZCLP 5FHTA 4ZHLU 3LPRA 1NN6A 5HXFA 2ZHFH 1V2OT 1QL7A 1A3EH 3PMBB 3H5CB 4ABHA 1TMBH 2VJ1A 2KAIB 1O2KA 2XXLA 1DSUA 5JBAS 4MNVA 2FLBH 2OD3B 1SFIA 3KN2A 1TAWA 1QR3E 1PPCE 3NPSA 1H4WA 2AH4X 3GCHC 3TGKE 4A1TA 1DWBH 3OU0A 1EOJA 1GHXH 2OBQA 4TT3D 3RDZA 3RXRA 4FUJA 2BDGA 2H9TH 3U98H 1C5YB 3PROA 2EQNA 6CHAC 3RXPA 2CN0H 1XVMA 1VR1H 4MPXA 3VG8A 1SQOA 2EI7A 4X6MA 1EPTB 1K1MA 2SGDE 4CRFA 3GY6A 1O5BB 4RN6A 4X6NA 3A8BA 3EYDA 4NG9H 3HKJB 1P3CA 1YWUA 1W11U 4AFSA 1AIXH 3VB4A 2BLWA 3TJOA 2VIDA 3RM2H 4B73A 2Z3CA 3QK1A 4AZ2B 1PFXC 4Q7XA 4XBCA 1FZZA 1WYKA 4WVPE 3RC6A 1V2TT 2F4LA 1VGCB 2RCEA 2ZEBA 1O2XA 1TB6H 1P10A 2HWLB 2UWLA 3NXPA 2AHME 1O32A 3BEUA 4Y79A 1QQ4A 1RD3B 4R0IA 5BPEA 3SOSA 1W13U 2J92A 1O3KA 2PUQH 4MNYA 1GI1A 5JBTA 1T8MA 2FI3E 2D26C 3OTJE 3SNEA 1S84A 4I7YH 1XUJA 3KQDA 4I33A 1ZRKA 4P00A 1Y3XA 1EASA 1K9OE 1TGNA 2AS9A 4A92A 4CH2B 2K1QA 2HNTE 3P70B 2PUXB 2ZFQH 4BAMB 5EOKA 5C0TA 2D1JA 1ZZZA 4X1NU 3P92A 2O8LA 5JYIA 4D7FA 2A4GA 3QZRA 1QIXB 1TBZH 1L1NA 1OYTH 1NS3A 2P94A 1TIOA 1SOTA 4Y76A 2W7UA 3ZZAA 1AE5A 2GCHF 1H8HD 1P09A 2C8XB 2WPJS 1MTWA 3F6UH 3RMNH 1OPHB 2HVXA 3RXAA 1FONA 5EQRA 4B75A 1THRH 1TNLA 1C1UH 2ALVA 2R0KA 2Y81A 2ZPSA 4MDSA 5FCRA 1Y5AT 4Y8XA 3MYWA 3A84A 3MU0A 6GCHF 5SGAE 3OX7U 1DY8A 2HOBA 3SV2H 2BTCE 1SGTA 3M7TA 1GBKA 1WQVH 1ZOMA 1SGRE 3UQVA 1TGBA 2HPQH 3A7ZA 1Q2WA 2HALA 4KELA 2R3YA 1V2KT 4FOUC 1TOCB 4KTUA 4X2VA 5A8XA 1AUJA 3RXSA 1N8OB 2ANWA 2RDLA 1BRAA 3F3BA 3K65B 1GGDC 1K2I1 4ZAEA 1ZRBA 5DP8A 2FOEA 4JK5A 1HAGE 1SQRA 1MD7A 2FO9A 2G4UA 3HATH 1EZQA 1MQ6A 3BTTE 3CENA 3SNAA 1RIWB 2IPQX 4NCYA 2FI4E 3UOUA 3ENSB 1EP6A 1YF4A 3UTUH 1F5RA 1INCA 1WTGH 1ZJKA 5TCCA 4NA9H 4FVDA 2K8IA 1C1SA 1SGNE 3KQBA 1VCQA 1N6XA 1YBWA 3DSPA 1SHYA 3ZVDA 2PKAA 4ZH8A 1C1NA 7LPRA 4XBDA 8ESTE 3LC3A 3LT3A 3U8OH 4BAHB 4B74A 2A45B 3FZZA 1ELGA 1C4V2 2VGCB 4DCDA 2KX4A 1GBJA 1O3GA 5CDFE 4OS2A 2AMQA 1FMGA 4WH6A 2BVSH 2VBCA 1S0RA 1E1RD 3F0OA 4UONA 3S9CA 1MQ5A 2ZFFH 3G01A 3MH4A 3PO1C 3U69H 2BY7X 2FOCA 2FX6A 2Q6FA 3RU4E 2QXJA 4O9VA 2DE8A 3GDVA 5IK2D 1TBQH 2AGEX 1G9IE 3DFLA 2Z7FE 3SU3A 2OC0A 3T2NA 2CV3A 2Z9JA 1PQ8A 1GI3A 1V2WT 1ZPBA 1G3CA 2F9OA 2P16A 2WINI 3BF6H 4ABJA 3PV5A 1UVSH 1CQQA 5JB8S 2A7HA 3BTGE 3F2GA 5JBBS 1VITH 2F9BH 4ZHMU 3P8OA 1AD8H 1BIOA 2WPDD 3A87A 2NU2E 1ARCA 1A0LA 1PYTC 2ANKH 4AFZA 1DY9A 3PV4A 5C20A 3LH3A 4NFFA 3HKIB 1KYNA 1QGFA 1SMFE 2BD2A 3PMHB 4VGCB 1LVMA 3K6YA 3SV8A 3UPEA 2C8YB 3GICB 4I32A 1HIAA 2A2QH 3RMLH 2RDEA 4B2CA 1NFYA 5F8ZA 5HM9A 2QN5T 1C2HA 1QB6A 1C2MA 2QCYA 1D3TB 2ZG0H 3UR9A 1DWCH 3MNCA 5HIZA 1ELDE 1Z6JH 5CHBA 1OWKA 1UJ1A 4VGCC 3V3MA 1UK2A 3LGIA 1NRRH 1XM1A 1C2DA 1O35A 1YY3A 1WDIA 4ZKSU 1C1TA 2F9VA 4IC5A 2FESH 4BTUB 1IQJA 2G5NA 1SQAA 1TNGA 1LHEH 5GCHF 3RMMH 4INLA 4RKJB 1G3EA 8GCHG 2Y5FA 2Z3EA 1ABIH 5KGOA 4AGJA 3BEIB 4MPWA 1P2OA 2ZCKP 1OWIA 3DFJA 1P2NA 1BTUA 3SU0A 2ODPA 4X6PA 1SSXA 3TK5A 3WWFA 3SV7A 3SNBA 8KME2 4IMQA 3P95A 1JIRA 3CP7A 1EX3A 4ISOA 1VJ9U 4CR9A 4NA8A 1LDTT 4D9QA 4X8TH 4CBOA 1C1QA 4FUIA 3RXGA 1GBEA 4FU9A 4X1RU 2WUCA 1GCTC 1Y5BT 3PTBA 4ABAA 2H5DA 4FXGH 3NCLA 3NKKA 3TGJE 1BBRE 1MAYA 1CT0E 4NFEA 4A6LA 1QB9A 2PV9B 1IHSH 3LGVA 3RXTA 3A85A 4ZKNU 3ZZ7A 1O2WA 1YP9A 1NRPH 1C2GA 2EI6A 1MTUA 2F9PA 2FDAA 5A2MH 1EP5A 2WSSD 1ZJDA 3SU6A 1MCTA 2PKSC 4X8UH 1O2VA 1GJ9B 2NU0E 4O3UA 1KTSB 5FX6A 4CRAA 2BX3A 3OAAD 1HAPH 3W94A 1KLIH 1ZR0A 3U28C 5L2YH 2G51A 5KEDA 2HLCA 2ZGHA 1GJ7B 4K5ZA 1BCUH 3SI3H 3TH4H 3GS9A 1O5DH 3VXEH 2SGFE 2J2UA 4NIWA 5TCAA 2CMYA 1UTNA 2ZA5A 5GIBA 4DIIH 1IQMA 1BTHH 3PWCA 2FI5E 2ZI2H 4U01A 3PLKA 4WMEA 4Y8YA 1C2EA 1FY1A 3PMAB 4MTBA 1ANBA 3RUOA 1S6LA 1FY5A 1MKWK 1KLJH 1EFRD 1VKYA 1TABE 4IC6A 3QN7A 4NWKA 1P0SH 5F6MA 3SI4H 3DCLA 1FQ3A 1Y3VA 2FS8A 2VB0A 3Q3KA 2QV1A 4MQAA 4JZFH 1OWEA 3FZDA 2JETB 4NIYA 1GL0E 1UW7A 5FPSA 5L6NH 1LQEA 1LKAA 3SW2B 1O2QA 3TK6A 1DPOA 3SYJA 5A09A 3LJJA 4Z0KA 3MO9A 3SGBE 4Q7YA 1YCPM 1ABJH 2VU8E 2SGPE 1F0SA 2ZFSA 4F48B 1PQ5A 3FFGA 3P8GA 4AGKA 3N7EA 1GI6A 1QBNA 3ZVCA 3SQHE 2GD4B 2BHGA 2BLQA 2ZTYA 1QJ6B 1ELEE 2G55A 1K1NA 1UTOA 2ZF0H 4MG3A 5ETXA 4AB8A 1EJMA 3FP7E 3M5NA 3SJ9A 3ZZ9A 1TPPA 1UK3A 5F8TA 2UWOA 1G2LA 2V0BA 1HCGA 2A4RA 3SUEA 3T62A 2ZHDA 1O3OA 1GG6C 1MH0A 1C5UA 4UFGH 2FTLE 4OGXA 2NWNA 1P12E 3ZZ6A 1NY22 2BY5X 3OY6U 1GHYH 3ZZ5A 3S0NA 2UUJB 5FPTA 1HNEE 5DG6A 1GMDF 1GI5A 2OC8A 3H7TA 1O34A 1GHZA 2BD4A 2BDHA 1WAYB 2H9EH 2UUKB 2Y5GA 3RXCA 1BUIA 3MU1A 1LTOA 2FLRH 1A7SA 2Q1JA 4CRGA 4FU8A 1HJ9A 3SNCA 4AYVB 1PPHE 1C1MA 1P3EA 1DLEA 4WXIA 2ZO3H 2NU3E 3P8FA 5DP7A 1HAOH 1E79D 2SNWA 1IQEA 3S9BA 1RIWC 2WUBA 1CA8B 3UQOA 3QGNB 2OQ5A 3UFAA 2GMTC 2C3SA 3U1IB 3MOCA 2BDCA 4JZIA 1GWAA 2XW9A 4GSOA 5ESBA 1C2IA 1M9UA 4WF8A 2ZWLH 5C1XA 1ETRH 4YM9A 5TJXA 1AQ7A 3SUDA 1D6RA 1KXCA 1GI2A 3UIRA 1RXPA 2FTMA 4KGAA 1SVPA 2C93B 3DSOA 3LOXA 1UHBB 3B23B 2FXRA 1IOEA 1AKSA 2TGDA 5C1UA 4FVBA 2P59A 3SBKA 4OS7A 1SL3A 2FP7B 1O3JA 3FO8D 3ODDA 1O3MA 1V2MT 2DUCA 1F7ZA 2OQUA 1F0UA 4D7GA 5L2ZH 3CS7A 1GI4A 1AO5A 3RMOH 4X1PU 4AORA 2A1DB 4I8LA 1C1PA 1IQLA 2STBE 4DY7B 1AUTC 1QFKH 1TLDA 3MWIU 1TA2A 2WHXA 3KQ5A 3AVZA 1RS0A 4JCNA 2XC4A 1SPJA 1FLEE 1SOZA 4OS4A 4YOIA 4ZROA 4Y0ZE 2P3FH 3SJOA 1BMAA 2HVYB 4F49A 1V2JT 2ZU4A 5CHAC 1P05A 1IQGA 3R0FA 2BY9X 2ZDLA 1BJUA 4BAOB 3BIUH 3QDZB 3TITA 1W0KD 5EW1H 2XBXA 2V3MA 1TRNA 1MKXK 5FPYA 5CE1A 2XBYA 2ZPRA 1ZSKA 4TYDA 4AX9H 3V7TA 1TPAE 3HGPA 4HI3A 2KCYA 2HPPH 3GY3A 2TGAA 1NRQH 4NWLA 4ZKRU 4TPYA 1CGHA 2ULLA 3UWIA 1HBTH 2C8WB 2ANYA 3I77A 4O03A 5EGMA 4YLQH 1Z8JB 2KCOA 1NBME 3T25A 3ZVBA 1A2CH 2XOKD 2CF8H 1FIZA 1E38B 2BYAX 6ESTA 4SGAE 1P2JA 3OE7D 1KY9A 1P2QA 5LPFA 4FETA 2QF4A 2P8OB 1W10U 2FM2A 1KLTA 1IQHA 1O5FH 2O8MA 1H9HE 6LPRA 2SFAA 1THSH 5GDSH 1SBWA 3R3GB 3VGCC 2NU4E 3GYMA 2UUFB 3LIWA 1YGCH 1AWHB 3VXFH 4M7GA 2TRMA 1YC0A 1P9SA 4Q7ZA 1YM0A 5G4BA 1N8OC 1Z8GA 5C3NA 3EA8A 1ZSJA 2BD3A 3IWMA 1JOUB 4DW2U 4GPGA 3MI4A 1E34B 1GJ5H 1C5OH 4H6TA 1GCTB 1C2LA 2PTCE 1F0RA 1BITA 4WWYA 1SG8B 3MO3A 1WU1A 4D76A 2BQWB 5GJ4B 2GGVB 1BT7A 3K6ZA 4X2XA 4SGBE 1J14A 2QYIA 1CO7E 2WPHS 1PPEE 1EPTC 3U8TH 2ZQ1A 3HK3B 1FUJA 2J94A 3M36A 4ABIA 2EA3A 4UE7H 3RU4T 2BLVA 1E36B 1QY6A 2BY6X 4NGAH 3SQEE 4ABGA 3KNXA 2IN2A 3SU1A 4NZLA 3FN8A 4THNH 1LQDB 1NU9A 1QNJA 1FY8E 1O2GH 2PKAB 5C67A 1SLUB 1MBQA 4CR5A 2FX4A 2HLDD 1BHXF 1GJ6A 3OFND 1H8IH 1HGTH 4P02A 1Z8RA 7ESTE 2R3UA 2O9QA 1JWTA 3B9FH 5FXLA 2VH0A 4IN1A 1YLDA 1GG6B 2FODA 1IQFA 2JKHA 1UVUH 3FOAA 4JMYA 1O0DH 1WQSA 3Q76A 1DWEH 2XBWA 5EODA 4XE4A 1SGDE 2SNVA 3ZVEA 3L6PA 2PTNA 1DWDH 3MH7A 1BMFD 1S81A 2GKVE 1TPSA 3F9GA 4I8GA 1SQTA 1QJ7B 3RC4A 4BOHA 1V2PT 1EJNA 3ZV8A 3GDSA 2F9UA 1Z8IB 4WH8A 3ZZ8A 4ZXXH 2VWNA 3WY8A 3PM3A 1DFPA 4X8SH 4E05H 2ZP0H 1O31A 1B5GH 1BMNH 3ZZCA 2QGRA 4WMFA 3ATIA 3PB1E 1ESAA 5A0CA 1G30B 3RU4D 1Y8TA 2G52A 2QXHA 2GVFA 1TALA 2BDYA 3RLWH 4U2WA 1EZSC 1EUFA 2TGTA 4OS5A 1JIMA 3ZZBA 1L1GA 1P03A 3ATKA 1YPHC 2VNTA 1YCPK 2V35A 4MNXA 5T3HA 1P9UA 2AFQB 5DKMA 2LELA 4GUXA 3VPKA 5JB9S 3M3TA 3GCTF 4DJZB 2ZU1A 1ELBA 1D3PB 1GBBA 1KDQA 1RRKA 4Y7BA 1UCYE 1PJPA 1UCYK 1TNKA 5HIYA 2LNCA 1YPHE 1OP2A 1YPGH 3GY8A 1TQ0B 1O5AB 5DSFA 2GCHG 3TIUA 2P3TB 2Y6TA 2AERH 1TRMA 2GJGA 2PP6A 5JPMH 3N7DA 4UFEH 1FN8A 5CMXH 3LGUA 1DITH 2DE9A 2G5VA 1HFDA 1B7XB 1OXGA 1E37B 1UTMA 1F2SE 3VEQB 7KMEH 2XWAA 4CRDA 3ZVGA 2WPIS 4E7RG 1SGFA 2Y7ZA 1HAVA 2FWWA 3LDXH 1K1JA 2Z9IA 5DP5A 4Z6AH 3E90B 1IQNA 2BD8A 2J97A 3TNSA 2BX4A 1THPB 4B2AA 1KXAA 1ORFA 4DURA 2O8WA 3GY2A 1GPZA 2AIPA 3ZVAA 5DJ7A 3KF2A 2O8TA 2ZU3A 3S69A 1EAXA 4ISLA 4YT7H 3UREA 1QB1A 4ABEA 1E35B 2OC7A 3RXMA 4BAKB 4Y11E 3GCNA 3F68H 5IDKA 3QO6A 3A81A 2BD5A 3V0XA 2VWOA 1O5GH 1SKYE 2OXSA 1K1IA 2B5TB 1PQ7A 1G36A 3BTFE 2OCVB 1LMWB 1O2TA 3GCTG 2STAE 1DDJA 5J4SA 1ETTH 3RC5A 1EKBB 3RXHA 2NU1E 2BOKA 3AAVA 3M5LA 1XMNB 4NA7A 2W26A 2F83A 4MPUA 5GPIB 5JBCS 2CHAC 3Q00A 4A5TS 2H6MA 1FAKH 3E91A 3CNRA 3O8CA 4FUHA 4ISIH 4TY6A 4YLUA 1EOLA 1XKBC 2ZIQH 2AGGX 5L30H 2BXUH 3SZEA 1Y59T 9ESTA 1O2MA 1GVZA 1CBWC 2IPHA 1A61H 1BTZA 3TGIE 5K7RA 1E0FD 1Y5UT 5E0GA 2PKSB 4B76A 4DIHH 1GMDG 2WV5A 2OK5A 1FPCH 1OSSA 2AYWA 2OUAA 4B6EA 1A5GH 2H5CA 2QF0A 1LHDH 1XVOA 1YKTA 5H4IB 1T4UH 1IQIA 1P2MA 2RA3A 3F2FA 2ALPA 1YLNA 1HXFH 4U32A 1AB9C 4FUDA 1V2QT 3MQKC 3FP6E 1HB0B 3ATLA 2ODQA 3A88A 3LC5A 3TJVA 2IJD1 3QX5H 2V6NA 1DE7H 1A0JA 2ZTXA 1A4WH 1EAIA 1Y3WA 4A7IB 2XTTB 1WSSH 3OSYA 1BRBE 5F53A 3BN9A 1C1VH 1BTYA 2VIVA 4ACBA 1L2EA 1QRWA 4K1EA 4K2YA 1NM6A 3BG4C 1MTNB 1GI8B 1P57B 4B1TA 3K9XB 1C2JA 4YZUA 3F1SB 1TONA 2SGQE 3EE0B 1L1JA 1ZMJA 3P8NA 3A8DA 2A32A 5C94A 3EA9A 2GCTB 1CVWH 2FYQA 4KTCA 1VJAU 2J98A 3ZYEA 3N7OA 1O3NA 4RI0A 3LONA 4K60A 3RXDA 4AFQA 2R2WU 1O3IA 3AAUA 1A1RA 2WPLS 3P6ZB 2ZDMA 1MTNC 4HZHA 2VH6A 2FPZA 4YTAA 4GCHF 4FU7A 3URCA 2GDDA 1QTFA 1BBRH 2FOGA 1YPKH 1SR5C 3E1XB 4OS6A 3MNBA 3M3VA 3MMGA 1DX5M 1EAUA 1WOFA 4NIVA 1QA7A 8LPRA 3ZIAD 3U1JB 1C1WH 1DXWA 1C1RA 2ZU5A 4JYVH 2Y5HA 3MH6A 3AK5A 4OS1A 3LH1A 3D65E 3W95A 2Z9GA 1HJAB 4YOJA 4GAWA 1J17T 1T32A 1O3BA 1LPZB 5LPEA 4TY7A 1NTPA 2FOAA 1ZSLA 1BA8B 3RXQA 3BTWE 1NESE 4OM9A 1GJBB 4BXWA 3PLPA 2BZAA 1EAWA 1ETSH 4ABDA 4K3JA 4PROA 1TX6A 1JXPA 3TH2H 1GMHG 3RXUA 4DVAU 1UVTH 1YYY1 1V2RT 1XUHA 2R2MB 3KYGA 2A7CA 2VINA 4IN2A 4GVUA 5EQSA 3SU4A 1CHGA 1ELFA 2ZPQA 1A5HA 1W0JD 3DHKH 1T4VH 3KQEA 2QC2A 1SGQE 4ZMAH 3QZQA 2Z9KA 3OY5U 2BVRH 5F8XA 1G3BA 1H8ED 4RKOB 3M7UA 3NK8A 1FAXA 2P93A 5E8EH 1HAYB 1GBCA 2WPMS 2FOBA 1ID5H 2KCPA 3PV2A 5DP6A 3WW7A 2GX4A 5AVDA 1QJ1B 2JH5D 1GL1A 1GHBF 2ZGJA 1SGFG 1B0EA 2Y82A 3FANA 3SNDA 1C5LH 1OKXA 1GBTA 1A0HB 1ZGIA 2ZZUH 4NZQA 4E7NA 3FKSD 5FBEA 4RT1A 4JK6A 3O8BA 5T6GA 1MU6B 2VVUA 3S9AA 2XCFA 2QXGA 1BB0B 1XKAC 4FUCA 1IQKA 1ESBA 1GBDA 4YESB 1O3AA 2KAIA 3RXOA 1SB1H 1QBOA 1W0ZU 3A80A 3OEHD 3TNTA 4DOQA 1O3LA 2IOTA 3ESTA 4YO9A 1JMOH 1CT2E 1WV7H 1DT2A 3ZZ3A 2CGAA 3OEED 4ABBA 2H1UA 3ELAH 1NRSH 2CJIA 3SGQE 3Q3YA 1JRTA 2OP9A 1HLTH 5GNDA 5LH8A 1KXEA 1O2RA 2ZDVH 5GCHG 1WBGB 1Y3UA 3T26A 1GMHF 3Q77A 2Q6DA 1FNIA 1HRTH 5E0JA 1SGEE 1SC8U 1FJSA 1TQ7B 4RT0A 4B2BA 2ANMH 1Z1IA 2KR7A 5FL7D 3HPTB 5T6FA 1C2KA 1V3XA 1TGCA 1LVOA 3SJIA 4K69A 2ZC9H 1L4ZA 1T31A 2BZ6H 2A0QB 1NC6A 2ZTZA 2YMSB 4Q2KA 3H09A 1HUTH 3PO1B 1AGJA 1C5PA 1XUIA 2RG3A 1O5EH 5EJZA 1OP0A 1QA0A 1NT1A 2VVCA 1Z1JA 4KKDA 3STJA 4JZDH 3T29A 1K1PA 4UFDH 3RXIA 2QF5A 2QY0B 1T8NA 4DGJA 2WV9A 3H7OA 3GOVB 2JETC 1GBIA 2BM2A 2GT8A 3PRBA 1DOJA 1CA0C 1S85A 5FAHA 1O3FA 2AMPA 2OLGA 1QCPA 2QF3A 2ZGXH 4AC9A 4IBLH 3ZYDA 1GHAG 1Z6EA 4IW4E 1J15A 3NUMA 4K1TA 2AIQA 3MH5A 4MPVA 2QE7D 4ESTE 1HAIH 2VWMA 3F0PA 1G37A 2A5AA 2FIRH 4Y0YE 1UMAH 2ZDAH 4A1VA 4O3TA 3SHCH 1LVYA 1U6QA 3UB0A 1TNHA 2B7DH 3MNSA 1V2VT 4XSKU 1K22H 3BG4B 1GBMA 2ZHQH 3BTHE 2J38A 2ZKSA 1DXPA 5C5NA 2BDAA 2ZCHP 1CHOF 1UO6A 4Y10E 4RSPA 4Q80A 2AMDA 2XYAA 1LPKB 2BLOA 4IS5A 4DT7B 3HK6B 1XX9A 1OWDA 3OYPA 3VB7A 1E1QD 3Q3XA 5FX5A 1O36A 4E06H 1G2MA 6GCHG 1YLCA 1LCYA 3L33A 3EGKH 4TSFD 3A7XA 3F9FA 3M7QA 1DANH 2W6JD 3O8DA 1O3CA 1CT4E 1Z71A 3VFEA 3T5FH 2GCTC 2HGTH 1O5CB 1EATA 4A1XA 1ARBA 2YNBA 4LK4A 1B0FA 1Q31A 2O8UA 1O2YA 3PYHA 1UTPA 3MFJA 1J16A 4ASHA 1V2UT 1SFQB 1SGYE 1NO9H 1T8LA 1S5SA 1OWHA 3GY7A 1GHVH 4D9RA 2Y80A 1CU1A 1FV9A 4K1SA 2WYJA 2JJ1D 2PGBB 3OTPA 3FP8E 1C5MD 4X0WU 1HV7A 2J95A 1NZQH 4MLFB 2IJOB 2J4IA 2G00A 4F55A 2THFB 3UNQA 1C5RA 1TMTH 3QTVH 5I25A 3SHAH 2GDEH 2GV7A 4DG4A 2GP9B 2SGAA 1GJ4H 4CH8B 1C4Y2 3ODFA 2G4TA 2I6SA 4NSVA 1F5KU 3SV9A 3A7VA 2TIOA 5DN6D 4H6SB 1HJ8A 5DP3A 2SGEE 1Y3YA 1C5NH 1ELCA 2FMJA 1IAUA 1DSTA 1RTLA 2J34A 2KFWA 5HKKD 1QBVH 4ACAA 4CBNA 1AN1E 4JZEH 2ZGBH 4Z1MD 2Z94A 1X7AC 5T1VA 4UEHH 5EPNA 4AG1A 1VCWA 1FXYA 3KYFA 4FUEA 1O2IA 1TGSZ 3AASA 3BG8A 1ANDA 2V7QD 3BTKE 1H9IE 2ZFPH 1QRXA 1C9PA 4I86A 1EQ9A 1ESTA 1QZ8A 1TPOA 4CHAC 1HIAB 3RXJA 1NRNH 4KP0A 1MKWH 1TOMH 1H1BA 1W0YH 1UVPA 1RTFB 1XUKA 3DA9B 1AVXA 1MTVA 3ZZ4A 5FCKA 1Q3XA 2ZDKA 1QRZA 1BZXE 3AW0A 2H2ZA 3TVJB 3SJKA 1G3DA 5EIYA 1WUNH 1AHTH 1FDPA 1SLVB 1MTSA 3A83A 1SGCA 5E2PA 1AE8H 3M61U 2R0LA 4I8HA 5A8YA 1AMHA 1SGIB 1GMCG 1K28D 1O39A 1ZTKA 2XNIA 1VZQH 1HPGA 2QXIA 3M5OA 3ZV9A 3A7TA 3RXFA 1ZHRA 1AFEH 2TGPZ 5AFYH 4X8VH 2YMSC 3A8AA 4CREA 1PQAA 2H9HA 3MTYA 1C5TA 1N6YA 4ASUD 4WXVA 3QUMP 1OOKB 1GDNA 3DT0H 1O33A 3W1EA 2P95A 1C5XB 1C5ZB 3GCOA 4HTCH 1GHWH 4K8YA 2CHAB 1TFXA 1BQYA 1TNJA 2QAAA 1O3DA 2XNDD 2A4OA 2A5KA 4MVNA 5HYOA 1C4U2 1D4PB 5BRRE 3RXEA 3F9EA 1BHXB 1MCVA 1YPJH 2VVVA 4J2YB 2B8OH 1KXFA 1QURH 5EU8A 3SZNA 5B6OA 3LJOA 3P17H 4X1QU 2LPRA 4R8TB 1UVOA 3D62A 5C17A 1GJDB 2ZQ2A 1W8BH 1OYQA 5AF9H 2FYRA 1FPHH 1VITG 5EPYA 4ZCNA 1TRYA 3GCHB 2W5EA 1SLXB 3L3TA 3BTQE 2YMSD 2VWLA 3SV6A 3EE7A 3UNRA 1NFXA 1KTTB 1C5WB 3E8LA 1GJCB 4XFQA 4XRNA 3CS0A 1ZMNA 2W3KA 3KEEA 3I78A 2PSXA 2C90B 1TA6A 3LU9B 1XXFA 4TWYA 1TGTA 1NFUA 3QLPH 1EXFA 1RJXB 3EQ0H 1NU7B 3MU8A 1O3PB 1V2LT 3KL6A 1MD8A 2F43B 2L6OA 5C2ZA 1COWD 4CRCA 4LXBH 1C5VA 3PTNA 4YXWD 1G32B 2ZFTA 1YCPH 1EB1H 3V12A 2CXVA 2GV6A 1HXEH 5HGGA 4X1SU 1W14U 4CRBA 1NPMA 1WXRA 2WPKS 5DPAA 1EPTA 5AHGH 3HGNA 1C5SA 1UCYH 5B6LA 2F3CE 1FY3A 5AFZH 3MNXA 3ATMA 4JZ1A 3MU4A 4YOGA 1QL9A 3PWBA 1UTKA 1W7XH 3BIVH
chains in the Genus database with same CATH topology
2FS9A 4X2WA 5FBIA 1QL8A 1L4DA 1O2NA 3KHVA 2XC0A 3TK9A 3I29A 5ABWA 1GHBG 1O2ZA 3TJNA 4YT6H 2ZFRH 3BV9B 1EB2A 2B9LA 3TH3H 3A7YA 1ZGVA 2WYGA 3DD2H 5J4QA 2JH6D 2M5TA 4WJG2 3D49H 2PSYA 4AYYB 1YPEH 4GHTA 1BDAA 3F9HA 1FY4A 2BDIA 2A2XH 3ZVFA 1GBHA 3SGAE 1PPZA 1AFQB 8GCHF 1MZAA 9LPRA 3EDXB 2D2DA 5JDUB 3JZ1B 1P2KA 1PYTD 1ZPZA 1ZYOA 3BSQA 3URDA 5I46H 2JH0D 1FIWA 2QA9E 1IHTH 5C5OA 1GBLA 2GZ7A 2VIOA 1F92A 2Q6GA 3T28A 3SU5A 3DUXH 3VB6A 3TJUA 3FVFB 3VB5A 4JYUH 1DVAH 4GLYA 1C5QA 1QQUA 1TWXB 1KXDA 1GI7B 2V3OH 3EA7A 1W12U 5EG4A 1GGDB 2ZU2A 1BTWA 1MU8B 1YPLH 1XUGA 4BXSA 1TNIA 2GTBA 1ZTJA 1GDUA 1W3CA 2BXTH 2BQ6B 2BY8X 2FZZA 4INKA 3U8RH 2FOHA 4TPIZ 3V13A 3ZZDA 2ILNA 2FEQH 4I8KA 2BVXH 1DS2E 4ZXYH 4FUGA 1GBAA 5DP4A 1H8DH 2I6QA 3GY5A 1BMMH 1BMLA 4ZUHA 1VCPA 1ZHMA 3NZIA 3LGWA 1DICA 1EZXC 3A7WA 3QTOH 1HAXB 4TWWA 4AFUA 1O2PA 2B0FA 1GI0A 1LHFH 2ZHWH 4BANB 4O97A 4Y6DA 4CHAB 3QGJA 5K0HA 1O2OA 4GHQA 1RFNA 2A5IA 2ZDNA 1F0TA 1GI9B 4AB9A 4ABFA 1UHBA 2XWBI 1VITF 2BD7A 1N1LA 1GCDA 1F5LA 1CBWB 1V2ST 4LOYH 1AKSB 1LVBA 2BQ7B 3ITIA 1UTQA 7GCHG 1S0QA 5PTPA 3UY9A 1CSOE 4ISNA 1LHCH 4H4FA 4H42U 1Z7KA 3GY4A 2P3UB 3A86A 4HFPB 1SGPE 5DO4H 1T7CA 5ESTE 1P02A 1TX8A 4NIXA 2VIQA 1O2UA 4Y71A 3U9AH 4F4OC 3C1KA 1AB9B 5EW2H 3IITA 1RGQA 1H9LB 1AVGH 1O38A 1GBFA 2R9PA 4XOJA 1KDQB 3SUFA 1TYNA 3M35A 2TBSA 1ANCA 1BRUP 2Z9LA 1BRCE 3BTME 1KXBA 4LZ4B 3STIA 1UK4A 1K1LA 1WCZA 3PLBA 2WV4A 4IMZA 5T6DA 2HNTF 2UUYA 4BTTB 2XCNA 3GYLB 2P8OC 3TLOA 4UD9H 2OBOA 1KIGH 3A82A 1GMCF 1YPMH 1BTXA 1HDTH 1HYLA 4U30A 4Y7AA 1GHAF 4MNWA 5E0HA 3RXKA 1P04A 4WY3A 2Z6BD 2ZHEH 3RP2A 1WTHD 2QIQA 4D8NA 3LGTA 3GISB 3LKWA 4X2YA 1J9CH 3EAJA 4AOQA 3S7HB 3M5MA 2J9NA 2YOLA 1O2LA 1O2SA 4UDWH 2FOFA 6CHAB 2BOHB 3QWCH 1MAXA 2GZ8A 7GCHF 3KGPA 1ELAA 1CE5A 3KCGH 2OTVA 4INHA 2GT7A 3TU7H 5E2OA 3E16B 2CF9H 1S6HA 2Z3DA 1GJAB 2XRCA 1MMJN 1PPBH 1V2NT 1DM4B 4K8BA 1HJAC 1O3HA 1HAHH 2EI8A 1S83A 2PHBA 1O30A 2ZECA 1DLKB 2GMTB 1D3QB 2BD9A 1EJAA 1UTJA 5C1YA 2BB4A 1A3BH 1J8AA 4B71A 3E3TA 2PGQB 1O3EA 1AWFH 1S82A 2F91A 2G8TA 3B8JA 1D6WA 2EC9H 1O2JA 1DUEA 1UTLM 1LO6A 3BTEE 4J1YA 3SN8A 3KQCA 4BTIB 1BTPA 2W7SA 2A31A 4KTSA 2HRVA 1O2HA 4FUBA 4FUFA 1BJVA 1C9TA 1CA0B 5A8ZA 3ATWA 1ZHPA 3RM0H 3LGYA 3FAOA 4JYTA 1ANEA 2VIWA 1ACBE 3SO3A 1PPFE 5F03A 3A89A 4IGDA 3KIDU 2RA0A 4UFFH 2OC1A 1O37A 3RXVA 2ZGCA 1W2KH 1TX7A 1AI8H 1C2FA 5DK1A 4LZ1H 5A0AE 3O8RA 5EXMA 1NFWA 2VIPA 4ZKOU 1TMUH 3UWJH 1JBUH 3BEFB 1NROH 5EXLA 1KSNA 3UNSA 1TE0A 1P06A 1HAZB 1SLWB 3IG6B 1P11E 1GVKB 2F9NA 3RXBA 4XBBA 4Y8ZA 1LHGH 4I31A 4AN7A 2PLXA 1XXDA 1MBMA 3A8CA 2A7JA 3S7KB 1P8VC 1GDQA 3D23A 5GXPA 4ISHH 3UR6A 3T27A 2C4FH 1LKBA 2EEKA 3MHWU 2ZNKH 5A0BA 1OX1A 1AZZA 1K21H 1RTKA 1CGIE 4WMDA 5EQQA 3UUZA 4AG2A 1CGJE 2ESTE 2C8ZB 2HNTC 3C27B 1OWJA 2Y7XA 2OINA 1SHHB 1AU8A 2XC5A 1ZLRA 1CHOG 1QHRB 2A4QA 1PPGE 4XDEA 1SI5H 2G81E 3M3SA 1ZPCA 1A5IA 3NWUA 1VGCC 2PFEA 3AW1A 4BAQB 1OS8A 1AZ8A 3RXLA 2FOMB 4QT8C 2PWXA 3VGCB 1AFQC 3PMJA 3JZ2B 1K1OA 2VGCC 2GZ9A 3GDUA 1S6FA 4X6OA 1AVWA 1FN6A 2PW8H 5HM2A 1L0ZA 1MZDA 4GCHG 2AEIH 3RLYH 2BDBA 2BMGB 4I8JA 5IYTA 3SUGA 4BNRA 1V6DA 1HAVB 2D8WA 3SJ8A 2ODYB 3VB3A 1DUAA 1P01A 1BOQA 3SU2A 1T8OA 3E0PB 3MO6A 3TPIZ 3BTDE 5DP9A 1AY6H 2XBVA 5EXNA 1ZTLA 5LPRA 3K2UA 3E0NB 5GWZA 1ELTA 1JRSA 2YNAA 2TPIZ 1ELVA 1BBRK 1EZUC 3M37A 3E6PH 4HGCA 1D9IA 2W3IA 3SORA 1ZMLA 2PR3A 1XUFA 2AGIX 1OP8A 1D3DB 5CHAB 1C1OA 2ASUB 4ZHAA 3MU5A 5DGJA 2UWPA 1TBRH 4NSYA 4OGYA 1GJ8B 1A46H 1MUEB 1P2IA 1W7GH 1GVLA 5LGOA 5HMAA 3UOPA 1FI8A 1LPGB 1MKXH 2V3HH 2ZCLP 5FHTA 4ZHLU 3LPRA 1NN6A 5HXFA 2ZHFH 1V2OT 1QL7A 1A3EH 3PMBB 3H5CB 4ABHA 1TMBH 2VJ1A 2KAIB 1O2KA 2XXLA 1DSUA 5JBAS 4MNVA 2FLBH 2OD3B 1SFIA 3KN2A 1TAWA 1QR3E 1PPCE 3NPSA 1H4WA 2AH4X 3GCHC 3TGKE 4A1TA 1DWBH 3OU0A 1EOJA 1GHXH 2OBQA 3RDZA 3RXRA 4FUJA 2BDGA 2H9TH 3U98H 1C5YB 3PROA 6CHAC 3RXPA 2CN0H 1XVMA 1VR1H 4MPXA 1SQOA 2EI7A 4X6MA 1EPTB 1K1MA 2SGDE 4CRFA 3GY6A 1O5BB 4RN6A 4X6NA 3A8BA 3EYDA 4NG9H 3HKJB 1P3CA 1W11U 4AFSA 1AIXH 3VB4A 2BLWA 3TJOA 2VIDA 3RM2H 4B73A 2Z3CA 3QK1A 4AZ2B 1PFXC 4Q7XA 4XBCA 1FZZA 1WYKA 4WVPE 3RC6A 1V2TT 1VGCB 2RCEA 2ZEBA 1O2XA 1TB6H 1P10A 2HWLB 2UWLA 3NXPA 1O32A 3BEUA 4Y79A 1QQ4A 1RD3B 4R0IA 5BPEA 3SOSA 1W13U 2J92A 1O3KA 2PUQH 4MNYA 1GI1A 5JBTA 1T8MA 2FI3E 2D26C 3OTJE 3SNEA 1S84A 4I7YH 1XUJA 3KQDA 4I33A 1ZRKA 1Y3XA 1EASA 1K9OE 1TGNA 2AS9A 4A92A 4CH2B 2K1QA 2HNTE 3P70B 2PUXB 2ZFQH 4BAMB 5EOKA 2D1JA 1ZZZA 4X1NU 3P92A 2O8LA 5JYIA 4D7FA 2A4GA 3QZRA 1QIXB 1TBZH 1L1NA 1OYTH 1NS3A 2P94A 1TIOA 1SOTA 4Y76A 2W7UA 3ZZAA 1AE5A 2GCHF 1P09A 2C8XB 2WPJS 1MTWA 3F6UH 3RMNH 1OPHB 2HVXA 3RXAA 1FONA 5EQRA 4B75A 1THRH 1TNLA 1C1UH 2ALVA 2R0KA 2Y81A 2ZPSA 4MDSA 5FCRA 1Y5AT 4Y8XA 3MYWA 3A84A 3MU0A 6GCHF 5SGAE 3OX7U 1DY8A 2HOBA 3SV2H 2BTCE 1SGTA 3M7TA 1GBKA 1WQVH 1ZOMA 1SGRE 3UQVA 1TGBA 2HPQH 3A7ZA 1Q2WA 2HALA 4KELA 2R3YA 1V2KT 1TOCB 4KTUA 4X2VA 5A8XA 1AUJA 3RXSA 1N8OB 2ANWA 2RDLA 1BRAA 3K65B 1GGDC 1K2I1 4ZAEA 1ZRBA 5DP8A 2FOEA 4JK5A 1HAGE 1MD7A 2FO9A 2G4UA 3HATH 1EZQA 1MQ6A 3BTTE 3CENA 3SNAA 1RIWB 4NCYA 2FI4E 3UOUA 3ENSB 1EP6A 1YF4A 3UTUH 1F5RA 1INCA 1WTGH 1ZJKA 5TCCA 4NA9H 4FVDA 1C1SA 1SGNE 3KQBA 1VCQA 1N6XA 1YBWA 1SHYA 3ZVDA 2PKAA 4ZH8A 1C1NA 7LPRA 4XBDA 8ESTE 3LC3A 3LT3A 3U8OH 4BAHB 4B74A 2A45B 3FZZA 1ELGA 1C4V2 2VGCB 4DCDA 1GBJA 1O3GA 4OS2A 2AMQA 1FMGA 4WH6A 2BVSH 1S0RA 4UONA 3S9CA 1MQ5A 2ZFFH 3G01A 3MH4A 3PO1C 3U69H 2BY7X 2FOCA 2FX6A 2Q6FA 3RU4E 2QXJA 4O9VA 2DE8A 3GDVA 1TBQH 2AGEX 1G9IE 3DFLA 2Z7FE 3SU3A 2OC0A 3T2NA 2CV3A 2Z9JA 1PQ8A 1GI3A 1V2WT 1ZPBA 1G3CA 2F9OA 2P16A 2WINI 3BF6H 4ABJA 1UVSH 1CQQA 5JB8S 2A7HA 3BTGE 5JBBS 1VITH 2F9BH 4ZHMU 3P8OA 1AD8H 1BIOA 3A87A 2NU2E 1ARCA 1A0LA 1PYTC 2ANKH 4AFZA 1DY9A 3PV4A 5C20A 3LH3A 4NFFA 3HKIB 1KYNA 1QGFA 1SMFE 2BD2A 3PMHB 4VGCB 1LVMA 3K6YA 3SV8A 3UPEA 2C8YB 3GICB 4I32A 1HIAA 2A2QH 3RMLH 4B2CA 1NFYA 5F8ZA 5HM9A 2QN5T 1C2HA 1QB6A 1C2MA 2QCYA 1D3TB 2ZG0H 3UR9A 1DWCH 3MNCA 1ELDE 1Z6JH 1OWKA 1UJ1A 4VGCC 3V3MA 1UK2A 3LGIA 1NRRH 1XM1A 1C2DA 1O35A 4ZKSU 1C1TA 2F9VA 4IC5A 2FESH 4BTUB 1IQJA 2G5NA 1SQAA 1TNGA 1LHEH 5GCHF 3RMMH 4INLA 4RKJB 1G3EA 8GCHG 2Y5FA 2Z3EA 1ABIH 4AGJA 3BEIB 4MPWA 1P2OA 2ZCKP 1OWIA 3DFJA 1P2NA 1BTUA 3SU0A 2ODPA 4X6PA 1SSXA 3TK5A 3SV7A 3SNBA 8KME2 4IMQA 3P95A 1JIRA 3CP7A 1EX3A 4ISOA 1VJ9U 4CR9A 4NA8A 1LDTT 4D9QA 4X8TH 4CBOA 1C1QA 4FUIA 3RXGA 1GBEA 4FU9A 4X1RU 2WUCA 1GCTC 1Y5BT 3PTBA 4ABAA 2H5DA 4FXGH 3NCLA 3NKKA 3TGJE 1BBRE 1MAYA 1CT0E 4NFEA 4A6LA 1QB9A 2PV9B 1IHSH 3LGVA 3RXTA 3A85A 4ZKNU 3ZZ7A 1O2WA 1YP9A 1NRPH 1C2GA 2EI6A 1MTUA 2F9PA 2FDAA 5A2MH 1EP5A 1ZJDA 3SU6A 1MCTA 2PKSC 4X8UH 1O2VA 1GJ9B 2NU0E 4O3UA 1KTSB 5FX6A 4CRAA 2BX3A 1HAPH 3W94A 1KLIH 1ZR0A 5L2YH 2G51A 2HLCA 2ZGHA 1GJ7B 4K5ZA 1BCUH 3SI3H 3TH4H 1O5DH 3VXEH 2SGFE 2J2UA 4NIWA 5TCAA 2CMYA 1UTNA 2ZA5A 5GIBA 4DIIH 1IQMA 1BTHH 3PWCA 2FI5E 2ZI2H 4U01A 3PLKA 4WMEA 4Y8YA 1C2EA 1FY1A 3PMAB 4MTBA 1ANBA 3RUOA 1FY5A 1MKWK 1KLJH 1TABE 4IC6A 3QN7A 4NWKA 1P0SH 5F6MA 3SI4H 1FQ3A 1Y3VA 2FS8A 2VB0A 3Q3KA 2QV1A 4MQAA 4JZFH 1OWEA 3FZDA 2JETB 4NIYA 1GL0E 5FPSA 5L6NH 1LQEA 1LKAA 3SW2B 1O2QA 3TK6A 1DPOA 5A09A 3LJJA 4Z0KA 3MO9A 3SGBE 4Q7YA 1YCPM 1ABJH 2VU8E 2SGPE 1F0SA 2ZFSA 1PQ5A 3FFGA 3P8GA 4AGKA 1GI6A 1QBNA 3ZVCA 3SQHE 2GD4B 2BHGA 2BLQA 2ZTYA 1QJ6B 1ELEE 2G55A 1K1NA 1UTOA 2ZF0H 4MG3A 5ETXA 4AB8A 1EJMA 3FP7E 3M5NA 3SJ9A 3ZZ9A 1TPPA 1UK3A 5F8TA 2UWOA 1G2LA 2V0BA 1HCGA 2A4RA 3SUEA 3T62A 2ZHDA 1O3OA 1GG6C 1MH0A 1C5UA 4UFGH 2FTLE 4OGXA 2NWNA 1P12E 3ZZ6A 1NY22 2BY5X 3OY6U 1GHYH 3ZZ5A 3S0NA 2UUJB 5FPTA 1HNEE 5DG6A 1GMDF 1GI5A 2OC8A 3H7TA 1O34A 1GHZA 2BD4A 2BDHA 1WAYB 2H9EH 2UUKB 2Y5GA 3RXCA 1BUIA 3MU1A 1LTOA 2FLRH 1A7SA 2Q1JA 4CRGA 4FU8A 1HJ9A 3SNCA 4AYVB 1PPHE 1C1MA 1P3EA 1DLEA 4WXIA 2ZO3H 2NU3E 3P8FA 5DP7A 1HAOH 2SNWA 1IQEA 3S9BA 1RIWC 2WUBA 1CA8B 3UQOA 3QGNB 2OQ5A 3UFAA 2GMTC 2C3SA 3U1IB 3MOCA 2BDCA 4JZIA 1GWAA 2XW9A 4GSOA 5ESBA 1C2IA 1M9UA 4WF8A 2ZWLH 5C1XA 1ETRH 4YM9A 5TJXA 1AQ7A 3SUDA 1D6RA 1KXCA