1V2PT

Trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.a4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSYIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2pT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2pT02
5J4SA 5CE1A 8LPRA 4THNH 4BANB 1EJMA 3DUXH 1F0TA 4NIVA 1QB9A 2P59A 2FM2A 1TNKA 1B0FA 5DGJA 4ZXYH 2PV9B 4AFSA 1GJ4H 1GVLA 4BTTB 1RXPA 1C1MA 1SFQB 2XBVA 1J9CH 1PYTD 4MDSA 3ZVFA 1OWDA 1Y3XA 2J38A 1LCYA 1T4VH 1FY5A 1TWXB 1H9IE 1QBVH 1FIWA 3GISB 1AZ8A 2AIQA 1OS8A 1HAOH 3TGKE 2ZHFH 2F9OA 2SNWA 3BEIB 3MMGA 1O32A 8GCHG 5FCKA 4IS5A 1HGTH 1O5BB 1HFDA 3QWCH 3MH4A 1C5QA 3UUZA 3O8RA 2GZ7A 2H9TH 1NTPA 1NU9A 1IQMA 2HVXA 1AO5A 2ANKH 2P8OB 3BG8A 3E1XB 1YPHE 4AYYB 1O30A 3O8BA 2A32A 3L33A 3ATIA 4B75A 3MNCA 4BNRA 1GJAB 1K22H 3JZ1B 3MO3A 1K21H 1IQIA 1O2MA 5K0HA 3UPEA 2XBYA 4RKOB 5EODA 4ISOA 1F0RA 3S7HB 4WH6A 2BX4A 1G3BA 4DGJA 1PPBH 2BLVA 4ZKRU 1O2JA 3ZYDA 1A7SA 3SJ9A 4FU9A 3A8CA 3PLBA 4B71A 2STBE 1G3EA 5C20A 5GPIB 1GHYH 1KTTB 1Z6JH 4KTSA 2Q6GA 1GGDC 2FTMA 2B8OH 1S0QA 1AB9B 2BD2A 1MTNC 2FPZA 1QRXA 3DD2H 1GI9B 1C5SA 2ZEBA 2VB0A 4ZHMU 3MH5A 4NA8A 1FONA 2STAE 1Y5UT 2ZI2H 1S84A 3SNBA 1O3CA 2P3TB 2GDDA 1C5UA 4DURA 3LGVA 1NM6A 1GJ7B 1ESBA 1SOTA 1T8LA 4K8YA 3MOCA 2AGIX 1O3IA 2XCNA 4QT8C 4IC5A 2BQWB 3RXRA 2UUKB 1S83A 4UFGH 2IJOB 1S6FA 4IC6A 4YZUA 3OY5U 2F3CE 1A5HA 1GHBG 1NRSH 2IOTA 2F9VA 4UONA 4D76A 3B9FH 1PQ8A 2ZFSA 2W5EA 1TRYA 1SGFA 5A09A 1FV9A 3MYWA 4X6PA 2SGPE 3RXBA 2QXGA 5TJXA 1ZGIA 1GJ5H 1QIXB 1K2I1 2BDBA 1YCPH 2JETB 1MZAA 3A8DA 4Y11E 1VGCB 2FODA 1DWBH 1Y3VA 4CR9A 1GMHF 4NIXA 3TJUA 3LT3A 5F8ZA 2Y5HA 1HJ9A 1SB1H 1BRUP 3UY9A 4IMZA 1H9LB 4AX9H 1OSSA 3FVFB 2XC0A 3PLKA 3SNDA 2CHAC 3ZZ5A 4JZ1A 3QUMP 4TWYA 2VGCB 1HAVB 3KHVA 3PWCA 4E7RG 3SBKA 1KY9A 3TU7H 1O5EH 1C1PA 2Z3EA 1A0LA 3V12A 1W2KH 4ABBA 4NIYA 2FZZA 3U1IB 1Q2WA 4VGCB 1C1SA 2Y5FA 1CHGA 4JCNA 2VINA 3ITIA 2D26C 2SFAA 2GDEH 1EOLA 3LH1A 1O5GH 5DP8A 3BV9B 3RU4D 1G30B 1EQ9A 3VB5A 4O97A 3IWMA 1DE7H 4YLQH 2THFB 4XBCA 4HI3A 1CGJE 2EC9H 3M35A 3QDZB 4CH2B 3LU9B 4MNWA 3GY5A 1P9SA 2BD8A 1ESTA 1C5OH 1QA7A 3GCHC 4K1SA 5DP9A 5F8XA 1S81A 1GMDG 1UTOA 1ELBA 1EUFA 1WCZA 6GCHG 1O2SA 5EQSA 1QA0A 2BVRH 3OU0A 2ZGHA 2XC4A 1F0SA 1O2QA 3RXDA 5ESTE 1G9IE 1O38A 1FUJA 4JK5A 1YCPK 2WV4A 1CA8B 1PYTC 3P6ZB 3BTME 4D7GA 4NA9H 4ZHLU 4ABEA 2CHAB 4NG9H 1S82A 3ENSB 1DPOA 1V2PT 2ZHWH 3A88A 3ODFA 4AFQA 2R9PA 1LVOA 3EDXB 3NWUA 4FUBA 2GCTC 1GJ6A 3U98H 2VWOA 1AE8H 3BEUA 5LH8A 3P8GA 1MCVA 1UO6A 3P70B 3RXUA 2WPJS 1UTNA 1CO7E 1RTFB 2ANYA 2ZFQH 3UOPA 1SGTA 1G37A 1ABJH 1OWJA 1U6QA 2GD4B 4JYTA 5SGAE 2NU0E 3BIVH 3IITA 1TBZH 2BXTH 4INKA 3M5LA 3QN7A 2ZIQH 4BAMB 3BSQA 5GCHF 5L6NH 3S0NA 1TNIA 4UD9H 4YESB 3RLWH 1HAXB 3FP6E 3AW0A 3SU3A 5A8YA 1MKXH 3ZZBA 4A5TS 2LPRA 1EAXA 4AN7A 3GDUA 3VB4A 3NZIA 2QA9E 1GBLA 1TE0A 2SGQE 1V2VT 4IW4E 4ZHAA 1JMOH 5G4BA 4AFUA 1W14U 2BMGB 3SO3A 1ACBE 1AZZA 5JBTA 1D3PB 3FAOA 2ANWA 2G52A 1PPHE 4MNVA 3AVZA 3ZZ7A 3ZVCA 1C5PA 1BOQA 1XUIA 2BHGA 1JWTA 2W26A 1E35B 3UQOA 1SGIB 1AY6H 3STJA 4UFFH 4CBNA 2ZKSA 3ZZ8A 5I25A 1A5GH 1UMAH 1YPMH 3A8AA 4YTAA 3TPIZ 2YOLA 3K65B 2GCTB 3SGQE 1WYKA 1K9OE 1OWEA 1QB6A 5JB8S 1F5KU 1MD7A 2P94A 3M37A 3P17H 4Y7AA 4BOHA 4MPVA 5DPAA 5FX5A 1HAYB 4B74A 2BLWA 1D9IA 4IN1A 1UVUH 3RXHA 1HAGE 2NU3E 3ODDA 3SZNA 2GCHF 1EAIA 3A7WA 3TLOA 4ZKOU 2QCYA 3TH2H 1C4V2 1W12U 4JZDH 1F7ZA 1O3PB 3KQDA 1DM4B 1DUAA 1HRTH 1UK3A 1QBOA 1AFQB 1C1UH 1CHOF 2QXIA 1MTVA 4FUGA 1THSH 5GJ4B 1MU8B 1WTGH 2CJIA 1ZRKA 2BXUH 1MKXK 4WXVA 4GLYA 2VIQA 1MQ6A 1IQKA 4K1EA 3TJVA 1AUTC 1VJ9U 2WPLS 5IYTA 1AI8H 2CF9H 1C2DA 1ELDE 1SPJA 3SU6A 3TK9A 1TGBA 1PQ7A 2OC0A 3RMNH 4HZHA 3URCA 4YT7H 2Z3CA 1O3KA 1MBQA 3F9GA 4I8GA 4Q7YA 1NT1A 5DG6A 2FWWA 6ESTA 2O8UA 5JB9S 1TRMA 2C8YB 1V2ST 2ZA5A 3EA7A 2QIQA 3HK6B 1AMHA 2BY8X 3SNCA 1KXDA 4JK6A 1Q3XA 1AHTH 1SQTA 3RXGA 1G32B 2ZFTA 1TGNA 2C8XB 2ZPSA 3MO6A 3SUEA 1S5SA 3OTJE 1SI5H 1GJ8B 4WH8A 3F9HA 1V2TT 1ZHMA 1C1OA 2P3FH 2I6SA 1EB2A 2BOHB 4ZKNU 3A89A 4IGDA 3HK3B 1BRBE 1IQNA 2ZU4A 5HXFA 1P01A 1TPAE 2OLGA 1UJ1A 2ZF0H 1K1JA 1E0FD 2XC5A 4NGAH 2VVCA 2F91A 3M36A 4ISIH 3W95A 1Z8GA 4UEHH 4X1QU 1P2MA 1HXEH 2C3SA 4MNYA 2FOBA 2K1QA 2Z9KA 2A5AA 1JBUH 4I8LA 2TGDA 1V2RT 3FZDA 2F9PA 1O5DH 2ZHDA 3HPTB 2WV5A 1W0ZU 1ABIH 2BOKA 4CREA 1HXFH 4B73A 1QRZA 4LZ4B 3URDA 1IQHA 5HGGA 4LXBH 5F6MA 4YLUA 2AIPA 1C2JA 4H42U 4U01A 1DLEA 2Y7XA 3FP7E 1SGRE 1MUEB 3D49H 3PMJA 3LIWA 2KAIB 4WJG2 3RXMA 3DFLA 1ELAA 1QJ7B 1LQDB 1HAPH 2BLOA 1SC8U 5HM9A 4SGAE 1Z8JB 2VH6A 3U69H 1UTPA 2BD3A 1V3XA 1O35A 5DO4H 1QQ4A 1SGQE 4A1VA 1C1VH 1FN6A 1GHBF 4K60A 3GY8A 3QGNB 4ABDA 4B1TA 3LGIA 1RD3B 2SNVA 1YKTA 1LPGB 2UWPA 1H9HE 4K5ZA 2FP7B 1SGCA 4HGCA 2DE8A 2PR3A 1A3BH 3F6UH 1BRAA 2G4TA 1O2OA 2BZ6H 1C2GA 1WQVH 1ZLRA 1EOJA 1FXYA 3SQEE 2W7UA 3A81A 1BHXF 1OYQA 1INCA 3L6PA 4ZUHA 3MTYA 2GKVE 2FOAA 2VH0A 4OGYA 1GJDB 3RC5A 2Z9GA 1WQSA 3AAUA 4Y0ZE 1ELEE 4A6LA 1A0JA 2JH0D 1O2NA 1A0HB 2FYRA 5JYIA 3OYPA 4TY7A 1IQGA 4FUCA 1LVYA 1SGFG 2PLXA 1UTKA 3U9AH 2FEQH 1C9PA 2RCEA 1EP5A 2HPPH 4HFPB 3UWIA 2AS9A 2A7CA 4WY3A 1NFUA 2FOGA 3UNQA 5LGOA 4X8SH 5AHGH 2B9LA 1DWEH 1L4DA 3RXLA 1TX7A 4AYVB 1H8IH 1PPCE 1T8OA 2VWLA 2ZP0H 3HKIB 1PPFE 1P2JA 3M3VA 4O3TA 2ZU1A 4TPYA 2IPHA 1VJAU 2GV7A 5EOKA 3SGBE 5A8ZA 1F2SE 4AGJA 1TX6A 1OX1A 2BY5X 2P8OC 2PTCE 2TBSA 1GI3A 1AQ7A 1ETTH 1KTSB 1BDAA 4IN2A 1O2YA 2XWAA 3M5NA 1BMMH 1B0EA 2ANMH 3T5FH 2ZGXH 1V2MT 3VEQB 1BTUA 1YGCH 2OC7A 1C9TA 1NRPH 7KMEH 3TK6A 1VITF 3BIUH 1SGEE 4NZQA 3B23B 5PTPA 1MCTA 1YLDA 5HYOA 4ABJA 2FI5E 3SUDA 1SGNE 1QY6A 1FQ3A 1P2QA 1TFXA 1NO9H 2FXRA 4ASHA 2A31A 1N8OB 2ZU3A 2PHBA 3BTDE 1MKWK 5JPMH 2FIRH 1XM1A 1A61H 1GWAA 1ZOMA 3H7TA 1C1NA 3VPKA 2Q6FA 1OP8A 2PKSB 4ZAEA 1AB9C 2RG3A 3L3TA 1TMUH 2WUBA 3MU0A 4GAWA 1RRKA 1KXBA 2XBWA 1O2IA 1GMCG 4SGBE 2Z3DA 3FANA 3BTGE 4B2AA 1BHXB 1ANBA 1O3NA 1ZYOA 2V35A 2BD5A 3E16B 3BTWE 4AB8A 3V7TA 3A87A 3K2UA 5T3HA 2FLBH 1DICA 1P2OA 2FX4A 1BIOA 2QYIA 3RXAA 1GBTA 5DK1A 2F9NA 2G4UA 1BZXE 2Z9LA 3Q3KA 1AGJA 3PWBA 3OY6U 3QLPH 2WYGA 2A4OA 3LC5A 3ZZ4A 4X1SU 1GI0A 2HNTF 4Y6DA 3EAJA 2NU4E 2ZCHP 3BF6H 2ESTE 2AMPA 1OWIA 2JETC 3RXIA 2FS9A 1W8BH 1P02A 1VGCC 1MAYA 2ZQ1A 1HLTH 2A1DB 3Q3YA 4RN6A 1K1LA 2A0QB 1AE5A 4TPIZ 5T6DA 2BVXH 2OUAA 1FPHH 1C2HA 1QJ1B 5DJ7A 3DHKH 1BJUA 5EW1H 3QK1A 1SLUB 3MO9A 3RMLH 2WPHS 4ZXXH 3UQVA 3PYHA 3TGIE 3RXPA 2VGCC 1W13U 4I31A 4CR5A 4DJZB 4B2CA 1ARCA 3VB7A 4MPWA 2GGVB 1BTPA 4Y10E 3ZZDA 4VGCC 4BXSA 5CMXH 1TPSA 3ZV8A 4FUEA 2G8TA 1YPHC 4HTCH 1GG6B 1GBBA 1VITH 1RGQA 1BMNH 1NRRH 3A7ZA 5AVDA 2ZGCA 1NY22 4WF8A 1C2MA 4H6SB 2Z6BD 3M3TA 4OS6A 3RU4T 2V3OH 4FU7A 3A8BA 2Y7ZA 4YOIA 2BZAA 3PO1C 1GBCA 1BTXA 3S7KB 1TNGA 1O3BA 3M7UA 4JYUH 1ZR0A 2AERH 1AD8H 4GVUA 1CGIE 2CGAA 4CH8B 1P10A 3I78A 5DP7A 2GZ8A 3NPSA 4NZLA 2SGAA 3DA9B 1LVMA 3ZVEA 4FUDA 4O9VA 1LMWB 1GDNA 3ATLA 3SJKA 2PWXA 2AH4X 1C5TA 1UCYH 2Z94A 3GY6A 4Y79A 1PQ5A 1AN1E 2BD7A 2UUFB 1BQYA 2AMQA 1Y3WA 2QF0A 1DWCH 3RXSA 1W10U 1ZZZA 4Y7BA 1O2PA 3PB1E 1HJ8A 3GY2A 3P8FA 2ZWLH 4MTBA 1GBKA 1TNJA 1ELFA 4WMFA 1EAWA 1AU8A 4MPXA 3LJJA 3E91A 3SW2B 2O8TA 2PW8H 3TJOA 4BAKB 3MWIU 4MLFB 3HATH 3TH4H 1LHDH 1Y3UA 4OS2A 1T8NA 2KAIA 3E8LA 5GDSH 4DCDA 1GI2A 4NFEA 5FPSA 3LDXH 1BCUH 3RC6A 1H1BA 1LTOA 2EEKA 1HIAA 5L2YH 3G01A 1RJXB 4I8KA 1IHSH 1C1TA 1VCWA 1GI8B 3PO1B 1JRSA 1MD8A 1P57B 4KELA 4FUIA 1O5AB 4X0WU 1L2EA 1ZTJA 4X2WA 1BUIA 1L1GA 2LNCA 4A1XA 4TYDA 3RXVA 2OC1A 1SGPE 1Z1IA 3MNBA 5C5OA 1F5LA 2PSYA 3D65E 4GCHF 3ZZAA 3BG4B 9LPRA 3QX5H 2JKHA 3PMAB 1RTLA 3M5OA 2ODQA 2JH6D 4DT7B 1OP2A 1V2OT 1Z7KA 2AMDA 3K9XB 3QGJA 4U2WA 2HOBA 2H9HA 4BTIB 1BT7A 1FY3A 1GI5A 3GCTG 2WPKS 4Q7XA 1P09A 3RMMH 1O39A 4NIWA 1N6XA 5E2PA 2QY0B 3T28A 4I33A 2TRMA 1ZMJA 1PFXC 2J92A 4CRDA 1LDTT 1TA6A 5EQRA 1CA0B 3TH3H 2HLCA 4X2YA 4ABIA 5C3NA 1CGHA 3MU5A 1WUNH 1K28D 2BB4A 1Y59T 1BMAA 4ZKSU 1DX5M 1SR5C 1WOFA 2A2XH 3GCOA 4LOYH 4XBBA 2V6NA 7ESTE 1BBRE 3U1JB 5HM2A 1XMNB 1MTUA 1AFQC 2A7HA 2W7SA 9ESTA 2ZGJA 1SLVB 2WYJA 5C1YA 1T7CA 2BDAA 1BRCE 1GBHA 1J16A 4FU8A 2SGFE 1PPZA 3RMOH 1A2CH 1FAKH 1A5IA 3KIDU 2AGGX 1LPKB 2YNBA 5EXMA 4MG3A 2DUCA 5L2ZH 1A1RA 2ZTXA 5J4QA 2VIVA 2OD3B 1QB1A 1NESE 1NRQH 1O3OA 1HAIH 1N1LA 4F4OC 1P2NA 1E34B 2TGTA 3HGNA 1EZUC 1O2ZA 1EASA 2OTVA 1LHCH 1PPGE 1QL9A 1C2EA 2D8WA 1ETSH 4KTUA 1G2MA 1TAWA 4J1YA 2BDGA 4E7NA 5E8EH 5LPFA 5AF9H 2H5DA 3ZZCA 3RXOA 4DY7B 1P2IA 1EZXC 4MNXA 4OGXA 1UTJA 1GBFA 4A92A 3WY8A 1K1IA 1BTHH 1THRH 4UFDH 1HJAB 1NC6A 2VVVA 1TA2A 2ZHEH 5A0CA 2BY9X 1TPPA 5F8TA 3RLYH 4NSVA 3SN8A 1N6YA 2EA3A 5JBAS 4Z6AH 3FZZA 1ZMNA 1NFWA 1BA8B 1J17T 2ZU5A 1W0YH 1DANH 1TGCA 1OP0A 2BDHA 4WMDA 3SV9A 4AG2A 4D9RA 3UR6A 6CHAB 1KYNA 5T6GA 4CRGA 1BTYA 1ZGVA 3CS7A 1O37A 3V13A 1O3JA 2C4FH 1LQEA 1S6HA 2PTNA 3D62A 4Y8XA 3S9CA 4R8TB 1XUGA 5DP5A 3C1KA 1G36A 1BJVA 2O8LA 4DIIH 3PMHB 2EI8A 2FI3E 5C67A 1UK4A 3U8OH 4YOGA 2VWMA 3LPRA 2BY6X 3SU0A 1ZSKA 8GCHF 1SOZA 3S9AA 5CHAB 1QFKH 2FOHA 3C27B 2ZC9H 3A84A 1ELVA 3M7QA 1KDQB 1VZQH 2XNIA 4E06H 4ZH8A 3QTOH 3NK8A 2TGAA 1LO6A 1YLCA 2ODPA 3A86A 1EZSC 1BMLA 1NROH 5BRRE 2AEIH 2CF8H 2BVSH 2V3HH 1W11U 4K1TA 1F92A 1PJPA 3VGCC 1ANDA 1WSSH 3P95A 1O3EA 1BBRH 2WPMS 4FUFA 1C2FA 1FAXA 2GTBA 2ZECA 7GCHG 1TX8A 2G55A 1MTSA 1TOMH 1F5RA 4CRFA 2A7JA 2XYAA 1O3LA 4OS5A 2O8MA 1XXDA 1YYY1 1KLTA 4BAHB 1IOEA 5BPEA 3VB6A 2V0BA 1AFEH 4KP0A 4I8JA 3SHCH 1OWKA 1QJ6B 4AGKA 3T62A 1TOCB 1HIAB 2VIWA 1E38B 1UVSH 4UE7H 3LH3A 4ZROA 2FO9A 1GHVH 1MZDA 4H4FA 2FTLE 3SGAE 1P11E 2R2MB 4M7GA 3KQBA 1WV7H 3U8TH 1DXWA 1GHZA 4GHTA 1FY8E 1O2LA 1O3MA 2FLRH 2OINA 1GBDA 4OS1A 1NFXA 1V2QT 1LHGH 3SV6A 2FS8A 3VGCB 1BB0B 1RTKA 1GI4A 1GHXH 3T26A 1TPOA 3T27A 5F03A 3KNXA 2PUQH 2HGTH 3P8OA 4JZEH 3BTKE 2H6MA 1FLEE 2QXHA 1DOJA 1T31A 3KCGH 3EA9A 3TJNA 3ATMA 2H5CA 3B8JA 4I7YH 1EJNA 4XBDA 5C5NA 5LPEA 4Y76A 4CHAC 1NRNH 1GVKB 2C90B 2QC2A 3UTUH 2VNTA 1ANEA 1KXFA 1SLWB 1GI7B 2GMTB 5T6FA 2GT8A 5HMAA 2FDAA 3RC4A 2UWLA 3AASA 5GCHG 4GUXA 1VR1H 2NU1E 3RXTA 4X1RU 2TPIZ 4Z0KA 4X1PU 3MNSA 1ZPZA 3EA8A 3RXFA 1FY1A 4RKJB 3SNEA 1P0SH 4PROA 3A80A 2H2ZA 1TALA 3SV7A 4UDWH 3TVJB 1E37B 1QGFA 2J4IA 1N8OC 3STIA 4NCYA 1GCDA 3A83A 1Z6EA 3IG6B 1GHWH 2D2DA 2PKSC 4X6NA 1O3DA 2A45B 3ZZ3A 5H4IB 5EGMA 1W7XH 4DG4A 3ELAH 4I32A 4JMYA 1JIRA 1GBAA 3E90B 2DE9A 3RXCA 5LPRA 2R0KA 4FVDA 1SQAA 3CENA 5DP6A 1O2TA 5ESBA 5FHTA 1QQUA 1S0RA 4KKDA 3MU4A 1TBQH 1GMDF 1D3QB 1ZRBA 6GCHF 1GJBB 3A7TA 4CHAB 4AFZA 1RS0A 3SU1A 2J34A 2B0FA 3MFJA 1RIWB 3KQEA 1YBWA 3UFAA 1D6RA 1QTFA 1Y3YA 1KSNA 2GCHG 3M3SA 1O2XA 1Z8IB 1OXGA 1A3EH 1DVAH 2Z9IA 1ESAA 3DT0H 5JBCS 2XXLA 2A4RA 1SGYE 4J2YB 3RDZA 1QL7A 4OS4A 2FMJA 4Q2KA 3UWJH 5JDUB 4TWWA 1CHOG 1RFNA 1TGTA 4IBLH 1UCYE 3LGUA 1EKBB 1B5GH 3BTQE 4B2BA 1KLIH 1ZHRA 3LC3A 2QF3A 2G5VA 2ULLA 4FVBA 2D1JA 2M5TA 2HPQH 1NU7B 4WWYA 1DSUA 1AKSB 3GYMA 4FXGH 2BQ7B 1GBJA 1HV7A 1YPLH 2A5IA 1C1WH 3SNAA 3T2NA 4K8BA 1SL3A 3ZV9A 3GOVB 4JZIA 1EPTB 1QR3E 1HAZB 3KGPA 5GWZA 1ZMLA 2BX3A 1QBNA 1ZJKA 1LKAA 1HPGA 2ALVA 1TLDA 5GIBA 3SHAH 2HNTE 2XTTB 1XVOA 2Z9JA 3EE0B 5GXPA 4Q7ZA 1EJAA 2GX4A 1O31A 1XUKA 3E6PH 1GG6C 2H9EH 2RA0A 1TNLA 3MU1A 3TITA 5C2ZA 3K6ZA 3NUMA 2HWLB 1AIXH 1HCGA 3ZZ9A 1KLJH 2R3YA 3PTNA 2J2UA 1C5NH 1DT2A 1P9UA 2A4GA 1XX9A 1B7XB 3KL6A 1SBWA 3TIUA 3GCNA 3SORA 2Y82A 2ZHQH 2W3IA 3NCLA 4ISHH 1CBWC 3F68H 1FI8A 4Y8ZA 4ISNA 1AWFH 2GZ9A 4ISLA 4CRCA 2PKAB 1L0ZA 3A82A 3SUFA 4BTUB 2FOFA 1C5MD 1MTWA 1LKBA 1UK2A 3EYDA 2AGEX 1JOUB 1EB1H 1D3DB 1G3DA 1IQJA 1O3HA 1CSOE 1FY4A 8KME2 2ZQ2A 1W7GH 2VIOA 3ZVDA 4AORA 2QGRA 1V2KT 3LJOA 2ASUB 3OX7U 3GY3A 1O3FA 4RSPA 3Q76A 1EXFA 4LK4A 1IAUA 2HNTC 3K6YA 1ANCA 1GL1A 3M61U 2BTCE 1W3CA 3BTTE 1NN6A 1KDQA 1LHFH 1DWDH 3LGTA 2ZDKA 2UUYA 3GDSA 3LKWA 3RUOA 1UVOA 4B76A 1H4WA 1AVGH 1CBWB 1HB0B 2ZDLA 3ZVAA 1G3CA 4I8HA 3MHWU 1GJ9B 3BEFB 1IQLA 2CXVA 1O3GA 1O0DH 3PMBB 1H8DH 1O5CB 3SUGA 1P2KA 3N7OA 1P03A 2PGQB 2Q1JA 4ABAA 4K69A 2OBOA 1FJSA 3VB3A 2A4QA 3BG4C 3BTHE 5IDKA 1KXCA 2ALPA 1CVWH 2I6QA 1DY9A 1GGDB 1DY8A 3Q3XA 4YOJA 2TGPZ 2FOMB 1J15A 2VU8E 1MTNB 1TGSZ 5FBIA 1DDJA 3RXQA 2ZCKP 4ABFA 2OC8A 1GBEA 2ZDNA 3ATWA 4AZ2B 3AW1A 2CV3A 2BYAX 3ZYEA 1O2KA 4YT6H 2VJ1A 1DITH 1GHAG 3A7VA 3ZVBA 3SV2H 2AYWA 4DW2U 1NZQH 1CA0C 4KGAA 2ZTZA 4X2XA 7GCHF 5FPTA 3GY4A 3MU8A 1K1PA 1CT2E 1EATA 1O33A 1O5FH 1DFPA 1GPZA 1PPEE 1CQQA 7LPRA 1UTLM 3MNXA 2G81E 2ZPQA 3LONA 3KQCA 4A1TA 1T4UH 3PV4A 2C8ZB 3H7OA 4H6TA 1TIOA 3HGPA 2P3UB 1BTZA 1FPCH 1V6DA 1DXPA 3Q77A 1F0UA 1V2WT 1ID5H 4ZMAH 3PTBA 1OOKB 4CBOA 1C1QA 1VCQA 3V0XA 5I46H 1UHBB 2YNAA 2ODYB 2GP9B 4ABHA 1SVPA 1NS3A 3QZQA 3RXJA 5L30H 1L1JA 3TNTA 2RA3A 1DSTA 3KN2A 1YM0A 5A0BA 1HBTH 1O2WA 4FUHA 2NU2E 2VIPA 1AWHB 1UCYK 1ZPCA 5FBEA 3T25A 2AFQB 3TNSA 1VITG 3O8DA 1P12E 4NWKA 1MU6B 2C93B 1SMFE 5C1UA 1EAUA 1X7AC 1AUJA 4U32A 5EW2H 4D8NA 1P06A 1QRWA 1TYNA 4Q80A 4X2VA 5ABWA 1HJAC 5E0GA 3AAVA 3UNSA 2J9NA 1HDTH 4BAQB 1WAYB 2GVFA 4AOQA 1D6WA 3HKJB 1SHHB 4DVAU 2P16A 1YPEH 3W94A 1CU1A 1V2JT 4AB9A 4IMQA 5AFYH 3EGKH 4X1NU 2OQUA 2BDYA 2PFEA 3SJOA 3BTFE 1FN8A 2PSXA 3QTVH 4O3UA 3GCHB 6CHAC 2HALA 2ZNKH 3SQHE 3PM3A 1TBRH 2FX6A 1LVBA 1UVPA 1V2UT 2ZFFH 4AG1A 4A7IB 2FOCA 2Y6TA 1V2LT 2TIOA 4Y8YA 5TCAA 1YPGH 2B5TB 1K1OA 1WTHD 4KTCA 3E3TA 1ORFA 1NPMA 1C2IA 2VIDA 2B7DH 1C4U2 2A2QH 1CT4E 3GY7A 2F83A 4R0IA 3QZRA 4WXIA 3PLPA 4XE4A 1FMGA 5CHAC 1L4ZA 2O9QA 1QURH 1C2KA 5FX6A 2XCFA 1UVTH 1C5WB 1E36B 1G2LA 1TQ7B 4NA7A 5EXNA 1ELTA 2ZGBH 4X8VH 5DKMA 3SI3H 2IN2A 3P8NA 3U8RH 8ESTE 5ETXA 1GDUA 1DUEA 1TNHA 1XUHA 1OPHB 2R3UA 1QL8A 4XSKU 4CRBA 2HRVA 4UFEH 3RU4E 3ESTA 3O8CA 3A7XA 1A4WH 1SGDE 2R2WU 5DP4A 4D7FA 1GCTC 1MH0A 4Y71A 2Z7FE 3ATKA 2ILNA 1SQOA 3VXEH 3KF2A 1Z8RA 4U30A 4OS7A 1AKSA 1OWHA 3SV8A 3TK5A 4YM9A 4ESTE 3SI4H 3R0FA 1EPTA 2BD9A 3SU4A 4XOJA 3S69A 2ZG0H 4NFFA 1C5XB 1GI1A 1TMBH 2ZDAH 1LPZB 1THPB 2WINI 3M5MA 2BQ6B 1DS2E 3M7TA 1L1NA 2F9UA 2ZDMA 1ZTLA 1D4PB 4GHQA 1GBIA 1C5ZB 2VWNA 5EPNA 4INLA 3V3MA 2BLQA 4X6OA 4DOQA 3QO6A 2ZZUH 1M9UA 3RP2A 1GMCF 1BTWA 2VVUA 5JBBS 2XBXA 1TONA 1TRNA 2Y81A 1J8AA 2EI7A 5DP3A 2A5KA 2QXJA 3SOSA 1WBGB 2BD4A 3LGYA 4TY6A 4E05H 4JZFH 1GMHG 3UOUA 2R0LA 3OSYA 4F49A 5K7RA 4LZ1H 2ZTYA 3UNRA 2WPIS 1O2GH 1FZZA 2ZPRA 3CP7A 1GCTB 1P04A 3E0PB 3T29A 1AVWA 5C1XA 4MQAA 1SHYA 2PKAA 1C2LA 2PGBB 3P92A 5FAHA 1J14A 2JH5D 2BY7X 2G5NA 2G51A 3GYLB 1KXAA 1TABE 1JRTA 1SG8B 4BXWA 4BAOB 1IQFA 2GMTC 1ZSJA 1P8VC 2QAAA 1UTQA 1FDPA 4INHA 1TMTH 1T8MA 4GSOA 2ZFRH 3ZZ6A 1XKAC 1C5RA 2SGEE 2UWOA 2GV6A 2J94A 2OXSA 3F9FA 4MVNA 3RM2H 3NXPA 1FIZA 3UREA 2ZO3H 3D23A 2Y80A 3VFEA 1QHRB 2ZU2A 2OP9A 1C5LH 2XW9A 1YF4A 2FESH 1IQEA 2FOEA 2XRCA 2FI4E 2EI6A 1O2HA 2OQ5A 1K1NA 1O2VA 3ZVGA 1P3EA 1QNJA 2RDLA 3SU5A 5B6OA 3JZ2B 3MH6A 3S9BA 5FPYA 1BITA 1HUTH 5EG4A 1ZSLA 4NSYA 1ZHPA 2P95A 2GT7A 3EQ0H 3UIRA 1EX3A 2W3KA 4GCHG 1Z71A 3KEEA 1WU1A 4X8UH 1HYLA 1OKXA 3LGWA 5AFZH 5EU8A 1HAHH 3LOXA 1MBMA 3A7YA 1ARBA 3DFJA 1D3TB 1QCPA 1EP6A 1UTMA 6LPRA 1MMJN 1BBRK 2H1UA 1EZQA 2XWBI 1YP9A 1P3CA 2J95A 1ZTKA 1K1MA 1SFIA 1MAXA 1RIWC 2C8WB 4D9QA 3BN9A 1CE5A 2Y5GA 5E2OA 1JIMA 2FYQA 1XVMA 4X8TH 4ABGA 1HAVA 3GICB 4XDEA 5EXLA 1GVZA 2CN0H 3F9EA 1ZJDA 1Z1JA 2OCVB 3A85A 1GI6A 4WMEA 1LHEH 1TQ0B 2WUCA 4WVPE 5E0JA 3SJ8A 5A2MH 1JXPA 1MQ5A 3MH7A 1O3AA 1ZPBA 2Q6DA 3VXFH 3RXKA 1TB6H 3SU2A 1O34A 1FNIA 5FCRA 1S85A 1Q31A 1DLKB 1MKWH 1CT0E 2F9BH 1YPKH 1GHAF 1O36A 1O2UA 3CS0A 1XUFA 1ETRH 3H5CB 2CMYA 1YPJH 2ZDVH 4GPGA 2PUXB 3PROA 1ELGA 1XKBC 1Y5AT 1C1RA 1O2RA 1UHBA 2P93A 5TCCA 2OBQA 3TGJE 2QN5T 3FFGA 3E0NB 3I29A 2QV1A 1C5VA 1GDQA 3RM0H 1EPTC 1VCPA 1KIGH 1YC0A 2ZCLP 1A46H 1HNEE 1T32A 1IHTH 3RXEA 1AVXA 2ZFPH 5A0AE 4YO9A 1PQAA 4MPUA 2NWNA 1Y8TA 5E0HA 3GDVA 2BDCA 3MI4A 1SLXB 5FXLA 1C4Y2 1ELCA 2BM2A 1V2NT 4NWLA 1XXFA 3R3GB 4DIHH 1GJCB 1P05A 3I77A 5A8XA 3F1SB 4K3JA 1NFYA 3NKKA 3SJIA 3UR9A 2UUJB 4XFQA 4X6MA 3BTEE 5EQQA 2G00A 4CRAA 4Y0YE 3FP8E 1OYTH 1GL0E 1YCPM 1SSXA 4FUJA 3Q00A 4JYVH 1GBMA 3GCTF 4O03A 1XUJA 1C5YB 5EPYA 2O8WA 2SGDE 4K2YA 1Y5BT 2BDIA 1KXEA
chains in the Genus database with same CATH superfamily
5J4SA 5CE1A 8LPRA 2WHXA 4THNH 4BANB 1EJMA 3DUXH 1F0TA 4NIVA 1QB9A 2P59A 2FM2A 1TNKA 1B0FA 5DGJA 4ZXYH 3GS9A 3W1EA 2PV9B 4AFSA 1GJ4H 1GVLA 4BTTB 1RXPA 1C1MA 1SFQB 2XBVA 1J9CH 1PYTD 4MDSA 3ZVFA 1OWDA 1Y3XA 2J38A 1LCYA 1T4VH 1FY5A 1TWXB 1H9IE 1QBVH 1FIWA 4M9FA 3GISB 2V7QD 1AZ8A 2AIQA 1OS8A 1HAOH 3TGKE 2ZHFH 2F9OA 2SNWA 3BEIB 3MMGA 1O32A 8GCHG 5FCKA 4IS5A 1HGTH 1O5BB 1HFDA 3QWCH 3MH4A 1C5QA 3UUZA 3O8RA 2GZ7A 2H9TH 4OM9A 1NTPA 1NU9A 1IQMA 2HVXA 1AO5A 2ANKH 2P8OB 3BG8A 3E1XB 1YPHE 4AYYB 1O30A 3O8BA 2A32A 3L33A 3ATIA 4B75A 3MNCA 4BNRA 2LP6A 1GJAB 1K22H 3JZ1B 2F43B 3MO3A 1K21H 1IQIA 1YWUA 1O2MA 5K0HA 3UPEA 1NBME 2XBYA 4RKOB 5EODA 4ISOA 1F0RA 3S7HB 4WH6A 2BX4A 1G3BA 4DGJA 1PPBH 2BLVA 4ZKRU 1O2JA 3ZYDA 3N7EA 1A7SA 3SJ9A 4FU9A 3A8CA 3PLBA 4B71A 2STBE 1G3EA 5C20A 5GPIB 1GHYH 1KTTB 1Z6JH 4KTSA 2Q6GA 1GGDC 3UB0A 2FTMA 2B8OH 1S0QA 1AB9B 2BD2A 1MTNC 2FPZA 1QRXA 3DD2H 1GI9B 1C5SA 2ZEBA 2VB0A 4ZHMU 3MH5A 4NA8A 1FONA 2STAE 1Y5UT 2ZI2H 1S84A 3SNBA 1O3CA 2P3TB 2GDDA 1C5UA 4DURA 3LGVA 1NM6A 1GJ7B 1ESBA 1SOTA 1T8LA 4K8YA 3MOCA 2AGIX 1O3IA 2XCNA 4QT8C 4IC5A 2BQWB 3RXRA 2UUKB 1S83A 4UFGH 2IJOB 1S6FA 4IC6A 4YZUA 3OY5U 2JJ1D 2F3CE 1A5HA 1GHBG 1NRSH 2IOTA 2F9VA 4UONA 1E1RD 4D76A 3B9FH 1PQ8A 2ZFSA 2W5EA 1TRYA 1SGFA 5A09A 1FV9A 1BMFD 3MYWA 4X6PA 3OEED 2SGPE 3RXBA 2QXGA 5TJXA 5EJ1A 1ZGIA 1GJ5H 1QIXB 5CDFE 1K2I1 2BDBA 1YCPH 2JETB 1MZAA 3A8DA 4Y11E 1VGCB 2FODA 1DWBH 1Y3VA 4CR9A 1GMHF 4NIXA 3TJUA 3LT3A 5F8ZA 2Y5HA 1HJ9A 1SB1H 1BRUP 3UY9A 4IMZA 1H9LB 4AX9H 1OSSA 3FVFB 2XC0A 3PLKA 3SNDA 2CHAC 3ZZ5A 4JZ1A 3QUMP 3EE7A 4TWYA 2VGCB 1HAVB 3KHVA 3PWCA 4E7RG 3SBKA 1KY9A 3TU7H 1O5EH 1WDIA 1C1PA 2Z3EA 1A0LA 3V12A 1W2KH 4ABBA 4NIYA 2FZZA 3U1IB 1Q2WA 4VGCB 1C1SA 2Y5FA 1CHGA 4JCNA 2VINA 3ITIA 2D26C 2SFAA 3UAIC 2GDEH 1EOLA 3LH1A 1O5GH 5DP8A 3BV9B 3RU4D 1G30B 1EQ9A 2L74A 4O97A 3VB5A 3IWMA 1DE7H 4YLQH 2THFB 4XBCA 4HI3A 1CGJE 2EC9H 3M35A 3QDZB 4CH2B 3LU9B 4MNWA 3GY5A 2KCAA 1P9SA 1ESTA 1C5OH 1QA7A 2BD8A 2LELA 3GCHC 2YMSC 4K1SA 5F8XA 1S81A 1GMDG 1UTOA 1ELBA 1EUFA 1WCZA 6GCHG 1O2SA 5EQSA 1QA0A 4ACBA 3KYFA 2BVRH 3OU0A 2ZGHA 2XC4A 1F0SA 1O2QA 3RXDA 5ESTE 1G9IE 1O38A 1FUJA 4JK5A 1YCPK 2WV4A 1CA8B 1PYTC 3P6ZB 3BTME 4D7GA 4NA9H 4ZHLU 4ABEA 2CHAB 4NG9H 1S82A 3ENSB 1DPOA 1V2PT 2ZHWH 3A88A 3ODFA 4AFQA 2R9PA 1LVOA 3EDXB 3NWUA 4FUBA 2GCTC 3PRDA 1GJ6A 3U98H 2VWOA 1AE8H 3BEUA 5LH8A 3P8GA 1MCVA 1UO6A 3P70B 3RXUA 2WPJS 1UTNA 1CO7E 1RTFB 2ANYA 2ZFQH 3UOPA 1SGTA 1G37A 1ABJH 1OWJA 1U6QA 2GD4B 2RDEA 3PV2A 4JYTA 5SGAE 2NU0E 3BIVH 3IITA 1TBZH 2BXTH 4INKA 3M5LA 3QN7A 2ZIQH 4BAMB 3BSQA 5GCHF 5L6NH 3S0NA 1TNIA 4UD9H 4YESB 3RLWH 1HAXB 3FP6E 3AW0A 3SU3A 5A8YA 1MKXH 3ZZBA 4A5TS 2LPRA 1EAXA 4AN7A 3GDUA 3VB4A 3NZIA 2QA9E 1GBLA 1TE0A 2SGQE 1V2VT 4IW4E 4ZHAA 4TT3D 1JMOH 5G4BA 4AFUA 1W14U 2BMGB 3SO3A 1ACBE 1AZZA 5JBTA 1D3PB 3FAOA 2ANWA 2G52A 1PPHE 4MNVA 3AVZA 3ZZ7A 3ZVCA 1C5PA 1BOQA 1XUIA 2BHGA 1JWTA 2W26A 2VBCA 1E35B 3UQOA 1SGIB 1AY6H 3STJA 4UFFH 4CBNA 2ZKSA 3ZZ8A 5I25A 1A5GH 1UMAH 1YPMH 3A8AA 4YTAA 3TPIZ 2YOLA 3K65B 2GCTB 3SGQE 1WYKA 1K9OE 1OWEA 1QB6A 5JB8S 3WWFA 1F5KU 1MD7A 2P94A 3M37A 3P17H 4Y7AA 4BOHA 4MPVA 5DPAA 5FX5A 1HAYB 4B74A 2BLWA 1D9IA 4IN1A 1UVUH 3RXHA 1HAGE 3H09A 2NU3E 3ODDA 3SZNA 2GCHF 3OTPA 1EAIA 3A7WA 3TLOA 4ZKOU 2QCYA 3TH2H 1C4V2 1QZ8A 1W12U 4JZDH 1F7ZA 1O3PB 3KQDA 1DM4B 1DUAA 1HRTH 1UK3A 1QBOA 1AFQB 1C1UH 1CHOF 2QXIA 1MTVA 4FUGA 1THSH 5GJ4B 4XD7D 1MU8B 1WTGH 2CJIA 4RI0A 1ZRKA 2BXUH 1MKXK 1SQRA 4WXVA 4GLYA 2VIQA 1MQ6A 1IQKA 4K1EA 3TJVA 1AUTC 1VJ9U 2WPLS 5IYTA 1AI8H 2CF9H 1C2DA 1ELDE 1SPJA 3F2FA 3SU6A 3TK9A 1TGBA 1PQ7A 2OC0A 3RMNH 4HZHA 3URCA 4YT7H 2Z3CA 3U28C 1O3KA 1MBQA 3F9GA 4I8GA 5DP9A 4Q7YA 1NT1A 5DG6A 2FWWA 6ESTA 2O8UA 5JB9S 1TRMA 2C8YB 1V2ST 2ZA5A 3EA7A 2QIQA 3HK6B 1AMHA 2BY8X 3SNCA 1KXDA 4JK6A 1Q3XA 1AHTH 1SQTA 3RXGA 1G32B 2ZFTA 1TGNA 2C8XB 2ZPSA 3MO6A 3SUEA 1S5SA 3OTJE 1SI5H 1GJ8B 4WH8A 3F9HA 1V2TT 1ZHMA 1C1OA 2P3FH 2I6SA 2PP6A 1EB2A 2BOHB 4ZKNU 3A89A 4IGDA 3HK3B 1BRBE 1IQNA 2ZU4A 5HXFA 1P01A 1TPAE 1UJ1A 2OLGA 2ZF0H 1K1JA 1E0FD 2EQNA 2XC5A 4NGAH 2VVCA 2F91A 3M36A 4ISIH 3W95A 1Z8GA 4UEHH 4X1QU 1P2MA 1HXEH 2C3SA 4MNYA 2FOBA 2K1QA 2Z9KA 2A5AA 1JBUH 4I8LA 2TGDA 1V2RT 3FZDA 2F9PA 1O5DH 2ZHDA 3HPTB 2WV5A 1W0ZU 1ABIH 2BOKA 4CREA 4DT4A 1E1QD 1HXFH 4B73A 1QRZA 4LZ4B 3URDA 1IQHA 5HGGA 4LXBH 5F6MA 4YLUA 3DSOA 2AIPA 5T1VA 1C2JA 4H42U 4U01A 1DLEA 2Y7XA 3FP7E 1SGRE 1MUEB 3D49H 4P02A 3PMJA 3LIWA 2KAIB 4WJG2 3RXMA 4Z1MD 3DFLA 1ELAA 1QJ7B 1LQDB 1HAPH 2BLOA 1SC8U 2KCYA 5HM9A 4SGAE 1Z8JB 2VH6A 3U69H 4ASUD 1UTPA 1SKYE 2BD3A 1V3XA 1O35A 5DO4H 1QQ4A 1H8ED 1SGQE 4A1VA 1C1VH 1FN6A 1GHBF 4K60A 3GY8A 3QGNB 4ABDA 4B1TA 3LGIA 2HVYB 1RD3B 2SNVA 5C94A 1YKTA 1LPGB 2UWPA 1H9HE 4K5ZA 2FP7B 1SGCA 4HGCA 2DE8A 2PR3A 1A3BH 3F6UH 1BRAA 2G4TA 1O2OA 2KFWA 2BZ6H 1C2GA 1WQVH 1ZLRA 1EOJA 1FXYA 3SQEE 2W7UA 3A81A 3OE7D 2K8IA 1BHXF 1OYQA 1INCA 3L6PA 4F48B 4ZUHA 3MTYA 2GKVE 2FOAA 2VH0A 4OGYA 1GJDB 3RC5A 2Z9GA 1WQSA 3AAUA 4Y0ZE 1ELEE 5EIYA 4A6LA 1A0JA 2JH0D 1O2NA 1A0HB 2FYRA 5JYIA 4TSFD 3OYPA 4TY7A 1IQGA 4FUCA 1LVYA 1SGFG 2PLXA 1UTKA 3U9AH 2FEQH 1C9PA 2RCEA 1EP5A 5KECA 4F55A 2HPPH 4HFPB 3UWIA 2AS9A 2J5UA 2K0QA 2A7CA 4WY3A 1NFUA 3N99A 2FOGA 3UNQA 5LGOA 4X8SH 5AHGH 2B9LA 1DWEH 1L4DA 3RXLA 1TX7A 4AYVB 1H8IH 1PPCE 1T8OA 2VWLA 2ZP0H 3HKIB 1PPFE 1KMHB 1P2JA 3M3VA 4O3TA 2ZU1A 4TPYA 2IPHA 1VJAU 3F2GA 2GV7A 5EOKA 3SGBE 5A8ZA 1F2SE 4AGJA 1TX6A 1OX1A 2BY5X 2P8OC 2PTCE 2TBSA 1GI3A 1AQ7A 1ETTH 1KTSB 1BDAA 4IN2A 1O2YA 2XWAA 3M5NA 1BMMH 1B0EA 2ANMH 3T5FH 2ZGXH 1V2MT 1UW7A 1BTUA 3VEQB 1YGCH 2OC7A 1C9TA 1NRPH 7KMEH 2YMSD 3TK6A 1VITF 3BIUH 1SGEE 4NZQA 3B23B 5PTPA 1MCTA 1YLDA 2XNDD 5HYOA 4ABJA 2FI5E 3SUDA 1SGNE 1QY6A 1FQ3A 1P2QA 1TFXA 1NO9H 2FXRA 4ASHA 2A31A 1N8OB 2ZU3A 2PHBA 3BTDE 1MKWK 5JPMH 2FIRH 1XM1A 1A61H 1GWAA 1ZOMA 2JJ2D 3H7TA 1C1NA 3VPKA 2Q6FA 1OP8A 2PKSB 4ZAEA 1AB9C 2RG3A 3L3TA 1TMUH 2WUBA 3MU0A 4GAWA 1RRKA 1KXBA 2XBWA 1O2IA 1GMCG 4SGBE 2Z3DA 3FANA 3BTGE 4B2AA 1BHXB 1ANBA 1O3NA 1ZYOA 2KZ4A 2V35A 4FETA 2BD5A 3E16B 4ZCNA 3BTWE 4AB8A 3V7TA 3A87A 3K2UA 5T3HA 2FLBH 1DICA 1P2OA 2FX4A 1BIOA 2QYIA 3RXAA 1GBTA 5DK1A 2F9NA 2G4UA 1BZXE 2Z9LA 3Q3KA 1AGJA 3PWBA 5IK2D 3OY6U 3QLPH 2WYGA 2A4OA 3LC5A 3ZZ4A 4X1SU 1GI0A 2HNTF 4Y6DA 3EAJA 2NU4E 2ZCHP 3BF6H 2ESTE 2AMPA 1OWIA 2JETC 3RXIA 2FS9A 1W8BH 5KGOA 1P02A 1VGCC 1MAYA 2ZQ1A 1HLTH 2A1DB 3Q3YA 4RN6A 1K1LA 2A0QB 1AE5A 4TPIZ 5T6DA 2BVXH 2OUAA 1FPHH 1C2HA 1QJ1B 4Q63A 3DHKH 1BJUA 5DJ7A 5EW1H 2GJGA 3QK1A 1SLUB 3MO9A 5EJLA 3RMLH 2WPHS 4ZXXH 3UQVA 5C0UA 3PYHA 3TGIE 3RXPA 2VGCC 1W13U 4I31A 4CR5A 4DJZB 4B2CA 1ARCA 3VB7A 4MPWA 2GGVB 1BTPA 4Y10E 3ZZDA 4VGCC 4BXSA 5CMXH 1TPSA 3ZV8A 4FUEA 2G8TA 1YPHC 2L6OA 4HTCH 3PRBA 1GG6B 1GBBA 1VITH 1RGQA 1BMNH 1NRRH 3A7ZA 5AVDA 2ZGCA 1NY22 4WF8A 1C2MA 2OK5A 4H6SB 2Z6BD 3M3TA 4OS6A 3RU4T 2V3OH 4FU7A 3A8BA 2Y7ZA 4YOIA 2BZAA 3PO1C 1GBCA 1BTXA 3S7KB 1TNGA 3WWBA 1O3BA 3M7UA 4JYUH 1ZR0A 2AERH 1AD8H 4GVUA 1CGIE 2CGAA 4CH8B 1P10A 3I78A 5DP7A 2GZ8A 3NPSA 2EY4C 4NZLA 2SGAA 3DA9B 1LVMA 3ZVEA 4FUDA 4O9VA 1LMWB 1GDNA 3ATLA 3SJKA 2XOKD 2PWXA 2AH4X 1C5TA 1UCYH 2Z94A 3GY6A 4Y79A 1PQ5A 1AN1E 1W0JD 2BD7A 2UUFB 1BQYA 2AMQA 3F0PA 1Y3WA 2QF0A 1DWCH 3RXSA 1W10U 1ZZZA 4Y7BA 1O2PA 3PB1E 1HJ8A 3GY2A 3P8FA 2ZWLH 4MTBA 1GBKA 1TNJA 1ELFA 4WMFA 1EAWA 1AU8A 4MPXA 3LJJA 3E91A 3SW2B 2O8TA 2PW8H 3TJOA 4BAKB 3MWIU 4MLFB 3HATH 3TH4H 1LHDH 1Y3UA 4OS2A 1T8NA 2KAIA 3E8LA 5GDSH 4DCDA 1GI2A 4NFEA 5FPSA 3LDXH 1BCUH 3RC6A 1H1BA 1LTOA 2EEKA 1HIAA 5L2YH 3G01A 1RJXB 4I8KA 3N7DA 1E79D 1IHSH 3CNRA 1C1TA 1VCWA 1GI8B 3PO1B 1JRSA 4RT1A 1MD8A 1P57B 4KELA 4FUIA 1O5AB 4X0WU 1L2EA 1ZTJA 4X2WA 1BUIA 4YXWD 1L1GA 2LNCA 4A1XA 4TYDA 3RXVA 2OC1A 1SGPE 1Z1IA 3MNBA 5C5OA 1F5LA 4AC9A 3F2HA 2PSYA 3D65E 4GCHF 3ZZAA 3BG4B 9LPRA 3QX5H 2JKHA 3PMAB 1RTLA 3M5OA 4B6FA 2ODQA 2JH6D 4DT7B 1OP2A 1V2OT 1Z7KA 2AMDA 3K9XB 3QGJA 4U2WA 2HOBA 2H9HA 4BTIB 1BT7A 1FY3A 1GI5A 3GCTG 2WPKS 4Q7XA 5C17A 1P09A 3RMMH 1O39A 4NIWA 1N6XA 5E2PA 2QY0B 3T28A 4I33A 2TRMA 1ZMJA 1PFXC 2J92A 4CRDA 1LDTT 1TA6A 5EQRA 1CA0B 3TH3H 2HLCA 4X2YA 4ABIA 5C3NA 1CGHA 3MU5A 1WUNH 1K28D 2BB4A 1Y59T 1BMAA 4ZKSU 1DX5M 1SR5C 1WOFA 2A2XH 3GCOA 4LOYH 4XBBA 2V6NA 7ESTE 1BBRE 3U1JB 5HM2A 1XMNB 1MTUA 1AFQC 2A7HA 2W7SA 9ESTA 2ZGJA 1SLVB 2WYJA 5C1YA 1T7CA 2BDAA 1BRCE 1GBHA 1J16A 4FU8A 2SGFE 1PPZA 3RMOH 1A2CH 1FAKH 1A5IA 3KIDU 2AGGX 1LPKB 2YNBA 5EXMA 4MG3A 2DUCA 5L2ZH 1A1RA 2ZTXA 5J4QA 2VIVA 2OD3B 1QB1A 1NESE 1NRQH 1O3OA 1HAIH 1N1LA 4F4OC 1P2NA 1E34B 2TGTA 3HGNA 1EZUC 1O2ZA 1EASA 2OTVA 1LHCH 1PPGE 1QL9A 1C2EA 2D8WA 1ETSH 4KTUA 1G2MA 1TAWA 4J1YA 2BDGA 4E7NA 5E8EH 4B6EA 5LPFA 5AF9H 2H5DA 3ZZCA 2J97A 3OEHD 3RXOA 1P2IA 1EZXC 4MNXA 4DY7B 4OGXA 1UTJA 1EFRD 1GBFA 4A92A 3WY8A 1K1IA 1BTHH 1THRH 4UFDH 1HJAB 1NC6A 2VVVA 1TA2A 2ZHEH 5A0CA 2BY9X 1TPPA 5F8TA 3RLYH 4NSVA 3SN8A 1N6YA 2EA3A 5JBAS 4Z6AH 3FZZA 1ZMNA 1NFWA 1BA8B 1J17T 2ZU5A 1W0KD 1W0YH 1DANH 1TGCA 1OP0A 2BDHA 4WMDA 3SV9A 4AG2A 4D9RA 3UR6A 6CHAB 1KYNA 5T6GA 4CRGA 1BTYA 1ZGVA 3CS7A 1O37A 3V13A 1O3JA 2C4FH 1LQEA 1S6HA 5GNDA 2PTNA 3D62A 4Y8XA 3S9CA 4R8TB 1XUGA 5DP5A 3C1KA 1G36A 1BJVA 2O8LA 4DIIH 1FX0B 3PMHB 2W6JD 2EI8A 2FI3E 5C67A 1UK4A 3U8OH 3PV5A 4YOGA 2VWMA 3LPRA 2BY6X 3SU0A 1ZSKA 8GCHF 1SOZA 3S9AA 5CHAB 1QFKH 2FOHA 3C27B 2ZC9H 3VG8A 3A84A 1ELVA 3M7QA 1KDQB 1VZQH 2XNIA 4E06H 4ZH8A 3QTOH 3NK8A 2TGAA 1LO6A 1YLCA 2ODPA 3A86A 1EZSC 1BMLA 1NROH 5BRRE 2AEIH 2CF8H 2BVSH 2V3HH 1W11U 4K1TA 1F92A 1PJPA 3VGCC 2WZQA 1ANDA 1WSSH 3P95A 1O3EA 1BBRH 2WPMS 4FUFA 1C2FA 1FAXA 2GTBA 2ZECA 2WV9A 7GCHG 1TX8A 2G55A 1MTSA 1TOMH 4P00A 1F5RA 4CRFA 2A7JA 2XYAA 1O3LA 4OS5A 2W6ID 2IJD1 2O8MA 1XXDA 1YYY1 1KLTA 4BAHB 1IOEA 5BPEA 3VB6A 2V0BA 1AFEH 4KP0A 2WSSD 4I8JA 3SHCH 1OWKA 1QJ6B 4AGKA 3T62A 1TOCB 1HIAB 2VIWA 1E38B 1UVSH 4UE7H 3LH3A 4ZROA 2FO9A 1GHVH 1MZDA 4H4FA 2FTLE 3SGAE 1P11E 2R2MB 4M7GA 3KQBA 1WV7H 3U8TH 1DXWA 1GHZA 4GHTA 1FY8E 1O2LA 1O3MA 2FLRH 2OINA 1GBDA 4OS1A 1NFXA 1V2QT 1LHGH 3SV6A 2FS8A 3VGCB 1BB0B 1RTKA 1GI4A 1GHXH 3T26A 1TPOA 3T27A 5F03A 3KNXA 2PUQH 2HGTH 3P8OA 4JZEH 3BTKE 2H6MA 3FKSD 1FLEE 2QXHA 1DOJA 1T31A 3KCGH 3EA9A 2V3MA 3TJNA 3ATMA 3OFND 2H5CA 3B8JA 4I7YH 1EJNA 5FL7D 4XBDA 5C5NA 5LPEA 4Y76A 4CHAC 1NRNH 3SZEA 1GVKB 2C90B 2QC2A 3UTUH 3AK5A 2VNTA 1ANEA 1KXFA 1SLWB 1GI7B 2GMTB 5T6FA 2GT8A 5HMAA 2FDAA 3RC4A 3KQ5A 2UWLA 3AASA 5GCHG 4GUXA 1VR1H 2NU1E 1NBMD 3RXTA 4X1RU 2TPIZ 4Z0KA 4X1PU 3MNSA 1ZPZA 3EA8A 3RXFA 1FY1A 4RKJB 3SNEA 1P0SH 4PROA 3A80A 2H2ZA 1TALA 3SV7A 4UDWH 3TVJB 1COWD 1E37B 1QGFA 2J4IA 1N8OC 3STIA 4NCYA 1GCDA 3A83A 1Z6EA 3IG6B 1GHWH 2D2DA 2PKSC 4X6NA 1O3DA 2A45B 3ZZ3A 5H4IB 5EGMA 1W7XH 4DG4A 3ELAH 4I32A 4JMYA 1JIRA 1GBAA 3E90B 2DE9A 3RXCA 5LPRA 2R0KA 4FVDA 1SQAA 3CENA 5DP6A 1O2TA 5ESBA 5FHTA 1QQUA 1S0RA 4KKDA 3MU4A 1TBQH 1GMDF 1D3QB 1ZRBA 6GCHF 1GJBB 3A7TA 4CHAB 4AFZA 1RS0A 3SU1A 2J34A 2B0FA 3MFJA 3F3BA 1RIWB 3KQEA 1YBWA 3UFAA 1D6RA 1QTFA 1Y3YA 1KSNA 2GCHG 2JDID 1O2XA 3M3SA 1Z8IB 1OXGA 1A3EH 1DVAH 2Z9IA 1ESAA 3DT0H 5JBCS 2XXLA 2A4RA 1SGYE 4J2YB 3RDZA 1QL7A 4OS4A 2FMJA 4Q2KA 3UWJH 5JDUB 2CK3D 4TWWA 1CHOG 1RFNA 1TGTA 4IBLH 1UCYE 3LGUA 1EKBB 1B5GH 3BTQE 4B2BA 1KLIH 1ZHRA 3LC3A 2QF3A 2G5VA 2ULLA 4FVBA 2D1JA 2M5TA 2HPQH 2J98B 1NU7B 4WWYA 1DSUA 1AKSB 3GYMA 4FXGH 2BQ7B 1GBJA 1HV7A 1YPLH 2A5IA 1C1WH 3SNAA 3T2NA 4K8BA 1SL3A 3ZV9A 3GOVB 4JZIA 1EPTB 1QR3E 3MQKC 1HAZB 3KGPA 5GWZA 1ZMLA 2BX3A 1QBNA 1ZJKA 1LKAA 1HPGA 2ALVA 1TLDA 5GIBA 3SHAH 2HNTE 2XTTB 1XVOA 2Z9JA 3EE0B 5GXPA 4Q7ZA 1EJAA 2GX4A 1O31A 1XUKA 3E6PH 1GG6C 2H9EH 2RA0A 1TNLA 3MU1A 3TITA 5C2ZA 3K6ZA 3NUMA 2HWLB 1AIXH 1HCGA 3ZZ9A 1KLJH 2R3YA 3PTNA 2J2UA 1C5NH 1DT2A 1P9UA 2A4GA 1XX9A 1B7XB 3KL6A 1SBWA 3TIUA 3GCNA 3SORA 2Y82A 2ZHQH 2W3IA 3FN8A 3NCLA 3OAAD 4ISHH 1CBWC 3F68H 1FI8A 4Y8ZA 4ISNA 1AWFH 2GZ9A 4ISLA 4CRCA 2PKAB 1L0ZA 3A82A 5CHBA 3SUFA 4BTUB 2FOFA 1C5MD 1MTWA 1LKBA 1UK2A 3EYDA 2AGEX 1JOUB 1EB1H 1D3DB 1G3DA 1IQJA 1O3HA 1CSOE 1FY4A 2WPDD 8KME2 2ZQ2A 1W7GH 2KCOA 2VIOA 3ZVDA 4AORA 2QGRA 1V2KT 3LJOA 2ASUB 3OX7U 4XRNA 3GY3A 1O3FA 4RSPA 3Q76A 1EXFA 2QF4A 4LK4A 1IAUA 2HNTC 3K6YA 1ANCA 1GL1A 3M61U 2BTCE 1W3CA 3BTTE 1NN6A 1KDQA 1LHFH 1DWDH 3LGTA 2ZDKA 3DSPA 2UUYA 3GDSA 3LKWA 3RUOA 5DN6D 1UVOA 4B76A 2RFKC 1H4WA 1AVGH 1CBWB 1HB0B 2ZDLA 3ZVAA 1G3CA 4I8HA 3MHWU 1GJ9B 3BEFB 5KEDA 1IQLA 2HLDD 2CXVA 1O3GA 1O0DH 3PMBB 1H8DH 1O5CB 3SUGA 1P2KA 3N7OA 1P03A 2PGQB 2Q1JA 4ABAA 4K69A 2OBOA 1FJSA 3VB3A 2A4QA 3BG4C 3BTHE 5IDKA 1KXCA 2ALPA 1CVWH 4ACAA 2I6QA 1DY9A 1GGDB 1DY8A 3Q3XA 4YOJA 2TGPZ 2FOMB 1J15A 2VU8E 1MTNB 1TGSZ 5FBIA 1DDJA 3RXQA 2ZCKP 4ABFA 2OC8A 1GBEA 2ZDNA 3ATWA 4AZ2B 3AW1A 2CV3A 2BYAX 3ZYEA 1O2KA 4YT6H 2VJ1A 1DITH 1GHAG 4Q4LA 3A7VA 3ZVBA 3SV2H 2AYWA 4DW2U 1NZQH 1CA0C 4KGAA 2ZTZA 4X2XA 7GCHF 5FPTA 3GY4A 3MU8A 1K1PA 1CT2E 1EATA 1O33A 1O5FH 4I86A 1DFPA 1GPZA 1PPEE 1CQQA 7LPRA 1UTLM 3MNXA 2G81E 2ZPQA 3LONA 3KQCA 4A1TA 2M2AA 1T4UH 3PV4A 2C8ZB 3H7OA 4H6TA 3ZIAD 1TIOA 3FO8D 3HGPA 2P3UB 2F4LA 1WXRA 1BTZA 1FPCH 1V6DA 1DXPA 3Q77A 1F0UA 1V2WT 2KM0A 1ID5H 4ZMAH 3PTBA 1OOKB 4CBOA 1C1QA 1VCQA 3FOAA 3V0XA 1UHBB 2YNAA 4HG6A 5I46H 2ODYB 2GP9B 4ABHA 1SVPA 1NS3A 3QZQA 3KYGA 3SYJA 3DSGA 3RXJA 5L30H 1YY3A 1L1JA 3TNTA 2RA3A 1DSTA 3KN2A 1YM0A 5A0BA 1HBTH 1O2WA 4FUHA 2NU2E 2VIPA 1AWHB 2KX4A 1UCYK 1ZPCA 5FBEA 3T25A 2AFQB 3TNSA 1VITG 3O8DA 1P12E 4NWKA 1MU6B 2C93B 1SMFE 5C1UA 1EAUA 1X7AC 1AUJA 4U32A 5EW2H 4D8NA 1P06A 1H8HD 1QRWA 1TYNA 4Q80A 4FOUC 4X2VA 5ABWA 1HJAC 5E0GA 3AAVA 3UNSA 2J9NA 1HDTH 3DCLA 4BAQB 1WAYB 2GVFA 4AOQA 1D6WA 3HKJB 1SHHB 4DVAU 2P16A 1YPEH 3W94A 1CU1A 1V2JT 4AB9A 4IMQA 5AFYH 5HIYA 3EGKH 4X1NU 2OQUA 2BDYA 2PFEA 3SJOA 3BTFE 1FN8A 2PSXA 3QTVH 4O3UA 2QE7D 3GCHB 2YMSB 6CHAC 2HALA 2ZNKH 3SQHE 3PM3A 1TBRH 2FX6A 1LVBA 1UVPA 1V2UT 2ZFFH 4AG1A 4A7IB 2FOCA 2Y6TA 1V2LT 2TIOA 4Y8YA 5TCAA 1YPGH 2B5TB 1K1OA 1WTHD 4KTCA 3E3TA 1ORFA 1NPMA 1C2IA 2VIDA 2B7DH 1C4U2 2A2QH 1CT4E 3GY7A 5F53A 2F83A 4R0IA 3QZRA 4WXIA 3PLPA 4XE4A 1FMGA 5CHAC 1L4ZA 2O9QA 1QURH 1C2KA 5FX6A 2XCFA 1UVTH 1C5WB 1E36B 1G2LA 1TQ7B 4NA7A 5EXNA 1ELTA 2ZGBH 2AHME 4X8VH 5DKMA 3SI3H 2IN2A 3P8NA 3U8RH 8ESTE 5ETXA 1GDUA 1DUEA 1TNHA 1XUHA 1OPHB 2R3UA 1QL8A 4XSKU 5HIZA 4CRBA 2HRVA 4UFEH 3RU4E 3ESTA 3O8CA 3A7XA 1A4WH 1SGDE 2R2WU 5DP4A 4D7FA 1GCTC 1MH0A 4Y71A 2Z7FE 2J98A 3ATKA 2ILNA 1SQOA 3VXEH 3KF2A 4RT0A 1Z8RA 4U30A 4OS7A 1AKSA 1OWHA 5DSFA 3SV8A 3TK5A 4YM9A 4ESTE 3SI4H 3R0FA 1EPTA 2BD9A 3SU4A 4XOJA 3S69A 2ZG0H 4NFFA 1C5XB 1GI1A 1TMBH 2ZDAH 1LPZB 1THPB 2WINI 3M5MA 2BQ6B 1DS2E 3M7TA 1L1NA 2F9UA 2ZDMA 1ZTLA 1D4PB 4GHQA 1GBIA 1C5ZB 2VWNA 5EPNA 4INLA 3V3MA 2BLQA 4X6OA 4DOQA 3QO6A 2ZZUH 1M9UA 3RP2A 1GMCF 1BTWA 2VVUA 5JBBS 2KR7A 2XBXA 1TONA 1TRNA 2Y81A 1J8AA 2EI7A 5DP3A 2A5KA 2QXJA 3SOSA 1WBGB 2BD4A 3LGYA 4TY6A 4E05H 4JZFH 1GMHG 3UOUA 2R0LA 3OSYA 4F49A 5K7RA 4LZ1H 2ZTYA 3UNRA 2WPIS 1O2GH 1FZZA 2ZPRA 3CP7A 1GCTB 1P04A 3E0PB 3T29A 1AVWA 5C1XA 4MQAA 1SHYA 2PKAA 1C2LA 2PGBB 3P92A 5FAHA 1J14A 2JH5D 2BY7X 2G5NA 2G51A 3GYLB 1S6LA 1KXAA 1TABE 1JRTA 1SG8B 4BXWA 3F0OA 3NRLA 4BAOB 1IQFA 2GMTC 1ZSJA 1P8VC 2QAAA 1UTQA 1FDPA 4INHA 1TMTH 1T8MA 4GSOA 2ZFRH 3ZZ6A 1XKAC 1C5RA 2SGEE 1YLNA 2UWOA 2GV6A 2J94A 2OXSA 3F9FA 4MVNA 3RM2H 3NXPA 1FIZA 3UREA 2ZO3H 3D23A 2Y80A 3VFEA 1QHRB 2ZU2A 2OP9A 2IPQX 1C5LH 2XW9A 1YF4A 2FESH 1IQEA 2FOEA 2XRCA 2FI4E 2EI6A 1O2HA 2OQ5A 1K1NA 1O2VA 3ZVGA 1P3EA 1QNJA 2RDLA 3SU5A 3WW7A 1K0HA 5B6OA 3JZ2B 3MH6A 5HKKD 3S9BA 2KCPA 5FPYA 1BITA 1HUTH 5EG4A 1ZSLA 2QF5A 4NSYA 1ZHPA 2P95A 2GT7A 3EQ0H 3UIRA 1EX3A 2W3KA 4GCHG 1Z71A 3KEEA 1WU1A 4X8UH 1HYLA 1OKXA 3LGWA 5AFZH 5EU8A 1HAHH 3LOXA 1MBMA 3A7YA 1ARBA 3DFJA 1D3TB 1QCPA 1EP6A 1UTMA 6LPRA 1MMJN 1BBRK 5EJZA 2H1UA 1EZQA 2XWBI 1YP9A 1P3CA 2J95A 1ZTKA 1K1MA 1SFIA 1MAXA 1RIWC 2C8WB 4D9QA 3BN9A 1CE5A 2Y5GA 5E2OA 1JIMA 2FYQA 1XVMA 4X8TH 4ABGA 1HAVA 3GICB 4XDEA 5EXLA 1GVZA 2CN0H 3F9EA 1ZJDA 1Z1JA 2OCVB 3A85A 1GI6A 4WMEA 1LHEH 1TQ0B 2WUCA 4WVPE 5E0JA 3SJ8A 5A2MH 5B6LA 1JXPA 1MQ5A 3MH7A 1O3AA 1ZPBA 2Q6DA 3VXFH 3RXKA 1TB6H 3SU2A 1O34A 1FNIA 5FCRA 1S85A 1Q31A 1DLKB 1MKWH 1CT0E 2F9BH 1YPKH 1GHAF 1O36A 1O2UA 3CS0A 1XUFA 1ETRH 2JIZD 3H5CB 2CMYA 1YPJH 2ZDVH 4GPGA 2PUXB 3PROA 1ELGA 1XKBC 1Y5AT 1C1RA 1O2RA 1UHBA 2P93A 5TCCA 2OBQA 3TGJE 2QN5T 3FFGA 3E0NB 3I29A 2QV1A 1C5VA 1GDQA 1VKYA 3RM0H 1EPTC 1VCPA 1KIGH 1YC0A 2ZCLP 1A46H 1HNEE 1T32A 1IHTH 3RXEA 1AVXA 2ZFPH 5C0TA 5A0AE 4YO9A 1PQAA 4MPUA 2NWNA 1Y8TA 5E0HA 3GDVA 2BDCA 3MI4A 1SLXB 5FXLA 1C4Y2 1MABB 1ELCA 2BM2A 1V2NT 4NWLA 1XXFA 3R3GB 1OHHD 4DIHH 1GJCB 1P05A 3I77A 5A8XA 3F1SB 4K3JA 1NFYA 3NKKA 3SJIA 3UR9A 2UUJB 4XFQA 4X6MA 3BTEE 5EQQA 2G00A 4CRAA 4Y0YE 3FP8E 1OYTH 1GL0E 1YCPM 1SSXA 4FUJA 3Q00A 4JYVH 1GBMA 3GCTF 4O03A 1XUJA 1C5YB 5EPYA 2O8WA 2SGDE 4K2YA 1Y5BT 2BDIA 1KXEA
chains in the Genus database with same CATH topology
5J4SA 5CE1A 8LPRA 4THNH 4BANB 1EJMA 3DUXH 1F0TA 4NIVA 1QB9A 2P59A 2FM2A 1TNKA 1B0FA 5DGJA 4ZXYH 2PV9B 4AFSA 1GJ4H 1GVLA 4BTTB 1RXPA 1C1MA 1SFQB 2XBVA 1J9CH 1PYTD 4MDSA 3ZVFA 1OWDA 1Y3XA 2J38A 1LCYA 1T4VH 1FY5A 1TWXB 1H9IE 1QBVH 1FIWA 3GISB 1AZ8A 2AIQA 1OS8A 1HAOH 3TGKE 2ZHFH 2F9OA 2SNWA 3BEIB 3MMGA 1O32A 8GCHG 5FCKA 4IS5A 1HGTH 1O5BB 1HFDA 3QWCH 3MH4A 1C5QA 3UUZA 3O8RA 2GZ7A 2H9TH 1NTPA 1NU9A 1IQMA 2HVXA 1AO5A 2ANKH 2P8OB 3BG8A 3E1XB 1YPHE 4AYYB 1O30A 3O8BA 2A32A 3L33A 3ATIA 4B75A 3MNCA 4BNRA 1GJAB 1K22H 3JZ1B 3MO3A 1K21H 1IQIA 1O2MA 5K0HA 3UPEA 2XBYA 4RKOB 5EODA 4ISOA 1F0RA 3S7HB 4WH6A 2BX4A 1G3BA 4DGJA 1PPBH 2BLVA 4ZKRU 1O2JA 3ZYDA 1A7SA 3SJ9A 4FU9A 3A8CA 3PLBA 4B71A 2STBE 1G3EA 5C20A 5GPIB 1GHYH 1KTTB 1Z6JH 4KTSA 2Q6GA 1GGDC 2FTMA 2B8OH 1S0QA 1AB9B 2BD2A 1MTNC 2FPZA 1QRXA 3DD2H 1GI9B 1C5SA 2ZEBA 2VB0A 4ZHMU 3MH5A 4NA8A 1FONA 2STAE 1Y5UT 2ZI2H 1S84A 3SNBA 1O3CA 2P3TB 2GDDA 1C5UA 4DURA 3LGVA 1NM6A 1GJ7B 1ESBA 1SOTA 1T8LA 4K8YA 3MOCA 2AGIX 1O3IA 2XCNA 4QT8C 4IC5A 2BQWB 3RXRA 2UUKB 1S83A 4UFGH 2IJOB 1S6FA 4IC6A 4YZUA 3OY5U 2F3CE 1A5HA 1GHBG 1NRSH 2IOTA 2F9VA 4UONA 4D76A 3B9FH 1PQ8A 2ZFSA 2W5EA 1TRYA 1SGFA 5A09A 1FV9A 3MYWA 4X6PA 2SGPE 3RXBA 2QXGA 5TJXA 1ZGIA 1GJ5H 1QIXB 1K2I1 2BDBA 1YCPH 2JETB 1MZAA 3A8DA 4Y11E 1VGCB 2FODA 1DWBH 1Y3VA 4CR9A 1GMHF 4NIXA 3TJUA 3LT3A 5F8ZA 2Y5HA 1HJ9A 1SB1H 1BRUP 3UY9A 4IMZA 1H9LB 4AX9H 1OSSA 3FVFB 2XC0A 3PLKA 3SNDA 2CHAC 3ZZ5A 4JZ1A 3QUMP 4TWYA 2VGCB 1HAVB 3KHVA 3PWCA 4E7RG 3SBKA 1KY9A 3TU7H 1O5EH 1C1PA 2Z3EA 1A0LA 3V12A 1W2KH 4ABBA 4NIYA 2FZZA 3U1IB 1Q2WA 4VGCB 1C1SA 2Y5FA 1CHGA 4JCNA 2VINA 3ITIA 2D26C 2SFAA 2GDEH 1EOLA 3LH1A 1O5GH 5DP8A 3BV9B 3RU4D 1G30B 1EQ9A 3VB5A 4O97A 3IWMA 1DE7H 4YLQH 2THFB 4XBCA 4HI3A 1CGJE 2EC9H 3M35A 3QDZB 4CH2B 3LU9B 4MNWA 3GY5A 1P9SA 2BD8A 1ESTA 1C5OH 1QA7A 3GCHC 4K1SA 5DP9A 5F8XA 1S81A 1GMDG 1UTOA 1ELBA 1EUFA 1WCZA 6GCHG 1O2SA 5EQSA 1QA0A 2BVRH 3OU0A 2ZGHA 2XC4A 1F0SA 1O2QA 3RXDA 5ESTE 1G9IE 1O38A 1FUJA 4JK5A 1YCPK 2WV4A 1CA8B 1PYTC 3P6ZB 3BTME 4D7GA 4NA9H 4ZHLU 4ABEA 2CHAB 4NG9H 1S82A 3ENSB 1DPOA 1V2PT 2ZHWH 3A88A 3ODFA 4AFQA 2R9PA 1LVOA 3EDXB 3NWUA 4FUBA 2GCTC 1GJ6A 3U98H 2VWOA 1AE8H 3BEUA 5LH8A 3P8GA 1MCVA 1UO6A 3P70B 3RXUA 2WPJS 1UTNA 1CO7E 1RTFB 2ANYA 2ZFQH 3UOPA 1SGTA 1G37A 1ABJH 1OWJA 1U6QA 2GD4B 4JYTA 5SGAE 2NU0E 3BIVH 3IITA 1TBZH 2BXTH 4INKA 3M5LA 3QN7A 2ZIQH 4BAMB 3BSQA 5GCHF 5L6NH 3S0NA 1TNIA 4UD9H 4YESB 3RLWH 1HAXB 3FP6E 3AW0A 3SU3A 5A8YA 1MKXH 3ZZBA 4A5TS 2LPRA 1EAXA 4AN7A 3GDUA 3VB4A 3NZIA 2QA9E 1GBLA 1TE0A 2SGQE 1V2VT 4IW4E 4ZHAA 1JMOH 5G4BA 4AFUA 1W14U 2BMGB 3SO3A 1ACBE 1AZZA 5JBTA 1D3PB 3FAOA 2ANWA 2G52A 1PPHE 4MNVA 3AVZA 3ZZ7A 3ZVCA 1C5PA 1BOQA 1XUIA 2BHGA 1JWTA 2W26A 1E35B 3UQOA 1SGIB 1AY6H 3STJA 4UFFH 4CBNA 2ZKSA 3ZZ8A 5I25A 1A5GH 1UMAH 1YPMH 3A8AA 4YTAA 3TPIZ 2YOLA 3K65B 2GCTB 3SGQE 1WYKA 1K9OE 1OWEA 1QB6A 5JB8S 1F5KU 1MD7A 2P94A 3M37A 3P17H 4Y7AA 4BOHA 4MPVA 5DPAA 5FX5A 1HAYB 4B74A 2BLWA 1D9IA 4IN1A 1UVUH 3RXHA 1HAGE 2NU3E 3ODDA 3SZNA 2GCHF 1EAIA 3A7WA 3TLOA 4ZKOU 2QCYA 3TH2H 1C4V2 1W12U 4JZDH 1F7ZA 1O3PB 3KQDA 1DM4B 1DUAA 1HRTH 1UK3A 1QBOA 1AFQB 1C1UH 1CHOF 2QXIA 1MTVA 4FUGA 1THSH 5GJ4B 1MU8B 1WTGH 2CJIA 1ZRKA 2BXUH 1MKXK 4WXVA 4GLYA 2VIQA 1MQ6A 1IQKA 4K1EA 3TJVA 1AUTC 1VJ9U 2WPLS 5IYTA 1AI8H 2CF9H 1C2DA 1ELDE 1SPJA 3SU6A 3TK9A 1TGBA 1PQ7A 2OC0A 3RMNH 4HZHA 3URCA 4YT7H 2Z3CA 1O3KA 1MBQA 3F9GA 4I8GA 4Q7YA 1NT1A 5DG6A 2FWWA 6ESTA 2O8UA 5JB9S 1TRMA 2C8YB 1V2ST 2ZA5A 3EA7A 2QIQA 3HK6B 1AMHA 2BY8X 3SNCA 1KXDA 4JK6A 1Q3XA 1AHTH 1SQTA 3RXGA 1G32B 2ZFTA 1TGNA 2C8XB 2ZPSA 3MO6A 3SUEA 1S5SA 3OTJE 1SI5H 1GJ8B 4WH8A 3F9HA 1V2TT 1ZHMA 1C1OA 2P3FH 2I6SA 1EB2A 2BOHB 4ZKNU 3A89A 4IGDA 3HK3B 1BRBE 1IQNA 2ZU4A 5HXFA 1P01A 1TPAE 2OLGA 1UJ1A 2ZF0H 1K1JA 1E0FD 2XC5A 4NGAH 2VVCA 2F91A 3M36A 4ISIH 3W95A 1Z8GA 4UEHH 4X1QU 1P2MA 1HXEH 2C3SA 4MNYA 2FOBA 2K1QA 2Z9KA 2A5AA 1JBUH 4I8LA 2TGDA 1V2RT 3FZDA 2F9PA 1O5DH 2ZHDA 3HPTB 2WV5A 1W0ZU 1ABIH 2BOKA 4CREA 1HXFH 4B73A 1QRZA 4LZ4B 3URDA 1IQHA 5HGGA 4LXBH 5F6MA 4YLUA 2AIPA 1C2JA 4H42U 4U01A 1DLEA 2Y7XA 3FP7E 1SGRE 1MUEB 3D49H 3PMJA 3LIWA 2KAIB 4WJG2 3RXMA 3DFLA 1ELAA 1QJ7B 1LQDB 1HAPH 2BLOA 1SC8U 5HM9A 4SGAE 1Z8JB 2VH6A 3U69H 1UTPA 2BD3A 1V3XA 1O35A 5DO4H 1QQ4A 1SGQE 4A1VA 1C1VH 1FN6A 1GHBF 4K60A 3GY8A 3QGNB 4ABDA 4B1TA 3LGIA 1RD3B 2SNVA 1YKTA 1LPGB 2UWPA 1H9HE 4K5ZA 2FP7B 1SGCA 4HGCA 2DE8A 2PR3A 1A3BH 3F6UH 1BRAA 2G4TA 1O2OA 2BZ6H 1C2GA 1WQVH 1ZLRA 1EOJA 1FXYA 3SQEE 2W7UA 3A81A 1BHXF 1OYQA 1INCA 3L6PA 4ZUHA 3MTYA 2GKVE 2FOAA 2VH0A 4OGYA 1GJDB 3RC5A 2Z9GA 1WQSA 3AAUA 4Y0ZE 1ELEE 4A6LA 1A0JA 2JH0D 1O2NA 1A0HB 2FYRA 5JYIA 3OYPA 4TY7A 1IQGA 4FUCA 1LVYA 1SGFG 2PLXA 1UTKA 3U9AH 2FEQH 1C9PA 2RCEA 1EP5A 2HPPH 4HFPB 3UWIA 2AS9A 2A7CA 4WY3A 1NFUA 2FOGA 3UNQA 5LGOA 4X8SH 5AHGH 2B9LA 1DWEH 1L4DA 3RXLA 1TX7A 4AYVB 1H8IH 1PPCE 1T8OA 2VWLA 2ZP0H 3HKIB 1PPFE 1P2JA 3M3VA 4O3TA 2ZU1A 4TPYA 2IPHA 1VJAU 2GV7A 5EOKA 3SGBE 5A8ZA 1F2SE 4AGJA 1TX6A 1OX1A 2BY5X 2P8OC 2PTCE 2TBSA 1GI3A 1AQ7A 1ETTH 1KTSB 1BDAA 4IN2A 1O2YA 2XWAA 3M5NA 1BMMH 1B0EA 2ANMH 3T5FH 2ZGXH 1V2MT 3VEQB 1BTUA 1YGCH 2OC7A 1C9TA 1NRPH 7KMEH 3TK6A 1VITF 3BIUH 1SGEE 4NZQA 3B23B 5PTPA 1MCTA 1YLDA 5HYOA 4ABJA 2FI5E 3SUDA 1SGNE 1QY6A 1FQ3A 1P2QA 1TFXA 1NO9H 2FXRA 4ASHA 2A31A 1N8OB 2ZU3A 2PHBA 3BTDE 1MKWK 5JPMH 2FIRH 1XM1A 1A61H 1GWAA 1ZOMA 3H7TA 1C1NA 3VPKA 2Q6FA 1OP8A 2PKSB 4ZAEA 1AB9C 2RG3A 3L3TA 1TMUH 2WUBA 3MU0A 4GAWA 1RRKA 1KXBA 2XBWA 1O2IA 1GMCG 4SGBE 2Z3DA 3FANA 3BTGE 4B2AA 1BHXB 1ANBA 1O3NA 1ZYOA 2V35A 2BD5A 3E16B 3BTWE 4AB8A 3V7TA 3A87A 3K2UA 5T3HA 2FLBH 1DICA 1P2OA 2FX4A 1BIOA 2QYIA 3RXAA 1GBTA 5DK1A 2F9NA 2G4UA 1BZXE 2Z9LA 3Q3KA 1AGJA 3PWBA 3OY6U 3QLPH 2WYGA 2A4OA 3LC5A 3ZZ4A 4X1SU 1GI0A 2HNTF 4Y6DA 3EAJA 2NU4E 2ZCHP 3BF6H 2ESTE 2AMPA 1OWIA 2JETC 3RXIA 2FS9A 1W8BH 1P02A 1VGCC 1MAYA 2ZQ1A 1HLTH 2A1DB 3Q3YA 4RN6A 1K1LA 2A0QB 1AE5A 4TPIZ 5T6DA 2BVXH 2OUAA 1FPHH 1C2HA 1QJ1B 5DJ7A 3DHKH 1BJUA 5EW1H 3QK1A 1SLUB 3MO9A 3RMLH 2WPHS 4ZXXH 3UQVA 3PYHA 3TGIE 3RXPA 2VGCC 1W13U 4I31A 4CR5A 4DJZB 4B2CA 1ARCA 3VB7A 4MPWA 2GGVB 1BTPA 4Y10E 3ZZDA 4VGCC 4BXSA 5CMXH 1TPSA 3ZV8A 4FUEA 2G8TA 1YPHC 4HTCH 1GG6B 1GBBA 1VITH 1RGQA 1BMNH 1NRRH 3A7ZA 5AVDA 2ZGCA 1NY22 4WF8A 1C2MA 4H6SB 2Z6BD 3M3TA 4OS6A 3RU4T 2V3OH 4FU7A 3A8BA 2Y7ZA 4YOIA 2BZAA 3PO1C 1GBCA 1BTXA 3S7KB 1TNGA 1O3BA 3M7UA 4JYUH 1ZR0A 2AERH 1AD8H 4GVUA 1CGIE 2CGAA 4CH8B 1P10A 3I78A 5DP7A 2GZ8A 3NPSA 4NZLA 2SGAA 3DA9B 1LVMA 3ZVEA 4FUDA 4O9VA 1LMWB 1GDNA 3ATLA 3SJKA 2PWXA 2AH4X 1C5TA 1UCYH 2Z94A 3GY6A 4Y79A 1PQ5A 1AN1E 2BD7A 2UUFB 1BQYA 2AMQA 1Y3WA 2QF0A 1DWCH 3RXSA 1W10U 1ZZZA 4Y7BA 1O2PA 3PB1E 1HJ8A 3GY2A 3P8FA 2ZWLH 4MTBA 1GBKA 1TNJA 1ELFA 4WMFA 1EAWA 1AU8A 4MPXA 3LJJA 3E91A 3SW2B 2O8TA 2PW8H 3TJOA 4BAKB 3MWIU 4MLFB 3HATH 3TH4H 1LHDH 1Y3UA 4OS2A 1T8NA 2KAIA 3E8LA 5GDSH 4DCDA 1GI2A 4NFEA 5FPSA 3LDXH 1BCUH 3RC6A 1H1BA 1LTOA 2EEKA 1HIAA 5L2YH 3G01A 1RJXB 4I8KA 1IHSH 1C1TA 1VCWA 1GI8B 3PO1B 1JRSA 1MD8A 1P57B 4KELA 4FUIA 1O5AB 4X0WU 1L2EA 1ZTJA 4X2WA 1BUIA 1L1GA 2LNCA 4A1XA 4TYDA 3RXVA 2OC1A 1SGPE 1Z1IA 3MNBA 5C5OA 1F5LA 2PSYA 3D65E 4GCHF 3ZZAA 3BG4B 9LPRA 3QX5H 2JKHA 3PMAB 1RTLA 3M5OA 2ODQA 2JH6D 4DT7B 1OP2A 1V2OT 1Z7KA 2AMDA 3K9XB 3QGJA 4U2WA 2HOBA 2H9HA 4BTIB 1BT7A 1FY3A 1GI5A 3GCTG 2WPKS 4Q7XA 1P09A 3RMMH 1O39A 4NIWA 1N6XA 5E2PA 2QY0B 3T28A 4I33A 2TRMA 1ZMJA 1PFXC 2J92A 4CRDA 1LDTT 1TA6A 5EQRA 1CA0B 3TH3H 2HLCA 4X2YA 4ABIA 5C3NA 1CGHA 3MU5A 1WUNH 1K28D 2BB4A 1Y59T 1BMAA 4ZKSU 1DX5M 1SR5C 1WOFA 2A2XH 3GCOA 4LOYH 4XBBA 2V6NA 7ESTE 1BBRE 3U1JB 5HM2A 1XMNB 1MTUA 1AFQC 2A7HA 2W7SA 9ESTA 2ZGJA 1SLVB 2WYJA 5C1YA 1T7CA 2BDAA 1BRCE 1GBHA 1J16A 4FU8A 2SGFE 1PPZA 3RMOH 1A2CH 1FAKH 1A5IA 3KIDU 2AGGX 1LPKB 2YNBA 5EXMA 4MG3A 2DUCA 5L2ZH 1A1RA 2ZTXA 5J4QA 2VIVA 2OD3B 1QB1A 1NESE 1NRQH 1O3OA 1HAIH 1N1LA 4F4OC 1P2NA 1E34B 2TGTA 3HGNA 1EZUC 1O2ZA 1EASA 2OTVA 1LHCH 1PPGE 1QL9A 1C2EA